5AVWB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 16.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avwB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avwB02
1CZQA 3NMDA 4LC1A 3WGUB 1CI6B 1T2KC 1GU5A 5AVQB 2ZXEB 3P8MC 2C9LY 3V5BA 3L35A 3NFQA 2WT7A 3L36A 3A3YB 1DH3A 1MV8A 5AVRB 1KQLA 2P2UA 2E42A 1HBWA 1J2JB 1GZLA 3M0AA 4RETB 2ZFCA 2H7HA 1HUCA 3TYYA 5AVSB 4HYTB 3IR9A 2XU6A 3A7OA 5AW4B 2BASA 2Z5IA 4JYBA 3NTNA 3KQGA 5APXA 3VMZA 1FOSE 1JUNA 5AW9B 3V4WA 1A02F 2YO3A 3VMYA 3NXSA 5AVTB 1MFZA 5AW5B 2WPRA 4GT1A 2R5DA 3I5CA 4C46A 5AVZB 1MUUA 2R5BA 3M91A 3TK1A 4I6MC 5AVYB 3HE5A 3O8ZA 3M9HA 3T97A 2WT7B 2Q3IA 2XV5A 1JNMA 4DZOA 5AW6B 2WPSA 1H89A 4I2LC 1HJBA 1A02J 3M9BA 5AW0B 2Z5HA 3L37A 5AW8B 1OXZA 2W6AA 5AW1B 3TNUA 1HWTC 2P67A 1SP4A 5APSA 2WTYA 1NWQA 2JJLA 1FAVA 1GTWA 5CMZA 1OWAA 1CSBA 1H88A 1X8YA 3HE4A 1H8AA 1S9KD 2W27A 2QM7A 4JYCA 5AVXB 4RESB 2WPQA 5AVVB 2C9NY 4AYCA 3HTKA 5APWA 2VRSA 3LIEA 4GKGA 1G2CB 3HE5B 5AW7B 3MD0A 2E43A 3P32A 1GK4A 3M06A 5APQA 5APUA 3V4QA 4KHXA 2WWWA 4C7NA 3B8EB 4AQRD 1YYCA 3OAKA 1NAFA 1S9KE 3KDPB 3A2AA 2N9BA 4AUWA 2P7JA 1T2KD 3VYIA 3TNUB 2R32A 2IPPA 4B86A 3M0DA 1CI6A 5APTA 5AVUB 1IO4A 1SLQA 2KP8A 5AW3B 4M3LA 3HE4B 5APVA 5AW2B 2QM8A 5APYA 4EOTA 3WGVB 1GD2E 3P7KA 3MGNA 2Q7CA 3VMXA 2R3CA 2YO2A 3SWFA 2XZRA 3VN0A 1GK6A 1GU4A 3A5TA 5AVWB 3LIDA 3VTPC 4C7NB 3UIAA 2Q5UA 4XE5B 2YNYA 1FOSF
chains in the Genus database with same CATH superfamily
4FG4A 3GUTB 1BM7A 5CR8A 1XF3A 3QORC 1YMMD 4FE9A 2A6DB 2VRQA 1GRWA 1JPTH 3NIFF 4UV4L 2AV7A 4B9CA 1MV8A 3PQYB 4NUJA 4JQ0D 1JO5A 5HDQL 4KXDA 4EVNA 5GZNC 1CL7H 1RUPL 1ZV5A 2NY5C 4YBHA 4DPBX 5C07E 1VGEL 3IDXL 1L2PA 1INEL 1E6OL 4O2FB 5HGAA 4JYBA 3BCDA 2CKBB 4R4NC 3VMZA 3CCVP 2FSDA 5DQJA 5EFIB 3F5WA 2WGNB 4HUWB 2NNAB 3S5ZA 4N0YL 3DC0A 3UJJH 4ANXA 1NTKE 3SKUD 2Y3AA 1I7RA 2VLKB 3DURB 4CW1B 5IW6B 2GHWB 2DKUA 2E76B 2XKNB 2WO2B 3CZGA 5DD3H 2O01J 4DAGH 2P8PA 2Z31A 2JJWA 3LNDA 4I3SH 4L4JA 5FW7A 3MREB 4RRPG 4ZAKA 4I2XA 4XH2B 3RUGA 3CK0L 1RZQA 4LK4A 4GG6A 3BSHA 3DDFA 4G6ML 3DXAB 1JCVA 2HLEB 3NOIA 3OAWA 4M6NL 4YR6B 4N2MA 3S37X 3UX9B 5FV1L 3X1NA 4NKMB 1QA9A 2XIDA 4UQAA 3WBDA 5FO7B 2R9HC 2VDPH 1FFRA 4PRDB 1KB9I 1S9VB 3UPRB 4NQUA 1FVCB 5C0IA 4XX1E 1OGAA 2IPKB 4XMUA 4WSKA 5BV7B 3BFQG 1HGVA 1FHGA 2CQVA 2NX5D 4Z95H 1HJCA 1DUZA 4MB5A 4KNSA 3AY4A 2CKBL 4UNIA 4UILH 5TDOA 4QYOB 2YZ8A 4U1LB 1ED3B 4FKHA 2J3SA 3MXVL 4GW4A 1KCSL 4MAUL 3EH2A 2VLRB 3NEEA 1YEFH 4S0TD 4K4KA 3RVXC 5D1XE 3GZQA 1PDKB 3O6LH 2V4HA 1LILA 1RH8A 4MXWH 4BZ2H 2E86A 2QJKC 1A6TB 2OULB 2Z7UA 4LOFA 1NPUA 5CINL 3OJDB 3VXTA 4HX1B 3W56A 2VLMD 1T1ZB 1T2KD 2XC8A 2FYNB 2F5BL 4HPOH 1E79H 4KMTH 4BCZA 2Q9OA 3O41B 4X80L 1DEEA 5H37A 4X4ZA 3TH2T 3AXLA 1QLED 2IANB 4UIKH 4Q9QH 2Z35A 1BM3H 3IRCA 3MCYA 3WIFB 3HE7B 3VA2C 4W9HC 5KS9E 5E9DB 1QLRA 3U83A 3ML9A 1RZKC 1E8WA 1S9KC 2E6QA 1H5BC 3SWFA 1Q0YL 2VMEA 3AQYA 3MNDA 1Q72H 1EXHA 5BV7L 3Q6GH 4NQCE 3A5TA 4OQTH 1SVZA 4KPHL 5GJSL 4LPCA 1YEKH 1AG0A 4UANA 3JTSA 2AXTH 1YITP 4PRIE 2Y25A 2O1JA 2P52A 3KPSE 3MGOA 4U7KA 4YPJA 4AGNA 3PWPE 5SX4I 2ZX7A 4HJGH 2GPZA 2HJKA 3EYVA 1EJ8A 1NAMH 4CILA 3KYOA 1IGTA 4KDTA 4XWOD 5IR1A 5DQDH 4KWUA 1LXMA 4XVSH 5I1LA 1PFIA 3Q6FB 5IFJB 4W7YA 1U91B 4L8CB 1BSNA 3BYTA 1JF1A 2K6YA 3ERXA 1IM9D 1MJJB 3FBQA 4OVVA 1O5DT 2WT7A 3MLSL 4H4NA 2E42A 3J07A 3G08A 5IK3B 5B66E 5IQ9A 2Y7MA 2KI7B 1XCQA 2ITAA 3B71A 1OAZH 3FFCB 5DC0A 1IQDA 5E00A 2H0PA 3KPQA 1FH5H 4LIQL 4S1DD 2BOCB 3P02A 5B22A 4A37A 1DUYB 1W72L 3H32A 2F18A 3LH8A 4YX2H 2CLVA 1YTZT 2HVKB 4YEFA 1CGWA 4GKZA 4IRJB 5FDWA 5HVGB 4NOFA 2YKPA 2OM5A 3RE0A 4EAEA 2NZ9C 1CDHA 1RY7B 5C08E 3BHBA 3HS9A 4E5XG 1CTOA 1TZHA 4UCFA 4F7KA 4M03A 4GO8A 4CC4A 1U6AL 3MLZH 1ZHNA 5E6ID 1D5IL 1A1MA 1MZYA 2OQJA 2PW2A 2NY6C 3VXUB 1C5CL 4EMZA 5C9KA 4GBXC 2Z9TA 4BSWB 1BQHG 3VXPB 1PVHA 3O0RH 4PJDF 4P2QE 5J3HD 3ZIYA 1S5IL 1I8UA 5E6UB 5A2FA 1T83C 1U3ZA 2D03L 4E2OA 2YKLL 1WA0X 5EEVA 3KZIE 2C3VA 2XN9B 2GC4C 3B6SB 2OI9C 5AW1B 1O7SA 3UBHA 2ODIA 4PJ6A 5APSA 4KK8C 3ESNA 1FORL 4ZT1A 3DVIA 3TM6A 2HODA 5LLIC 4XMKH 2H1XA 1B3JA 5CCHC 1AI1L 4FNLH 1IEBA 2ZX8A 1KNOB 4LLWB 5DZPA 5EU6E 5AWNL 5DFWH 2HP4A 4HC1A 3NGBB 2LU3A 3ZKNC 5F7EH 3L73E 1P0SE 1UATA 4YC2C 4NRXA 5A2BA 2BHFA 3Q5TA 5K9QI 5APQA 2C4FU 1BYPA 1JMMA 3IPBA 4MYPA 5GRJL 3UZEC 3DHJA 4HHAB 1RK0A 2G30A 1DLFH 1JZGA 3WTTA 4HK3N 5HVWA 1R9FA 3P30L 3CUPA 1XD1A 3HZKB 1V5JA 2A0LD 1XF5B 2BJMH 5DJDB 1QHQA 3VXOB 4UYQA 3TNUB 3ZUCA 5J4MA 1A02N 3TH4T 4B86A 4IHOB 4EPSA 1C16B 1PKQA 3F6LA 4WV1A 3OAYK 3WE1A 4PJEA 3QWNA 4A66A 1TJIH 4UOQA 3G9AB 2A2QT 3G6JF 2DLGA 3CE1A 1ZLUK 1S7SA 2EIJB 1RE4C 3UG3A 3ZY7A 2N9YB 4FTVD 4XNYH 3SZKC 4JFFB 2Y5QA 4A38A 1EUUA 4GP5B 5EF1A 3FULA 4PY8I 3R18A 1IKNA 1WHPA 3N55A 4OLVL 3IKKA 2YMOA 3LCYA 3WIHH 3C5ZD 3RBXA 2OMUB 3R7RA 2OJ1A 3LH2L 2J12B 5F8RC 2UY7A 1S7XA 4EN3C 3JBG7 4ZJ9A 1YLBB 3A4FA 1IAOA 1J0YA 1FZBA 5EBLA 5EC2A 4YHPB 2QGDA 3CN1A 2Q1KA 5EU7C 5HDLA 5LAXA 5ITBH 1AHKA 3RGVA 1IKFH 2R69A 3BQUB 4W70A 4LARH 2OYHC 3SDYL 2GVYA 3HAEB 1KCBA 5H4YA 4X7SL 4WW2B 5D7JA 5KYNA 3QCVL 4JFOB 2YMXL 