5AW2B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw2B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw2B02
1HWTC 1MUUA 1KQLA 5AVZB 1SLQA 5AW8B 4JYCA 4I6MC 5APWA 3M0AA 2Q3IA 3O8ZA 1GU4A 3NXSA 1HBWA 1OWAA 3NMDA 2BASA 4DZOA 2WTYA 3A3YB 2Q5UA 1G2CB 3KDPB 5AW3B 4AQRD 4C7NA 3WGVB 4C7NB 1MV8A 5APVA 5AW9B 1NAFA 3A7OA 2WPRA 1CI6A 1MFZA 1H88A 5AVQB 3M91A 1DH3A 1H8AA 5AVTB 3VN0A 2E43A 5APTA 2C9LY 1T2KC 3L37A 2Z5IA 5AW2B 3T97A 5AVUB 1HUCA 3A2AA 2W6AA 3MGNA 3TK1A 2R5DA 3L35A 1S9KE 2C9NY 2ZXEB 2P67A 2QM7A 2YO2A 3LIEA 3NTNA 4LC1A 5AVYB 3HTKA 5CMZA 2R32A 2ZFCA 3LIDA 1A02J 3M9BA 1FOSE 5AVSB 3TNUA 1T2KD 3MD0A 1CI6B 3V4WA 1JNMA 4AYCA 5AW1B 1IO4A 1H89A 3VMZA 5APQA 2VRSA 5AW7B 3M9HA 2XU6A 4KHXA 3UIAA 2YNYA 1A02F 2IPPA 3HE4A 2JJLA 3HE4B 3HE5A 3VMXA 3HE5B 1NWQA 1CSBA 2QM8A 1J2JB 2WT7A 2WT7B 1GK6A 3IR9A 4GT1A 3TYYA 1CZQA 4B86A 3VMYA 4AUWA 1GK4A 5AW0B 3NFQA 1GZLA 2Z5HA 5AW6B 3B8EB 5AVWB 4JYBA 3I5CA 3VTPC 3M0DA 4HYTB 1S9KD 1X8YA 3V4QA 3TNUB 5APSA 2XV5A 4XE5B 1GD2E 4C46A 1HJBA 3OAKA 3WGUB 1SP4A 4I2LC 1GU5A 2N9BA 4RESB 5AW4B 5AVRB 3M06A 3P32A 2XZRA 3P7KA 2Q7CA 1JUNA 2P7JA 2WPSA 5AVVB 2H7HA 2WWWA 2KP8A 1OXZA 4M3LA 5AVXB 2P2UA 4RETB 5APXA 3VYIA 1YYCA 4EOTA 5APUA 2WPQA 3KQGA 1FAVA 2W27A 2YO3A 5AW5B 1GTWA 4GKGA 3V5BA 3P8MC 2E42A 3A5TA 2R3CA 1FOSF 3SWFA 5APYA 2R5BA 3L36A
chains in the Genus database with same CATH superfamily
4GEIA 4OLWH 2OSXA 1E65A 4P46D 1DANT 1EAPA 4PRPD 3EXLA 4WB4A 2JTYA 3PUCA 3B7SA 4Y4FA 4IK6A 2DYRB 4NERA 5F21B 2EDQA 3F64A 3QUKA 2BNUB 4XRCB 5DHXB 2E8ZA 3JWDL 3BWAB 1QHQA 2P45B 3SDCA 3WAJA 4CSZA 3SPJA 2P1YA 2LHAA 3JT0A 4NGHH 3IVKA 3QJVB 2H9GA 3PAYA 2Q7AA 4HHAA 3GTVA 3DO7B 2Y07H 4Y19B 5AZ2L 2JWAA 4N1HB 4EI5C 2ZWYA 2DD8L 3M1OA 4R97C 3SE4C 5F89B 2BINA 1AI1L 3WAKA 1EHXA 1V3KA 2IQAB 1R3LB 1NCGA 4N8VG 4HWEH 1INDL 5ISZE 2J8UF 1HH9B 3MIWA 1LK3H 5ICYB 3WFDH 1FZCA 2ADGB 4PJDE 3JZYA 1QLFB 4LNRA 2CO6B 5JXEA 3L4UA 2GTQA 3MXWL 5D7JC 3CCSP 3AY2A 3LXBA 4OQTL 1EK3A 4ORZC 1WFMA 3ESVF 2HWZL 4BK4A 4ZPVA 4FXKA 1CLCA 2QADC 2RQEA 4WKZB 5KAQG 3C9IA 1EZVY 4HLZH 4LSSL 2VDNL 1SQBD 3C60B 5ECGA 3KYQA 1F58L 4QHLA 5FYKH 4ALAH 3HKZA 1NLDH 4EIZC 3LIDA 1QACA 3MGTA 4GW1B 5TDNB 1WRGA 4X4XA 4EKJA 4HC1L 3DIFB 1BJ8A 3F7KA 4RGNB 4MFHA 2EKSB 1A6UH 3FBQA 1RV6X 1U92B 3D0VA 3IFNL 4RCAA 3M9HA 5KG9B 5L8LB 4QXVA 1A02F 4DGIL 1XTLA 4JL2A 5A2BA 1U7MA 5I1LB 5IMLA 3M7OA 1HH6A 3G6AA 1UM6L 4GUPA 4GNKB 2XZAH 1S7VA 4RZCB 5DUML 1XF4B 1BV8A 2NR6C 5BRPA 4JDZA 2A9ML 3F7VB 1JZ5A 2BFGA 1MCOH 1EO7A 1K9TA 4UIMB 1PG7L 2ZUYA 4HS6A 3H9SA 1CDJA 1TZGL 4APQB 3GI8L 4S0HA 3NIGF 5LCVH 1ZT7B 4ATTA 4KO5A 2C1PA 3K7UA 1ZJAA 1A4JB 1FAKT 2O6PA 2MNUA 2UV3A 3OLDA 2L5GB 2F5AL 3BLKA 2COVD 4GKSB 4OCLC 5C1MB 4P5KB 1KIUA 4D7PA 3CFDA 2QT6A 