5AVWB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avwB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avwB02
2WPRA 3V5BA 4GKGA 1GTWA 1SLQA 3M9HA 1CI6A 1A02J 3HTKA 1H8AA 4C46A 2Z5HA 4EOTA 1S9KE 3VYIA 2YO2A 1HJBA 4JYCA 1GU4A 2XZRA 2Z5IA 1S9KD 1T2KD 1OXZA 2N9BA 3UIAA 3VN0A 2KP8A 2ZFCA 3M06A 1GZLA 3WGUB 3MD0A 5AW2B 3NXSA 1HBWA 1OWAA 5AVUB 4C7NA 1GU5A 4B86A 2C9NY 3VMZA 5AW3B 3M0DA 2YNYA 2R5BA 1IO4A 3WGVB 2WPSA 3TNUA 2BASA 3IR9A 3VMXA 4GT1A 2Q5UA 3A7OA 5AW5B 2Q7CA 4AYCA 2Q3IA 3HE4B 5AVWB 4I2LC 4LC1A 1X8YA 3LIDA 5AVXB 2XU6A 5AVYB 1FAVA 5AW0B 3M9BA 1GK4A 3A3YB 2H7HA 1NAFA 3TYYA 2C9LY 2WT7B 1HWTC 3KQGA 1SP4A 1JNMA 3L36A 3KDPB 4RETB 5AW9B 5APSA 1MV8A 1NWQA 5AVQB 1A02F 3M0AA 2WWWA 2P7JA 3P8MC 1HUCA 3TK1A 2WTYA 1KQLA 2WPQA 3HE5A 3HE4A 3NTNA 2R3CA 2ZXEB 1CZQA 1J2JB 4HYTB 2W27A 1MFZA 4AQRD 3V4QA 1DH3A 3HE5B 4C7NB 5AVTB 3OAKA 3A5TA 2QM7A 3NFQA 2P67A 4JYBA 2R32A 4KHXA 5APTA 1GK6A 1YYCA 1T2KC 5APQA 3L37A 5AVVB 3SWFA 1G2CB 5APXA 2IPPA 2JJLA 4I6MC 3VTPC 5AVSB 5AW7B 5AW1B 2XV5A 5AW6B 5AW8B 5AVRB 1H89A 5APYA 3O8ZA 1JUNA 3M91A 3A2AA 4XE5B 1FOSE 2WT7A 1CI6B 2R5DA 3V4WA 5AW4B 1GD2E 3TNUB 5APWA 2QM8A 1CSBA 4RESB 2P2UA 3P32A 5APUA 4AUWA 3NMDA 5AVZB 3I5CA 2E43A 2YO3A 3MGNA 5APVA 1FOSF 3VMYA 2VRSA 2E42A 4DZOA 4M3LA 3T97A 1H88A 3LIEA 1MUUA 3P7KA 2W6AA 5CMZA 3B8EB 3L35A
chains in the Genus database with same CATH superfamily
1CFNA 3U82B 1SQXJ 3PF2A 4BYHA 1LP1A 2JO1A 1UOWA 1LNQA 2XNDH 1A9BA 1FAIH 1IEBB 3N85H 4K3JH 2BVOB 1E5BA 4M5YL 3VWKB 1ETZA 3O2DA 3B43A 4K3DH 4PJXF 4ZNCD 2Z5IA 5DVKA 1SLUA 3D06A 5TE7H 2JQZA 3OKNA 3EO0A 3VXPA 2FYUD 1Y0LA 3BSZA 2X6MA 2WLIB 4JFVA 4LGPB 4O51A 5F9WC 3R4YA 1KB5B 3V0FA 1KTDA 3UMTA 4ZTOH 4RISH 4EXPX 4N25A 2VE6B 5KBNC 4FEMA 1U8KB 1YN6A 5D1XE 2OBGA 4PRBB 3WUWB 5D1ZA 1JVOA 1KENL 3CHQA 2BSSA 2QPSA 1WBXB 1NQBA 3P11L 1QYGH 2VDLH 1H15B 3PJSB 3FB5A 3ULAB 2OYPA 3QRLA 4MAYA 1NCTA 1UEMA 1CQKA 4RMRA 5EH1A 2ENYA 3O3EA 4OCYH 5C97A 1SXBA 5HI4D 3LNIA 3F5WB 5ID1B 3GMOA 4UILL 4BD4A 5DJCB 4HB1A 4XMLL 2AFNA 2IAMC 2XRAL 3AUWB 4M6NL 5AB1A 4D94A 4Z3EA 2WO2B 2EIKB 1BSNA 1AGBA 1PPJD 4AKQA 3KBHE 1P0SE 2WXIA 3IMTA 3RWGA 3RU8H 1M7XA 1OAQH 1HTYA 1JTTA 2ZAHA 4GEIA 1SEQH 5EOQH 3SE4A 3IJ8A 5CEZE 3P8CD 5JW3L 2PP7A 3MO1B 3RVWC 4ZW8A 3M0AA 1NLDH 1LT9A 3GJFK 4OVVA 3FOLA 3RL2B 3RVVD 4B0MB 3AE4C 3GXUB 3LTVA 3ZDXE 3B5ND 2WAHA 2WYHA 1TQCB 4XVUC 1ML0A 5GGRY 3ESOA 4ODWB 1TTUA 2GJZA 1AQKH 2XPZA 5E79H 4KKBC 1NC2B 4HIIB 4ES9A 5BS0B 1U8LB 3UMNA 2BK8A 1YVLA 3EZJB 2NUTA 2OYOA 3HEIB 4FZEH 1FP5A 3I74A 4Q9BA 1EIBA 4JK0D 4ODUB 3ZE0F 2C7FA 1MHCB 1RK1B 1KQSO 2G2RA 1EBAA 3CXHJ 5DJ2B 1K6QL 5J3HD 1KBGL 4FFZL 3W37A 4QGTA 3KHQA 2FHFA 2WGXA 1MAML 4LVHB 4XC1L 2D2CB 1JUNA 1UM4H 4QR7A 1IE4A 3NFSH 4AZ8B 4MN4C 2BHYA 3MOBH 4LRIA 5IGXL 5L88L 3EJUA 4CSSA 3X13A 4WWKA 3LOWA 3P0YL 4FLQA 4AUUA 3R4RA 1WZLA 4GUOA 1JK8B 1UATA 5DFAA 4ALAL 3MGOB 1A6UH 5D1ZI 5D5MF 4ZMAT 3CWBD 3QDHA 2OV0A 3QIWB 4DZOA 5KBKA 3P2TA 5E2VL 4YDZA 1UZ6F 1HC1A 2R29L 1SHWA 3SDDA 5IK3A 3CFNA 5FHAL 1HH6A 4Q0XH 4K71C 3U7YL 1URLA 5DJ2A 1JY3O 2OJEA 5HJBA 1OAXH 4WI3A 2F7QA 5GGSA 4KUZL 3RNQA 1P9MC 5HVWA 4KK8C 4LLDB 2ZUSA 1RMFL 5I23A 4P2OC 3WGUB 2Y5EA 1RQ5A 1YPZF 4BIKA 2YK1H 3O8XB 2E9GA 4FJYA 1UM4L 1HH0A 2V37A 4NJAH 5L4FA 1DD3A 1N2DC 4U7MA 5A7BA 3D25B 1L9TA 2A73A 4FAAB 3SKOA 4N90D 4K9JA 3L95B 2IH1B 1NAML 2X6AA 4OM1H 1AOHA 2J1YA 4X6BB 5IOPB 3CE1A 3MCKA 1GMJA 3BPLB 5I16B 2ZP9A 4Y16C 1M7UA 4JO5A 5CN1A 1RJLA 3F58H 1OOAA 1CD8A 1M57B 4JKNA 3B71A 4P4RA 4X6DA 3SB3A 5I1IL 2LGNA 2CR0A 1NMCC 2N1TB 2NXYB 4PHXA 3U1AA 3L70E 3CCJP 1C12A 2Y7LA 2Z7YA 3DLQR 3WFBL 2E76C 3VA2C 3QA3A 4PVNA 4QMAA 4LNRA 2D7TH 1YECL 5B66E 3KZ8A 4U7JA 3K6SB 2NY2C 2R0WH 1R8EA 4FCHA 2HG0A 2AJ3A 3HD7B 3USSA 4GAYA 4EZLA 5A2BA 2BHZA 4OGXH 3O81A 4D9LL 2VN5A 5D7JC 5K9QI 3HG1D 4F33A 1N8RQ 1MKFA 3HNSH 1E28A 4PJFE 3SFDC 5DA0B 1ZS8A 2HRGA 1CW5A 4Z7VF 3EDFA 3S3JA 4IKJA 4YXDC 3HE7B 1AD0A 1QSEA 4LHUA 2ZOKA 4NRZB 1L4IA 3HS8A 2I1KA 2C3VB 1A8ZA 3QZMA 5JR1L 5I17B 3S4RA 1KLUB 1IO4C 4TVUA 2TRYA 1G7IA 3GIVB 4ONFL 2FGWL 2CLZB 4YPJA 1XVSA 3RZCB 2HJLA 3MLXL 1N68A 4FD0A 2FT7A 2XVGA 1M7DB 2CNYA 3MV7D 3DHMA 1KIUB 1CFNB 4M93C 3PH0A 4XP6L 2CLRA 1OO2A 5L8KB 5BQ7A 2FEEL 3LSOB 2RKLA 4PJ6A 1M1JA 4HCIA 2E9JA 3LNGA 3HBPA 5E03A 4QHNB 6TAAA 3AB0C 1E9QB 4R97C 4CGUB 4JJHA 4PD4K 3EJJX 1R3KB 1XTMA 4NJ9H 1A4KA 5J1TC 2JVUA 4Q0XL 1LWRA 1N5AB 3OZ9L 4LXFA 3IETA 1FL6A 4G6KH 5DCCA 4EJ1C 4DVRH 5A40E 5FDWA 3T0EA 2NT1A 3FN9A 3TN0A 3J27A 5I1CH 4NKMA 4PRBA 4DEPC 2OMXB 2ZXAA 4PV9A 2AJZA 3GTVA 3CCUP 4IFDK 4HC1L 3H42H 2IGTA 5IHZA 3L3JA 3PHQA 3VSTA 3BO8B 4Y9EA 4Y4FB 1XGQB 5JHDE 2IYOA 3S3CB 5IV2A 3RK3B 4NO2A 4KTGA 3MV8D 4WB4A 4FYTA 2FBJL 1HZHH 3ULUL 1L9SA 1CFMA 3QULB 1R3KA 5EZJB 2AQSA 1S9VB 5KOVC 3IT8D 4L76A 2YD2A 2XN0A 4E9WA 3CCHA 3CBRA 1H3GA 1HYRC 3SPJA 4DP7X 4PREA 2F0CA 1OM3L 4JFEE 1JK9A 1IBDA 3CN0A 3DOSB 3CWBE 3O4LB 3QQ3A 3SY0B 4HH9B 3NEOA 2IBZX 4QRFA 3TO2A 1LEGB 4NO0A 5LLIC 4U6HA 4LCWA 5TISE 3E9UA 1L3NA 1ZTXH 1GJWA 2W9DL 1NUGA 3ARFC 1DR9A 1VFAA 4S0HA 1JPSL 4XRCA 1T21A 5IY5B 