5AVWB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avwB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avwB02
4KHXA 2Q7CA 5AW0B 3TYYA 1JNMA 1A02F 3VMXA 4RESB 4LC1A 1HJBA 3HE4B 1MFZA 2W27A 3L37A 3M9HA 1YYCA 1T2KC 5APWA 2WPRA 3A5TA 2WT7A 5APUA 2P67A 3A2AA 3M0AA 3VYIA 1S9KE 4DZOA 2Q5UA 1FAVA 2C9LY 1J2JB 5AVRB 1GZLA 3HE4A 2WPQA 2R5DA 2QM8A 1T2KD 2H7HA 5AW3B 4C7NA 4EOTA 2WTYA 2YO3A 3V5BA 1MV8A 4JYCA 1GTWA 1GK4A 4AUWA 1GU4A 3MD0A 1FOSE 2R3CA 3VN0A 2VRSA 1X8YA 1HWTC 1HBWA 5AW9B 2WWWA 3LIDA 5APTA 5AVYB 4RETB 4C7NB 1JUNA 1KQLA 3KDPB 3V4QA 1SP4A 2XZRA 1CZQA 3M91A 5APVA 3WGVB 1HUCA 2ZFCA 5AVXB 3P7KA 5AW5B 1OXZA 3NMDA 3P8MC 2P7JA 2YO2A 3VMYA 3HE5B 3O8ZA 1H89A 1FOSF 5AW2B 3P32A 2ZXEB 3IR9A 1CSBA 5AVVB 5AW7B 3TNUA 1GU5A 3I5CA 4I2LC 1G2CB 4GKGA 2R5BA 2YNYA 3WGUB 3T97A 2Z5IA 4I6MC 1H88A 4M3LA 2E43A 1OWAA 3M06A 2C9NY 2P2UA 4XE5B 3SWFA 2W6AA 3HE5A 5AVTB 1IO4A 1S9KD 1GK6A 5AW6B 1NAFA 3HTKA 5APYA 3TNUB 3MGNA 1MUUA 3VMZA 3NTNA 3VTPC 1GD2E 3TK1A 1DH3A 1SLQA 2E42A 5APSA 2JJLA 3M0DA 1H8AA 3V4WA 1NWQA 3L36A 2WPSA 5APXA 2N9BA 5AVQB 3A3YB 4GT1A 5APQA 5AVZB 4B86A 2BASA 4AYCA 1CI6B 3L35A 5CMZA 3NXSA 1A02J 2Q3IA 3KQGA 5AVSB 2QM7A 3LIEA 3A7OA 5AW1B 4AQRD 3NFQA 4HYTB 4JYBA 5AW4B 2Z5HA 2XV5A 2IPPA 5AVUB 2WT7B 1CI6A 5AVWB 2KP8A 4C46A 2XU6A 3OAKA 5AW8B 3B8EB 2R32A 3M9BA 3UIAA
chains in the Genus database with same CATH superfamily
3H25A 4JFPB 1NM9A 3BRFA 1M71A 5FAAA 5IG7A 1AC6A 1N19A 3QUMA 1FFOA 1JUFA 2AJUH 3WCYA 1TO4A 3ARGC 3ZL4H 1ZJAA 2YD0A 1Z56A 1FDOA 3T3PF 1U3YA 1TENA 4PRAA 3BIKB 3GDCA 2Q5BA 2WBJB 2B1HH 4HB1A 3NSJA 2FFDA 4Q9RL 1KTCA 3M9QA 5L2KA 1ZY9A 2OTJP 3O41A 5I1IH 1ZA6A 2O01J 2EYSB 2NTSP 2JKTM 3KPLA 1P7QB 4JQIL 5HGDA 2V7QH 1XTGB 1D5ZB 4ZXBD 1EDHA 3VXTB 5KW9L 4FYSA 4IU2A 5KYUA 4K7PX 4OF5A 1FZCC 2BVUA 1LEGA 1ORQA 2XWTB 1Q1PA 4OH8B 5FA4A 2R7EA 2WLMA 4FG2A 1IC4H 1TNNA 2W60B 1LMKA 4XAWL 1XF1A 3AG2B 1IBZA 3QNXA 3CFBA 5T1DL 5DMIH 2OTWB 5C9JA 1AXSB 2KHAA 2YPLB 4AZ8A 3QG6A 4I3GA 3UCRA 1XAKA 5JW5A 2VDLH 4HBQA 2KLVA 1IVLA 5FM8A 3REVB 1XGUB 4EDXA 3QPQC 4ZS7L 2UXTA 4YDKH 3VI4E 3EFGA 3EFOA 1YPZA 2IG2L 3F7VA 1U91A 1BIIB 2ZTBA 3FT2A 4PY7A 4I0PA 4DT2A 3DPBB 5C0RH 3ULUH 1PF3A 5E8OB 2EIJB 1P4IH 4HC1A 3OAUH 3FB6B 4GIOA 2VE6B 2Z92B 4XVUC 2Y23A 1B4JH 3ULUD 2CRIA 3QZBA 4F92B 2R56H 4L4JA 5DSCB 5FEBA 3R4RA 5AAWA 4MAYD 4HJTA 1HXMA 2OMWB 1KCKA 1T4KA 2JDIH 2ZXQA 1S7WB 1T03H 5GRVL 4ZG1A 1AMXA 4ZMZA 1OTSC 15C8H 3TS8A 2DJMA 2TSAA 1SYSB 3M88A 5FHAH 4YHMH 3T1WA 2KQMA 4OZIF 1R75A 32C2A 3BUQA 3ZL2A 1IV8A 2AK4D 2AMGA 2IALA 1NCDH 3VFRA 5IBTL 4K3JL 4GI6A 2FYYA 1MIEL 5A6IA 3B2VL 3BH8B 3FN3A 4OU3A 1WWCA 3AGVA 3DXAE 2XLLA 3EGSB 2OYIC 1JV5B 1MNUL 3M8OH 2VCOA 4X4ZA 4AJWA 3FU7B 3VXPB 3D25A 2N59A 1SN5A 3FOLB 4L4TA 3RNQA 4LSPL 2ATAA 1WZ1L 1KENH 5IJVA 2PWHA 1E4XI 4UTCA 1HGVA 2WSCH 1LDSA 2I1JA 1Z66A 3SY0B 4FFYH 1E6JH 4XTRD 5D2LB 5SWSB 1XGTB 2E6PA 3NSFA 1QZ1A 2MJZA 4HSQA 4LCWD 1T5WB 1XGRB 1F8TH 3LW5H 1HJBA 3W81A 2NX5B 5JHLL 4LU5L 3MLPA 3FO1A 4OLVL 1JJUA 2YBRB 2R1XA 4UZGA 3T3PB 5T5FA 4A2EA 5DHYA 2CPCA 5T5NG 3X11B 2XWBA 1I1YA 2DQUH 3EBAA 4ANUA 5C0IA 2EH8L 1QLRA 3BD4A 3W9DA 2D2CD 2OAAA 2R69A 3TA3A 1J5IA 2J5LC 4Z7OE 1Z1WA 5EU3B 4X7DC 1BAWA 3HZMB 4PJ6A 3BIAX 4HUXB 4XMUA 2Z35B 4ZOEA 3HNSH 1QW9A 1GMEA 4HGWB 2A6KB 2V9RA 1CFNA 4QY8B 4LNVA 4A7GF 2J6EH 1G5GA 4MAUL 1MCOH 3P1VA 3V5HA 3GNMH 1U8HB 1BDCA 1EO7A 3BPCA 3LS4H 3LZPA 3P9MA 4X83A 4TULL 1AGEB 3FQRB 2MCAA 4DEPB 1Z5LB 4OJCA 1VQ6P 3T2NH 4FQ2L 2FYUK 3WMPA 1Q9WA 1OAXH 4RZCB 3FBKA 2P7JA 3CZGA 5HYSA 5D1QE 4IBYA 2FJGA 4IIQB 4IFDK 1KLFA 5B1BB 1DO5A 1NAYA 3EYOA 5D8JL 1IAMA 1WT5C 3ZTCC 3ILEA 5C0CA 2WQYC 2DQEH 1PLCA 3HVNA 2GSIB 4K5LA 4ADGA 2R5BA 2I9TB 3CPUA 2OQJA 4P8QA 4Y4HB 2JI3A 2B0SL 1FNGA 43C9A 5BV7B 1F58L 4F7CA 5EO1A 1ZLEA 4TQ8A 4UT6L 3DI3B 2XU9A 4WGWB 1KV7A 5A6MA 2V2XA 4I3RL 2FUQA 2ZUUA 3U2SB 1JDCA 3B9KB 4NN5C 3I84A 1MNNA 3CXFA 3KM1A 1WH0A 5IROA 1AGDA 4UB0L 1CFTA 1YYLH 3M1BB 5EU5B 2E86A 4OZIB 1AGFB 4E9WA 1WFJA 1Q94A 4H88H 3PJSB 1CFQA 2XHNA 3DO4A 1XCWA 1GW6A 3E1F1 5H37G 4BWUA 4DGYL 2WV3A 5GGTA 2OJZH 3DSNB 4S11A 2Y22A 3DUHA 3QA3A 4UQAA 5FOBB 4ANWA 5CBOA 4HK3J 3Q5RA 3SDDB 2LFEA 4HGKC 4PLJD 5IW1B 3NFQA 1PBYA 4MA3A 3KJ6L 1TJXA 2W5PA 3T71A 5TDOA 1JPSL 3SKUD 4JNXA 5F0LB 3OG6B 5DVNA 5DK2B 3L54A 3NA9H 1J5OH 3ZE1F 4JRXD 2Q6QA 5MEQA 3HMWL 4ERSL 5BZDB 4QF1B 1YEDB 3H1JE 4P2YA 8FABB 3RK3B 4JPKL 1R3IL 2W07B 1BM3L 4BWNA 1JYNA 2NQDA 3IN2A 3L3DA 2AERT 5F7MC 1VEPA 4TQEL 2L4OA 3AAZB 5DEJA 4YSAA 4BSVA 4P23D 5IREA 1H6FA 5FUZL 3HG1B 5E1AB 1QA9A 4XMLH 4UILL 1TVHB 2W0LA 3F5WB 4XPTH 1SXZA 1BV8A 4LVOC 4FNTA 3ZZSA 3SKJH 3N44F 1OGSA 2X44D 1N7SA 1UC6A 5E6YA 2WTYA 4NZTH 4APXB 2EE2A 1K8IB 4FCAA 1VHPA 4K71C 4WSKA 1U8QA 2WINB 2GBVA 1DN0A 5CP7B 4CU8A 1H3VA 4FLOA 2Q8BL 4MCZB 4PV8B 1G1KA 3JWNC 4GLRI 5JXEA 1AQ8A 3CH1A 1HHIB 3FONA 1NTMD 4LAQL 4J12A 1I8KA 1A7BA 2PPFA 2Y7SA 2WXQA 2F0CA 3BUBA 1S7TA 1Q9OB 3D69A 3K8LA 4XC1L 1LJMA 4HD5A 5LGYA 4O2EA 5JDSB 5KBNC 5D7JA 1DJXA 4OR1A 1NKOA 3M86A 1J10A 3MNWB 4W4OA 2YSSA 2HUHA 3KLSA 1IJ9A 1JERA 2XXGA 4PRIB 