4GLRH 5HTSA 5APUA 5E6ID 5HPMB 3IDYB 2UZXA 1V5JA 3QDMA 2A6KB 4M5ZL 1NTKE 4R90L 5CS7A 5CZVH 3TGUJ 4DGYH 1X79B 3QG6B 3C5ZB 2ZUTA 4U3XA 4YPGA 3UJJL 5F6IB 3PV7A 5DQ9B 2WWKO 1M9SA 4P5TA 4HWZB 1FZMA 2Q2EB 2GIXA 3BGMA 4N87A 1BAWA 3LN5B 2XBTA 2MQ0A 1P7QD 1NPNA 1IM9B 3UAAA 3X13A 4J3OH 2VXTL 2GIMA 3DO4A 1SQXG 1R5IA 5EPMB 4LVEA 4OF0A 1RZIA 3LHAA 3O3EA 3QUGA 1IQWH 4PB9H 3ZVVA 5HHOD 2EKJA 2XWJB 3KBHE 4U1GC 4GSDH 1IBYA 5IHBA 1M7LA 3MRKA 2CGRL 1ZVYA 3IDUA 4J27A 1HU8A 1CD8A 2E43A 3L4WA 2QQKL 1P84J 2ZKHL 3EGSB 1MEXH 4FZEH 3OHMB 2JQMA 3ARDA 4MAYC 2JB6B 4XP4H 1N8ZA 4FTVE 5HYSB 1Z9OA 1ACYL 4AQ8C 4N90D 3QUMB 2VUYA 4PW3A 3STLA 5D1QB 4EN3A 1AGCA 1QSEE 3J27A 4JPKH 4NQTA 4E9WA 2EIMB 1IU1A 1C12B 2HYMA 3SO5A 3K2KA 4LXFA 3RNKB 4K71C 4U3HA 3D06A 1UIIA 2F19H 4LC1A 2BIIA 1EDQA 4OF5A 1S78C 2TSAA 1YMMD 4JPVH 4JKPL 1X5FA 3CPLB 3NACH 1T2KD 5JHBA 3FCSA 2XX0A 1IGIL 2BWDA 1PFOA 5LNDA 1GXEA 3ABGA 3FCGA 4NC2B 4AG4L 1RL1A 5AAMC 2GUVA 3OB8A 1JCDA 1KJVB 4MCZA 3CFKA 5DTFA 3JT2A 5CN3A 5JW3H 2OQJB 5KVEH 1DBAH 5EU5A 2YS4A 3IGFA 1RIHH 2NQDA 2XHNA 3B6SB 1J5HA 5L2KA 2W6BA 3TYYA 2FYUJ 1TO5A 2IBZD 2LU3A 5E5UB 4C83A 5ESVB 4EUPG 5FXCH 5E79E 3MV7A 4DT0A 1CG9B 2X9YA 2E5EA 4J39A 3HE6C 5F7UA 3RG1C 5D1ZC 5HY9A 2AS5M 1RD6A 1L6ZA 2X89A 2OSWA 3S4SG 4PYGA 4GPVA 3WLBB 4P4KC 3RWHB 4H5SB 1FAIH 4PBWD 4CJ1A 2VXVH 1ODUA 3TCXA 1U8HA 1OTTD 3O6LH 2UXGA 4W9DC 1UACH 1HQRB 4LAQH 2WXHA 1H3WM 1JWUA 4UDUB 2NPLX 4TQEL 4PRHB 3HNSL 3U9PH 3IFPB 3QB7C 3QFJE 3EYOA 2WSEJ 3VDBA 5JA8B 5KVGE 4C56B 4WJ5B 3VYIA 4IL6H 2XV3A 3DHJA 5JOFB 3P4OA 4M6AA 4XMKL 2MTPA 1XR9A 2ENPA 3CDGA 1KJ2L 4GP5B 5EO0A 5JYMA 3JVGA 3D3VB 2P42B 3RGVA 2R56H 5KSBF 2ODIA 1M05A 1RUKH 3AMKA 4MSWB 4S2SA 4X2UA 3RTQA 3NT0A 4H44C 2AVFA 1P0SE 3CIAA 1RQVA 1KTLA 4IHOB 1ZXKA 2YD9A 2X70A 4QXGH 5BCAA 5GSVA 5C0CD 2NPSC 1HBWA 3QUKB 4H13B 1V27A 1W6WA 1XZWA 3DETC 3SIKA 2IQ9L 3AXLA 2ZXCA 1NCOA 1A65A 3MN8A 1EZVG 2DJUA 2ZXGA 5E6RB 3VG0H 1QFWL 3FQNA 3M17A 4QRAA 1NGXA 2X3BA 4HHAB 2AJSH 5TFSH 3KZIH 4FFYL 3F6LA 1HOEA 1KFAH 4KH9A 3VI3E 2KI6A 3JWOL 1FNGB 3HD7D 1XSJA 1KZQA 1Q9LB 3CVIL 4EAEA 3L3JA 3GNML 3FU6A 1AE6H 3WN5A 5KZCD 1CPUA 1SEQL 3K6IA 5JHDA 1HUCA 4RKUJ 4UV4L 1NTMJ 2A5UA 2WNXA 1B3JA 1GSKA 3OAZH 3VXSA 4MQXD 3HC4L 3V7MA 3AZUA 4ZPVB 4BH8A 1WZKA 1S9KE 4JJOA 1OY3B 4G9DA 3U79A 3FBKA 5D96C 3US0A 3NTNA 4XGZA 2ARWA 4PLJD 7PAZA 3CXHJ 1N64H 4WQOA 1G1CA 3ZDYF 4X4XB 1CI6B 5GGTA 4WGVB 1SMAA 1F6LL 3WV0A 1UZ8B 3MCKA 2WQUA 2IX7C 3E8UL 5L9DH 1OAJA 3NCCB 4FI7A 3S2CA 4Y19D 3D0VB 2F54B 5C6TH 1IZJA 4ISVB 1T22B 1JZHA 4JFEE 2E5YA 5E9NA 5EU6A 1KCKA 1XT5A 2MHAA 1RHHA 1NCWH 3MROA 2X4NA 5PCYA 2VZVA 4MDIA 1BDYA 1HH6B 3G6AB 4GUPB 1ZTMA 4UYPA 4XPBH 5TQ0H 1OW7A 1NIDA 2YA2A 2YUZA 2QQLL 3LH8A 4F57L 2X0VA 1XSKA 4HK0A 2P80A 3D70A 