2PTTB 1JGEA 3LKSB 2VJ8A 4JL1A 5B8CB 2W80C 3IWUA 2DQDH 4TQHA 3S48A 5T3ZL 4PR5A 3QUKA 3GG2A 3O8XC 1JNMA 1JZEA 4H5SA 4I3GA 2QJPB 4M43L 4MMZC 4U1LB 3S4SB 1OF2B 5BRQA 2GEQA 4L8BB 2KSEA 2X4OB 3C6LB 5I9QC 2DQEL 2OW7A 4YHPB 4YUEL 5F8QC 1LP9B 4TUOA 5DT1L 5E2WH 3TN0C 1ZRTE 2YD5A 1NFDF 4NPJA 2XYBA 1MCSA 4WWKC 5CR8A 1JZ6A 2PR9A 2APSA 1R5VA 5EUOE 3V0EA 3MRLA 4LVOC 2VDMB 3KBEA 1E30A 4HWUA 3JV4B 4M6OL 2QM7A 3NFQA 3MUDC 3PHOA 3EOBA 3VSUA 4OR1A 4LDEB 5CGMA 1ZXKA 3A4EA 4JQIL 2Z4QB 1OAKL 5FW8A 2FXPA 2NY6D 1MFCH 4PJAB 1QW8A 3NAAL 3MUY1 2PRRA 4K8RH 4NKIH 4P46C 3HZYB 2WJ5A 1V7NH 2IDSA 5FYKL 3J2PA 5DS1A 4OQ1A 3H6PA 4GUPA 4YNYB 3ILPA 3KWWA 5F7EH 3C8HA 3KG5A 1S3JA 1S9XA 3CFBB 3P4OA 1XD0A 4R7VA 2H1PL 4YSCA 1DQDH 3O41B 1SHMA 2FJUB 2GUSA 1E0OB 2NRDA 3BDYL 4OUUB 1BYNA 4OGQC 1EFQA 1LL1A 3LNDA 3H32A 3RWCA 3WKNA 5GS0L 1EZUA 1J8RA 3SZ6A 1TZGH 5DD1L 4DUVA 4B60A 4WW2A 1WQVT 5E8NA 2X9WA 1T3FB 3PXJA 1Q0XL 5J8OA 3ARFB 5JW5A 2APBA 5BVZA 2GM4A 1A6WH 1PLGL 4XVJL 1PLAA 4GEJA 3CC5B 4D0DB 1KORA 4HFWB 4MJIA 4GG8A 4JHAL 1EZVD 5D1QC 3DO7A 5E8PB 3D0AA 1J9RA 3DX8A 1CF8H 3TFKD 3NCMA 3LVTA 3HE6B 4G2AA 4JY4A 3UC0L 2XN9D 2HRPL 4LCYA 4Z77B 2DD8L 2AEMA 2IIJA 3RBZA 2EACA 3FCTB 1URIA 1BDDA 3AE5C 1NAMB 1YY8A 5GZND 5BQDA 3K2MC 2BSED 2BSTB 4AV0A 3IJEA 4GQPH 2MRYA 1KF9B 4GW1A 3V4VB 3F7RA 4N78E 2CNZA 2KC0A 1RY3A 4HU8A 4P8QA 4PRAB 2ZJSL 4PB9H 4DEPB 4WFED 3STZA 1AGDA 1CGSL 2XG4A 4TNWK 1EDJA 1QLFA 2V17L 4ONOA 5MENE 1NL0H 3AE8C 2DTSA 1RZKL 4BDVB 4HZLA 4NP9A 4DOHB 2QGDA 3GHGB 1T6BX 2MOGA 1DIPA 1FZCB 1I8IB 5B5EH 3U1SL 1IGFL 5JA9A 5BRPA 2FLBT 1FAKT 2ZSVA 1MCRA 3B37A 3MP7B 3C5JA 4ICWA 2XZQH 4QOKB 3OV6A 3UBHA 4PV1D 3N4XA 4FA6A 4ABUA 4XMPL 3O6FD 3TNNB 1J2JB 3RWHA 5EU5A 1UXWA 3APCA 3ULUE 4JY5L 1RU9L 1A8JH 3L13A 1IGCH 4LF3A 5F89A 4K23L 1IC5L 2CGYA 2JB6B 2DOCA 5D2NB 1IM9D 1WH0A 2DWSA 4HKXA 1EH9A 3OAWA 3MGOA 4J5VA 1Y47A 5A6LA 1RUMH 1YMMB 2UV3A 1MFMA 4L1LA 4ZS7L 4Z5RA 4WWKB 5ETUB 3CCQP 2YJQA 4L3EA 3CHRA 3AABA 3BZDA 1RERA 1XMWA 3ATFA 3GMPB 5DRXB 4HT1L 4RQQA 5F7EL 1HCYA 3FRUB 3VA6A 2ZWSA 2WSFJ 3D34A 2Y9RT 2X7LA 1S6NA 2A9DA 5DHYB 2Y5TB 4J3SA 4ONGL 2YQ3A 3QAZC 4LSVH 4LGRB 2OMXA 4PV9B 1KNOA 5FK9A 5IBLC 1KMIZ 4ZTEA 3ZOAA 2FQGA 3GXNA 4OFQA 4JY6B 2ITAA 4ODBD 4CW1A 5KVEH 4FEIA 4D0CA 4GSUA 1SGKA 2BHUA 3BFWA 3PHQB 1X44A 2P1YA 1PYWA 3WU2H 5F0PB 1GJUA 1OPGL 1QZNA 2W94A 3PNRB 2VLJB 4AGLA 4IBQA 1PMYA 3T09A 3J07A 2W6AA 1CFQA 3QPQD 4FJ6A 5J3HC 4AE1A 1J8HA 4NKDB 2XN1A 3S6CA 4DP2X 3VG9C 2IFFL 3GMPA 5DRXA 4YPGB 4ODVH 2FH8A 5KS9F 4LDOB 3OSVA 3H25A 3HZVA 4NKQB 1BBJA 4OGQB 3ES6A 3T4AC 1NBYA 3QT2A 5HGBB 3T2NL 2HRPH 4H8UA 4NPDA 3V4PA 2DYSB 3NCYS 5KLVJ 3HPJB 3E8UH 4JM0A 3AITA 4NERA 3VG0L 2QA4P 1DDHA 3LXAA 5BS0E 1NCBH 5FYLE 5EZIL 3VGAC 4WAFA 1K04A 1F90L 1LD9A 4GINA 2D3VA 2IANE 3GD1C 1ZHKA 4KZDH 5AEAA 3KCWA 2YKLL 3L3DA 2LT9A 4MMZB 4Y1AB 5KVDE 1MOEA 5JA8B 2CO4A 1JI2A 2BASA 3BZFA 2XG5B 2VZOA 4HIHB 4O58L 2WZPD 4PV1B 1KCBA 3WNPA 3ZU8A 1J1EC 2BIMA 3MACH 3MRFB 3PGFL 1CI3M 4P5SA 4KMQA 1SYSA 4HEPG 2NXZD 4PJ8B 3VFMB 2CLVB 3F12B 3RX8A 3KWXA 5JQ6L 2R39A 3KQGA 2VDNH 3WIFB 4DEUA 4N86A 2EDOA 2AW2A 1M7IB 2RQ8A 5KYUA 3QDGE 3WLWC 1BVKA 3K3QA 1CDHA 1N8ZB 1CJYA 1CICD 2COVD 2WWNA 2ZKHL 3BEVB 1KB5H 1QSZA 3BCDA 2DQCL 4GW1B 2V3EA 5DS2A 5J13B 4GJTB 1S1CX 1RIUH 2ADFL 3KGRA 3Q1EA 3OXRB 4ZS6C 2GITB 1CZQA 3VSVA 1KGIA 1TFPA 4JKPH 3BYTA 3OKOA 1QP1A 1S7SA 4BUQA 3BZ4A 1R4XA 3RL1A 2IG2L 1XWVA 4L37B 3QWRA 4CMMB 5IOKA 3CC4P 1PIXA 4I1RA 4JFZL 3SBPA 4OB5L 3TV3H 3VI4A 3UH8A 4DO4A 4K3DL 3ZDWA 3VU2A 2YA1A 5IMLA 2R2HB 3HLAB 3VGBA 3KWUA 5D7IF 4ZMWA 3ULVC 1Y9BA 1Q9KA 1HWGB 4QRPD 5SWSE 4WO0A 3P02A 1D9KB 4A7PA 2DLEA 3DUHA 3NK4A 1FIEA 3ZGHA 3CZJA 3NDZE 2VUOA 4PJ0E 3DV6A 4KI5D 1KXVA 3BMVA 3FHEA 4EZJA 2P8MA 4LHJB 3VXQB 5HYQB 2P5EB 1INEH 2XV2A 4UF7C 4OJAA 2ZKHH 1JZ8A 1SJHB 2AVGA 3F7QA 4LLQA 3FW6A 1A6ZA 2WD0A 4NQDE 1S5IL 3ZQWA 5K1JA 4LE8A 5C0GB 4MQTB 4KVNH 1YEHH 5JUEL 2ZUXA 3TPUB 1IM9A 4XMVA 3P54A 1OHQA 2WANA 4N0YH 4HF5L 2UZXA 4UYPA 2V3DA 4WWKD 1DQMH 2IAMD 1FG9C 2HJKB 4E9SA 4H44B 1YI2P 3BPNB 4L29B 4L8SA 2XWJA 3RA7H 4BQCA 2ZCKL 4NZTL 1G87A 2H8PD 1ZA6A 3S37H 5D5MA 3GO1H 2JJWA 4FNQA 2A45H 4XPAL 4EIUA 3E1RA 4G7YL 4AQAA 5KYXA 2NZIA 4JQ0D 3DHJA 3L9EA 1HCZA 4YHYB 4HJ0D 3CC7P 1OPOA 2WSFH 1AQKL 2TAAA 5E0FA 4GIAA 4N87A 3H1KD 3L73D 4H26B 1S72P 5J6HA 1AVYA 4PB0L 2D3NA 4F7MB 3MRJA 5EU3A 1IB5A 4XN2A 4PBVC 5I0ZA 1XTGB 3VGAB 3IFPB 2KT6A 1N3NA 1ND0B 2HYMA 5IK3B 5BZZA 4MMYA 1H3TA 1NOHA 4GKSA 1T0MB 4OT1H 2UXTA 2O5NA 5KLVD 2E7HA 5TDPA 1OCOB 2CR6A 2DQMA 1U3HA 2AP2A 3BH8B 1B2WH 2JCWA 1BWWA 2AJZB 2YZ1A 3EFFA 4I2XE 1F86A 3SOTA 3D51A 2P58A 1S5HB 1L7IH 4NQXA 1GYWA 1NTKK 2B9BA 3PWVB 1W2KT 4G59C 1CL7I 1RZFH 5DQ9A 3VXTA 2X0UA 1BXAA 5E2UH 4HBQA 2A4CA 2OSLB 5JXEC 2M2DA 2DW5A 2KERA 4PP1C 4LAQL 2VXQA 2VQTA 4I0PD 2WPQA 1W0VA 1I1AA 2N3JA 1S4XA 2EDJA 3FAXA 2F08A 4AYBA 1B0GA 1GGCL 3AT8A 3GFUA 1KFGA 3PJNA 4FN0A 4KI1A 4DN4L 2XACC 2O5YL 2NUTB 3ZRCC 1P4UA 1Q9WB 4YDMA 5EN2B 5KAQF 4JYBA 32C2A 4GXUN 3MUUA 3D08A 4IBYA 3B5NB 2WC7A 5J13C 2UWEA 1YN7B 4PJ8C 5J06A 2R1WB 1BF5A 