5AVWB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avwB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avwB02
5APXA 2JJLA 3HE5B 2C9LY 3KQGA 3HE4B 4C7NB 4JYCA 4KHXA 3TNUA 4XE5B 1MV8A 2XV5A 4I6MC 5AVWB 2R5DA 3NXSA 3M9BA 1J2JB 4AUWA 5AW8B 3M0DA 1YYCA 5AW2B 2Q7CA 2N9BA 2Q5UA 4GT1A 2R5BA 3V4QA 5AW3B 3O8ZA 2WTYA 2P7JA 2H7HA 1H89A 5AVXB 4RETB 1S9KE 2WPSA 3V4WA 1GK4A 1CI6B 2P2UA 2ZXEB 2YO2A 3VMXA 1GK6A 2C9NY 4JYBA 3UIAA 5APYA 3T97A 3VTPC 5APVA 3TYYA 3A7OA 3VMZA 3HE5A 2WPQA 2XU6A 2Q3IA 3SWFA 3B8EB 1FOSF 2XZRA 4B86A 2BASA 1A02F 3A5TA 3IR9A 4EOTA 5AVTB 1MFZA 2W27A 1GU4A 3LIDA 2WPRA 2W6AA 2VRSA 4HYTB 1H8AA 3WGUB 3HTKA 3KDPB 1GU5A 5AW9B 1HJBA 2QM7A 1MUUA 2WWWA 2WT7B 1DH3A 5AVUB 3OAKA 5AW4B 1H88A 3L35A 2QM8A 1FAVA 1CI6A 1T2KC 2E42A 1FOSE 3L36A 4C46A 3M9HA 2Z5HA 3L37A 1NWQA 5AVSB 5AVQB 3NFQA 3TK1A 3HE4A 4C7NA 1CZQA 4I2LC 5APSA 3VYIA 4LC1A 1JNMA 1KQLA 3WGVB 3A2AA 3MD0A 5AVYB 4GKGA 3M0AA 4M3LA 2YO3A 1OWAA 5AW5B 2KP8A 5APTA 1T2KD 1HBWA 5CMZA 3P32A 2WT7A 1SP4A 3A3YB 3NMDA 4AQRD 1JUNA 3TNUB 2ZFCA 3P8MC 1OXZA 1A02J 3VMYA 1G2CB 2R32A 3V5BA 2P67A 3VN0A 5AW7B 5AW0B 3LIEA 5AVZB 2R3CA 1X8YA 2Z5IA 1IO4A 2YNYA 3M06A 5AVVB 3MGNA 4AYCA 1SLQA 5APQA 3M91A 1GTWA 5AW1B 1HUCA 1GZLA 2E43A 2IPPA 4DZOA 1CSBA 5APWA 3I5CA 4RESB 3NTNA 1HWTC 1GD2E 1NAFA 5AVRB 1S9KD 3P7KA 5AW6B 5APUA
chains in the Genus database with same CATH superfamily
2JE8A 5K9KB 3MKKA 3Q3DA 1NTZE 1N19A 1MWAH 1VGKB 1MRDH 4X7EC 5IMOB 3O3DA 1N0LA 4FG6C 4P2CG 3VXRD 4B7IA 1FC1A 3WHXB 2QVFB 4Q6IC 5BRZA 2A4CA 2EVFA 5EN2A 3BSHA 4TQEH 2JJTA 1EUUA 3L72D 2BSTB 3FTGA 5FO7A 4JN2A 2YOAA 3RGBA 3WTTA 5AOLA 4HSAC 3MXVH 5HJBA 4GKZA 1CD1B 3CFNA 1JGDA 2F8OA 4XCCL 5GGSA 3WFZA 5AVXB 1RIVL 1DQJA 5LGJA 4NP4H 5EBLA 2VQ4A 4Y19E 2V2WB 3G7TA 3NSDA 3CXHE 4JO1H 2L8AA 3INOA 4K71C 3NIDF 3T65A 5MENB 3QJHA 4JRYD 2VDNB 2ZXEB 3K71B 5CKGA 3K7UA 3T09A 4DVBA 1YTZT 3MV7E 3NCYP 2PRRA 2GBVA 1ZD6A 3SJVD 5IFHH 2GAZB 1CXKA 1QFWI 4HUNB 5GQBA 1ZLVK 1G0XA 3NCWA 4QF1A 1S9VB 1OCWH 2BEQD 3IB4A 4M1CD 1PZSA 1GJIA 5F96H 4TPRL 3B9KD 4HYTB 1QEXA 3V0FA 3IVKA 3ZW3A 5J1TC 5BS0E 3KWVA 2KC0A 1MWAB 4AIOA 4Q9QL 1IBZA 1XF4A 4WWPA 4JFDB 2NW3B 1AC6A 1I8KB 4LCYA 4P2RB 1TQBB 1L0ND 3CD4A 4GRWE 4AGQA 4YSCA 4P23D 4AC2A 2XKUA 3S88L 1BM3L 4J8QA 1K8AQ 1VLXA 2J88H 5BNXD 5C71A 3DSNA 5DK2B 1M90Q 1GGBL 1J88A 4JFTA 2NYKA 1G7LB 3OXSA 5HYSB 2ZSWA 4QRTB 1CU4H 1B6DA 1KIPA 2C8NA 4WK4B 1D2OA 4NO0D 4PVMA 4YNYA 3SDDC 4DTGL 1JDAA 1CGSL 3TFKC 4JLRB 2JCCF 2QSQA 4MJ6A 3BIKA 1F18A 2QHRL 3PGCA 4PJXF 2FIKB 3S36L 1LTXA 3TBWB 1J5HA 1UACH 2H8PD 4L4VA 5C7ZA 2X6VA 5EOCJ 2IBZG 1QSFA 1ECYA 1T1YB 4UB6H 1JWUA 1D5IL 2GT9A 4G1EB 2BFVH 1WHPA 5SWQA 1UT2A 2A2QT 4PV8B 1L0LK 4F9LC 3QIWC 4KJMA 4B0MB 3KPEA 1UTDA 5I0YA 1MJ7L 3UZEA 2CHZA 4OM1L 3QUMH 2YMXH 3WCYA 1G1KA 4OV5B 4G6MH 3QH3A 2BCCD 3K5SA 3V2AR 4WBAA 3H0TB 1MHEA 5FUZL 2VDOL 5ACLA 1R0AL 3REWA 3GEFA 4WW1A 3TJHC 4QRAA 5C0BB 3W2DL 1KYFA 3ABVC 3PGFL 1HJCA 2WOBA 5EF0A 5FHAL 2AITA 2Z3FA 2GSGA 4BELD 2F1BA 3L9RA 4I1NB 4O2CA 4RGNB 1QR1B 2PPAA 2WXQA 5GZNA 4Z18A 3JUZA 3HI6H 2E7LA 4JFQB 4W7YA 4AUWA 3PHOA 4O5LL 3CFIC 3D39D 4XP4L 1Q90A 4R90H 4HC1A 3EH4B 4H44B 4TNVK 5SWSA 3U30B 3D85A 4ESKA 4E9YA 3ZKSD 1OK0A 4P59H 1G7MA 4KX8A 5H8DA 5EZIL 1PG7H 5AL0A 4PG2A 3QQ3B 4LCWB 4AJYV 4YAQA 1S8DA 5FKAB 2JXMB 2IBZX 5EO9A 3U0TA 1XF2B 2F18A 4NKIL 5AAWC 4Y5YB 1FNEA 1XIWC 5F1OB 5GS1A 4WWOA 4JPKH 4XTRC 1S9XB 2IWEA 3FQNB 5DD5H 1RERA 2DWXA 4B3VA 1X5FA 5ENWB 4YSTA 3MJ7B 3TO2A 4ZXBD 1RJYA 1PPJE 1Y1UA 3PQYD 4HEPG 2R0KH 2WQRA 3LEXB 4ONGL 2YD6A 2UWEB 4KWUA 5IB2B 1HL5A 2VDNL 3QNFA 4N5UA 4PHXA 2L5GB 4KZDH 3GSNH 2WUCH 1Y47A 1TMCB 3BWAB 3D8MA 4CRPA 3FXIC 1ETZB 4G43A 2HN7A 1NWOA 5ANMB 4AK1A 5C39A 4I0CC 4U1HA 4QRBA 1JPGA 1Z5HA 4O02L 2WT7B 5L4MA 3BIBX 5IB1B 2F5AH 3ZKXC 4HJGA 3HD7A 1GJUA 5K5YA 2WZ6A 3HEIB 3ILPB 5FYKD 3RI5F 3QPQD 3FUDA 4J5VA 4NRYB 3WV0A 3IFNL 2YPLE 2R27A 4PS7A 1FUNA 1K2DB 4I4WB 5CINL 1IFMA 1KLUB 2OTUB 3BKML 1YMMA 4QYAA 5E9AA 4ISVA 5JPNB 2IWKA 1IE4A 3CDCA 5IF0A 1VFBB 2CAKA 3U79A 1GGYA 4KK8D 5A2CA 3DJRA 4U1IA 1L4IA 2EYSB 5ITBH 3BZEB 3C5ZD 3WJMB 2F54E 4DEWA 1HEZB 1C5DA 2EEFA 2OCFD 2BRRH 1N2RB 5EU5A 5C0IA 4QCIA 3FTWA 5GSRB 1MCPL 15C8L 2FEDD 4PW9A 1BAWA 2W38A 1YNTB 2LVEA 3KZIE 2YFOA 1OZHA 3MRPB 3OB0H 1CBJA 2EIBA 1CFSB 4Q0XL 3GSNB 5A2KH 3GDCA 3WDHA 1A7QH 5IKCB 1U8NA 1MFCL 3G9AB 2ATPA 3LKPA 5KBKA 1JM0A 3I02B 5JHMA 4HUXA 4U6XA 2A9AA 4Z95H 3VXSB 5APQA 5AUMB 4PGCB 3G5ZA 4JM2C 2BZDA 2QKIA 3MGAA 3FRPB 4PBDA 2UXFA 3MU3A 4XNUH 4DPCX 5DHYA 4Q9RL 2EVHA 5FYJU 2F7IA 3HJ0A 3AGVA 2NY0D 1JZJA 1DLHB 4Z7QE 3Q9QA 3O3UN 2GUOB 2WINA 2M8RA 4PHZA 4PMFA 3CE1A 4LVNC 4MAUH 1JY2N 4F37F 4J4PA 4GOSA 2H6PB 4H25B 1N59A 4OIIH 3GI9H 2XICA 2G5BA 1S1CX 2EKSB 3PWLA 1EFQA 5HI4D 2MNWA 3CX5H 4ZNCD 1VPOL 3D6ZA 4RETB 1TJIL 1X5JA 5KJRL 1AKJA 2VMCA 2X1QA 3BDXA 3G5YB 4K23L 1JNLL 4YBLB 3EO0A 1NKRA 3NN8B 3CG8A 4N2CA 5I19L 2Y22A 1RZ8A 2JJSA 5HGBB 4PPTA 2XV0A 4XVSL 5AZ2L 4QLRA 4Z1MH 1VGKA 4GBXC 3WN6A 4NNPL 1Q0YL 3BAYA 4IDJH 4MMXC 1FOSF 1T04B 4OKDA 4NO5B 5IMOA 4C57C 4KQ3H 3WHXA 