4JDZB 1KENH 2B2XH 3OQRA 4NQEA 3HTKB 3C60D 4HS3B 1E4WL 4JBZA 3EBAA 2EIKB 1OK8A 4N2KA 4NRXA 1EJOL 4HS6B 3H9SB 2AXWA 3IMRA 1F2XK 3MV8E 4KJYA 5BZWA 2QSCL 4RRPM 3WE6B 1M6OA 3VRJA 3MRFA 1SF5A 2DM2A 4FQJL 3NRPA 5J12B 1WTLA 1EXIA 1U57A 3QW9A 1GZPA 3CFDB 4ZS7L 1BFVH 2FO8A 2H1XA 4GKZB 3QDMB 5EEWA 2JCCA 4FRWA 3EJTA 3D7PA 4U1NA 3MTXA 3MNVB 3U7YL 3OKMA 4JREB 4P5TB 1JS4A 1N26A 1R3IH 2DQJH 4PY7A 1L9SA 3NCYP 4V2BA 2VLLB 3ME0A 1CQKA 4APQD 1I9JH 3FQWA 1PTZA 3K1KC 2VDLH 5C6PB 3FT1A 1EDHA 3KPQB 4QOKA 1YJDC 3VGDA 3V4LA 3N04A 2NTFA 4OI7A 1F02I 3IGAA 2DWEA 3O3EB 4LCIL 5B7MA 3SE9L 5TISE 4BDVA 4ZFOA 3O4LA 1Q90D 5IBTH 5FHBH 2K0RA 1T03L 1MFZA 35C8L 2BVQA 3EO9L 2N0MA 3MRKB 2OS7A 4X5QA 1W0YT 2OFQA 3IAPA 2W65A 1IAII 4WI2A 2FT7A 4ZNEE 3QZBA 5JHLL 5K1VA 3ULUD 1BMZA 3D48R 3CHRA 2R0LL 5LCVA 1AGCB 4Q2ZA 3RIAK 5F7KC 5F7NC 3VRLE 1IM9D 3PQYE 4GXVL 5CNHA 3GIVB 1SJEB 1I7ZA 4U1JB 3K8MA 5ES4B 5DGRA 4LQFL 1CF8H 1I1FA 2N1TE 3Q2WA 5IF0B 1B4LA 3DURA 3FCSB 3I6KA 4S1RL 1HL8A 4FQCH 1MAKA 3OZ9L 1YAIA 1ZDQA 2V8MA 1CCZA 3OJMB 1KILA 4MCZB 3SDXF 1N70A 4HWNA 3TGUE 5DTFB 1KCUL 2YNYA 4L3EA 4P9HH 3ECBA 5EU5B 3L1FA 1NWQA 1F8TL 1X6NA 3ESNA 3D0LA 5C39A 3T77B 5GZOC 4BXLA 7FABH 2KQNA 5L2KB 1H8NA 4Y4HD 3GHGB 5D1QD 4L0PB 4F9PC 5KBPA 2E76B 1QUPA 4RDQG 3I75A 5I24A 3T8MA 1G9NC 2NYYC 2CDGA 3RZCC 1NU1K 4PJBE 5D7SH 4HEPG 5INDA 4TRPH 3IEAA 5AKRA 3QCVL 3DV6A 3CWBG 1E8YA 1SLVA 5IVXF 2N9BA 2ZSWB 1AH1A 4RMBA 2X0WA 2XQYK 3USSA 3LMJL 2IANE 1JGVH 2WXIA 4NI3A 1CB4A 4S11A 1X3DA 1P84E 3DHMA 1JWUB 1OSPH 4WSGA 1MIEH 1JI2A 1R19A 3EYOB 3VW3L 3H56A 3G5ZA 4PUBL 1QLEB 4M7JH 1HE7A 1O75A 2PXYC 1XR9B 1PY4A 1OAXL 2QMJA 1E9OA 2PCFA 4U0RC 1Y1UA 1M05B 2H6OA 4KXDA 3S36L 3MRLA 4S2SB 1CD9B 5IJBC 2YAFA 1L5GB 5IJVA 5AVZB 2ZWKA 5JTWA 3LYRA 1CK0H 5E2VH 2X70B 4Z7OF 4X4ZA 5GGQL 1ECZA 2XCMC 5T1JA 2ZIDA 4JDTH 3PNWB 2QPFA 2LR2A 3FCTA 1FL5B 4NRYA 4XPHL 5J06A 3Q8FA 4MCYA 2Y22A 1AC0A 4PRHD 1GOFA 3RHWF 1CUOA 3FQNB 3M17B 5HDWA 4L5FH 1NGXB 4C56D 1TU3F 2DD8H 2WTRA 1G1IA 3CCUP 1AIFA 1AI1H 2FYUE 3AS1A 3U4BH 1INDH 4IRZH 4ODSL 4XB3A 5FPIA 3K5SA 4OIIL 5T1MA 1J9TA 1G6RB 1A25A 3D3VD 1ZV5A 4Y1AE 1ZCRA 2HLFD 2WVRA 5EFWB 3L3JB 2ZNWA 3MXWH 2E75C 3WN5B 4G8AC 2VO8A 3HLKA 1BBDL 5JHDB 2HWZH 1ZV9A 4BH8B 4NN6C 3ELAT 4LVNB 2DWYA 1JSYA 2WUCL 4LSSH 5ELIA 3MLPA 3CZLA 2JKVA 1F58H 1DFBH 2KPWA 3D33A 3KYKL 3UTQA 3ZL4L 2WLYA 4GI8A 1DJXA 1HXMB 3OMZA 4H13D 1WBYA 2UZYA 1SQVK 3BH4A 2OCFD 3DVIA 1P2CA 4XGZB 3WMSA 3T1WA 3V9CA 2R2BB 3CU1A 4HC1H 1A6VH 5BVPL 4LSPH 5TQ2L 4KDVA 3MCKB 4HKBA 4N28A 4N2OA 2APSA 3A0HE 2D3NA 4RGOH 4LPXA 3L4ZA 1BOGA 1GS6X 4DGIH 4JEGB 3PWLA 4FP8L 3B8SA 3V4UL 3V5HB 2JFCA 1GS8A 4PJHF 4QY8A 1I8MB 5EU6B 5T3ZE 1CSBA 4AWJC 5GRJL 1UM6H 2X4NB 5BZDA 1TTBA 1R5LA 2CQVA 1EXUA 5DEGB 3QQNA 