1NTKD 1MI5D 1JHTB 5EV7A 1VGKA 2ZWKA 5T1JA 3KPSA 5ETUA 3T0AA 1FJ1B 5LNEA 1QGKB 4OM1L 2IANB 3GSNB 3CFEB 3GBEA 4PUBH 2WKOA 4TRPH 4O5LL 1S7UB 4NPEA 5L4MA 2V33A 3JTSA 4G9FD 4PV9B 1XF4B 1CGYA 4GXVH 4BFIA 2BCCD 2OULB 3WIFB 2RHEA 3C60D 5TE7L 1IM9D 1MCPL 5B8CA 5IEKA 3U9PH 1YBKA 2QVIA 2G60H 3MTRA 3QDJD 1JZ4A 3MLRL 1HZHL 1EJ6A 3AY2A 3GO1H 4JPVH 2OBGA 3ZMNA 2OZ4A 2K3RA 4NQEE 3VRIA 1CLOL 2O5YH 4LZKA 3QQNA 2KC0A 1BLIA 1YEJH 5IB4A 2AXTE 2ZCLL 5ELIA 1UXSA 3APMA 2R0LH 4GUQA 4OI8A 4U7MA 1DBBL 3LNGA 5KVFL 2VERN 4WWID 5CR1A 1D7FA 4Z1MH 3BZ4A 3D85B 5D1QD 3B2UD 4NNXB 4KJQD 3LH2H 4N2BA 4C58B 5A2IH 3NN8A 3DGGB 5C9KA 3L08A 4IRZL 1WJ3A 1JHLL 4HIXH 4M6ML 2N1TB 2ZT9C 1EQWA 3OF6A 3OKDB 1RZGA 4UIMA 3WXWL 5TE6L 1MQKH 2IMMA 4R4BB 4AYFB 4UM8A 3ZE1B 3HUSC 4NUPA 3Q1MA 1ZWIB 5TQ0H 3FT4A 2J5UA 3E2HC 4PJIE 3C9NA 2P28B 2VAAB 4QMEA 2H2PD 3AQYA 2W81C 2VR8A 4X7TA 2QLYA 3U82B 1ZANH 3GRWA 4OGYH 1M7DB 4UV7L 1URZA 2ICWI 5I17A 3VJ6B 3C2SA 2KUTA 1BZ8A 2X53A 1DUYA 1FIGH 25C8H 2JIXB 2KNCB 3F8UB 4CKQA 4ES9A 5HGHA 2NPSA 2BIPA 3HG3A 5D6DC 2Y36L 3G5VB 4MMXB 4UI2A 3QXUA 3MAWA 5EUOF 2CJ3A 3DOIA 1G7IA 2F68X 3VRJA 1QSFE 3T2QA 1H3PL 1LP1B 3H3PH 2BERA 3QDGB 2OR9L 4XMZA 1NJ9B 3FAXA 1S8DB 1YEKH 2MKWA 4UAOC 3PYCA 4GAGL 4GG6E 3VWKC 5DJ8B 3SDYH 3P73B 4X9IA 2HKHL 3LTVA 3PJLA 3WNIA 1HEZB 4DN4L 1QFWH 4QO1B 1AVOA 4RVBA 2YXVA 3IR9A 1A4JA 3QUXB 3FQNB 2ZX9A 5JIKA 1G5AA 4YSOA 1L6XA 2WLIB 4FL4B 1WLHA 3H1JD 4YXWH 1G7JA 4MKTA 3WY4A 4UM9A 3GF8A 4YSDA 3WTVA 2JE8A 4IOIB 2BIHA 4QDGA 2ZJSL 3NPSB 5D5MF 1F2XK 2VDOB 4PJXA 4HJGA 4F1ZA 4JFQA 3UTQA 1P6FA 1ZDSA 2IPTL 2VDQL 4HZ1A 2ALWA 3H9HB 4PWEA 2EDRA 4XN5A 1DQDH 3DA0A 4XI5D 3TZVD 4K5NA 1HWGB 1LE9A 1PLGH 3VTAA 3WJJA 4WO0A 5APXA 1TETH 4V1DE 4K3GA 5D2NB 1ADQH 3EO0B 5F88A 4F2EA 5ISZA 4NFCA 4S1RL 3H32A 2R2BB 4BXLA 2VC2H 1B0IA 1F1AA 2WJ7A 4MB4A 1B0WA 3H9SD 1SQXJ 1M1JC 2UY7B 2DIEA 3MUDC 2VRKA 2I07A 4LSQL 2VH5L 5JNYB 3PP4L 1KIPA 2NUPA 4FZEL 5EU6A 4TNFA 1NKZB 1F11B 5L88L 5HSFA 2Y7OA 5IESL 3CWGA 3F05A 5CZKA 4WK0B 5EZIL 5F9WC 1OP5K 4O2CA 3V4PL 2FJUB 2VM3A 5MEOB 4MKMA 1AY1L 1N6UA 1AGCA 4ZFOL 2EYTB 1SQQJ 1E9QB 3CC4P 1DJIA 2QKIB 1FAKT 1U8KA 1K9TA 4HGMA 5LBVA 4ODTH 4M5SA 5JOFB 1N8ZA 2A4ZA 4IMKC 1QWHA 3ULUF 4BH8A 3ZKQD 3MODL 2Q7CA 2FECL 2A6JB 3HZYB 4GG8A 4X4ME 5TK2A 3TT3L 4MJ6A 1HC1A 3KYNB 4H1LG 4ZMQA 5DVLA 1R5IB 2YEQA 3IF4A 2A77L 5AQ0A 4Z0XA 5TGBA 1CGUA 5HDQH 5EIIA 1KB5B 3LV3B 1AA0A 1KXHA 3GKZA 3VDAA 4Z3FA 2O93L 1WCQA 5LCVA 5AAMA 5EMYA 1A9EA 3LX9A 3TVMD 1QTYT 2P5WD 4RAVB 2AXTH 1VQ5P 3Q01A 1N73A 4JFZH 4JQXA 3T9WA 4Y99B 1AD0A 5CIPA 5IFJB 5FKPA 3PRJA 1LL1A 3VXQA 2OMVB 1IZNB 1PFOA 2XZCL 4WI6A 5FB8B 1BMGA 3MGTA 5EUOB 3WY1A 2OXHB 2QSVA 2Z7ZA 2NZ2A 3X13A 2WQSA 4FZ8L 5M1BA 3ZZ1A 4RA3A 1PGQA 5KSAA 3PDOB 2WYHA 4M4RB 4AM0Q 1ZLVH 3C08L 4QHNA 3T0ED 3QJTB 1EEQA 4IRSA 2APFA 4Q14A 4MD4A 1KYDA 3C6LC 3RK2C 4AK1A 3B2MA 2ZD0A 2KPNA 3H4FA 1EJFA 3W9EA 1RJYA 4JKPH 1S7SA 4YXLH 1IFDA 1I1AA 2ZXEB 1A8ZA 3PJSK 5IB2B 3O6LH 3IFPB 3D39A 1D6EB 1PPIA 4O4YL 4NUMA 3KHUA 3Q6FB 5KBLA 4KV5F 1FU1A 2YBGA 5DJYB 3RU8H 2C3HA 4ZMOA 1L4IA 3A0HE 2JK5B 5D5MB 3IB4A 1GK6A 2QADD 1SQVG 1I1FB 4X8JB 1FV1B 3B5HA 4Y2OA 2XKNA 4L8SA 3P4NB 3U4EB 3PE9A 5SX4I 1GH7A 1CLCA 4HPYL 3BWUF 1SVCP 1RF1A 5CZXD 1RK7A 3OLIA 2E9BA 4NQVA 1AI1H 1SQVJ 4FGMA 2CKNA 1CB4A 4AQ1A 2HP4A 2XDHA 3SKOB 2BZ7A 1A4KB 3I02A 3LPOA 4XT1C 3HRZC 3BAWA 4R0LA 4AZUA 3HKZA 3S48A 4FA7B 1XTLA 4QYAA 2APTA 2BDNL 5IHUH 2H1PL 5EO0B 1FGNL 3KPPA 4IOSD 3LNFA 3JV0A 4FMVA 2LE9A 3IS1X 3CFTA 2F7OA 1D7DA 2EDWA 6PAZA 4K9EL 3SPJA 2WZ5A 4MRBA 5C0BA 1MWOA 3JWOL 4OLYL 3H1HE 2O6CA 2CJSA 5AVWB 2BNRA 4CC4C 3EYUL 3CLEH 4I8DA 3LRLA 4MRCA 5D70L 3ZLQC 1QBLH 5DD6B 1BXVA 1KGYE 1MUJA 4FHJA 4LVNC 1HCZA 3KS0H 4MB1A 5DQDL 4MAYB 5CJ5A 1FLTX 4LLMB 3HW7A 4ODBD 3SKMA 4BXSV 5L2KE 4BWWA 1A66A 2FEDD 4PTUB 2X4NB 4HWEL 4PS8A 2IOIA 1F90L 1IBFA 3BPLC 1R5VB 1LTBC 5FCSH 3M0AA 4LKCB 1XDTT 4MCYA 2VDML 1GGIL 2CDEA 2GEEA 3GHEL 3BQUA 4KJYB 3RWJA 1G9HA 2UX7A 3ITKA 3PIQA 3MRQA 5IJDC 4RA0C 2AK4B 3STLB 1JFQL 4YMPA 2J43A 5GSRA 5FO9B 4C7NA 4XNMB 1DJSA 3US1A 2J1WA 1SM3H 2OYMA 4GRLC 4TT3H 1KJ2H 3BVNB 4JZOB 3SDAC 5I1EH 1F6LL 4FMKA 4N2EA 3WFEH 3FUHA 3TEWA 1UTDA 3VE0B 3VI4F 2VLRD 3Q5TA 4P46C 2IPKB 3ARRA 1YPZE 3HE6A 4OW6A 3D6GA 4ZOBA 3D9AL 1AFVL 4UINL 5EBMA 4JFDA 1JY2P 4OZFH 3D18B 3DVGB 4AQAA 4BK5C 4G8IA 4I48A 1CE6B 4WHYH 3LRSB 1MJ8H 1U41A 1WP6A 1JGLL 2ZKHL 3ARDA 1DQQB 4AYGA 5BO1H 2DQHL 4IKIA 1IGMH 2I27N 4Y5VA 1GSKA 3RWHB 3OX8B 2HH0H 4H5SB 3MRIA 1KZUB 3CVHA 3GXIA 4LCWB 3ZT6A 2E75D 2EJ1A 2QR0B 2RCSH 4ODUB 5DUPL 3WDIA 4WCYL 1G7LB 4AEIL 5C0NC 5KS9A 2IV9A 4I6MC 1DDTA 5J13C 4LQFH 4NGHH 1NPNA 3V8CA 5K9JH 2DIJA 2ZIDA 5C2UB 4Z0BL 5BOZG 1FO0L 2Q2LA 2EC8A 3ZYIA 5EA0L 4OI7A 5DHXB 1JI1A 1MG2C 2OMZB 2WMPB 3QUGA 5DZ9A 2WO4A 3H1KG 1NEPA 2D2CB 1UURA 5DD0H 5EUKB 2R83A 4KQ3L 5GRUH 2F7RA 3QQ9D 4JN1L 4UZSA 3TO4D 1CLYH 1SEBA 1YMMA 3AB0B 4HCFA 3GGWB 3APNA 5B1KA 3GSXB 4AEHL 2D7PA 2VQ4A 1AKJD 3H1ZA 2Y7QA 1QPKA 2VW7A 2F2HA 3NPZB 3H1KJ 4O58L 4FQXB 3BDBA 3IDGA 2WO3B 2BEZF 3MSPA 4NOFA 3VXNA 5I15H 4IHOB 5J6HA 