3PL6A 4UMGA 1WE5A 5BNXD 3B2UC 4P0DA 1IAOA 1BFVL 3FDWA 2EH7H 2VC2L 1X7SA 4NUJB 4XO9A 5I8EA 3WNJA 1U2CA 4W9CC 3I2CL 4QF1B 2X2JA 2FKWB 5LO7A 3MOAH 5AUMA 4OZGE 1AS6A 4JO3H 3GHEL 3DYOA 1Q0YH 1USZA 1BJ1H 4WFEE 4G9DB 5DVMA 1IT9L 2ZUQB 4H8HA 4AYFB 25C8H 1WFOA 5IG7B 3Q05A 3BJ91 4BZYA 2PCFA 4F33B 3L7EA 5GS2H 3TGXA 3RILA 4UI2A 4HEMA 3QCTL 4BFNA 2HMID 5F1KC 1MF2H 1QNZL 4B9GA 3QYMA 3C6SB 1WA2X 4KKLD 4IRJD 4NC2B 4XBEH 1TEFA 3ETBJ 5I1DB 2CPSA 4RRPA 4YFDB 4FG6C 5TPWL 1MLCB 2B9AA 2VSCA 4S1RL 4AL8L 1BHGA 5IEKB 3BT2H 1VF5C 3BC9A 3BMWA 2OQJB 3TEXA 1F4WH 2AK4E 4AYFA 1FC1A 3MOAL 3WDIA 4EMZA 3DVFA 3MCKB 4RMUA 3PTZA 1L6PA 1XX9C 3NZHL 4LSSL 4NPEA 5BZWA 2QR0B 4Z7OF 4N0CD 5C0IA 5HVGB 3WEBA 3O6KL 1UZ8B 2JCCE 3S0PA 1E4KA 2GCYA 2Q8AH 5A2IH 2IANA 2QL1A 2YPLD 1AV1A 3IR9A 1QUNA 2W0FA 2WLZA 2I5YH 1Q81Q 4HIJA 3GBMH 4PJDB 3UG3A 2YK1L 3B5GA 3EBIA 4XI5C 1CGYA 2XN2A 1XBDA 1MWAA 1WHOA 1A21A 3FB7A 3L3GA 1PZ2A 4G82A 2F5BL 3RKPA 3GMNB 1VFUA 3F7YB 4NWUH 1B9KA 1I1FB 2R23B 1XF3B 3QUMA 4I88A 5C0BE 3WUUA 3QEQB 3R0NA 2BVOA 3CUPB 1SP4A 3NH7H 2CDEA 3KDMB 1NLDL 1S5LE 1TQVA 4N2OA 2QJKB 5B4MD 5D1XA 2XT1B 2VXVH 1SQPD 1BZ7A 3EYOB 4HSQA 1LK2A 4JDEA 3L73J 1NPNA 3TA3D 1IK7A 1UACL 4XNQA 2NX5A 4NJ9L 2A38A 1QRND 2XKNA 5FGBC 2BS8A 1DJWA 2ESVE 5GGSY 2EABA 1IGMH 1AD0B 1QSEB 4LHUB 1LWUC 3B6SB 1P5UC 2O6CA 2QQKL 4JDZB 4RMWA 3ZT7A 4CKVX 4YE0A 5JOFA 1QFPA 1WA1X 4X6CF 4H88L 3WY2A 2MKVA 3P11H 3BUIA 1BAWA 2CG9X 4CRPA 1ZHLA 3NGBC 1ZXGA 3IDIB 3K2KA 3ISYA 2AV7B 5DVLA 4BKSC 2DQTL 4FFZH 4DP1X 2YPLB 4OCXH 3T4YA 1NCWL 4OLXH 5KSVA 1LTGC 2UX7A 3DSNB 3WHXB 3ULVE 3IN0A 1I9EA 3MV9E 3FT4B 3ROOB 1HIML 2K7PA 1PPIA 4GIOA 4JO3L 4F7CB 4E9LA 2ED6A 4F2MA 2FBJH 4N20A 5F96H 1WFIA 4GBXA 3TXAA 1VL2A 2P4AB 4KJWC 1UIIA 3T6XA 1DEBA 5E2TH 3E1ZA 4JDTL 4WO4D 2IF7A 3L5WA 3GUFA 3V6BR 1PQZB 1HSBA 4HALA 2BZCA 5M94B 2VDQH 1UT2A 2VZ1A 2B15A 2CHXA 3O4LE 4G8FB 1ZTXL 2W07B 1ET5A 3NEEA 2WGNB 4V1DD 4KKZA 3NIDB 1CXHA 1GL2C 2B4CL 5FGCB 5IB1B 5CD5D 5EU5B 4F7KA 5JPMC 3I50H 3PNWA 2L7EA 2XQBH 1SQXE 3ZIMA 1T0NA 1S3RA 1TTRA 2XFXA 3N55A 3BQUD 5T3ZH 4F7MA 1FBIL 3K72A 2VB5A 3SE3A 4H20L 1KN7A 5AB0A 2DLGA 1BWMA 1HIMH 3RVVC 4HIIA 4PUBL 5GHWL 4ZFZB 3UBGA 5DHVB 1E27A 4L3EB 4L5FL 4NZ8A 2ICCA 5T5NF 4I48A 1TT6A 2A99A 4C83B 1QFUH 5KSBB 1L0LE 1O9WA 1TZHA 1NAMH 4N24A 1F18A 1KYOE 2UY7B 4O02H 3I84A 4OUUA 3WMQA 4LARL 2MHAB 4ACPA 3UAJD 2QQLH 2XBDA 2DMHA 1MLBB 1KDJA 4YGAB 3M46A 5AW5B 3DX1A 1OKEA 3V5DA 3PDGA 1UFUA 5FYKU 5IJKA 3RWFB 2PCYA 3KPMA 3MJ7A 3V0DA 3Q2VA 1VPCA 3WJLC 1D7CA 3ZDYE 1M57D 1I31A 2R29H 2XQBL 3CX2A 1GK4A 3NSDA 1KB9E 1GGIL 3MJ8A 4ZW7A 2OMYB 3RURA 3S35H 1QD0A 1G6VK 3I6KA 2CHDA 5KEZA 3BCFA 1I3RA 2H6PA 5KVGE 3PV6A 4EOWH 5KVDL 1HGVA 1LP1B 5AAPA 5EWIL 2FYUK 1CIDA 1GGYA 5APSA 4DKFH 2KKQA 4P2QE 3VTMA 1U9KA 1IFMA 3MRLB 4MJ6A 1Z1WA 2WQRA 1GZHC 3RFZA 1W2BO 2IBBA 2FBOJ 4NEHB 4PJ5D 3HI5L 4YBLC 3V9EA 4L75A 4OZGF 1BZ9A 2D9CA 3OB8A 5KBLA 1S3KH 3QG7H 1Q9KB 1ADQL 2BIQA 3MHVA 4KAQH 4GO6B 4FQXC 1OM3H 1KEGH 1YEFH 1ED3B 5EU6D 2C26A 3S37X 5A2AA 2EICA 5DUBA 1KXTB 4NI6A 5AUMB 1Y18A 2WP3T 1XGRA 3WIIH 1VQPP 1NKRA 5E5MB 4LSVL 1RHFA 4OD3H 3TZVD 5F21B 4CILA 3VXUA 4X98A 2MEJB 2KS0A 3KWWB 2AHIA 5AVRB 1U2HA 3Q8EA 3ZBMA 4QCIA 3LQMA 5D8JH 4PV1C 3C6SA 5L4MA 4L8CA 2BP0A 2PYFB 2V4HA 2HN7B 5GISH 1MDTA 2N1TA 2FTAA 4POZC 3FBKA 3V52L 2NUPB 1R3LB 2X4UB 3N41B 4M6OH 5EU6A 4Z3IA 2A06G 5T5NG 2Y07H 5I1KL 5C0EB 1OB0A 2QSTA 4EIZC 1URQD 2DRUA 2Q3ZA 1MFCL 2Y22A 5G2NA 2ARWA 3SGDI 4B5ZA 1GDTA 3BPNC 5INCB 1YBKA 5IFAL 4M7LT 2E4TA 4NXSA 4OGXL 2A45G 1A4CA 1GAFL 1NCAH 1IKFL 5J7CC 3SDYH 4KROB 4LKXB 2X2IA 3V95A 3H9HB 1G6RH 3L2LA 3W5MA 3QJHA 2KS1A 5DQJA 2YIUC 1QR4A 4OV6F 3B4NA 1CLOL 2FNWA 1QPXA 3KLLA 4KKCD 5EUOA 2M5AA 3KYMB 4KOBA 3DWTA 4BHUI 5CWSA 1Z0MA 3F62A 1KV4A 3LKPB 4PS4L 3GSNA 3LXCA 2I32A 3FBQA 3IE9A 3PHAA 1C5CH 2XZRA 4UV7L 4BZ1H 3UZVB 5I8KH 4MD4B 3FXIC 1OW0C 3IBOA 4P2RD 5EOTA 1EAJA 4JFHD 1C5DB 5K9OA 3EKCA 4TQEH 1N3NB 1YYLH 1GSMA 1MFNA 3KPRD 3MXWH 4J6RH 2VLJE 2MQ0A 3KGTA 4KKPA 1M1JC 5EEXA 1KJ3L 2G5BB 2OXGB 2Y7MA 1L4AD 4R4LA 4S2SB 4YBLB 1MY5A 1A7RL 3NCCB 3RL0B 1KJ2H 2MOQA 3QCVL 4RRPG 5I30H 1ZLDA 2IBZY 4WW2F 1C8QA 4CVXA 3HAEH 4OFDA 4AOFA 3Q2CA 3ECQA 1PX3A 2O61B 1TTCA 1WGVA 4ZXBA 2QVAA 3WU2E 4KKNA 2NRGA 2RIKA 1PD0A 3T0BA 1K72A 2K6ZA 1TCRA 1AH1A 2PW1B 4ZUSA 4YE4L 3EFFK 1ZK5A 1TTFA 3GKZA 4KRMB 5ERWA 4JKPL 1KEML 3ZRFC 5JHBA 4F8PA 2GUOB 5FKAA 1N6QL 4CNIB 2D3JA 2Q7AA 2K88A 4BQBA 4QRPA 2OSYA 3MODL 4Q56A 1UWEL 3ABKB 2H3XC 1X5KA 4FG6D 5MI0C 4FXTA 2W0LA 4DPCX 4U1IA 3HD7A 3DIVA 4AQAB 5ETUA 4HG4K 3ARDA 3I02B 4HJIA 2X42A 3SYAA 2WTOA 4GW5A 3UAJA 2C34A 4HJ1A 4ZUSB 4M48L 1DUYA 3MVSA 5DZAA 3QUHA 3U6XS 1MFAH 3I6KB 4XNUH 1AI1L 1PY4A 4QXWA 3L73E 2DYRB 2YPKB 4GT0A 3TO4D 2WLJA 3ULSA 2LLNA 4XCNA 2YAFA 2VR4A 1NTMJ 2BRRL 2WLLB 2AJYL 3EG9A 1F90H 1IGCL 3DX7B 2OTPA 3RGVB 1T1ZA 3V4PL 1NTZK 4XI5D 1PYWB 5CJXA 4IBZA 1FUNA 1LWJA 1FZOA 3CK0L 4GY4A 4QTHA 4PWGA 4XCEA 1SY6L 3AREC 2EDFA 4Z7QF 2AI0H 2BVQB 2V5RA 1MAJA 4GO9A 1GZQB 2A2QT 2XNAA 3MKGA 4M4RB 4XP4L 4XTRD 4FQHB 5CMAB 1BGYJ 1EZVI 3CFDA 