4HK3N 4GRLB 2I25N 3BISA 4PJCA 2EDDA 2GEEA 1SQXD 2BSTA 3BN3B 4B95C 2YLHA 1QSVA 1I53A 2OMTB 5L4FA 4G5ZL 5E51A 1DD3A 3X11B 2VL5A 3DYMA 4WDIB 3HMXL 5GRUL 1IBGL 3U9UB 5MENA 1CFTB 1ULVA 3MJ9L 1CTNA 4HLEA 3MMEA 1IEHA 2A06G 3O11B 1HNGA 1L7IH 5JXEC 2V9RA 3H9SB 4O00A 5AAPA 2C1OB 4G9FA 3FQ4A 3WJJA 3T8XB 1G1OA 3UO1H 2XFXA 4O02A 4ERSL 3SOBH 1BFVH 2WBJA 1R24B 1NDGB 3MACL 3RY4A 5ITFA 5GJTL 1T83A 4Z3JA 3WXWL 3P3SA 4G7YH 4X80L 5AVYB 1DEEB 3L17A 3DI2B 4L0ZA 4BYHA 2CO6B 1EEZB 1TF4A 3VX0A 4GW5A 3HFMH 1TSRA 1XB3A 3F01A 3HS0B 3PV7A 6FABL 4KRMB 3B34A 2K1AA 1DBBL 5BZDA 3DKHA 2Z35A 4M9PA 1I8KA 5FYJE 1RHFA 2FX9L 3EG9B 5FYLD 7TAAA 2NW2B 1CLZL 4JG9A 4Q6IB 1JPEA 4Z77A 4AENA 2ZZUT 2HX8A 3MV7B 3S4RA 1U8QB 3L6FA 3OMIB 3MKGA 4ZW6A 5HYSA 1MY7A 4E9WA 1ZXGA 4QRTA 1KYUA 1E2WA 2XC8A 4K5OA 2FB4H 1HI6A 4K71B 3SSUA 5CCHC 5C0RL 2BIOA 1YY9C 3FF8A 2GIYA 1XD1A 2BSED 3WFHA 3QUYD 2FIKA 2NYYC 1PIGA 2Q6WA 5BS0B 5E8EB 3SKOA 4TV3A 3HE4B 2EO9A 3RJOA 1LTGC 1JVOA 1JIBA 4F3FB 1BE3G 1T1YA 1BWWA 4UDUB 1FIGL 4G1EA 3VP8A 5MERA 3FUMA 4GRWB 5CCHE 4K3EL 1PY4A 5F7YC 4X5RA 4PV8A 1Q94A 4HIHA 5HGAA 5AW3B 2DDQL 1PZUB 2ED6A 3WD5L 4S0SD 2NZ2A 5J6HB 3I9GL 4BV1A 3EH5B 5CO1A 1P7KB 3O3EA 4OCRH 5C0GB 3IDJA 1VACB 3MBWB 4FCHA 3S35H 3P0VH 2Q8AL 1OF0A 4BFGA 1HOEA 3FU0A 3GRGA 3H0TA 1PYWA 2C3WA 4JFPA 2KI7B 4JFUA 4WUKH 1OAZH 2BK8A 4XPBL 1MVUB 1OEZW 2AJUH 1FC2C 5EEWA 2L7JA 5FLUA 4BRJA 1FAKT 3C6EA 3QSKB 3ET9F 3JWNH 3D4YA 1W0WB 1QR1A 1UD6A 5D7SL 2O5NA 1QVGO 4JFQA 1NGXB 2K3HA 4DUVA 3O0RH 3MUY1 2XJKA 3SGDI 4ADIA 4DP0X 1MFBH 1UXWB 3SYOA 4K73A 3IMBA 3IKKA 5DMIL 4ZS7H 2CM6A 2EH7L 5IBTH 3VQMA 4HOZA 1I3GL 3KJ4B 4GUOA 4LEBA 2YSTA 4GSQA 1CXEA 1WUZA 2FLBT 3QQ3A 4JO3H 4LCWA 1BJ1J 1DFBL 5FKAA 2JXMA 4PJDE 2ZXWB 4EEEA 4Y5YA 1UWGH 3QIWB 1S9XA 4PRPE 3PPEA 1N6UA 4IBVA 2YZ8A 4NPYA 3T3ME 1RUQL 2BIQA 1XD0A 2IBZD 1G0DA 3DDGA 5ENWA 4AG4L 3AWEA 3MJ7A 3HMXA 2WZ7A 1A6UL 2VLJB 3LEXA 4K3GA 5IB2A 2UWEA 1IBDA 4Q74A 3MJ9A 3T2NH 2J6EL 3KPMA 3IFMA 1CYGA 3BWAA 4AKQA 4LHQB 2O01H 2VLRD 4G8EB 3DROB 2WT7A 3WFEL 5IB1A 2QRXA 3IPEA 4TNVF 3ARBC 1IBBA 4LGDE 1JUNA 4Z76B 2EDYA 1NDMB 3ILPA 1AMYA 1CF8H 2JDIH 2CBTA 5T3XH 2P67A 4MA7L 1WA0X 5D1XC 3MRFB 1K2DA 3N04A 4I4WA 1KLUA 5JPNA 3AE2C 1KB9J 3T08A 1NCDH 3S4SG 2YIUC 4I3SH 4LCCC 4AYDC 1VFBA 4NQDE 4BWTA 4YLBA 1IVLA 3WNJA 2IC2A 1Y6MR 4HIXL 3SGJA 1EERB 3K1DA 3BZEA 3WJMA 1URQA 4GLRI 5F3HB 4KO6A 1N2RA 3JYCA 1WDAA 2BO0A 1CDYA 5GSRA 4IKLA 5HJDA 3B5HA 2YXMA 1CFVH 2D9CA 3TEZA 4K7PL 1YNTA 4M02A 8PAZA 3ZQ9A 1TO5A 2MKWA 2DWYA 3OAUL 3MRPA 4GSDH 3S37H 2PP6A 1FWXA 1CFSA 3NT0A 3BD5A 2AJYH 5FW6A 1A22B 2I60L 3ZIMA 1A02N 3OKKA 1SLVA 4WSGA 4ZZFA 1J12A 4UNTA 1JPST 1EHKB 3S3CB 2Q5UA 3S9OA 3CSTA 4ZYKA 3S5LB 3I02A 1ECZA 2YPLB 2DYPB 1BQLL 2F7PA 2X1XR 5M95B 2KUBA 2K9UA 3QULB 4WIQA 3VXSA 2DM7A 4MS8C 2BNRD 5BOJA 3ZKXB 4DP2X 1G1IA 9PCYA 4NYLA 1HL8A 2VZ1A 2DI7A 2H4EA 4IOFD 3UTSD 2VDKB 2L3BA 1DLHA 2W07B 1AE6L 1FCGA 5C2BH 2AABL 2H2SD 1I7UB 3K2IA 1GVIA 4M3JA 1T7XA 3QCVH 5DUJA 4Z7WA 3FPXA 2UX6A 4ZK8A 1WZ1H 2PKDA 4WFHE 2ZTBA 2BOCB 4AEIL 5F1KC 2EKSA 2VXSL 2MCAA 1CN4A 2DL2A 4LIQE 1RP8A 3GWJA 4ZJ9A 3RWIB 3SY6A 5F7UA 2HYNA 4HLZH 4OTXH 4W9FC 2WTRA 2DKUA 5IMLA 3O2DH 3H1IE 4HEME 3G5YA 3PLNA 3N40P 5L4JA 1MFMA 2J3SA 5DRXB 4LAQH 4B9YA 3OLDA 1AANA 5GGTL 3RVWC 5HGBA 4JG1H 1KYOH 2BY3A 2GABA 4N24A 3PWUA 2Y9YA 4QRSA 4Z7QB 1T04A 2E74C 3L1GA 3MUZ1 2ATKB 1X5AA 1KY7A 1LE9B 2NNRA 4HU8A 4JM2B 5TGBA 4N2FA 1ES0B 2E9GA 1OTUC 3VSQA 3OJAB 5LG6A 4M4RA 1OWAA 2WY3B 3P3UA 2V33A 2OMTA 4JPVH 4NOBA 4Z7VE 3L7FA 4DT0A 2X3CA 2Y07L 1TZIB 2XRAH 3FTXA 1ZMEC 2VM9A 3WIFB 4I9XA 3X11A 4MCNA 4WDIA 3NMDA 2AQTA 4MJHA 5HYJE 2YEVB 4LVNB 2XWJB 3CXFA 2APVA 3BEWB 3TM6A 4EZLA 2J6EA 1NM4A 5F3FA 4M5ZH 3H9SA 2C1OA 2IGFL 2W0LA 2G3AA 1CLOL 6PAZA 3D08A 4XX1G 3OC5A 4TN9A 3GEWB 2EO1A 4RMUA 2NY7L 2J8UF 4FQQB 4JFHD 3WELA 1R24A 5J57B 1NDGA 5IQ9B 4KRNA 1H6TA 1QSZA 4LARH 4HS3B 4KJQD 4PRBA 3X3GL 1DEEA 1MFDH 3Q7JA 3AQYA 3D05A 4MAZA 2CO6A 1D5MA 1EEZA 3MRGB 1MAKA 1TLMA 1F5WA 1RK1B 1V3MA 3HS0A 3E8UL 4U0QB 4Z7OF 3GO1L 4GBXB 2ZF9A 4M6AA 2WN2A 2Z7ZA 5GS3A 3EG9A 4MMXB 5EZOL 2NW2A 1HZHL 2PPCA 2NZ9D 2R9HC 4UQ2A 4H8WL 4Y19A 1ZCRA 3VTMA 3L70E 2LXBA 4A6YH 2ZUSA 4FXGC 2I5YL 3EIFA 5IQLA 2D3NA 2WXHA 2A9NL 3HC2A 3MV7A 4L1LA 3V0AC 5DTFA 1BGYE 2FWUA 1KXHA 5CN2A 1CIUA 4OLZL 4G1MB 1V8HA 1WSST 1M9WA 3P9LB 3MGTB 3PL6C 4JE4B 3U2JA 1AO7D 1G9ML 3CSYA 3WEMA 4KJWD 3LSOB 5CU9A 1N6QH 1FG2B 4BD4A 3QJQB 4Q2ZB 3VMPA 2P26A 1A6AA 1NTKE 1F4WH 5E8EA 2OTLP 4YHLL 2VH5L 3PUUA 5E0QA 1CL7L 4F3FA 2A3TA 3NSFA 4NM4H 5I5IA 3APFA 5IBUG 3T0AA 3X14B 2N7SA 4FQXA 1PGOA 1YN6B 2GBAA 3FO1B 4P2OA 2A06D 4URTB 5FCSH 1NM9A 5DT1H 3D69B 5AQ0A 3PIQB 2DQHH 4C56E 3O4LD 1U92B 1CFNA 3QZNA 3Q8BA 3DOSA 4K9EC 4AH2B 2ZF8A 5CHNB 4P3DB 1RHZB 4QRPE 1TVHA 4NHCL 5J6HA 3BUPA 4HFUH 3TH4T 5AW4B 3MBWA 3EJYD 2MWCA 2J59M 1DJZA 1EO7A 1UCBH 1SJEB 5CP7B 1EXIA 2J8HA 2Z8WC 4NZUH 1XXFC 1XSJA 4PJGE 2Y5EA 3HNTL 3BKJH 5L0QC 1DBMH 2R0WL 4JZOB 3QFJD 4Y5XB 3U0WL 5SX5K 3SE8H 1FZMB 5AENA 4EIUA 4GG6E 3JTBA 3RWCA 1NU1G 4JFED 3ZHLA 1WS8A 2RN0A 2QFPA 