3AE2C 2A74B 2H0JA 1WFNA 1B0GA 3BUIA 1NAKH 2DJSA 4HK0A 4L4TE 5H8DA 2OYKA 1R19A 1ET8A 4ZBJA 1UATA 3EJTA 4HCIA 4NP9A 5DQ9B 1AQKH 1FZOB 3WUUA 3PLNA 1ZMYA 2KDGA 3ZU8A 2FATL 2Y1ZA 2HLOA 3C5JA 1KCWA 3SY6A 1DQTA 1DQKA 3VCLA 3IF1B 4UUJB 4XGZB 4AX3A 3HC4L 3A0HH 3ZN6A 1A7QL 1S9XB 4FFVC 4NI3A 3GSVA 1EMTL 3X1FA 1GGBH 3NRFA 5FX3A 4I18C 4QNPF 3KYKL 1WAAA 1FHNA 3G04A 3MRDA 2FLMA 1C9SA 2P1JA 1G9NC 2PW1B 3FQUB 1EHAA 3QZPA 2OXGB 4WI2A 3SZ6A 5HHXL 1UUNA 4RGMB 3UZEA 4UAHA 2OYLA 3EWKA 1AZZC 1A6UH 3SQRA 4X4YA 2A9NL 3MRMA 5IJKA 1OP4A 5BVZA 1KFGA 1Q9LB 4M7LT 4DZBA 2H7HA 3MV7E 1AC0A 1JN6B 3N85H 5E94A 2EXSA 2R1WA 1OY3B 2N1KA 6PCYA 5IQNA 3ASNB 1IM3B 3VA6A 4F27A 3PWJB 1X9RA 1ZW0A 1QEWB 3NTCL 3QFGA 4N0FA 1DUZA 1IKNC 5IVNA 3Q8FA 3VI4B 2FYUG 4WWNA 4LSUH 1YN7A 3QR1A 5C08A 4YOKA 3K6FA 5ITFB 4M6NH 2JJWA 2OYPA 3QUMH 2XN9D 4YIQB 2HLAB 4TN9A 1SXBA 4ZOCA 5AVXB 4GXUM 4OH2A 2EXTA 1SDDA 1T7YA 1NCAL 5C0CE 2F8VA 3EOAB 2FYUJ 4YO0A 1ETB1 3QJRB 5EWIL 4F80A 1I9RL 4JRXB 5HDLA 3LN4B 5IB5B 3W39B 4X6FB 4ODXB 4Y4FC 5DC2A 5L2KD 2P8LB 4M1GH 1M4KA 4HKBB 3V6OC 3ISWA 2X4TB 2AEMA 2CK0L 4WW2A 3DX4A 4P23B 3D51A 5C6TH 3V5DB 2I24N 1KFMA 1MCKA 1LK3L 4R7NB 2V5YA 5HYJD 5H2BB 2XN1A 3B5GA 3WN5C 1H5BB 3ZT5A 3FFCA 3ZO0A 1T0MA 1JK9A 1OK0A 3ORJA 1HWHB 4JY4A 2VIRB 1TEGA 3HI5H 3DXAB 3IRZA 1DN2A 4K3DL 4LPVA 3WJMA 3VXMA 4TOYL 5E6SB 1KYAA 3P0YH 3QJSB 3DSFL 1FQ9C 3NCJL 4NT6B 5I1CL 2D0FA 5LGHH 3L72E 4HC1H 5DYOA 1QEXA 5GGSB 3FXIC 2BNUA 3LKQA 4KX8A 4NWTL 3JCUE 1GC1C 3T6XA 4XO4A 4WW1B 4LKXA 4M8RA 1EZVY 3MU3A 3AEFC 1IKFH 1KGCE 1NCCL 4Z5RB 4X0KA 3BDXA 5C0FA 5AW4B 4Q9BA 3FO9A 3CDGA 2MWCA 1P84E 4QI3A 2HRPL 5CCGC 1TQSA 2A73B 1MVFA 4MJ5A 4WNSA 3DRTA 1GYVA 4YDIL 1D5IH 4XVSL 4OKDA 4XN9A 3RX7A 1Y07A 1FYTA 2M5AB 4YE0A 4F3FA 4HWBL 2X4PB 4DOJA 4LLWA 3ZDZE 1HHGA 2JTDA 4LEBA 1T2JA 3D4GA 3BSZA 3PNWB 5LGJB 1A7OL 5DS8A 1D6VL 2Z31D 4IBTA 3VX0A 1IM9B 4R6UA 1U21A 1C08B 1T20A 1JY3P 5EFWB 1U3HC 3QDJB 1LDPL 4JUSA 4C54A 5A16A 2X10A 4XBGB 4IS6A 2BSTB 4AGNA 1T2KD 3N6YA 3SYQA 1WC7B 4XN7A 4HU8A 2OYHC 1A8JH 4WI0B 4I7ZC 5FYLL 1ZT1A 1SJEB 5T1MB 2V17H 7CGTA 4JKMA 4ZW5A 3FOMB 4E42A 1A9VA 1QI5A 3K91A 3AEDC 4W6WB 1BFVH 4L1BA 2XV2A 3HC3L 2ZOLB 5D1QB 4POZC 3ESPA 1W0YT 4I2XE 1JGDB 2HG5A 1A1MA 3EFDH 3QBTB 1LD9B 3PHQA 1OXZA 4XMPH 3SGEH 3NIFE 5T5FH 4FHKA 4WU7B 3GHPA 3VMYA 3CHOA 3P77B 3O8ZA 5JORB 3KPSE 3HS0A 2YMOA 3JBG7 2VMCA 5MEND 4ELMA 4FXKA 3MJ9A 4GUOA 1QATA 4F9LC 4H13C 3ZY7A 1PYWA 5GS0D 2CM5A 2JXMB 2QGEA 3ZX1A 2WQ8A 1J1XL 1A2YA 2WQWA 2LLNA 3ZQXA 1F4WH 1GGCL 2KS1B 1QVFO 4ONOA 3CHPA 3TA3D 2WB1A 5KYWA 3CG8A 1RUQL 4BINA 1OOWA 2YIHA 4TSCL 2HKFL 1SLQA 1Y6KR 5C1MB 1HILA 4NRZA 2QJYC 3V4WA 1S5HB 3S4RA 1CT8B 1IU1A 2WUCL 3HFML 4WFHD 3VYOA 1G6RA 4IOFD 4CDGC 1N7MH 1D5XA 3TXAA 3VFPB 5F7KC 1IIKA 1GZQA 5D1ZI 4PM1A 4ATWA 2PR9A 1RHHA 3DV6A 3IM1A 3LZQA 1LTXA 3CX5J 2CO7A 2H3NA 2LABA 4J3OC 5E8NA 5JHAA 1X22A 3OAZK 2ROXA 3MLTB 3IN0A 1MEXL 2CA3A 3RTQA 2GAZB 3GW6A 4Z7QE 3GIZH 3KXFD 4W9LC 5BRQA 1OAQL 5I82A 1GL2D 1U8PB 1QTSA 3G71P 4XP9L 3ROOA 3CJJA 4ZAKA 5I74B 2FQDA 4LHQB 3SQBA 4P2RA 4UDUB 1ANUA 4YDVA 3BEVA 3PHSA 4AIXA 2AJZB 2Z3FA 4G2AA 4N5ED 4GODA 1NUFA 3MC0A 4BD4A 5FGBC 4PJIF 2F58H 4GFTB 3RFZB 4KTDH 1HDMA 5DRNB 4KKCD 3RWIB 3ARFC 1E90A 2BIQA 2ZYGA 1TVDA 3ETTA 3WENA 4D9QD 3O2WH 4U3FE 2GA1A 2BHYA 4Y9EA 1CCZA 4YHPA 5A3IC 2SODB 3G5XA 4DP6X 3MRFA 1LEIA 1BYOA 2X4QB 4LCYA 1E4KA 4LL1A 1EAPB 4JDTH 5CHXA 4YXDC 3U0TB 1W0VA 2GCYB 1FYHB 2NLJA 2Z4QB 4U1GB 4Y9FA 4MCMA 3OR6B 3CN3A 3MBXL 3JCUH 2J71A 2WLHA 2G2RB 2PTUA 5EU4A 3NQIA 4PN6A 4GG6F 1J0IA 2F5BH 1VFOA 2DBLL 5DWUL 3GDBA 1WUNT 1P84H 2QZ5A 3L5WB 4ONHB 4W9GC 4X9GA 3RNKA 2Y69B 1KELH 2BS9A 2WTOA 1KGCD 3AE4C 2E7HA 4OJFL 4JMNA 3EYQD 1SP4A 3FAWA 3CXHJ 4HULB 4Z3TA 2AEIT 1KIUA 4PFEA 4BE6A 4BV1A 3CZEA 3I75B 5CFAA 2EE3A 2Y2WA 2WNGA 2TAAA 2X2IA 2AEJA 2PFXA 1P7KA 2YMTA 3P2BA 5FPIA 1BVOA 3BCCD 1D7MA 4LDLB 2HWZL 3MDJA 3PPEA 2PKDA 5IR1B 1LQBC 1IGIL 2Q76B 3MKGA 3VWJA 2ZUTA 4UQCA 3L73E 1O6SB 5E8DH 5DFWH 4N0CD 3S35L 5CM1A 5FO7A 4K7FB 1ZOYC 1PX8A 4AK2A 1N7SD 2XV6B 4ELDA 2ATKB 2W0KA 2JFCA 1Q86Q 2I5YL 2VXUH 2JKXA 5IVOA 2MIZA 3TVMB 4NUGH 2J1YA 2P5WB 2F5AH 2YS4A 3FPYA 3FYIB 5D72H 5AZEH 3RGVA 1I9EA 3GJEB 4JPQA 5E6IB 3QXDB 1YDPA 1E27A 3OQRA 2XUWA 2WVVB 3QJXA 4HLJA 3CGTA 1NL0L 4P48A 2IFGA 2CD0A 3U36A 5I66B 2X2UA 1WISA 1I9IL 3P69A 1PG7L 1ZT4A 3LKPB 1M3JA 3P30H 5EU6E 1J0YA 2IEPA 4IDLA 2EH7L 4MXQD 4KGLA 3OKLA 2K78A 4QRUA 1EXGA 1ZLWH 5FYKL 3T0EB 4JRYA 4JO2L 2K8QA 1MPAH 4HV8B 1KPRA 2TSBA 1RK1A 2A45G 2QFPA 3DX1A 2W91A 4DKDC 2IAMC 2BP5M 2Q7NA 2Y6TE 1KPVB 4WI8A 5IV2B 5LNGA 3Q2CA 2V4HA 4DPAX 2AITA 2VSKB 4OGQC 4PJIB 3RVUC 3ETSA 5KG9B 4Z7UA 4PJ8D 4NC2B 1T04B 2B4CL 2A3TA 3HPLB 2BP8B 1DSFH 4RISH 2B15A 4KH9A 1B9ZA 4UMGA 4DEPC 4DP7X 1K73Q 3NCFB 2EVGA 2OZ4H 5J1TC 1PU0A 3MJ8B 3ALPA 2QADB 1DBMH 3L5JA 2DW3A 5AALA 2CGRL 4M7KH 5CD3A 2EUVA 4X6BA 2WY3B 2HLFD 2L7UA 2NZIA 3ZIYA 1G0XA 3NIDE 4HUUB 1XHHA 4IIQC 2IFFH 1ZPUA 5IMKB 4FJ6A 3H2WA 1FORH 3S6CA 1FFPA 4P5MB 2DQCL 1AR2A 1GA2A 1E42A 4Y4HC 5DFVC 3F12A 1LJ2A 1NLDL 5BV7C 3MRKA 1QSFB 