5AVWB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avwB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avwB02
3V5BA 2R32A 2YO3A 1H88A 4XE5B 2XV5A 5AVZB 2N9BA 1CSBA 1SLQA 4C7NB 1GK6A 1H89A 3VYIA 2Q3IA 5AW7B 5APXA 4AUWA 1GK4A 2BASA 1MUUA 2R5DA 3UIAA 1HUCA 2C9LY 1GTWA 4C46A 1GU5A 3VN0A 3VTPC 3LIEA 2XU6A 2XZRA 1FOSE 3M91A 3NFQA 4M3LA 2H7HA 4RETB 1CI6B 3WGVB 2VRSA 4RESB 3NMDA 5AW4B 3A3YB 5AVXB 3L35A 5CMZA 2YNYA 2WPRA 1GD2E 4HYTB 2YO2A 1GU4A 3L37A 4DZOA 4GT1A 3TNUA 3A7OA 2ZFCA 3HTKA 2QM7A 3LIDA 2R5BA 1HBWA 1GZLA 3M06A 4GKGA 5APTA 4AYCA 2WT7B 1X8YA 2KP8A 5AW8B 2W6AA 3B8EB 1CZQA 3L36A 3I5CA 1HJBA 5AW0B 3M9BA 2JJLA 2Z5IA 2C9NY 5AVUB 3VMYA 2WPSA 4JYBA 5AW1B 3M0AA 1A02J 5APVA 3NXSA 3TYYA 3KDPB 4C7NA 5AVYB 1MV8A 1IO4A 1JUNA 4AQRD 5AVQB 3V4QA 3OAKA 5AW9B 1OXZA 5APUA 3TNUB 3VMZA 1S9KD 5AW3B 3HE5A 1NAFA 2QM8A 2Z5HA 5AW2B 2R3CA 2P2UA 3V4WA 1T2KD 5AW6B 3O8ZA 1H8AA 2W27A 2Q5UA 1G2CB 5APWA 5AVRB 5APSA 3WGUB 1T2KC 2ZXEB 3HE4A 3A2AA 2Q7CA 4I6MC 5APQA 4KHXA 3M9HA 1OWAA 5AVSB 4EOTA 3M0DA 5APYA 4I2LC 3IR9A 5AVTB 4B86A 3SWFA 2P67A 1FAVA 3P32A 5AVVB 5AW5B 1HWTC 1NWQA 3P8MC 1A02F 1YYCA 2WWWA 4JYCA 1FOSF 2P7JA 2WT7A 3A5TA 3HE5B 4LC1A 1J2JB 2IPPA 3MGNA 2E43A 2WPQA 3TK1A 3MD0A 3VMXA 3NTNA 1SP4A 1S9KE 2E42A 2WTYA 1MFZA 1JNMA 1CI6A 1DH3A 3P7KA 3HE4B 3KQGA 3T97A 1KQLA 5AVWB
chains in the Genus database with same CATH superfamily
4D6TG 1SQBD 1XL4A 4NZRL 4QRPA 2YMYA 1BIIA 2YO3A 3VXMA 5F70A 3V7AE 1EQ7A 1BQ5A 4KAQH 3T0XA 2M8RA 5C0RL 4Y99C 4QOKB 1WFMA 3BW9A 4JANB 4LOVA 1HVXA 4YSRA 5FUCC 3UCRA 3QUXA 5IKCB 3JZ7A 1KGCD 1F56A 1WH0A 1HHGB 3BAIA 3NRPA 1SQQE 1F90L 1LHZA 2WNGA 4PJ7B 3RNQA 3HAEH 4BFIB 1RHHB 4J5VA 3O0RL 3ECBB 3L4FA 4YSTA 5FLUA 2LR4A 4JRYB 1FL3B 4H2CA 3ZGHA 1GY1A 5BS0B 1F4XH 4FFZA 3AG2B 4X8CA 1KILA 4HWBL 1MI5B 2A6DB 2OYMA 2O6DA 5CBAA 3ZHLA 1BV8A 1E3FA 2ED9A 1SMOA 3PAYA 1BFOA 3WKMH 4YPGA 3UX9B 3ABMB 4BEIA 5IESH 1PS3A 3ARBD 5AENA 4G6FD 1QASA 1AS8A 3FZUC 1M56B 2XYBA 3VFUA 2W9DL 3PRZA 1KLGB 2DL9A 2OS7A 3PP3H 1LK2A 3OPZH 3QJTB 5ITBH 5KVFE 4PLKC 4GIPD 2BVOA 1ZHNB 1G9MC 3N40F 4JZJC 3FO2A 1DX7A 3GSXB 3QH3B 1THAA 2IANE 2F08A 1CI3M 4G80A 4N22A 3QZWB 2D7TH 5C0AE 1YZZA 1EZVX 4RRPG 2VYRE 3KVDD 4NZUL 4C7NA 1J9TA 4IKKA 3C8VA 2EC8A 3EF7A 3MYJB 4ANUA 3UPRA 1T7WA 3AZUA 3AABA 1M2VA 1CGXA 2NXZC 3I6LE 3NCXA 3D70A 2A6KA 2J8HA 1NAFA 5D7JD 4XXCC 3HLAA 2X4UB 1EHLH 1ZVSB 1L0XA 4E9TA 5T3ZE 2PYEE 1MPAH 3BJLA 3F64A 1OPGL 1FFTB 2DQIL 3UC2A 3CFTA 2F54A 3WY2A 1DJIA 2Q7CA 3QCVH 3CFUA 3GPSA 1YIJP 4H26A 3V5KA 5AVSB 4K7PH 1FVDB 5I1EL 1OTSD 5DJZA 3GTTA 2VDPL 1NCIA 3BWAA 2B3IA 2P67A 3P32A 2BIQA 2R0WH 3IKCA 2H0PA 3VSUA 3OXRB 3NBNA 4PB9H 3RTQA 2AV7B 3KYQA 1Q4NX 2EDXA 2UWEF 3KPPB 4JE4B 5T5NF 3P0YL 2GK2A 2X41A 3A24A 4M5SA 3BIKA 5AOKA 2RQEA 1RUAL 4JUSA 4NDMB 2W60B 2DDQH 3VFPB 4M43H 7FABH 4Y4HB 2YZ1A 1J5OH 4X6DF 1I3RB 3CCSP 1T3JA 1EO8H 5GSVB 2IPTH 3VVWA 4PJXA 2AJXH 3HE4B 2PTTA 1TLKA 3JTTB 3WEOA 4OGXH 3L13A 3VTAA 5I16B 3L4UA 4NQVB 2BWDA 1T1WB 5IFJB 2R9HC 1T2XA 4X4ZA 5FYJH 4M29A 3VRJB 4F5CA 2AQ1A 3ZBMA 2AEWA 4DP5X 5MENA 3MRJA 2YWZA 3FU6A 1G5GA 3GBEA 3T09A 4AQ1B 1R3KB 4ODSH 4UBDC 1SEQL 3PWJB 5GS0C 2PUQT 5GS3A 3GSQB 3J2PA 1D5RA 1GL2A 4UM9A 3I84A 4XVTL 3ARGC 2Q76A 4L4VA 3ZYOA 3ESMA 1YQ4C 1JZGA 3A6BH 3BMWA 1OSPH 1JFHA 5E2VL 1JSYA 3WNIA 1MREH 5E7FA 3BQUC 1IEAA 5B1CA 1T1ZB 2CBTA 3L5JA 3GB7B 4PJAA 1TNNA 4MS6A 1JPTL 4M6MH 4TPRL 4W81A 3EH4B 5AFAA 2Y0SA 4JL2A 4NRYA 5DA0B 2JLLA 2YC1B 3D06A 4ZTPH 1QUNB 3HG4A 5B66H 1M7IB 1UCBH 1NGZB 3O45B 3IS0X 3OHXC 3SBWC 4BKTC 4QNPE 5IM7A 1KENL 3IFOB 4YDMA 4NQED 4OM1H 4UOQA 3H8NA 4PV1D 3KL5A 4HFWB 8CGTA 2ZKHL 1NGQL 4K7FA 5GZND 1PCXA 2DYPA 3SJVA 1TPXC 4JGNA 3C87A 4KHXL 3W9DB 4KWUA 5KWYC 5FW6A 3EO9H 1A22B 2PO6D 3R8BB 5GRVK 3UH8A 1JNHA 3B7YA 5ESAA 1TU3F 2X2HA 3FK3A 1ZLVH 4H13B 1FA4A 4I4WA 2NTFB 2Y24A 1JZ3A 3B7SA 4LP5A 3HE6D 2EVGA 4QAWA 1DJSA 2CBMA 1BQHG 1P4LA 3KYAA 4ONHB 1AGCB 4QKTA 2DY2A 4AT6A 4AV4A 1YMMB 5EBWB 1C5CH 1QRND 4FQ1H 3ZE2F 4DP4X 3FN0H 1RULL 1UA7A 3IF4A 4XI5D 4DO6A 2VDKH 3AREA 4M7KH 3T2NH 3GXDA 3MN8A 2N1TB 4Q6IB 1UWEL 3D6ZA 4L5FH 4Y9CA 3SOTA 4CC4C 5DMYA 4KNTA 1W80A 4BDVA 2ZG1A 4XPBL 1I8KB 1RSFA 2CJ3A 3HHSA 4Y2OB 3WBDA 1T0OA 5HXMA 2JJSC 3TT3H 5H35B 4EVNA 1NWQA 3RWEA 4CW1B 3L9RB 1X6LA 2JIXB 2WSFH 2G2RB 2UWJE 2WP3O 4HIJA 3U9PL 2NY7H 5C09E 1IJDB 1II4E 5AKRA 3AY2A 3PUUA 2UY6A 4AI7A 2ZYDA 2WITA 4MXWL 4P48A 2VMJA 1A7QH 4DJGA 5KYWB 5HHOE 1L3NA 2R4RH 2DQFA 4OJDH 2DQMA 4XO8A 5DJ2A 2JLPA 1S2EA 4X5XB 5KG9B 2R32A 4Y5VB 1ZT7A 3W0WA 4JG1H 4XMZA 1MCEA 1A14H 4WTWA 5CP7B 2E8ZA 4JCLA 3VWJC 5HDQH 1NGXB 2N9BA 3QJQB 4F15C 2PWDA 1I7UA 4KKPA 3X3GL 4Q97A 4M8VA 2AQ2A 1NO4A 1EZVE 4RMRA 3SSUA 4QPEA 1V7MH 3T65A 2K78A 1Z5YD 2YD4A 5E1AB 3K6IA 5C07E 3HZYA 4J23A 5DUML 1JN6A 4EZKA 1BAFH 3L71D 3KWXA 5DVOA 1TQBB 5FYLL 4AY0A 1ZS8A 4JFYA 5I74B 4TOYH 5JO5A 1H0TB 2QEXP 3KWWB 1MCBA 1NJIQ 4TRPL 1U3HC 2GTZB 3SKMB 2B0SH 5JW3H 4JPKL 1KTDA 2VO5A 3E6FA 3OF6A 1MCPH 5CGTA 1U8NB 3NACL 1GSMA 1S9YB 1MFEL 3TNUA 3UZVB 3QFJA 2MCMA 4K5LA 4P3DA 3ZL4H 3NFSL 4J3TA 2RKLA 