3BAIA 1FGNL 1R75A 1JGVH 4HGWB 4WU5B 1HDMA 4MDIA 4N2BA 3WMPA 5FWRA 2BCCG 1YHPA 5F1IA 3CZEA 1A1MA 4IFMA 1NUDA 3GPSA 3MV9A 2K9YA 3KEHA 2X87A 1GU4A 3UTSD 2HJFB 5F70A 4UQAA 1ZLVH 3ARGA 5DK3A 2WLYA 1EHLL 4F8LA 2K70A 1A14L 3EF7A 4DW2H 1NOAA 2EDNA 1F8TH 5HGHB 4TTGA 1B90A 5KSAC 1JZGA 3HMXH 2JP3A 5FAAA 3QC6X 3GZOA 2EC9T 3VMZA 1CYGA 3LV3A 3VH8G 3M1CA 5ILTH 2HT3D 3AXLB 4XP5L 3MMEB 4BXLA 2EE9A 2OX5B 4ODVL 4UM9D 2ESVA 1JZHA 4FNSA 3KGSA 3KL0A 5EO0B 1RF1C 1N73C 4ZT1A 4ZNEE 1WZMA 3AG1B 2CUHA 1I1AD 2XI9A 1I1YB 2GTWA 3MLYL 1FVCA 1U95A 3GSUB 4TSBL 3WKML 4YEEA 2VSKB 4Y5XA 1LWHA 4PSPA 2CJSA 4B9YA 5E1AA 3EYFB 1MJJB 5KLIC 3CWBG 4ZODA 4KX8A 1JPGA 1YPZE 3B9KC 2VDKL 4WI0B 3RL0C 4OGAC 1N70A 3NSXA 3T6QC 1MIML 4LSUH 3U46B 1OFCX 4XMXA 3ZUCA 5GJSH 5KYWA 5FYJE 5F1SA 4HFUH 2AQQA 2E27H 1I7RB 4N0UA 3MBXH 1MCEA 4PJEA 2QKIB 1WFTA 4BSVB 1E5ZA 4PRHA 3ZZSA 4HMDA 3HHSB 2JQMA 1TJIL 2JCCA 4MDJA 4NN5C 1ZT7A 2EE0A 2O61A 1T89A 5EZOL 4U1HA 4MNQD 3F7VB 4Q2ZB 3IS1X 3LAFA 1S7WB 4AQOA 4Z77A 3T2PA 1PP9E 2YD6A 3JUZA 3WEXB 5EF2A 4KDWA 1UM6L 3W56A 3WN5C 3P4LA 4TN9A 4XZUB 2GEEA 5GRXG 3P8CE 1S9VA 5I6XB 4ZD3H 3FB8B 3JSSA 2MNUA 3RDTC 1AR2A 4QXTA 1WO2A 3RG1C 4MASA 3MRDB 3FQUA 2OMWA 4D0BB 4W9DC 1JZ2A 2SEBB 3O9WD 4OFPA 2NYZA 4JRXB 3TBTA 2C4FT 5AW7B 5BUAA 2DKSA 3HB3C 1RK7A 1BVOA 2DIEA 1VFBB 5B3JF 4XN1A 3GLMA 2IG2H 1B3IA 4P2YA 1NTZJ 4F80A 1GL2B 5CWSB 2XN9B 5T5FA 4G7SB 2JFCA 1NJ9B 4MB5A 4NM8H 5E6SB 1KTBA 4AGNA 4WVRA 4F8NA 1SVBA 3FO0H 4N2NA 4PR5B 1D5XB 1MRDH 3MA9L 1FNLA 4Y5YC 1MNUH 1IIKA 4ZFZA 4A6YA 1U30A 1XH3B 3EJPA 2VRSA 3UZVA 4R96A 1TSRA 3GUTB 4W9HC 3RPIB 2NPSA 1JGDA 2VW7A 4TUOB 2BFVH 5EULV 5LQBH 4Z9KB 2CM6A 4J3OD 1XGZA 1CE1L 4QTIH 1E3XA 2EDRA 5E4EC 4BGDA 3QDGA 5K9QG 5ELIA 2DQGH 2IXQA 5DQDH 1LT9B 2HLFD 1KJ2B 2VR5A 3BH9A 2KZIA 4X8CA 4LSQH 3VFUA 3CLWA 3K8MA 1B6UA 2ZUUA 3LIUA 3LMJL 3NK3A 3ZT5A 2DLIA 4QRUB 3K5SA 1CTNA 3WN5A 5CD3A 2WKOA 1KWKA 4OLVH 3FUFA 3E6FB 1DQQB 4QXGL 2UWEF 4Z3TA 3L70G 1JK9B 3DOSA 5C6TH 4JFDE 4NPFX 1HT6A 2W90A 4DN4H 2JDIH 5DVOA 1EQWA 1SYVA 3DPBA 1EAOA 5EOCH 3FQXA 1QRNA 4JB9H 3KPSB 4KVCH 3RB7A 4JR9L 2Q7YA 4L18A 3AQYA 4ZTOL 2CJUH 5IB3A 3H1HE 4U6YA 1IZKA 1KTMA 4R2GB 3ZTEA 2VQUA 3GKWH 5B8CA 3DVNA 4JG9A 1UACH 3H9YA 2AXFA 5IQ9A 4CSTA 1I9IH 4YDKL 1GMEA 4XMKH 5EORL 2OQQA 3H9ZA 4DSYA 1T3FA 2GW5A 3NN8B 1Z9OA 4K5NA 4GAYB 5I1LB 3LEVL 2HFGH 4BV1A 4OAWB 2F7OA 1KQLA 3MGTB 3AREA 3FH7A 2HVBA 1OD9A 4BH7B 1JMXA 1YEGL 3D0VB 3RVTC 1LTTC 2IANB 3V6OA 5C0EA 4WDIA 4IKNA 1XGUB 5I17A 2WCGA 4KTYA 4IFFA 1KCUL 1XGQA 5EEUA 3X1EA 1PZAA 3HZMA 3P30L 5DU7A 5E8OB 3S7GA 4OBSA 2J1XA 3JWOL 3WY4A 4DK6A 2PAJA 3FB6B 5IF0B 2YMKA 1IKOP 4I18C 1FNSL 1FCGA 3HZYA 5F71A 4HWBA 4MQSB 4AJVA 5H35A 4OLUL 5F7WC 3MRRB 1MW0A 5DS8B 4LQFH 3D25A 1Z9MA 1XDTT 1MFVA 3JTTA 4K7PY 1ET8A 4KGJA 4HJJH 3CX5K 4AUWA 3V0JA 4K8RD 3VX0A 3X3FH 3BPOB 3PP4H 1BZ9B 4PN6A 3C8KB 2B77A 1DVXA 2F53B 5ESAA 1L0NK 3QS2A 3D85A 5DJ0A 2E75D 1GHFH 3CPLA 1ZD6A 2XXCB 1F1AA 3GS4A 4GP8B 4R4NC 4F91B 4UTAH 4O2CB 4Y16D 3HS0C 4KRPC 5LG6A 1OM9A 2DWYA 2F7PA 2OX5A 2EVJA 3RIAK 1BM3L 5ALBH 3T2OA 3O9WB 3CSPA 3LV3B 1H6TA 5LJYH 4CL7A 3SDAB 5FB8B 3VXUB 5K9JL 5CCGE 2IWEA 1UYWH 2R0WL 1USDA 3NIFE 1IARB 1ONQB 2QV2A 4CSZA 4PP2A 1CR9H 2DY2A 2Y7QA 3D85D 2ZP0T 4F7TA 5D7LD 3LN5A 1ORQB 5DFVD 1I3UA 1E28B 5CN3A 1RJYB 5EBWB 5EOCL 1RSYA 5HHOB 1ZRTD 1IC4H 1UOKA 1BVLA 3VWJA 2H88C 3MZWB 4NO5B 1XH0A 1J8HD 4UM8A 3CSTA 1YO4A 1RMFH 3PRZA 3TZVB 1TPXC 5DYOB 4QHLA 1KYOJ 4FQIH 5B38B 1ZT4A 1AANA 2KOGA 2NCEA 4NN5B 3TWYA 5IB1A 4U1NA 2DMKA 3II3A 3M17A 3C5SA 4TF4A 4XN4A 1TLKA 4YUEH 3VH8A 3EYOA 3LS4H 3HI1A 2DS4A 1Z2KA 5D1XB 2DWDA 3IVKB 4BGLA 4R5TA 2Y7QB 1JN6B 1KT2A 1SBSH 1WF5A 3DTDA 4G8GA 1KJVB 1ECYA 3TM6A 3WELA 1ODAA 4KHTL 2HFGL 2LVCA 3ZDYF 4DGUA 4UQ3B 1UQSB 3EUDA 3VXMA 3FWLA 1T6VN 1D7MA 1KJMA 3ETBF 4NZTH 3IFLL 1JTHB 1OX3A 4HAFA 2Q8BH 1QW9A 5L0QB 2HT3C 3E2HB 1QKZL 1WUNT 2NNRA 3DOIA 4L3CA 4WY4A 1H3VA 2VMDA 4TVSa 5D2NC 2AEPL 5SX4H 1TQBB 4KGLA 5GTIE 1BCCG 2WHVA 4YR6B 2YPLA 3T4YB 2XICA 2DEXX 2Q8AL 2ED8A 2UUDK 1NU1K 5KBPA 2AJUH 5KANI 3A4FA 1M05B 4ODHL 3F7PC 3TEUA 3VH8B 1TENA 3MI6A 1T0PB 4DGVL 3V8OA 1WDAA 3ZE1E 4ENED 5L2KD 4NQQA 2KLTA 1WBYA 4WY7L 1AC0A 4HWBH 3BN9C 4I87A 5IHZB 5CEZL 1SOXA 3MLZH 2L5GB 4JW3A 4HKZA 4A7QA 3T0DA 4P4KC 1TVHA 3SDAC 5I1JH 2YD9A 3MRJB 3IU4H 1L0LJ 1EXJA 3EO0B 2BNRD 1QATA 3RHWF 4ETQA 1BQHG 3KM2A 3JTSB 1WC7B 5IREA 2P49B 2B1HH 3FONA 2OCCB 3ZR5A 3T3ME 3MJ9A 2HVKA 4UAHA 2WWMC 4J8RA 3T08A 5CP3H 5F7AA 1QBMH 2QVFB 3TL5A 6PCYA 5GSRB 4RSYA 1E9PB 4XBPB 3L72G 4KROC 3VM5A 5FO8B 1FOSF 2HPCB 5F2FA 1FRGL 3H1JE 4BRJA 1UD2A 4LLWB 1MREH 6CGTA 2FEDD 4MMXB 2P28B 5CNHA 3MV7E 4WJ5B 1XFPA 4R2GD 1J05B 5IJDC 1X6NA 2A6JB 3N91A 2TRHA 4FMFA 1RQVA 4NNXA 3SKMB 3QJXA 4XWGH 2XZCL 2BIIA 4R4BA 4GO8A 4EZMA 2YO2A 4TNVK 2BS71 4JLRB 4ZOBA 3UTTA 3GLAA 1D6EA 3KL5A 4XPHL 3BWAA 2O1KA 3PGCB 1U8NB 4Y8AA 3M06A 1IAOB 1IC0A 3OZ9H 4GQRA 5LB1A 1G7JA 3C1LA 4KY2A 4AQ8A 4LL4A 3MR9A 3OG6B 1CGWA 1NIBA 3I2CH 4M5SA 3IK2A 1GZPA 3BPOC 5CJBA 1CLVA 5T33H 1WRFA 3BLKA 3N42B 5ACLA 2A4EA 5KS9A 4KT0J 4L9LA 2FFDA 