1TZIB 1VQLP 2OMBA 1T5XB 4AOFA 4RMUA 3SJVD 1KG0B 1VF5C 3NZSA 3C5ZB 3OXSB 1XZ0A 4HUVB 4Q0XH 4GG6B 1CGSH 3G6JF 2QGBA 2OTKE 1PPJE 1MN4A 5A2CA 4OD1H 3TYFA 1RUMH 2Q0ZX 1EUTA 3QHFH 4DETA 1TSHA 1U93A 4R8WH 5F0JB 2QTVA 1VQKP 3QS3A 3D06A 3OF6D 5KTEL 4BKLA 3PWNB 5GXBB 3CFIC 4NQCA 1KCUL 5D93B 3GRWH 3D39E 5JR1L 1JGVH 3C2AL 5HHVH 5B21A 4K8RD 3CCMP 2J4WH 1M6UA 3L74E 2RTTA 4G1EB 4XCNB 3SDDC 1OWRM 1GZHA 2KLTA 3MZGB 4JPZB 2IH9A 5JHLA 1NTMK 2PR4H 4JY6B 1SDYA 4WJ5B 4IRJA 2V3EA 2FK9A 3SEPA 1DANT 5F89A 1YN6A 3FQTA 4V1DB 2YK1L 1I75A 1T1XB 1HIML 3HG2A 2EVJA 3U2IA 1CE1H 4WWKB 3NZ8A 3TASA 1ACYH 2BOCB 5ABZA 5JA9A 5KVDE 4UQ2A 2D7TH 2W0PA 3Q1SL 1NTKK 4BE5A 5A2FA 3RK3C 4N2KA 1MFNA 1KJ3H 1DJGA 3ARWA 4P2OB 5DDHA 3A4EA 2DLFL 5APQA 5JUEL 4JY5H 5E7FA 4RBPH 4FFWD 3UAFA 1YYMH 5SV3A 5TDNA 1KJ2B 3Q8AA 4G71B 2ED7A 3SPGA 3T6VA 4AYEC 4PRBA 2P58A 1AHWA 2X0UA 3D3VD 2ZKXA 1ETA1 3ECQA 5IOPA 4OAWB 4Y9BA 4DP8X 2K8MA 5B1AB 2BNRE 1A6WL 3C87A 1FZKB 4HJGH 1DCLA 2G8YA 1E6OH 2EC9U 3IDIA 3U4AA 1NMCB 2OL3L 3GSNL 3OJ2C 2E75B 3WEAA 4ZQKA 3TGXA 3NJJA 1A7NL 3UIYA 4F91B 1U8CA 2DQDL 4U1NA 2CWRA 2J8HA 4X7EC 3GXFA 4KKLD 3T4AA 2ETWA 1D5MA 1CDHA 3ZYOA 2HRHA 2LGNA 5KSVB 5A2LH 3ATDA 4DFIA 4P05A 2M2DA 1PLAA 5DJCA 4UT6A 2DQGL 2AJXH 3GFUA 3MCYA 1DBJH 3GMAA 3NAAH 5DRZB 4W9EC 5CILH 2FEEL 4BRYB 3TO4B 3UYOD 5ISZD 1L9PA 3IWVA 3VGEA 2XACC 1J8RA 4KKQA 4LE8A 4QHLA 1HZKA 3BZEB 1NCBH 2XNAA 1AKJB 1Y47A 3ZMRA 2H6UA 1NINA 5EHFA 4JW3A 1E9OB 5CGMA 1D5BB 3N41F 4Q6YA 1JNNH 2WCSA 1UH2A 4TNGA 1AE6H 4UNUA 4AMKL 3P8CE 2ZKYA 1RJLB 2ZUQC 4AVHA 1U8JA 3PCYA 4JFDE 3PH0A 3ETBF 2WQUA 3G6JB 3DLQR 3H4HA 5BVPH 5HJ3B 4L8BB 3UP1A 1P84I 3F58L 3PNRB 4QXUL 3QDAA 4F9PC 4HXAL 4MDIB 3LKSB 1UOLA 1S6NA 5CINH 1LNUA 1RXLA 4NCC2 4PRNB 1R5WB 1HSBA 1CJYA 1CG9B 5AWNL 4K3AA 2ZWYA 4N8UA 5KS9E 1Q9KB 3CC5A 5LCVH 3KYMB 3AXLA 2UZIL 3RPIB 4URKA 3TNUA 3JVGA 3KW8A 2Y06H 3B8SA 4KHXL 4XX1E 4KUCD 4XZUA 2GK0B 5IMOB 5GIRA 3VXUD 5FKAB 3MQIA 5CSZB 1ZSHA 5CIPH 5CSGA 1YITP 2PPAA 3V7AG 1CO1A 5DHMC 3T6WA 4U0RC 2GTQA 2PPCA 3WDHA 1YMME 4NPKA 3NTNA 1INEL 4DO5A 2N1TC 3BP5B 5KVEL 3S35X 4G7RB 3BVDB 2YJQA 3L3HB 3LXUX 1XSOA 5FHBL 5L0QB 1WBXA 1ZHNA 3WU1A 4PB9L 3GSUA 2C1OB 4JFTA 5DEFB 3BRVB 2BCKA 1RIUL 4FXGB 3LJ3A 3FQYA 4AT6B 5FFOA 1T66D 3MFGB 1D5RA 5EOCH 4WGKA 1T7XA 4LOVA 5D9SA 2XN9B 1PG7X 1PGPA 1KFAH 2CNYA 3BKJL 3L17A 4EKJA 5K9OA 4P4KA 2C9AA 5BS0D 5DEGA 5B7FA 2DH2A 2Y7MA 1JUFB 2EAEA 3QUMB 2AJVL 2JP3A 4MMXC 2WYZA 1AH1A 3FWNA 1Q2NA 2GJ6D 1BQLH 2OP4L 2CBQA 4PRAB 2WWKT 3N9GH 5L2KB 1KDIA 1YNLH 3AG4B 3O41B 1ZA6B 2VW6A 2VUOA 1EVUA 3KPLB 3O8XA 5HGDB 3L9BA 3B3IA 3P11H 3PL6C 5KVDH 1E5CA 5DJZA 3GPEA 5KYUB 2C8NA 4H25A 1LEGB 1FPTL 1ORQB 1BCCG 2MQ0A 3GRGA 3ME0B 4WSJA 5D55A 5DJXA 2R7EB 5FA4B 5IVZA 4ENZA 4YZWA 2W92A 3HZKA 1L9NA 2XFXA 1QASA 3FTWA 3PLYA 3QUXC 3ULSA 3MGAA 5C9JB 3JWDC 4FL4C 3FH5A 4AZ8B 3QG6B 1OXYA 5JW5B 1W91A 3FFDA 1BCCJ 4PSRA 4EDXB 2UUDK 3MLWL 3N41B 1VQ4P 2VZUA 1YHPA 3NPSC 2AK1L 3EFOB 2DMCA 4S1QL 5T8IA 1FOSE 1RIVL 5C08E 4ZFGL 1CN4A 1D2OA 3F7VB 3OKKA 1U91B 4B50A 3FT2B 4PY7B 4I0PB 3BO8A 3BAEL 5C0BD 2AAAA 3ABKB 3UG4A 4EKXA 4WO4A 3O45A 2HODA 2IQ9H 4WUUD 3TH4T 5D2NC 2IV8A 2I60H 3A6BH 4AUYA 4JKWA 4JFYA 1F4XL 4QTIH 2VKWA 5FW8A 1XB6A 1HXMB 2X5PA 1ZVSA 4GBXA 2EE0A 1KB5L 4XXWA 5DRWA 5BVJA 1J9TA 1BZDA 3ABVC 1SLUA 2YD6A 3OR7B 5F9JA 4L3ED 1FGVH 5BZXA 3WS6C 3IDYB 3GYRA 32C2B 3PDGA 1FAIH 2NY3D 2Z31B 2IALB 4OFDA 1TJHL 2HPCA 1JGUH 2FYYB 3I74A 3FO2A 1UCBL 1OAKL 1TFHA 3FB8A 3FFCE 3QH3A 3WG7B 4FKKA 4PCSA 5E4OA 1ULVA 5E4AA 3GMRA 5K1JA 1K3ZA 1RHZB 5E1GA 4J8QA 3VXME 1OAJA 4OQTL 3KPTA 1BWWA 4X4XA 3D25B 4D6TE 4L4TB 3RNQB 2AFNA 4OLWL 3NFPA 5IJVB 3CVHH 2HKAA 2A0LC 4BM7A 3MV9A 3VD3A 4CGUB 5EEWA 5I16A 2A99A 3WFZA 2YAQA 1W2KT 4DVBB 3Q5PA 3FHAA 1VQMP 4UTAL 5KYYA 3EGXB 1RMFL 3K6OA 3K46A 3LH9A 3C8DA 3LD8B 3PHAA 4RX4A 1HHJA 3FO1B 1FYTE 2XCMC 4EF3A 1WMKA 3MNVA 5AVUB 3BLPX 3ZDZF 2VRQA 1FZEA 2GIMA 3I50H 3JXAA 2XU6A 4XP4L 5C92A 1EO8L 1SHXA 1AYRA 1N67A 3ULVC 2UWJE 1CL7I 1ZTXL 5GTIE 6CGTA 1I1YB 1T5KA 5AB9A 2AGJL 1H9VA 4MJ2A 5GGQH 3W9DB 4U2ZA 3TA3B 4TNVF 3G6AA 5E9DE 2POHA 2Y6SD 1NU1E 3AE1C 4Y1SA 3ULAB 1FFTB 4NHCL 5HYQA 4OCSL 4UIKL 1JGEA 2QVTA 3BGFB 4QHUA 4IFFA 4DCQA 1K6QH 1CFNB 1J1DB 2H0FA 3V5HB 4A63A 3DX6A 2B8OT 3BPCB 3P9MB 3CN1A 4FMFA 1WEJL 2PXYC 4ZMAT 3UAJC 4WGVB 4QRAA 3ML8A 4KVCH 5K33A 1UWFA 4C56A 3Q2NA 4U4BA 1DBAH 2K9FB 1ORSB 1UWEH 2HT3C 5HYSB 1NCJA 3S9OA 3SBQA 4YDKL 1LT9A 1XF3A 1Q72L 2ZP0T 1N6VA 4A2MA 1UADC 2XN2A 1EXIA 3EYOB 3QCVL 1K4CA 3VXRA 2HX7A 1KQLA 3V4QA 2ZG3A 1VDGA 5C0CB 4U6YA 5D7KD 2OQJB 4ZJ9A 2FCBA 5AKVA 4P99A 1FNGB 43C9B 2QEXP 2NZ9C 4KQ0A 5EO1B 3V4PA 3EH3B 2WKOF 4U1IB 4ABUA 3F5HA 1DQVA 4HEPG 1LQSR 3DBXA 5ILTL 5TF0A 4CU6A 4ELME 2V2XB 4ZFOA 1DCEA 4WHCA 4HMCA 1UD5A 4KRMB 2VL5A 2NY2C 4OF8A 4YC2C 1AGDB 2I32A 1CFTB 1H8LA 2V7QJ 1X6NA 2CG9X 3AVEA 1V10A 4K9JA 4QJ4B 3CBRA 3J2PA 4MQ7A 3NJHA 1Q94B 2KT6A 1W8OA 3GZPA 4Z95H 5HXMA 1JZEA 5FCUL 2AXFA 2J6WA 4KO6A 3QA3B 4N86A 3CMAP 2VT0A 3ULUC 5JW4Q 4M5ZL 3U1QA 4GYBA 4M1CC 2KDYA 1RK0A 2FIRT 4MAYC 4Z7QF 3UEQA 5CD5D 5C08D 