4L4TA 3SKOA 4JRWA 2X40A 3MJ7A 3TVMD 1K5WA 1CGSL 4WWKD 2Y9YA 4EIJA 1N3NA 1CW5A 3BFOA 2YO3A 1VIWA 2JH2A 4CSTA 2OMZA 2K9YA 5E2VL 5E79H 4OCLC 1YNLH 1DEEB 2GHZA 5D7SL 5FCUL 2BY2A 3U9UA 3EJSA 2HJLA 2O72A 4LP4A 4QXVA 2H89C 5CJOH 3GSUB 4M62H 3B7SA 3L1OH 4HUXB 2O5ZH 3MNVB 2J2ZA 5HHXL 3FFOA 3ZZLA 1ZLDA 4WI0B 4AQ1C 1J0JA 1PEWA 1IJDB 1R3HA 3CFTA 3FPYA 4I4WA 2JI3A 3EQ2A 3JXAA 4EI2A 2BVOA 4NC0B 3TLRA 3KYOB 5E4OA 1MIEL 5I1LB 4X50A 4LLQB 4CN4A 1NL0H 3QRGL 3UDWA 5DF0A 5TDNB 1ORQA 1U7MA 2L0DA 3GPEA 5AB1A 1EWHA 1S9YA 1J1OH 1GZPA 3IJYA 5KG9A 2ODHA 1GR7A 5HJ3B 4NQSA 4Z5RB 5C6TH 2X53A 2WP3T 1Q7YQ 4K2UL 1BQKA 4XO3A 3E6HA 4GINA 1AS8A 4UIMA 4DP4X 4F57H 3RTQB 3D18B 3PWUA 1URLA 1IQDB 1SOQA 2IIJA 4PRPE 5E94A 3W9DB 3KPQB 4OAWA 5CD3B 5A43C 2JB5H 5FUCC 4AJ0A 4PAZA 1JRHL 5EIIA 4QT5A 4IMKC 1OLZA 4IBSA 4B9YA 5I6XC 5FDWB 1JWSB 3RWHA 2ICWI 2Y7QB 3DX9B 4HSCX 3SJVD 2YRLA 3CAFA 5LNDA 3QDMD 5EC1B 4GAYB 4L3ED 4LFHD 4Y4KD 5FW6A 3FSZA 4XMTA 2M8XA 3ECVA 1P69B 2PW2B 3HI1A 3QUXD 2EO7A 2NYZA 4I13B 4MJIE 4BKLA 1G1OA 2FH6A 2E6JA 3E1RA 5F9JA 2VZSA 1RXLA 4AMKL 3ARFD 4KQ0A 2Z4QA 4JB9L 4M9OA 2PP8A 3ZW3A 2C3VB 4NUQA 3L75E 1XGPB 3D2UA 1CF1A 2OMTA 2J44A 1NUGA 3KPTA 5DJ8B 1L0YA 4PV1C 5BRQA 4JE4B 4TUOB 3WI9A 3V52L 1ILUA 3EAKA 2KYVA 3AE7C 5T5FA 3IN0A 5FYLH 1MLBA 5JXAL 2PP6A 4PLJD 1UADC 4I3RL 4XPHL 4AYEC 4HEME 1MAMH 1P4IL 3BVTA 3GK8L 4NRXB 5CEXB 2NY2B 1ONQA 3DMMD 1PLGH 4NO2A 5IBLD 5CZKA 1CTNA 1JDDA 3UAJD 2CCWA 4ORZC 3ARDA 3EFDH 4Q74A 5C70A 1I9IL 1EGJA 2A6IA 2MOGA 3FN0L 4K3HA 3GSQB 5GS2D 4I1LA 4I1RA 3MV9A 3TASA 2UZPA 5HGDA 3FCBA 4Z3TA 3WNKA 1XR9A 3RFZA 3UTTE 3FOMB 1QL1A 3WLBB 1G2CA 1J48A 2NZ2A 1AC6A 1R3KA 4XP6H 3BUQA 5E99L 3UTSE 4AL8C 4Z76B 1DVFD 4LU5H 4GKOA 2NPSC 1QSFE 4HXAL 4LE8A 4M43L 4N8CL 4I9XA 2NR6D 1VB9A 1CU4L 2ZF9A 1E43A 1AVYA 1JXKA 5FOBB 1XEDA 5I28A 3ARSA 4UTAA 1I7UA 1ZT7A 3P73B 5EFWB 1FDIA 3CSGA 5GRVK 1HWHB 3RL1B 5HHPB 4OFVA 1NWQA 1TENA 3I75B 2FUTA 3H6PA 2BP3A 2ICEA 1NYHA 4DOJA 2UY7B 1NTKG 4OVNF 4HETA 3ESMA 1FUNA 5E8NB 5J13C 3L3OB 4WJ5B 3L1EA 4Q97A 1BBDL 2ZWZA 1U57A 1U93B 4MHHI 5K93A 3MRRA 4E41B 5DD5L 1M1KQ 4XNZC 4HZLB 4X6CA 1M57B 3HC0B 3HW7A 4KZ0A 5HDBB 2GIMA 3B5NA 4YSAA 1N73B 3FU0A 3QO1B 1ACYL 3C60D 3ZK0A 2D7PA 4OGAD 5CZXD 1V05A 2MOVA 1BPVA 1BAFH 1T22A 3FONB 4F80A 1HNYA 2JKSA 3EJRA 4KXBA 1SRDA 3E1F1 3MA9H 4JK0D 4FQHB 1CLZH 3KGSA 4XX1G 5EU3B 4EI5B 5HSFA 4KTDH 1LWRA 4B9JA 4ZS6C 1WPCA 1PZUB 1NBVH 1KV3A 3KPNB 2QQNH 3ME0B 4KXZI 4XVTL 3IWUA 5DVKA 5I5MA 2R2BB 2NQCA 5EU5A 2HJLB 1FBMA 2EADA 4W9LC 5HDRA 4LCWB 5GS1C 3O6ML 3RWDB 4DN3L 3MRDB 4JM4H 1PD1A 5KJ4A 3KPLA 5F1SA 1EV2E 1FRGL 4MTMA 5KKZC 4R4LA 4FL4C 3JWDL 4DQOL 3GF7A 2VR8A 4ORGB 3N7NA 3MFFB 1DSFL 2R69L 3QUKA 4BZ1L 2RBLA 4F33B 2DMBA 1X5JA 1R3HB 5CP3A 3SGJC 5F7DB 1J1DB 3ZYOA 1JHTA 4U6VH 2UUDH 3RRQA 2A74B 3DX1A 1TQWA 6PAZA 2JKNA 4FQXD 1PZ2A 2FFDA 4P2RA 2WXNA 4HUNB 4XI5D 3DOHA 2CR6A 1I9JH 1EC5A 3V4VB 7TAAA 1HOCB 3GTNA 2ICCA 1NCCL 2Z7YA 2VMJA 2CCVA 4HGKC 1CBJA 2A9CA 4AEIH 5D2LB 5KG9B 4JFZH 4ONGL 1ORSB 4MS6A 4JG5A 5HGHA 2PTUA 1B9KA 1ZRTD 1BSIA 2UWEE 1HNGA 5I1CH 3E0GA 1H6FA 1MPAH 3S3CB 5I73B 2W8CA 3JWOL 3D9AL 3I56P 1USZA 3Q2WA 3V4PH 2GUOB 1ZSHA 5FDYA 5EIIB 2H47C 2CHXA 1P84K 2ZP9A 3VXRE 1MWAA 4Z7NE 1IC7L 3O4LB 2X38A 1RF0A 2AABL 5I8CA 4N0CD 4YDJA 3LNIA 1XF4A 1SFCD 1GKEA 4W9DC 2DTMH 4B6ZA 2OYIC 1URZA 2EJ1A 3OKDA 5EZJA 1NKZB 3R8QA 1TZ8A 3QUMH 4L4VD 3SB3A 1BVLA 4A67A 2LLLA 4OJFL 3RZWA 4EXKA 5CN3A 1A14L 2ZOLB 4P4KC 4JDVA 4LB8A 1F1AA 3OR7B 3QI9C 3H1JJ 3S88H 1U8JA 3KHOA 3K0YA 3L4WA 2GIXA 4G8GA 4EI6B 1U0QA 1HHIB 5DU7A 3ELAT 4HS6B 3D6ZA 3LIEA 3LPGA 3SDDD 2F53A 3UIYA 4YSDA 2QQLL 1NBZA 3CHPA 2QEJA 5F7KC 1GOGA 4NB7A 4MXQC 3TYFA 2IH9A 5F7FA 1JZ4A 5L6YH 3U4EA 4XOAA 4Y1AB 1NPJA 3OKLA 3T0EC 4BV1A 1MQ8A 3JQOB 3QWOB 3WTXA 1F00I 4OJYA 2BNQD 2GI0A 1AHWC 4HB1A 3OKYA 5HGDB 1SVFA 1I3GH 3RVWD 5FYKH 3AEBC 3BKJL 4KK5D 2E74C 4NWTH 1V3KA 3L73G 2F7OA 2XXGA 4BUHA 1QSEA 2J8OA 3WIAA 3VCLA 5KSAA 3FO1A 4Y4HB 1OT4A 4M29A 1YSOA 2HFFA 1JNNL 5DZAA 5BVJB 3O81A 1KWKA 4QRRA 3D0AA 3NZHL 3ARTA 2EIBA 4Y2DA 2V3FA 5I8OL 3QZPA 5T5FL 3TPKA 4NZJA 3L3JB 4XCCL 1R4XA 1TO4A 1FOSF 4FQCL 4IHBA 5GGRB 1SQBE 4OTXL 2FHCA 3L81A 3CCQP 2XDHA 3ETTA 2MCPH 2PXYD 4BE5A 4DO5A 1H0TA 1P84D 1A8ZA 1AKJA 3QUYD 4MZ3A 5DEZA 3WO4B 2Y5EA 3KXFB 3UC0H 1P1ZA 1MEXH 3S2AA 4HS8H 4GXVL 3U36A 1MG3C 1X5AA 2ZYHA 4WCYL 5EG6C 2VDQL 3G5XA 1EGJL 5DHMC 3ULSA 2NLJA 3KL5A 3B9KB 3B9EA 2B77A 5FIEA 1G7LB 1RZ7H 3TBWA 2NZIA 4X6CB 3LKQA 5AAWA 4KRPD 3QYNA 2AJSL 5FO9B 2IAMA 5GGTL 3UBGA 3O6KH 4AYBA 1SYVB 3IKCA 3P4OB 3SCMA 3HN8A 5I1KH 3GS0A 4XCYB 2GTZA 2B0SL 3MR9B 5IEHB 4PUBH 3U0TB 2ICWB 4KRLB 1JXJA 2QFPA 3AC0A 1X0TA 4C46A 3V5DA 2HPCA 2EEBA 4NM8H 4L8SA 2Y23A 4N86A 3GEFA 1KYOI 1D6VH 2H8PA 3SPVB 2Q8BL 5C86A 2WSFJ 3ARPA 1YUHA 3GMOB 4NRZA 2Q3EA 1NGXA 1ZXKA 5AZUA 1J5IA 2LE9A 3HBZA 1XGZA 2YSSB 3VH8A 1UB5B 3GRGA 1DDHB 3LPOA 1UM5H 5E70A 1MVFA 3VNZA 3H8NA 4G6FD 3GMQA 4O9BA 5DK0B 5DFAA 1MHPH 5DDHB 1JZ8A 4Y5YC 4WI5A 3D0VB 3BCCE 3QUKB 1BFTA 4TXVB 1W0WB 1GZHA 4WI2A 2R1XB 1JGLL 1KIPA 5HI5D 1Q90A 4IJTA 4YVNA 1MW2A 