2Q1KA 2BVQA 4NM4L 2R5BA 1VIWA 4FFZA 4NUJA 5B1AB 4EBQH 4MYWB 3QYNA 2JTYA 4OVNF 4MX7B 1X3DA 2EYTB 3ZL4H 2YLHA 1DO5A 1JCVA 8CGTA 3AREB 2X7LB 2ENSA 4MLIA 4PD4I 5JIDA 1RK0B 1VLXA 4YSOA 1YEDB 2WUBL 1U41A 4EI6B 1IAII 4AENA 2EUZA 4WDIB 1SBBA 5DK2A 5E9DB 5KYUB 1S7VA 2VQ1A 4H1LB 4E5XA 2BNQB 1A6VL 4ZMQA 1ORSB 2X41A 4BK5A 3EFFB 5C2BH 3LKQA 1F3RB 4YO0A 1J5DA 2IQAA 2EDQA 3MV8A 4WI7A 1M2VB 2O3JA 2ZT9B 1JHTB 3OPZL 3FO9A 4PG9B 3Q3GA 5IFAH 1KYOD 1PKQA 4G1EA 4H0IA 5HGGS 2X6VA 2Q10A 5T1KB 5KTBA 2NY3B 5DUBB 2D0HA 2IBZG 3W9DA 2YXVA 4LLYB 1II4E 1OARH 2QJYB 2BCMA 2CIKA 4R5VA 4JANB 1L9MA 3EOYG 1V7ML 3WEAA 4EVNA 3OKNB 2AMUA 3QGVA 4HS6A 2QBWA 2EUWA 4BZ1L 2E5YA 2QPFA 2R8SL 2B3IA 1JD9A 2HKHL 3E2HC 3DJ9A 3FHQA 2Q9IA 3QYCA 2JELL 4FXGA 2BC4B 5JW4N 3FSAA 4HU2A 4IKLA 4Y1AA 4IOIH 3JBG7 3DHPA 4LQ1A 5SV4A 4NZDA 5CFAA 2E5EA 3DXAA 4LCUB 3VUAA 3OGCB 5JW4R 1IBFA 3V4VA 1FFTB 1S5HA 1L0XA 5D7SH 2YAQA 2R29A 4ERSH 1H5BA 1QABA 5CCKH 2HG5A 5BUGA 3V5HA 2QSCL 5DJUB 2YGOA 4X7FC 1FG2B 4P5TA 2E42A 4WNQA 3IPFA 1H8NA 1UT1A 1PEWA 5DHXB 4XAWL 1HNFA 2UZXB 4U1HB 1FYTE 1L0LD 3RZCD 2J1ZA 4P9MH 1H8AA 3E0GA 2OYHC 5CZXC 1T0OA 1JGIA 5HYSB 5MENA 1MCIA 1G7QB 5D71H 4Y89A 2UXFA 2DQJL 4LSPL 4LVOB 5D1QE 5E4AA 4YSPA 5KTEL 4PVMA 5B38A 3LS5L 1GU5A 4MJ5A 2XKMA 1TEGA 2H43A 1GSKA 3Q8FA 4GODA 2YNYA 1ZT1B 3CZUB 2DQFB 4WY4C 1P53A 1F3DJ 3OMAB 5D2NA 5DD6A 1JEKA 1LILA 5IWLC 4WKZA 2UX6A 2L91A 2W0PA 4WTQA 4X9FA 3B2DC 4C56A 1BVNP 2HMIC 2JKWA 2VDOB 2Z6FA 1YQ4C 1XCTA 3IF1B 1Z32X 3FSOA 3O6MH 4FQCH 3ARXA 5FO9A 5DEJA 2DQIH 1T4KB 2WLIA 1LQBC 4BQ8A 3BH8A 4JO4H 1X5HA 5ACZB 2NZ9C 5HHNB 1BGYG 4POZD 3SCMD 2H32H 3UO8B 3VXOB 4QPEA 4AQZA 1PGQA 1OTTC 3D0VA 1SJHA 2B59B 5T1LA 3EYQD 4R4FL 5FOBB 3UAAA 1QLEB 4NWTL 4WWNA 5DSCA 3MCLL 5AQ0A 4WUKL 3I02A 3RBSA 2NW3B 3MU3A 1OT4A 4MXWH 5I76A 4Q7DA 4Y4KA 1EJ6A 4HUUA 4OIFA 4UDUB 4K94H 4DGIH 2XA3A 4JE4B 4NSKA 5FXCH 5B66H 4L4JA 5LBSA 5KLVE 1J86A 3BDXA 4DAGH 3UIYA 2WQ8A 1K8IA 5KSBF 3Q6FA 4AIZA 2A6KB 4JJOA 3W68A 3VU1A 4XX5A 3CI9A 2WYIA 1C08B 3VXOA 4KZEL 1Y6MR 5FYKE 3PJLA 4NQSA 2K0RA 2FJGB 4ZPVA 1A14H 4IDJH 3RDJA 4L4VD 3N50A 4PI0A 4PGDB 5HHOD 3T2LA 3T8VA 5TQ0L 5IUSA 3MJ7B 3HMXL 4OLZH 2ZCHL 4M7LL 4NAMA 1UZ6E 3SDDC 2DWTA 1KV7A 1BDCA 1I7RA 3N06B 1JGLL 4YPCA 1UJ3C 2F8XC 4BE6A 3LY6A 3KAAA 3MLPA 2FIKA 4YSDA 1JFHA 3NMDA 3HZKA 4G8IB 3CCHB 2NXZC 2NPLX 3DBSA 4LNVA 3R7QA 3K6OA 4XBGB 4AIEA 4XMWA 3M7OA 2HX7A 4QRAA 5DQDL 3QDAA 1G5AA 3K4DA 3POHA 3ZZQA 4BFIA 2VL5B 3PAYA 5LVEA 2P5WE 3IAGC 1I8KB 4OAWA 4RDQG 5EG6C 4BEIA 2LXBA 1BQHA 6FABH 1QL1A 1T22B 1DSWA 5AYQA 3CXHD 5KS9B 1AGCB 1ZVYA 2O6PA 2R44A 3U9UB 3P2DA 2VXTL 5J57B 3WIFA 2HLAB 2GBAA 5L4IA 1JL8A 4LL9A 1RKRA 2WXLA 3T65A 1E4XH 2M0BA 4A38A 1D5MA 1NC2D 5AWNL 4X5XB 4QOKE 3I9GL 1KCSL 4HLZH 4CJ1A 5IB5B 1IFHH 5KKZC 1J1PH 1AJ7L 3LN4A 4YXLH 4IU2B 2C1PA 3SPGA 5FECA 4K71B 4PD4D 5GISL 2WWMD 4M7ZC 3CWBJ 3OKOB 2ZXWB 1MIEH 4Z7NB 3N40P 1XR8A 2EIZA 3KLHD 3HD7C 4PRIE 2BVPA 3QIUA 4XNXL 3HIZA 2M8XA 3ETTA 2WZ5A 3T2NH 4RGNE 2H2PC 3H85A 5IW1B 1JE6A 5CBEA 2BEZF 3FYIB 1HVXA 1E2WA 3VYPA 4JFSA 5HDQL 5SWSA 3QUYD 4PJXE 2O1JA 1FDLL 2WBWB 2YUZA 1K8DB 1HHKB 3II2A 1XT5A 3JUYA 5E2UL 5E6IC 5HYJE 4V2BA 5EDSA 2IAND 1IC1A 4P23D 1S9WB 5J0BA 1F3JB 1L0QA 2QMJA 3ZKMD 4AQ1B 5GGVL 4N1CA 2QVIA 1ZLUH 1SQMA 2WYTA 1R0AL 1HJCA 3ROLA 4IGBC 1NUFA 4LSRL 2R4SL 3T8XA 4PJDF 1TVHB 1NWQA 3SIKA 4NPYB 3LZQA 1S5IH 2IWGA 3HG3A 2QSIA 2O01J 4URKA 4P59H 1MWOA 1VQLP 1AHWB 2EDTA 1NO4A 1VEMA 2BERA 1LO4L 3BH4A 4ELKA 4Z7OB 3D6YA 3GT6A 3TBTB 1X9LA 1N5AA 2C1OA 4TLTA 3ZDZE 3TA3A 3CBJB 4G6JH 4J2XA 2OXHB 3BP5B 3QCVH 3RK2D 5GJSL 3TT3H 3KYKL 2HWZH 4X99A 1MWAL 1KTKE 2G5BA 2J2ZA 2X44D 1YYCA 1TXKA 3L37A 3BVVA 3ZTJH 4I2XB 4ZUTB 1VKXA 1VFBA 4JUSA 1EEQA 3HBQA 1AGEB 4X2UA 2Q6QA 1JPTH 3B5HA 4OJCA 4KHXH 5EIVA 3BKMH 2BZ7A 3DO7B 3FU0A 1KZYA 4M3HA 4GKLA 1KJVA 1YMMA 1T66D 5DHDA 3P9WB 1MFTA 1KGCE 2JKTM 3SE8H 1ZTMA 3TNUB 1SXAA 2RFXA 3NZ8A 5FKAB 4JG5A 4OJDH 4GKSB 4V33A 1SLWA 3MROA 5D7LA 1UEYA 4LOUC 3LH8A 2NY3D 2HYNA 2CJUL 3A6OA 4N0UE 3RAJL 2G9HA 4RZKA 1H0DB 5IHUL 3JC22 1U58B 3L72E 2X5PA 3VWJD 2C7UA 1NCDL 2MIZA 2DDQL 3QH3B 4KUCF 1HZLA 4HZ1A 1G5GA 3GBEA 2YWZA 2YAEA 2Z34A 1YJWP 1OAQL 2CA4A 2RGSA 3CD4A 4GXVL 3WI9A 3RYMA 1JDAA 3BZ5A 1FPTL 3FO0L 3GPEA 5FA4A 3UBXA 1DVTA 5C9JA 2FX9H 3OAYH 4HIXL 2HKFL 3PWLB 4Z76B 4R7LA 3RWJA 5DURB 2HRLA 4EUPA 2R56H 3IBEA 4UB0L 3GB7B 5C3IA 4HIEA 4XP5H 2YC1B 3QIWA 1KN4L 3GBML 1TDQA 3MREA 3X3GH 2ZG3A 2A74B 2Y2TA 4TRPL 3TNNA 2PYFA 3FH8A 4PJDE 2ICEB 1INQB 2VXQL 4KXZH 2VMFA 2WPSA 2GBUA 3CVIL 3V5DB 1UB5B 4LSQL 5DJ0B 1SJEA 5HJ3A 4KH2A 3U9UA 1AQHA 5BVJB 4Y1SA 4XC3H 4LLHA 4MKTA 2CCVA 3OJMB 4ZRGA 4UDUA 1DN0B 3CN4A 4F2MB 3UPAA 3H6JA 3N3EA 2A06D 2EH8H 1J5IA 1OB1A 4U3FE 2X4RA 4MWFA 4PLJC 4QRQB 4U05A 4P46B 3OD3A 4UWQB 1YEIH 5GRUH 4DGWC 4GB9A 1MI5D 3MRFA 3CMAP 2RJMA 4KVPA 3PPEA 4C55A 4Y1AE 5SX4I 1KYDA 3Q1MA 2VAAA 2WXRA 3HUSA 2CR3A 4LGSB 2BNRA 1AG0A 5B7MA 3LPPA 2JSFA 5HVHC 1M9SA 2NTSP 4WFGD 1WFMA 4CNIA 1KILA 4U6HB 1SQBE 4L5FE 5B8CC 2EXWD 5ILTL 1F4XL 5FHAH 3WIHL 4YDVB 4NPKA 1A1OA 3A0BE 1E5UI 