4MA3B 3KL5A 4WIQA 3O3EB 2OR7A 4GQ9H 2WZPD 4ETQA 3QRGH 4CUCA 5DT1L 3I6KA 1NBQA 3HJ0A 4L9DA 5IEHA 4YDJA 2AEQL 5H2FE 3E1IA 3CZLA 5TDOB 3I9GH 5F71A 2H1XA 2WXIA 3IFNL 4N25A 4BA0A 4OB5H 3UMNA 5MEQB 2FX9H 4ZMWA 1NLBL 2VQTA 3BUTA 2PP7A 2XKMA 3GQFA 3L3DB 4NCDA 3ZDZB 1NANI 3M1CA 4EJ1C 4K7PH 4BSVB 1ZHLA 2W9LA 4Y88A 1J05A 2EXYC 5CUSL 2VWEE 4FNQA 4HCRL 3VU2A 4EPSA 2EDHA 4JLRA 1XCXA 2F8OA 4QT5A 1N7SB 4TNWF 4N78E 1SYVA 5JA8B 5IGXH 4MXWH 3CWBE 1H0TA 3QUHA 3VYIA 3KLKA 1OPOA 2FRGP 3LIUA 4XBEL 2WMMA 1DN0B 3VXMD 1BQUA 4TVUA 3EDDA 3L1FA 1F97A 4X5LA 5I76A 1PFIA 1FNEA 3KBHE 2IDCA 3TN0D 3OXRA 3CH1B 2XT1B 5I30L 3FONB 2QJPB 5CJQH 1M57D 1I8KB 3BASA 3D69B 5EO9B 3UPRB 1S7TB 2B59A 4JFEE 1L0LD 2R2CA 2XC8A 2DTML 4NC0B 2HJKA 4ELKA 5IHWA 4KZEL 5L6YL 1N64H 3UTTA 2YSSB 2XPZA 3VB9A 3QWOC 1YJNP 5MHSD 3BWUC 3MRLA 1T2QL 3AB0C 2AI0L 1QFOA 2WWNA 5GTIH 1VGKB 3BSZH 3LW5J 3L3KA 5ETUB 4NUQA 1JVOA 2V9TA 4OFPA 2X12A 3KWUA 1C5CL 1JPFA 4FQXC 4PJXF 1QWNA 3OMNB 2VQUA 1GHFL 4APQA 5B38G 2A74C 1ETZA 2C9PA 3DRQA 2K37A 3F64A 3JTSB 5I1LA 4CJ1A 3B5ND 1FF5A 1HHKA 3CFJA 5DVOA 5B8CB 2PO6D 1Z3RA 4ETYA 2DDQL 2NSXA 2R8SL 1E3FA 1KYOI 3N55A 4B95C 3WO3B 5J9PA 2R59A 4JVWA 2Z1KA 4QHKI 3BKML 4TNEA 1WD9A 5DF0A 3VFUA 3VRIB 3MA9H 3MJ6A 5HTSA 1FVEA 3SGJC 4Q97A 4UOJA 4PJ9A 1DH3A 2AJSL 5LDUA 3CCQP 3EUDA 5IB4B 3NJLA 2LR4A 1HFUA 3B6SA 1UXSB 4WF7A 3CCSP 4YLCA 3EFFK 3BFOA 3HE7A 5ALCL 4Z7QB 3H0TA 2IQAA 3P40A 3BZ4B 4N2LA 3Q8CA 3X14A 4U31A 5KTBA 3CX2A 3HUJA 3NN8B 2NYYD 1QBMH 4RGMC 4JRYE 3K2KA 1TO5A 3MJ9H 4UIMB 4F8QA 1RZGB 4IK6A 2R29L 3L70D 1CYGA 5DZNA 4P5SA 3SFEC 1SJVA 4UM8B 3L75D 3L9RA 4XNUL 3CZFA 1KCSL 3D4CA 5LN8A 2XIIA 1CWVA 3C9NB 4PBDA 4Z7UE 5SWZE 3VYPA 1G9MH 1NUDA 3FTGA 2ZWLT 3ZR5A 2FQGA 3QDHA 3QNFA 4KVNL 4KUCF 4X7TB 4B9GA 4MJID 1G6RH 4R7DA 1DUYB 1A02F 3AW5A 3NIDF 1MY5A 1VAHA 3QZWA 1HXYA 5DMYA 3GTNA 3PGCA 1Z9PA 4IYKA 5HGHB 2NPSB 4KKBD 2BOLA 2Q8AL 1E2WA 1FO0A 3MLUH 4D2NA 4IEFA 5ACZA 1OW0C 3DROA 1ZAGA 3BIBX 3APDA 2ZP9A 3ZHFA 1M9WA 4OVNF 1G7IB 4F57L 3VRJB 2C7UA 4P3DA 3KLDA 4R3SA 5H2FH 3RTQD 4OD3H 3PDDA 4AVIA 1AIZA 4TSBL 3QRFM 1T0OA 4PYGA 2FNBA 5BUGA 1N7LA 2CBOA 3D3VB 2I1KA 4N8CH 2XTSA 4P2RD 3MFFA 3HZVB 3WJLA 1JF1A 4NBYB 2BSBA 3LZFH 4NQCE 1H5BC 1TOXA 3MLZH 1MZZA 4LARL 2IH1A 1G7JB 4MQTB 2UX6A 3GMPA 2JJTC 2WVSA 5C07D 2CMRH 3QQ3A 4QCIA 1MAJA 4TKWA 1NFIA 1EXUA 1QKZL 2ZG1A 1OTTD 1OPGH 3B83A 4PJXB 3PWPA 4JFQB 2APSA 5GZOA 3UTQB 4EZMA 1TCMA 4AV5A 2X0WA 2R3SA 1UACL 3SE6A 1BREA 1RY7B 2IYPA 4MBRA 5IFAL 4TRPL 3BKCL 3STZA 1NTMG 4RDQF 5DK0A 3PQYA 1HKFA 1LE9B 3UC2A 1KGUA 4P2QD 1SMOA 5FOJA 1W2EA 1RJCA 3Q1EA 1NSNL 3QE5A 5F88B 2G5RA 4U33A 1RH5B 5ISZB 1KJMA 4ZNEE 2ZX5A 3H32B 1NAFA 1DX7A 2IADB 2JQZA 3CU7A 4YBLB 3FKUS 4JFHE 1HQ4A 4JDVB 1NTMJ 2Z93A 1E8YA 2FXPA 1NTKG 1RURL 2GSGA 2Z91B 2QHRH 1EHLH 4TTDD 2FWSA 5FWQA 1E5ZA 3CXDH 3MBWB 4NSKA 2EABA 3TCXA 1KBGL 3W2DL 1HNGA 1KIPB 2NUPB 4BQBA 3ARXA 3TEYA 5EU6B 2VDPH 1VSCA 4PS4L 3S37L 1MCJA 1UT9A 1WT6A 1KTKE 2P80D 3K0YA 3QJFA 4FG6D 3TC9A 4O2CB 3QIUD 3VG0H 1OVUA 2DLGA 4DTGH 4RGOH 2BCCG 4ORGA 4BFJA 2W8ZA 2AQTA 4E9VA 1RVFL 3RP1A 5E2TH 3E8UL 5CO1A 3I6LD 3NXSA 3EOTL 5CCKL 1N8ZB 3RBGA 4BH8B 3RVXC 4D9LL 9PCYA 2FSDA 3SYPA 3MA7B 4GG8B 4RGND 5J89A 4IBVA 2BCCJ 2H88C 4MJ6B 3ZKND 1S7QA 3VWJD 5TGBB 2WYIA 3O6KL 4OGAD 4BFOA 5EIIB 1BBJA 3T8XB 4Q9RH 3TDKA 3LRHA 3UH8A 2M1KA 3VXUB 4DUXA 5KW9H 5D1QC 1A9EB 1KBWA 4KJQC 3VMXA 3NIDB 1J18A 4XX5A 3UZQA 1JZDC 5FA3A 1LK2A 2NY6B 3BFQG 4NO5A 4N26A 1AD0B 2HJFA 4XAWH 5FKPB 3VXQB 4OUUA 2YLHA 3VXOB 4PRHA 4TUOA 5T1DH 3MGTB 4IQHA 1TTCA 4QPEA 5HI4D 1EDQA 1YNKL 3X13B 1MRFL 1OT2A 5AKSA 5JW4M 4JHAL 4ZS7H 3UZVA 2ZYIA 2H2PC 3HR5A 2IG2H 3OGOE 3WXVL 3DX8A 4MS6A 1UH3A 2CHXA 3MD0A 4IRSB 3UBXB 4D3CL 3RL1A 4MD4B 4NYLA 2VXTL 5F0PB 3AE9C 2FHCA 3W9EB 1AZUA 1RJYB 4B9ZA 1E8ZA 1BZQK 1I1AB 1QNIA 2VMJA 3EF4A 4Z7IA 4HHWA 3D39B 5KS9F 4XR8C 3QORC 3GIVA 4PU2A 2NOYA 1RSFA 4M1DL 4WVRA 4F1SA 3HJEA 2R4SL 4L0YA 4HOZA 1OHZA 1T1WA 1UFUA 4Y2OB 4P9HL 5B7EA 1PVHA 4R84A 2XKNB 4L8SB 3CD4A 2J88L 4EI5C 2BP0A 4NO0A 2DWSA 1RF1B 4HWBA 1TF4A 3GK8L 4NQVB 5I74C 4N0UE 5IBTH 4K3JH 2GJRA 4WFFD 1MIEH 2V8LA 5GISH 3B2VH 4AQ1B 1EO5A 2IIJA 1GS8A 1WHPA 4PJDA 1CF8L 3I02B 4R0LB 3MP7B 4EDFA 2Q9IA 5F7WC 3H1JG 4TUJA 5L8JB 1MNUH 4WV1A 1T0NA 3KPPB 3NRPA 1ZIAA 3VI3A 3B7YA 4FQJL 3ZKMC 3DX9A 1UQSB 4F37K 3OKOA 3RAJL 1P5UA 4LSPH 1WZ1H 2VUKA 4J3UA 1VGEL 5C0BB 3H1JJ 1VEMA 1L7TL 1KIRA 4ANVA 5EN3A 3LNEA 2BNRB 4WKZA 2P24A 1V27A 4G1MA 1QVOA 4KRPB 4TPRL 4EN3D 3MUGA 4LU5H 3RYMA 1MUJB 5JHLH 1WAAF 1WAEA 4OLVH 3B34A 3SKMB 3WFBL 3EJYD 5E70A 2K7QA 4L1LA 3EJZD 1L9MA 4PJ7B 3MNZA 3B7UX 4MCYB 1U8NA 2CDEB 3ESUF 4IRJD 4L3EB 4N0YL 4KOBA 4W9IC 3RWJB 5DLLA 2EH8H 4C83A 4G70B 1MRCL 2NY3B 3DX7A 4QRPD 5G2NA 2EYSA 4YTPC 1P7QA 4KPHL 5DUBA 3BZDA 3EUUA 3T0VA 4HBCL 2OQQA 3TH2T 3HB3D 4I1PA 1YO4A 1IC1A 1XH2A 3S5ZA 4MAUH 4ABVA 5GRXG 3EHBD 4DFHA 2W60A 4TULH 4WB4A 1M2VA 1Q0XL 4I1RA 4CNIA 4EZJA 3ZW3A 3TJEL 1OAUL 3HE6B 1D9KD 4JB9L 4XAKD 3EDKA 2OTWA 3EQ2A 3O81A 2GUVA 1SQBD 4JFDB 4OF0A 1SFCC 3D6ZA 1UB6A 4HUWA 4MYWB 4G8IB 4I48B 