3CI9A

Crystal structure of the human hsbp1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
44
structure length
44
Chain Sequence
PKTVQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Heat shock factor-binding protein 1
publication title Crystal structure of the hexamer of human heat shock factor binding protein 1
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ci9A00
2O1KA 2WITA 3CI9A 4LLHA 1G1IA 4C7RA 2O1JA 4WB4A 4DOJA 4WBAA 3MIWA 1G1JA 4HH2A 2L5GB
chains in the Genus database with same CATH superfamily
1BDDA 3G3ZA 5DJTB 1EXIA 1NTZE 1MZ9A 3HUSC 1RF1A 2FFDB 1IFNA 3NMDA 1EQ7A 1X0TA 2E75D 1NTKE 2P1JA 2P2UA 4JYCA 3V2QA 1KB9H 2A45G 3IAOA 1SQBJ 1N7SC 3Q5RA 5H2FH 4PJ0H 1L2PA 1R5SA 1H0TB 3CCRP 1PPJE 4LC1A 2M5AB 5AVUB 3CWBG 2SPZA 2RN0A 3MIWA 1KILC 1KYOD 3O6QB 5AVVB 3CL3D 3BRVB 3LIEA 4PV1B 3N4XA 3H1JE 1IO4A 3AE1C 2BCCG 2XNXA 4H0LC 1SQBK 4O9BA 2KYVA 1M1JB 4NPEA 2KLUA 2WSFJ 2E75C 1U7JA 1M90Q 1OX3A 1HF9A 2LR2A 2JO1A 1ZR2A 2WSSH 1JOCA 4L75A 4I2LC 2QIWA 1L0NE 2RH0A 1KB9E 3M06A 3CMAP 5H2FE 2O1KA 3GG2A 2ZYAA 3L71G 3CX5I 3V6IA 3L72D 3KHUA 3M91A 1JY3N 2QE7H 1JO5A 4WWIA 2YMYA 1FZGA 3KPEA 3PTZA 4BWNA 2C9LY 1L0LE 3H1LJ 1GW3A 3C8VA 1NU1D 2R3CA 2N9YB 1RF1C 3L73G 1FZCA 2V7QJ 3T97A 1T2KD 3CCSP 1N73B 2D2CD 3LW5H 5CHXA 1HGVA 2K3RA 2OTLP 1T8ZA 1USEA 4ZKUA 1S3JA 1RQUA 3H32B 5AVQB 2E5YA 1VQ5P 3TF5A 1VQ4P 2WMMA 5KJ7A 2O01N 2Y0CA 3V2RA 1N2DC 2R3SA 3UIAA 3B8EB 1R8EA 1M56D 3ABVC 5AW1B 1NTME 3H1HD 5CJ0A 1S5LH 3OAKA 2E76B 1SQQE 3RGUA 2GUVA 3FXDA 5APYA 1NU1K 3L75G 1WRGA 1Y9BA 1BSHA 2ZXXA 3VP9A 4HYTB 4GOFA 3WUVA 3HUSB 1AQTA 2KUBA 2D2CC 1NTZG 1KQLA 2WSEJ 5GTIE 1HJBA 1PP9E 3CLQA 4JPZB 1IC2A 1N7SB 1BGYD 1NTKG 3MHVA 2JWDA 5KLIC 2K9JA 5GTHH 1GDTA 3L36A 2FFDA 4WVZA 1PPJG 1KILB 5KJ7D 4N78D 1RE4A 1VF5D 2Q9IA 2Y0DA 3SSUA 3CWBJ 1RHZB 4D6TG 3B5NB 3H1IE 1PGOA 2M5AA 3SFEC 1KQGB 3H1JG 3CX5D 4H0LB 2Z4EA 1S5LE 3O6QA 2BCCJ 1IFPA 1EDKA 2E75B 4YPCA 1FZCC 3WU2H 3G4SP 1M1JA 5AVSB 4I6MC 3IFMA 2C0XA 3P8CE 4EI2A 1L0NG 2HODA 1VF5C 1IJDB 3D70A 5GTHE 3CCJP 3AE6C 3L71J 5AVWB 3CC7P 2K37A 4HH2A 1NO4A 3L35A 1X8YA 2FY8A 1JTHB 1L0LG 1ZOYC 1QX8A 3FWLA 3MUDA 1P84I 4JYBA 3L73D 2KI7B 2E74B 3BCCG 4PV1D 5CCGC 1QVFO 3S4RA 1YYCA 2I8DA 4Y28J 2LKMA 2P10A 3L73J 3WU2E 2KNCA 1RE3A 5BU5A 5TISH 2FFDC 1UIXA 1DEBA 1EDJA 3HE5B 5CCHA 1YIJP 4AUWA 3VMZA 2Q3IA 2FKWB 1NTMG 3Q1MA 2GM4A 4NPDA 2Q1KA 3A2AA 3VYIA 4KHXA 4W7ZA 1SQQG 5AW9B 1PL5A 1LTSC 2JEEA 2CPBA 5L8RJ 1JCDA 4U7JA 3RL0C 3VOPA 3L75J 1HWTC 4GDOA 1LT1A 4U3FE 1PP9G 1YHQP 1NTZJ 1PGQA 4OWFA 5KLIB 2KK7A 2L5GB 3CD6P 1NHLA 3V2PA 1NTKJ 1PV3A 1PPJD 2IBZE 3RBZA 4HJGH 3L74D 1RY3A 3CCLP 1KYOI 1N7SA 5TISE 2PFXA 2ZXEB 5AW5B 1NKNA 3HTKA 4D6TD 1GU5A 3GW6A 2H8PD 2IZ1A 3CCEP 3H1IG 1HVVA 1JEKA 1ZP0C 1FJKA 2Q3EA 4D6TJ 1ZV8A 1J1EC 1KILA 2OYHC 3H1JJ 2QJPC 3B5NA 1TU3F 1NTKK 2WSCH 2KLVA 1FZCB 3L70D 2B9BA 3T97B 3B71A 1KFNA 2E76D 5KAIH 1S4XA 3F89A 1E79H 3TGUE 1Q7YQ 1P84D 1RE3C 1KB9D 4L74A 5K5GB 1GK6A 2YKPA 1SQXE 2YKQA 1L0NJ 1ZRTE 2H43A 4W80A 1N7SD 3CCVP 2BASA 1OMIA 2IPPA 3D6ZA 4XFJA 1BE3D 2R5DA 3D71A 1YTZI 2FXPA 1CSBA 1LTJC 1KILD 2GA1A 3BCCD 4RO0A 2E76C 1L0LJ 4K3AA 3B5ND 3L4FA 2R5BA 1FBMA 1L0NK 1JTHA 2AXCA 1LP1A 5CBOA 1EDLA 4H0LD 4C46A 3BCCJ 3ZDMA 1SQBD 2K88A 1S72P 1NAFA 4OGQC 1DX7A 2K9JB 5KAIE 1SQPG 1QLED 5AVRB 2P7JA 2OQQA 1AA0A 3PRJA 2R32A 3FXEA 2YO2A 3K5BA 3U59A 4Z1MH 4A7PA 2WQYC 2AEMA 1YQ4C 2A06D 1KORA 1SVFA 3HE5A 1KV4A 4UB6H 1NTMJ 1J1DC 2W83C 3G6EP 5AVZB 3H1KE 2E5TA 3B5NC 4BRYB 1SQQJ 4XE5B 2IDBA 3RL0B 1L4AB 3Q2YA 2A45I 3HE4B 2YXQB 1N86A 1VQPP 1W2BO 4U3FG 1VQOP 1FJPA 4ZMDA 2HPCA 4M3LA 1SQVE 2H7HA 1JB0J 3CC4P 3RK2C 3AE8C 2G3AA 1PP9J 1LJ2A 2HODB 2E74D 4W7YA 1MV8A 2IBZG 1SLQA 1K9MQ 2MKVA 1FAVA 1NTMK 1K73Q 3LW5J 1IFMA 3HD7A 4R4MA 1SQQK 1LWUC 2QA4P 1FDIA 1WT6A 3V2NA 1Q86Q 1Z56A 3W67A 2GUSA 2ZYDA 