4JFDB 4Z7WB 1A3ZA 3MUDC 2E86A 4FLSA 4YBLC 4L0ZA 2WTRB 3MRCB 4S1RL 1I8IA 1GAFL 2HKFH 3B2UD 1B4JH 4FS0A 4U4IA 4F7TA 2FX7L 3UP6A 3BP7B 2N9YB 2D7QA 3AB0C 2GUOA 3VFMA 3G5VB 4Q52A 3MRGA 1QVFO 1P5VA 1JIBA 3QXAB 3BEVA 1W0VB 3VFWA 4K9EH 3AQYA 1AXTH 2QKIC 2BNQB 1J11A 1MJ7H 3EOYG 1K5WA 3F7QA 4W93A 2OZNA 4HHGA 2OMXA 3P73A 4OKDA 3MLUL 4Y7OC 5I1AB 5BVJB 3EJRA 1NL0H 3RVXD 3DPBB 4TL5A 4P23C 4QO1B 3KHOA 1I75A 4YSOA 1FO0B 1KJ2B 3IGAB 2W91A 3TA4D 3NP3A 3AUVA 2Z0UA 5E1HB 4PJCB 4PR5B 5APWA 1E42A 3OAYH 4RIRA 2VH5L 3KYNA 5DI8B 5GTHH 2B15A 3O2WL 1NCUA 4HS6A 3OZ9L 4P59L 3D51A 3TO4C 1S7UB 3IETB 1NC2A 2AGJL 1UACH 25C8H 1URIA 3KJ4C 1QHQA 1DLHB 5JPNA 1B88A 4ICXA 4UI2A 3R4YA 4N8VG 3N1PC 4Q58C 2ERJB 3FO9B 2VDLB 4H0HB 5JIKA 1A1OB 1JCKA 1KBPA 1XCTA 3TLRA 3L72J 1Q9LB 4DAGL 3MA9H 2YUXA 3VXUD 4K94H 1S8DA 1K6QH 4RVBA 4WY4B 3ZKND 3LDBC 3PYCA 4YHPB 2IOOA 3HFML 4RFNB 4KKCC 4WUKH 5KVEE 4U1KB 1FZEA 2CG9X 3WSQL 2P1YA 2F15A 3BAJA 5I71B 5GIRA 4NRXA 3MGTA 1XMEB 4IRJB 4OCWL 3BQVA 1I3VA 2JB6A 3B5NB 3RDTC 2XKNA 3RPIA 1Q94A 2CO7A 2PAJA 4MWFA 3KGSA 2H9GB 4MDJA 3RAJL 3SO3B 1T1YB 1WICA 1IFNA 1ID2A 1RK0B 4XP6H 1RUQL 3TOPA 2OTWA 3EYFA 1N6VA 3NTCH 3PAZA 4R4NC 1QA9B 1AI1L 2H5UA 4JFQB 2ITCB 1Q90A 2ROYA 3HC3H 4NN5C 3GXIA 3H3KA 3WJLC 4X7EC 4PP1C 1CWVA 1MFAL 4X4YA 2Z8WC 4HCRL 4Q14A 2C9VA 4E5XA 3B5GA 4JR9H 3VH8B 4FE9A 4WWOA 1AD9B 1T83A 2WJ7A 1M71A 3M8OL 4Y5YA 2XKSA 1AH1A 4JLRB 1OAQL 4H4NA 4NENB 3TA3D 2OYIB 1JGDB 2PR9A 1AHMA 4EI5C 3IVKB 2WSEJ 1KYOK 2XG4B 2BDNL 5KLIC 5GS1C 3RUGB 4DOJA 1RH8A 5HHQA 2DICA 4CGUB 1RJLB 2Q5BA 2P5WD 4G8IA 1UUNA 2DWDB 4XXWA 5DK2B 1XZ0A 3PJSA 2KNCA 3GJEB 3GC3A 2EIJB 2P46B 4I1PA 1W91A 8FABB 2XA3A 1MHCB 1WZAA 3PNRB 4PYGA 3FAXA 5K9QI 4GKZB 5BMFL 4AGNA 4YVUA 4E0RA 3KZ8A 4NJAL 1L7IL 4W80A 2VLKD 3G5WA 3H56A 2VC2H 4ASVA 3IDMB 1OTTD 2FJFA 4FNQA 1CFQB 2WW8A 4L18A 1RIHH 5E9NA 1KTJA 4PRPB 5BXFA 5FO8B 2NY6C 3IE9A 5IFAH 3PGFH 2CMRL 3E38A 3CQQA 4WSKA 4F8QA 1HEJC 1JHKH 1KF9B 5SX5H 4XO3A 5KANI 2A45H 4QMAA 1VF5D 4BIKA 1U8HA 4GOEA 3CLFH 4JPVL 4WFED 3VGAB 4KMTL 4MQXD 4Z7AA 4FDWA 3T0VA 2X0UA 1JUFA 4MNQB 3Q2YA 1EO7A 5D4QA 3ROLB 2IH8A 5E8DL 5CSZA 2MSPA 1DJXA 1PDKB 4HPOH 5EUOA 5C0BB 1TFPA 4N8VA 3VMXA 4EI6B 4HUWB 3NIFF 4ZQKA 1QACA 2CDGB 2NOYA 4WUUB 1FZGA 5ILTL 4A7QA 5KYXB 1N5AB 2IPUK 3U2IA 4AEHL 4AJVA 3KW8A 4OKVA 1T6VN 3TZVC 2WWMC 4NM8L 5DCCA 1VQ9P 4G82A 1YYML 4YSAA 2W9EH 5AVZB 4EQ2A 1PYWA 4ZO7A 3GJFA 1EFXD 1NBCA 4MD0B 3OKNB 1KJ3L 1Z9NA 3MBED 3L73J 4OQTL 4OCXL 4UNTA 2C9LY 4JHVA 1GTWA 1UB5B 1Q9OA 3EDJA 2LQRA 4KI5E 2AS5M 3DTXB 4BJLA 3N41B 2ZAGA 5E99L 5DD5H 2NDGA 4M5YL 2APXA 3A0BH 3PXLA 1FU1A 1HK6A 3HPLB 4J28A 3R1GL 1XF5B 4F7KA 2GA1A 4W1TA 5DJDA 2X7LB 3T3ME 1ZXQA 2HWZH 2YPLD 3U46A 4Y5XC 5C7XH 4P46B 1HQ4A 5FPIA 3EJZD 5HGGS 4MCYA 5SWZD 4IRZA 2X70B 3QCTL 3FONA 2W81C 5MEOA 1DVFB 4D9QE 1A02N 1F86A 5HDWA 3THMH 5TD4A 5JHDA 5EOCH 2Z5IA 1S7TB 1XHHA 2X2IA 4OUOA 2LXBA 3S34L 1BE3E 2ICEA 1X9LA 5HP5A 2DJ4A 3MRFA 2NX5D 5KSAC 4I3GA 3NFNB 3LKOB 4JKWA 3IPFA 2ZG3A 5I19H 4IGBC 3MOAL 4LQFL 1JS4A 1YHPA 1MVUA 4XOBA 3ZIMA 3H1KD 1HNYA 2MEJB 4BQ6A 3KCPB 4DZBB 4QWWD 4F20A 4ENZA 5KJ7C 3CCJP 5TQ2H 5B5EH 3CK0H 5TF1H 3ZKMC 4CMMA 4H1LB 4UM8A 3ZO9A 5K1VA 4N1HB 2P8MB 3QIUB 2EINB 1NANI 1PSKH 3GMMA 4WB4A 1VQPP 3GZOA 4AYDC 1A6ZB 4PB0L 1ZJAA 2ED6A 3CFMA 5EO9A 4D3CL 3KPOB 2XV3A 5HTSA 4ZO8A 1MEXL 4U6YA 5AVTB 2R1WA 1ZLEA 5EUKB 1LLAA 5CCHA 1JDDA 2ZOOA 1KN4L 1IGTB 2Z65C 3DPDA 4M03A 4NYLB 4NQDB 3STLB 1J8SA 2R0KL 1RE4A 2AXCA 1M1SA 4JVPA 5LQBL 3OQ3B 4HJ1A 5K9JL 4JPSA 3Q5YA 5FWRA 4WIQA 4LK4A 4S1SH 3UTPE 4NO0B 1G7QB 3WHXA 4YFEA 4LPVA 5F9JB 1HHJB 3SCMB 1LEGB 4E41D 3IK2A 5CCGA 1XIWC 2OI9B 2WWKO 1N7SA 3WFBL 1OOWA 1VLXA 3CHPA 3HG1A 4F37K 2W92A 1NLDL 1GK6A 4AQ8A 2ATAA 3ZDYE 3LB6D 3FFCA 2O6PA 5AW7B 4QOKE 5APXA 4PJEB 5D9SA 5KJ4A 5J6HA 2YFOA 1FNHA 1GC1L 1OLZA 2ZP8A 4ZMVA 2NY0B 4JPWL 4ERSL 4PJ7E 3RWDB 2EYSB 4BFJA 4LHUG 4NC2B 3SDDA 4IOFC 1SQPJ 1FVCA 1I8MA 1KYOD 4JRYE 5BS0E 1MCFA 3G4SP 4BFRA 3I6KB 1Q0EA 2CDEA 1F42A 3P4MA 5DO8A 5AG8A 1MI5E 4PG9B 5A1AA 1EXJA 4ZFZA 4WY7H 3SE9L 4IIQC 4FP8H 4DP8X 2BHYA 3H2PA 3GBLA 3UACA 4G83A 2IFFH 3MTUE 5HJGA 1NU1G 4DGVH 3H55A 4FQXB 4HPYH 5E5RB 3CDGA 1N73A 4YK4B 1QR1B 5K59F 5I0XA 2NW2A 2YQGA 1XR9B 4BGDA 1A6AA 4XP9L 5EG6C 1AIZA 3L7EA 4DP9X 1OY3B 1RZ7H 2X0VA 3QQ4B 2P8LB 3HA0A 3BE1H 1MW1A 1MN4A 1OGTB 2AXGB 2XY1A 5BZDA 3CU1A 4F8TA 3TO2B 2B9BA 3UL4A 5ID1B 1A4JA 4W9IC 3DO7B 1FFQA 1CE1H 3K5BA 3LHPL 3LD8B 3HMXA 2GT9A 3NJGA 5KAIH 4ONGH 1NTME 5I66B 4FMKA 1JF1B 3GSUB 1VZHA 4JRXA 4X0KA 2ZUSA 2A2QT 3UTSB 3ZSSA 3KPEA 5C0CA 4X99B 2O5XH 2Z4TA 1JV2B 3QIWB 1ZEAL 2FFDB 2VXUL 3CHOA 3G08A 1D7DA 1FBIH 5BQDA 1JERA 1SJVA 5FCUH 3DJSA 1K8DA 1EZUA 3RL0C 2EYRB 1CBVL 4FFWD 4EN3C 1R19A 1T2KC 1W8NA 3IDUA 4H40A 3RX5A 3V52H 3VFNB 4L3EB 4N2DA 3NZHL 1S9XA 3Q5PA 5FFLA 2QSTA 3UJIL 4WAFA 4H88L 1K3ZA 5CEYB 3IE4A 1TJIL 4JFPA 1AP2A 2I24N 3L3OB 2XWJB 1JZIA 2G75B 2R1XB 1ZW0A 4GQ9L 3VTTA 3FJTA 4CADB 3CQPA 3OX8B 5F6HJ 5IJDC 1XSOA 4HS3A 3P8MC 1UWXK 3L72G 3LVEA 3BZEB 3HI6L 4YN3A 3UGXA 4GG6A 4UT7L 2GSGB 2EEAA 1IL1A 