3WN5C 3HTKA 5C0GB 4MA8L 3DVNB 3VFNA 2FCBA 2CO4A 2FFDB 2XTJE 4H0LC 2N7BA 1GS6X 4LP5A 3IMBA 1ZAGA 3B8EB 5FC9A 3R2PA 5LBGA 4G83A 2F61A 3SSUA 3T6VA 3UPCA 2HR3A 4ZXBB 2QPEB 4NP4H 4OLXL 3VGEA 3NIGE 3QFJB 1LE9A 1IFGA 3C6LB 1ZR2A 2R2HA 2Y6SD 5C71A 3IJ8A 3BDBA 5BVPL 2APVA 1TDQA 4OZFH 4Z0XB 5JLZA 2Q8AH 4OLUL 1QBLH 2YA0A 1I8MA 5CKAA 4GKLA 2KZ1B 2B2XH 1GC1H 1KGIA 4HALA 2R3CA 4DGIL 2A4CA 3UYPB 1USQA 5ICYB 3BJLA 4M5ZL 1T66D 1E4JA 4NO0A 2O6PA 3HLAA 1Y47A 4AEEA 5IROD 1RK7A 1S7VA 3NIDB 4KKPA 4DWHA 2E8YA 4JGNA 1U33A 4PG9B 5GS0D 3MRMA 1WE5A 4FNTA 4XE5B 1ICTA 1L7IH 2YAEA 3C5SB 4YK4C 1DQMH 4Y19E 3RY6C 4KKLD 1SHMA 4D0DA 1YEIH 5AVRB 4OGQB 1NCAH 1XBDA 3QIUD 3K71B 1KV4A 1Z0NA 4KI5C 5ICZA 2I9LB 1PPJD 1PFOA 4LASL 3HNVH 2K3HA 4IKJA 2KBGA 3F84A 3GIVA 1EH9A 3K46A 4FA8A 1XCTA 4Y2NA 4Z7UA 3OZKA 3RL2A 4F37F 4XN2A 1PZCA 1TVHB 2ZSWA 4DPAX 3U4EB 3KBEA 4X5XA 5GTIE 4YDLC 3N85L 4OF7A 5F88B 2J8UF 3Q8CA 1PSKH 3L75G 2G3MA 1MFNA 4QOKB 4BWWA 4JBZA 2YQ2A 3RZCD 3MO1A 4NN7C 3QPXH 1A7PL 3HS0C 1A1NA 5BU8B 1R5WA 2XPYA 4OFDA 5DMYA 1B6UA 4Y16A 2WVUA 4GMSH 4KX7A 4O2EA 4GEIA 3QDGE 4YE0A 1KFAL 3WD5L 4FNQA 3RVUD 1DQQB 3HHRB 4AZ8A 2VDRB 4K9EH 2OSWA 4QRUA 3QO0A 3BZ5A 4QRRB 1WS8A 4XXCA 3SODB 3QH3B 5DRZB 3AECC 1WP6A 5FYJL 5F0JB 1OHQA 4HDIB 2X4OA 2ZCZA 5D71H 5FAAA 3W9EA 4XNUH 4P5TD 3MJWA 5B5EE 1LO2H 3SDAD 2P5EA 2ED6A 2YS4A 3F00A 4YE4L 3M17B 5HDWA 1I1CA 3OGCB 1AKJB 1R5IA 1BFVL 1JGDA 4PJ8A 3ZX1A 2YBGA 1JWMA 3L5IA 3O9WD 2B5IB 3TV8A 2DZEA 3EXJA 4KZEL 1DZBA 3ULUL 4FG6C 1NU1J 4QCIA 3EJTA 5JR1H 3FU7B 4MMXA 1NGQH 3FF7A 5TD4A 4GSDH 1OCOB 1RURL 2FWUA 5DZ9A 1A6ZB 4XP4L 1MKMA 1G6RA 4QRQB 2V2WB 4GRWF 4C8XA 1RIHL 2ITFA 4PBVC 4Q0XH 1RUQL 3VMOA 3PJSB 4N2FA 1CWVA 3INUL 4PSPA 4E9QA 5I1EH 2VDRL 3CXDH 2UY6B 3VMNA 5ID0B 3RX7A 5DJZA 3X3FL 4F8QA 1IAIH 4J23A 5SWSE 3FOLA 5CD5C 1GGUA 1I1FA 2YXQB 2HPCB 2PYED 1XGRA 2V3DA 3PL6A 1OAYH 4XVJH 3H9YA 1X7TA 2HTLC 5F1KC 2P1YA 3NPZB 2WXOA 1LT9C 1KIUB 3F7QA 1XH3B 1AO7A 1F58L 1UWEL 3KMDA 5EIQA 3THMH 2YNYA 1BFSA 1Q82Q 1NLDL 2UWJE 1HQRA 1WFMA 2WZAA 3QCUH 4MS8C 4YAQA 4DP7X 4GOFA 5IHZB 4PS4L 1L9PA 2XN2A 2OL3B 3AAZA 4LSUL 3KLHC 4KZDL 4B60A 4BFEA 2WP3O 4EQ2A 4XCEA 1ND0A 1YECL 2VDNB 4FJ6A 4J4PD 1HYSC 3MV8B 3KLQA 1SOXA 2YR3A 4NP9A 3NESA 3VFNB 3VDCA 2DWDB 1XX9C 5KJ7D 4GQ9L 1ZVYA 3CU7A 2F8OA 3GSWB 5MEQB 2F15A 1SDAB 1H9VA 1NSNH 2AVGA 3LS5H 1FGVH 3L13A 4AGOA 4HOZA 3OJAB 2CE6A 3P0VH 1KQFB 4JG1L 1Z5YD 4ZTEA 5T1LD 2D3JA 2AK4D 3VD4A 4ZMQA 5GISH 2FAUA 3NH7H 4LOUC 3N43F 2XY1A 2ZJSE 1NTZJ 3EH5B 3OLEA 5D7IF 1DEDA 1V10A 4PJXF 4OZFG 2B87B 3IDYC 3WFBH 3UC2A 4Y8AA 4TLTA 3NTCL 4KO9A 5C09A 1YYLH 4UQCA 4O58L 3IGUA 4KJPC 4NO0B 4UT9L 1JI1A 2NY4D 2VXQA 4HIIA 1HF9A 1NAKH 3FBKA 4QHNA 35C8H 4OBSA 3TA3C 3VG0L 3PP3K 4N78E 4Z7OF 1NTZD 1BJ1H 1HC1A 1GTWA 2ZWSA 1BSHA 2CHZA 1FCGA 4M7JH 4U2YA 2VH5H 5GSRB 5C0CA 4D9RD 2R0WL 1BF2A 3HI6L 3TBTB 1LK2B 4L2LA 4OM0H 5INDA 2Z1PA 1DVXA 3LZLA 2Z7WA 2VT0A 2COQA 1QUNA 3RLSA 4BRJA 5AKRA 4QXGL 4L23A 3GJFK 2CD0A 5F7BA 4YHOH 4LSQH 4XCFH 3CC2P 3F64A 3FO2B 3HD7A 2FJGB 3QG7L 5ACZB 1WA2X 3LN4B 4AIOA 3F12A 4S1RL 2QZQA 4PJ7F 1KN2L 5CGYD 3MOAL 2CXKA 5AYUL 3IMSA 1M6OB 4HKBB 1HNFA 3U7WH 1NCUA 3KVQA 3WFEL 3BCFA 1PF3A 1M7DB 1TTBA 3L72E 2AF2A 5BRZE 1RZ8B 4NO3A 4WO4C 4OWFA 2XQ0A 5E1IA 4MJ5A 4F5CE 5I19H 2E9WA 4FXGA 3DVGB 4NGHH 1NFDE 4PJBE 2IOMA 5FV2A 5KYWA 1BJ8A 2OW7A 3FFDA 4Y16B 4TVPD 1R3IL 1ULVA 4JM2C 4MB4A 1XSIA 2QMJA 5E8DH 4G9DB 3CD6P 2J21A 4YSUA 5F93C 5FS5A 4GS7C 2OMYA 2LT9A 1BA9A 3VTMA 4M1DH 4OZIB 1Y6KR 5DO2D 2W6BA 1OW0A 2NTSP 1PAMA 1P6WA 4KKZA 5CFHA 2D3NA 3QIBD 2ZXCA 2E0PA 2CGRH 2JXMB 4GI8A 5KVFE 3U6RB 1QLFA 3QAQA 2GI7A 1EJFA 1HVXA 1QHPA 2VZ1A 1KLGA 3VGHA 3D3VB 2J20A 2P5EB 3O2DA 3NCFB 3S0PA 1WAAE 5HGBB 2B15A 1MFCH 3CPLA 2K7PA 1YQVH 3A4AA 3HE6D 3IDIB 3LEYH 2EEAA 5L4JA 3HMWH 4PJ8B 5JZ7C 1LL1A 4FNUA 3TN0C 1P7QA 3VQLA 3LSOB 3OKMB 4U3SA 1JUNA 4GRLD 1OVZA 4P46A 1EZVD 1NBYB 4ZUTA 5B4MD 1U95B 5B5EH 5MEPA 1TT6A 4P06A 4PY7A 4TOYL 2DD8H 2D73A 2MRYA 4Q9CA 1SQBG 1S9WA 2Z0UA 2YGQA 3JSSA 3V9EA 3EDKA 3FJTA 1QOKA 1G6RB 4L05A 1BDCA 4KTGA 3LB6D 3SE6A 2X6UA 3FUHA 2R39A 1NVOA 1KGYE 4LVHB 3V0JA 2FEJA 1FNLA 5ISZA 5HI4D 4A6YB 2C1OB 4I0PA 5E8PB 1IEHA 3ECBA 5KANG 2HLFD 3L45A 2VDOB 2GUSA 2DQDH 3CG8A 1M1XA 4LCIH 4NDMA 2EP6A 2G9HB 1JN6A 4ATWA 1T1XB 3OJMB 5IESL 1IILE 3RK3B 4LCCC 2P46B 4GRMA 5F96L 2RH0A 4X42A 3H42H 3D39A 4V1DA 5HYEA 3CPUA 4NHCH 1AP2A 3NIFE 1KCVL 3A23A 3NQIA 1CT8B 1JTHB 4NZFA 1AVAA 4YAQB 1IC0A 1U3HB 5AKVA 1XIWC 3Q1SL 4BE6A 1H3XA 4Y9BA 4DKDC 3IE4A 2EIZA 3AG4B 1KJ3L 4N0UA 5AOKA 2EVIA 1ZTXL 4L0YA 3EGSA 4U1KA 2D4FA 1G6RL 3TF5A 1ZHLB 1HSAB 1D5XB 4OGXH 5KVDE 3QEGH 4RGNC 4X6FB 4ANKA 4WI7A 2N1TE 3RU8L 4A6YL 3L8QA 4ZW5A 4PJ9A 3B5HA 3BZEA 2LLNA 4WGWB 4WZ9A 4P2OA 4NNXA 4TMPA 3BCCG 5C0EB 1WIUA 3SY0A 3PWVA 4PB9H 3MGAA 5IJKA 4FFYH 2XNXA 2A6JA 3L4YA 4YFDB 3W5MA 5JMOC 5SWZE 5HBBA 4E0RA 1G7JB 1J10A 2XKMA 2GAZA 2L7QA 1EFXD 4UU9A 4ZPTB 1DBBH 4XNXL 1GW0A 3T4AC 3IJSB 1QBML 4PJHA 5JA9A 1ASQA 1OSEA 4ZPVB 1RLWA 4HIIB 1KY6A 4CVXA 2ZJSH 3ZR5A 1QVOA 4QHNB 1KPVA 4MQ7B 1RE3C 1DJYA 4PGCB 