3CCQP 1S5LX 5AVXB 4PJ0E 3BVHA 1Q2NA 4GODA 3U1CA 1ZMEC 1YTZT 1J1EB 3AE4C 2OYHB 1T6AA 3H1LD 2FYZA 3H1IJ 3VMXA 2HG5D 4UB6E 2QJPB 2QG4A 4EDFA 1GU4A 2Z5HA 4I1LA 2IX7C 1OIPA 3KQGA 3S1KA 3EQ2A 3M0DC 3BATA 4WBAA 1GTWA 2KNCB 3TGUG 3P8CD 3JC22 1YJWP 2E74C 1BCCE 2YIUB 4TLFA 3CXHI 1PFIA 2W6AA 1AQ5A 3TNUB 1GL2A 3PP5A 2FYUE 2WSFH 1URQC 4IFFA 1QGKB 2YKOA 4B86A 1RF0A 1JY2O 1S2EA 3HD7D 1EZVE 1USDA 1JCCA 3A7OA 3TK1A 2ZFCA 1FE6A 5AW8B 1LTJB 5KLVE 2HFED 3PH0A 1AVOA 2Q7CA 1YBKA 2I1JA 2KS1B 5CJ4A 4NPFX 1SQPD 4OGQB 3I55P 1JNMA 5AW7B 1VL2A 2K1AA 1YQ3C 5CCGA 2M8RA 1Q81Q 1SQPJ 1GL2D 4IL6X 3HD7C 3HTKB 2BEQD 1OZHA 2QSIA 2WT7B 4PD4I 3CWBD 2W6JH 2W8ZA 1PIXA 1M1KQ 2OYIC 1DD4A 3JCUH 1S1CX 2QM7A 5APSA 1SS1A 1J1DB 3V4QA 3AEBC 2BCCD 1HBWA 2ZAEB 3FWNA 3H1KG 5APUA 1QVGO 1SQPK 5KTBA 1CZQA 1OFCX 1EC5A 2WWWA 5AW4B 2CK3H 4BRYA 2KB7P 1MKMA 4LGDE 1L4AA 2QEXP 3RK2B 3V5BA 4U3FJ 3HE4A 1LTIC 3L72E 1GL2C 1SQVG 3VP8A 5CCGD 3AE2C 4H13C 3RK3D 4CPGA 1FOSE 1OW7A 3AECC 2XKMA 1RF0C 1LWUB 2H88C 3L71D 1BDCA 4GKGA 1WMKA 3CXHD 2QJYB 1N8RQ 2J5UA 4IL6H 4WY4B 3U1AA 2I1KA 2A45H 2KZIA 1CW5A 1G2CB 1NU1E 2Y9YA 2N1TA 3JCUE 3II6A 2ZYGA 2O3JA 1DEEG 1HGZA 1Q82Q 1LP1B 5M1BA 4GT1A 2KSJA 2OYHA 3WMM0 4EIJA 3Q5PA 1S9KE 4WB4A 1OW8A 1M7LA 1FZAA 1AVYA 1KB9I 3C1LA 4LLHA 2NZ2A 2WPQA 5E79H 3L37A 2ZVOB 3RL0D 1BCCG 1L4AD 3V4WA 1ZR4A 3RK3C 3TGUJ 1URQB 3CX5H 2FYUG 2YXRB 3H1HE 3PHLA 1FZEA 4YXDC 3TNUA 4DCKA 4C7NB 1FDMA 1EZVG 2OTKE 1ZW0A 4RJTA 2C9NY 3M9BA 4IL6E 3SFDC 5KKZC 5APQA 4PD4D 1VPCA 2N1TD 3BASA 5KLVG 3L75D 1BGYE 2Z5IA 1LTJA 3RL0g 2HPCB 1NTZD 3M9QA 1L4AC 1X9VA 4XA4A 1YI2P 3I56P 4GOEA 1KQFB 3WUUA 2FBWC 1X22A 1NTKD 2WSCJ 1NH4A 2L91A 4N78E 4ASWA 1GMJA 3RBXA 2KS1A 5E79E 2AEJA 3OA7A 1NGMB 1GD2E 2CPSA 2JR8A 1H89A 3HD7B 2K9YA 3OJAB 3EFGA 1HH0A 2V4HA 1J2JB 3CX5E 1FZFA 1YITP 2RKLA 1SP4A 3AE9C 2OYIB 2WTYA 2N1TC 2WT7A 3H1JD 4IFDK 5KAFH 1UIIA 1NTZK 3I5CA 3H1KJ 2O01H 2IFNA 5APWA 3M9HA 3GHGA 3MP7B 3USSA 1KFMA 1GL2B 1XTCC 2Q6QA 3L72G 4EYYQ 4H13B 4BXLA 1L0ND 1SQVJ 2B87A 3G9RA 2YIUC 1AFOA 4OGQD 2YMKA 1E5WA 2LXBA 2KSEA 1QEXA 2ZT9B 1LWUA 1NU1G 3P8MC 4YTPC 1CI6B 1L0LD 3IR9A 1K8AQ 4Y99C 2JKVA 1JMMA 4WY4A 3A0BH 2XNDH 1SFCC 4QMAA 1SQVK 1G2CA 1EXJA 4JF7A 5CBNA 1LT9C 1RH5B 4L73A 3RK3B 1OWAA 4DZOA 3KDPB 3M0DA 1IFJA 4IOIH 1QL2A 1BCCJ 3H1HG 1D7MA 5AVYB 2FYUJ 3RK2D 1LTGC 1PGPA 1H8AA 1URQA 2KIKA 2FXOA 3TDKA 3EWKA 1NTMD 1L0LK 2PRRA 5KKZB 1FU1A 1P84H 5KLVD 5EFWB 2J59M 1SQQD 1OVRA 4ASVA 1VQNP 1AV1A 4C7NA 3CI9A 1BGYG 4WY4D 5KLVJ 4R4LA 1NYHA 3A0BE 2FYUK 3GHGC 3L74E 2N9BA 1PP9D 2PAJA 2M3BA 1LTBC 3S9OA 2G8YA 3AE3C 1Q90D 4D6TE 2XV5A 1GW4A 3P32A 4UB8H 3AEEC 3CMEP 1G1JA 1FC2C 3KZIH 4RKUJ 2Y9ZA 3AEAC 3NFQA 3GF7A 1OXZA 2OTJP 3CC2P 2P67A 2QM8A 5KLVK 3ITKA 2UWJE 1Y8AA 1URQD 5AW2B 1OVVA 2N1TB 2PP6A 3L70E 3H1ID 3MZWB 3BRTB 2QJYC 2J58A 3AE5C 2OYIA 1JY2P 2KXPB 4WY4C 3PJSK 5B66H 1P84E 2AXTH 3PLNA 4KJMA 2IBZI 3MGNA 1NVOA 3O8ZA 2XU6A 3IF4A 1FS0E 5TJHA 3A0HH 1KYOH 1OW6A 4DJGA 1VQ9P 3L72J 1BE3E 1NWQA 1G1IA 1JM0A 1NKZB 2HYNA 1LTAC 1KD1Q 1MUUA 1OVUA 2ITAA 1HJ0A 4UB8E 1YJ9P 3KZIE 1KILE 5GTIH 1SQXG 3BCCE 4OVNF 3AEDC 2M0BA 2W6BA 4MN4C 3H6PA 1IK7A 5AW6B 4N6JA 3P7KA 1FDOA 2IYPA 5C39A 4Y99B 1SQBE 2NPSB 1LTTC 3G71P 1NU1J 1SFCB 3GMAA 1A02J 3A3YB 3GF3A 1S9KD 1VQKP 1IZNB 1VQ8P 2VRSA 5B66E 1W5CE 1XTGB 1LT9B 2OYOA 1H88A 1CI6A 1KQSO 1ZN5A 2AXTE 2Q5UA 1QL1A 2QJKB 1NAYA 1IFDA 3CCUP 3VN0A 1VQ7P 2A06E 1W2EA 2POHA 1BSNA 3A0HE 1KYOE 3E7KA 3H1HJ 2B89A 2XDJA 4ZKPA 3AEFC 1DD3A 2V7QH 3NXSA 4H13D 3N7NA 1T2KC 1IK9A 1T3JA 1VQMP 1DH3A 2WVRA 3NTNA 2OGUA 1GZLA 2ZT9D 3GHGB 1BGYJ 3W68A 2OARA 1PGJA 4U3FD 1KMIZ 3L74G 2DW3A 3CPWO 4JBZA 2O1JA 5APXA 2KOGA 1H0TA 2B87B 2H89C 2WPSA 2FYNC 2IBZD 5APTA 4C7RA 1KC8Q 1MFTA 2JWAA 2C0WA 3H1LE 2WSEH 1AJYA 1X79B 1K04A 2WPVB 2ZVNB 1M57D 3L70G 3HRNA 4H44D 2R44A 2ZT9C 2KP8A 4I7ZC 