4GQQA 3HC2A 1RJYB 4DERA 5HI3C 3OKLA 3NJMA 2J8UB 4XPAL 4ZXBD 2QLYA 2YOCA 4FG6C 3WJJC 4K9EC 2FTAA 2VW7A 2CK0L 5DFTA 1SNRA 2AK4D 3B8SA 1FZMA 4GW4B 2GSIB 4HJIA 3T97A 3U0PA 4ZNEA 3DRQA 5DS2A 1MIEL 4JO3L 1XH3B 4DP0X 2Q6QA 5FGBA 3C8DA 4MJIA 4GIFA 2IWGA 4OT1H 4PRHD 3MROB 4IJTA 2QIWA 5AWNH 4PY8I 2F68X 3GMPA 3KWUA 2R0ZH 2NNXA 3MRMB 4HH9A 1DBJH 3LKSA 3T0DA 2ZOUA 3UIAA 2GY5A 3GSVB 3PREA 1M1JC 3V0VB 2QZ5A 1BLNA 2E75D 1KCUH 2QGDA 2A0LC 1WD9A 1KCVL 3KGTA 2EVIA 5I8OL 3A0HE 4KVNH 5KSBA 3NEEA 4J8RA 2J56A 5DQJA 4DK3A 3CPWO 4HAGA 5B1JA 4IRSA 3O81A 4LHUA 1NCDH 4N0CD 1G7PA 1GZQB 4WV1B 3UC0H 4K94C 5EMYA 2OGUA 3EOTH 1NBZA 1E90A 4G5AA 3U4AA 1MZZA 3RVUC 4HA1A 1XCWA 3P9MB 5AOIA 5HHVL 1G43A 4XC1H 5DLML 1RCYA 1XVSA 4XOAA 1V05A 2XNAB 3SBRA 1K4DA 2KMWA 3PQYA 2PXYA 4G2AA 3SGJC 1CXHA 3HUSA 3C5ZA 1JK8A 5H94B 5AAWC 4QUOA 2NY2B 2C9NY 5J8OA 4BZ2A 1J10A 2ADGA 3QQ3B 2BPBA 4KX8A 2OCFD 1CURA 4N5UA 1KEMH 1TMCB 1FGNH 3GSOB 4XHJC 3RVTD 1QSFD 5DJ6B 5CIPH 4PJIA 3P2DA 2GUSA 3HRZA 4N2AA 4TF4A 3USSA 1E4WH 3F83A 3M46A 2CO6B 3WI9A 4N2HA 3T4YA 2QSCH 5GJTH 1RJZA 5IBLC 5LGHL 3CZKA 1YMME 5BQ7B 2FNBA 1JY3O 1G2CB 3GZQA 5C39A 2IZ1A 4PD4I 3QEQA 3QQDA 3FOMB 2PCYA 2P80D 3HS0A 4HUCA 2N1TE 4MA3A 1AKPA 2DLFL 2YKKA 3BUDA 4D0CB 2WGXA 3BN3B 1P7QD 2WXHA 1IFIA 2AI0L 4OQ1A 1NFIA 4LQ1A 1J1XH 4TULH 3N5AA 3OJ2C 1UADC 2AJZA 5TE7L 3U83A 3V6OC 2CXKA 35C8L 2JB5H 3ZUCA 5HD8C 5T3XD 2NY1D 4N8CH 5D96C 3MZWB 4Y28J 2WWWA 5DRXB 1L5GB 5IJBC 4LP8A 2EECA 3BP5B 3BYYA 1FOSF 2M8XA 5FGCB 1HOEA 1QABA 2BFVH 4JDZA 3B2MA 4OFPA 3TK1A 3ARDC 1EGJL 2X4RB 2F53B 4LU5H 5EA0H 4BSWB 3VD2A 32C2A 3RKDC 5DMKA 5CJ0A 4FFZL 3EBIA 5KJRL 2OQJB 4AOFA 4B9CA 5DD0L 5IB5B 3PP4L 3GI8L 1R5WB 1QVOA 4PGCA 3QUYB 4NNPL 2IH1A 2RMZA 2Y3NA 3K2KA 1N4XH 4GJTB 2ESVE 5A6IA 1HHIA 3GWJA 4L1HA 4WU5A 2QR0A 3LRSA 4BQBA 4Z18A 2GCYB 1S7QB 3VFSB 2P9RA 3BKML 4JM2D 2Z92B 3HNVH 3W67A 3L73G 2GC4C 1OWWA 2Z7ZA 1D9KB 4CUCA 1BJ1H 1DQDH 3CLEH 1FFRA 4KUCF 4XNBA 2R4SL 5ADPH 4HWEH 3PAVA 3AB0B 5KBLA 1IGJA 1M7XA 2Y7OA 5DTFA 2V7NA 4JHUA 2OMVA 5F9AC 2NY4D 1I7RB 4R4MA 4FRWA 1NFDB 1EAOA 1COBA 3APMA 3H1IJ 4MQ7A 2DM7A 5EU3A 1SVZA 3T1FA 4Z5RB 2VSMB 4O2FB 4AJYV 4RA3A 4N8PA 3SY0B 5B8CC 4YSSA 4AJ0A 3G3ZA 1VACA 3EFOB 4JFWA 3C6SB 4M1DH 5IEHA 2JKNA 4N4YB 4QCIA 3BZ4B 1E9QB 1WO2A 4X6FB 4JBZA 4JFDE 4Z7WE 2ZNWA 1PFIA 4PUBL 5KOMC 4RAVA 1B4RA 1JGVL 1T0NA 1D6VL 5D1ZD 2JFCA 4YHNB 1JBJA 3QPXH 2XV6B 1J8HD 3OKEB 3ZPDA 3QC5X 4DT0A 3RK2D 4PRAA 3AACA 3O9WA 1FJ1A 2XN9E 2X6MA 3MGAA 5CD5C 4KKAD 2BNQE 1BIIB 3B2PA 4HQQL 2FJGB 3AG3B 4EDXA 1FZCB 1CLVA 3CJJA 3ULUE 5MEPA 3TWCH 2CPUA 4QHMA 3HE5A 3GHBH 4GBXA 3ARBC 3LEYH 4HKZH 3I56P 5JHLH 3CZNA 1PKQB 2LLGA 1KFGA 2APTA 1YEIH 2L4OA 4PJCE 5A2BA 4XNXL 1TO5A 5ICXA 1K2DB 1FYHB 2CJUH 3GBDA 5TF0A 4K9JA 2JKLA 1U91B 2J4WL 5FYKH 5DFVD 5I1GL 3TGUE 4ZQTA 5C70A 1GGBL 4PG2A 3CTTA 5HPMA 4OGYL 3HRPA 4LAQH 1NTZK 1AD0B 4HMCA 1KGYE 5L8RJ 2NXYC 5E9DB 1Z3GL 1JD7A 3RBZA 5L9DH 3VWKB 3CI9A 1O6SB 2I9LA 1LK2B 1QSEA 2V2TB 4MJ2A 4PWEA 1YAZA 8PAZA 1CPUA 5D7LD 5GTIE 2QG4A 5KKZB 4R96B 5D7JC 1OCWL 4ZMQA 1I1CA 4TNVK 5CN1A 3VXSA 1MQKH 1SQQK 1UEMA 3L3KB 5EFWB 1NIAA 2FR4B 2IH3B 2VR7A 4R97B 5T1LA 2KC0A 3I75B 1GIGL 5AD0A 4JX0A 3GBMH 3IJEA 5T1KD 1ZLSH 3RNKB 1CO1A 3E2HB 4C7NB 3WFEH 4NKIH 3ZTNH 1AMYA 4W9LC 1OTSC 4XX1E 5DGRA 3CFEA 4OZFG 3C6LB 5TDOB 3JYCA 3S5LB 4YXHH 2QE7H 5FAAA 3BPNB 1AR1D 3KNBB 3TEZA 4AZUA 1SQPG 2BSEA 1RUPH 1WFJA 4UYPA 4Y4FB 1MNUH 2MPAL 2OTJP 2RD0A 2MTAA 1FBMA 3GD1C 2DI7A 3MA7B 4NQSA 4WTXA 3U6XA 2R56L 5F3HA 4FULA 1NCNA 2IWFA 2R7EB 5IB1A 3BSZH 4AK1A 4WEMB 3V5KB 1HAUA 5L2KA 2PCPB 3Q48A 3P8CE 2YN3A 1KB5L 4N2MA 5BZWB 4LDLB 4KZ0A 3NJFA 4JVWA 4W70A 5JQHC 1H3PL 2VR6A 4XXCA 4BFGA 3NZSA 5IMLA 4WK0B 3V4VH 2R1YA 4DVBA 2BIOA 4Y1AD 3LEXA 3RUGE 1L9QA 1QTYT 4ZDHB 2GIXA 3LQZA 1N0XH 1U58A 2F7IA 1IBGH 5DYFA 2J88L 3VFTB 3TFKD 3BKCL 2Q1KA 1EUTA 1CTMA 3K80A 3F7LA 3PRJA 1FQ9C 2OW7A 1UCTA 4JCWA 5LHDA 2NNFA 5K9KA 1O9WA 3QYCA 5T5NG 1MF2L 2V9TA 3FTGA 1H6FA 4OZIA 4OGAD 2VDOH 4TVUA 5DD1L 4ZUUB 4TSCL 2K6ZA 4HEPG 5GGVY 3P9WB 5TDPA 5C3TA 1NCCH 3NRQA 4CVXA 4PRPE 5TGBB 2O6FA 5DJXA 3MRJB 3NGBB 3NRFA 3HZKA 2Y0DA 3PHSA 5GRUH 1CVSC 1W72H 2IDUA 3D85D 4WTQA 4P4KB 3C60B 4P9ML 1IGCL 3RZCD 1KC8Q 4HZLA 4PV1C 4O51B 4BFBD 2HN7B 4PWFA 3KXFD 3M9HA 4KKLD 4L4VB 4JFFD 4RGMB 3HD7B 3O3UN 5FO7A 3VE0B 3FXIC 1FDLL 2GBVA 3AMLA 3LY6A 3UMTA 1G1YA 3WXVL 3BZ5A 4IQHA 4MNQE 3G6AA 4D8OA 3HOGA 2OFQA 4PJDB 1NC4A 3DJRA 5DJUB 1GY2A 4S2SA 3B3BA 3HE7C 1KQGB 1H9VA 5C0BE 5JOEA 1S7XA 4Z77B 4I9WD 3MV7D 2WSFJ 2DMCA 3FTXA 4L23A 1UZ8A 2EEFA 4ZSOA 5DJYB 5BRZD 4XP1H 3ARGA 3WEAA 4AX3A 4WUUE 2BZDA 5DWPA 2WSPA 3VW3H 1OX3A 2X3AA 1R47A 3QJSB 3BQUA 3EIFA 5DEJA 2QJYC 5HGHB 3ALXA 2BP0B 3LZLA 2CIKA 4DW2H 1EH9A 1LO2H 2WSDA 2WLJA 3D2UB 4BK4A 2WXMA 1KYOH 5BJTA 3GLZA 1TEGA 4FTVB 4RMQA 3N0PB 4YJZL 3LMJL 3OHXA 5IZ7A 1X9RA 4I4WB 5JOFB 1LWUB 4GP8B 3SBWA 5CBNA 1TG8A 3BLPX 3ABKB 4QT5A 3EBGA 4U1MA 4YHMH 1HUCA 4PJ5D 3B9KB 3FOLB 1JP5A 4XMKL 3U1SL 2C9PA 2A83A 2HVKB 2X1QA 1DBKH 3WUVA 4O4YL 4EYYQ 4J4PC 1QYGL 3P4LA 1JK9A 4WTZA 4M3LA 3ZR5A 