1NGXA 2R23A 2COQA 4XBEL 4K5MA 5F7HA 3LQAC 1ZT4B 3B9VA 3GF8A 4ZW3A 3HAEG 3L73J 1H3UA 5CCGD 2WB7A 5GGTA 4C55A 3G6AB 5DWUL 2VAAA 3KHOA 1FFNB 4FA8A 1O7SA 5K59E 4YVUA 4S1QH 3FXDA 3ZE2E 4V1DE 3P4MB 3FB7B 3QFDA 4K5LA 1DSFL 1QPPA 1ZVSB 3QYNA 4GYBA 5DJ2B 2GUVA 1I8UA 2E6PA 3FU9A 4F9LA 1AD0B 2DTMH 3H9YA 4NZTL 2O61B 1BWMA 2QQQA 5CFAA 1BEXA 3ETBF 1BE3D 1THAA 4ZQKB 2VDPL 4BUGA 3GXNA 5FECB 2HP4A 3CWBD 4M93C 4XNMB 3L5JA 5JHLL 4HUKB 3QFGA 1S7SB 4JFFE 3MRNA 4YHPB 3FCTA 1FORH 3L3OA 5DDHB 3H6JA 2VN6A 4OF7A 4GXUN 3QG7H 4DKEL 2AHIA 4XXCC 3ZSTA 1U0QA 1NDMA 3ZZSA 1OARL 2DS4A 2EE2A 3PWPD 3RWFB 2Y24A 4UNVA 4N6JA 2N9YB 5C0DB 4HKZA 2NT1A 1KT2B 1AD9B 2Z7YA 4OGQD 3POCA 5HPMB 1CF1A 1OAXH 1JZ8A 1MFAL 3SGEI 5JLZB 4PRPB 4GDOA 3CFMA 3VRLF 5CIPB 3T3MB 4ZW5A 4HD5A 2R39A 1MCKA 2P49B 3RKDC 2IAND 1ASOA 4R26H 4L9LC 1SJMA 4KI1A 3MRCB 5F3HA 2YPVH 4ZMTA 5AAWA 1UGKA 2QL1A 4EN2A 1Q0XL 2H89C 3LKQB 4GKNA 3CMAP 3V0VA 3VYPA 3V9CA 2YKPA 3DIFB 1LEKB 2Q6QA 2HG0A 3SPIA 4RFEB 1DVSA 3AE4C 3AG4B 2HKFL 3PP4L 4YHIA 2GBUA 1WO2A 2G75B 1CXFA 3RL0C 1T5WB 1P5UA 3I6GA 3BGAA 4AJWA 4JZJA 4PRAA 3GKWH 4Z0BL 4GXVH 1X6LA 4FQ2L 2V3DA 2GTWB 3NIDE 1XGRB 2E7MA 1YEIL 3ZKNC 1T89C 1ETB1 2A9BA 2DYPA 2R7EB 2YPLA 3BLPX 1FNHA 4OZGE 4XP6H 3RWJA 3ZPDA 5HHME 4KC3B 2FX7H 1IBYA 5FYJL 1S7WB 4XFJA 4PLNC 1LGVA 4YXWH 4MA8L 3QUXD 4YK4C 3HB3D 3W38A 2L7EA 4RFOH 2F54A 4E41B 4XPFH 4YGVB 3GUTB 1WD9A 3AQZA 5D1XB 2NNAB 4RGMC 1SQPK 4N2BA 2YIUB 4LCCB 4UOW0 1MCLA 5DC2A 4KDVA 3R1GH 4XPAH 4LGSB 3WFDL 3S8GB 3OKDB 2W9DL 3A67H 3M1OA 5CMAA 3LRSB 3L48A 3CFJB 3TGUG 5GS0D 1P1ZA 1KBKA 1RURH 1UM4H 4PH8A 4BQ8A 4MXWH 1EJ6A 4R4BA 5GGVH 1BA9A 2WPVB 1HAWA 3FK3A 5E5RB 4ODWA 4L18A 3LS5H 5B8CC 3QJOA 3O6FC 1SXSA 4U05A 2F1EA 4WK0B 5IY5B 3EJCA 3QXVA 5C09A 3ARRA 1IEAB 2Z8VC 4M43L 1D5BB 1KPUB 4Z78A 3VFUA 2VZSA 1C7TA 2JCCE 4YUEL 1JY2P 5GGSY 2PPEA 4MSWB 4PJXE 3D48R 3WY4A 3VXOB 4DO5A 4APXA 5L6YH 5CGTA 3NJLA 4OD3H 3T0DA 3CXHI 1ES0A 4WHYG 1GD2E 1JZFA 2O6EA 5EOQL 4CKQA 1G9EA 1B0RB 3D51A 3VXRE 4H5SB 4P2QD 5EIQA 1TZIA 1G9HA 3WIFA 5JW4R 4DNLA 4TVPE 3KQGA 3MNZB 2YKOA 3FWLA 1BXUA 2XWJA 3KBHE 5EIIB 1GIGL 4N5ED 1UJ3C 1WEJH 5JHLA 2FZ3B 1NTMG 3D70A 4IKJA 1YDPB 3MJGX 4JKNA 1NIAA 4OT1H 4ANKA 4YSSA 4FQQA 2FVNA 4M1CC 4AQAB 1AGEB 4UU9B 1MJ8H 3K8MA 1GA2A 2EDNA 3B9KC 4NNXB 3FUEA 3VRIA 4J27A 3SJVE 1WWWX 3MCLH 1HWHB 1VESA 3Q2YA 4PJAF 5IEHB 3MRGA 3PYCA 5I1HH 1RK1A 4RJTA 5B66E 1PU0A 5GTHE 1L7TH 2OMUB 4P23C 4Z7VB 3RNQB 3CVIH 5AYTA 3LRKA 4J3OD 4XNAA 1NCJA 3FB8A 5HYJB 4MMXA 1HZKA 2FATH 3CZNA 2B1HH 3SWYA 2E74B 3OA7A 1MQ8A 3L3IA 5A7BA 1WA1X 1RPQA 3ETSA 4OI8A 3DETD 2B3IA 1KIQB 4DKFH 1IGCH 3VWJA 1J9SA 1IAIH 4YFLF 3DHUA 3SPVB 3STZB 5JUEH 3F89A 3SDXF 4QJ4B 5I1CL 2Q86B 3VGBA 1ZTXE 4JG0H 4NT6A 4ANUA 3LSOA 1RZ7L 4OB5H 4C83B 5I16A 2GCYB 4Y4FD 3H25A 1Q82Q 3LKOB 4Q2ZA 3S8WA 5D1ZD 2C1PB 2EEXA 5CKAA 3MODL 2VZ3A 2NR6A 1BZEA 2OMWA 4TNWK 4H0LD 3FMGL 2NT0A 1MDTA 4IMLB 1KFGA 2I9LA 4AUYA 1CDCA 1R1CA 2Z65C 5CSZB 1OP5K 3PIQA 4L8CB 3BW9B 1DQDH 3FN0L 1EHNA 3NVQA 5FHBH 1U92A 2APSA 2B3RA 3A6OA 3HR5B 3BT2H 1S5HB 4AH2A 3N3EA 4LB8A 4G11A 2HRPL 2X28A 4P3DA 1C9SA 4YEEA 4XR8C 3LN5B 1E6JL 3TVMD 1VFUA 1SJEA 3B9DA 4PCTA 1RZKC 4ZUSB 3RB5A 4YXKL 4FXGB 1RH5B 2Z4EA 3ZL2A 2WLNA 1WICA 4IU2B 5FOBA 5J11C 4BGLA 4JZOA 4Y5XA 2JKJA 2QQNL 3T4AB 4UZUA 1U8JA 2BXYA 3W81A 4AC4A 1PG7W 1NU1J 1W80A 4NSKB 4QRQB 4QAWA 4BH8B 4DZOA 4LCUB 4HV8A 2UZXB 3CAFA 4LEOA 3KGUA 3PL6B 2V9QA 3OV6A 3UG3A 1NMBL 4OH8B 5CCHA 4KUZH 4PVNA 1LYQA 5MHSE 5L8JB 3LQAH 4KGJA 3G6AA 1FFNA 1CZ8L 1WUNT 1QYGH 4FJYA 4LLMB 2IPUG 3P4MA 4J3OF 3MTUE 1ZVSA 2IPKB 3NXSA 4QPEA 2XDHA 2X4RB 5DJ2A 1OP5H 1NMAL 1TDQA 5H37G 3QZOA 4PD4D 4LESA 4F2MA 4PJGB 4ZXBC 1AD0A 3VGGA 3IM1A 5K9QG 3AMLA 4XMPL 3ESNA 4LIQL 4XPHL 4KOBA 4PS4H 1F97A 1UC6A 1AR1D 3LX9A 2X4OB 1GY1A 3DHMA 4XVUD 4H13B 4ZQKA 3EYSH 1JZ2A 2AJVL 5FECA 2XV2A 4RZCA 4GG6B 3T71A 4XNMA 4QYOA 1A1MB 1K04A 1IFGA 4ZMLA 4M7LL 5CEZD 3T0ED 2IWFA 1NFIB 2VDMB 4IJTA 4YHPA 2IVFC 1BZ9B 2CUMA 2ZYGA 1T4KB 1UFUA 2AJXL 5L0QB 4OCSH 2IOOA 3UYRL 3N50A 3CWGA 2DQCH 2E7HA 1CL7I 3RWFA 3ZE2B 4UTAL 1KT2A 4O51B 4PJDA 1KV3A 5DZOA 3WHE1 2G5RA 3LN4A 3SDAA 5HPMA 4U6VH 1IM3B 1FGVL 3BUBA 4KK8C 5JQ6L 4XRCB 3VD2A 2F19L 4PRPA 2CIIA 3MBED 4N8CH 4OLVH 1TU3F 3C5ZC 5CIPA 2DMCA 4HKBA 5SX4H 3HZYA 3L3KB 1AI1H 4BDVB 4KQ0A 2R1YA 1NU1D 1WWCA 3EO1B 3GLEA 1NGQH 4C7RA 3MVSA 3QNXB 3TPUA 2FEDC 1FOSE 3MRCA 2KLUA 4UQAA 1KDIA 4XWOD 5KJ4A 1JY3N 3WDJA 6CGTA 1OB1B 3MV8B 3HIZA 4WZ9A 5EZLB 1XCQB 4JAMA 1WLHA 4I88A 1LEKA 4JKLA 1OP4A 1EFXA 1IFNA 5J8OA 1GGTA 5AUMA 2V7NB 3IJ9A 2G75A 3RVVD 1T5WA 5MP6L 1AJ7H 4WO0A 1G6RB 5I6MA 2YPKB 2GTWA 1XGRA 1N9PA 5BZWB 2R7EA 4WUUD 4L4TD 3IN6A 1YNLH 3EWKA 5F9OH 3ZN6A 2R3SA 1G9NC 4NQDA 1F00I 1T6WA 2VDRH 4ZFOB 3ESUF 3QXUA 1T3FB 3A22A 1MF2L 1CE6A 1DN0B 1WTLA 3VGHA 2CK3H 4JVWA 4XP1L 4YGVA 4MJ5B 4NWUL 2NNAA 3AJ7A 3LNGA 3JZ7A 4TULH 5GISL 5JO5B 3VTTA 2YGNA 3AVEA 3C8KB 2ITDB 1LO0H 3LKNB 3IFPB 4RRPA 2XPYA 3MV9D 3AY2A 4JG5A 1RCYA 3OZ9L 2VRKA 4LFHD 4XVTL 2JQAA 3C8VA 4OWFA 3OGCB 2BSRB 1FE8H 2VMEA 1TQUA 2XKNA 3OKDA 3TGUJ 