3VTPC 2WPRA 1JUNA 5AW0B 5KJ7C 3JSVC 4JQ0D 4KT0J 3IN6A 3SWYA 2Y0EA 3OW2O 2IYOA 4HKZH 3TGUD 3VMAA 3A5TA 2M3EA 1U57A 4K35A 1JY2N 1BE3G 2NRGA 1SQXD 1ZRTD 1R5LA 5AVTB 1MFZA 3MTUE 4HB1A 1IFIA 1RF1B 1SQXJ 4H44C 3LIDA 1K05A 4RESB 2JDIH 2YNYA 1SQPE 2E43A 1M8OB 3FX0A 1DIPA 1SQBG 3KXDA 2JP3A 3AE7C 1N73A 1NOHA 5APVA 2XZRA 1RE4C 2NPSA 3CXHH 5DJUB 1SFCA 1Y47A 5AW3B 1PZQA 3KYQA 3CWBE 3M0AA 3H32A 2JJLA 1SQXK 2A06G 2MJZA 1LT9A 2O01J 4N3YB 1EZVI 3QWOC 2IZ0A 3MD0A 4PV1C 2BCCE 1RQVA 2HLOA 3QH9A 1LGHB 5B5EH 2WZ7A 2D2CB 1U7MA 2ZJSE 2PGDA 1M1JC 3Q3DA 2HR3A 1JY3P 1VDFA 4EOTA 3H1KD 3HUSA 5CMZA 3EFFK 2AEFA 1GK4A 5BU8B 3FGAD 2P58A 3RK3E 5CCHD 1HTLC 2KZJA 2NPSD 3L71E 1SFCD 1KTMA 3SWKA 1SQVD 3CXHE 3L74J 5BVZA 2E42A 4TT3H 2FYNB 2LXCB 4GIFA 4OH8B 4PD4H 2WITA 3VMYA 1HUCA 3MUDC 1EDIA 2FXMA 3B4SA 1VQLP 2W90A 2W27A 1FOSF 3AEGC 3H1LG 4L76A 1YJNP 1N7LA 4YXWH 2B88A 1JY3O 1ZXGA 2BEZF 1VQ6P 1KZUB 3Q5SA 1ZLLA 5B5EE 1FZBA 3L73E 4I7ZB 3WUTA 3TYYA 1NJIQ 3L70J 1A02F 1LNQA 2YO3A 1T3UA 3TSIA 3R4YA 1N73C 1KN7A 5CCHC 1VF5B 3SWFA 2RMZA 2NPSC 3E1RA 3H25A 3GLMA 3CCMP 5KAFE 1BCCD 4AYCA 4IFMA 2QVAA 2FYUD 3F5HA 3D6YA 2QJKC 1JMBA 4DOJA 3R2PA 1BE3J 4PD4E 3E1IA 4DT0A 2IFMA 3L75E 4AQRD 4H44B 1EZVD 2QRXA 4ZNCA 3C9IA
chains in the Genus database with same CATH topology
3RK3D 3G3ZA 1FOSE 2L5GB 1MZ9A 2XKMA 1RF0C 3HUSC 1LWUB 2W6BA 3H6PA 1NHLA 5AW6B 3V2PA 4N6JA 3P7KA 4GKGA 1RF1A 1IFNA 2FFDB 3NMDA 1EQ7A 2P1JA 2P2UA 4JYCA 3V2QA 2A45G 1RY3A 1N7SC 4Y99B 4WY4B 1N7SA 3U1AA 2I1KA 2A45H 1LTTC 2NPSB 2ZXEB 5AW5B 1NKNA 1CW5A 1SFCB 1G2CB 1A02J 3HTKA 3A3YB 1S9KD 2N1TA 1GU5A 4LC1A 3II6A 2VRSA 2H8PD 5AVUB 1XTGB 1LT9B 1H88A 1CI6A 3MIWA 1HGZA 1ZN5A 1HVVA 2Q5UA 1FJKA 1KILC 1ZV8A 1QL1A 1J1EC 1KILA 4GT1A 2OYHC 2KSJA 5AVVB 2OYHA 3WMM0 4EIJA 3CL3D 3BRVB 3LIEA 1IFDA 1S9KE 4WB4A 1M7LA 3N4XA 3VN0A 1FZAA 4LLHA 3B5NA 1W2EA 2WPQA 1IO4A 1NTKK 2POHA 2WSCH 2KLVA 1FZCB 2XNXA 3L37A 1KFNA 3RL0D 1L4AD 1SQBK 3V4WA 1ZR4A 3RK3C 4O9BA 2KYVA 1M1JB 1URQB 2XDJA 4ZKPA 3NXSA 1RE3C 3N7NA 1FZEA 1T2KC 1GK6A 1IK9A 1T3JA 2YKPA 1ZR2A 3TNUA 1JOCA 4I2LC 2YKQA 1DH3A 3NTNA 4C7NB 1FDMA 2H43A 4W80A 1N7SD 1GZLA 2C9NY 2BASA 3M06A 3M9BA 5APQA 2O1KA 2IPPA 1VPCA 2N1TD 3BASA 3GHGB 2R5DA 1YTZI 2OARA 3M91A 1JY3N 2Z5IA 1CSBA 1JO5A 2YMYA 1LTJC 1FZGA 1LTJA 2O1JA 1KILD 5APXA 3KPEA 2KOGA 2HPCB 3M9QA 1L4AC 1X9VA 2WPSA 4XA4A 3B5ND 2C9LY 3L4FA 2R5BA 1FBMA 5APTA 4C7RA 1L0NK 1JTHA 1NH4A 4N78E 4C46A 2C0WA 1GW3A 3OA7A 1GD2E 1NAFA 2WSEH 2CPSA 1DX7A 1H89A 3HD7B 1X79B 3OJAB 2R3CA 1RF1C 5AVRB 2P7JA 3EFGA 1HH0A 1FZCA 1FZFA 1J2JB 3T97A 1T2KD 2R32A 1N73B 1SP4A 3LW5H 5CHXA 2OYIB 3HRNA 2YO2A 1HGVA 3U59A 2WTYA 1T8ZA 2KP8A 3VTPC 2WPRA 2N1TC 2WT7A 4ZKUA 1JUNA 4IFDK 5AW0B 3H32B 1SVFA 5AVQB 3HE5A 5KJ7C 5KJ7A 3V2RA 1N2DC 3UIAA 3SWYA 3B8EB 1NTZK 3I5CA 1J1DC 5AVZB 5AW1B 3B5NC 5CJ0A 3A5TA 2O01H 3OAKA 4XE5B 3RL0B 2IFNA 1L4AB 2A45I 3HE4B 5APWA 3M9HA 3GHGA 1KFMA 1GL2B 1N86A 1JY2N 2GUVA 1XTCC 5APYA 1NU1K 1WRGA 5AVTB 1MFZA 3MTUE 3VP9A 1FJPA 4HYTB 2HPCA 4M3LA 2H7HA 3HUSB 3RK2C 1AFOA 1IFIA 1RF1B 1KQLA 2HODB 4W7YA 1HJBA 1MV8A 3CLQA 1E5WA 3LIDA 1SLQA 4RESB 1IC2A 1FAVA 1N7SB 1NTMK 2YNYA 2E43A 1IFMA 3HD7A 1SQQK 1LWUC 1GDTA 3L36A 1LWUA 3V2NA 1WT6A 1Z56A 3P8MC 2FFDA 2GUSA 5AVXB 1N73A 1CI6B 1NOHA 3BVHA 3IR9A 4Y99C 1JMMA 5APVA 4WY4A 3U1CA 2XZRA 1KILB 1RE4C 5KJ7D 1YTZT 4N78D 1J1EB 1RE4A 2NPSA 2Q9IA 2OYHB 1SFCC 1SFCA 1SQVK 1G2CA 5AW3B 2FYZA 3VMXA 2HG5D 3KYQA 3B5NB 4JF7A 3M0AA 3H32A 2JJLA 1GU4A 1SQXK 2Z5HA 1LT9C 2MJZA 1LT9A 4I1LA 2IX7C 3KQGA 4N3YB 2Z4EA 3RK3B 1OWAA 3EQ2A 4DZOA 3KDPB 3M0DC 3M0DA 3BATA 1IFJA 4WBAA 3MD0A 1GTWA 1QL2A 3P8CD 2HLOA 1LGHB 1FZCC 2WZ7A 1PFIA 5AVYB 2W6AA 1AQ5A 3TNUB 1GL2A 3RK2D 1LTGC 3PP5A 1M1JC 1M1JA 2WSFH 5AVSB 4I6MC 3IFMA 1H8AA 1URQC 1JY3P 1URQA 4IFFA 1VDFA 2C0XA 3P8CE 2YKOA 4EOTA 4B86A 1L0LK 1RF0A 