3D07A 4WU5A 1THCA 2DYPA 5DI8A 3BKYL 2JQMA 2FD6L 1WFOA 4XAKE 1DBAL 3MJ9H 4P57A 4HPYH 4M6OH 3EJCA 5A2KH 5AOLA 3GZOA 3V6OE 5INDB 5JIQA 32C2A 1GGBL 2UVEA 4KK6D 2AEFA 5GGQL 1X5HA 2XQYG 2KUTA 5FM4A 4A2FA 4FXKC 2EYSA 4KAQH 4TULH 1OGTA 3CZFA 1TZAA 4GQZA 3I6SA 2M2DA 2JELH 4FKKA 5FF6A 3GUFA 3U9PL 2APBA 4ZTOL 4NCC1 2EZ0C 5KVMC 4OI9A 5GRXG 3SKJH 5ALCH 1QPKA 5IB5B 5EV7A 4D9QD 1FZMB 4Z7WA 2WTPA 3DK2A 4JFWA 5ITFA 3C8DA 2E7HA 4ZFZB 3LOWA 3S36L 2GABA 2HJFA 4EDWH 4XB8A 1UA6H 3HCVA 1QRND 4AYDC 1F1GA 1VQ8P 4NQEE 5FM5M 2XV3A 3Q8BA 4JFEB 1OAXL 4R7NA 3MA7B 4Q9RH 1XD0A 3NDZE 4X8GA 1MFBH 1HWTC 3ARED 3WCYA 2YOAA 3ZO0A 4IIQC 4A7QA 4FQLH 5HHOD 2BNRB 2CMRH 3BWUF 3UGUA 4KZCA 5CILH 1TZGL 5C39A 4TSCH 4OVUA 5CIPB 3CMGA 5BZWA 4OSUH 4KQ4H 3V95A 1SJHA 1KYUA 3NA9L 3QISA 4QIRA 3DJZA 4HFWB 4OD3L 2K88A 5M7QA 4UDUB 3U30B 3I6KA 2OJEA 1QLFB 3IXAA 3HNTL 3F6JA 1JZ6A 5ALBH 2XPGA 2W6JH 4GW1B 1SF3A 1U8LB 5EOCJ 3L7EA 1FAIL 4JDTH 3CPLB 4B9IA 1WV7T 1T7ZA 5KVFH 4U3SB 5G5DB 1GYAA 5IIEB 1KILD 3CHRA 4UOW0 3CSFA 1NICA 2YPLE 4LQ1A 1TU3F 3RX8A 1HCVA 3OV6A 4PJDE 3CVBA 1S9WB 2WWNA 2WXHA 5DMKB 3M8OL 3MCG1 4QHKJ 5IJVB 5DD0H 4AQEB 1F11B 2YO2A 1C5BH 1MRFH 1UXLA 3AWEA 3NSYA 3WUVA 4WWID 2K0RA 5L2JA 3MRGB 5C8JA 4C56A 2IGFH 4W6XB 2JF1A 4PCYA 1QFWM 4A68A 1OSPH 2VLJE 1JV2B 3ECBB 3QORB 4Q6IC 3RJQB 4F2FA 2YA1A 2WSKA 4HZAA 1M1XB 1PW3A 1A9BB 25C8L 4MYWB 1EXJA 4GKSB 4JPVL 3GF3A 1ZLEA 2N3JA 4UUJB 3CX5E 1TYJA 3ZTCC 1NIDA 2JI1A 3N6YA 2CLRB 5H2BA 3QQNA 4LCUA 5HI3C 1WGVA 3SEPA 5KZCB 5D4QA 2ZXXA 2QHLA 3MTRA 2XA8L 3ECWA 3DJSA 2XFGB 3QNZA 3WLWC 2F5AH 1ZS8A 1OGSA 2E76D 4RMUA 2CPSA 1N7ML 1HHGB 2BCCJ 1E5AA 3RVVD 4RAVB 1PX4A 1HXYA 3V6FB 1OCCB 1URQA 1Y18B 2EIZB 1N68A 2SEBB 3MBXL 3KR3L 2J7LA 3DXAD 3WUTA 4D7PA 3ULVL 1YMME 4G7SB 5EUOB 4MX7B 1OD7A 4TLKA 3C1LA 2CO2A 5I9QC 1FL5B 3F7LA 2KNCA 5TK4A 3MRBB 3CU1A 3G5YB 4I88A 4K5NA 1OB1A 4JAMA 3MZWB 3G6JE 4LT7A 2Q86A 4I6MC 4U6XA 3BH4A 2Y1ZA 2OR7A 4R90H 1OVUA 1CLOH 4A7TA 1T1WA 1JMZA 4HUUA 3D87B 3LX9A 1WCBB 2NYYD 2EDWA 4HUCA 5CBAB 2VDMH 3KHUA 5KVDH 2VLRD 2W0KA 2NY5L 3KPRA 1JD9A 4HBCH 3JV6A 1PX8A 3P2DA 4L0ZA 2DQTH 3DRQB 3GNML 1QACA 1YY9D 2CK0L 3BZ4A 1HINH 2FSEB 4IK7A 2GAZB 1ASOA 1GS8A 4R96B 3KGRA 2ZPKL 2BVQA 3LQZB 4K15A 3ARXA 3QNXB 2B08A 3E1ZA 2BFVH 2EDBA 1IAKA 3QQ9D 4AQZA 1RU9H 3IAOA 1BHGA 4NZ8A 2WWMC 2IAND 5FLUA 3FQXB 2QJKB 2ALAA 3RNKB 2H2SC 1ZANL 3FNKA 3FRPG 4WU5B 3HE7D 3BAXA 2X4PA 4OZGB 5E9DD 1IC4H 2DLEA 3C9IA 3T2OA 2UX7A 5E1AB 1JK9A 2AJ3A 2BMKA 4WEBH 4NNPL 2P24A 2NX5E 4PJCB 3UIZA 2XYBA 1I1AC 4ELKA 3LDBC 3QNFA 2NCEA 5H2FE 3L2NA 1DL7H 3FTUA 4QF1B 2O6DA 4PW4A 4XRCB 3Q3GB 3TU6A 1FZJB 1H5BB 3T2PA 4ODSL 4UYPA 2JWYA 3LIZA 2VERA 4UDTA 3EZ8A 2NW3B 2X4RA 1ES0B 2H5UA 3OG4B 1YC7A 2ZAEB 5DJXA 1KJ2A 2UZXA 2VLME 3MV11 4JDEB 3JZYA 2HT2D 3I9PA 2DDQH 4O02A 4AC2A 3CMEP 1JHLH 1C1EH 3DHPA 3MRFA 1EEYB 1N7SC 2V5RA 3FFCD 4IOIB 3IJEB 4PRHA 4H44C 3HB3C 5HYQB 3VNYA 1RV6X 2HSIA 2AZAA 3K6NA 1BREA 4YBLB 2L91A 4EJ1C 4IRJD 3NMDA 1OXYA 3L72G 3LHAA 4HEPA 3L3KA 5ACMA 1ZPUA 3A3YB 1CDCA 2J43A 4P48A 4ZFOB 1VFMA 4BFBD 3VXUD 1NGZA 1JS4A 3GM8A 3L9RB 2J5LC 1RZKL 2PLTA 3PU7A 1OQOA 3CCMP 3WXWH 4E9WA 5D1QA 1K72A 3VDBA 3QJTB 4FABL 3I02A 4KQ3L 1N5YH 3IS0X 4JPWH 5GZOA 5JHDB 1DVZA 2NY6B 1M3IA 3EFOB 4GUPA 4GBXB 2XN9D 4O2CA 4YQXH 3ESVF 4G9FB 5I5JA 1SBSH 5GSVA 3LQAH 3B5GA 2GJ6A 1UH4A 4K7PL 4Y5VA 1SQQK 3ZE0B 2KLRA 2EE3A 2OZ4A 4U6HA 5F0PB 1EJOH 3VWJD 4ONFL 1B9ZA 1JWUA 2OI9B 3IGKA 1LD9B 3OHXA 4FHKA 4JVUA 1M7IB 3BC9A 1S7UA 5DMGC 3U2SB 1UYWH 2X4TB 1DJGA 3O2VL 3OKOB 2Q3XA 3GZPA 5B39A 3PIQB 3WEAA 3BUPA 3WJMA 2H2PC 1VQOP 2GJZA 3GLAA 4BM7A 4ZFOL 1LMIA 5B7EA 4JO1H 4ZUWB 1JP5A 3CMOH 1AGCA 1E2VA 3GI8H 4PGEB 2M3EA 3FQ2A 4YC2B 1Z66A 4YEEA 3ZRSA 3A4EA 5TGBA 4JFYA 5BO1H 5MERA 3CSYB 4JFUA 2J1KA 5HHQA 3BP4A 2BDNL 4X4ME 3CCSP 1L4AC 4N9OB 4OLYH 1GC1C 2GA1A 1S8DA 1Z3RA 4DP2X 3HEIB 4U3XA 4G7YL 3RAJH 2YAHA 4JFFD 4ZUSA 3GMPB 5CEZH 3CX5H 3ZKSD 1QNIA 1B6DA 3RKPA 2F54B 4C83A 5A40E 4LSTH 4Y5XC 4G8AC 4F7MA 5DD6B 4OF0A 4NAQA 1XT5A 1RPQA 3BPOC 1A22B 3P11L 3VVWA 4OIAA 1AQKH 4BH7A 4PW3A 5C97A 5AAMC 2FX8L 1XR8B 2B1HH 4JAMB 3BE1L 3MRKB 1LO4H 1O9VA 4DGVL 5B8CA 3W11D 3B9DA 1VQ5P 4RWHA 5INCB 1ZLWH 1BMZA 2JKXA 3BQUD 1GK6A 4EN3B 2ZSVB 4GLRI 4IRZL 4Q14A 4UQ3A 1JVOA 3SKMA 2FJHA 1WBYA 2NNFA 3V4UL 1L0LK 2QA4P 1BG9A 3HZYA 4LEXL 2IQAA 3VRJA 3DI3B 1T7YA 3KWTA 5TJWK 2WINB 3BT2L 2OYHB 3BP5B 1UIIA 4X5LA 2D31B 4LBEA 4R4MA 1EEZB 1N6QL 2BVQB 3NCMA 1OIPA 4MBOA 1T04A 1F90L 1SQQD 1B2WL 1SY6H 4KH2A 2WYZA 1BGYJ 4ICXA 2OS7A 5JORA 2W9DL 2ZONA 2B4CC 4YGAB 1Y6NR 3V9CA 4NENB 3SIKA 3MN8A 1IMHC 3VRLF 1L3WA 4D6TD 5AOZA 1N64H 1UD2A 1NKGA 4AG4L 1AQMA 1SDDA 2VL5A 5L2KA 5CJXA 4XMLH 2ZOWA 1S78C 3KL3A 3ASOB 1IEAB 5JW4M 1DD4A 5IM7B 4CVWA 5JXEA 5TE6H 1BGYD 5DJ2A 1TKWA 3GSRA 4OM1L 4A39A 1FS0E 2R29H 3AG1B 1UEMA 3QZWG 1OP5K 1AGBA 3WKPA 5DHYA 3M9HA 3HZMA 2N59A 2ZAHA 4AQ1B 3E38A 5AKTA 1WF5A 4LL1A 2X4RB 1XXFC 3QG6B 1MJ7H 4IRSC 4KTEH 3MUGA 5H2FH 3HRZC 2VRKA 2HFEB 3TA4D 2VXUH 3NFNA 5CN2A 5I30H 2QRXA 4KVPA 2GITB 4W4NA 5EIVA 3I6GA 2Q10A 4ZX3A 1EAPB 3D52A 3HG1B 3D12B 