2ZJSH 3ARVA 3LRSA 4L9LB 3FUKA 4UILH 3BO8B 3RYMA 5AW6B 2R2BA 3NIDB 3UBGA 2V7HB 4U1SB 2KZJA 2Q2LA 4OZGB 1FGNH 4KUCF 3FO0H 5HHMB 2R1WB 3ARXA 3U6XA 2XZCH 3FHAA 4FL4C 3ILDA 5AD0B 3RL0B 2KYIA 5K93A 4D2NA 3MUDA 1D5BA 1KPUA 4XMUA 1F1GA 4LSPL 1FZKB 1MRFL 3HTKB 2LABA 1UUSA 4XZUB 3TA3D 1QLEB 2DYRB 3QEGL 4ZMPA 4MSWA 3A6BL 1A6VL 1T0PB 4CUCA 3SFDC 1BFSA 1NCOA 1QPXA 5B5EE 1NBVL 4GODA 4JKKA 4YK4B 1YN7B 2DKMA 4N0CD 1QWHA 2DM3A 5B38B 3JCUE 1M53A 1KTJA 1OTSC 1NBCA 3FTZA 3TDKA 3VP9A 2XX0A 3JTSA 3P02A 4AKPA 1QRNE 3MNZA 4RGMB 4GUCA 4Y89A 3NCMA 3R4RA 2E5YA 3MLUL 3QIBA 4HEMA 5EORL 1PCSA 4FZ8L 4S0TD 4X9YA 4XOCA 5EOTA 4WCYL 2FZ3A 2VDML 1YDPA 1MNUH 1YZZA 3WU2H 25C8L 2NUTA 4X6FB 1TVBB 2JCCB 4UU9A 1TFPA 4MA3B 4NNXA 1JCDA 3KL0A 4PJXB 4ZFGH 1U9KA 4QRRA 2D03H 1P4IH 4UTAA 3TGUD 3RX7A 2XWTA 1G7JA 3IAPA 5IEHA 2DWEB 2CQVA 2D7OA 1S5LH 1YPZF 4Y9EA 5INDB 3VXRB 1S78D 2OMUA 1IM9A 3MTRA 2KB7P 4PRDB 3RNQA 3ZZ1A 3CMOH 1YLBB 1L0LE 3OKNB 3V7AG 5HYJA 2BVEA 2PN5A 5A3ID 5KYWB 4RGOL 3GJEB 5CHXA 2OBGA 3NK4A 1L5GA 4FD0A 5FUCC 5I5MA 2VISB 2WJ5A 1QEWB 4HSCX 3OKOA 1PEWA 5GIRA 3H54A 3NTCH 3STZA 4NGHH 3SPVA 5EV7A 4KROC 4DKAA 2HUEA 2GW5A 2W0FA 2PXYA 2Q86A 4JDTH 4OCMC 1G6RL 1ACXA 1F4YH 4NPKA 5FUCE 3WJLC 2N0MA 3QUYC 1VQ5P 4RWYL 1Z5YD 2GJ6A 4UYPA 4K5NA 3FSAA 2GCYA 4I5BB 1UJ3B 3MCG1 2YK1L 1USDA 3SJVB 2QQKH 4CVUA 1MQKL 2C1PA 3TIEB 4DJMA 5EWIL 3UTPE 1FNLA 5CCJA 1TVDA 5IT2L 4BFBD 3PDOB 4IMLA 4HJIA 3IETB 2Q8BL 2BCKB 3A6CL 3F7KA 4ZFOL 1UHVA 1SM3H 2FE0A 3B9KB 5CSZA 1G4RA 3CLWA 4M48H 2EIZB 1NTMD 1KENH 2B9BA 2NCMA 5KANI 4AGMA 1PL5A 5CM1A 1RQUA 4PG9B 2M5AB 1S5HA 3BZDA 3U4EB 4AL8H 3MRRA 4OLUL 4Y88A 2LGNA 2X41A 4JO8A 2OMXB 2C9LY 4P23B 4EUPH 4KT0J 2PUQT 3Q5OA 5FCUH 3OJDB 3AREB 1EAQA 4LCIL 1F2XK 4PVLA 3KDMB 2LR4A 4JBSA 4ZUSA 1OPGL 2B2XH 4GT1A 1UENA 4IU2A 3Q5YA 1HL9A 2YXWA 1AS8A 2OI9C 3O8ZA 3T4AA 3V52H 3HZVB 4MZ3A 4JVPA 4ENED 4NO0B 3APCA 1OW8A 4RMTA 1YQ2A 4NSKA 2K0RA 4TNWF 4LCUA 1BDCA 2UZXA 3PL6A 4KQ4L 3BPOC 3U7YH 4CJ1A 2OTWB 5EEUA 2WLMA 5I8KH 2H8PB 1LWUA 4C56A 1ID5I 3O0LA 1DYZA 1A0QH 4F5CA 3GM0A 4XODA 3LMJL 1Z9SA 4E9RA 5PAZA 1JPSL 4UANA 4V11A 1E42A 2YD7A 4QRPA 3SQRA 3VXTB 1JEKA 1TO4A 4X2UA 1ML0A 3WL9B 1KXTA 2CHXA 1JP5A 1M42A 3QWNA 4F33B 4YS4A 1IGTB 3MYJB 4M7KL 2XIIA 1B3JA 3FTUA 1L9QA 1KNOA 2GB2A 4I9WD 3TP4A 4N2OA 5DD3H 1KJMA 2D0GA 2XA8H 1E9OB 5EOCH 5HJGA 2DM2A 4FYSA 2WXGA 3RY5A 2QA4P 3V8OA 1A66A 4GG6A 3B6SA 1A1MA 1KLFB 1UD8A 1YQVL 3OQ3B 1SY6H 4IHOB 2Z5HA 3HN5A 3PRZA 2B4CH 3NEOA 1OM3H 3ZZQA 1J0YA 1BZ9A 1T4KA 3H7LA 3SQBB 5J11B 3BZFB 4N2KA 4I2LC 3UYPB 3KH4A 2YD5A 3QEQA 5FYKH 3BQUD 5I17B 5IESL 3EJJX 3RE0A 3D39B 4V1DA 3VA6A 3H1LG 2EVGA 4O51A 5FGRA 3N2JA 4FFVD 4YSOA 2XXMB 2Z92B 3ALPA 4M61A 3VFVB 2XX1A 3QAZC 4KK6D 3O9WD 2PLTA 1UXMA 2V6HA 4LMQE 4DCKA 4GINA 3TCLB 4BRYB 4TVPL 5I1IH 1RD6A 2OMVA 5IVXF 3ZDWA 3TNUB 1NFKA 3HE7D 3GK8L 1A14L 2XQYG 5L88L 1LP9B 4OD2B 3ZYIA 1ZEAH 1COBA 1HHHB 4J3SA 1A6PA 3FS9A 3IDXH 1OB1A 4JDEA 4JFFA 1MCCA 4ZXBB 2LU7A 5BO0D 1ZGLP 2I27N 1DJIA 4N2IA 2OK0H 1ZPUA 5ISZD 1ZPLA 1TJMA 1NCAL 5D8JH 5CN1A 1X5GA 1G6RA 2KS1B 2H32H 3DRTA 1FG9C 2W80C 2ITEA 2KMWA 2CHWA 4RISL 1PGPA 4LVEA 5J6SA 2JI1A 5BW7C 1DUYA 5BZWA 9CGTA 4L8BB 1WD8A 2Y23A 3EDDA 1CE1H 3G5VA 1RK7A 2AZAA 2HPCB 2QR0B 3O2WL 1G6VK 1OAUH 2XZAL 4XXCA 4ZFOA 3GZQA 1T3FA 2J8UE 1N7MH 4A7PA 1DN0A 4PAZA 3NJMA 5GZOA 5IMKB 3JT2A 2K78A 2RFXB 4MJ5A 3QCUH 3EBHA 3MYZA 3L3HA 1OVVA 2Y2TA 3C8KA 3FOLA 1BBJB 1BQHG 3LKNA 4LOUD 3EYVB 3MNVB 3N1PC 3UTSE 2ZUUA 4LHUA 4Z7OE 2BSRA 1C1EH 4Z7UF 3O3BB 1Q72L 1V3JA 4L9LA 2ZX8A 1OQOA 2XU9A 3LXUX 4DESA 4ETQA 4X99B 5JQHC 3KPLB 3V8CA 3UC0H 4HUCA 4JS7A 4U1SA 1CDBA 4B60A 1FZAA 2EE9A 2R1WA 4XHJD 4RMQA 3DMMD 2H32B 5AD0A 1WFIA 3A5TA 2APFA 1FE6A 2FGWL 4GJTB 3MQIA 3B2XA 3SKJL 4FP8H 1Z3GL 1RZJC 1UWXH 3WFBL 3CDGA 3HTKA 1KCSH 3UABA 2B59B 3IPBA 3WEXA 4XZUA 2IDFA 1D5XB 2O3JA 1AGFB 1X5ZA 2BZCA 3GMAA 1FF5A 2FYYB 4AOFA 4EYYQ 4QHLB 1TJGH 2RHEA 3QUZD 3KW8A 1YN7A 2VTFA 3TN0A 4GP8B 2I85A 4JFXB 3RX9A 1Y1DA 3CHSA 1FL5B 1MIML 2EE6A 1C5BL 2POHA 3BAXA 3RQ3A 4OCNC 5C97A 5MEPA 4R6UA 1TENA 2ZCLH 3SFEC 3CCUP 1RZKL 2AGJH 3LZFH 4PI2A 3BVWA 4OZ4B 3TZVA 4X9BA 3OAYK 4GRMB 3CFBA 4AQ8C 4X6FA 3RPIB 1JJUA 1Q8MA 1TVBA 3SPHA 5IJCC 5K9OB 1I1YB 1QGKB 3VFGH 3VQ1C 4PJXA 4GMSH 4XC3L 3T0WA 3V5KA 2ZWKA 4DO6A 1NBZB 4GP4B 1ADWA 4FL4B 3DVIA 1U33A 5F72S 2RALA 4ZUTB 1DO6A 2HT2D 3VXRA 4DGYH 3N4XA 1YEEH 2NZ9C 4PRDA 2K3RA 4KO7A 5FYLH 4ES9A 3C5JB 1K9MQ 1QRNB 4K7PY 3AS0A 4WTWA 2EO7A 4FQCH 4PJ8D 1GTFA 2VISA 1QEWA 4YPCA 1F11B 3JWOC 2UZIL 1N5YL 5FDWB 1VQ7P 1GL4B 1M8OB 5F97E 1XSIA 4X7SL 1CXIA 4MB1A 3CSFA 4KJWC 5I26A 3A24A 3MLVL 2ZOUA 5KJ7E 1J7VR 4KKBD 1PY9A 1E4KC 3RDTD 5A2BA 1HQRA 4WI2A 2IGLA 1UJ3A 4I5BA 4L1SA 4UWQB 2Y2YA 3G5XB 3PLYA 4GAGL 1PS3A 2VB5A 3TIEA 5MEOA 3ABZA 1KTLB 4KH9A 2YD8A 2CLZA 4A66A 4WENB 3B2VL 5EBGA 3PDOA 3HI5L 2E0PA 2BCKA 4FMVA 4HJEA 4OCWH 4Z8FH 1INQB 3B9KA 4K2UL 5I8CA 3HBPA 4XCNA 3WO3B 1DQML 5JOEA 1ZLUK 2WAHA 1F45A 4NP4L 4LEEA 3OXRB 4YR6A 2M5AA 2FEEL 3EJYC 3U4EA 4ZTEA 2AMUA 4X6CF 5FXCH 1GYUA 3PFUA 5CBEB 2OMXA 4HJSA 5JXAH 