1JY2O 3HUSA 3HD7D 5CMZA 1FU1A 2J59M 1GK4A 2HODA 5BU8B 1IJDB 1JCCA 3A7OA 3TK1A 2ZFCA 4C7NA 3CI9A 1HTLC 5CCHD 5AW8B 1LTJB 4WY4D 5AVWB 2NPSD 4HH2A 1NO4A 1SFCD 3L35A 1X8YA 2FYUK 5BVZA 3GHGC 2E42A 2HFED 2N9BA 2Q7CA 4GIFA 4OH8B 1JTHB 2PAJA 2WITA 2M3BA 3VMYA 1LTBC 1HUCA 3MUDA 2FXMA 2I1JA 5CJ4A 4JYBA 2XV5A 1GW4A 2W27A 3P32A 1FOSF 5AW7B 1G1JA 1JNMA 1N7LA 5CCGC 1JY3O 5CCGA 3NFQA 1YYCA 1OXZA 1KZUB 2M8RA 1ZLLA 1GL2D 2LKMA 2P67A 1FZBA 2QM8A 5KLVK 3HD7C 3HTKB 1URQD 3TYYA 5AW2B 2N1TB 1RE3A 2WT7B 5BU5A 2FFDC 1A02F 2PP6A 2YO3A 1T3UA 3TSIA 1DEBA 1N73C 3HE5B 3BRTB 5CCHC 5CCHA 2OYIC 2J58A 2OYIA 1JY2P 4WY4C 4AUWA 3SWFA 3VMZA 2NPSC 2QM7A 5APSA 1J1DB 3V4QA 2Q3IA 1HBWA 2FKWB 2GM4A 3MGNA 3O8ZA 4AYCA 3A2AA 3VYIA 4KHXA 4W7ZA 5APUA 4IFMA 1SQPK 5KTBA 1CZQA 2XU6A 5AW9B 1LTSC 2WWWA 4DOJA 2JEEA 2CPBA 5AW4B 3R2PA 1JCDA 3RL0C 3E1IA 2KB7P 4LGDE 3VOPA 1G1IA 1L4AA 3RK2B 1NWQA 2IFMA 3V5BA 3HE4A 1LTIC 1HWTC 1GL2C 1NKZB 2HYNA 1LTAC 3VP8A 4AQRD 1MUUA 5CCGD 3C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1K A;  2WIT A;  3CI9 A;  4LLH A;  1G1I A;  4C7R A;  2O1J A;  4WB4 A;  4DOJ A;  4WBA A;  3MIW A;  1G1J A;  4HH2 A;  2L5G B; 
#chains in the Genus database with same CATH topology
 1BDD A;  3G3Z A;  5DJT B;  1EXI A;  1NTZ E;  1MZ9 A;  3HUS C;  1RF1 A;  2FFD B;  1IFN A;  3NMD A;  1EQ7 A;  1X0T A;  2E75 D;  1NTK E;  2P1J A;  2P2U A;  4JYC A;  3V2Q A;  1KB9 H;  2A45 G;  3IAO A;  1SQB J;  1N7S C;  3Q5R A;  5H2F H;  4PJ0 H;  1L2P A;  1R5S A;  1H0T B;  3CCR P;  1PPJ E;  4LC1 A;  2M5A B;  5AVU B;  3CWB G;  2SPZ A;  2RN0 A;  3MIW A;  1KIL C;  1KYO D;  3O6Q B;  5AVV B;  3CL3 D;  3BRV B;  3LIE A;  4PV1 B;  3N4X A;  3H1J E;  1IO4 A;  3AE1 C;  2BCC G;  2XNX A;  4H0L C;  1SQB K;  4O9B A;  2KYV A;  1M1J B;  4NPE A;  2KLU A;  2WSF J;  2E75 C;  1U7J A;  1M90 Q;  1OX3 A;  1HF9 A;  2LR2 A;  2JO1 A;  1ZR2 A;  2WSS H;  1JOC A;  4L75 A;  4I2L C;  2QIW A;  1L0N E;  2RH0 A;  1KB9 E;  3M06 A;  3CMA P;  5H2F E;  2O1K A;  3GG2 A;  2ZYA A;  3L71 G;  3CX5 I;  3V6I A;  3L72 D;  3KHU A;  3M91 A;  1JY3 N;  2QE7 H;  1JO5 A;  4WWI A;  2YMY A;  1FZG A;  3KPE A;  3PTZ A;  4BWN A;  2C9L Y;  1L0L E;  3H1L J;  1GW3 A;  3C8V A;  1NU1 D;  2R3C A;  2N9Y B;  1RF1 C;  3L73 G;  1FZC A;  2V7Q J;  3T97 A;  1T2K D;  3CCS P;  1N73 B;  2D2C D;  3LW5 H;  5CHX A;  1HGV A;  2K3R A;  2OTL P;  1T8Z A;  1USE A;  4ZKU A;  1S3J A;  1RQU A;  3H32 B;  5AVQ B;  2E5Y A;  1VQ5 P;  3TF5 A;  1VQ4 P;  2WMM A;  5KJ7 A;  2O01 N;  2Y0C A;  3V2R A;  1N2D C;  2R3S A;  3UIA A;  3B8E B;  1R8E A;  1M56 D;  3ABV C;  5AW1 B;  1NTM E;  3H1H D;  5CJ0 A;  1S5L H;  3OAK A;  2E76 B;  1SQQ E;  3RGU A;  2GUV A;  3FXD A;  5APY A;  1NU1 K;  3L75 G;  1WRG A;  1Y9B A;  1BSH A;  2ZXX A;  3VP9 A;  4HYT B;  4GOF A;  3WUV A;  3HUS B;  1AQT A;  2KUB A;  2D2C C;  1NTZ G;  1KQL A;  2WSE J;  5GTI E;  1HJB A;  1PP9 E;  3CLQ A;  4JPZ B;  1IC2 A;  1N7S B;  1BGY D;  1NTK G;  3MHV A;  2JWD A;  5KLI C;  2K9J A;  5GTH H;  1GDT A;  3L36 A;  2FFD A;  4WVZ A;  1PPJ G;  1KIL B;  5KJ7 D;  4N78 D;  1RE4 A;  1VF5 D;  2Q9I A;  2Y0D A;  3SSU A;  3CWB J;  1RHZ B;  4D6T G;  3B5N B;  3H1I E;  1PGO A;  2M5A A;  3SFE C;  1KQG B;  3H1J G;  3CX5 D;  4H0L B;  2Z4E A;  1S5L E;  3O6Q A;  2BCC J;  1IFP A;  1EDK A;  2E75 B;  4YPC A;  1FZC C;  3WU2 H;  3G4S P;  1M1J A;  5AVS B;  4I6M C;  3IFM A;  2C0X A;  3P8C E;  4EI2 A;  1L0N G;  2HOD A;  1VF5 C;  1IJD B;  3D70 A;  5GTH E;  3CCJ P;  3AE6 C;  3L71 J;  5AVW B;  3CC7 P;  2K37 A;  4HH2 A;  1NO4 A;  3L35 A;  1X8Y A;  2FY8 A;  1JTH B;  1L0L G;  1ZOY C;  1QX8 A;  3FWL A;  3MUD A;  1P84 I;  4JYB A;  3L73 D;  2KI7 B;  2E74 B;  3BCC G;  4PV1 D;  5CCG C;  1QVF O;  3S4R A;  1YYC A;  2I8D A;  4Y28 J;  2LKM A;  2P10 A;  3L73 J;  3WU2 E;  2KNC A;  1RE3 A;  5BU5 A;  