3RTQD 5ESVA 4EO5A 4ZI8A 4IFMA 3SSGA 4PTUA 3MBEA 3G9RA 5FUZL 1WT5A 1J88A 1QEWA 1Z9LA 2D9CA 2X7LA 2G4EA 2CCLA 2WWKT 3DPBA 1ETA1 4LRNL 3EYUL 1Q0XH 5DUPH 2O5XH 4XP5L 5F1OB 2YGPA 2OYOA 3ASNB 2PUQT 3W39B 2MJWA 4DZBA 4ALAL 5T1JA 2YPKB 5IFAL 1QZNA 2ZF8A 2F19H 1KB9J 1EXGA 3RWIA 2J4WH 4NQQA 3RX5A 4OZHA 5EWIL 3FTGB 3CLFL 2EO9A 3N91A 3MRQA 2MOQA 1A7OH 4OZ4B 4KH9A 4K7FA 2D3VA 1CD0A 3LIZL 4H1LH 1CFVL 1SYSA 1NCHA 1KIRB 4PJEE 1KTDA 5EZIL 1KJ2L 2PPEA 4ZD3L 1O7DE 5D7EA 3L7FA 1A6VL 3MRHA 1IFMA 5GSVB 4H13C 3VSVA 2APWA 1NTMK 3L95A 1CI5A 1GCFA 2JKTM 1GD2E 1SQPJ 4JVWA 3RWEA 1MHHB 3HG2A 3U1CA 3MXWH 4RRPA 1IM3A 2AQ2A 3S37L 4S2SA 3M7FB 1MN4A 3NJKA 3ETSA 1A4KA 3HHSA 4PV1B 4LOEA 1S7UB 4TQIA 2G75A 1IFHH 5DK2B 2X4QA 3SJVE 4L3EE 4B9PA 1Q1JH 1IGFH 2NY2D 2VL4A 4X0KB 4WUUA 2RD0A 5KJRL 4IYKA 2Q5UA 5FECA 1WFTA 3WJMB 4HHWA 1TCRB 1LK3H 2WUCH 3WHXA 2X1OA 4N20A 1MLCA 1SQPD 1DQVA 3TGUJ 5TFSH 2APSA 1FDLL 4M4PA 2ED9A 2F58H 4IMLB 2VIRB 4LPYA 2XTJC 4QWWD 4XN5A 5H8DA 3CC5A 5MERB 1NPNA 1G9EA 4GAJH 1BZ9B 1E4XH 2OTPA 1X9RA 3MBWB 3EO0B 3VW3H 3G6AA 3BEWA 1FBIL 1ZA3A 3II1A 3O8XC 3TGUD 1QTSA 4MVBC 5FM8A 3NG5A 5IMLB 2G2RA 2I8DA 1MRCL 3LPWA 4MKTA 1BJMA 3EOBA 2PO6C 1MFVA 1FC2C 1JPGB 2D7QA 2YEQA 2FZ3A 2NPSB 3VSUA 1KENL 2LR2A 1CL7I 3BSZL 4NNYB 1T0MA 2NPLX 5LGKA 2OK0H 2GT9B 2Y7SA 4PJGA 1TQSA 2IG2H 5C0JA 3CLWA 3C6SB 4HH9A 4F9LC 1NCTA 3L71J 3FSAA 4JJ5B 5B3NA 3QWQB 1F6AA 5H37H 6CGTA 4NZRH 4E41D 1JGIA 5AW0B 1S7TA 2WZ0A 3VFPA 5EEYA 3R4YA 4NUMA 1M57D 5DRXB 1U2CA 4JANA 3H9SA 3LKSB 3U59A 3MNWB 4IFFA 2V6HA 3QR2A 3L4VA 4I9WD 4ODVH 1YEJL 2OJZL 2P5WA 2PKDA 1OWAA 3L71D 3GXFA 4XNZB 2F1BA 3L9EA 3OC5A 4FA6A 4OW6A 2CDFA 4X4YA 4EI5D 4HWEL 1M71B 3HC4L 5AVVB 1I8KA 1NTMD 2NY0C 1T04B 4WW2F 3NCWA 5TDPB 1BPLB 4AL8L 4DP8X 2IXQA 1HHKA 5BZZA 4D0CB 3VI4B 2RKLA 1B4TA 2H1PL 5ANME 3A21A 4LCWD 1J9SA 3WFCH 4JUSA 4ABUA 3WTWA 2GK0B 3GSVB 1NCIA 1SEBB 2DQJL 4X9YA 3DOIA 4IEFB 4MNQB 1JNLL 3R06B 1LTGC 1J8HA 3KPOB 4RFEB 5GS1B 4E5XA 4YTPC 3BN9C 2B1AL 1MREL 3N40F 4WNJA 1QPXA 4PP1D 1MCNA 1FFTB 4L29B 3VD5A 2Q76A 3TOPA 3FB6B 4N1HB 3IF1B 4HT1H 5KW9H 3SGEI 1S4XA 4WDIA 1E27B 1FIGH 2Y2YA 3CFEA 1QNZH 1ZD6A 3EYOB 4I18A 4WKZA 3GXDA 2ARWA 4C7NB 2ZT9C 1U8MA 3O6FC 3PJNA 1HCFX 4PYGA 2AC0A 3NFNB 3K74B 1NUFA 1B3IA 3GRWA 3L70D 1S3RA 5DJTB 1K3IA 3SQRA 1RK1A 4X9IA 5I18H 4JS7A 2A73A 3BD4A 3PLNA 5DVMA 4X83A 3IDJB 5F9OH 2R4SL 4DIXA 3RK2C 3A0OA 2NNCA 4BQBA 2QVIA 5DHVA 5E2WH 3WEXB 1AIFA 3O4LD 3BIKA 4LNVA 1LTAC 1D7CA 4A2HA 3MV7B 1WCQA 1ZGLM 2VR3A 3U79A 2NOYA 3CZKA 4RNRA 5DA4A 5LB1A 3QK0A 2K8QA 4XWGH 4HC1H 1BZ7B 1WICA 1TZIA 3MV9E 2J8HA 1S5HA 4QRPB 2NT1A 1ET8A 1Z3GL 2OTKE 4WEUD 4AYGA 1R8EA 4R4FH 2YK1L 3FW6A 1ZLSH 4Z7AA 4H1LG 4PVMA 3A0HE 1MJ8H 3PABA 2OYIB 3MAWA 2ENQA 3BAYA 3B34A 1A0QH 4B9KC 2E56A 1C7SA 3MCKB 5F3HA 1ZRTE 3RWJA 3VFTB 1N2DC 1KSRA 4P4KB 3CXHK 3OAYH 3QI9B 1ZMEC 1ZLUH 4S2SB 3V8OA 1ZT1A 3CMAP 3RURA 2ESVA 4YLCA 5MENB 2Q3AA 4Y1AD 4BYHA 2BCKB 4XPBH 2VW7A 2R0LL 3B2UD 1JK8B 2VABA 4JLRA 2XCMC 3HE4A 1Q9LA 3CNKA 2F7IA 3WTYA 1I3RA 4Y2OB 4ZMXA 5DHDA 4JKMA 4MDIB 4L4VE 1DSWA 3AT9A 3AROA 4EIUA 4FQPA 4PJIB 4AEHL 2X4SA 3LZFH 3LEXB 1KT2B 4F58L 1F6LL 1AHWB 1HL5A 4Y4HD 4YDVA 3UGXA 2J1YA 2J8UE 9CGTA 3IAPA 2ZWYA 2E74B 2A6KB 3OKKB 1JTOA 1DBMH 1SJVA 2OTUB 1F4YL 4Z78A 3VXNA 2FX9H 3V0FA 1UFUA 2N0KA 2ATPA 2I60L 4OD2B 4XHQA 1ITBB 4IGBD 3R19A 3BRFA 2Q7CA 1E9QA 1JFQL 5EBMB 3KXFD 4E9LA 4FRWA 1VPOH 5AL8A 3BPCA 2ICWJ 1T2QL 2BNQE 2XRAH 4LGPB 4M61A 5A16B 1JY2P 4EE2A 5A3IC 1JVLA 3WUZA 2Z1KA 2HT4D 3B9KD 1DX7A 4WY4C 4PS8A 4N1EA 1YNKH 3MLUL 4K5LA 1LEGB 2CBOA 5H37G 3V0EA 1SVCP 3Q2VA 1MHEB 4JX0A 4LAJH 3FHAA 3N3EA 4OQTA 4QJ4B 1X6LA 3B2PA 2PWDA 3ZL1A 1P4LA 1TTCA 5B38B 8FABA 1YDPA 3CHXA 4UM9A 1HTLC 4MXVF 4HJGA 4XO5A 1XO8A 3S35H 2AJUH 2Y22A 4TNEA 5HDBF 2DBLL 2A45G 1KEML 4QHUA 3TJPA 4GKNB 4M8RA 5I5RA 3MKGA 3WSQL 4IL6H 5FFOA 1LT1A 1N7LA 1AQ5A 3PLYA 3QJHA 3KLKA 3FWLA 1FYTB 3A4DA 1G7IA 1P84E 1LP9A 2X89A 3QNYA 2MJZA 4N2LA 4WSGA 4HP5A 2VZTA 4GRWE 3F85A 4Y88A 2F9BT 3ARBC 3STLA 1DO5A 3MNZB 1CXHA 2WLLB 1PBYA 3GTVA 3UJIL 3QW9A 2WSCH 4EDXA 1TOXA 3H7LA 2CPCA 1AE6L 3K4ZA 4DVRH 1BV8A 2WXGA 4Y8DC 1VAHA 1OLLA 4XXWA 2AXHA 1SXBA 2VNCA 4M8VA 5F7YC 3FQ4A 3APNA 3UEQA 1FLRL 4WQOA 2JLLA 3GHEH 5TQ0H 2OYLA 1BQHB 2Y0SA 1UM4L 1I7TB 3Q9PA 1YPZA 3KS0J 4Y5YB 4BRVA 4O51B 2AV1A 1RZGA 3AEEC 2HKHH 1XZ0A 3SE4A 5I15H 5KSVA 1MCPL 4EIBA 4AIZB 4Z9KB 4QGYA 5D5MB 3ZIMA 3WN5B 5DC2A 4ZXBD 1KEGL 4FKEA 4A7GF 4WI6A 2DJ4A 4AQAA 3QFJD 4QXTB 1U8KA 2YD9A 4P3CH 4H0LB 3C6LD 5FHBL 2X4UB 3G3LA 4HFUL 2F53E 1N4XH 3OAUL 3IETB 5B3JF 1RK1B 1MFEH 1IKOP 1CGTA 2CO6A 2HLAB 4QRSB 2EKSB 5ADPH 5D2LF 3Q1EA 4P49A 5ILTL 1CGYA 2IDBA 1AIFB 1WMKA 3Q2LA 1F4XH 3H56A 1T03H 4HWBL 4N2NA 1FSKC 5J11C 2FE0A 1FFPA 1TJHL 5CCGD 3B1UA 2C3GA 5EO9B 1CE1L 1FZOB 2WUBL 5IBTL 3TZVC 2EXYD 4AENB 1I8LC 4U0RC 1MHCA 3KNBA 3AE5C 1OY3B 2WYTA 3SD5A 4JO4L 3DROB 5D7IE 1WFUA 4PJXE 1OWRM 2FUQA 4Q58C 4XNDA 5HYJB 5F89B 4OGQD 5F3HB 4L8BA 1DQLL 4X6BA 1N8ZB 4YK4B 4PGDA 5FYJD 5C07A 1AD0B 2R83A 4FP8L 4TS6A 2XXMB 1JHKL 3BDYH 1HSBA 4IIZA 4Z7OE 3TBSA 