3GGWA 3AREB 4DSYA 5DLLA 3S88L 3BASA 4ACPA 1U8PA 4L4TB 1KTMA 4MMZA 1HIML 1VHPA 5DUPH 5GRJL 4PEEA 1BGYD 5J1SC 2K3TA 1KTLA 2H2PD 5F1IA 4EVNB 3P2TA 3E3QC 4Z95L 5E94B 4ANXA 4NZUH 3QJZA 1B2WH 4OLUL 1NGMB 4NWUH 1SBSL 1TJGL 4KXCA 3QULA 4GAGL 4DQOH 1SHSA 5GGTL 4NEHB 5CR1A 3SDXF 5M7QA 1BSHA 5EEWA 1QNZH 4LOFA 3UAEA 5LNEA 2BINA 4CC4A 1VFOA 5I17A 1Z9MA 1XGTA 2DM4A 1D6EB 5DDHB 2UYLA 2WIMA 4Q9BA 2CGRL 3MNDA 4JKMA 4C58B 3FQXA 1NEZG 1OFCX 1ZR2A 1CGVA 2VLRD 4U3FJ 2VLLA 4JZOB 2WXPA 5GGUA 4Y2LA 3K3QA 4JPZB 5EOQH 5IF0B 5FOJA 2I5YH 5CLTA 2PFXA 3AEBC 3R0NA 1I7UB 3I3BA 1XF2A 5ESQA 1XTGB 1XR8A 5BW7C 4N6QA 5I5IA 1YN6B 1NTZD 3V0JA 3EJSA 3JSVC 3FH7A 4N90E 4XPHL 3OLGA 2UWEA 3T65B 4YE0A 3VXNB 1DUYA 3RFZB 4FGMA 4NERA 2O61A 1KXQE 5JMRA 4UZSA 4F7PB 4I1RA 4JFYB 5DEFB 3EDDA 4X7SH 3E7KA 3VDAA 1UD3A 2ETWA 5F7EL 5E4EB 3QARA 3VWJA 3O3EA 1D2OA 3FUNA 2BK8A 1BJMA 1KTDB 4AM0Q 1SQQD 1HZLA 1DUZB 3EUDA 2FD6L 4I18B 5E4IA 5CGBA 1AHWC 1R3JA 5EZJA 3QHFL 3TIEB 3VU1A 4NQDE 2XZAL 1S6NA 1VQ6P 4HFUL 2Q7AA 2VDKB 4U0RB 4P3DB 3P0VL 4LGRB 1KPRB 3K4AA 4GUQA 2E42A 2XVLA 2BNUA 2D7MA 3LEVH 4GH7B 3RVXC 4HS8H 1RY3A 3QNYA 1UKTA 4M5TA 1H8NA 3DX6A 3ARQA 5L7XL 1U3HA 4RFEA 3VXOA 1JXFA 1KZYA 2F61A 2GUOB 3LIZL 1KFAL 4H5SB 4CU8A 1DN2A 5DYOB 3IMUA 4XVTH 2UZYB 4C4KT 5KZCD 2IDBA 2IDCA 3DROB 3M1OA 2DD8H 1GTNA 4ZTOL 1IJNA 4ALAH 1JYVA 1VFUA 3QJXA 2MKWA 2UZXB 3MUGB 3SE3C 5T1JA 2YBRB 1W5CE 4I1LA 3MUDA 1YJWP 4PJEE 4NNXB 3SQRA 2BNRB 1YNLH 2IBZG 4EKJA 2R3SA 5I76A 5C0AD 5I15L 2FLRT 4PM1A 2OAAA 5GHWH 3N44B 3IGLA 1RMFH 2ATKB 3LW5J 3HAEG 1F02I 1A3QA 2YIUB 3KYNB 5ISZA 1GL4B 4HS6B 3AEFC 4OLZL 1BQHB 5FFOA 1ONQB 3H1IG 2Z31D 1JZ4A 3I6LD 3BVNB 4LSTL 4GXUN 2AKRB 4KK9D 4W6XB 5DQDL 4ZOCA 4ODVL 3BCFA 2W6JH 4U7MA 5T3ZD 3MRHB 1QEWA 2ALAA 2PYED 3RWGB 3MACH 3U9UA 5ACZA 5I0WA 4P23A 4E68A 3GIVA 4G8GB 4KTEH 4NN7B 5D1XA 4PJ8B 2GC7C 3QORB 1U42A 4MD5B 1Q9KA 4QTHA 1JDCA 5KBPA 2GJZA 1F58L 3C8KB 1O7DC 4ZT1A 3X13B 4QTFA 4ADGA 1FN4A 5CJ5A 4UDTB 1FLRL 3MGTB 4WW2F 3GQFA 1NCBL 4KI1A 2P5EB 4MASA 1S9WA 2IDFA 3NK3A 2KS1A 5F6IC 2Q6WA 2MH4A 3UTSE 1RF0A 2RTTA 1PZ5A 4NN6C 2CO7B 3VMZA 4K15A 4MWFB 5DHVH 5DJAB 3MO1A 1RUKL 3CH1A 1BF2A 5JMOC 2M0BA 1NEZA 4KV5E 5PCYA 2WPGA 4PWKA 2Y25A 5FM5O 3MTXA 3H42H 1HYSD 4KTDL 2FXOA 5IOPB 4HD9A 5T3XH 2E7CA 3BVUA 3L2LA 4ZO9A 4MXWH 2BERA 3V9CA 3MLTB 4L3EE 1EEUA 1L6XA 3ALWA 5LBVA 4PVLA 5IBUG 3GS7A 4X4YB 1X5JA 2WIIA 4GSDH 4H8UA 4N0YH 4J6IA 5GZOA 1A25A 3KBHE 1FAVA 1AVOA 1T4WA 4L0PB 3QI9A 2CK3H 2Q10A 1QD0A 3MOBH 5HGDB 4Y5YB 5DJ8A 1M05B 2VXSL 3T4AB 4G9FB 3GRBA 4CN1A 5E5UB 1OTTC 1IK9A 2A1WL 4APQA 4UIKL 1XGZA 2M3BA 1U8CA 3EYOB 1D5MA 3FWNA 3QQ9D 2IWKA 2J8UE 2DQTL 1LO0L 4PI0A 4B9IA 5JW4R 3O6FD 5LGJA 3GO1L 3BPCA 2B87B 1JD9A 2AXWA 1VF5C 1CG9A 1G9NL 1T7ZA 2GJ6A 1MFBH 3B2XA 4L3FA 1H9DA 1Z2KA 2H89C 1DJWA 3NA9H 4KHTL 4O02A 1KTRL 3PUCA 1MQ8A 1J5HA 2IDSA 4A39A 4WVRA 3VYIA 1PF3A 4JPKH 4YL4A 4EI5A 1A9VA 1SFCB 1AE6L 1IQWH 3W9EA 3RWJA 5KLVE 3ZYIA 4S0HA 1EDLA 5GS1A 2I9TA 5IT2H 4GS7B 2C34A 4IRZL 4L9DA 4MD4A 4N3UA 2E7LC 1ET5A 4O5LL 2ENQA 2X9ZA 2WY3B 1WWAX 2ZF8A 3IJ8A 4S1RH 4ZS7H 2IBZY 3QRGL 1MFNA 5EBLA 1U8HB 2B3RA 1Q72L 3WIHA 2J6EH 1J88A 2EADA 3IT8D 3QQNA 1DQLL 4PJ0E 3HAEA 5BNXD 1JUFB 1M57B 4PJHA 3OKOB 5CCKL 2W5PA 1T6AA 1ZPLA 2P7TB 2G3MA 5CSZB 2QHLA 3X2QB 5AUMA 2ZUUA 2A9AA 4K3DH 4LVNB 3X3FL 1DZBA 4YHLH 3D48R 2CO3A 3MBEC 4PRIA 3I5CA 1H8OA 3BO8A 3L8QA 1ASQA 3MCLH 3RVVC 3VI3F 3BVHA 2FDBP 3SKJH 1KB9I 3M9BA 3CVCA 3KDMB 4HKJB 5ECJE 1MJ8L 2OR8A 3RGHA 1JJUA 1FP5A 2LVEA 3NEXA 3PY9A 3L3DB 4XBGA 3UGUA 1FV1A 4BGLA 3CX5J 4BSJA 4R8WH 4OKVB 4A2GA 5C09D 43C9B 4B9ZA 2ZCHL 2C9XA 5E8EA 4JMNA 5D71L 2VUKA 1RQVA 1DBBL 2AERT 4KXZI 3GJFB 3K6OA 3C2SA 1JI1A 1NJ9B 2GFBB 2W83C 1DVUA 3BDYL 2WLLA 3O6LL 3IMWA 4PVNA 5HHOD 1FZOA 4ZOAA 3SDAB 5L88L 2D9QB 1S7SB 3FU7B 4GT0A 1CFNB 4R7DB 4ZMTA 3PGCA 1L4AD 4AKPA 1TQWA 3QWOC 3IMBA 3JCUE 1JZDC 1YITP 3TCLA 1C7TA 2B59A 3LKPA 2BJML 1N5YH 3TZVA 3QWRD 3CVHH 4JY6B 5FB8A 1EZVD 3R0MA 2Q1EA 3BUTA 3Q1EA 4ZNCA 1BAWA 4G8EA 5C07D 4ZMZA 4YZFF 2E59A 3NZ8B 5DJDB 1MFDL 5I82A 2XWTB 1AHKA 4OCWH 1UYWL 3L9EA 4P2QA 4PJGF 2WXRA 1OF2B 1X5FA 4XPTH 3U0TA 3ULVE 3KS0H 1J8RA 3MUUA 3O4LA 5FGCE 2Y0CA 3FU5A 4I77H 1U8KB 1Y47A 1HQ4B 4K7PY 2IFNA 4F24A 2LVCA 3RY6A 1TT6A 4XMTA 1CLYL 2F53E 4MLSA 4YQXH 3V4PH 1S4XA 4QWWC 2LHAA 1FPTH 4QAMB 3S36L 1RU9L 5GXBB 4X2UA 1AJYA 1A6WH 1B0IA 4XNYH 1SYSA 2KB7P 3SFDC 2P47B 2ICEB 2R29A 1YQ2A 2ISDA 3NJNA 5HJ3B 2E0PA 3KYOB 2J7LA 3E1ZA 2Q3IA 2JCCB 3VG0H 2ZYHA 2HX7A 1S3KL 1WUNT 1ND0A 2VDNH 2IZ0A 2YMXH 3MRIB 5I1DB 1PLGL 3TBBA 2FRGP 4KRMB 2BY3A 1JOIA 2PLTA 4FMVA 4L1BA 3S3JA 3D4CA 3WIAA 4CKQA 2YUVA 4PJBB 2BDNH 1HGZA 4MLIA 5A2KH 1E2ZA 2H1XA 1JO5A 2Q3ZA 3I2CH 2CO2A 3GMMB 3DK0A 5AW4B 2BFGA 4I3SH 4UTAA 4YVNA 7PAZA 2E56A 3CUPA 3MX0A 4POZC 1NFDE 5KSAA 4EOWH 1RH5B 4LVHB 3H1HJ 1KPUB 4I48B 1Y1DA 4JG0L 4IGBA 4IDJH 3VGGA 1NFKA 1TQTA 2VAAB 3QB7C 3ULUL 1CGYA 2BHFA 4TTGA 4LSRL 4ADJA 1FORL 2VITB 4J1UB 4OZHA 1WWWX 4NJAH 5F21B 4G6FB 1LMKA 1YEGH 2DMHA 3K8MA 4XN7A 2EEXA 4BZYA 1KJ2L 4X5RA 1MVYA 3S35X 2G0KA 5MP6H 5MEQB 