1H6FA 1I1FB 2M26A 3C6LC 3O4LE 4JDZB 5KBNC 3OJDA 3AREA 5EFIA 2X6UA 3TBYA 2HXAA 2K1MA 3VRLE 4LPUA 3WE6B 2WQYC 1P5VB 3TYGL 5I6OA 2Z64C 3CH1B 4DK6A 2WYZA 3C60D 3EH2A 3I2CH 3HZVA 1AZNA 5C0CE 4KROB 1S7RB 1X5XA 5KYYA 2CA4A 5TH2B 3H56A 1U30A 5DJ8A 4FNUA 5CCGC 1IFRA 4W4OA 3TT3L 4O9BA 1J1XL 3QUYB 2ORBH 2PP7A 2WMMA 4FNRA 1UH4A 1QAWA 3ILEA 1ZLWK 2JB6A 3V4VH 2OX5A 1ZIBA 4AYBA 1L9NA 1SPDA 2RBLA 4ODTL 5CJOH 3Q9PA 1BJMA 1KGWA 3TOPA 3C12A 4HDIB 3K8LA 4LLQB 1IQWL 5KAIE 3LB6D 4ZMNA 5KVDH 3D4GA 3EGSA 4F33A 4UT7H 3L71E 1J0ZA 1IGTA 3MYJA 4LLAA 1ZLUH 5LAXB 5CR1A 5IQMA 2FWSA 3VQLA 5KAQG 3BE1H 1NPJA 4P5TA 2NY6B 3DX8A 5BV7C 1DQTA 1JG9A 5CBAB 1E9OA 1SBSL 3IFLH 3G6DL 1XGTB 2WQSA 3HUJF 1F4AA 4P05A 2CO4A 4HHAB 1V7MH 3ES6A 3MLWH 1J0KA 1HHKB 4ZO6A 3TEYA 2BJML 1KLFA 3V5BA 3DJ9A 3GBNL 4AYEC 3KEHA 1XX9C 1HEJC 5A2FA 4XOAA 1M7DB 1F2QA 2VR8A 2RMZA 3CWBE 3BZFA 3SQBA 2HT4D 4AGPA 1G7HA 3E1RA 2OI9B 4R0LB 2WVVB 1KJ2H 3UYPA 1JPTL 4P5MA 5E1AB 5L8LB 5I17A 4WNQB 2HVJB 2XLLA 3I5CA 4P5KA 1FZBA 2F5BL 3BPOB 4FXKC 4WI9A 2QEXP 2Z92A 5I6NA 3O4OC 1X79B 3BUDA 1EQWA 4TM9A 3SKNA 3TCLA 5DUBA 2WZPD 5SX4I 4BRYA 1PJWA 4NQQA 3TNUA 4LLWB 2YKKA 4QNPF 1LQBC 4FYRA 1KZYA 1HHHA 4KHXH 5F2FA 1J5OL 4IFFA 1UFGA 3KBEA 4OR1A 4F27A 1KB9K 4APQD 3B3IB 1NJ9B 3LOWA 4JMXA 3MLZH 3BFQG 1A2YA 4L1BA 5DRNB 1U3YA 2WUBH 3K6DA 5I8EA 1KTCA 3KMDA 1Q9KB 1R33A 4TMPA 3VG0L 1BJ1H 3L2NA 4OQTL 1PFIA 2OW6A 5CZVH 3BH9A 2VL4A 5DZLA 1F3DH 5DJ0B 3RGVA 2N0KA 3UCRA 3CUPB 4W68A 2CBPA 4GXUM 3LH8A 1ZGLM 3B5ND 3CHOA 3QUXC 2V8LA 1ZDSA 2QR0A 5IHZB 1XGPB 1JY3P 4FFTA 2O01N 4UDTA 5FOJA 3DRQB 4L8SC 3I3DA 3KR3L 5IMKA 1NL0L 5TF1L 2NSMA 5LB1A 2F1AA 2C0XA 1RIHL 3QAZB 2RH0A 2PW1B 3U1CA 1BBJA 4PJAE 4GQPH 4G71B 3R0MA 4A55A 1NCCL 3EYVA 2GFBA 3CFTA 3E1IA 4L3ED 5GS0C 2E4TA 1ZS8B 3BPNC 3TIDB 4AUUA 3H1LD 3B2PA 2QM8A 4OSUH 1YJDL 3GXIA 5IFAH 2ATAA 3NGBB 2QPFA 3H1JE 3K8KA 3MLXH 4AYGA 3AXLB 3QEUB 4QHMA 1FDLL 2GA1A 2YD0A 4X99A 4PCYA 4F1SA 4NRXB 1R5LA 3EXJA 1G94A 4LXFA 3DHJA 1MJUL 3DHPA 3MOBL 2XHNA 1S7UA 4MJ4A 4R4FL 3KGSA 1M7XA 3IJ7A 1GKOA 1LVEA 3DOIA 3I6SA 1CQYA 1GSMA 1QLFB 4XMKL 1D3CA 3SDXE 3VNYA 2VZUA 4NCDA 1E50A 4BKLA 4U7KA 1DBAL 5BMFL 5BJTA 2VN3A 4TUJB 5TQ0H 2B59A 3NZHL 3RP1A 3CCMP 2C9SA 2VLMD 1D5XA 1DE4B 1RZJH 1N0XH 2IALB 3JXAA 2GK0B 3WN5C 5G4NA 2WQ8A 2FYYA 5IHUL 4QHLA 3UTSB 5L2JB 1D5ZB 3VFMA 2LTQC 3K80A 2NY2D 2VDQH 4NUMA 1T7YA 4U7MA 4AVHA 4ANVA 1S7TB 4OI7A 2FLMA 3EFGA 4B96A 3ESOA 2YAPA 3HC3L 1FL5A 2ZXBA 2ZUTA 4NZJA 2VN7A 4N5EC 5ILTH 1CVSC 2F58H 4OGXL 3ARYA 1ONQA 1OW0A 4JF7A 1JWMB 3F05A 3H3PL 1IBFA 5TDOA 1CWVA 3MUGA 4NQVA 2P44B 4YXHL 5A2IH 3INUL 1OGAE 5DJXB 1AHKA 4OZ4A 3QYMA 4JN1L 4X6BB 4XO9A 1A4KB 1T6VN 1TU2B 4KNTA 4DUWA 1SYVB 1I1YA 2UWJE 4AMXA 1I9RH 4C7NB 3V55A 1IIKA 4G5AA 2KLSA 1BQSA 4RDQG 4M7JH 1NBZA 1T2QH 2BLFA 4Z0XA 4BCYA 4ZUTA 4H1LB 4H8UA 4J3OC 4MAUL 4ZFFA 2CJTA 2QMJA 3MUHL 5FA4B 1QG3A 3UTTA 3KYKL 2L4OA 4M5SA 3PNRB 1JD9A 1JVKA 1A1OB 2HFFA 2EC9T 4WJG3 5HDRA 1RUKL 5DMYA 1QRNA 4FFZL 4L3CB 5GGRA 1PD0A 2R2CA 4PQXA 1BGXL 2ETWA 5BRPA 4J8RB 1F11A 4HKXA 4YXLH 3UTOA 2XNXA 5KBPA 4ODHL 5FDWA 5I0XA 3I50L 3EO9L 2AZUA 3VMZA 1I7RA 2L7QA 3FUIA 3O45A 5EEXA 3LS4L 4NKDA 4Y4FC 3IS1X 4OQTA 5D1ZC 4N78E 1JV2A 2X9WA 3ZL4L 1U8MB 2CGRL 2WYHA 1E79H 3P9MB 3K6NA 1KIRB 2VMJA 5EEZA 1KIUA 1IEBB 2BMKB 2W8CA 3BVUA 4NP9A 3K6SB 1OSPH 3NRFA 1KTLA 5ICXB 2EH8H 2OL3B 3S36X 1DH3A 4KVNH 4HCGA 4XMLL 1EZVE 3GI8L 2XWCA 1NCIA 1XF5A 3PABB 3IYLW 3QE5A 1QQDB 3ZYJA 2A0LD 1FYTD 5I82A 3T1FB 2BX5A 4HIQA 4ANWA 5I1KH 2X4TA 3QXDB 2ARJB 3OXRA 2NPSA 3EBGA 3BPLC 3NFQA 4YHML 5CBEA 2KZBA 1XR8B 1B2YA 1X5MA 2ENPA 4NJ9H 4JDZA 3GXPA 4HH8A 1WS7A 2QZQA 3UO1L 2HB0A 1P5VA 4MASA 3L5XL 4BWNA 3CH1A 3LHPH 3E8VA 1Y9BA 4ZRGA 1L0YA 2O6DA 2BIPA 1MFTA 1E6OL 1WBXB 1KCRL 1J1PL 1BZ7B 2APXA 4CBPA 3A47A 4DN3H 2YMTA 1LE5B 2ADFL 3E38A 3S34H 1C08B 1DQLL 4GSXA 2BSEA 1NO4A 5I6KA 3WJLA 4BFFA 5LLIC 4BHUI 2ZP0T 2D7QA 3QQDA 3KWWB 2WLIA 4BXVA 4LEXH 1KN2H 3AE8C 3EYUL 2H7WA 3Q5SA 4QT5B 5EFWB 3ZTDC 4LLQA 1QVOB 3O4LB 3IJSA 3MREB 4NM8H 1AR1C 4ODVL 2RQ8A 5LAXA 4B3EA 3JVFC 1MI5D 4PJEB 3T9WA 5HYSG 3QJVB 1FL3B 2FB4L 3ZE1F 5CBAA 1T03H 5BRZD 1E3FA 1AVOA 1XGTA 4QHUB 1O7DC 5C0CB 4PD4E 3IGUA 5EO0B 4HHAA 3C6LB 4PRNA 3T0EC 3FB6B 1KEGH 3M0DC 3QFJB 4OKVB 1KJ3H 1BEYL 4I7ZC 2WVSA 4K94C 1KMGA 5LBSH 2CZNA 3V6OC 1HGZA 1SQVG 1I3UA 2WTYA 5FWRA 3GRWL 3MDJA 4JFEB 2WVVA 4R0LA 4U3SB 5E1AA 4HOMA 1O7DE 1T6AA 4YL4A 5I0VA 2WPSA 2HVJA 3T0EE 5BPPA 3GJFK 2XACC 3C08H 3I9PA 3MBEC 4IRZL 3RWEB 3QK0A 1KELL 3AW5A 4OCRL 1GPOL 1MEXL 3P0VL 4EQ2A 3EAKA 3F7QA 1KGYE 1MDAA 4XWOC 4LLWA 1UT1A 3TF5A 1C8QA 1VFMA 4DVRL 2ZOKB 2VLLA 3OLGA 4FFZA 5IW3A 5KVMC 4NX0A 1BPVA 2P1JA 1GSKA 4N0YH 4NB7A 2ZYDA 4OZHF 1NCTA 1GU4A 1NJ9A 2YXRB 2ZCHL 3RVVC 1PQZB 2BNUB 3MCYA 5DRNA 3MZGB 3PUCA 5BV7B 1Q9KA 1LTIC 2Z31D 5IWLC 3S96B 3CMGA 4O2FA 5LN8A 1NC4A 5F7EH 1PNDA 2NRGA 2R0LH 5IBTL 4C46A 4XAKE 3JZYA 3L3JB 3C5SB 2RKLA 4JO3L 1AFVH 1B0GB 4F58H 1Q2NA 1X7QA 5D7IF 4S1SH 5SWZD 4XNXL 1WK0A 5IHZA 1XGPA 3GZKA 1Y6KR 4CSZA 1TTAA 4FYTA 5EH1A 1FJPA 2GC4C 2J1WA 3NJXA 1GW3A 