5TIS H;  2FFD C;  1UIX A;  1DEB A;  1EDJ A;  3HE5 B;  5CCH A;  1YIJ P;  4AUW A;  3VMZ A;  2Q3I A;  2FKW B;  1NTM G;  3Q1M A;  2GM4 A;  4NPD A;  2Q1K A;  3A2A A;  3VYI A;  4KHX A;  4W7Z A;  1SQQ G;  5AW9 B;  1PL5 A;  1LTS C;  2JEE A;  2CPB A;  5L8R J;  1JCD A;  4U7J A;  3RL0 C;  3VOP A;  3L75 J;  1HWT C;  4GDO A;  1LT1 A;  4U3F E;  1PP9 G;  1YHQ P;  1NTZ J;  1PGQ A;  4OWF A;  5KLI B;  2KK7 A;  2L5G B;  3CD6 P;  1NHL A;  3V2P A;  1NTK J;  1PV3 A;  1PPJ D;  2IBZ E;  3RBZ A;  4HJG H;  3L74 D;  1RY3 A;  3CCL P;  1KYO I;  1N7S A;  5TIS E;  2PFX A;  2ZXE B;  5AW5 B;  1NKN A;  3HTK A;  4D6T D;  1GU5 A;  3GW6 A;  2H8P D;  2IZ1 A;  3CCE P;  3H1I G;  1HVV A;  1JEK A;  1ZP0 C;  1FJK A;  2Q3E A;  4D6T J;  1ZV8 A;  1J1E C;  1KIL A;  2OYH C;  3H1J J;  2QJP C;  3B5N A;  1TU3 F;  1NTK K;  2WSC H;  2KLV A;  1FZC B;  3L70 D;  2B9B A;  3T97 B;  3B71 A;  1KFN A;  2E76 D;  5KAI H;  1S4X A;  3F89 A;  1E79 H;  3TGU E;  1Q7Y Q;  1P84 D;  1RE3 C;  1KB9 D;  4L74 A;  5K5G B;  1GK6 A;  2YKP A;  1SQX E;  2YKQ A;  1L0N J;  1ZRT E;  2H43 A;  4W80 A;  1N7S D;  3CCV P;  2BAS A;  1OMI A;  2IPP A;  3D6Z A;  4XFJ A;  1BE3 D;  2R5D A;  3D71 A;  1YTZ I;  2FXP A;  1CSB A;  1LTJ C;  1KIL D;  2GA1 A;  3BCC D;  4RO0 A;  2E76 C;  1L0L J;  4K3A A;  3B5N D;  3L4F A;  2R5B A;  1FBM A;  1L0N K;  1JTH A;  2AXC A;  1LP1 A;  5CBO A;  1EDL A;  4H0L D;  4C46 A;  3BCC J;  3ZDM A;  1SQB D;  2K88 A;  1S72 P;  1NAF A;  4OGQ C;  1DX7 A;  2K9J B;  5KAI E;  1SQP G;  1QLE D;  5AVR B;  2P7J A;  2OQQ A;  1AA0 A;  3PRJ A;  2R32 A;  3FXE A;  2YO2 A;  3K5B A;  3U59 A;  4Z1M H;  4A7P A;  2WQY C;  2AEM A;  1YQ4 C;  2A06 D;  1KOR A;  1SVF A;  3HE5 A;  1KV4 A;  4UB6 H;  1NTM J;  1J1D C;  2W83 C;  3G6E P;  5AVZ B;  3H1K E;  2E5T A;  3B5N C;  4BRY B;  1SQQ J;  4XE5 B;  2IDB A;  3RL0 B;  1L4A B;  3Q2Y A;  2A45 I;  3HE4 B;  2YXQ B;  1N86 A;  1VQP P;  1W2B O;  4U3F G;  1VQO P;  1FJP A;  4ZMD A;  2HPC A;  4M3L A;  1SQV E;  2H7H A;  1JB0 J;  3CC4 P;  3RK2 C;  3AE8 C;  2G3A A;  1PP9 J;  1LJ2 A;  2HOD B;  2E74 D;  4W7Y A;  1MV8 A;  2IBZ G;  1SLQ A;  1K9M Q;  2MKV A;  1FAV A;  1NTM K;  1K73 Q;  3LW5 J;  1IFM A;  3HD7 A;  4R4M A;  1SQQ K;  1LWU C;  2QA4 P;  1FDI A;  1WT6 A;  3V2N A;  1Q86 Q;  1Z56 A;  3W67 A;  2GUS A;  2ZYD A;  3CCQ P;  1S5L X;  5AVX B;  4PJ0 E;  3BVH A;  1Q2N A;  4GOD A;  3U1C A;  1ZME C;  1YTZ T;  1J1E B;  3AE4 C;  2OYH B;  1T6A A;  3H1L D;  2FYZ A;  3H1I J;  3VMX A;  2HG5 D;  4UB6 E;  2QJP B;  2QG4 A;  4EDF A;  1GU4 A;  2Z5H A;  4I1L A;  2IX7 C;  1OIP A;  3KQG A;  3S1K A;  3EQ2 A;  3M0D C;  3BAT A;  4WBA A;  1GTW A;  2KNC B;  3TGU G;  3P8C D;  3JC2 2;  1YJW P;  2E74 C;  1BCC E;  2YIU B;  4TLF A;  3CXH I;  1PFI A;  2W6A A;  1AQ5 A;  3TNU B;  1GL2 A;  3PP5 A;  2FYU E;  2WSF H;  1URQ C;  4IFF A;  1QGK B;  2YKO A;  4B86 A;  1RF0 A;  1JY2 O;  1S2E A;  3HD7 D;  1EZV E;  1USD A;  1JCC A;  3A7O A;  3TK1 A;  2ZFC A;  1FE6 A;  5AW8 B;  1LTJ B;  5KLV E;  2HFE D;  3PH0 A;  1AVO A;  2Q7C A;  1YBK A;  2I1J A;  2KS1 B;  5CJ4 A;  4NPF X;  1SQP D;  4OGQ B;  3I55 P;  1JNM A;  5AW7 B;  1VL2 A;  2K1A A;  1YQ3 C;  5CCG A;  2M8R A;  1Q81 Q;  1SQP J;  1GL2 D;  4IL6 X;  3HD7 C;  3HTK B;  2BEQ D;  1OZH A;  2QSI A;  2WT7 B;  4PD4 I;  3CWB D;  2W6J H;  2W8Z A;  1PIX A;  1M1K Q;  2OYI C;  1DD4 A;  3JCU H;  1S1C X;  2QM7 A;  5APS A;  1SS1 A;  1J1D B;  3V4Q A;  3AEB C;  2BCC D;  1HBW A;  2ZAE B;  3FWN A;  3H1K G;  5APU A;  1QVG O;  1SQP K;  5KTB A;  1CZQ A;  1OFC X;  1EC5 A;  2WWW A;  5AW4 B;  2CK3 H;  4BRY A;  2KB7 P;  1MKM A;  4LGD E;  1L4A A;  2QEX P;  3RK2 B;  3V5B A;  4U3F J;  3HE4 A;  1LTI C;  3L72 E;  1GL2 C;  1SQV G;  3VP8 A;  5CCG D;  3AE2 C;  4H13 C;  3RK3 D;  4CPG A;  1FOS E;  1OW7 A;  3AEC C;  2XKM A;  1RF0 C;  1LWU B;  2H88 