2L7JA 5JXED 3U7WL 4QEGA 1Z3GL 3M8OL 1J7VR 1OX3A 1G6VK 1DYZA 4NQEB 3QPQD 3V4QA 4XOEA 5CZRA 2G0KA 2XETA 4KO6A 3RWCA 4BHUI 3SSUA 3GI8H 4KQ4L 2YXQB 4UB6H 1GU5A 2JJSA 5BZWB 4KJYB 3T8XA 3QXWA 3EZJB 1M6OB 3VRJB 3D6YA 2F5AH 3FYIB 3WJMB 4KDTC 5L88L 2CRZA 5F0LB 2J20A 1GS7A 1QBAA 3QUZC 4M4RA 1RERA 1ZW0A 2PW2A 5BXFA 3S48A 4BRJA 1VCAA 1GZPB 1OB1A 1S72P 5IQLA 2HODA 1NTME 3OZKA 5E1GA 2WXNA 4EBQL 1TQBB 4M5ZH 4R90H 3IFLH 1LNUB 5BZXA 4DT2A 1FN4A 2JCCB 4U1NB 1WT5C 3WTWA 4MNHB 4DFHA 3CXHE 3UEZA 4AQRD 1A8ZA 2BHFA 4X5PA 1J0IA 4NQSA 3IBEA 4PY7B 1RFDL 4JYCA 2VXTH 4YK4B 2XKNB 4K4KA 1PEWA 3H9SD 4PJ8A 4OR1A 4TL4A 1U3HA 4DCKA 3FQWB 3RVVC 3QS2A 4N78D 3FUJA 4QOKB 4CMMA 1IEBA 3QJHA 3A23A 2I1KA 2DWEB 3IGAB 4PY8J 2Q1KA 1Y18A 4D8PB 4U6YB 4PVBA 4XNZC 3LDBB 1FLTX 3O4LB 4BDVB 5T8IA 4PGEA 2CGRH 2ESVE 5MP6L 2FH6A 2UY7B 2QQKH 2Q86A 1HNFA 3ILPA 1CLYL 5DD5H 2XBZA 2W65B 5IROC 3TYFA 1FZJA 3BZ5A 2W0LA 2P47B 3QDMD 5D6CB 2FYNC 1T0NB 3H7LA 3BPOC 5MENA 1PLCA 5AUMA 4RAHA 4XMPL 5D2LF 5D4HA 4S1SH 3FUEA 3R7RA 4P5TD 3V52H 1OTSC 2I8DA 1FFOA 4N1CA 4R4ND 4XCEA 2YKQA 4OGZA 4Q2ZB 1JP5A 1QZNA 4EXPX 3DMMC 4NQDA 1IB5A 1LJ2A 3D08A 3SYPA 4GRMA 5JO5B 5FHAH 2Z0UA 3SQOL 5CEZL 3P2TA 5G4NA 1JUFB 4JKPH 3IRPX 4UB8H 1FIGL 1IGIH 1I1FB 3D07A 1SQQD 5IMMA 1OCRB 1KDJA 1VACA 43C9A 1LMIA 3I6KB 5FYKE 1N6QL 5E5RB 2AHIA 3D69B 3U59A 2FATL 3KVPA 1E50A 5EF2A 3LZRA 1KILB 4TQPA 5E4AA 3OD3A 4AEFA 1G7QA 3L74G 3CUPA 2J56A 3M46A 1OFCX 2X9WA 3HG1E 4R83A 4PJ5A 2ITCB 2JJLA 1YPZF 2BCCD 3NCJL 3ARDD 3ZDZE 4H0LB 5CINL 3BYYA 3EYVA 1FCGA 3U0TA 1S5LH 4OQ1A 3UTSE 1HDMA 1GSMA 1REIA 1LVEA 4EN3D 3OXSB 2ZYGA 2CKBL 1BX2A 2CPUA 4IKJA 5DD1H 5L7XL 4K7PL 4S0TD 5M94B 2UZIL 3P9MA 4NDMA 1AJ7L 4G7RB 4A66A 3ROOA 4WF7A 3QZNA 5INDB 2B0SL 5IT2L 3GSOB 1FFRA 5F44A 1L3NA 1J1OL 1XO8A 1OT4A 2BNRB 1WIPA 3NA9L 4FQQB 2FQDA 4B60A 2IH1A 3QQ4A 3VXQA 3VCLB 4JVPA 1NIBA 1R24B 5APXA 5DGQA 5HVHC 4JPZB 5JOPE 2ZQKA 2Y7LA 3VD9A 4L9DA 2EE0A 1KJ2H 4PG9A 5L2KD 2YIHA 2OTKE 1ONQA 2WBXA 4OCXH 1MY7A 1YNTA 3VB9A 2QL1A 1G7MB 2E76D 3T4AC 1E9OB 4ZMLA 3FW6A 2VLRA 4HETA 3QHFL 4PRAA 5JW4M 3QEHA 5IJVB 1KB9H 5FYJD 3SDAB 2VR8A 2X89D 3TIDA 3HN5A 4P46C 1TTUA 4WTQA 3JWNC 4W9EC 2GI7A 3OF6D 2IQ9H 1QPKA 3BZFB 1PCXA 3ALPA 1XGRB 3FCTB 4LGSB 3UZQA 4PW9A 3ITKA 3N43B 4KJPD 1RE3A 4PCSA 2PCPA 4ZMZA 3ERXA 4M6ML 4P06A 3CPUA 3J2PA 4TSBL 5DHVA 1LT9C 3PP3H 5IREA 1EMTL 1BVNP 1QLED 3JWOH 3W39A 1J8HA 3T0DA 2EYSA 4XCNB 3ZDXE 3IMSA 2P24A 3CVIH 4R26L 1HL4A 2HFEA 2H2SC 1QEXA 3GNMH 5T1MB 2WBKA 1A6AA 4XAKE 5AVUB 4UV4H 2A38A 4HB1A 2VDML 3H0TA 5FYJU 3KH4A 1HCYA 1FVEA 3PDGA 2BVTA 2ZXWB 4U4BA 3SBPA 1UTDA 4POUB 2IBZI 1OF2B 1CURA 5E95B 1WBYB 2UZYB 2OJZL 4GSUA 1LEKA 1Q9OA 2N1KA 3HBZA 2W8CA 2F61A 5FDWA 3NSYA 4XNQA 3BDYH 3E8UH 2Y0DA 2WJ5A 1NSNH 