3A0HH 1AXSA 2XACC 3QWRD 2CIIA 5T3ZL 3US1A 2R56H 3TWCH 3I2CL 3N41B 4WTZG 4YHNB 3KYNB 2E7DA 3FT2A 2IQ9L 4OCSH 4QLWA 4QOKD 4UTAH 2VABB 4PD4J 1OPOA 1KQLA 1JPTL 2TRYA 4G5ZH 2HTKD 1D7MA 3ULUD 4HVBA 2E4FA 1CL7L 4YDLB 3QC6X 4K94H 1N67A 2G4GA 1PPIA 4NPKA 3D0LB 4CU6A 2N1TC 2DMHA 2EE9A 4LGDE 2ORBH 2YAFA 1DSYA 2VXVH 4NN7B 4U6YB 2J88H 3CLEH 5AW9B 3ABZA 4G42B 4FLRA 3T8XB 3VQMA 1YMHB 3HS0B 2V9RA 5I17A 1PPJE 1FP5A 1BDYA 1MDTA 3AU0A 3FCTB 3IFLH 1DLHB 4QRRD 5D6DC 2Q20A 4H5SB 2WZPD 5JMRA 2FL5A 3UJJL 3FU8A 4HJ1A 4DO6A 2FJFA 3HI5H 3MI6A 4NQXB 4MMZC 2OQQA 5DD3L 4L5FE 1TEYA 1AS6A 4DAGL 3AMLA 2FIKA 5T33H 5K1NA 2BY1A 5I0VA 3GWJA 1RLBA 4UQEA 3VFMA 2Y2TA 4U1HB 5D1XA 1T6AA 4MQXD 5BNXD 5IB2B 4ZFQA 3BPCB 5EMYA 3EH4B 4BXVA 1MZZA 1IQWH 4WK2B 2VSMB 1X7SA 3VX0A 2VDPL 1HZLA 4PFEA 1X5YA 1HK6A 3CLQA 4ZMNA 5EA0H 4BCXA 3RY4A 1WRGA 4Z95L 5CGTA 4HPHA 1I7ZA 2F2HA 2BSED 3KH4A 4YDKH 4YPGA 3C9NB 4UILL 4PV8A 3DBXB 4MB1A 5KS9A 1SQXJ 5IHWA 1NAMB 2DYSB 1NTDA 2ZXGA 4R0LA 2O5YH 2FBOJ 5CP3H 3O6LL 4MXWL 2HG5A 3IN2A 4BZ2L 4NQCA 3TIDA 3O3EA 2W8ZA 4BHUA 2B14A 4PRIA 4ODUB 3KPSA 4JZOA 3PWPA 3Q5SA 4HPOL 2EICA 1ITCA 3QNYB 1SQXD 4FYTA 3L5WA 4KVNH 3STLB 4KUZH 3DRTA 3L9BA 4UIKL 4Q9QL 1BM3L 3D25A 4HJTA 1OM3L 2AK1H 2VZVA 4HLJA 4ZMZA 3VFUB 4YXLH 3VMXA 1NM4A 1FQ9C 3MRCB 4A7PA 1CFNA 1J9QA 1M42A 2WIIA 1P84H 2X09A 5DEGA 5EOTB 5EHFA 2YUZA 1T7WA 3GMRA 3MV8D 3Q6GL 4D0BA 4WEEA 4OQTL 1INDH 2EILB 4BWNA 3QSKB 1YEKL 4KOCA 4W9FC 1MWAH 1FL3A 2WWKO 2C9RA 3VGFA 1TYRA 4S0HA 3DO7B 2OW6A 3BWAB 2AEQH 2IDCA 1IT9H 1NAML 3MUHL 3LQAC 2NQDA 2PYEE 2JEEA 4TSAH 5DQDL 1NIAA 4J3XA 2DI7A 4XVSL 4HIHB 2C0XA 1FU1A 5C08A 4AWJC 3D05A 4AQAB 4IBWA 2IADB 2WWOA 4PCKA 1T3FA 3OMIB 4ADJA 1FA4A 3IU3B 2OMVA 2FNBA 3MC0A 2ZFCA 2AXFA 4L1BA 1UVQA 2GIYA 2IGLA 1OAZL 3QUZC 2I07B 3WFHB 2NTFA 1FH5L 3L3IA 5D6CA 4YX2L 3QQ4B 2ITDA 2RHEA 3QEHB 1NKRA 1WZKA 2JIXA 3LY6A 4FZ8H 2WLIA 4G1EA 3UP1A 2H32H 2Y0EA 1FJ1A 1FFPB 1ZDSA 5FFLA 2XBZA 3IDYB 3P9MB 3QJZA 1NCGA 5KJ7E 2ZXAA 2R5BA 3MLZL 5EU6A 1GS7A 2L4OA 4E68A 5KYYA 1JB0J 1B88A 2P49B 5BV7C 3O0RL 1UXWB 3TA3B 3NIDF 2ZUUA 3WHE1 2AK4E 1YJWP 2CDGA 3GGWA 1BIHA 5KVGE 4BRYA 4GT0A 4G80B 5JUEH 4MAYA 4AQ8C 3PHOA 4V33A 4MJHA 1BLIA 4C4UA 5EEZA 3BRDA 3VE0A 1XGUA 4Y4FC 1H6EA 1KYOJ 5JHAA 3AVEA 1PJ9A 1L0NJ 1SQVK 3PWLA 4HJUA 1FNGA 4M8QA 2AS5M 2Q7YA 4XBGB 3GLMA 2G5RA 4XMKL 3FQUB 4G6AD 4FNLL 5KOMC 2F68X 1SOSA 4DH2A 2FYNC 1OTTC 3SFDC 2IBGA 1J0IA 4KKBC 3KVPA 1OZUA 5F7EL 5B1JA 2ADGB 1DO6A 3UZVA 1AFVH 4OLZH 1RZFL 1BXUA 1ZN5A 1RHHB 1KYOD 1VFAA 3HC2A 3NRPA 3OBAA 1L0ND 2J1ZA 2DEXX 4HIEB 2XWEA 1DLFL 1HYRC 1KGXA 4WO4B 4F3FB 5MEOB 3K5SA 2BP8B 3OF6A 2BJML 4AOFA 1M53A 4N2CA 2DJMA 3E3QC 1GCYA 1AZRA 5GS0H 2DQEH 4HKXA 3GM0A 3ULUF 4JN2B 5I0YA 3JT0A 5DURB 1TJIL 1KPUA 4RDQF 4QMAA 1JY3O 4JM2B 4ZFFB 1LO5B 1CK0H 3UG4A 1U7JA 4H25B 4LNRB 1DCEA 4GS7B 4XNYL 1Z56A 1HIMH 2ZUSA 4ZMOA 4NWUH 3D3VD 4ZDHB 5KAIE 2GM4A 2P5ED 3D5OF 1I1YB 3EW3B 2W0FB 3WIHL 2Y2WA 1NFKA 1P7BA 1MWOA 2EC9T 4KXCA 1EA9C 4QDGA 4TNVK 3WY3A 5JIPA 4NKDA 2O1KA 4YNYB 1IBBA 5FPIA 3PDOA 4PREA 3CWBJ 1PJWA 5LWYH 3L54A 4S1SH 3K1KC 1WAEA 2EE2A 1UWFA 4OUUA 2E3VA 4IRJC 3V5BA 1MQKH 3VD0A 3W67A 4MCZB 4KMQA 3D8MA 4KKRA 3TN0B 4XP1H 1IKFL 4XZUA 2POHA 4LARL 1PY4A 4UT7H 2AKRB 2NUTB 3FX0A 4DT2A 1EQ7A 3HUSC 3CDGB 5C7ZA 1PG7H 2Z5IA 4FC3E 4RX4D 5FCSH 3SYQA 5KBNC 1EK3A 1N8RQ 1UXMA 3BKCH 3LNGA 1HILA 3VMAA 3MUDA 3G71P 1CN4A 1TEFA 2V7NA 1E6JH 4HXBH 5C0RH 4F8OA 5K9KA 3RK3D 5KYUB 1SQVD 1A3ZA 1WTGT 1IL1A 3CVIH 3OX8A 1HL9A 1YNLL 2X5PA 2IYOA 3SBPA 1JZ5A 4DJGA 2XVLA 4TQHA 3L5WB 3WUWB 2QR0B 1BBJB 2RALA 1IFJA 3V4PA 1WD9A 4QXUH 1BQUA 1DHKA 2XWTB 5CJOL 4YO0B 4LCCB 1U3HD 1EZVE 4M62L 2H6PB 5C09E 3VXQB 2Z8VC 1Q86Q 3GSNB 5DFVC 5TK2A 3L1OL 2O5ZL 2ZUYA 2Z5HA 4N6QA 5C2BH 4LLVA 5DTFB 2N7AA 4N6JA 3G9VA 3WG7B 4KJWC 4OGZA 4PRPA 4EN2A 1INQA 2ID5A 2YD1A 4ZMVA 1A25A 5EO0B 5C0CE 4PRNB 4ZKPA 4NQDA 5GGSY 5E1HB 3SPJA 4UOZA 2YD5A 1AGFB 4KFMA 2BERA 1JUFB 1NL0L 4M9PA 3QHFH 4XCNB 4D8PB 1BWMA 5BXFA 2PFXA 5ICUA 2BC4A 1J1OL 3T04D 4RGNB 1MAJA 2QVMA 2FT6A 3NRFA 5C6TL 2X9YA 1BZOA 3LIUA 1FI8C 4OFPA 4MJIA 3S35X 5I6KA 1KXVA 4CMHC 4F57L 4HJIA 2XSKA 3WTUA 4P2QB 1ETZB 2R0ZH 1AS7A 1JD7A 1H6TA 2Y7OA 3TT3H 2Z31C 4ZZKA 3FHQA 4IL6X 2JB5L 2G9KA 1DQJA 4HKZH 4ZAKC 5T1KB 1CFSB 5D2NE 2JIXB 1RJZA 1D9KA 3VGAC 5IKCB 5HHNB 3T4AB 3PWNA 4OCRH 3FK3A 3GW6A 2V9TA 2O4EA 1MCWM 2VAAA 1T0NB 2XYCA 2I7SA 2E9JA 4HEMA 2XBDA 1UACH 3PXLA 4HV8B 4QRTB 4BD4A 3AY4C 4F91B 1W8NA 3GGWB 4LO9A 1NEZB 3DV4A 3FXIC 2VQ4A 4QHLA 3NSDA 3VWKA 4CADA 2R4RH 3OWEA 1CB4A 1KBWA 2N01B 2WVTA 1FNGB 1FVEA 2ILLA 3IWVA 1MCBA 4FXKB 1KUMA 1HTYA 2VR6A 3MRNB 1QRKA 1W8EA 2YBRA 4FQJH 4K5MA 5CP7B 2CGZA 3BVXA 5FYLL 4JFDB 3HHMA 4OV5A 4HCGA 5KVGH 2A99A 3UTSA 1WO2A 1QSFA 1AA0A 1MAML 2NY3C 2BSCA 1N10A 4I1PA 2EE0A 1ZCRA 3ES6B 3FQ1A 1PLGL 1RIVH 3CCUP 4JFED 4U4IA 4DZ8A 4FI6A 3S5LA 1YJNP 3MMEA 4MWFA 5HVFB 1GZQA 1SMDA 4JO3H 1BQLH 3HR5A 5F9WC 3NZUA 2BNRD 1MFZA 4N8VB 1JTPA 4KK9D 3UL4A 2KQNA 3TNMA 5GRWA 5HYSB 4X5WA 4Z7VB 4ZUUA 3ZTJH 1W0VB 2VITA 3HZVB 3MVSA 3RWCA 3ZVVA 4IIQB 4LU5L 4KDTC 1M56B 