C;  3L71 D;  1BDC A;  4GKG A;  1WMK A;  3CXH D;  2QJY B;  1N8R Q;  2J5U A;  4IL6 H;  4WY4 B;  3U1A A;  2I1K A;  2A45 H;  2KZI A;  1CW5 A;  1G2C B;  1NU1 E;  2Y9Y A;  2N1T A;  3JCU E;  3II6 A;  2ZYG A;  2O3J A;  1DEE G;  1HGZ A;  1Q82 Q;  1LP1 B;  5M1B A;  4GT1 A;  2KSJ A;  2OYH A;  3WMM 0;  4EIJ A;  3Q5P A;  1S9K E;  4WB4 A;  1OW8 A;  1M7L A;  1FZA A;  1AVY A;  1KB9 I;  3C1L A;  4LLH A;  2NZ2 A;  2WPQ A;  5E79 H;  3L37 A;  2ZVO B;  3RL0 D;  1BCC G;  1L4A D;  3V4W A;  1ZR4 A;  3RK3 C;  3TGU J;  1URQ B;  3CX5 H;  2FYU G;  2YXR B;  3H1H E;  3PHL A;  1FZE A;  4YXD C;  3TNU A;  4DCK A;  4C7N B;  1FDM A;  1EZV G;  2OTK E;  1ZW0 A;  4RJT A;  2C9N Y;  3M9B A;  4IL6 E;  3SFD C;  5KKZ C;  5APQ A;  4PD4 D;  1VPC A;  2N1T D;  3BAS A;  5KLV G;  3L75 D;  1BGY E;  2Z5I A;  1LTJ A;  3RL0 g;  2HPC B;  1NTZ D;  3M9Q A;  1L4A C;  1X9V A;  4XA4 A;  1YI2 P;  3I56 P;  4GOE A;  1KQF B;  3WUU A;  2FBW C;  1X22 A;  1NTK D;  2WSC J;  1NH4 A;  2L91 A;  4N78 E;  4ASW A;  1GMJ A;  3RBX A;  2KS1 A;  5E79 E;  2AEJ A;  3OA7 A;  1NGM B;  1GD2 E;  2CPS A;  2JR8 A;  1H89 A;  3HD7 B;  2K9Y A;  3OJA B;  3EFG A;  1HH0 A;  2V4H A;  1J2J B;  3CX5 E;  1FZF A;  1YIT P;  2RKL A;  1SP4 A;  3AE9 C;  2OYI B;  2WTY A;  2N1T C;  2WT7 A;  3H1J D;  4IFD K;  5KAF H;  1UII A;  1NTZ K;  3I5C A;  3H1K J;  2O01 H;  2IFN A;  5APW A;  3M9H A;  3GHG A;  3MP7 B;  3USS A;  1KFM A;  1GL2 B;  1XTC C;  2Q6Q A;  3L72 G;  4EYY Q;  4H13 B;  4BXL A;  1L0N D;  1SQV J;  2B87 A;  3G9R A;  2YIU C;  1AFO A;  4OGQ D;  2YMK A;  1E5W A;  2LXB A;  2KSE A;  1QEX A;  2ZT9 B;  1LWU A;  1NU1 G;  3P8M C;  4YTP C;  1CI6 B;  1L0L D;  3IR9 A;  1K8A Q;  4Y99 C;  2JKV A;  1JMM A;  4WY4 A;  3A0B H;  2XND H;  1SFC C;  4QMA A;  1SQV K;  1G2C A;  1EXJ A;  4JF7 A;  5CBN A;  1LT9 C;  1RH5 B;  4L73 A;  3RK3 B;  1OWA A;  4DZO A;  3KDP B;  3M0D A;  1IFJ A;  4IOI H;  1QL2 A;  1BCC J;  3H1H G;  1D7M A;  5AVY B;  2FYU J;  3RK2 D;  1LTG C;  1PGP A;  1H8A A;  1URQ A;  2KIK A;  2FXO A;  3TDK A;  3EWK A;  1NTM D;  1L0L K;  2PRR A;  5KKZ B;  1FU1 A;  1P84 H;  5KLV D;  5EFW B;  2J59 M;  1SQQ D;  1OVR A;  4ASV A;  1VQN P;  1AV1 A;  4C7N A;  3CI9 A;  1BGY G;  4WY4 D;  5KLV J;  4R4L A;  1NYH A;  3A0B E;  2FYU K;  3GHG C;  3L74 E;  2N9B A;  1PP9 D;  2PAJ A;  2M3B A;  1LTB C;  3S9O A;  2G8Y A;  3AE3 C;  1Q90 D;  4D6T E;  2XV5 A;  1GW4 A;  3P32 A;  4UB8 H;  3AEE C;  3CME P;  1G1J A;  1FC2 C;  3KZI H;  4RKU J;  2Y9Z A;  3AEA C;  3NFQ A;  3GF7 A;  1OXZ A;  2OTJ P;  3CC2 P;  2P67 A;  2QM8 A;  5KLV K;  3ITK A;  2UWJ E;  1Y8A A;  1URQ D;  5AW2 B;  1OVV A;  2N1T B;  2PP6 A;  3L70 E;  3H1I D;  3MZW B;  3BRT B;  2QJY C;  2J58 A;  3AE5 C;  2OYI A;  1JY2 P;  2KXP B;  4WY4 C;  3PJS K;  5B66 H;  1P84 E;  2AXT H;  3PLN A;  4KJM A;  2IBZ I;  3MGN A;  1NVO A;  3O8Z A;  2XU6 A;  3IF4 A;  1FS0 E;  5TJH A;  3A0H H;  1KYO H;  1OW6 A;  4DJG A;  1VQ9 P;  3L72 J;  1BE3 E;  1NWQ A;  1G1I A;  1JM0 A;  1NKZ B;  2HYN A;  1LTA C;  1KD1 Q;  1MUU A;  1OVU A;  2ITA A;  1HJ0 A;  4UB8 E;  1YJ9 P;  3KZI E;  1KIL E;  5GTI H;  1SQX G;  3BCC E;  4OVN F;  3AED C;  2M0B A;  2W6B A;  4MN4 C;  3H6P A;  1IK7 A;  5AW6 B;  4N6J A;  3P7K A;  1FDO A;  2IYP A;  5C39 A;  4Y99 B;  1SQB E;  2NPS B;  1LTT C;  3G71 P;  1NU1 J;  1SFC B;  3GMA A;  1A02 J;  3A3Y B;  3GF3 A;  1S9K D;  1VQK P;  1IZN B;  1VQ8 P;  2VRS A;  5B66 E;  1W5C E;  1XTG B;  1LT9 B;  2OYO A;  1H88 A;  1CI6 A;  1KQS O;  1ZN5 A;  2AXT E;  2Q5U A;  1QL1 A;  2QJK B;  1NAY A;  1IFD A;  3CCU P;  3VN0 A;  1VQ7 P;  2A06 E;  1W2E A;  2POH A;  1BSN A;  3A0H E;  1KYO E;  3E7K A;  3H1H J;  2B89 A;  2XDJ A;  4ZKP A;  3AEF C;  1DD3 A;  2V7Q H;  3NXS A;  4H13 D;  3N7N A;  1T2K C;  1IK9 A;  1T3J A;  1VQM P;  1DH3 A;  2WVR A;  3NTN A;  2OGU A;  1GZL A;  2ZT9 