1RZ8B 5AW0B 1BFTA 2IDQA 4BXSV 2J55A 3KPRA 4Z7QF 5CJ8A 1XBDA 4OJAA 1FS0E 5AEAA 5APVA 2WB7A 3WHXB 4Z3IA 3EH2A 4U3FG 3PXJA 2CLZA 3IFNL 1MV8A 4GRLD 2DTML 4AGQA 1P1ZB 1YRKA 3NDZE 3ULSA 3HG1B 5JIMA 2RA1A 3BPLC 4YSCA 2YD8A 4XGZB 2D7PA 1BD2D 2H32H 3LRHA 1JVLA 3CN1A 2FGZA 4F8NA 4H25A 2AJUH 4WO4D 2P3YA 1PKQE 4ZUVA 5I6OA 2QVMA 4GG8A 2OYKA 2AJYH 3U2SA 4MNGA 3A2AA 4A63A 3NN8A 3OLDA 2P28B 3BISA 2QV4A 3CX2A 4ZFZB 4FFYA 2ZX7A 2R27A 3C08L 3OGOE 4AVIA 3L4YA 3HB3C 1QGKB 2YAFA 2Z8RA 4ZUWB 4KJYB 1ODAA 3AXIA 1SJHA 5E9DE 1N73B 1X5IA 1IMHC 4HHWA 4I2XB 1U8MA 3QYMA 2PPFA 3IFLH 3ARUA 1S5IH 4ZI8A 4MSWA 1BEYH 2NW2B 2AEPL 1KJ3H 2A9DA 1MFZA 1UM5L 4HBCH 3NQKA 3RDJA 4JDVB 1WZKA 4M7ZC 2XOTA 1RP8A 2D7NA 4HX1B 4KH2A 5FV1L 1F18A 2E27L 3GMNB 3W39A 1JZ5A 4FFWC 1GCFA 2VMDA 4H2AA 2YHGA 2ZIDA 3K46A 3V6FA 3ZQWA 4L29B 4ELMA 2Y7LA 2Y5TA 5C9JA 4R2GD 2VDQH 1IFPA 1X9UA 2Y22A 3W1ZA 4KZEH 1ML0A 3G9AB 4M6AA 3DSNA 5JUEL 4XNDA 2MOVA 5HBBA 3HJ0A 2FYNC 2WVVA 4PS4H 3EHBC 3FO0L 4UINL 1G1CA 3G08B 3LX9A 2ZXGA 2X9WA 2ZNXA 4HIXH 4ZYKA 4KT0J 1D2PA 2TSAA 3L1EA 1AACA 3WGVB 1U57A 1FL6B 4V11A 1BMZA 5JHAA 1S9XB 3VFSA 3L54A 1A4AA 1J5IA 1ZRTE 1I1AD 3H9SD 2YAHA 4MJ5A 4JFPB 1OB1A 1ED3B 4NO3B 4G7YH 4PI2A 1A9EA 2B1AL 2Z1PA 4UILL 4W9EC 5EF1A 1QLFA 1DD3A 4GRWB 4B9GA 3FUFA 4HS3B 4R9HA 4FYQA 3LS5H 4RX4D 1T1XA 1W0WA 5FCSH 1NTMK 5EU6A 4G6KL 4U1IA 1BDCA 3NABH 1NDMA 3DUSA 4NHCL 4TNGA 4UNUA 4X7FC 4EN3A 4NQEB 5A2IH 3WENA 3BSHA 3QR0A 1BZOA 1E7UA 3JTBA 5AOJA 5FA4B 4LOEA 4MJ4A 3ZTCC 4ALAC 3H2WA 3SE4C 4HIIB 2OZ4H 4WFHE 1OT1A 4WDIA 3M45A 4LEOA 3QDGA 4RMSA 3ZLQC 1Y8AA 2PO6B 4CSSA 3LSOA 4E42A 3V4QA 4M62H 3U36B 4LPCA 4N0CC 3V0AC 1JTTA 1MEXH 4WFFD 4HH9B 3UAJA 1CI5A 3HS9A 4FXGA 4M5ZH 3F8UB 3HE6B 4XCFH 3FQNB 5MENE 3HG0A 1LP1B 3WJJA 2H6PA 3SE8L 1PY0A 2ZXEB 1XTLA 3QXDA 2UV3A 3GXPA 3DX7B 4FLHA 1KGWA 3IF1A 4J8RB 3WFDL 4L4VE 1F1GA 2F8VA 2A45G 2FYUJ 1CU4L 1EHKB 2BMKA 2DM3A 4R4FH 3KEDA 4JKLA 4PQXA 4UOZA 4PJ9C 4EIJA 1HJ0A 1AKJA 4LBAA 1NBZB 4KI5D 1G4RA 4N6RB 4EDWH 2AXFB 4PJDE 4LLQA 1M1JA 4J6RH 1IAIH 4KKBD 1SXCA 3RVTC 5JPMB 3BHBB 5IBTH 2EIMB 3PABA 4JO5A 4KC3B 4MZRA 5KVFH 4O9BA 1YEHL 2EIDA 3RK3B 1K4DB 1ZXGA 1HZHH 3HUSB 2ZOLB 5CSGA 1DLFL 3WY1A 1Z3RA 3CC1A 2DQCH 4KO9A 1T20A 2AHIA 3L1OH 4FKHA 1C5BL 2IO5A 1U8OA 3Q5TA 4UOJA 1QHPA 1ACYH 1EDKA 4FTVE 4OB5L 1IEBB 2KZBA 4D9QD 3G04A 3PGDA 4ODTL 4PJIB 5C0FA 4JB9H 2NY1C 3L7FB 3MJ7A 4Q6KA 4EF3A 5FO9B 2EDDA 1DR9A 1XTMA 4P05A 2K1MA 4WU7A 5JOPE 3MHVA 3T4YB 3U4BH 1MWAA 1BE3D 2J5LB 4J3UA 4YE4L 2Z3FA 1KJVB 2H41A 1FYTA 5AAWA 5KBKA 5T3ZH 3OLEA 4AJWA 3QFDA 2JK5A 3D9AL 3DETD 4OD2B 2WYIA 5CCJA 1RIVH 5CEZL 4YFLI 2P48B 2B89A 4PLOB 4KK6C 3TWYA 4L4TE 3FHQA 4MN4C 2OK0H 1AGBB 1CDYA 5ALBL 2UY7A 1TCRA 2EDQA 2VQ1B 3D30A 1MHPL 4UQ2B 4DEPB 4H0LB 2HT4C 1OVUA 3SQBA 3QHZL 4FC3E 4U6HB 3BUYA 3ZE0B 1S7WB 4G11A 1WZMA 3VQ2C 5C2BL 1X5GA 1N7ML 1EHNA 4EUPG 3FRPA 4JDZB 3T77A 4L1SA 3NJIA 4ZX6A 3QIBC 1GXEA 4QRPB 5DMKB 3VRLF 4L05A 4X6EB 1P4IL 1XGQB 1MJUL 3JUZA 1JGLH 4LVEA 4QXGL 4CSTA 3MRBA 1QATA 4N5ED 5LXGH 1QVOB 2HG5D 3EXJA 3GKWH 1AV1A 5HI4D 2NY4C 4CVWA 1IZKA 3B71A 2ZOTA 4ODXA 2P44B 4NAQA 3LRSB 4HF5L 4N2NA 3PFQA 4GQ9H 1DBMH 3ABGA 1OT4A 4HCFA 4RISL 3ARDA 4N2FA 4OM0H 5IB4A 5LO7A 3LCYA 1QMUA 1KTCA 2ZONA 3ETTA 3UTPD 3N43F 3BVWA 3EBAA 3WN5C 3OHMB 3F5HA 4KY1H 1XZWA 4K07A 1FZJB 2BWIA 2FEDD 3AROA 3V0FA 2V7NB 4QGYA 1IJ9A 1FVEA 4DN4L 4TUKL 5D1ZC 1R3LA 4QOKD 3SB3A 5DQ9A 4MQ7B 3RK2C 1N18A 1OAKH 1J0IA 4ELKA 1MIEH 1JF6A 2MKVA 4QTIH 4JRYD 4WFGE 4WJ5B 5BS0D 1F1DA 1INDL 2OXHB 3ARVA 3KM1A 4QCIB 4AE0A 1G9ML 3V9FA 2PRRA 1FNSL 2VJ8A 4Q74A 4ODWA 5MHSE 1SS1A 1VCAA 3UAFA 4CBPA 1GPOL 1OKEA 1T0NB 4CAGA 4QRUA 1TTFA 5L4MA 3GMOA 3N85H 4W4OC 4JPIA 3N1FC 3F12B 1M56D 1KCVH 4YGVA 3O9WB 1ZLWK 3L6FB 1IFJA 1FJ1B 1WG3A 4WHTA 2VXVH 2IYPA 2VSCA 5DFVC 4HKBB 3K4ZA 1TU2A 4PV9A 2O4EA 1O9ZA 3L2MA 3UERA 5AL8A 4MB3A 4Y2DD 4YSDA 4O2CB 4BINA 3WDIA 3M1CA 1J9SA 2BNRE 2ZYRA 1ZHBB 3CMOH 3BN9C 3KPMA 6FABH 1CFSA 2EVFA 1NH4A 2BHZA 1NCAH 5CUSL 3W11D 3AGVA 1LO4L 1WIOA 1NTMD 5DLMH 1KZQA 3PLYA 4FXLA 4E9QA 2W6BA 3V9EA 5F72S 2QBWA 3IS1X 3H1HG 3SBPA 5F6IB 5E2UH 1GD2E 3SWKA 3WY3A 1GU4A 2XNDH 4NN6B 4AYFB 2YXRB 2BP5M 5HPMB 1L0LJ 3CXDL 3HZMA 5GGQH 5C1MB 3I50L 2WQUA 1HINH 1YPZB 3IJYA 2QELA 3ARBA 3ARYA 3H1JD 2R23A 1JZEA 4MDIA 1WYJA 5GGVL 2RB8A 1PQZA 3KPNA 4FLOA 4G8GE 2MRYA 3TA3B 1JTOA 3S8WA 1WAPA 3A4DA 3P4OB 1P69B 1GMIA 2GITA 2Q2LA 2VDRB 2VRAA 1SF5A 2P5WB 4ODHL 1AR1C 3TGXA 3O6MH 2EE3A 1RV6X 3OMAB 4J3OD 1YEEL 2GI7A 4XMWA 4Z7VF 2XZQL 1GA2A 2P5EE 2DLFH 2E74B 1F4HA 3EYQD 1SXBA 4HMDA 1JPSL 3P77A 5KTEL 5I8KL 1YG9A 4Y4HD 1G7HA 5BO1L 3HBPA 1IFMA 2GUVA 2Y5QA 2VISB 3CFEB 5SX4H 3WAKA 3W38A 3SYCA 5EBMA 3IJSA 4DCQA 1IM3B 4CL7A 1HESA 2FY8A 1IGYB 4U1GC 2L7UA 3GEWB 4JS7A 5H2FE 5I8EB 3GRWH 1IKFL 4FNLL 3K72A 5JIHA 3PHOA 4I6MC 1HFUA 3AU1B 5FXCH 4NKDB 1G7LA 1A64A 2WYTA 3BFQG 2A9ML 3WNJA 3D0AA 5AAMA 4M6NL 4MTMA 1YY9D 3G6JB 1A1NA 4OIFA 3CPLB 2DQUH 5AZ2H 3ZDXB 1WBXB 1NDGB 3FQTB 4QXWA 3AUWB 3T0EC 3VCLA 2YQ3A 3GSNB 4G9FE 2FKWB 3CSTA 4OGAC 5IMLB 4L9LB 4R26H 2R1YB 4DVBB 