4JZJC 1CFBA 5TPWH 1JF1A 1XGUA 3K80A 2IPUG 1BOGB 4I18A 3PWLB 4WI6A 5EZPA 1WDAA 4QY8B 4WHTB 1IEAA 3ZT5A 1G7PA 3IETA 3W1ZA 2P28B 1HHIA 4PRIA 5B3JE 3ARBB 5BZDB 1EXUB 1KN4H 4PJ9C 5JHDD 4PWFA 2JWDA 5AWNL 4F57H 4P2QA 4X8CA 3N44B 4MMZB 4FFVC 4MQSB 3CDFA 4F7TA 4NPKA 4JKLA 1E4WH 4HH9A 2X9XA 4JHVA 2RCSL 1PW3A 4TUUA 4UOW0 3VVVA 4LLYA 5CCGE 4UM8A 2V0AA 3RWCB 3K6OA 1M71B 3AXIA 5HHMB 3WXVL 2QSCH 2Y5QA 1IFJA 3M06A 1JMBA 5ID1A 1MFVA 3T8XB 5B22A 2BIOA 5I18H 4RBPH 4Y9EA 5F9JA 4FQJH 3S5ZA 5INCB 2CE6A 1ZHBA 1N2DC 4OQTA 4YSPA 3CSYB 4EOTA 4GW5A 3UZVA 4JFWA 5BXFB 3QH3A 5EU6D 3VRIB 1OB1B 1VHPA 4HFWA 2R0ZL 4KZCA 3W3BA 2WBJC 1EERB 3GXIA 2Q3EA 1F13A 4Y2OB 1FN4B 1HSBA 3B4SA 3G6EP 2DQTH 5F3FA 3U7YH 1AQHA 1VJSA 5APYA 4EVNA 3K71B 2XXMB 2P80D 2MEJB 4NQED 1GYVA 5I8CA 1A4BA 2J58A 1X9UA 3TA3C 1E3ZA 3RI5F 3EDEA 4JUTA 4PJ8B 5KAFH 3U30B 2BP0B 2A9DA 5DMIH 4XODA 2ZP9A 4AZUA 4LCIH 4CMMB 4XCCL 3QJHB 1M7UA 3M9QA 5AW3B 2NQCA 1VQ4P 2OARA 1P6FA 2HVJB 4NWTH 1Y18B 4UNTA 3RFZC 4WSKA 1T03H 4YHKL 1BLNA 4OCNC 1KBPA 4W9ZA 1VERA 2YAHA 5HDBB 5J6HA 4HAKA 3SCMC 3ILPB 5C09A 1IZNB 2XVKA 2XN0A 3MXVH 2JJTA 3VD7A 3ZE0F 5JHLH 2Y3AA 3V4VA 3QIBA 3FTGB 4XNAA 3FJTA 3PP5A 2M2DA 5F1SA 2MCMA 1T66D 5MENB 1RVFL 8CGTA 2R0LH 3H9ZA 1YEFL 4AGMA 1MAMH 1FFOB 5KJ7A 2LE9A 3FQRA 3N9GL 4XCEB 5HPOA 4GXVH 5D5ME 2OW7A 4Q9RL 1FG2B 4NQDB 3IN0A 3LIZH 12E8H 1C08A 2CCWA 4LQFH 3KLAA 4QOKD 4MB5A 5AVSB 4F58L 2IWKA 2X1PA 3B9EA 5E7BA 4AGQA 4Z7WA 5AKSA 5FKPA 3OZ9H 1VACB 3FSAA 3QJXA 1ZR2A 3O4LD 1I7RA 2CO4A 3OAWA 2HTLD 1KCUH 3ML8A 4G8IB 4NC1C 3W9EB 4FYTA 1UYWL 3P4NB 1EDJA 1G7QB 3K46A 4HK3N 2VLKE 1F8TH 3MO1B 1X4XA 1CU4H 4PJGE 5FO9A 4Y16C 4N2LA 1CLOL 4GRLA 4W9GC 1WLHA 1KORA 4QDGA 2NQ3A 2DW3A 4G6KL 3EYVB 4LOVA 3U0TB 3BW9A 5GZND 3NJLA 5EUOA 2K9JA 2FECL 4YSOA 5EIIB 4ASWA 1RJZA 5HHQA 1BX2B 4H0GA 4KROB 3L3OA 3FB6A 1OTUD 4NO3A 5EOCL 3P9MB 1RHFA 3QEQA 2N7AA 5HDOA 2J5WA 4D2NA 1T83A 4RESB 1AQKL 1XGPA 3C6LA 5EO9A 3PL6A 3EGXA 1F3JA 3SY0B 1TPXB 3F7PC 4L3CB 4OZIE 5D1XE 3DJRA 3GMQA 3PCYA 1KXVA 1KILD 1ZHKA 3GBEA 2GHWB 3QQ4B 3UFIA 4DEUA 4FQXC 5BQDA 3P0GB 4PUBH 2CK3H 2OMNA 1AD9A 4U7SA 5HDQL 3UAJA 3SB3A 5HDRA 4TNGA 1JZDC 4K94L 5AW5B 1LLAA 4H0LD 5ETUB 1OAXH 4JHZA 1ONQB 2ZP0T 3C8KA 4P4RA 1IM3B 2YFNA 4BWUA 4FFZH 4NZTH 3BQUA 3GM0A 2CLZB 3R06A 1A9EA 3S37X 5A3ID 1EHLL 2VLRB 1IC0A 1BVLA 1LE5A 4PRAB 3RUGF 1LTJA 1F18A 3QEHB 1RZJL 4G5ZL 5GGQH 1JVOA 3VXNA 3SKNA 1OWAA 4MHHI 3MCLL 4N2FA 2PRRA 4QRTB 3H1HJ 4DKTA 1MG2C 3SO3C 3TH4T 4U2ZA 5FC9A 2VZOA 5JIMA 2VXQL 4OZHF 2FGZA 1NU1D 1QBBA 1X5AA 4GS7C 5DHVB 4AIZA 1NJIQ 4OIIH 1URQB 2P24B 4X6FB 5DO2C 3INUH 4JG5A 2M26A 4HUVB 1T4KA 4FQHB 1M7DA 4DAGL 2DF3A 3ASNB 4H1LB 2AAVA 3RY5A 3GMRA 1J5IA 3NAAH 4XXWC 4F8NA 5I6XC 3EFFA 4GQQA 3H0TB 5IWLA 2AMUA 