4JR9H 4WUUE 5E6ZA 2FT6A 3KHQA 4NZRH 4WI6A 4L4VD 4YDJA 4FXKB 3S3PA 1QSFD 3TTSA 4NUGH 4FI8A 5EF1A 1W6WA 4I48B 1YITP 4FKHA 4JRWA 3H9HB 5E08H 4WI4A 5HGDB 5EBWB 1YPZE 2J20A 4G82A 1DEBA 1S7XB 1ZS8A 1HYRC 3P8MC 3TIDA 3DX7B 4WSKA 1ORQB 5ID0B 1PP9E 1MFNA 3OLIA 4WHCA 1P4LB 3KLLA 3VN0A 1BW8A 3WFCH 3U4KA 3OMNB 1CURA 1LK3H 3JWOL 3TBBA 4AIEA 5E6UB 4HPHA 1KGJA 4NRXA 5E70A 5K33A 1S7VB 4CN6A 2QHLA 3IJEB 3ZMRA 3RUGF 1X9VA 5CLTA 3IMSA 4K3JL 2GUSA 4P9MH 3TF4A 3CU1A 2J8UA 1ROWA 3SBPA 3TA3C 3S1KA 5J06A 3KYQA 4MAYC 4TUJA 3OHXC 5GZND 2G9KA 2IALA 2GK0A 3MLRH 4PJAB 2FD6H 4O9HL 3QUXB 4UIMB 4N0CC 5E2VL 4A7QA 4WFEE 2HKAA 1Q90D 2AEPH 1D5ZA 2XV6B 1DQIA 1BMZA 4XO3A 5SWSD 5L8KB 1H3GA 1PLGH 3D85D 4L8SB 3THMH 3I75B 5AW2B 3MRDA 1RMFH 3WG7B 3F7VB 4KMTL 1J86A 2YBRB 2FJGB 1GS8A 1FQ9C 2NPLX 2ZOOA 4JKPL 5JIIA 1A3RL 3V4WA 3QJSB 1UT9A 4EJ1C 3BPNB 1UM6H 1PLBA 2C3HA 3MXWL 5FO8A 3SDXB 2CRYA 2O5YH 1MZ9A 3IWUA 5DJXA 3WIIH 2KLTA 1WHOA 2XY2A 1U2CA 4X6BA 3BRFA 1HDMB 4QAMB 2VLKE 1MHPH 2NNFA 4XVJL 5CEXB 1FNSL 3U7WH 2IQAA 1NCGA 1CFQA 3ZL1A 5FFLA 2FYUG 1SYVA 3GRWA 4TTDD 4N3TA 3WS3A 3LRHA 5GJSL 4K15A 3F58L 1U4FA 1S78C 3QCVL 4IRZA 4J3WA 4I3GA 3U0PA 4H1LA 3AS3A 3I74A 2EDMA 1WZ1L 5JPMA 5A3IC 5IHHA 3HD7D 3HMWH 5FA4A 4DKDC 5HHXH 3AT0A 3L5WB 2FHCA 5AW9B 1UADC 3CXDL 3QPXH 1B88A 4ZFZB 4ZT1A 5KLVK 3BVHA 1SUHA 4AEHH 3VFPB 3WN5B 1F8TH 3FQYA 4L3CA 3C5XA 4OBRA 4AIZB 1U21A 3BOVA 5LHDA 1NANH 3DDFA 2LTQB 4PU2A 3O2DL 4F2FA 1OGAB 1TTGA 5T3ZH 1P84D 5CZXD 5BV7L 2ZIDA 2CH8A 2YRPA 1QFUL 4ELKB 3AEAC 3CN3A 1Y18A 1R4XA 4AXWB 4YDKH 1FLRH 4R7XA 3MLTB 1DANU 4JHVA 5B4MD 2WXLA 1I1RA 1MXDA 1U8MA 2MQCA 5TDPB 3P9MA 1EAJA 1NLDL 1KIRA 4PI0A 5CP3A 1IEBA 2BMKA 3GQFA 3K6SA 4IBWA 2EDOA 3M1BB 4NENA 4JGNA 1NCWL 3G6JB 4N6RB 1OT2A 1EO8H 1A9EA 2EKJA 3L9BA 3P9WB 4HSQA 2IGTA 4RMWA 5EUOE 4AQ8A 5I1EH 1KWKA 4MNQE 1UZ8B 2AFNA 4NQXB 2NDGA 4JPVL 2ARWA 1QQDA 1B0IA 3IMUA 3LY6A 2VE6B 2AXFB 2CKBB 3T1FA 3CVDA 1OAQH 1ZRTD 3ATBA 2ARJA 5TPWL 3KS0J 1UURA 2FL5B 3L7EA 2YKQA 1IO4A 5DCCA 1KTMA 4FCAA 3TO4D 1GGIL 3GLAA 2DD8L 2MJZA 3VXPA 3M91A 5TQ2L 2KZIA 1J5IA 1OANA 4ZMXA 5KJ7A 1FVCA 5IVXE 1UD3A 2WXNA 5B39B 1HXMB 2YAEA 4ENEC 3K74B 2OR8A 4EQ3A 2GI0A 3QA3A 5EA0H 4M6OH 1Z9NA 1NTZG 2YUVA 4J4PD 1MFDL 1WBXA 4NUPA 4CSSA 1VGEL 1LE5A 2BSCA 1DEEG 4FC3E 4HJJH 3Q05A 1XL4A 1C08A 1QTSA 1UH2A 3AEFC 2JVUA 2JP3A 3P77B 4Y4FB 4EI6B 5D1ZB 1ZHKA 3DUSA 4PJ0H 2O5ZL 1E4KA 3EYFB 5H2FH 2VAJA 4TRPL 3OX8B 3QJZA 1GJWA 3BVTA 3S98A 1ZP0C 1AKJD 4CJ0A 2PGDA 2WWNA 3CIAA 5AWNL 4A6YL 4NN5C 5LNEA 3UG5A 1WT5A 4OZIB 4KMQA 1XZWA 2IDBA 1DVQA 3RL1A 1QVOA 1GOGA 3WKMH 3MREA 1CI6B 2ZPKL 4WTZA 4HJUA 4MVBD 4QKTA 3UH8A 1WRFA 1GK6A 2BC4B 5DQDH 4S0HA 1AQKL 2IBZI 1JI1A 3BP5B 3BVNB 3BPLB 3DV6A 4CPGA 3H42L 2VR6A 5E6YA 5FDYA 4QHUA 4DHLA 5C0CA 4HGWB 2OMYB 3SWFA 3ULSB 7FABL 5GS0L 4BCXA 3C6LA 2VZTA 3L4XA 4G59C 4UTBL 4I9WE 4P3WA 5FGCE 3ZTJG 3FB6A 3U2SB 5CEZH 2LFGA 4OKVA 3ZUCA 4RCAA 3VW3H 1V3KA 3DX1A 1SQVJ 1D7MA 3HRNA 2ROYA 3AZUA 3BQUC 4Z7UE 3WYRA 4DAGH 4RMVA 5AFAA 4U3SA 2ZG1A 5MEND 4WKZB 1W2BO 4FFVC 2XSKA 4HCRH 4NDMB 3VD0A 3STLA 1T0MA 3V2PA 4N4YB 1HZLA 1SDDB 4LMQI 4KK6C 1GZPB 4RA0C 1G43A 1T20A 2JKWA 2QDWA 4G9FD 2Y7NA 5KVFH 4HFUL 2WKGA 4MD4A 1KTDB 2WBJD 4XP9H 3HE7C 2UZYB 4L5FE 2P7TA 5D5ME 2E46A 5LGHH 3DOHA 1K8IB 1NGWA 3HAEH 3WLWD 3JSVC 1BD2E 1L9OA 3K3QA 3N44B 5E8NB 1EGJH 1A1NA 4IQHA 1YEDB 5TK4A 3O2DA 1AR1B 3QHFH 2BNUA 1WP6A 5D4QA 4FJ6A 4BK4A 5E5UB 1A7NH 3MHZA 1HILB 3E6HB 1FZJB 4K7PX 4HWEH 1Z32X 2AXGB 5IMMA 3T0EB 4W6XB 4D7PA 1YEKL 1VA9A 3LRMA 4QO1A 5AKSA 4EBQH 1ZLSL 5ACZB 4FABL 4I7ZB 2MEJB 1G0YR 1RF0A 1N4XH 2DEXX 1IX2A 4HB1A 3U4BH 1JNJA 1KACB 1M1SA 5HDLA 2E43A 5C08E 3V0WH 4FULA 4M8UA 2CKBL 2EDFA 1CTMA 4FTVE 3BDBA 4JJHA 1WMKA 1KCBA 1P4BL 1U95B 2WP3T 5L7XL 1SVBA 1WC7B 1SQVD 1I75A 4E0RB 3SPCA 4I48A 4WWKB 1VQMP 5HGDA 2XQBL 4ZTPL 3GMQB 3ILQD 4B9ZA 5ID0A 3DX7A 3FFCE 1NOLA 1ORQA 4C4KT 5J1SC 4RAHA 2ICWB 5I30L 2QJKC 1P4LA 2YA0A 3LV3B 2ENYA 5D55A 3CJJA 3UAJC 3UTZB 2VSKB 1PZCA 5AG9A 1J0JA 4XHJC 2KIKA 5KTBA 3DMMC 4S1DD 4WU7B 3CDYA 5B1CA 2R8SL 3MZTA 3DVGB 2BVTA 3Q2VA 3PP3H 4ZMQA 1PAMA 2CGYA 1DJWA 4G7VH 4MCZA 4MZ2A 5D96C 3H2QA 4I0KA 4YOKA 1ZAGA 2NY5C 1C5CL 3U46B 4HUUA 3W82A 5I1AB 3GXTA 4YDVA 4WUUB 3OTTA 5AKRA 4H20L 3UMNA 4L75A 2AP2A 3G5WA 4DW2L 2KT6A 4X8CA 4A6YA 4PJAA 1PPJG 1HT6A 3QUZC 4UIMA 5KLVD 5HDQH 3CZKA 4AM0B 1M71A 4OFKA 3V10A 4OUOA 3AM8A 2W88A 1YEHL 5TE7H 3BAJA 3KPPA 3MV9B 3FAXA 4X6DF 4LCWD 2YBRA 3P2DA 5JR1L 3GKWL 1JZ5A 1IAOB 4BZ2H 4JX0A 4XWGL 2VUKA 2EDRA 2JTDA 2YAQA 4X6CE 3VD3A 4UTBA 3GLDA 4KXZH 3SDXA 4NO3B 4Y16A 4YDMA 1DJGA 1INDL 1HDMA 4PGBB 5J13C 2V17L 4UT6L 1KBGH 3N91A 4LSUL 1PKQE 4HQQL 1PVHA 2VDLH 1CLYL 5FF6A 3GC3A 3L75E 4GEJA 2MCMA 5HVFB 1YECH 2HT2C 3FU8A 3MX0A 4TYUA 2OJ1A 4NZ8A 3RL0g 3ZHNA 4KY2A 2DBLL 4MJJA 4LOEA 3TA3B 4TLFA 2VSCA 3BWZA 4MAYB 2XNAB 3OHXB 2YQ3A 3PWNA 4PJ8C 4PREB 4ZFZA 4JNXA 3VH8B 3WN5A 4JHAH 2GJRA 1EBAA 2ICEC 3PAZA 4LPCA 5C7XL 3L4TA 5GGVL 5GRZA 2RA1A 4F2EA 5F1NB 4C54A 4PB9H 4JY6A 1OGAA 1EUTA 3Q8FA 4HZLB 1VCAA 2DQIH 5AVVB 1URQD 4OF0A 3RDTC 