4AQAB 4AYSA 3OD3A 3IJEA 4QTHA 3LN9A 1ASPA 5KVFE 2MHAA 2DYPD 1BX2B 3E38A 1HWTC 4OCYL 4MD0A 4Y5VB 5D8JH 3UG5A 5CEXA 3CVHB 5CLYA 4R7VA 3EDFA 5E6IC 1NBCA 5E8OA 2A6DA 2B0SH 2NT0A 2CUMA 5KS9B 1F58H 4ABWA 4FE9A 4ZK8A 4LHJB 2G9HA 2VE6A 4UT6H 1TEYA 5AOMA 2OX5A 3IMRA 3O6LL 4I3RH 1EEZA 1IC7L 1OF0A 2FWLB 4QRRE 4XB3A 2MPAL 4UB0H 2QA4P 1I9JL 1PEWA 1N6QL 2CGYA 2VMFA 5I8OL 2PTTA 2ZNXA 2IBZY 3OB0H 1SEBB 1YMMB 1SBBA 3H3BC 3WIHL 4M8QA 1G4RA 3RZCA 4HJJH 1SYSA 1JHKL 2A06D 4DGYH 2Y7QB 2WLLA 4K5PA 5I0YA 2R0WL 4OFYA 4WEMB 2E6QA 4X98B 4AKPA 1KLUA 3VXNB 5J6HB 2YIUB 4HK0B 4M3JA 3ATFA 4XC3L 1FBIL 2FLRT 2BJML 4HAKA 2CUIA 4PRPE 1LE5A 3KJ6H 3MV9E 4DW2L 3LS5L 1J9CT 3C5JB 1A9BB 3MUY1 4YK4B 3WMM0 2YHGA 3CVDA 4I13B 5AOLA 1JCKA 1FNSL 1JPSH 1MDTA 3VCLB 4IKLA 4U2YA 2BZCA 5CMZA 4A7VA 4TLFA 5INDA 4HW6A 4UMSA 4CBPA 3HMWH 4ERSH 4FI6A 1W72A 4JPKH 1R3IH 2DICA 1BM3H 3DMMA 4P5RA 4XP5L 4W93A 3MRDB 4JYBA 1MVUA 3G04B 5F9OL 1T5WA 4HPOH 2QEJA 1ZR2A 4TQEH 3C5ZC 5KBMA 4H8HA 5L8RJ 2HVKA 4LOFA 5FUZH 5I8EA 3RDJA 4R2GC 1WDAA 4UILH 4GOEA 2VLKD 5CBAA 4XZ4A 1P69B 2ZJSE 3QRLA 3SSGA 1QSEE 3J07A 4X4YB 4LGSB 3MRMB 4D94A 4RBPK 1J0KA 4DZBB 1J8HD 4MS8C 2HFTA 5E5LA 5E94B 4AJYV 3Q5OA 2R1WB 2ZCKL 5EU3A 1FDLL 1NWOA 3HZMA 3UPAA 1AACA 2CK2A 1CICD 5HI3D 3U1CA 4HUXA 5DU7A 1RF0C 2Z35A 2Q8BH 4N0FB 1DUZB 1OSEA 3AU0A 4NZRL 1E40A 4C56E 1K85A 3NIGE 4U49A 1YN7B 5C08B 5I6LA 3HIZA 1VZGA 3AY4C 3FTVA 1BQRA 3WUTA 4LAQH 3U7YH 4ONGL 4XC1H 4KROD 4PGDA 4K5OA 4P4KD 1IGYB 4S2SA 1KN7A 4EQ2A 3VXRE 1REIA 1SDDB 1CR9L 4ZKPA 5CZRA 1HBWA 2CJTA 3ATAA 2GM4A 4C4KO 4WWKC 1OP9A 5FO2A 2B3IA 3BISA 4ELMF 1QLED 1OQXA 2YXFA 3KWXA 4AI7A 1MREL 1MFTA 3GINA 4OM1H 3KS0J 1S3RA 2CO2A 5DJ0A 3FZUC 5KBPA 4KOCA 4P2OC 3QO0A 4O5LH 1IFHL 1UT2A 2E9IA 4EXKA 4Q9QL 1VFMA 3ABGA 2V0AA 4KXDA 1IBBA 1M90Q 3D4YA 4FQLL 4Q58C 2WIIA 5TE7H 4G83A 1MCPH 3U2SA 5FDYA 3HBPA 5I6OA 2D7OA 4JR9L 1G0DA 1NBYA 1W80A 3H2PA 3MLRH 1HZHH 1JXKA 2A9DA 4YHZL 4H40A 1HU8A 3QXVA 3FFCB 4PLOB 4WHDA 4LMQE 4FOMA 3UERA 1J9QA 3WJMB 3GXDA 1CLOH 1BZOA 3VXMB 3BJLA 5FUCC 5I1KL 4Z7WA 2E75C 1U3ZA 2K70A 2VN5A 4R97C 2ZCLH 1VL2A 1DHKA 4GO6B 4LCCA 5DYOB 3TN0B 3H54A 3KL0A 1YQ4C 1HCFX 2BNUB 3LKQB 3UEZA 5KVFH 2WWMD 1M57B 2P48B 5L8LB 4LKXB 3VDCA 2L8AA 1SQVE 2GBTA 2GJPA 4KI5D 4OIIL 4X0KB 9CGTA 5FM5M 5IQ9A 1Y6MR 4LRIC 3FO9B 4IRZH 3U6XS 2B5IB 1Y0LB 3QQ9C 4M6MH 3TO4C 1OGAD 3B2XA 4MJ5B 3WXWH 3DRTB 3GD1C 5GS1A 1NC2D 1NQBA 3IGAA 5IWLC 5TE6H 2XWZA 2EDNA 4ZI8A 2AXHA 3IDXL 3Q5SA 1FYTB 4GBXD 4ZPTA 3HC0B 4NZFA 4F3FB 3AS3A 5DK2A 5DQJA 1LTJA 4L8DA 1MJ7L 4LLVA 5BZDA 2BH0A 2FNWA 4MZIA 3A67L 5DS8B 8FABA 5C0AD 3S88L 5A40E 4UV7H 4Y4KC 5IHHA 4HIEA 1F2QA 1T20B 2PO6B 2APXA 4Y7OC 4YXHL 5E5MA 3U7YL 3HG1A 5E1AA 2H0PA 4IS6B 3RILA 4LC1A 4QR7A 1TITA 1ZHKA 4M61A 2EC9T 2Y36H 3W57A 1ZT1B 1PEZA 3PS6A 1R33A 4E42B 4R4MA 4Y0GA 3PGFL 4Y2DA 5B66E 1JP5A 1H3PH 2DN7A 4AL8L 2OR9H 4DP1X 2WINA 3FB5A 1R9FA 1AQMA 3VOPA 1B4LA 4GAGH 4A7GA 2QM8A 5EC2A 4MCZA 3L3GB 3K72A 2HKHH 1M2OA 1NJIQ 1QHOA 4Z3HA 1A1MB 5I9QB 4Y5YA 3MYJA 4I85A 5G4OA 4DAGL 1VACA 2G3ZA 4DN4H 2Q1EA 3HVDA 1IQDA 2RACA 2PCFA 5BRZD 4WJKB 5KJ7E 1I82A 2B08A 3QIWD 4FQQA 4C4UA 2JNZA 4NBZB 1PIFA 3AFLA 4FXKB 1BG1A 1FA4A 2A4CA 1PYWB 4H8WL 3FQ1A 5FK9A 4WK2B 3F6JA 2JB6A 3L71D 1FDMA 1A2YB 2ZJSH 2MRYA 4CDHA 3AABA 3AZUA 4HALA 1CDYA 5L9DL 3V79C 1U6AL 1OAYH 3CSFA 4FXGC 4HSCX 5KYWB 2IPTH 2VDQH 2OL3A 3SO3B 4PTTA 5B1JA 3U9WA 1TZGL 1CDGA 2J1KA 4ZUWA 3WNMA 2Z9TA 3B2DC 4W1TA 5E4EB 3TEZA 3ATBA 5I8KL 3POCA 3SCMA 1HYSD 4BUQA 2WYTA 1HILB 2WP3O 4NRZB 4RKUJ 3NEXA 2WN2A 4R83A 2IGFL 1G6RB 1L3WA 2ARJA 2HT4C 1D5XB 3CFNA 3NGBB 4M02A 3Q9QA 4NNPL 4H1LH 4S1RH 4N2GA 1B90A 1GZQB 4CVXA 1K5NB 3OC8A 1RHHB 4FABL 5KJRL 5BJTA 2FSEA 3AS1A 4C56D 3N42F 2E4TA 2H3NB 2BNQA 4P49A 2VH5H 2FFDC 3RTQB 5EDSA 3PP4H 4FZEH 3H1HJ 3O6ML 1PCXA 5L88H 1WIUA 5IESH 4CVZA 2HN7A 3VSTA 5EZIH 3WBDA 3IE4A 1MJUL 2CRZA 3VH8A 1BJ8A 3V4PH 4JO4L 2QPUA 4ZAKB 1AY1H 3SQBB 1YY9C 3H1KE 1JWSB 4P2RB 3OAYH 3D0AA 1TJIH 4YDVB 3BEVB 5DHVA 4WHTA 3DGGA 4KK6C 1DVQA 2QDWA 2X3AA 3MODH 4Z7UF 5D1XA 1HDMB 2EDLA 5CKAA 4AQRD 3OKDA 4HETA 3TT3H 2YD7A 3LMJL 1F6FB 1OALA 2A77H 3G6DL 3LRKA 4AYFA 4H0GA 4PJFA 3FUDA 3EYSL 1FZBA 1BFOA 3FUEA 3QNZB 1UM5L 2BSSA 4YHPB 3G5XB 4I0PC 3MRFB 4LHUA 1FZCA 3GMMA 4CSPA 1LEIB 1I1CA 4AQEA 3KPMA 1MFDL 4KHXA 2X9YA 1PZUB 1KBKA 3NUKA 4CGTA 3SYAA 5A2JH 3GSOA 2DV6A 2V5MA 1YYCA 4XPHL 1UXLA 2X40A 1JI2A 5JPNA 4ZS6C 2XZCH 1N5AA 2WGXA 1HOCB 4Y16A 4RRPA 5AAWC 2XIBA 2F1AA 5EU4B 1UWXH 3D48R 4TVPD 4LNRA 4JKLA 4BKTC 4FZ8H 2OJ1A 4H2CA 3RNKB 5T5NF 4ZNCA 1SF5A 2F19L 4F7EB 4R4ND 5DYFA 1JZ8A 1RP9A 1LP1A 1Z3GL 2KLUA 3IDYC 4K2UL 2BSCA 2J3SA 3QIUB 3O4OC 4PYHA 1IE5A 2VDPB 1GJUA 1KIUB 5AL8A 3PRZA 3R8BB 1ECYA 4OJAA 1HEZA 1RZFL 3QCUL 1P7KB 4QO1A 5CU9A 3VD9A 3LKNA 5FR3A 3H7LA 2OZNA 4O4YH 2UXFA 5GS0L 1FL6A 4DCKA 2DIBA 3PWPE 2VR4A 5TQ2L 3VWJB 5CJBA 4B5ZA 1YEGH 2GT9A 1ZA3A 4DGVL 3K5RA 2R69L 3GMOB 2QL1A 3V0VB 2YO2A 4LOUC 1SY6L 5CCHD 5FO7B 2EACA 3L2MA 4JAMA 3PQYE 4TQIA 3VVVA 1A6ZA 4LGPB 1L0PA 3QI9D 3QZOA 2DQMA 4HPYH 2G4GA 4W4NA 1GU5A 3ZRSA 