3E2HC 1G94A 5DVLA 2BZDA 4ZUSA 2LW3A 1FVEB 1UWXH 2WUCH 3KLDA 3ZL4H 2Q2LA 4JPSA 4U1MA 2J5LC 1WWCA 4F15C 3JV0A 1JYVA 1OAQL 3HAEH 4I2XA 2X6VA 5CSBA 3MTRA 5BVPH 4UIKH 3ZQWA 1Q9OB 3H6PA 1ASPA 3NJNA 1WIUA 3X1NA 1BXAA 2WINA 1KJ2A 5FDWB 1T04B 3FF8A 4XNQB 1MFCH 1H6UA 3UBXA 3P0YH 1KB9J 4FP8H 4MNGB 2XPGB 1CLVA 2WOBA 3REWA 3T04D 1KPRA 3EDKA 1FH2A 4UF7C 5GRJH 4CADA 1YEDA 4PREA 3W0WB 3VFRA 3IETB 4Q52A 4PRIB 2WGNB 4X6CA 2CH8A 1UJ3A 1CVSC 4ZYKA 2P1JA 3B9KC 1Z3GH 2QZQA 4D6TJ 3M8OH 2A9CA 5I66B 4P2QB 4WV1A 1I7TA 4AE1A 4NO0A 3CC5A 3G08A 1CIUA 3UTZA 4RMRA 4F7TB 2F15A 3AG3B 4IBUA 4HH9B 4IYKA 1BG9A 4XO5A 4HCGA 4KQ4H 4LLYB 2WLNA 2DQEL 4UM8B 4FFYA 5ICXB 4CSPA 1A6ZA 2K3TA 2RD0A 2D7MA 1CWVA 1NTKK 3F62A 5CIPA 2DM3A 2PCYA 1U91A 3L5XL 3VE0B 3FFDA 4JO1L 1PGPA 1RZ8A 2CAKA 1AXSB 1SYVA 3DGGA 4JKWA 2IBZG 3ZIMA 1ZHBB 3NJGA 1UEYA 4YFEA 3R18A 2D7TH 3DTXB 4K3HA 3RL1A 3T65A 4EBQH 4U3FD 1G1OA 4OLZL 3APDA 2DKUA 3QH3B 3TXAA 1TENA 4NNPL 1DQJA 1SQVD 1IC7H 4FFTA 4HFWB 4RDQF 2AK4E 1S5IL 3I50L 2VDNB 4JFDE 1AP2A 2R3CA 1HSBB 3I3DA 2WYZA 4N4YB 4RZKA 3UTPD 1OXYA 2HPOA 1DJWA 2CJTA 3NIDE 3CAFA 1QVOA 1N7SB 2QSIA 1RFDH 3FSZA 4LLHA 4P59L 2O5XH 5FUOL 1E9PA 4LRNL 3GZOA 4PN6A 5I71B 1BXUA 1DIPA 2Q0ZX 4FDWA 4GRWF 2HT3D 3GMNA 4FQ1H 4PFEA 2FO4A 5GJSH 1KV3A 4B97A 4E0RA 3GKWH 1R33A 4LARL 5L6YL 4DZOA 1JNNL 3CN4A 4R96A 5TE7L 5CGYC 4DP9X 1JPTH 4E41A 3VFTA 1F3RB 5MP6H 1B90A 4JFFE 4AH2B 1BCCJ 3QIUA 2K70A 4LHJB 1CLYH 4DHLA 1N73A 5J6HB 2ZICA 4OZGB 5C09B 2Z6FA 4L5FE 1P5UA 3GSNL 4ZFFA 3UP1A 5D9SB 1OD9A 1KMIZ 3L3GA 3T97A 4HLJA 1V7NH 2X12A 3V4VB 3QIBB 1XIWA 4FNSA 2APTA 3ZE1B 4CKVX 1KCLA 4EZMA 4G7VL 4EE2A 5BU5A 1EHKB 1G7HB 2GKIA 4M1CD 3PGDB 5IHZA 1CBJA 1EJ8A 5CEZH 1RKRA 2YMTA 2QLVB 4PJ8D 5C0EB 1GJIA 5HYIA 1CJYA 5CR1A 1FIGH 2FRGP 2P3YA 4P2OC 3KLAB 2RB8A 4X9IA 3T6VA 3EADA 3IFMA 1PAMA 2BCKA 3C2AL 5DUPL 3L70J 3LKQA 4Z7WB 5F96L 1WA2X 1MFAL 2ADIB 4XP5H 3CZGA 1I7RB 3M88A 2VERA 1NAYA 4ELMA 5ACLA 2DICA 4IMLA 1KTCA 4JHWL 1XSOA 1U3JA 4I3SL 1YQ3C 4M1DL 5FO9B 3RBXA 4EF3A 2VW4A 4GRLB 4NUGL 3QDJE 3NRFA 5MEND 1PGOA 1YJNP 5E8NA 4BWWA 1NC2A 1DL7L 2HH0L 1GK4A 2OMYA 2CKBH 1EC5A 3E7KA 5EUOB 4GUOA 2K9JB 1OZTG 5L7XH 4K7PH 2HLAB 1RJZB 2XIBA 4NZUH 2ORBL 4NAMA 4Y4HC 3PWPA 3FB6B 1XV8A 4LIQL 1LO2L 1I53A 3GZKA 3QEQB 2EECA 4NQDD 5TE4L 5GRZA 1U8JA 3Q2YA 2AJXH 1Z66A 5IT2H 4NQCA 3KDMA 1CFVH 2EABA 4NN5B 1YN6A 1ZTXE 2NY6B 4CGUB 5EO9B 2WQSA 2E0PA 3NA9H 3EGXB 3QS3A 1PZ5B 5DQDL 1BEYL 3D2UB 3QA3B 3VFOB 4KQ0A 1EFXB 1JZIA 2KZJA 4UZUA 4UB6E 5MERA 1PDKB 2XWRA 3HG2A 3SPIA 5JHLA 4Z7NF 2I27N 3QFJA 1WHOA 3AT9A 1N5YL 1AD9B 3ARFB 4KBPA 4OJCA 1VZIA 1FNLA 2WSDA 1SXNA 2JXMA 2NY5H 4JPIB 3X1EA 3S35L 3L73J 3WNIA 4AIXA 2IFGA 1USZA 1U95B 1FOSF 4H20H 1O9ZA 3TEWA 3BQUB 3R06B 3O41A 1RLWA 5C0GA 