4FQ1L 4WHYH 3BYTA 1SHWA 3QQXA 1AHWC 1HHGB 5TDPA 5CD5D 3HUJE 5ICUA 4F7CA 3NRQA 3I84A 5K9JH 3N40F 4UM8B 5IBLD 3BZ5A 4GW4B 3WAJA 2K7QA 2HWZH 2ZG2A 3M1BA 3VO0A 2BDNH 4N6RA 1BSNA 4BUHA 1R5VA 4ZX4A 1X9QA 1A4JB 1RSYA 2FFDC 4NKOA 2B5IC 1DSWA 5ACMA 1WITA 1HE7A 2R5DA 1JGVL 2APBA 2VE6A 2AXFA 3FYIB 2CKBA 1ADQH 1OD9A 1J1EC 4OZFB 3G04B 2K9JB 3VXSD 1S5IH 2FL5A 4HS6B 5I24A 2FYUD 3V4QA 3WUUA 4LL4A 1YVLA 4D0CA 4N85A 4PWJA 4PWIA 4KY1L 3W39A 4ABQA 3QQ9C 4P8QA 4QXTB 3C60C 4OT1L 2FEJA 3FCBA 1SS1A 2IDCA 5B39A 1QNIA 4QNPE 1NTZJ 1R3KA 1FP5A 1R3JB 1AVYA 1R8EA 2EEDA 2KLRA 3DWTA 1N64L 3ARQA 4UUJB 4HIEB 4HUMB 1KC8Q 1S6NA 1TPXC 5EUOB 4CMHC 3P77A 1G7PB 5HHPB 1JGUL 2FGZA 4EI6A 3KVQA 1AVAA 2WSFJ 3EYFA 4KZCA 5A6IA 3CXHJ 3LB6C 1DX7A 4MDJB 4PM1A 5JW5B 4DQOL 1FNGB 1NEZA 3OF6A 4JPWL 4TQ8A 4DKFL 4RNRB 4RMBA 5J4MA 4U1KB 1JHKL 1CI6A 2G2RB 4P3CL 5B1AB 1T0NA 2ADIB 2AF2A 2E3VA 4HXAL 5KSBF 2IPUK 3BP5A 3CHRA 3D12B 3P0GB 3BVNA 1OAYL 1LNUB 1PDKB 3CQQA 1RIUL 1YAIA 2CCVA 1EHLL 3TNMB 1JAEA 5BRQA 3U2SA 5CJBA 4JPIB 2HT4C 4V2BA 4OM0L 4PBXA 3DGDA 1MCJA 1F41A 1OHZA 2YN3A 4HAKA 3SE4C 4UT6A 3WEBA 4WKZA 4NC0B 2HVKA 4WK2B 1SP4A 3FFDA 4NDMA 4HF5H 1KQSO 3H9SD 5EU7E 1GZPA 5HYIA 1JTOA 2CJUL 2CPUA 3WMSA 3O6LL 1LNQA 2ENQA 3IMWA 4KKAD 1KTDA 1NTZD 1N10A 4J1UA 3WOVA 2MFNA 1YYLH 2PF6A 2UZYA 2WZ5A 4R4NC 3V5DB 2YKLH 4APQC 2ZICA 1K8IA 1BMWA 2CD0A 3TJEL 4MMYB 3LRGA 5FGCB 3NFPB 5E8NA 2DF3A 2Q7NA 2H3XC 2Y25A 4UZGA 1S3RA 3MLPA 3MV01 5D71H 1I4FA 1KUMA 3BC9A 1VEPA 4Y19D 3D4CA 5L4IA 4A39A 3CXHD 5FB8B 3E6HA 4FFWC 1FZJA 2G30A 1VAHA 1PZ2A 1NC2D 3IRZA 2AXGA 5H37H 3NIGF 4L0PB 4YZWA 3T0EA 3MV7D 3F7LA 3B5NC 4N8UA 2Z91A 3E7KA 4LLYA 2W6JH 3M0DA 2OYPA 3MNDA 5ACZA 1P2CB 5M94B 2IJ0C 3BQUB 4PWEA 3VRJB 3MRJB 4BXSV 3ZT5A 1UOVA 1S9KE 4DPRA 5KANG 5D5MB 1N70A 1KCVH 1YA5A 4PS4L 4L73A 2X53A 4NKMB 4U6HB 3IU4L 4LL9A 1U95A 1YYML 5EZPA 4LASH 3VM5A 1FPTH 3KLSA 4D6TJ 4DGVL 4E0RA 4WWKA 1EC5A 3HE7B 2VMDA 4FQXD 2X12A 4I2XA 4P2OD 5DUPH 3P73A 3GMQA 4X8GA 1L0QA 3GSWB 5D7KE 5FGBC 5GGQH 1Y07A 1MLBA 4GI8A 2Z8RA 5DGRA 4M5TA 2P5PA 2YARA 5I0WA 1JRHL 4YFLI 3LV3A 4I0PA 3BFOA 1MFEL 2E27L 2D4DA 1U6AL 1X9LA 3RLSA 3CFDA 5IR1B 3CFCL 3V7MA 4N9GB 4WU7A 5ERWB 1TEGA 1U8PB 3DVGA 3ETTA 4U6VL 2CWRA 5IB4A 5LQBH 3E6FA 1E28B 1WGVA 4X8JB 5H35B 2MCPH 4OLVL 4ONHB 5I1AA 4WUUA 2C4XA 5KVEE 3P2TA 3O6QA 1AI1L 2Y06H 4FTVB 5DHVH 3RFZC 2PETA 4A2HA 2KKQA 3CC7P 4I77H 4WGVB 1LDSA 2I26N 2B15A 1CPUA 1YEFL 5ALBH 2GQHA 1ZANL 2Y7QA 1K73Q 1YPZA 2WIIA 4HUWB 4OCLC 4AM0A 5J0BA 3TFKD 3FFCB 1AG6A 2VLME 3OB8A 4BSWB 3ZDZF 1LEIA 2HT3D 3KJ6H 1IAKB 4Y8AA 5E1GA 1OX3A 4A1RA 4UB8E 1IAOA 1PEZA 1SJHA 3BN9D 4HPYH 4DCQB 1QATA 4FQJH 3HN8A 1DJYA 3Q2NA 1EMTH 3OBAA 4WU5A 2DQDH 2QJKB 2P8PB 4PLJD 4PGBA 2X4SB 2J12B 4GW1A 1ZN5A 1ZLEA 2X70A 2QT6A 4FERA 2C5DC 4NLAA 3D07A 3MGNA 4CN1A 1T21B 5D96B 4MQ7B 2EXYC 4S10A 1O9WA 4LRIA 3G3ZA 3WNPA 1HWTC 1KBVA 4U3FE 1VFOA 2GBTA 3HA0A 4LOFA 1F1DA 5DHVB 5GGRY 5T5NG 3OWRA 2J1XA 4RRPG 5LO7A 1U36A 2ZUYA 4MAYA 2KBGA 4PREA 5CF3A 3VH8A 3P1VA 1HS6A 2YAHA 1NGPL 1C12A 3Q1EA 4BK8A 4UILL 1E5BA 4RBPK 4G9DB 4ORZC 2HJKB 1EDLA 4DN4L 5ANHA 4EXPX 3B8YA 3DXAE 5I71C 4IBTA 2XZCL 3QDME 3Q5RA 2VLKA 4GKSB 4HZLA 4KTDL 4HWBH 4CC4A 1PPJD 3DUHA 5KYXA 1H89A 3AAZA 3X3FL 4A7SA 1HE8A 2DH3A 1ORSB 2LAGB 2J2ZB 1J18A 3MO1B 2JTYA 3ZE1E 5DD0L 1HHGA 2OYHA 1HIMH 1EZVI 1BX2A 1NFDF 1UVQB 2DMHA 1XV8A 3L13A 4M62L 3UC2A 4OLWH 4UM8A 5D1ZI 5CLWA 1JSYA 4CVZA 1UQSA 5J13B 4HETA 5A43C 3GHBH 4XO5A 3Q5PA 2R2HB 4P9HC 2A0LC 3AE9C 3DNKA 4L5FL 2QTEA 2V0AA 2EIDA 3D18B 5ADPL 1Z0MA 2FNWA 2KZKA 1RJZB 2OKMA 2UUDK 4OZFA 5T5FL 5D6DC 3NSCA 1QTYT 2YPLD 2DYPD 5JNYB 3G04A 1J87A 1IC0A 2ITCB 2XA3A 4BZ1L 3KGTA 3F5WB 4HS6A 1RE3C 2XG5B 5T1KA 1FYTE 3H1IG 4WJ5B 3CZSA 4AV5A 4WEUD 1Z7JA 4PJ8B 5JA8B 3FULA 2F54D 2Q3EA 4F7TB 3CBJB 3NPZB 3LYRA 4QXTA 3UACA 2CMRL 2ICEB 4PN6A 3HUJB 3KL3A 4PJBF 2DIJA 3O2VH 5DFWH 1OE3A 2W65B 5F6HI 5CU5A 3LDBC 1XCTA 4OZHE 1I9JL 1AA0A 3AWGA 4WNSA 1JNMA 4MNQA 2CG9X 4Y1AE 1G7PA 1F58L 5HHPA 1R6VA 3MD0A 1DR9A 1AHWB 1I9EA 2ZXCA 3LKSA 1J9CT 4D3CH 4ZMAT 5C92A 1NGMB 2OLDA 2P3YA 4ODUB 5E8DL 5APTA 1JYNA 5TDNB 2FFDB 1FNGA 3BATA 1SN2A 4HGMA 5C09D 1AAJA 1TOXA 5F0PB 2B5IB 2Y1YA 4IMKA 5D7IE 4GAJL 1FU1A 4U1KA 4PD4I 4LGPB 2CBQA 2G2RA 3EDEA 4PJ7F 4DOHE 5JDSB 4JY5L 2ADIA 3TYFB 1J1EB 1MPAH 5IVXA 1W8NA 3LIEA 2JJTC 3MRHB 3FH7A 5KOMC 2OZ4H 3F04A 4IRSD 2LLNA 4PGDB 4DSYA 1OALA 3E1F1 1M1JB 3CL3D 1LNUA 2BP0B 4NFDA 3UJIL 2X1WL 2VR3A 2EILB 4QRUB 1JUFB 1MI5E 1DBKH 1KB9E 2WHVA 2X40A 3TL5A 4Z5RB 4IL6E 1JFQH 3K81A 3C60B 2DM4A 5BRZE 4MNGB 2ADJB 1NAML 1JMBA 1ZVNA 3JTTB 2I8DA 2LU3A 4IDLA 1I8IA 2CIKB 4FA7B 3S9DB 2FBJL 4H88L 1SOXA 5CBNA 1KENL 2W9LA 2PMZA 1U8IB 1DHKA 3BCCJ 1OHQA 1TPXB 1DVZA 4M6ML 3L70G 1Z56A 1HH6A 3IMRA 4O2EA 1IGFL 2PWEA 2NY5L 3FT4A 3OW2O 3U25A 1BG9A 4AL8L 1J2JB 3RUGE 1K4CB 2D3LA 2ED7A 4TOYL 4LQFH 2OCCB 3CLEH 5FCUL 3ROOA 1BGYG 3ELQA 4ZS6D 1M7IB 3RIAK 2AK1H 1OF2B 1WIPA 3TV3L 3EGDB 5T1DH 1XAKA 4G72B 4MMYA 1VQ4P 2NDFA 3NFPA 3E7JA 2ICWI 4XO4A 4YDIH 1JXJA 4ZODA 1GOHA 2Z31C 2RD0A 2BS9A 1NTKG 3LH2H 1IAMA 