D;  3GHG B;  1BGY J;  3W68 A;  2OAR A;  1PGJ A;  4U3F D;  1KMI Z;  3L74 G;  2DW3 A;  3CPW O;  4JBZ A;  2O1J A;  5APX A;  2KOG A;  1H0T A;  2B87 B;  2H89 C;  2WPS A;  2FYN C;  2IBZ D;  5APT A;  4C7R A;  1KC8 Q;  1MFT A;  2JWA A;  2C0W A;  3H1L E;  2WSE H;  1AJY A;  1X79 B;  1K04 A;  2WPV B;  2ZVN B;  1M57 D;  3L70 G;  3HRN A;  4H44 D;  2R44 A;  2ZT9 C;  2KP8 A;  4I7Z C;  3VTP C;  2WPR A;  1JUN A;  5AW0 B;  5KJ7 C;  3JSV C;  4JQ0 D;  4KT0 J;  3IN6 A;  3SWY A;  2Y0E A;  3OW2 O;  2IYO A;  4HKZ H;  3TGU D;  3VMA A;  3A5T A;  2M3E A;  1U57 A;  4K35 A;  1JY2 N;  1BE3 G;  2NRG A;  1SQX D;  1ZRT D;  1R5L A;  5AVT B;  1MFZ A;  3MTU E;  4HB1 A;  1IFI A;  1RF1 B;  1SQX J;  4H44 C;  3LID A;  1K05 A;  4RES B;  2JDI H;  2YNY A;  1SQP E;  2E43 A;  1M8O B;  3FX0 A;  1DIP A;  1SQB G;  3KXD A;  2JP3 A;  3AE7 C;  1N73 A;  1NOH A;  5APV A;  2XZR A;  1RE4 C;  2NPS A;  3CXH H;  5DJU B;  1SFC A;  1Y47 A;  5AW3 B;  1PZQ A;  3KYQ A;  3CWB E;  3M0A A;  3H32 A;  2JJL A;  1SQX K;  2A06 G;  2MJZ A;  1LT9 A;  2O01 J;  4N3Y B;  1EZV I;  3QWO C;  2IZ0 A;  3MD0 A;  4PV1 C;  2BCC E;  1RQV A;  2HLO A;  3QH9 A;  1LGH B;  5B5E H;  2WZ7 A;  2D2C B;  1U7M A;  2ZJS E;  2PGD A;  1M1J C;  3Q3D A;  2HR3 A;  1JY3 P;  1VDF A;  4EOT A;  3H1K D;  3HUS A;  5CMZ A;  3EFF K;  2AEF A;  1GK4 A;  5BU8 B;  3FGA D;  2P58 A;  3RK3 E;  5CCH D;  1HTL C;  2KZJ A;  2NPS D;  3L71 E;  1SFC D;  1KTM A;  3SWK A;  1SQV D;  3CXH E;  3L74 J;  5BVZ A;  2E42 A;  4TT3 H;  2FYN B;  2LXC B;  4GIF A;  4OH8 B;  4PD4 H;  2WIT A;  3VMY A;  1HUC A;  3MUD C;  1EDI A;  2FXM A;  3B4S A;  1VQL P;  2W90 A;  2W27 A;  1FOS F;  3AEG C;  3H1L G;  4L76 A;  1YJN P;  1N7L A;  4YXW H;  2B88 A;  1JY3 O;  1ZXG A;  2BEZ F;  1VQ6 P;  1KZU B;  3Q5S A;  1ZLL A;  5B5E E;  1FZB A;  3L73 E;  4I7Z B;  3WUT A;  3TYY A;  1NJI Q;  3L70 J;  1A02 F;  1LNQ A;  2YO3 A;  1T3U A;  3TSI A;  3R4Y A;  1N73 C;  1KN7 A;  5CCH C;  1VF5 B;  3SWF A;  2RMZ A;  2NPS C;  3E1R A;  3H25 A;  3GLM A;  3CCM P;  5KAF E;  1BCC D;  4AYC A;  4IFM A;  2QVA A;  2FYU D;  3F5H A;  3D6Y A;  2QJK C;  1JMB A;  4DOJ A;  3R2P A;  1BE3 J;  4PD4 E;  3E1I A;  4DT0 A;  2IFM A;  3L75 E;  4AQR D;  4H44 B;  1EZV D;  2QRX A;  4ZNC A;  3C9I A; 
#chains in the Genus database with same CATH homology
 3RK3 D;  3G3Z A;  1FOS E;  2L5G B;  1MZ9 A;  2XKM A;  1RF0 C;  3HUS C;  1LWU B;  2W6B A;  3H6P A;  1NHL A;  5AW6 B;  3V2P A;  4N6J A;  3P7K A;  4GKG A;  1RF1 A;  1IFN A;  2FFD B;  3NMD A;  1EQ7 A;  2P1J A;  2P2U A;  4JYC A;  3V2Q A;  2A45 G;  1RY3 A;  1N7S C;  4Y99 B;  4WY4 B;  1N7S A;  3U1A A;  2I1K A;  2A45 H;  1LTT C;  2NPS B;  2ZXE B;  5AW5 B;  1NKN A;  1CW5 A;  1SFC B;  1G2C B;  1A02 J;  3HTK A;  3A3Y B;  1S9K D;  2N1T A;  1GU5 A;  4LC1 A;  3II6 A;  2VRS A;  2H8P D;  5AVU B;  1XTG B;  1LT9 B;  1H88 A;  1CI6 A;  3MIW A;  1HGZ A;  1ZN5 A;  1HVV A;  2Q5U A;  1FJK A;  1KIL C;  1ZV8 A;  1QL1 A;  1J1E C;  1KIL A;  4GT1 A;  2OYH C;  2KSJ A;  5AVV B;  2OYH A;  3WMM 0;  4EIJ A;  3CL3 D;  3BRV B;  3LIE A;  1IFD A;  1S9K E;  4WB4 A;  1M7L A;  3N4X A;  3VN0 A;  1FZA A;  4LLH A;  3B5N A;  1W2E A;  2WPQ A;  1IO4 A;  1NTK K;  2POH A;  2WSC H;  2KLV A;  1FZC B;  2XNX A;  3L37 A;  1KFN A;  3RL0 D;  1L4A D;  1SQB K;  3V4W A;  1ZR4 A;  3RK3 C;  4O9B A;  2KYV A;  1M1J B;  1URQ B;  2XDJ A;  4ZKP A;  3NXS A;  1RE3 C;  3N7N A;  1FZE A;  1T2K C;  1GK6 A;  1IK9 A;  1T3J A;  2YKP A;  1ZR2 A;  3TNU A;  1JOC A;  4I2L C;  2YKQ A;  1DH3 A;  3NTN A;  4C7N B;  1FDM A;  2H43 A;  4W80 A;  1N7S D;  1GZL A;  2C9N Y;  2BAS A;  3M06 A;  3M9B A;  5APQ A;  2O1K A;  2IPP A;  1VPC A;  2N1T D;  3BAS A;  3GHG B;  2R5D A;  1YTZ I;  2OAR A;  3M91 A;  1JY3 N;  2Z5I A;  1CSB A;  1JO5 A;  2YMY A;  1LTJ C;  1FZG A;  1LTJ A;  2O1J A;  1KIL D;  