5T3XH 3NZUA 4UTAL 1AKPA 4YDLB 2KIKA 4E9VA 1IFJA 5ADPH 1FO0A 3RI5F 1JGEB 3X14B 5H4ZA 3L4FA 1EHXA 2E3VA 4HPOL 4MBOA 4G83A 2CIIA 2HTKD 3MRPA 3N44B 3RP1A 1MCLA 1OSEA 2IAMB 4W70A 4YHIA 1IQWH 4WI4A 4KXDA 4WY4D 5GGQL 3B7TA 3HI1B 3L3OA 2VLRA 4MB3A 3H53A 4H8WL 1WT5C 1KILD 4WEBL 5TQ2L 1I9JH 3WSQH 2YR3A 3W39B 3NJLA 4O9HH 5GGSB 3TVMD 2DEYX 3PJSK 2CRZA 4BWTA 1JWSB 3BUDA 3IGKA 4KZCA 5E95B 5BPPA 3TBVB 3K80A 4K2UL 1I1AC 2PPDA 1RH8A 4J3TA 4NB7A 4J6IA 3GTTA 2BP5M 3APMA 4AITA 5D1ZB 4XWGL 4HULB 1TJIH 2KLSA 1QLEH 1FBIH 3HRZB 2F54B 3CMGA 4A66A 4ZNCA 3U1QA 4QRPB 1AACA 2C9VA 4U2ZA 2H0FA 4XAKE 3UDWC 5BVPL 3L1OL 4RLDA 5I5MA 1WZ1H 1ZLWK 4B9FA 1BAFH 3P69A 4HAKA 4EUPH 2NY4B 4ZAKB 1UD8A 4DERA 2EADA 5D7IB 4ODXA 1HAUA 3VCLB 1JRHI 1FN4A 4H8WH 4WUUE 3WUTA 1DUYB 2BM3A 1K8DA 1AZCA 2GUVA 4PJGF 4WGVB 3SDXA 4NQCB 2WBJD 12E8L 1L3WA 4JCWA 3V6IA 1FDIA 5F89B 3V6ZB 3OGCA 3L7FA 1I8MB 1FZFA 5E08H 3FTZA 4DFIA 4FXKB 3L3JB 1ACZA 1KPVA 2AJUL 2MNWA 3RZCC 1TQTA 4R2GC 3UJIL 2XVBA 2OCJA 2O72A 2IVFC 2Q5UA 3GI8L 4X42A 4AJYV 3QDJD 2Z8VC 1ZLSH 4Y16A 1CD9B 2VKWA 4QRRE 1F41A 3ARGD 3RK2B 4B6ZA 5IV2B 2WBJA 2JI3A 2E75C 4MKMA 3CH1A 1KNOB 1HX0A 2GABA 3QDME 4OFYA 3NRPA 2Q76B 5K9JH 3QZOA 1WEJL 1IZJA 3G5WA 3HHMA 4NIYE 5FYJU 2AAVA 4LRNL 2WBXA 3MRNB 3FSVA 1KPUA 4V2CB 2BXYA 1JO5A 4ZXBC 4AEHH 3NCFB 3DETC 1SVFA 2IBZI 5GTHH 1UXSA 3G5YB 3ISWA 4HK3N 4HV8A 5EC2A 1QEXA 1DBAH 2MMXA 1UOLA 4MQ7A 4NN6B 3H1HG 1G7PB 3UJJL 2IDCA 1X5AA 1M90Q 1N0XH 4IL6H 3FQNB 2WWKT 2CO6A 4IBVA 3FFDA 3D39D 5CLTA 2X38A 1UH4A 3F7VA 4KHTH 2A6IA 2AEIT 4JFDB 3ZYIA 4D8OA 4L2YA 3ATDA 4QHMB 1NGZB 4FQLH 3S36L 4JPQA 2Q76A 3W0WD 1E3ZA 2KQNA 1HXMB 3GMQB 3QIBD 4OLYL 4XNZB 1E4JA 1J1XH 3MFGB 2BVYA 4QCIB 1QFOA 2VRAA 3SBQA 1DBBH 1MJ7L 3CQFA 3RL0D 3ZGIA 1AFOA 1VQ4P 3TN0B 4ADJA 3MSPA 1MVUB 1AGCA 2VLJD 4PCSA 1MN4A 4PRNA 3WTSA 2MHAA 3DX0A 5HDLA 1G1YA 5ANHA 3A2AA 2YUXA 2WT7A 1GAFH 2IYPA 4JFHE 1NTDA 3MV8B 4MQXC 1L9QA 1AS7A 2VKXA 4K5MA 4NRYA 4RGMB 5I26A 3MTUE 4CC4A 4S1QL 4YHML 1UJ3A 1JNLH 3M9QA 3JTBA 3DO4A 3EGDA 2J58A 3O8XA 2OS7A 3MV11 5CEZH 4QHUA 3IFOB 1CE6A 5ISZA 4NSKB 3C9NB 2C9XA 2WOYA 2ZG1A 3F7KA 1N0XL 4N2CA 4NZUL 5CSGA 1ZHBB 3QUZB 5HGAB 3THML 4P2QA 4ABQA 1LHZA 3CFEA 1BM3H 4YNYA 2QHRH 1UURA 1UWXH 2BVPB 2WUBH 3L5HA 3NJFA 3QIUB 2OYIB 2HT4D 3WS3A 4H13B 2B5IB 1A4JB 3F85A 2DM7A 4EXKA 4D7PA 3EBHA 1U8CB 1X4XA 2VDQL 3AS2A 2R2EA 1E40A 1QFHA 4LHQB 3WDHA 4ALAH 2ZF9A 5LXVA 1C08A 3VVWA 3VN0A 5L2KE 4FFVC 2O26U 5MEPB 1KJ2L 3MBWB 3IJHB 3J7HA 5D6CA 1MH5A 2D7MA 1IQDB 3QI9A 3IJ7A 3D07A 3LZFH 3ESUF 4EI5B 2ENJA 1RZJL 2AK4B 4JBSA 4HX1A 3Q43A 1HEZB 1XEUA 3AS3A 3QHZH 4ZKUA 5IQ7H 2P48B 3GDCA 1I4FB 1TJGH 1OARL 1U3JA 3ZE1B 3CC2P 5FV2A 4M8UA 3BN9D 4OD3L 4HJGH 4XPHH 1AHKA 1DLHB 2VL5A 2YPLE 5F1NA 5IMKA 5CCGD 4L5FH 2E0PA 4WEUD 2CPBA 1NGQL 1N73B 2JF1A 4O5LL 3C5ZC 1BX2A 3GSRA 3TZVC 2FT6A 4XT1C 4XVTH 1B4LA 1U33A 5I8OH 2AK1H 3PXLA 4MD0A 1IL1B 4MCYA 4PJ9B 1CDYA 1Q0XH 4H25A 4WSKA 2O5XH 3X1NA 5E4EB 3U48A 3V7MA 4IGBA 4TQIA 5HDOA 5FLVA 2Z64C 4L4VA 5L6YH 3C87A 5FB8A 5JORA 1QWUA 2IH1A 4RRPM 1FFQA 1NCAL 1EHKB 4QYOB 1D5BB 3VXSE 1PDKA 1HEHC 3ORJA 5L7XH 4OWFA 3MRBA 3ARRA 4NQED 5DJ8A 1G4RA 1BVLB 1WFJA 2VZSA 4MFHA 4WI2A 3VWJB 1BVKB 4OLYH 1DQIA 1R3IL 1ZJAA 3BGMB 2KYIA 3G9VA 1B4TA 3EIFA 4GT7A 4N0RA 4X6DE 3TBVA 1BSIA 1UVQB 2APXA 2IDBA 3U2SA 5F0LB 1G1KA 2KZ1B 5AENA 4KAQL 2ZX7A 4HKJA 1NTKE 4AV5A 1FOSE 1HOCB 3E3QC 1PZCA 1F3JA 2BXZA 4NQEA 4P5TB 1BP3B 4OTXH 5K39A 2P5PA 3MRMA 1DBJH 4H7VA 1F6AB 1RUAH 4G7VL 3WFEL 2WITA 1BOGB 4ODWA 3GZQA 2E6QA 4UAOB 1KT2B 1AHWC 5JPNA 4BFEA 1F42A 1MCCA 2NSQA 2I26N 2GIXA 1RUQH 1QWNA 2QQNL 1YYML 4EN3A 1QSFE 3Q5SA 2OP4H 4F1SA 1DL7L 3RK3E 1CYXA 2NY1D 2DQHH 4LT7A 4NZFA 1IAIL 2Y07L 4XXCA 4AXWA 3HC4H 1U8QA 2YWYA 2HJFA 4UUJA 4WFGE 1JHLL 3ZE1F 1OGTA 3BYYA 4BK5C 1A6ZB 1XV8A 2FJHA 2VLKE 3LZFL 4P57A 3KEDA 3MFFA 1BSHA 4X6EA 3IU4L 5JO5B 3QR1A 4U3HA 4NFDA 2WY3B 1BEYH 3H1JG 4PJAE 1JZDC 2PR4L 1VQNP 3EOAA 3WKMH 1KMGA 1IGIL 4LLVB 1DE4A 3WD5H 3IXAB 4MS8D 1KGJA 1NWOA 2WBJB 3GNML 1LE5A 4P23B 5BW7C 2O93L 1U4EA 1NTME 1BQUA 2R59A 3G4SP 3QAQA 1FL6B 4DP0X 4JO8A 2ZCLL 2Q7YB 1PKOA 3TNUA 3H42L 3QQ9D 4XMUA 4F57H 2F8VA 3TVMC 3V6OE 3Q8CA 2QMKA 4MLSA 3WIAA 4CJ0A 1DUZA 1YAZA 1BFOA 2CGRL 2YN5A 2GA1A 2Q3IA 2Q3XA 3FSZA 2Y6SC 2YEVB 3HMWH 4TQEL 1LMIA 2DD8H 3TFBA 4Z7NF 1JZ3A 2ZG2A 5KTEH 5AVXB 2X89A 2FXMA 1V55B 5EEZA 4FKKA 3MBXL 2I69A 4K07A 3F65A 3WFHB 1J0HA 3ARWA 4C54A 2LLGA 3UTSB 2EIMB 1QSED 4LHUD 1PZDA 43C9B 4P59L 1M8OB 4KZ0A 4YDLC 3P2BA 3DVGB 4FMKA 2ADJA 4M29A 3SWKA 2ED9A 4G7RB 1ANUA 3H1KJ 3QXWA 4TVPL 5FA4B 4NUGH 3WJJC 2YRBA 3EJYD 3IGAB 1E90A 1OW8A 3KPRA 2R7EB 3SPIA 5DJTB 4K7FA 1JGVL 5L4JA 1KB9K 3WD5L 1UWYA 2WB7A 4PJ0H 2WXMA 1XXFC 4NQUA 2N01B 1GW0A 4C7NB 1MUJA 2P5WB 4PM1A 4OZFH 3TEWA 2LKMA 1HXKA 1N4XL 1AP2A 4JQVC 2ZZUT 5IGXH 5E6UB 1SXCA 4R90H 3BQVA 3K91A 2YFNA 2WM0A 2CCLA 5CD3B 1E6OH 3DURA 3D69A 4X5WB 3QCUL 3AAZB 1R5IB 2WVTA 4P2CG 5J1AA 5AAMC 4CMMA 5DYOA 4AGPA 1EO8H 4OZIF 2K78A 3IN2A 1PLBA 2XUWA 1W0VB 3ZO0A 2I27N 4HS3B 3NRQA 4JHVA 4ASVA 5A6MA 4YLQT 3I6GA 3ES6B 