4Z7UA 5JOPE 3VOPA 1SYSB 1Z3RA 4LSQL 3DX2A 5TK2A 3UFIA 1F1AA 1HHIA 2ADGB 3D34A 3KW7A 2KOGA 3VWJD 3QUKA 3RDJA 3V6ZB 4AJVA 5KYNA 2XTSA 3DX3A 3TEXA 5HTSA 5D9SA 3BQUA 2ZSVA 4L2LA 3MRJA 2RB8A 5KSAD 3VRJA 1I1AC 1KBWA 2HRLA 4OF5A 2GC7C 4WO4C 4NQSB 3SKNB 3TONA 1XQ4A 3QI9A 1DLFL 4XPGH 1GXEA 4KBPA 1QFWH 2C9XA 5DD3L 1S3JA 1X5KA 4NKMA 4U6HA 5T5FA 3FU7B 2BWDA 3TBVB 2NR6D 3FAWA 1BD2A 5EIVA 4TSCH 5SWZE 3ULUD 1M6OA 4BZ1A 2OYKA 2PR9A 5FYJD 2NQDA 3HE7A 4N8VB 32C2B 3GHEL 3SY0B 1KCUL 2B4CL 2X3AA 4L4VE 3UZEC 1QSFE 4JHWH 1D6VH 1GS6X 1T22B 2LLGA 2NZIA 3P3TA 2J56A 4WEBL 3VAEA 2ZAGA 1NCBH 1R75A 5IR1A 2UVFA 3PE9A 4CN4A 4N9GA 3ZO9A 1FH2A 1U8PA 1OE1A 1I3RB 2BXZA 2FTAA 3Q2LA 4N68A 5E24E 5ESVB 2W95A 3OC8A 3W3BA 3MFGB 2GSIB 5C08A 5CWSB 5DU7A 3TBCA 4FDWA 5GZNC 5JIDA 4URKA 4RZKA 4FTVA 3B5NB 1E8YA 4D9LL 4HJ1A 3D0LB 1SDAB 1X5YA 3GS7A 3CVHL 3HCVA 4ZOEA 2BERA 1XGZA 2B0SH 3FTVA 2C4FU 4Y2DD 3E9TA 3IN0A 3OD3A 1HC1A 5CCHD 4BM7A 2MOGA 4HUWA 5DR5H 4JFZH 2VERN 1YY9D 3FFCA 4PG2C 4CMHB 3DTDA 3LXCA 1K4DA 3NTNA 1EPFA 4GAFB 4WW2F 4BSWA 3GXDA 2OK0L 3UTQA 1RP9A 3WKQA 4U1JB 1MAJA 2GTZB 4L3EB 3DX4A 5GS1C 3T97B 3L2LA 2G60L 4AGOA 1RZQA 4DCQA 2I69A 1URZA 2BNQE 3V2RA 3NRPA 2VCOA 2H3KA 2QEJA 2EP6A 1N8ZA 3NAAL 3AS2A 1ZHBB 1NAMA 5J12B 3UAJA 3FTYA 5A40E 2M0BA 4OLYL 1V10A 4PJFF 3GKZA 4WTQA 2ZUVA 4NJAL 4QGYA 8CGTA 1IZKA 2BOBA 2BHYA 5DI8B 5BVPH 1JY3O 3U4AA 2R69H 1FN4B 4YX2H 2QQLL 3HD7C 4PGEB 1YEGH 1QHOA 3ARWA 5HP5A 3WLBA 2YS4A 5GHWL 1DUZB 1SJXA 4UV4L 3VMNA 3ULUF 3RFZB 1WJ3A 4DH2A 5EC1B 4EIZC 2E75D 3BFWA 4LHUG 5E2TH 4RAVB 4IOIH 3LQMA 3SDAD 1HL4A 4KKQA 4X6CA 1A02F 2HJKA 2VSMB 4OD1H 5CZXC 4PRPD 2X2IA 4U4IA 4D8PB 5EU4A 4R8WH 1R34A 3IR9A 1MWOA 1GMEA 4PJ9B 2Z7UA 3N9GH 5A1AA 1VHPA 2IH9A 5B4MC 4U6TA 2DJSA 3OR6A 4R7DB 1J1OH 4GQQA 1ZA6B 2CLVB 1YO4A 2OJEB 1PKQA 2EIEA 1BOGB 2SEBA 4FP8L 5AVUB 3MO1A 4KTEL 3ZGHA 4MS6A 1I9IH 7CGTA 2H43A 5KWYC 1UVQA 3N85H 4OU3A 3NESA 5LCVH 3QWRA 1NWQA 4BJLA 1RZFH 5LGKA 1EFXD 1JXDA 2F53E 2KQMA 5D1QC 2R2HA 3D50A 4F93B 4XCEB 5DD6B 1PD6A 3CN1A 3DIVA 1IK9A 1JNNH 1WCBB 1E30A 3QC6X 4GT0A 2ITCA 3TO4C 7PAZA 3KZ8A 3MR9A 4P5SA 2R2EB 3H1IJ 2I1KA 2XG5A 2R29L 4NQDD 5D1QE 5E5MB 4DP4X 3QDMB 4WJ5A 4ELMF 3NCXA 2AGJL 3P32A 4CMMB 3L73E 1KLGB 4H0GA 3K4DA 2EINB 3L3DA 4UQ3B 1EAPB 1ED3B 4F7TA 1TUPA 4W70A 4XCFL 2ICEA 3ZE1B 2NQ3A 2VQ1B 4DP6X 3EYOA 2DL9A 3HUJA 1X4ZA 4J4PC 3E1ZA 4X9IA 2G2NA 4ZOAA 4D9RE 3T1WA 5I71B 2W65A 4OJFH 2X5PA 4E5XB 3US0A 3SE6A 2EADA 4N86A 2WW8A 5FWQA 2N56A 4YPGB 4ATTA 4DP1X 3MA9H 4DGYL 2HH0L 1JPFB 4U33A 1ZK9A 2AAVA 2GJZA 1BP3B 3PGDB 3M7OA 4NI6A 1QSEA 4BQ9A 2JJSC 1SZNA 4EOWH 3WHE0 3CVHA 1ACYH 2R1XA 3ITKA 4PJ5E 5IREA 2FFDA 1FYTB 4MVBC 1JZ6A 3RBSA 4FNLL 1BVKA 3VXNA 4LSRH 2H9GB 5T8IA 3HHSA 2QJPC 5H4YA 2W6BA 1XSOA 1Z1WA 1J8HA 4G3YH 4MS8D 1M1JA 5DF0A 3HNVH 3FNKA 4I3RL 4WFHD 4OZHB 3UBXA 1YQ3C 1DVUA 2AI0L 4UB0L 4Y1AB 1RKRA 5CZKA 3SDCA 1H0DA 3Q8EA 3X13B 3MGOA 5KVEL 3CC1A 1CT8B 3TT1L 2CIKA 1AGDB 3U1PA 3QIBD 3MRQA 2F8VA 4WRLA 2LKMA 3LDBB 4S1RH 2J55A 1SVZA 4OVVA 3WJJC 1IAIM 4AQ1B 1FHGA 2WBJC 3NCJH 1JDDA 5IB5B 1HOCB 1T83C 1IC4L 2BY1A 1SLXA 3K1KC 2VM3A 1BGYJ 4OFDA 3PHQA 5C3IA 2JO1A 1HFUA 2X09A 2IV8A 4U2YA 5IGXL 2VXQL 4NC1C 3MJ6A 4QRRD 1AZRA 4G9FE 5DJZB 4Q4IA 1ZTMA 1OF2A 3C2SA 4WWID 3PHLA 4H8PA 4LLUA 3QO1A 2KYVA 1NCNA 3L35A 3ZHFA 3GNMH 1MI5B 2DQUH 3O3DB 4XGZB 5F88A 1QKZH 1R47A 3GGWA 1NVOA 1IM9D 1NTKJ 3P0YH 3RVWD 1XEDA 3VG9C 4WHTB 1U8KA 1A7BA 3QEHA 5BRZB 5HYJD 5FO7B 3UJJL 35C8H 3FTGB 3QZWB 1LTJA 4JN2B 4NC1E 1UA6H 1X7SA 4YWGL 2WO4A 3MNWA 4GKZB 3LZQA 1JGDB 4X6DE 5GGSB 2ADGA 4HVBA 1BOYA 1DQJB 4LLVA 3BJLA 4PY7B 5EBLB 3V6ZA 5K9QI 1WT6A 5IEKA 3H85A 4ZMZA 5CJ0A 3FT9A 2O5XH 4UBDD 3T65B 4KNUA 2PXYD 4XPTH 5DFAA 3SE4A 4DVBB 1NUFA 2ZWZA 4AW7A 5J3HD 4NQSA 2D7PA 4LSVL 2FX8H 2GJ6D 1EXUA 1UYWL 2VR7A 3ZRFC 3RIAF 2CLRA 3GSOA 2QGBA 5E2UL 3HNSH 3FU7A 3V4PH 2Y0CA 4L0YA 3MBXH 2WZPA 4N2MA 3ILQC 3EOTL 1H3TA 3SE9H 4WKXA 2DW5A 2R29A 2V5MA 32C2A 3VFWA 3IVKB 3A23A 2A7BA 1H3WM 3BHBB 4R4MA 1HINL 2DQJH 3PJNA 3L70D 2XQ0A 1XO8A 1TJHL 1RUAL 2WTOA 4S1DC 1PY0A 4JZNB 4DETA 4ASVA 1UEYA 4Y99C 4DT2A 5AVRB 1BGYD 2Z31B 1E9PB 5IB3B 3V0EA 1I3RA 3DSNB 5E2WL 5ESVA 5TISE 3D9AH 4JO4L 4W9HC 4YHOH 3GSRB 4JFVA 2GSIA 5C07A 3FGAD 1KILE 1JZIA 1B6UA 3W0WE 4POYA 3MZWB 2MTPA 4FTDA 2AANA 5C0ND 1FAIH 4W9CC 2H2PC 3Q1SL 1R9FA 1XGYH 1FH5L 5SWZB 1Q0EA 4HG4J 1A5FH 1FJ1B 4AV0A 4YHZL 4BWWA 4P9HL 3PL6D 1KGCE 4YDNA 1I1AB 5KAFE 4LDOB 4WO4B 1HKLH 2FQGA 4HC1H 3L8QA 4NI3A 5LWYH 4XB8A 4L4VB 4C56D 4G6KL 3IF4A 1JZ4A 1QSFB 5SV3A 2AEQH 4JL2A 4WAFA 3LNHA 1EX0A 1DJXA 1RLBA 3ATAA 5KLVE 2VUOA 5LNGA 4QRPD 3OPZL 2LT9A 3IDNA 3T97A 1KN4L 5JR1H 5B3NA 3D0VB 5ICYA 3EFDL 3QJTB 5CN3A 3KXDA 2K4WA 4H2AA 4RLDA 5FGBA 1BVZA 1ET5A 4XCCH 2KNCA 1LD9B 4FEMA 3J2PA 5I73C 5I75C 4ZMWA 3ASWA 5ALCH 3TCTA 4H13D 1ZHBA 5DGQA 2IH1B 2WC7A 4CVXA 1MHEB 4XH2B 2P45B 5I1LB 2OQQA 3FKUS 2X0VA 2QM7A 1W6LA 2EYTB 5DI8A 4R2GD 2ESVD 2DQMA 4PB0L 1LHZA 3IJHA 1G7QA 3VI4F 5I23A 2UY7A 1LTSC 4FZEL 2WYTA 3L9RB 4O2CB 4C59B 2OR9L 4HW6A 2E7BA 4HJGH 1DVFC 1DUZA 3QEQD 5DURD