5APX A;  3KPE A;  2KOG A;  2HPC B;  3M9Q A;  1L4A C;  1X9V A;  2WPS A;  4XA4 A;  3B5N D;  2C9L Y;  3L4F A;  2R5B A;  1FBM A;  5APT A;  4C7R A;  1L0N K;  1JTH A;  1NH4 A;  4N78 E;  4C46 A;  2C0W A;  1GW3 A;  3OA7 A;  1GD2 E;  1NAF A;  2WSE H;  2CPS A;  1DX7 A;  1H89 A;  3HD7 B;  1X79 B;  3OJA B;  2R3C A;  1RF1 C;  5AVR B;  2P7J A;  3EFG A;  1HH0 A;  1FZC A;  1FZF A;  1J2J B;  3T97 A;  1T2K D;  2R32 A;  1N73 B;  1SP4 A;  3LW5 H;  5CHX A;  2OYI B;  3HRN A;  2YO2 A;  1HGV A;  3U59 A;  2WTY A;  1T8Z A;  2KP8 A;  3VTP C;  2WPR A;  2N1T C;  2WT7 A;  4ZKU A;  1JUN A;  4IFD K;  5AW0 B;  3H32 B;  1SVF A;  5AVQ B;  3HE5 A;  5KJ7 C;  5KJ7 A;  3V2R A;  1N2D C;  3UIA A;  3SWY A;  3B8E B;  1NTZ K;  3I5C A;  1J1D C;  5AVZ B;  5AW1 B;  3B5N C;  5CJ0 A;  3A5T A;  2O01 H;  3OAK A;  4XE5 B;  3RL0 B;  2IFN A;  1L4A B;  2A45 I;  3HE4 B;  5APW A;  3M9H A;  3GHG A;  1KFM A;  1GL2 B;  1N86 A;  1JY2 N;  2GUV A;  1XTC C;  5APY A;  1NU1 K;  1WRG A;  5AVT B;  1MFZ A;  3MTU E;  3VP9 A;  1FJP A;  4HYT B;  2HPC A;  4M3L A;  2H7H A;  3HUS B;  3RK2 C;  1AFO A;  1IFI A;  1RF1 B;  1KQL A;  2HOD B;  4W7Y A;  1HJB A;  1MV8 A;  3CLQ A;  1E5W A;  3LID A;  1SLQ A;  4RES B;  1IC2 A;  1FAV A;  1N7S B;  1NTM K;  2YNY A;  2E43 A;  1IFM A;  3HD7 A;  1SQQ K;  1LWU C;  1GDT A;  3L36 A;  1LWU A;  3V2N A;  1WT6 A;  1Z56 A;  3P8M C;  2FFD A;  2GUS A;  5AVX B;  1N73 A;  1CI6 B;  1NOH A;  3BVH A;  3IR9 A;  4Y99 C;  1JMM A;  5APV A;  4WY4 A;  3U1C A;  2XZR A;  1KIL B;  1RE4 C;  5KJ7 D;  1YTZ T;  4N78 D;  1J1E B;  1RE4 A;  2NPS A;  2Q9I A;  2OYH B;  1SFC C;  1SFC A;  1SQV K;  1G2C A;  5AW3 B;  2FYZ A;  3VMX A;  2HG5 D;  3KYQ A;  3B5N B;  4JF7 A;  3M0A A;  3H32 A;  2JJL A;  1GU4 A;  1SQX K;  2Z5H A;  1LT9 C;  2MJZ A;  1LT9 A;  4I1L A;  2IX7 C;  3KQG A;  4N3Y B;  2Z4E A;  3RK3 B;  1OWA A;  3EQ2 A;  4DZO A;  3KDP B;  3M0D C;  3M0D A;  3BAT A;  1IFJ A;  4WBA A;  3MD0 A;  1GTW A;  1QL2 A;  3P8C D;  2HLO A;  1LGH B;  1FZC C;  2WZ7 A;  1PFI A;  5AVY B;  2W6A A;  1AQ5 A;  3TNU B;  1GL2 A;  3RK2 D;  1LTG C;  3PP5 A;  1M1J C;  1M1J A;  2WSF H;  5AVS B;  4I6M C;  3IFM A;  1H8A A;  1URQ C;  1JY3 P;  1URQ A;  4IFF A;  1VDF A;  2C0X A;  3P8C E;  2YKO A;  4EOT A;  4B86 A;  1L0L K;  1RF0 A;  1JY2 O;  3HUS A;  3HD7 D;  5CMZ A;  1FU1 A;  2J59 M;  1GK4 A;  2HOD A;  5BU8 B;  1IJD B;  1JCC A;  3A7O A;  3TK1 A;  2ZFC A;  4C7N A;  3CI9 A;  1HTL C;  5CCH D;  5AW8 B;  1LTJ B;  4WY4 D;  5AVW B;  2NPS D;  4HH2 A;  1NO4 A;  1SFC D;  3L35 A;  1X8Y A;  2FYU K;  5BVZ A;  3GHG C;  2E42 A;  2HFE D;  2N9B A;  2Q7C A;  4GIF A;  4OH8 B;  1JTH B;  2PAJ A;  2WIT A;  2M3B A;  3VMY A;  1LTB C;  1HUC A;  3MUD A;  2FXM A;  2I1J A;  5CJ4 A;  4JYB A;  2XV5 A;  1GW4 A;  2W27 A;  3P32 A;  1FOS F;  5AW7 B;  1G1J A;  1JNM A;  1N7L A;  5CCG C;  1JY3 O;  5CCG A;  3NFQ A;  1YYC A;  1OXZ A;  1KZU B;  2M8R A;  1ZLL A;  1GL2 D;  2LKM A;  2P67 A;  1FZB A;  2QM8 A;  5KLV K;  3HD7 C;  3HTK B;  1URQ D;  3TYY A;  5AW2 B;  2N1T B;  1RE3 A;  2WT7 B;  5BU5 A;  2FFD C;  1A02 F;  2PP6 A;  2YO3 A;  1T3U A;  3TSI A;  1DEB A;  1N73 C;  3HE5 B;  3BRT B;  5CCH C;  5CCH A;  2OYI C;  2J58 A;  2OYI A;  1JY2 P;  4WY4 C;  4AUW A;  3SWF A;  3VMZ A;  2NPS C;  2QM7 A;  5APS A;  1J1D B;  3V4Q A;  2Q3I A;  1HBW A;  2FKW B;  2GM4 A;  3MGN A;  3O8Z A;  4AYC A;  3A2A A;  3VYI A;  4KHX A;  4W7Z A;  5APU A;  4IFM A;  1SQP K;  5KTB A;  1CZQ A;  2XU6 A;  5AW9 B;  1LTS C;  2WWW A;  4DOJ A;  2JEE A;  2CPB A;  5AW4 B;  3R2P A;  1JCD A;  3RL0 C;  3E1I A;  2KB7 P;  4LGD E;  3VOP A;  1G1I A;  1L4A A;  3RK2 B;  1NWQ A;  2IFM A;  3V5B A;  3HE4 A;  1LTI C;  1HWT C;  1GL2 C;  1NKZ B;  2HYN A;  1LTA C;  3VP8 A;  4AQR D;  1MUU A;  5CCG D;  3C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...