5LGHL 1S7VB 3BWZA 4UQCA 3EDKA 3ULVH 5L9DH 1DJXA 1DJZA 2DDQH 1TU2A 5AVZB 5A43C 4X9IA 4HOXA 1Y6KR 2GFBB 3CWGA 4HA1A 4HIPA 2NPSB 5DEGB 1TF4A 3QIWD 3N6YA 3TJEH 3ARDC 2OULB 5D7KD 3IJYB 2QEXP 3BKCH 3KPNB 2Y23A 3RDTA 1NU1D 2VDKH 3O9WA 5CCHD 4HK3J 5TDOA 1FL3A 1VDFA 4GPVA 4NBZB 1JGLH 3CFKB 1AXSB 4K3EH 3ZQ9A 3IFNH 7FABL 1R0AH 1P5VB 2EVIA 5KVEL 5IBLD 4F9LC 3GEFA 1NTKG 2YD8A 4DQOH 5EPMA 1O75A 4C7RA 1D6EB 2CXGA 2MQ3A 4QWWD 3ILQC 3OZLA 4MNGB 4RA3A 1KB3A 1EFXD 2Y9ZA 5I2IB 5ESQA 4JR9H 4PJGB 3LHAA 1JWSA 4KUCD 3FB8A 4LDCA 2KDYA 3SBWA 5KSUB 3IMVA 2EIBA 3BRVB 5E4OA 4YXKL 4NC1E 4G6JL 3AQXA 5SWSB 4IOIA 5AG8A 3QWQB 3I85A 2XKUA 2OCFD 3LRMA 4JO1H 4N6JA 2N7SA 3A23A 3EOTH 5EZIH 5EO1B 3IGFA 2ARJA 5GSRA 4FFWC 1J1PL 1MZZA 5B3NA 3TCTA 3P4NB 2X1XR 5T1MA 3VFTA 3TYFB 5H4YA 4KQ3L 4X98B 1WCQA 5KUMA 4MAYC 9CGTA 3E1IA 3TH3T 1D5XA 4FI7A 1M1SA 2DM3A 4WCYH 4FYRA 4N0YL 1PZSA 3C2AH 1T1XB 3RWJB 4LASL 3DC0A 5CEZD 1MRDL 2G3XA 2V4LA 5KSAA 2YPVL 1UVQA 2CD0A 5DUPL 4U4BA 5D9SA 3MACL 3ALXA 2J5UA 5KN5A 1OAUH 3UEZA 3GMAA 4KFZC 4R3SB 3X1GA 4MDRA 3WTTA 3QQ4B 4GAFB 4LZKA 3RX5A 4JFYA 2EJ1A 1AZVA 4LO9A 5D1XD 1BFVH 4KXAA 3U4EB 1Z6JT 5DD3H 1UJ3B 3DGDA 4HG4J 4QJ4B 2V5MA 3MOBL 1MW2A 2YXMA 3T6VA 2MJZA 3LEXB 5HDQH 4O9HL 2IPUK 1X79B 4P49A 1X22A 4XNQB 2GJPA 2AXWA 3PABB 4M61B 1P7BA 1UZGA 4PW3A 3ZKNC 1KFMA 2XZQL 4TNFA 1SQPJ 3AY2A 1IC7L 4JDEB 1HHIB 1WK0A 1E43A 2WQAA 4YQXH 5HHME 3C75A 1PFCA 3CMEP 3VFNA 3ULVL 5L2KA 2AS5M 1CB4A 1ZIAA 4LBEA 1WUZA 2QEJA 4P3DA 1N7SA 5LBVA 3TV3L 4DETA 4ZQTA 2L3BA 3O3DB 4R8WH 5J89A 3D71A 5CEXA 2ZAEB 2C7UB 3RUGB 2P3YA 5DMIL 1V10A 3B5NC 1TR7A 3T1FB 1OV8A 5KKZB 1VQ7P 1ZV5A 3EOBB 2FQFA 3WY1A 5E6ID 2MWCA 2WNKA 2I60L 5CS7A 2NT0A 5ACMA 2O1AA 2Y2WA 1A6AB 4M4RA 5IBUG 3JYBA 2AEWA 3FRPG 4DPRA 3VMNA 5C09A 3KL3A 4WTZG 2IC2A 3AFLA 2DQUH 4JREC 3S3PA 4JPKH 2VDNL 4X7TB 3CZFB 4XPFH 3GJFA 3EH3B 4WSGA 4I18A 3P9LA 3WXVL 1ES0B 3O2WL 5JIQA 2NSMA 5EFIB 3UG5A 5EBLB 1MCHA 1WBZB 1PD6A 3FTUA 5FYJH 4DZ8B 3QJUB 2A74A 2YAPA 4M7KL 4HOWA 2VMJA 1ZN5A 1MW3A 4G5AA 1WMKA 1OANA 1KGXA 4BCZA 5EO9A 5JQHC 4FQIL 4PJHE 4F37K 1L9RA 3VD2A 1UB5A 2ZUTA 5FUCE 5JIHA 1VZIA 3CCSP 4ADGA 2BWDA 2PETA 2WINB 4OZHE 2BVUA 3MZGB 4R7DA 2UVFA 3LXUX 1CLYH 2VXUH 3MLTB 4JJ5B 2HODA 3QZWG 1UASA 1XGYL 3ARFA 4PS8A 3RTLA 1V27A 5CHNB 2ZUVA 5A16B 4N9GA 4UNUA 3SE3C 4L4TA 1MAKA 2ZKXA 4B7IA 1H3PL 4LP5A 4UNIA 6FABL 4G11A 1EMTL 3GXMA 3AU1B 4ZO7A 3H9SA 3IDYB 2EYRA 3OLGA 3BXNB 2P44B 4I89A 2XIDA 1REIA 4KVCL 2ZUWA 3VVVA 3X3FL 3HE7A 1D5MB 3SE9L 4K2UH 5HHVH 5TPWH 5CFHA 3MRIB 4KRNA 1QLEL 3OPUA 1AQDA 2YSTA 2MFNA 2OMZA 4TNGA 4Y19E 2E9BA 5DQJB 1CDIA 3MGAA 1M05A 3PWPA 4M56A 3PXHA 2OZNA 4AG4L 2F74A 4YDIL 1LO0L 4NHCL 35C8H 3PCYA 5E00A 4P2RE 5APTA 1HL4A 2FL5A 1N9PA 2YBRB 2Z8RA 4YAQB 4H8VA 3KH3A 2I85A 3CV5A 1ZVSA 4Y2DC 3UTPE 4CPGA 2RCSH 4LEXL 4E68A 5APXA 2R0KL 4GOFA 1RZQA 2RH0A 1GPOL 1C16B 3K4ZA 4WSJA 1GCYA 4A2LA 3H7BA 3F6IA 2SEBA 2GHWB 2ERJB 3IRPX 4NNYB 4PJ9A 1B88A 3C5JB 4QOKA 2BCCJ 4H2CA 3NCJL 3IMBA 1Q0EA 1VQ5P 3C5ZB 1AXSA 1JWUA 2YXFA 5EU4B 2X9XA 4JFZH 4ZYKA 3MUHL 3IE4A 4NQDB 3IPEA 3T0EB 5HI4C 3PQYE 2DH2A 5ICZB 3M17B 4HC1H 3D2TA 3ALPA 4I5BB 1ZS2A 4WW2C 1AE6H 2PW1A 3KXFB 3T97A 4U6VH 3VX1A 4NO0D 2W91A 3LQAH 1Y0LB 2GT9B 2BCKB 4O51B 5GSVA 4E41B 1CS6A 5MEOA 3CXHI 5GGTL 3UTTB 5I1EL 2IDUA 4U2YA 1WEJH 4A68A 2FX7H 4LBEB 5BO0D 3JV6A 4H0LB 4TXVB 2BSTA 1T20A 4N8VB 3H9SE 5TDNB 1M7DA 2OMTB 3DUUB 3IDJB 1JFQL 3IWVA 4ZX3A 4UIKL 1IFIA 1BQSA 4MXQC 3MLXH 5I1HL 2W9DH 4OLXL 2Q2EB 3RUGA 2JJTA 2D7PA 2CM5A 2UZYA 5IM7A 4IMKC 1A3RL 1KJ2A 3IF4A 3SDCA 5IB5A 1THCA 5I0YA 2VXUL 5T1MB 3VXRB 1KXQA 1WJ3A 1ZT7B 3GRWH 3SQOH 3B2VL 4JO2H 5DK0B 5C0GA 5LKNA 1EGJA 2B2XH 1NHLA 1DVQA 3UCRA 3LJ3A 4RNRA 2BO0A 2ZXBA 1BXXA 5EF0A 4U1SB 4AGQA 4HIQA 2F5AL 4MJIE 3EZ8A 3NIFB 1KIRA 5L6YL 5ADOH 4ODSH 3M45A 1ADQH 4HUVB 1BMZA 4BFKA 2YD0A 2Y0EA 4RGNC 4KQ4L 2CO1A 2EC8A 4F15B 3MFFB 3L36A 1P84K 3TNMA 3WO3B 1JZ7A 1EAPB 5ICYA 4H20H 4G8GE 2NCMA 1NMAL 4PY7A 4R7DB 5DK0A 3NJXA 3K2IA 3VP9A 1INDH 2NY4C 4NI3A 4JF7A 3QCTH 3HTLX 3VWJC 3IDYC 3BE1L 4MYPA 1EZLA 1GR7A 3L75E 3UJIH 7CGTA 1DFXA 3I9AA 4Z18A 4BK4A 2VLLA 1GL4B 4P23A 3EGSA 3V52H 1DVZA 4HHAA 4OY9A 2A6KA 4PI2A 1J9TA 4XPGL 3S34H 2KH2B 4Z7VB 4WTWA 4CVWA 4L0YA 2K9FB 5DWUH 2XV0A 3MUGB 4X9HA 4Q6YA 3T3PE 4L4TD 3BSHA 1N0LA 3GLZA 3BHBB 1JZ4A 1UWFA 5IB4A 3V0VA 4A04A 4GMSH 4FG0A 4XAKD 4ONHA 2DQFA 1RZJH 4GRMB 5AD0B 2ADIA 6PAZA 2V7NA 4FCAA 1TJXA 5JXAH 4FQJH 5DJAB 4DGVH 1CLOH 1FL3B 3TN0D 1RIVL 4FOMA 1KYFA 3SDDB 3PWNA 2YO3A 5IQOA 2IADA 3FX0A 3IXTA 1JHLH 1SN0A 3FQXB 4APXA 3MLWH 3IN6A 5KYYB 5J12B 2OJEB 1FJ1A 5AVTB 1T1WB 1ZPUA 2B88A 2A0LD 4H4NA 1KILE 3K0YA 3U0PB 5DI8A 5FOBA 1U3HC 5FEBA 4Z7IA 2Z0UA 3BISA 2V2TB 4XCFH 2BCCD 1O6TA 1JHTA 3S9OA 1LDPH 2Z93B 5DRZA 3VQMA 4MMXC 5MHSD 2IQAB 1YMME 5CJXC 1F5WA 3UO1L 3RK2C 3P4NA 4N2HA 5AW2B 1IBBA 2GI0A 4F15C 4PB9L 2WMMA 4P23C 3FO2B 4FQQB 5JNYB 1YIJP 4P5KB 2PCPA 1C8PA 3BLBA 3VRIA 3IXTB 3VE0B 4EVNB 1YEEH 2AJXH 2XBZA 4WKZB 4WNSA 5LAPA 3I6GB 3QFJE 2CIKB 2DWXA 2J73A 3OKEA 2IMNA 4M5ZH 4RGOH 5JDJA 4CGTA 4XCCH 4M3KB 