4KROD 2RTTA 4JE0A 1JPGB 3O4OB 1LE5B 1XR8A 4N1EA 4XE0A 3UGEA 2C9VA 5KBLA 2ERJB 2VZTA 3K72A 5ADOL 3SGDH 1EFQA 1WBZA 2HMID 2HRLA 2PTVA 3UMNA 4XAWL 1BGXH 3GBLA 5EDSA 4FMVA 4NOBA 1X0TA 5IUSA 5KJRL 1OAYL 5FUCC 1OEZW 4CDGC 4TSBH 3BD3A 3WNNA 1EMTH 3O3UN 3KLQA 1Q2NA 1E8ZA 1F90L 3VN0A 2VQ1A 1X7SA 3ZX1A 4R26H 2AXCA 4AIZB 3BXNA 3OWRA 1CW5A 1UVQB 4F9LA 4UTBH 4AJVA 3LOWA 4WUUE 5I30L 2BSRB 1M7DB 3BUIA 2FE0A 2VDMH 3EHBD 3KL0A 2VLRD 3VFNA 2OYIA 2HLFC 3SE3A 3OL2A 2YRZA 4ZUSB 4NBZB 5EN2A 4DKEL 5IB3A 2IFMA 1S7UA 3HRPA 5HGAA 1PL3A 4R7DA 4U1MB 2EQDA 5H4ZA 1TTFA 4JQVC 5CP7A 1EXGA 3MQIA 2GEEA 1CXIA 1VA9A 4HV8B 1A02J 4Y4FC 5GISH 3ARGA 3MREA 3ULSA 3FB5B 1OAKL 3KPRA 4F7CA 2AJVH 2ENQA 4HUUB 2EEDA 4WI7A 3SDCC 1OW6A 3VU2A 2NSMA 4ZW7A 3UBXB 4BKSC 5K5GB 2VDOB 1JN6B 3MNDA 4AW7A 1URQD 1J8HD 2H3NB 2BSSB 2MCAA 1KPRB 1U2CA 4P57B 3KPMA 4MXVF 1OAZH 4JG0H 4PREB 3I74A 2C9PA 3IDXL 4X6CB 5I8OL 4ZYKB 1SQ2N 2A4ZA 1PPJE 1QKZH 3AWEA 4UT6L 1FZCC 3H3KA 1I7TB 4LLVA 4Q0XH 4ETQB 5JXEC 1BW8A 2RCSH 3G08B 1Z6JT 3UTZB 3WKNA 2OMUB 2TRYA 3WELA 3H1HE 4FNPA 4TVPL 1DLFH 3S5LA 1V7MH 3KPNB 4FXKC 1GD2E 1I9EA 4M9OA 4FKEA 5IW6A 4LLUA 2PTTA 1U0QA 3BN9D 1A6ZB 3QPQC 4XP6H 3BZ4B 3LVEA 3QUXA 1UCBH 4PHXA 3WUWG 5CIPB 5HYSG 5F3BA 5E2JA 2Y7MA 1MWAB 2WWNA 3S36H 3D4CA 5C92A 4OFPA 2XA3A 3CWGA 3T65B 2DYPB 2R9HD 1YEJL 4DUVA 2H6PA 1DQJB 2PR4H 5FGBA 1EX0A 4PRID 1MLBB 1J86A 1MFNA 4FQPA 3VFUB 1HINL 1AP2B 3V0JA 3CLEH 1KYOD 4K55A 4P2QD 2PO6A 2VLJA 3SWFA 1VPOL 4RMSA 2AP2A 4MB4A 2AEFA 2W90A 5F93C 4Z0XA 1QVOB 5KYYA 1DTUA 1BE3E 1CICA 1FG9C 1W0WA 4KI1A 5J8OA 2WB7A 4X7CC 1T3JA 3P11L 3DECA 5TDOA 3CHPA 1K9MQ 3ALWA 3NXSA 3QCUL 3GMNB 1KOAA 3IJYB 4LVHB 2X42A 3KR3H 2BRRL 5GRUL 4XCCH 4R96B 4EXKA 3MKGA 1XBRA 4P2YA 4JFPA 2AV1A 4ODHL 4PJ6A 2G8YA 2O01J 1IGYA 5FWRA 2WPRA 1H88A 3QIUB 1ROCA 4IRSA 1N73B 4D6TE 1HL5A 1UGKA 3VGBA 4F8TA 2C9LY 3TNNA 3II3A 4DOHE 4OIFA 1P5UB 3GMMB 4ZFFB 5BRQA 3D25A 4Q7DA 5I23A 3RY6A 4ZNEA 1LWRA 1ZV8A 1RVFH 3T97B 2I9TA 3W67A 1GL2C 1YEFH 4FTVB 3U7AA 3R0NA 1N7SD 1U36A 4XO9A 1SFCC 3BDXA 4YQXH 4Q9RH 3W81A 4HS8L 4JN2A 3IAQA 1M3JA 4P5TC 1EAJA 1GIGL 1S8DA 1RJLB 1OE1A 4R4NC 3CQPA 2Q1EA 2OULB 1S4XA 4RSVA 3BSZL 3AE1C 1GYUA 1T3FA 1SQPE 4XOAA 2BCKB 2IH8A 2E6QA 2XG5A 1I9RL 4CL7A 1GCYA 3QPKA 3T6QC 4BFOA 1UYWH 3UCRA 1FHGA 4OM1L 4B9IA 1ADWA 4PQXA 2WQXA 1FPTL 5C09D 1ZMEC 1Z9LA 4IMLB 1L0QA 3P73B 3EH1A 4K0OA 3B2DC 3DX8A 4QRFA 5DRWB 4G6KH 3L16A 4Z0BL 2X6AA 1T1ZA 5GTHH 3QIBD 2XUWA 3SGEI 5E8NB 3UPCA 5JW5B 1NC2B 1S7QB 1I9IH 2OMYB 3ARDC 1N59A 4HCFA 5IVZA 4GP8B 5I1GL 1P84K 3WY2A 4AYSA 4EN3C 1E3FA 4DO6A 1S7XA 1WBXB 5E1AA 5GGVY 2XV5A 1U8JB 3HS9A 4HCIA 2FXMA 3BWUC 3GUTB 1WCQA 3U2SA 4RNRA 4Z1PA 3KJ4B 1AQKH 4NQCB 1UM5L 4NAQA 3MA9L 4NB7A 5AAPA 5F3HA 1UB6A 1YN6B 