3GJEA 3O3UN 3HVNA 5DYOB 5C0NC 4IKLA 4KKAD 5KTBA 2DWEB 4WK4B 4K8RH 5AEAA 4D9QE 2P3YA 3QDAA 1WUZA 4UB8E 4C47A 1S1CX 4OZIF 2CRIA 4MCNA 5GGUA 4LSRH 4X6EA 1QRNE 2MNJB 3DHUA 3VD3A 5HHVH 4AK1A 4DVBB 3BH9B 1PPJG 1PP9J 2FT8A 1IZNB 2D2CC 2BVPA 2QM7A 3VJ6A 2Q6WA 1CXIA 4N0UE 5J6GA 1MH5A 3MTUE 3T97B 2DOCA 2XNAB 4DUXA 3MJ8B 3EJPA 5DS8B 1WC7B 3POCA 3JV0A 4FXTA 4XN8A 2CJ3A 3IMVA 1L3NA 4CC4C 3VH8G 3RQ3A 4K23H 1F45A 2BSTA 2WQRA 1PP9D 2XZCH 4MSWB 1A66A 5DLLA 3H1HJ 1BAFL 1LO0H 4JFQB 2N56A 1MVUB 1UGNA 2ZICA 3QORD 1OK0A 1X5GA 2DM7A 1N2RA 3MA9L 4M7ZC 3TPUA 4Z7IA 1CLZL 3MCLH 5I2IA 5I75C 4KTDL 3VD9A 5GZND 2WBJA 4OF8A 4Y0GA 5KZCD 4EOTA 1NBVL 1KIQB 4Q6IB 3O45B 2QQNL 4PRBA 2M5AB 2RIKA 2WQ8A 4RWYH 3US9A 4IOFC 4R4ND 3V4PB 2CBTA 4K9JA 2VTFA 1G5AA 4TNFA 4JM4L 4LLAA 2WXQA 2CPUA 4L1HA 2YGNA 2DL2A 3L3HA 5KANI 2O3JA 1P5VA 1KC5H 5IT2H 1MKFA 2UWEA 5I1AA 2Y5TA 4NQTA 2Q9IA 3DI2B 2OP4H 1YHPA 4PRPB 1INQB 4PP2B 2K6WA 1X22A 3LN5B 4YS4A 4U6VL 1H3PH 4PMFA 1VADA 3AABA 1TJGH 3QUMB 3V0HA 2VXQH 3PP3H 3VXRA 1HBWA 1Q8MA 4Z3HA 5IG7B 2JB6A 1I9JL 4X7DC 1P1VA 2Y36H 2IZ1A 3H1ZA 5I9QB 5JDJA 4JN1H 2R9HD 3KBHE 3K5RA 2OPCA 1NCDH 2HX8A 1U4FA 3NPSC 1J18A 4JHAH 2UXGA 4WV1C 4JO8A 4GOEA 4JFZL 4AEIL 4ZMTA 2EC9U 1C9SA 1M90Q 2AQNA 3D69A 3CC1A 4P4RB 3BH8A 5D72H 3GJFH 1ILSA 5I1CL 5CSZA 1CF8H 3MHZA 5CBNA 1MW0A 1MPAL 2X6AA 4QXWA 3CFJB 3GBNH 5LVEA 1OFCX 4LKXA 3V4PL 1BFOB 3AUVA 1E9OA 2IEPA 1WIPA 1IKNC 2IAAC 2VDLB 3RVXD 1A1OB 2YQ3A 5BQ7A 1Q9OA 1VFBA 3DXAE 1MFDH 2FO8A 3SQBA 5J6HA 1MFTA 3VI3B 3GMNA 4Y9FA 1RVFH 3M9BA 5PAZA 2DTML 1AQDA 3CCHA 2GTWB 1X5XA 3MGTB 3QUML 1Y1UA 2NSXA 3RDJA 4AE0A 5T1MA 1BYNA 5FKAA 3RGVC 5IVXB 2DJSA 4M5TA 2NUPA 1Z1WA 2AITA 2ZX9A 3MACL 4WK0B 3KJ6H 3AE3C 5D7JC 1FZEA 1PY0A 3IDUA 3FGAD 1KGJA 2UZYB 4ZQKB 2NDFA 3S88L 2VLRE 3QVAA 4YGVA 1S9KD 1IFNA 4WJG3 1BVZA 1ASPA 3BMVA 3LVTA 1O5PA 1FVEB 3HE5B 1I1AB 2E27H 2WCSA 4CC1A 4LPTA 3LDBB 3V6ZB 2QEXP 5C9JA 3VRLE 2IFMA 2GB2A 1GK4A 2XN0A 3O3DB 2OYKA 4DGWC 3KWUA 2DIEA 2NQ3A 3TBCA 5J56B 1A21A 1WWCA 2DV6A 2JKIS 4QO1A 4ANVA 1U30A 1YA5A 2UYLB 2R1WB 3G5VB 4J3OC 3OJVC 2N9BA 1NKNA 1BP3B 1HE7A 3JWOC 1O6TA 2X6VA 1E7VA 5IF0A 1DBJH 5IVOA 2BY0A 1E3FA 3O2DH 1HQ4B 5E9DE 4BH8A 1CICA 4EZJA 1EZUA 4ZOEA 5IMMB 3OKEA 4NEHB 3OZ9H 2SPZA 1ZV9A 2FRGP 1A47A 3AQDA 1IGJB 4PJFB 4YLQT 1N7SB 2W0PA 3W0WB 1I3GL 1VF5C 2C7UB 4FCHA 4H44B 4OB5H 3HB3B 5FYKL 3BUYB 2QQKH 2AHIA 4C56E 1BMWA 5KLVJ 3VFWA 4N22A 1DBKH 2R23B 1BWWA 4ZUUB 4KMLB 3PDDA 5DEFB 3ZDWA 2IOIA 4PI0A 4ODXA 1KCKA 2O6CA 5JPMA 2NZ9D 3UDWC 5A2IH 3S3JA 2WO3B 2V5SA 3D85A 4FNSA 1XGTB 2P7TA 5JHDD 3HJ0A 4YIQB 1IFIA 2IH1B 2NY6D 2R7EA 2J5LB 3FSVA 3QULB 1R46A 1VGKB 4GBXD 3BEVB 4Y7MA 4G9FD 2V2XB 5AVQB 4X9FA 2MCPL 1L0QA 4HCRH 4FA7B 3FFCE 3VB8A 2EDQA 4UB6E 3NZ8A 3UC0L 3CFDA 3MZTA 1MEXL 2Q6WB 2KPWA 4HS8L 5L4FA 3Q2NA 3WL9B 3WS3A 1USEA 1BD2D 4UB8H 1MXGA 1K8DB 4FEMA 5ETUA 2J59M 1JF5A 4KK8D 4XO8A 1YNTB 1XF2B 4TVSa 5T3XL 1RZ7L 4ZMWA 1II4E 3PWJB 3LKNA 5FGCB 1A6AA 5E8EB 3BATA 5CCHD 2FWOB 2Y06H 3LS4H 4LCYA 4P23A 3O6KL 4S11A 3VXUE 1P4BH 5GIRA 2JKLA 1Y1DA 3ZKND 2C3WA 4PUBL 4QRFA 4F8PA 2W5PA 4G1MA 3BP6A 5IB1B 1ZOXA 4NO5A 2IV8A 4PV9A 1GW3A 5BW7C 4NM8L 3P3TA 3BO8A 4XGZA 4FN0A 4MJ6A 3OLGA 1D6VL 3T8VA 2FR4A 2XN9E 2GY7B 4W6YB 4HWNA 1PAZA 3UO1H 1AHMA 4OD1L 1FO0A 2BSRB 2YPVH 5JO5A 2DEWX 1Z5LA 4OZFB 3RDTA 2AXGA 3QHZH 5BUGA 5IW1A 3B2VH 2GSGB 3QZBA 1L4AB 1UM5L 4PIBA 2HA1A 2F54D 2YIUC 1P5VB 1MHPL 4YVUA 2Z8WC 2Y5TB 3F7YA 4KJYA 4WI3A 1U8IB 4WVZA 3UBXG 5ICXA 2PO6A 5ABAA 3ARDC 3QJVB 5EDXA 1UZ8A 2JQZA 4NBYB 1GGCH 4TUJB 4W9ZA 4QHPA 1UD6A 5FKPB 4Y5XB 1AD9A 1EZVG 3EGXB 3H7BA 3DUUB 3UABA 4M6NH 5TTRA 2APFA 4RMRA 1ZGLP 3RFZC 2XQYA 3BPOB 3F83A 5EUOF 4APXA 1T5XA 2ZCHH 1KXTB 4EN3D 3F7KA 2P7JA 1DJXA 5IMOA 4NP4L 5B21A 1PG7X 3D69B 4OGYH 2Y0DA 3U7YH 5DVLA 3I50H 3U25A 3OLDA 3KZ8A 4JFFE 2Q8AL 1U92B 3JWNC 4Y19A 4R4BB 3TVMC 1E9OB 1QBLL 2NDGA 4UV7H 2AI0H 1E40A 4UZSA 2B2XL 1GC1L 1EXUB 4PJ5B 3IAQA 3A67L 2ICEC 3ZQ9A 3TBYA 3PTZA 5J6HB 1IZKA 4NJAH 5D9SA 3SPCA 5EBWB 1X4XA 4QYAA 2VWEC 3V2PA 3FO0H 3DSNB 3CCHB 3L74E 3ESPA 4XZ4A 4HD9A 3IF4A 3EFFK 1KDIA 1CVRA 1UJTA 3TV3H 1L7IL 1WBXA 1L5GA 1PY9A 2YN3A 4LL4A 3CWGA 3M45A 2VSDA 3B5NC 4RJTA 2W88A 2YFOA 4RSYA 4OJAA 3QAZB 3EBIA 5J8OA 1NOHA 1NCJA 1MI5B 3LKRA 1NFIA 2YC1A 2OKMA 1YEIL 4OZGF 3GQFA 3JYBA 1NCAL 1JGVH 1MOEA 3NEOA 3DIVA 5D1QE 1EDYA 3WDIA 3DIFB 3NP3A 1K9TA 3HNVL 1KG0B 2PTVA 4PJCF 4ELMA 2WIMA 3QDGA 1W91A 1XXDC 4OIBA 2YEZA 4F9PA 1SQQE 2HFED 3WJJA 4MJJA 3V4WA 3C8KB 4MDJB 4Z8FH 3HG1D 3ILPB 2B59B 2IH8A 2AMUA 4Z3JA 3MU3A 1PSKL 4F7EA 4M48H 2Z4EA 2H26A 5IF0B 4IRSB 4NFBA 3WMSA 4XHJC 3PREA 1QR1B 3HRZB 1T4KB 4D6TE 3ETBJ 1CR9H 1Z9PA 3PP4L 5IBUG 5CF3A 3QPXL 1SXNA 3K81A 3VQ2C 1GGIH 1NGYA 1U58B 1IBFA 1FHNA 4GMSL 3PAVA 3QJSB 5DGRA 4XXDB 2NY1C 3HBQA 2NRDA 3VFWB 3DGGA 1VEPA 1ADQH 3QPQC 1TFPA 3QZOA 2BP0A 1CYWA 3J8F7 2Q2EB 1QL2A 3GHBH 2OTLP 4FQQA 3BVUA 1I8IA 3B3IB 1KBKA 3FUEA 4BFOA 5D71L 1U6AH 4NKOA 4XNUL 1PZ5A 4YHYC 2VISA 3AWGA 4ZRGA 4UZGA 1LO2L 3BWZA 2MMXA 2P48B 2MHAB 4JRXB 1OARH 5F7LB 3VFRA 5SWSA 2R1YA 3NP4A 3CFDB 