2IALB 4OF5A 1SQ2N 2HKHH 1R3IH 3WY3A 4NDMA 2VW4A 2ZAGA 4QY8A 1IFNA 1BG1A 2AKRB 1W8EA 4PD4H 1MRFH 3GSQB 1ZHLB 3SDYL 3APDA 1IC2A 4F58H 4KKAD 3VMAA 1BMGA 4AKOA 3MV8E 2QDWA 4JAMA 5IBUB 3TTSA 3HZKB 2QZ5A 4NZRL 2FATH 2K9UA 2JTDA 3AE1C 2KLUA 4WUUB 1NGYB 2NY6C 4Y2DB 4R5XA 2FSEA 4F1ZA 1OD7A 2MNJB 5D7SL 1T83C 1TQCC 3BVUA 3UTPD 5C9KA 5JPNC 3LW5J 43CAA 4O4YH 5KVGH 3D39E 4PIRF 3CSFA 4K7PL 4QI3A 3T2QA 2DQDL 1CT8B 1QVOA 1NLBL 1PGJA 3ZE0B 4ZSOE 1OGAE 4FA7B 2OTUA 4NWUL 3NFNB 1EO5A 4RGOL 5D96C 3GIVA 4MNGE 5KVDH 1L6XA 2O5XL 1UADC 4G5ZH 1E5AA 3B2MA 3KR3H 4E9XA 3N2JA 2DJSA 2NQDA 3FN3A 5JIPA 4TLSA 1MI5A 3TX4A 4JAMB 3U4AA 5K9KA 1TMCB 3OKKA 4PGDA 4WU7B 4PJBA 2P8PB 4KK5D 3ARBB 3FFOA 5K39B 1KGUA 3TCXA 2ZT9C 4OIIH 2B1AL 3UYRL 5F7HA 3GSOB 1I85A 4WGWB 5FM8A 5H37H 4EI0A 7PAZA 2EE3A 4HUWB 5L7XL 1KEGL 1XH2A 4YK4B 5MP6L 5C6WH 1E5WA 3EHBD 3L2NA 4WLCA 4YHOL 2GI7A 2R83A 4P46A 4B53A 3LZLA 5GQBA 4S10A 5D7JA 2VDOL 5CIPB 1P4IH 4MS8C 1ZLUK 3K5RA 1N6QH 4WVZA 5GRVL 2QHRL 2ADYA 1NLBH 2Q3AA 3MJ9H 4ZW6A 4JS7A 2PPEA 2V9QA 1MHEB 3HMWL 3VXRE 3WNKA 4HKBB 3SDCB 4M3LA 1TTBA 1IVLA 1FLRH 1T4KA 4TLKA 5HY9A 4BQ9A 2NW2A 4X50A 2OL3B 2BY3A 4Q6IA 1H3XA 2APVA 3HG1E 2ADGB 5C0RL 2NY7L 4N2FA 3D69B 4X5WA 5J1AB 2BEQD 3AEGC 2XXMB 4K5PA 1LT1A 1Q82Q 5CKGA 1RUML 5I1LA 2G60L 2NNXA 3P1VA 4FX5A 1LE5B 3U0WL 2R51A 3DMMB 3LIZA 4DUWA 3PLYA 1ZV9A 4UV4H 3S88H 1MCWM 3BWSA 2WVRA 1U3HB 1QTPA 4ZOEA 2C9NY 3L81A 2IOIA 5BCAA 2XIBA 5HYJB 4AZ8A 1RV6X 4KK9D 1A6PA 1YEJH 1A1MB 4QO1A 4PWEA 1LO5A 4PJXB 1LK3L 2QRXA 3L6FB 3F89A 1NGPH 1O6SA 4YR6A 4LPXA 1D7BA 3L74J 1HINL 3QWOA 1WZAA 4P48A 5SV3A 2X05A 3H0TA 1I1AB 4WENB 3U9WA 2IMMA 1DVSA 4Y9GA 43C9A 5I8OL 1P7KA 2UWEE 1UD3A 4WV1C 3R0MA 4ETYA 2QIWA 5B5EE 5KZCD 3BX7C 3W3BA 3PAUA 4DO6A 5C0DB 3B9AA 5DJ6B 3OMZA 3MDJA 3DX9A 1RD6A 2N0KA 3QK0A 3PWUB 3MLSH 3O0RL 2YXWA 1A0QH 4NC0B 1QTYT 3MRHA 1J5OH 5CF3A 4ZAKA 4KDTC 4JFEB 3QJFA 2WTYA 1IBZA 3TJEL 4N8VG 1AQMA 1JMBA 4KTDH 3MBEB 2GJRA 1F4HA 2YMXL 3QWOB 1IBGH 1D3CA 5KAFE 1WCBA 4TNVF 3HN3A 5F1OB 3A21A 5FCSH 1MCJA 5KSAD 3KW8A 5I6KA 4OFYD 4WFHD 2YRPA 4AUYA 3W0WB 4Z7QB 4FFYL 4IBTA 4PG2C 4ENZA 1ZLLA 2M1KA 3DHUA 4F7TB 3SCMA 4KO6A 3SD2A 1EEZA 4U6XB 1H6FA 2C3GA 2YOAA 4Y4FD 2KUBA 3CXHE 4Z23A 5GJTL 1MIEL 4K94C 2WCPA 4PPTA 3SQBA 4ZS7H 3ILDA 2HJKA 2AABL 1OXYA 3IJYA 2EQDA 3JVGC 4M5YH 1WAAE 3NQIA 5K1VA 5GS1A 1IM9B 1TG8A 3P32A 5HDRA 5C08A 4LGDE 2QPEB 1JZJA 1KCRH 3DYPA 4ZUVA 2GSIA 3RGHA 1HSAA 4QXTB 4OGAD 1SQVK 5D4HA 1K2DB 3SD5A 3TA3C 5KW9L 1EO7A 1D5BA 1DYZA 1D5IL 4HUCA 5FUOL 3DXAB 1FFPA 4LCUA 4BCXA 1AR1D 1NH4A 4Q14A 3V2NA 1TPXB 2EDKA 5E8EA 5FCUL 5AAWC 4R97B 4U1NB 4I3RH 1JWMB 2PO6A 3NABH 5HHMD 4XMLH 5C3TA 4BJLA 4M7JL 2C9AA 4JUTA 1QUNB 2VABB 1A66A 3ZHNA 4KY1H 3UTSE 5E9DA 4RMQA 4MNGA 2E7LA 1E9OA 4MSWA 2IBGA 1ID2A 3GZKA 4QUOA 3RFZC 3LHPL 3MUJA 4M8RA 3HLAA 5DWPA 4K9EH 4L0PB 1YJDL 5HYSA 5I6OA 3SOBH 4XC3L 5HHQA 4A1RA 3VXQA 1NOFA 1OZTG 3GSWB 1EGJL 4XR8C 3HE7D 1W72A 1DSFL 3K6IA 3O45B 2QADB 4C47A 3E8UL 2PP6A 4JGJA 1TTAA 3FKUS 3QZWA 4XNYH 3L4VA 5IBTH 4LSTL 1MCBA 4X0KA 1CO1A 4PRPA 3OR7B 4XO8A 1IV8A 3BGAA 4PY7B 2ZJSE 1IC7H 4ELDA 2VQ4A 1AGBB 1EZVX 5EEWA 3QRGH 4MSWB 1IFDA 4PJ7B 4HJSA 3VFSB 4J1UB 1Q9WA 4APQD 3DV4A 4DKAA 3FHAA 3TJHD 3N85L 1I7TB 1OQOA 2JEEA 4ELMA 2OMTA 1PZ5B 5FGRA 4XPBH 2A0LC 3EDDA 3IJSA 3NQKA 2FD6L 3WMM0 1GYVA 2AMGA 1SS1A 2D73A 3APFA 1UXSB 2X88A 3LH9A 3L74D 5I8EB 5JQ6H 3I55P 2IGLA 2VR7A 4J3OF 1DH3A 4OD1H 4LLVA 3FRPA 4IIQA 3ZHKA 4G72B 1TQSA 1FWXA 1B0RA 2YGQA 3T0ED 2I07A 4PJBE 5CMAA 1M3JA 5TJHA 1RULL 2ITDA 3BWAB 2A6IB 3C5ZD 4JFDA 5ERWB 1X5ZA 2YC1A 3BD5A 4JB9L 3N41F 3QZLA 4ZX6A 3AU1A 3KXDA 5HHPB 4PIBA 1PCSA 3CH8A 3RY5A 3V0IA 4BH7A 4EUPB 1PZUB 3ILEA 4YJZL 2EIDA 2J21A 2VJ0A 2NX5D 3O4OC 4OGZA 3GSXA 4XX1E 3PRJA 4GP5B 3BH9B 3HUJE 1KYOK 1MWAH 1LTSC 1JY3N 1QNIA 2J7LA 5DJDA 1QR1B 3LZNA 4YDKH 1NOLA 1BG9A 2CALA 4KC3B 2MJWA 3CDCA 5D93B 5E5LA 1NKGA 3IFOA 5DUPH 3Q2NA 1TZAA 4Y9CA 1VHPA 1TZ8A 3GF8A 3BKCL 3EGDB 1BPVA 3MGNA 2K3TA 4FQ2H 2EYTA 2AXTE 3E9TA 5HJDA 1IEHA 4IRJB 3FTXA 1W0YT 3C09B 3P4MA 4M7JH 4OZGB 4B9IA 3RHWK 3U6RA 2NZ2A 3MRNA 3KGUA 5DGQA 3KPSA 4OU3A 3VRJB 3GMLB 5EFWB 3PL6B 4ZOCA 1Z5HA 4GQ9H 1UCTA 2EUVA 3VGGA 4N78D 2UWEB 2VDLL 5CBNA 3H7BB 5L8LB 3ABVC 5IHUH 4HCGA 4UM9B 2N7BA 4X4ZA 1FGNH 1Q9OB 3MNDA 3QJZA 5IJVB 4DF9A 2NYYC 4LEEA 5E6YA 3WIHH 4KQ0A 2P5EA 2VRQA 1T04A 1SFDA 4JVPA 4IL6X 5I1IH 2B39A 2MPVA 3MRPB 3D2UB 4PD4E 2XTJE 1NU1E 3SO5A 2ADIB 2FZ3A 1PU0A 3JWOC 5GS0D 4FXLA 1E5CA 2EC9U 4GS7B 5CJQL 3X14A 4YDIH 1I7ZA 4B3EA 2P8LA 4LLMA 1CD1A 1D5ZB 3SQRA 2GTQA 4UB6H 4AM0A 4K3GA 3WJJA 2FSEB 2I60H 4WTZA 4LIQL 3LN5B 2B7DT 1ZSHA 3I9PA 1CK0L 2QT6A 4URTB 4FFYA 4JFFD 2V6HA 2WUCL 2ZQKA 2ATPB 4ZPVB 1IJDB 3O2WH 3WJMA 1HL8A 4ORZC 4CBZA 1RSFA 5FYKD 1XGRB 1EFXB 4KKRA 4R4ND 1S9WA 3OXRA 4NZJA 3VAEA 4GG8B 2Y7OA 1XAUA 5AVQB 1X9UA 3HKZA 4MA1C 1JERA 1DN2A 1BJMA 3FU7A 1COBA 2W5PA 3KJ6L 3O3UN 3PL6D 3MV7A 2EE6A 4IK6A 2FX8H 4JFOA 5GRUL 1U8JA 4NCC2 4GAGL 1FYTD 3L3IA 4L8DB 4P5KA 3GSNH 2D7NA 1JJUA 3IMSA 4BZ1A 3CN3A 5CGYC 3GBLA 3ARTA 3UTQA 3NCEB 4G6FD