1XEUA 3UJTL 4MZRA 5B66H 5EU7E 2Z5IA 1YDPB 3COOA 1ASOA 1SDAB 1XGYL 1IGJA 2K9UA 1HJBC 3U36B 4RIRA 3HE5A 1KGJA 3BX7C 3BPOB 5EG6C 1ZT4B 2BDNH 3CZNA 1Y6NR 2H1PH 2FR4B 3N42B 1NKNA 1FGNH 5APSA 2JJLA 2VNCA 4PV1D 3TX4A 3OKLB 4ICWA 4QRUB 4HK3N 2ZSVB 1CXEA 4ZKUA 3UTTD 3CFMA 2BSED 2CPUA 4JDEA 3WEXA 4Z77A 2WKGA 4K9EH 4PJBA 4ZO7A 2HVBA 4AYID 1BEXA 3C8VA 2AQSA 3JWOH 2VM9A 3ZKXC 4OLYH 5H94A 1B4TA 3KPNA 3BGFC 3EYUH 4NQDA 4O51B 3F84A 3RX9A 2K6WA 5D70H 4JK0D 3KHOA 3AEAC 4B9PA 2NY1D 3ILQD 4Z7UB 5HHOA 2OTUA 4I9WD 5A2AA 1TVBA 1YMHA 1RZKL 5DQDH 4APQD 2I9LA 3RVTD 3N04A 3ZR6A 4HWEH 5CD3B 1F90H 3QO1A 4X6BB 2K0RA 1PY4A 5I5RA 3D09A 3LOWA 4QWWC 3C1LA 2VDMH 1GGIH 3GHEH 2P5EA 3GMLA 2IDSA 5HVWA 4EI0A 4M5YL 5KKZB 1OOAA 1B6UA 5DS2A 5GGTL 5BMFL 1E5YA 3SWYA 1JFQH 1OCWL 4I1NB 1FFPB 4PJ9D 2F74A 3DBSA 5B4MD 4PRHE 1KUMA 2XWRA 3H9ZA 2NDGA 5GS2H 1AANA 1PZAA 1EEYA 3ECWA 1FSKB 3MRKB 5FYJD 4HJ0C 2OK0L 4L8CA 3HE7D 1H19A 2BWDA 2WXNA 1XZ0B 3OJAB 5DJAB 4Y9GA 4WY7L 4W6YB 1VQ9P 3D9AH 1AFVH 4UINH 1WAPA 1FRGL 1U93B 2F1EA 4XXCC 2H32A 4LDOB 1TT6A 4OQTA 4H2AA 2RR3A 4A38A 2C7FA 2BS71 1JGLH 2ZKHH 4BKLB 1GVIA 1ZGLB 2DQHH 5TE4L 4LVHB 4IGBA 4GY4A 4E9QA 4PB0L 4IU3B 4YGAB 2Z8RA 1ZRTE 5DUPH 3ZGIA 3BC9A 1NPJA 3S98A 3LN5B 4AEIH 1YIJP 1KC8Q 1CZQA 2QVFB 4LPXA 1PMYA 4Z0BH 5IB2A 3N40P 2NR6D 1FO0H 1CD1A 1RV6X 3QUZC 5EA0H 4JG9A 3RJQB 2H9GA 5IEKB 5DJYA 4IRJB 4L73A 3O4LA 2I7OA 1L0LK 5F89B 1YN6B 5D5MA 4N90E 4KQ3H 1G1CA 3DGDA 3FQTB 1I1FA 4JN1H 3IDMA 1YJ9P 3NZ8B 2RIKA 3JT2A 3P4NA 3L72J 1U92A 4AJVA 4ZXBA 5I8CA 4PJDE 5CEZD 4AEHH 5GHWL 1X44A 1DP0A 1ZLUH 5DDHB 4PCKA 3WNKA 5J4MA 4O58H 4V2CB 1U7JA 1TUPA 3EHBB 4M7JL 3U30C 1OZUA 3VI3E 2OMXA 3T0XA 1A4AA 5CFHA 5LXGL 3BCCG 1KN4L 4HEPA 2VJ0A 3CZKA 1P84J 3D8MA 3GHBL 3QCTL 1A4KA 4MWFA 5CGBA 5TDNB 5FYLE 2EKJA 7FABH 1AHWB 2ZUSA 4TUUA 3HG4A 3V0WL 2FATH 2YKLL 3NMEA 3Q9PA 2R9HD 4Z3EA 1ROCA 3FDWA 1ICTA 2F54D 4PVBA 3KEDA 4H8VA 2WLZA 3H55A 1A5FL 3LPPA 2DYSB 1FNAA 2WIMA 2HFED 2NXYD 3DHPA 3HC4H 4G59C 3L35A 1U2CA 3T0BA 1A7QH 4PWKA 4ZQKB 2ADIA 1BVZA 1EMTH 2XVBA 1U8CB 1JG9A 3PWPD 4J1UB 4U1NB 3VG9B 2QDVA 2HRGA 3T4AB 4MZ2A 3KYKH 5JXEC 3PV6A 2QJPC 4XWOC 1MCIA 3HD7C 1U4FA 1CIDA 5DJCB 5HHXH 1PP9D 5D7JC 1E43A 4LESA 3R4YA 3WEBA 1J88A 4L05A 5ERWA 1TTFA 1WFOA 4YHOL 4LMQI 2ZOKB 3M9BA 1OM3L 4NENB 3ABLB 3UAAA 3NCYP 1L7IL 4BHUI 2XNAB 1YC7A 4MA8L 1XEDA 4N87A 1RQVA 1UJ3B 3STLA 3V6ZB 3RUGF 3IN6A 3FCTA 4FS0A 1KGIA 3NTCH 1BJ1H 2YPLE 3BVNA 3VQLA 1U8JB 3TESA 4HDIB 1CGWA 1DE4A 5B8CC 4KI5F 3W3BA 4PR5A 3FJTA 2P44B 1DJZA 4OD1L 2HCZX 4GAJL 4KMQA 2FIKB 3KCPA 1NCAH 1CVRA 3DVGA 5F0MB 4R8WL 4YJZL 1HSBB 1SHSA 4LGRB 1GW4A 3KXDA 5EWIH 5DHEA 1I9RH 4QRQA 3WIIL 3CC5B 5DJUB 3AXLB 1AQTA 4K8RL 5K59E 3RWHA 1E4XL 1U2HA 5KLVE 2CPBA 3L16A 3M17A 4XZUB 2RQ8A 3HC2A 5GIRB 4E41A 3MRGA 4A7PA 5IFHL 1PV3A 1Y7VA 3II6A 2CK0H 4UBDD 4LSRL 3GHGA 5T3ZD 1F0LA 1LK3H 1C12A 3K5BA 1F6AA 5AW2B 4BELD 2IXQA 1NGPL 5MP6L 2PCPB 2AXJA 1QR4A 5CKGA 7FABL 2JWDA 3LVEA 1J8HB 4ZDHA 1R5SA 3UX9B 1L0YA 4TOYH 1WBXB 1ZHNB 5DMGC 3VW3L 5JHDA 3DSFH 3NCJH 5I1CH 3U83A 4Y2LA 4E36A 1M42A 2X3BA 5CMAA 4HX1A 5D9SB 5B38A 1T83A 2PWDA 4LFHG 3L4UA 3NFNB 5H35A 5I75B 1NCCH 2G5UA 5K9OB 4P4KB 2DWDA 3E1RA 3B1UA 5F1NA 1IJNA 5JZ7C 3P02A 1XX9C 5DEGB 2XICA 2NPSC 5ECJE 3L4XA 2HRPH 2D03L 2XNDH 2DBJA 4MNHA 5HYJB 4ODHL 1ZRTD 4YDIH 2X42A 1OVZA 1QLEB 4XVSH 2BW4A 4ACTA 2GG1A 4XWGH 3DVNA 3IF1A 1BECA 4HWBH 2NRGA 1Q90D 2Z6FA 1NICA 4C7RA 3ARBD 3G08A 3O8XB 4KNSA 3VTMA 1J1EC 1A7OH 1XR9B 5DJZB 1D6VH 3UBGA 4YDMA 3BP6A 3MYZA 4Y89A 5DJXB 3TIDA 4A6YL 4GW5A 4W81A 5AW8B 1CXKA 4D8PA 5IVZB 2AP2A 3UROR 1LDPH 5D6DA 4PD4E 3V9EA 5DLML 3HZKB 3ULSB 5HHPA 2XFXB 3P4LA 1BAFL 5EO9A 3AROA 4FFTA 5FYLH 4N1HB 2Q2EB 3FFDB 1I31A 2ZICA 2YKOA 4A68A 2ADGA 3RUGB 3NIGF 3FFOA 5DFAA 4OV5B 3MGOA 5FYLD 2HTLD 3OKKB 4J2XA 1KYOD 2HX9A 3EDJA 4OVVA 4WO4B 3O45B 4JG5A 2HODB 4ZO8A 3WNPA 3LCYA 2QZQA 5C0GA 4N8VA 1GK4A 1EGJL 2RGSA 3RY6C 4JFYB 1JTOA 4KK9D 2VRSA 4PGBA 1NC2B 5FYKE 1F00I 3RI5F 1SVFA 4GBXB 1ZVSB 1MFVA 4NIKB 1TQWA 4JGJA 1JZFA 5DRWB 5BVJB 4KXCA 3D34A 4KZDL 2GFBA 3NP4A 1J1XH 3SIKA 5F9JB 3MRJA 3W39A 1GGCH 3PUCA 4ODXA 5AYUL 2Z7YA 1LT1A 3UTPD 4PIRF 1E65A 1X5ZA 3X3FL 1RUQH 4XMKL 3ARED 4GIAA 5D7LD 1AO7D 2P8LA 3S4SB 1ZV5A 4TSCH 2HKFH 2HPCB 1YZZA 5K5YA 3OLGA 2YMKA 3FO2B 4P23A 3FB8B 1ZKAA 4U7SA 3V5DA 3HFMH 2WUCH 3GMRB 1J9SA 4RH4A 1TYEB 2RALA 3IAOA 4Z7WE 2WLKA 1HKLL 1HEJC 2XG5B 4X4XB 1IO4A 3S5YA 4KXZI 2VIRA 1HWWA 2VR3A 2W9DL 1MEXH 2X6AA 3NFPB 3RL0C 2Y0EA 1MF2L 1X5AA 2FT8A 2OCCB 3FT0A 3MV9B 1OAQH 1N8OE 1HYRC 2X9WA 2YGVA 5AAMC 1ZGLM 1L0ND 4XP9H 5GGSA 1VKXA 5HGAA 5DO8A 1N73C 2NY6C 5AENA 2L04A 1LO0L 5HPOA 1USEA 4J3XA 5I5IA 3O9WD 1WFUA 4TLSA 1XWVA 3MNVB 4AIZA 3K5SA 5KLVD 5MI0B 2GUSA 2YPVA 1A02J 3N5AA 4FKEA 3R8QA 5KSAC 1MI5A 2F15A 4J4PD 1PSKL 4ENEC 4KNTA 2E76B 4UU9A 4JE0A 3PV7A 2DMBA 4IRSC 3KCWA 1DZ0A 5C7XL 3NSXA 2YFOA 3RZCD 3UBXG 4NM8L 3HG1E 5HYQB 5LGJA 3RIFF 1JGEB 3PTZA 4G9FA 4DKFL 4QHUB 3WD5L 1BQHB 2R32A 4DCQB 1I1AC 2ZYDA 3C60A 3MNDA 4LL9A 4X5WA 3DX6B 5C6PB 2MOGA 3QDJA 4YEEA 3MBXH 4Z6AT 1I85A 