1ROCA 4PV8A 2V5RA 3FPYA 3LEXB 3NJHA 3UJTH 1T89C 4LDCA 3RIFF 4RBPK 3KW7A 2BVTA 4XCYB 3DSFH 4TLUA 5EZOL 3U7WL 3CCUP 2LTQB 1IBBA 1Z56A 5KVDL 3X11A 1HOCB 2I07A 3RZCC 5MERB 4PYHA 3TYFB 4BH8A 2EJ1A 4TVSa 5HGAA 2HT3D 3T08A 2O3JA 1KXVA 3E80A 3OWRA 5ACMA 1IKNC 4AYID 2FWOA 2XBDA 3HC0A 4XRCB 4BXVA 1M2OA 2F5BL 4OZIB 2NY3D 4X9GA 1MXDA 2P4AB 5D2NC 2FT8A 1BZ9B 4LSDA 1D5IL 4FQJH 3VA2C 1U95A 2ARWA 1HT6A 3AM8C 4K73A 3K8LA 1SLXA 4LGSB 2DBJA 1QTSA 3OKMA 4EXPX 1IZJA 2N7AA 3LPGA 3MCKB 3PWPB 4UT9H 5L0QC 4NPYB 3WTWA 4LCWD 4HOWA 1C1EL 5EBGA 3JVFC 4AYBA 5CS7A 4PJFB 1ZHLA 3RP1A 1NAYA 4Y16C 4Q9QH 2E7HA 5M95B 2QHRH 5SV4A 3ELAT 3ES6A 1S5LE 4ENED 1Z9OA 3O11B 2O5ZH 3ZZSA 1YMMD 4QRRA 3VRIA 1E0OB 3NFPA 5BVZA 4K23H 1I3UA 4A7TA 5IOKA 2WXKA 3CV5A 2V6HA 1UGNA 2EDYA 1PP9J 5A2LH 2KI7B 1P84J 4XBEL 5FUOL 1S7XB 4LARL 1PG7H 3BDXA 1ZGLP 1GCYA 4FL4B 3OD3A 3DV6B 4NPKA 4ZSOB 1R75A 3WU1A 4EQ3A 3ZRCC 3GI9L 5LNDA 2ORBL 4G6JH 1R1CA 5KVEH 4JYBA 1XH1A 2OP4H 2JIXD 1E9PB 1F8TH 4LIQE 4NOBA 1D5XB 1UXMA 2VDMH 5CZXD 4LCCC 2NX5B 2W1NA 4RMWA 2ZQKA 3UJJL 3ULVL 5I9QC 2JKIS 3HE7A 3ARFA 3L3HA 1KSRA 1DEEA 4ASWA 4UAOB 3CCQP 5IW6A 4BM7A 1I8UA 1I31A 1KXTA 1V3MA 3WIIH 2A7BA 3A4AA 2WZ6A 2ESVD 3GSWA 1ZT1B 2CCWA 5EORL 2Z64C 4OZFB 1N67A 4NI6A 1HSAB 1AQDA 2C5DC 2FHBA 4O2EA 4ETYA 2P24A 2FYUG 4DVRL 4MMZB 4FAAB 1L7TL 1NKOA 5DZJA 4FABL 1BQRA 1PTZA 3BZFA 1E4KC 3EGSA 2BSDA 3FUDA 4R0LB 3ZQ9A 4LCUA 4EZMA 2E9IA 1WK0A 3D07A 3CXFA 5E1GA 5F1IB 5BZZA 5E8NA 1HEHC 2KERA 1J9CT 3MHZA 3KYKL 1KT2A 3CMEP 2P1JA 4J4PA 2QRXA 1NM9A 1R5IA 4GKSA 3M6DA 4HWZB 3G5ZA 3DWTA 5EEXA 4EI2A 5LBGA 4DGIL 5I17B 1LM8V 5T1MA 4UV4L 1JTHA 3D39B 4KQ3H 4DNLA 1U8JA 4ORGA 1JY3N 5ANMA 3QNXB 3HJEA 5GGUB 3QISA 5EU7E 2VLLB 3TBCA 3LRMA 3AAZA 1SQBE 4E41B 5C6WH 2VW4A 2JCCE 2Y6TE 4HVBA 2K3HA 1XF2B 3D1MC 1KDJA 3EDKA 4XN8A 1DFXA 1WFIA 3NPSB 2Q8AH 5MI0B 1WFTA 3X14A 2UWEB 7PCYA 4YHYC 2XN9D 2IWEA 1DUYB 2CKNA 4Q0XH 4JN2A 4AEFA 4F92B 1UC6A 2BNQD 2TRYA 4PJBE 5C7ZA 2WWNA 1I85C 2B14A 5ERWB 2EDNA 1F00I 4X6DB 2BC4B 2QMKA 1R24B 2MHAA 4AIZB 5IB2A 1A7OH 4F3FA 2OARA 5IMOA 2V9UA 4YXLH 1RLWA 1S7VA 2PTUA 3FB5A 1AMXA 4DGYH 2K4AA 1LTJB 2Q8BL 4XPGL 1WRFA 5BW7A 3UROR 3LZQA 3RL0g 5CCHE 2J21A 4ZUTB 2IBZI 4ODUA 3JWNG 4PIRF 1IFRA 2I7OA 3JVGC 2O93L 4GQZA 3MLZH 4AWJC 1PX3A 4X6BA 3TN0C 1UT2A 3QUMB 4WWKD 3G5YB 3STBA 1PEWA 1QFWH 3TGUD 1XGYH 2ATPA 5HVHC 1RZJH 4NO2B 1CGSH 1EFQA 3DX6B 3L9BA 3O6QA 3PHQA 1J1PL 3VXOB 4KZDH 1JPGB 3TS8A 2R0LL 1MHEA 1NPUA 1XEDA 2YWYA 3BXNA 2YKLH 3M0AA 1MIML 3W2DH 4CC0A 1MRDL 5FHAL 3ME0A 2FL5A 3ERXA 4X4XA 4NWTH 4RZCA 1G6RH 4WJKB 1AHWA 4IBZA 5HYSA 3VB9A 3MXVH 4ZMYA 1JPST 2EO9A 3HG1E 1I3GH 4KK9C 4NP4H 1EMTL 3CCEP 1H6EA 2WN3A 2WXJA 3BP6B 4NC1E 1UB6B 4PN6A 5FYLD 5KW9H 1F6AA 1E5UI 1IC5H 5IQMA 5I76B 2C9UA 5ESVA 4X9FA 1IAOB 4LLVA 1SXAA 2ZCKH 4ZMAT 4IRJD 5IV2A 5JW5B 4EIUA 3PTZA 3UIYA 1MW2A 3B5ND 1WISA 3BUPA 1NAML 3QO1A 5CIPA 5ISZB 5DJ0B 1DQJA 1E43A 2AQNA 1B90A 2Z35B 4S1QL 3TJHD 4L8CA 5ID0A 3SWFA 4O02L 2XWRA 5LDSA 4FHKA 2NR6D 3HPJA 1YYCA 1KCRH 2B16A 4YR6A 1KCWA 4U1HA 4GUOA 1YECL 3MOQA 4WI5A 4G8FA 4I2XE 3CCHA 4Z0XA 4R4BA 3GIVB 2IFMA 4G6MH 5D1XB 1S9KE 1IT9H 3PCYA 4OZGA 1YCSA 4X4MA 1LT9C 2H3NB 1I9EA 1VESA 2QFPA 1HYSC 5CN2A 2ZYGA 3P8CD 1AYOA 3HZ3A 3P40A 4KAQL 4ZXBB 3T6VA 4OFVA 4G1MB 3ZE2B 5EDSA 2E4TA 2R69A 2IGTA 3MLVH 1FN4B 2AK4B 2PYFB 3AT8A 4HC1H 4LLUB 1FE6A 1T7YA 4PREB 5GPRA 1C16A 4BHUA 1S9WB 4I3RL 2KS1B 2XA8H 4OBSA 3P11H 3ZTJG 1CFTA 4PIBA 4JRXE 4PVMA 4U2YA 1OP3H 1PZ5B 4PRHB 1F4XL 1KWKA 5IHWA 2W94A 4TUUA 3CH1B 4Z78B 5SWQA 2G3NA 2IAAC 3G6DH 2BOBB 4Z95H 3SODB 2X4QB 1Q7YQ 3L4CA 1V5JA 4OIIH 3U59A 4APXB 1J7VR 5E51A 1SBSH 3A6OA 4K3HA 5GRWA 1TR7A 2R51A 5LBSH 2E75B 3SDXA 4H7VA 3WKML 5IESL 1G0YR 1MCRA 4HWUA 4YDVB 4IFMA 2VLJA 1WSST 4QXUH 4AMKH 4OAWA 2NPSD 1CDIA 2NCEA 2UXFA 1GS7A 3HFFA 3BRFA 5I75B 3OPZL 4K8RD 1EX0A 1XCQA 2QVAA 2Y6SD 1BVOA 4OLVH 3FTWA 1L0LG 3NJVA 4E36A 3DBXA 4Z7NB 3QI9B 2AQSA 4BBWA 3LQMA 4GRWE 4XVSH 3KPQB 1X8YA 1JGEB 2D7TL 3Q06A 1QTPA 3AXLB 4URKA 4APQB 5IW3A 3BGAA 4L8DA 2QJPC 2KSEA 4NQEE 1D5MB 1QI5A 4GOFA 5AVUB 1HDMB 1NOLA 2M1KA 1VEMA 3JV4A 4N1CA 4R5TA 5LGJB 4F8LA 5C08A 3A67H 1XGUA 1LE5A 2GJ6B 4ZNEE 1TJMA 1SN0A 5C0BD 5B22A 5TTRA 1EHLL 3FQWA 4ZFOA 3A22A 4BK5C 2VZTA 1MPAL 2BIIA 2IXQB 5E9AA 4KXBA 3PWVB 4WUUD 1QSFB 2YAPA 2PCFA 1E30A 4HIEA 4Z3FA 3K71B 3QCVL 2R83A 4IHOA 3S0PA 2A9NH 4V1DD 4MD4B 2BSRA 4BK8A 4K7PL 4XNQB 4JZNA 1LP9B 1T22B 5KAIE 1BZ7A 1ES0B 4D7BA 2XVBA 4PB9L 5EO1B 3FUEA 3QAQA 4JJ5A 2APFA 1Z5LB 1P2CA 2QKSA 4GW5B 1PX4A 4MVBD 4ES8A 3LIUA 4R7NB 1P7QB 3C8HA 5CBOA 5HVWA 3HR5B 3ATFA 4HKZA 5JHLA 2DDQL 5KSVB 1TVHB 4M43L 1OGAA 7FABL 4AGMA 4LSSH 4P5TC 5H37H 2CCVA 4JYCA 2CUMA 2K3RA 1EO8L 2IPTL 2OYHC 2AJXL 2E7LA 2YGNA 3MRKA 3S4SA 1OAXH 3X1BA 4LF3A 4OGXL 4PJXF 2ZKWA 4ZS6C 2O1KA 4LEXH 5EN2A 2NZIA 2EC9T 4PY7A 3T0AA 4PRIB 3BO8B 4YSQA 1BAGA 5KLVK 3RK3E 4B50A 1J05B 5FYJL 2WOYA 1AVYA 1L4AC 5TISE 1URLA 2EH8H 4OY9A 4QLRA 4R7VA 3L74D 1JHLH 3L75D 1SQXJ 1H88A 3MKGA 4P46D 2WQSA 3WE6B 1GMJA 4ODSL 4JDTH 1LTSC 1I7ZA 5AZEH 3RG1C 1IFDA 1ZSHA 