3I3DA 43C9B 2D03H 4Z77B 1J8RA 5LJYH 3GXTA 1D6EA 2AGJH 3A5VA 3KYMB 3CCJP 4O5LH 4PBDA 4AEFA 1H15B 1RF0C 2DN7A 4PV1D 5JR1L 1L9NA 3BESR 1CFQA 1NGQL 4J1UA 4GSDL 1J8SA 1UJ3A 2AEOA 2XWBA 3ZE1B 4C54A 1R24A 1RJYB 1WITA 3RB5A 2H0FA 3K0WA 1AI1H 4JRLA 5AWNH 4Q0XL 4NAJA 3CDFA 4DKTA 4GO9A 3WY1A 1YY8A 4M3LA 5IHHA 1N6VA 5I1EL 4EUPB 3CXDL 3MRLB 1ZVNA 3FB5A 3WDJA 4H20H 4AIXA 1IAIL 2M26A 1NGMB 1WBZA 3O11A 4XGZB 1OAYL 4TL4A 3LW5J 4XVJL 4MJ6B 4TRPH 4WFFD 2WLNA 2ZZUT 1N18A 3FT3B 3S96B 4P2AA 3KM1A 3QZMA 3KDMB 2OYMA 4KJQC 5CHXA 2XTJB 1Z5LB 4LSDA 2Y07H 2PMZA 2AXGB 4WJKB 5DSCB 5JOPD 5DO8A 3THML 4M6MH 5HTSA 2CRYA 3IXTA 4AV4A 3QCUL 3GBML 2NPSD 3MYJB 4OCYH 1UH2A 1QAWA 2WNXA 3EG9A 3O8XB 3X12B 4L1DA 4BBWA 4UQBA 3QUHA 4HF5H 3EOAB 1AYRA 2LHAA 3PE9A 2E9IA 2A9BA 3F6IA 3FRPA 5KTEH 2F1EA 4NLAA 3BAKA 1CDIA 2PO6B 1X3DA 4J3TA 4M3HA 4EKJA 1K8AQ 2AJZA 2VR4A 3EJJX 1JPSH 1ZIBA 3L5JA 4TTDC 1BF8A 4O4YH 3MJ9A 2BSSB 1T20B 3LS5L 1NSNL 3M1BB 4OLWH 4XBPA 3BRTB 1ZLLA 3P0VL 1FZCA 3FCSB 2JCCF 2AEPL 3RWFB 5BS0B 4IBUA 2RFXA 5KSAC 3QQ3B 3STBA 3Q7JA 4FADA 3ARUA 4LKCA 1IFPA 1HESA 2GFBB 2D0GA 3TGUE 3NH7L 4FYSA 4OR1A 5K33A 5SX5K 2XFXB 1HHHA 3IDNB 1MFAL 3MX0B 1BE3E 3LZQA 4Y2DC 4AGPA 5I6MA 4H26B 1NC2D 4H88H 3JZ7A 3O3BB 4XNMB 4MD5B 5LBVA 4I2LC 3WFBL 1LEKA 4Z23A 1YYLL 5ID1A 2OGUA 3HLKA 3TBYB 5JNYA 1VQKP 1A2YA 2IDSA 1AGEB 5D9SB 4A2MA 2J5UA 1NAKL 1G1KA 2NY0B 35C8L 3CSTA 1KTLA 4OT1H 4ZS6D 5JPNA 2K4WA 2QT6A 4O02H 2NYKA 2DLFH 2PP9A 4M7JL 4MNQD 4E41E 3APCA 2VH5L 3H4FA 3R7QA 5BRZA 5AAWC 3A22A 3U0WH 4OM0L 3PHQB 5HDBE 1H0DA 2IAMC 3GDBA 1N0XH 4U1SB 5F1IB 1DFBH 1UH3A 4F5CA 3SCMC 3LKRB 1GH7A 3M06A 1BVKB 2YC1B 4I9WE 4YHOL 1NFDA 4LSQL 4PJBA 4XCFL 3S36X 3L71E 1MXDA 2E7MA 4OFKA 4PRAB 3CVHB 4L8SC 2EDTA 3T0VA 4AW7A 1NTME 2CIKA 3HAEH 3L4UA 1JFHA 2K3TA 2WSEJ 2KS0A 2VYRE 3RNQB 2VE6B 4N0FA 4X4KA 4D94A 3U7WL 3TO4A 4ISVA 1RAMA 4I87A 1IIKA 4UOJA 3ZBMA 3DX4A 7CGTA 4LCWE 3WGVB 1RHFA 1HVVA 2ZT9B 1CDGA 3O6FB 1F3DH 1E2WA 5I19L 1OO2A 1AH1A 1GMEA 4NGHL 1QPPA 1A4JA 2B39A 5JDSB 1X5FA 4NC1E 4OKDA 4E9XA 1NGYB 4WUUE 1WAAA 3MV7D 1GZHC 2OZ4H 1NGPH 1Q38A 3EHBC 4Q2ZA 4TNWK 4DERA 4HOMA 3PF2A 1TU2B 4WNQB 5KYXA 2DQIH 5E8DL 4ZMAT 2ENSA 4DO4A 3RK2B 2XXFA 2ROYA 2X4NA 4UM8B 4LF3B 4KDVA 1I53A 4RFOL 1GL4B 4QRPD 4M1DL 5CEYA 5DHEA 3P0GB 3ZTNH 2RQ8A 3QS2A 3TO2A 3PAYA 4ONHB 1GOFA 2H43A 2ZUQC 3ZL2A 2CGRL 4RA0C 2AQRA 2ADIA 4HH8A 2PW1B 5D2LE 3VFSB 1O9ZA 4FTDA 3QIWA 4LBAA 2H7HA 4LEOA 3L70E 4HYTB 4QR7A 2Q6QA 4X7FC 3REVB 4JZNA 4HMCA 2FXPA 3A7OA 1NDTA 3LEYL 1MFCL 1UQSA 1YQVL 4P4KD 2Q0ZX 3QI9D 3O6QA 2OX5B 4HG4J 3EYFB 3ARWA 3H0TB 3D51A 3O4LE 4F7PA 2K9JB 5MEND 3C5JA 3RVTC 4M7LT 3NXSA 1U8QB 4RQQB 2DD8L 5IV2A 1KCUL 1UJ3B 3QB7C 1X9LA 2IALB 2XVKA 2P43B 3ATFA 4JW3A 3TIEB 2LU4A 1IUZA 3KLAB 1AZNA 4MXQD 5DHXB 5I1DB 1BOGA 3U1QA 4OKVB 2CWRA 3SPIA 3FB5B 1QSZA 3LYRA 3ZUNC 4YN3A 5ACLA 3T0ED 1SLXA 5ESAB 5AW8B 3ISRA 3TSIA 2X87A 2DQDL 3O11B 4LCIL 4QHKI 3K72A 4ZMPA 2JFCA 3B1TA 3GFUA 3FH8A 2GBUA 2W9EH 1KWGA 1MCKA 5CMAB 5J7CC 1Y0LA 5CHNA 1MFUA 1U4EA 3H42L 1AV1A 1JY2O 2E74D 2Y7LA 3QGVA 1FDOA 4IKNA 4NHCL 3G5ZB 5IHUH 2H88C 3U46B 4X5QA 3LKOA 3CDZA 4XMZA 2VN4A 4XN1A 2GUYA 4P5MB 2ZTBA 4CMMB 1JPFB 4M43H 4XOEA 5I1IH 1DYZA 2ED8A 4PLKC 1UWGH 4JY5L 4Y1AE 3V6IA 2CDEA 3VB9A 5J1AA 2EDHA 3ZZSA 2FECL 2O01N 2YGVA 5SWZA 1MZ9A 4OGXL 2BIHA 3EOYG 4G8EA 3VP8A 3QEGL 1W6WA 3P4NA 4J8RA 1G7MB 4Y16C 4LSPH 2WBKA 4HCFA 5GRUH 3ZMNA 4L8DA 3AE8C 4BFJA 1QR4A 1OX3A 3LRSA 1MCQA 3BVHA 5EO1A 3QZWA 3Q3DA 3D70A 3CX5I 2MNWA 5APVA 4LEBA 3C09C 5CR1A 2RMNA 4WY4B 5FWQA 4WUKH 1PS3A 4XXCC 1KXQE 3IPEA 4HMDA 1EANA 4NSKB 3V6OA 1B0GA 1VFOA 1R5VA 2J72A 4FFYL 4MAZA 4UT6H 1OP5H 1SXCA 1HFUA 2ZOOA 3TNNB 3PGCB 3QCTH 3FF8A 5FGRA 2YLKA 1DBBL 3ENEA 3SO3C 4C59B 4MCYA 4YSSA 1XB6A 4K3GA 1FYTD 2GYSA 4L9LA 4F7TA 1AJ7H 3HKFA 5C0FB 4AJVA 3KAAA 4DW2H 3KXFE 4F8TA 1Q94B 4OIIH 2ZJSL 1KPRA 3KWWA 1JY2N 4PJ8C 4WU7A 3VP9A 4KOBA 1KTLB 5E6ZA 4HS3B 1SJMA 2OTWB 4BQCA 1NDMA 5SX4H 1GPOH 2OBGA 4MMXC 4RZCA 4POZC 3F04A 4HPYL 1QTYT 1S7RA 2NNRA 4M6OL 3RL0g 3VI4F 3TBVA 3ARBB 1KB5B 1PX3A 1JI2A 3OXSA 4NQEA 1NFDB 3FQWB 4KAQL 4TULL 4K8RC 4FFWC 4EYYQ 4IS6A 5CZRA 5LCVA 3X14B 4BK5A 3L74G 3DTXB 2V17H 4BJLA 2JELL 2DIAA 2A06D 1F5WA 3PL6C 5CBEA 4QAMB 4DOHB 5CU5A 1PYWB 1LO3H 3B4NA 2ZYAA 5CS7A 3K8KA 5E5MB 2EDEA 1HAWA 2CR0A 1LDSA 2HT3C 3CIQA 3SKJL 4LEEA 5ALCL 3CFCH 1OSZB 3HAEG 4H0LD 4JFHD 3ARGA 2A38A 1Q1PA 5I1HH 3M07A 4EDWL 2XI9A 5F44A 1UA6L 4QTHA 4OCXH 4QTIH 3N5AA 3QEUB 1BG1A 1K4CA 3NABH 5T3ZD 5AB9A 3TEXA 1G7HA 4TSBH 2XICA 5DRWB 1G7PA 2HLOA 3LXBA 4Q9RL 1TSHA 4X8JA 5T8IA 1DE4A 1MFBL 3O2WH 1SQQG 5E8OA 4ZW8A 1J1XH 1T7XA 2VUYA 2DEYX 1Q9KA 4FQLL 4Q6KA 5KYXB 2CMRL 1KB5L 2RQEA 1BECA 5CILL 1OAKH 1RZJH 2IBZX 1GL2A 3E2HC 4TSCL 4K7PX 2YPLA 4KQ4L 2M1KA 4OSUL 4D6TG 3DPDA 4WWNA 3TO2B 3A24A 4PJDA 2CO7B 3IK2A 1HXMB 4HK0A 2F74B 4N25A 5J11B 5DT1H 4CNIA 3RPIA 5FGSA 3CI9A 1VFUA 5ALBL 2YZ1A 5B39G 3QFJE 2WLKA 3TZVB 5HYJD 4U1IB 2ZCLH 3Q8AA 4U0RB 2VN7A 3MODH 4JDTL 5GGVH 3ZE2B 2X3CA 4D2NA 1WAPA 4HOXA 2VLJA 3V4VH 5DJYB 3K6DA 3GB7A 1KELH 3L5XL 1U8PB 5KVFL