2HPOA 4XBGA 1I8IB 1SOXA 3BVTA 2BSTA 3UACA 2XG4B 4C56B 4M00A 1WIOA 3NIGB 4WI0A 3S3CB 2DBLH 5K39B 3QEQD 5DWUH 2NY4B 2QFRA 3VFTA 2NW2A 1LT9B 3MR9A 4L8SC 1KILA 3C6LA 4OJFH 3VXRB 3HE4A 1RF1C 2DWYA 2QQNL 3L3JA 2XXCB 4U6YB 3T77B 4RDQG 2C0WA 3L3OB 3L74J 1QPPA 3P2DA 1FVCA 4BDVB 1X6LA 2Y5QA 1HL4A 1L5GB 4AQ1C 1K2DA 3V4PB 2GW5A 1F3JA 1KB3A 1VFBA 4PRIE 3P77A 5LQBL 2HWZH 3EJJX 1TZ8A 3BVVA 2Y3NA 5JORA 2VL5B 1IGIH 1EQ7A 1JMBA 3LHPL 4PD4H 1CFVL 1IFMA 1QFUL 3JQOB 1ZXQA 3V10A 3VAEA 2V2TA 2FXMA 4NCC1 3S35H 1S9YA 1SQBK 2A45H 1TDQA 4G9DB 1K72A 2JXMA 4MQ7B 2X4SA 3LEVL 4Y2NA 5GZNA 4PD4D 4ZD3L 2I5YH 2ZVNB 3N0PB 2AXFB 1GGYA 2Y5TA 1J1PL 2X1PA 2DL2A 4KRPC 1L6PA 4KO9A 5I24A 1NL0H 3OSVA 5DD1L 3QJUB 1RK0B 4KVPA 4GOFA 3GBNL 1I9IH 4PBVC 2W6AA 1PG7H 1IKOP 4PS7A 1MCLA 4ETQB 3HUJF 1NGMB 3VTPC 1A47A 3H1ID 3I6KB 3TTSA 2EH7H 2MPVA 3RQ3A 4DK6A 4YDJB 3CCEP 3N1QC 4QTFA 3P2TA 5IEHB 2D9CA 1NHLA 3BQUC 5FYKH 1OZTG 2VO8A 2NY3C 3V7AE 1WF5A 2AQ1A 4JO2H 3IT8D 3A4AA 4OV6F 1TFPA 4L5FL 2R2HA 1UEYA 1FC2C 1UWGL 4YL4A 4MFHA 5JLZA 2IJ0C 3ARZA 4S1DD 4PLKC 3IXAA 5D1XE 4B5EA 2G0KA 3BWZA 2NNAA 2O5ZL 3O2VL 2FO1A 3N1MC 2E74C 2YOAA 3QC5X 4EEEA 5I18L 2AJZA 1ZHLB 2B4CH 2WSSH 3ILPA 3HE6C 4PJFE 5I0XA 5J12B 2XNXA 1LTIC 3IJYA 4L1TA 3RFZA 1F56A 3UABA 4JLRB 2CGRH 5AB2A 4UCFA 2G2PA 1G7PB 4JRLA 1SYVB 3ARDC 1JXGA 3MKKA 1H0TB 3DIFA 3JSVC 1NFDA 3D50A 5IUCA 5J1AB 1EZVD 5I1DA 1KT2A 2DQCH 3TZVA 1HNYA 4X80L 5I76B 1CBJA 1X7TA 1NLDH 1FNEB 4ESKA 1JOIA 3U0TA 4N6QA 2EEFA 2GCYA 3OXRB 4CADA 4OT1L 5KVEE 3FQ4A 1YAIA 2PCXA 5APUA 4GSDL 2B59B 1RZQA 2D2OA 3WE6B 2PYFB 3EDEA 3H9SA 4HJEA 4PV1B 3NBNA 1KBVA 2HJKB 1CLVA 3F6IA 3QDGE 2G2RA 2Y07L 3ZZQA 4ELKB 4GO9A 3UTTB 4YXKL 1SEQL 5E79E 3W38A 4DPCX 2PRRA 1O5DT 2YR3A 3MRLB 3UPCA 1JGIA 1IBHA 2CBMA 3RFRA 3F7KA 3PABA 4JYCA 1OIPA 1H6UA 1M7IA 3ATEA 1KCUH 3GG2A 5JR1H 5J56B 2HT2C 4NNYA 3C2AH 5FGCE 3I75A 4APQB 3DRQB 1ETZB 5I1LB 1WZKA 2YIUC 4KK8D 2CA4A 3P4OA 2OR8A 1HHKB 2FJSA 4ASWA 3CFJB 4UTBA 4JFOA 3ZDXE 4HHAA 4C4KT 4YK4C 5J9PB 3JC22 4OCXL 1T7ZA 3VFUB 5FM4A 4JUTA 4MMZA 2YK1H 3FHEA 1HIMH 1CK0L 1FVEB 2XA8L 4BFGA 4X42A 4PJ9B 2VDMB 1F13A 4HH8A 4KAQL 3C5SB 4M5TA 4OZHF 4BXVA 1PL5A 3Q1SH 4Z8FL 2P5WA 3B6SB 3L2LA 5DA4A 2FWOA 2P2UA 2LKMA 3HE7B 5JUEH 5ANMB 3H0TB 2IQAB 2BXYA 2UZXA 2WVVA 3X14B 3UYRL 4YHKL 3HUJB 5DC0A 4RMSA 35C8L 5BQ7A 1EZLA 3VVWA 2EXWC 4PJBE 3JSSA 1P0SE 3F62A 3OC5A 4NKIL 1CC3A 1DQMH 1P4LA 4F33A 3PFQA 5IJKC 1R3HB 1A6WH 3T0EA 1IEAA 2JLPA 3K8MA 3L9RB 3CZFB 2HFGL 3QXAB 1YLBB 5HYEA 1MJJA 2OL3H 3GSNH 4HV8A 5HHOE 2BASA 3BESR 4KI1A 1A7NH 3CXHI 2A4EA 2DQDH 4PGCA 2WSFH 3F7QA 4LSTL 4WI4A 1GZPA 4KKAD 2WBXA 2A7BA 3KR3L 1M53A 3HHMA 2AS5M 1EXJA 3O3DA 4R7DB 3OZ9L 2VLME 1NDTA 2P5EE 3QZWB 1HXYB 3PGCB 4KQ4L 2DQGH 1G0YR 2WXJA 4WSGA 4GQRA 2CLVA 2H47C 3BXNB 4H44B 4EYYQ 1FO0B 3FUIA 4IEFB 3QZLA 5ACZB 3DROB 1CPUA 3LZOA 3O6FA 3VXSD 5DMJB 4XNXL 2Z4EA 4FQCL 3KAAA 2F53D 2LVEA 2C7UB 1YJDL 4IKKA 4BFEA 5BNXD 4R3SB 5AOJA 2BNQD 1JDDA 3LQMA 3ALWA 5IMKA 2XTJD 4DH2A 3MMEB 4XMXA 1MCSA 4GKOA 3WIHA 5CZVL 1MFAL 3VFMA 5LAXA 1UOVA 2O6FA 3CQFA 3IU3A 4R5TA 4AMKH 1C5BL 4WI5A 4U1MA 4UV4L 4PY8J 4WW2C 3VFNB 3WAKA 1UT1A 5KANI 1UD8A 1TZIA 3KPRD 5BW7A 3F58H 5FDWA 4JJOA 5GJTL 4HUVA 4BCXA 1CD0A 4QXUH 2HX8A 2XOTA 1JF1B 1XVSA 2P4AB 3ARGD 4WJG3 3GUFA 4HXAH 3VQ2C 3ZTJG 4E2OA 1MXDA 1KMGA 3GMPB 5D1XD 1LP9F 2O61B 3FSOA 1OSPL 4BFBD 3QQ3B 2NXYB 4QCIB 4AGLA 1NFIB 1EXUB 2P10A 2K1MA 2VSDA 5AWNH 4BIKA 5AYQA 1BMZA 3PWPB 4NXSA 1TQBB 4BZ2L 3F01A 2YEVB 2ITFA 1CTMA 2VMEA 3MJ7A 4KHXH 4RNRA 5EPMB 3QR0A 3VB8A 2KYIA 1F45A 3V4VA 1SVBA 3STZB 4LHUD 4KT0J 4P0DA 5DK0B 1BEYL 2JJVA 5KOMC 5D5ME 2P8PA 1L0LG 5HHQA 2XVLA 1JZIA 1ZTXE 2MCPL 4GKNA 2B5IC 2A45I 1INEH 5EC1A 4PJDF 3WHXA 1AR1C 4NO2A 1BBDL 5KVEH 4YUEL 4GKZB 1HQ4B 2ADFL 2YA2A 2Z93B 3A0OA 2J58A 2D31B 2GSGB 3ESVF 3I55P 3QPQD 5FHBH 4OZHB 3VI3F 1T1XA 4JPIA 1N4XL 1EDLA 1G6VK 3JTTA 3NCCB 3VMOA 5E79H 4PB9H 1A3QA 3Q7JA 1M6OA 3K2UL 2HLEB 2EO7A 3QJFB 3POHA 2WP3T 1H15A 3MGNA 1CS6A 4ORGB 5ESVA 1A64A 5IW3A 2VLJD 2VLRA 4KGJA 4XVUD 5L2JA 3BKJH 3WAJA 5CCGA 2HB0A 5HI5C 1GW0A 2BFVL 4UOW1 3QIBC 1JZ2A 2W65A 2AJVH 4DSYA 1KCBA 3NP3A 2R4RL 3H42L 5FYKU 2OP4H 1RZJL 2ZOOA 3V55A 4PGJA 2K6YA 4HKJA 1S7QB 1OTSD 2X89D 5CLXA 3QUYA 2HR3A 1BBJB 1JNHB 4FQPA 3QG7L 4PWGA 3ZDWA 4G5ZL 3D0VB 5HJDA 2EP6A 3MN8A 3MRPA 4YH6A 2OARA 2VRAA 4KJPC 4J3WA 4LP8A 2GUOA 3GBLA 5I1HL 4P2AA 3UZQB 2XZZA 3NJFA 4F7PB 2UZYA 5FA3B 1LK2B 5I9QC 1FPTH 1RL1A 1G6RL 1HCYA 2HJFB 4NO5B 4AUJA 5IB3A 2P1YA 3IS0X 5K9QG 2DZEA 3DTXB 3QZMA 4OUUB 1S7XA 3MBEA 1NVOA 3ZBMA 1QO3A 4PRHB 4TUOB 5C70A 1CUOA 3HS0C 3L70G 2AK4E 3RDTA 4HWUA 4NZDA 4JO3L 4S1SL 3CDFA 3L75G 4X6DA 4BRYA 3D87B 3IDJB 4FXKC 5IMMA 4H8QA 2BWQA 5AG9A 4A2GA 3L37A 3MLWH 3OAYK 1TJGL 4C4BA 4PJCA 3HR5B 4FN0A 2J56A 2AK1H 4S1QH 2M3EA 1RIVH 1E9OA 3ELQA 3Q2LA 4ZFGH 6TAAA 2AF2A 1GS6X 1D5BA 3L70J 1Q38A 1KOAA 3A5VA 3RL1B 1IGTA 4NYLB 3V0JA 2KZ1B 3BAEH 1G9MC 4IM8A 3L75J 1HL5A 3G9RA 3CHSA 1L2PA 2NNRA 1SQPD 2FAUA 4NQDD 3UOAB 4ZOAA 2WHVA 2E5EA 1NEZA 4ODSL 3NT0A 1FE8L 3KDMA 4L8BA 3NGBC 3NDZE