1DVFD 5F3BA 1G7MA 4B9PA 1QZNA 2XZZA 1EFXA 3HZVB 2MTPA 4G7QB 1OVVA 3NSXA 4PJIE 1KY6A 1MLCA 4JM2B 3A6BL 2BEZF 1OSPL 1RHFA 1FZOB 4HKXA 2XU6A 2G8YA 1MREL 5DT1H 4AYGA 4F57H 2JKWA 4K35A 3TM6A 1CI6B 2LFEA 2B59B 2F19H 3LKPB 4ZTPL 1P6AB 1R0AL 2B2XH 1UCBL 2VR4A 2NY4B 3SYAA 3UBXG 4OM1L 4GAFB 4FADA 2JJTC 5D55A 1GYWA 3F00A 1EEYA 3PDDA 1SQ2N 4MMXC 3ZE0E 1G1KA 2YPLA 3SN6N 3QIUD 3R19A 4J3OH 3WL9A 5C86A 1PP9G 1SVBA 3O4LB 4AUJA 4NZJA 1FFPA 1NSNH 1IBYA 1SJXA 1RUML 2YAOA 3BX7C 2L0DA 3EO9L 3UTZB 3L74J 1RFDL 1TQVA 3L75J 3BSZA 3QWOA 4NUJA 1NLBH 3ZE1F 3CFJA 3S98A 1TZ8A 4IL6X 1UXSA 1VZGA 3DX9B 3RGVB 1KJMA 3T2QA 3T6ZA 4Y4KC 3UMNA 4J8QA 3FO1B 5F7NC 4FA7B 2IMMA 3MJ9H 1OVZA 3V4VA 1U3YA 4IKLA 4J3BA 3WE1A 2FT7A 1C5CL 5DGQA 2XC8A 3DRTA 5APUA 4FQ1L 1SVCP 2YEZB 3FN0L 2EE2A 4NKOB 5J13C 2VDKL 4M7KL 3T2NL 5C2UB 1QBLH 2VXQA 1ND0B 2R2EB 2CUAA 4L5FL 3BD5A 2CLRB 4O9HH 5F9WC 3BCCJ 4NO0D 1GOHA 2E7MA 4M8QB 3IMTA 4QMEA 1KMGA 3V10A 1B6DA 4I88A 4OFQA 4QRQA 2X4OA 3TT3L 3VGHA 1UGKA 1A6UH 1RK1B 2QT6A 3LKNA 5DSCA 1SYVA 5A2AA 4CNIA 3DGDA 2QGBA 2WTPA 1VFAA 3FU3A 3A0HH 1NICA 3F05A 4Z76B 2NY7L 1UJ3C 4AM0A 5D6DC 5FM8A 3X12B 3CHQA 3C5SB 2N0KA 2FATH 3VFOB 1A7QL 4Q9RH 2NY0D 2WVRA 4NGHH 3L95B 1W72A 5CLXA 1AZBA 4CN4A 2XU9A 1OCOB 4GRLC 4NQCA 2B39A 2R4RL 4CVZB 1ZP0C 2WPQA 3LZOA 4K5MA 4ZPTB 4MS8D 2W0KA 3S3PA 3CVHB 4JQVA 3ZT7A 1BX2B 5DRWA 4JG1L 1A14L 5HDQL 1LE9A 2NQ3A 5HYQA 4WO4C 4X9BA 2KPWA 3S96B 1TXKA 5F8QC 2C0WA 2C3HA 3BATA 3II6A 1V7ML 3GHGB 2ZP0T 4WHDA 5E6ZA 4YIQB 1BAFL 4C59B 4KDWA 5T1KB 1PJ9A 1Z66A 3ULSB 2K6YA 2YRZA 2QQNH 4HZ1A 4TOYL 4XNZC 5HJDA 2HKHH 2E7DA 3UZQB 1X5XA 2B0SL 5JW3L 1JWUB 2R2BB 1OGSA 1NGPH 4FXTA 1MCPL 2AJSH 4YO0A 2WKOF 5I6XB 2YXMA 3P3YA 3ZW3A 2X6AA 3NIFB 4Z3HA 4W9JC 3B7UX 4LHQB 4U1LA 3UTSD 4KKRA 3ZL4L 2VDNB 3QIWD 3CWBD 1FHGA 5FLVA 3VMNA 1GMEA 1SQVJ 4TKWA 2HKFL 1B4JL 5IW1A 4MCNA 2ZX8A 3MLWH 1YPZE 4R2GC 3U9WA 1ASOA 4L3CA 3WCYA 3Q3GB 1BXAA 4N20A 4KROD 2X9XA 4XBMA 5C8JB 2KS0A 4IOIA 5FA3A 4K9EL 3RIAF 4OD1H 1MJ7L 3QO0B 1A0QH 3EH5B 3M17B 5FW8A 2P5WE 4GAYB 3T8XA 1B2YA 4FXKB 3RB5A 5FHBH 1NL0L 1DSFH 5JYLA 5KVMC 4B6ZA 2ZUQB 1YEJH 2BJMH 2KLSA 5D6CA 2CH8A 3IDJB 1DQMH 2ZYAA 2V2XB 2M5AA 2Y5TB 3LN5B 4IFFA 4KUZH 4WSJA 5C9JB 3MRQB 1I1AC 1KELH 4AZ8A 3AS3A 5CGYD 2QM8A 4LPTA 3KCWA 3GS4A 4PJGA 2ZWSA 3QRLA 1NBYA 2WVVB 1UACL 2WKLA 25C8L 5E6SB 3ZSTA 1ZOXA 3LV3B 3VFVB 1ZLWH 1Z0MA 1WAAE 5INCA 5GS2H 4XBPB 4BA8A 1IBZA 2Z8VC 1F4YH 4EOTA 3V0WH 3S36H 3MA9L 4K94L 5KLVD 2IAMB 1K6QL 4MJ6A 5D1QB 3NCEB 1LTTC 4JFFB 3G6JE 2A6JA 3APCA 1CYXA 3ZDXE 3MC0A 1MXGA 1A9EB 5JQIB 1BVKA 4WUKL 2K8QA 1CK0H 4WI0A 4HJGB 4LXFA 3KPLB 4MYWB 5L4FA 2K9JA 7TAAA 1RZJC 1W0WB 4U1IB 1AXSA 3DUSB 1HE7A 2WZPA 1KUMA 1TSRA 1E6OH 1GRWA 1ZK9A 5BRZB 2A45I 3ZK0A 2JSFA 3WEXB 1L9RA 3D4ZA 4ZMNA 4CN6A 1LTIC 2JV6A 4ATWA 4XP6L 2EILB 3VXPB 1EHXA 2BIHA 5DURB 4IL6E 3QXTA 3NTCL 1TIUA 2FQDA 4WDIB 4HG4K 2DQEH 4E42B 1DE4A 3PV6B 2HPCB 2Z93A 3HC3L 3GINA 4OZIE 1WE5A 3ZYZA 5EF3A 2HLAA 2A5UA 4XO4A 5B39G 1TEFA 4KI5C 2ODHA 1RVFH 4HK3J 4P5MA 4PJ5B 4I85A 2FBJH 4JR9L 4KKBC 2H6PB 1FAKT 1FO0H 2Y5EA 3PWPE 4XCEA 3CH8A 3KHQA 3NIDF 4GI6A 3SE4A 4LIQL 3IF1B 4C55A 4PJFE 4Y19D 1NCJA 5FKPA 1CIDA 4M93C 5D7IA 4LCCB 1MCWM 2OX5B 2M3EA 1AOZA 5TK4A 4G6AC 3Q2VA 4GAJH 4ATTA 4UTBH 1LEKA 2PKDA 3QC6X 5IIEB 2VDLH 3TNNB 1BQLH 1A2YB 5FOBA 5C0DA 3JTSA 3GDBA 1QPPA 5AW8B 4LEBA 3QUKA 3CFBA 3T0BA 1E4XH 3CC5A 3CDZA 3ISWA 5GSRB 3WS3B 3PABB 1TETH 4ZSOE 2VC2L 5GTIH 1DBAH 3F5WB 1GOFA 2WSCJ 1RIHL 4B7LA 1SHXA 4WEBL 3MR9A 3NXSA 3FT3A 1QBBA 1WDAA 3EFDH 4K3EH 1IAKB 4PJ9A 5B4MC 2JKSA 1VZIA 3DETC 3FQRA 5IFAL 2K7QA 1RLBA 1U8OB 3PGFL 5DEGA 2WLIB 1C08B 1JHKL 2NX5E 2F53D 5CMAB 1WWBX 2BVYA 4C4BA 2EXTA 3DMMA 3S8FB 3G04B 3OKDB 3CLFL 1CW5A 2D4DA 2FUQA 2FEEL 4RBPH 4AKQA 4Z7OF 1EZSA 2QFRA 3QUYD 1INQA 1MWAB 2VE6B 1OCZB 2VZ3A 3H7BB 1J1EC 1FYTB 3TPUA 3MV11 3TP4A 3CX5I 2JK5B 4J2XA 3I6GA 3AE2C 6TAAA 3EO1A 4HPOL 4WWPA 2P80A 5TE6H 3MJWA 3GIZL 3UDWC 3TBSA 5EUOF 3FU0A 4N5EC 3HG2A 3RL1B 1D9KD 4IEFB 1SQPE 4MNHB 1IEHA 5HI4C 2VSDA 5K1NA 5IROD 1BMWA 4EPSA 1CICC 3ILDA 4MX7B 3BAKA 2ZD0A 2C4FT 1QSVA 1ZWIA 1PZCA 1HXMA 2CK2A 2WTYA 3WJMB 1G94A 1P0SE 4YWGH 5IHUH 1EEZB 3SYOA 2W9EL 1VGEH 4GKOA 4XVJH 1KQLA 1MCQA 4LPUA 3D39E 3L81A 4F9LC 4XX5A 4X5WA 2W0FB 1SQXG 1ZT4B 2FEDC 1GYCA 1ZVHA 1OOAA 3KBPA 1SLQA 2OSLB 4N9GB 4V2CB 5CLWA 5KZCB 1Y18A 4E41E 1SN2A 3FQYA 4ODXB 1B3IA 2UX6A 2N0MA 2CIIA 4FLRA 5DD5L 5DUBA 2OMWB 4CA4A 2ZT9D 2OMUA 2YD7A 4XB3A 1WHPA 1HILA 3FB8A 4IMLB 3QIBA 4CJ1A 4U3HA 4JQ0D 3GLEA 4K8RH 4KRLB 2UWEE 2IBZX 2H7HA 4BRYB 1RZIB 3TJEH 5GGSY 3N9GH 2HWZL 4AQAA 3AS1A 3BEWA 3D3VB 3D69A 5K5YA 5GGSA 1UWFA 2JH2A 1FVEB 2Y7SA 3MLSH 4X6DE 5C7XL 2FUTA 3VACA 4DP7X 2NZ1A 1BZQK 3D2TA 1S72P 4XXDB 3F62A 2Z31B 3QUXD 5D2LB 5IK3A 1BMGA 3B2VH 1Q9WB 2X3CA 2CHDA 4U2ZA 3FB7B 4GW1B 3THML 5INDA 1NGWB 2R15A 5EOCL 3WD5H 5BV7H 2BW5A 3WN5A 2R2HA 4HK0B 2VAJA 3RHWK 2J6EA 1KILD 3UAAA 5DRNA 5EZLA 1BLIA 3S7GA 3FDWA 2XJKA 4A6YB 3TC9A 1QLED 5I19L 1ZMEC 3QEHA 5TE4H 3GMOB 4FI7A 1YA5A 2DIJA 1K04A 4HUMB 1SEBB 1J0JA 3OR7B 1FWXA 2HTLD 4YGVB 3DXAA 2V5TA 4RGOH 1MVFA 1HWHB 5TQ2L 2D3NA 3CK0L 5TF1L 3VWKD 3V8CA 1JCVA 5ICYB 1IIKA 1X5KA 2FNWA 1IRAY 1PSKL 3I02A 1H19A 4DEUA 1OT2A 1XAKA 5F2FA 2BOCA 1QR4A 2Q7YA 2VQTA 2VERA 1WA2X 3BCCG 3KPMB 1E7VA 3FRUA 4FQLH 4QKXB 3VX0A 2M2DA 3MV8B 1EQWA 1LTAC 1ZK5A 3KLKA 5ISZE 1U8IA 4LNRA 3NIGF 1LNUA 2BWQA 5D72H 4XNMA 2BEQD 2XG5A 4DTGH 1QL2A 4KXDA 1UXWA 2RBLA 4W6WB 1JPFB 2X1XR 1T21A 4J3OC 3V8OA 3VTMA 3X1EA 2DIAA 4AV5A 2BVUA 2WT7A 2MOGA 5DK0B 5HHXH 1O0VA 3EG9A 4K7PX 4S1SL 1HHKB 2R23B 4Y4FD 2ZXAA 3KPNB 3LS4H 4D9LH 5BOPA 4JM4L 1VENA 3F7VA 2NSXA 4Y4HC 2F54D 4FI8A 1X6NA 4HCIA 1I4FA 5D1XE 1MH5A 3SKUD 5D7LA 5D7HA 1TO4A 3ZE2E 4EUPB 4QRFA 3C75A 3O6FB 1W8EA 2AK4E 5E5MB 1KGXA 3RTQD 3JBG7 1SY6H 2YD0A 5I6LA 2HTKD 1WFNA 2W88A 4LDEB 1QL1A 4QXTA 2X5PA 4TQHA 1UURA 4IYKA 1BCCJ 2BS71 1GK4A 3CPUA 1YY9C 2YUWA 1MUUA 3ASNB 3V4PA 5JQ6H 5EV7A 1G7HB 4LNVA 4BKSC 3ATEA 1OANA 2Y23A 4AQ1C 4RQQA 5ALCL 1JNNH 3IJSB 4WY7L 4FP8L 1MFMA 4L8BB 3AITA 1T5XA 3QJHB 4WFHD 4PD4J 3DYMA 5A3IC 2EO7A 2IFFL 2BVPA 4H1LH 4DGVL 3VXTA 4HPYL 4GO9A 4HCRA 3QDMA 4ZMLA 2XPGB 2V3FA 4P3CH 1UD2A 1IARB 3LRLA 4UANA 3ASOB 3FCSB 3DKHA 4D6TD 1SQVG 5BU8B 3L16A 1T2QH 4ZMPA 5MEND 3JV5A 3F6IA 4Z7UA 2DM2A 4Z7NE 3Q5RA 3JXAA 1RZ7L 1X7QB 1KFNA 2H3XC 3C60D 3BE1L 3II3A 5C0EB 2DQDH 1GL2D 1FF5A 2H0FA 1LJ2A 1QW8A 3FU8A 4UM9D 5CILH 4KJQD 1USEA 3VYOA 4L4VD 4NBYB 4ZX3A 1CE1L 1XCXA 4U7SA 4ONGL 1DEBA 1EJ6A 1UOWA 3AW5A 1TFHA 1RZFH 4X80L 2BCCG 2H8PA 3I6SA 2A06G 2O5XL 3UYPA 2PR4H 4P0DA 3ULUF 3TIDB 3D0VA 1FCGA 1FBIL 4FX5A 1URZA 2GJ6E 4UT6H 3VJ6A 4H13C 1ZLLA 3BVDB 5FCUL 2B9AA 5HGAB 4X5LA 3HUJF 3QDJB 3T0EA 3TTSA 3FTYA 4QHUB 5IHHA 1BBJB 1WA0X 4YPCA 3GTNA 3LH2H 3MI6A 1NWPA 4JCMA 1HH6B 1KLFA 1TTCA 2FECI 4JRFA 1QSFE 4U1NB 4X98B 1R3IH 3ZJAA 3MRNB 1T66D 4ESKA 3EYVA 3N2JA 4XCNB 3H1LJ 3V0IA 1AQHA 3A4FA 4Q6IC 2N1TC 2PPDA 4P06A 1FNSH 5FDWB 1LP9E 2JMRA 2E5EA 3WIFA 3D2UD 3RZCA 3DTUB 3OTTA 1S7RB 2H32A 3IR9A 2ZG2A 3KXFA 4LEEA 5EFIB 4GG6F 3MJ8A 1IKNA 1DVYA 1OM9A 1QBMH 1X0TA 3HHRB 3FB6A 4F9PC 5JOPD 1IO4C 3B9KD 1P7HL 5C6PB 1Z9LA 3WNPA 2A4ZA 5D2NA 4UMGA 3I9IA 4LLWA 3L4ZA 4TUJA 3VRIB 4BQCA 4ZFFA 5J56B 4LSQH 2ADFH 3AM8A 4MA7L 3EOBB 5C6TH 3ARED 3ARRA 2IV8A 1BDYA 2APWA 3NSFA 3T5WA 3C5JA 4L4TD 5FYJU 4POUB 3MV7A 2E8YA 4PRIE 4OT1L 3KL3A 1F41A 5CWSB 5AWNL 5H8DA 4Y16A 2R0ZL 1KFMA 1DBJL 4Y5VC 5KN5A 3IFPB 2P10A 1L9OA 2WZ5A 1ZGLM 1M90Q 1A7BA 3DX8A 4L2LA 3HNTH 2VRKA 1E5YA 2X87A 4OJYA 1KCUL 4MJHA 2FSEB 4MMXB 4OQTA 3OJDA 1MAMH 2ICWB 1BVLB 2OSXA 3CFQA 3PIQB 4P2RA 3ARFB 2OJZH 1KG0A 4FZEH 4PLJD 4BHUI 3SYPA 2X89D 5DD3H 4X4KA 2V4LA 1TQBC 3LZRA 5IVXA 1NCDL 3NCBB 1HKLH 5I74C 1VAHA 2AQRA 3MLYH 4EN2A 5CLYA 2BIMA 2XV2A 3MUHL 3UC0L 4TNWF 3EOTL 3W0WD 4PTTA 1SJEB 4Z7IA 3A3YB 2QJDA 1AQDB 1GGTA 5IR1B 1F2QA 3LZFH 4O2EB 1V3KA 2FECL 4GUPA 3ILPB 3VM7A 4QR7A 3WFHA 3ZU8A 2VRQA 1KBVA 4XC1L 4YHZH 3VYNA 4Z7VA 3BZFB 4C7RA 3EGSB 3GMLB 3OZLA 5EIIG 4P5KB 3BC9A 5HY9B 3CBRA 5EZPA 4DT2A 3GUTA 4HALA 4YBQD 5LGYA 4K0OA 4B95C 3RIKA 3GMQA 3HI5H 3O4LE 5DC2A 1ZLUK 4LMQI 1UQSA 2XQYK 4HUXA 3O0LA 1QUPA 1R5IB 2ZVOB 2CNYA 1KEML 3GJFK 1RZGA 1FGNL 2H6OA 3PF2A 4EE2A 5SWSA 1KIRB 5JW4Q 1U92B 2Y4SA 4NM4H 1K5NA 2YA0A 3Q8AA 3P02A 3V4LA 1OW7A 5IQ7H 1E4WL 4WFGD 2PW1B 4ORGB 1JMZA 1E4KA 2J73A 3GXMA 3VXRA 2ITAA 2QSCL 3MNVB 5GJTL 1KYDA 4F2MA 5MHSD 3ULUC 3WEMA 2LOEA 2HRPL 4C56B 4M6NH 3NH7H 1HH9A 5SV3A 3HVNA 4NQXA 3PWNA 3WYRA 3QS2A 1N2RA 1BD2B 5EC1B 1IE4A 3FSAA 1NANH 1J1XL 4TULL 3X14B 2IPKB 2OZ4A 3DIFA 2JB5L 4JN2B 1H6TA 4N8CL 3ABVC 4FQ2H 3FT1A 1KB3A 3HN5A 3V5DB 2WZ0A 4BZ1H 1ZLDA 1W2EA 1RL1A 2H0EA 4NFCA 5KS9B 2JQZA 2BFVL 2BXYA 2ENPA 3MJGX 2ERJC 4FZ8H 1XGPB 5B38G 3FB5B 3K2UH 1YYLH 4LU5L 5CKGA 3MAWA 5EA0L 1BWWA 5BRQA 4BH7B 2YR3A 2C4FU 1YSOA 2YK1H 3GMRB 4PJ0H 3QAZB 3SPGA 5T33H 5IHBA 5JLZA 4YSEA 1U8LA 5G5DA 4KPHH 4D0BA 1FJKA 4WY4C 2CKBB 1E6JH 2KL6A 2QVTA 2WO3B 3LNEA 3QJRB 5CJOH 1KCBA 3TASA 1L0QA 3P4NB 1N4XL 4LP4A 4M1CD 4RFNC 1ZHKA 1I85A 3QS3A 4WW1A 5I71C 1T04A 1DQQA 3AQDA 2X4SA 3BOVA 4IRJC 3CFKA 2DWEB 3HNVL 3M0DC 3V0EA 4DKTA 1DYZA 2LABA 2VABA 3B5NC 1DQDL 2RCSH 3CLEL 3IPBA 4PJ8D 5ADPL 2ZKMX 1H3VA 1YN7B 3QORD 2VCOA 1M6OB 4HWEL 3SO3C 3JVGA 4NOFA 1M42A 4G5ZH 5GRVL 3TN0A 3U4KA 5EU5A 4C46A 4OW6A 4X6CB 5DHYA 2IANA 4QHNB 5CNHA 1L3WA 1XF3A 3BRTB 5ESVB 4TVPE 5L8KB 3MBXH 4ZOBA 1U7MA 2VRSA 4A2EA 1RK7A 2SPZA 2N4IA 1FNGA 5E8PB 2A6IA 3NIFE 5HDBF 3JCUH 3BAWA 4M1DL 4IBUA 4L8CB 4J39A 1Z0NA 2O01J 3RWIB 2WLYA 5ID0B 1PD0A 3H9SB 2UXVA 4Y9FA 4L1DA 1P9MC 3WLBA 4QRTA 4RMTA 1WA1X 2OYIC 3RWHA 3QPXL 5CD3B 1CLCA 5I23A 1Q90D 4PS7A 3IJHA 2GTWB 1I8LC 4UQBA 1YY8A 5JR1H 4G8FB 2HFFB 1OCRB 3ULVH 5JXED 4PGDA 3DHMA 2J44A 4C4KO 2NY5H 2ZSWB 1AZZC 4AH2A 3FU9A 4HH2A 3EWKA 5FEBA 2QADD 4QXVA 2LKMA 4I5BA 1CE6B 2RFXA 3TWCL 1FDIA 1F3DH 3GHBL 2CHWA 3LEYL 2J6WA 4HUVB 5JHLL 3LPPA 1OARH 1E67A 2NPSC 1TZIA 2Y1AA 4DVRH 4LESA 1YEIL 3EGDA 1CFTB 4AYMC 1S3JA 4K8RC 2Y6SC 2X4PB 2D3LA 3ZTEA 3L4XA 2GAZA 4N68A 2F18A 2BHUA 5FYKL 1H8AA 5HHPB 1DDHB 2X42A 2IADB 2IBBA 2XYCA 3P3RA 1LT9A 4M6OH 4RKUJ 2V8LA 1QFUH 3RBGA 4A2FA 3F85A 1EZVG