5D72H 1OGAA 3MBWA 4YGVA 1RZ7L 4JGUA 2Y24A 3CG8A 3SPVB 4M8VA 1EJ6A 5I1CL 1UHVA 1QNZH 4KXBA 2KXPB 4PD4H 2VDKL 1N12A 4Q6KA 2BVUA 3H54A 4WO0A 6CGTA 3QDGE 1TQCB 5F88A 1R6VA 3QFJB 3SKMA 1AGEB 2WQWA 4K94H 4ECNA 2GT9B 4IU2B 4W9FC 3EF4A 4GRLD 4CNIA 4AYEC 5KSBA 2OBGA 2JXMB 2Z7ZA 2V5SA 4M5TA 4WI8A 4KKQA 1NH4A 3NPSB 3MUDC 4U7KA 1WWBX 3BVDB 3SGKA 1YYLL 2DEWX 2Q5BA 1I1AB 1RZJH 2E74D 3MLRL 3QEQD 4G5ZH 1XR8B 5LGKA 4ZNCA 4LFHG 3L70E 4AYID 1JY2P 1HCZA 2FYUK 1YLBB 2GABA 3K72B 5ERWA 1TG8A 3AJ7A 3VG9B 3MCLH 3PL6D 4I9WE 2ICWJ 1YIJP 4IL6X 3UAFA 2JJUA 4K15A 1G5AA 1EFXD 2Z1PA 1MRDL 4NZJA 3ZO0A 2J6WA 3QNYA 2A3TA 2AQQA 1DO5A 2VXQH 3MRQA 3DVFA 4FABL 2OZ4L 1W72L 4Y2LA 1E5AA 3MRBA 1WG3A 3VX0A 4KJPC 4JMNA 5IB2B 3UAJD 1HHKA 2VQ1B 3R8QA 2JI3A 3BXNB 4KRMB 3VI3B 2FEDD 2P5EE 4DP7X 3UROR 3WE1A 3BQUD 3L3DA 4XMUA 3JVGC 4FXGC 3WU2E 3VFNB 2OYIB 3RGVC 3IDMA 3SYQA 5KVMC 3VOPA 4OLVL 2G5UA 3VGEA 3NQIA 4HT1L 4NS0A 4L1BA 5DC0A 1S7UB 4M8QA 3KGRA 3RTQC 1C5CL 2QM7A 4PJAF 5B5EH 5CP7B 2IWGA 5CMZA 2O1JA 2VABA 2DMBA 3ARGB 4WI0B 3MREB 1NM9A 4NZDA 1CTOA 4F7CB 2K8MA 3LZFH 1B6UA 4R5XA 2FTAA 1ETJA 3L73E 3O6FB 5FCUL 1AOHA 1E8XA 2LU5A 4QRQA 3V55A 3N42F 4JFEB 4ZW3A 2NNAA 1H5BB 3AREA 3HRZA 4MZ2A 3X12A 4H2AA 1Y0LA 3WIHA 3LZPA 2VMCA 1JCKA 2FXOA 4YDJA 1P4IL 1UXSA 4M5YL 1NGZB 4JRYA 5I73C 4K2UH 4LLVB 1QR1A 4UAHA 4JYBA 3BISA 4H8WL 3DRQA 1BQKA 3S3PA 2DQEH 4OI9A 2J8UE 1DHKA 3E3QC 3OKOB 5FF6A 1TEYA 4LLUB 1NTMK 3KZ8A 2PTTB 5E4EB 5CZXC 3TV8A 2UX6A 4XVTL 3QUXB 1V8HA 3MV8B 2R4RH 3MUZ1 2BCCG 1OM9A 3L5HA 3RNQA 5F3BB 4KXZI 2Z91A 3CXHK 5DK0B 3SE8L 4XOBA 3RGBA 2D3JA 3MUHL 4NNPH 1U8IB 3LSOA 3RVUD 4GW4A 1S5IH 3I50H 1HXKA 5JIHA 2PP7A 3CFCH 7TAAA 3VH8A 2YD2A 4KRPB 3VD3A 2CALA 4MZRA 2GW5A 4WTXA 5FV1L 2PO6B 3S0PA 1QAWA 3MLYL 2ISDA 4I13B 1DUYA 3ARZA 1RUML 4LRNH 1O6SA 1CICB 3KCWA 4UT9H 1W0WB 3UPRA 4L4VA 3JXAA 3O8XA 4LARH 4KZDL 1UT2A 2Q3ZA 1DQDL 1BFTA 1D2OA 2CIIB 2GJ6E 1RE4A 5TE7H 2YPVH 3LQAL 1O9VA 1J87A 3QWRD 3MUGA 3PAZA 1TNNA 1IGYB 3ZRCC 1D6VL 4LLDA 2ESVA 1NCBL 5CFHA 2FZ3B 3GSNH 4MA3B 1S9VA 2MJZA 5HHXL 4FG6C 1CFQB 1M3IA 4X6EB 4X7SH 4NOFA 4PV1B 3BGFC 2Y2YA 2X05A 2AANA 3WBDA 1U58A 3D25B 2VC2L 1FVDA 3V2AR 1EJFA 2NY7L 1X5HA 5E08H 1GJUA 4G7VH 2NCEA 4ODBD 4PPTA 2YAEA 3DX0A 2FLBT 1P1ZA 1HXYB 1PZQA 2CM5A 4ZX5A 4JN2B 1RK0A 4ALAC 3CI9A 4IDJL 2PFXA 1S8DB 2EDEA 3CU7A 4QHUA 2A6DA 4XN8A 2CUHA 4LSRL 3FOMA 3PQYB 4KAQL 3HG4A 3HNTL 3IS1X 3LH9A 2FBJL 4LL9A 5DUPH 3QO1A 4EZJA 5F96H 3TF5A 1BIIA 1MFAH 2WZ5A 5KW9L 1TIUA 4E41D 2DH3A 3H1LD 2C4XA 4CJ0A 4BELD 1MHEB 3QIUD 4JHWH 4I3SH 5C07A 3QAZB 3T4YB 3N50A 3L72D 1P7KA 2XYCA 4YEEA 4A2MA 3T0AA 2D3LA 3DX8B 4AC2A 1L6XA 5DS8B 1XIWD 4MRCA 2B39A 2KMWA 1HJ0A 4LIQH 1LO2H 4R4FL 1XXFC 2F58H 2YARA 1QR4A 3UJTL 5TE4H 3VWKA 2KH2B 5IVXA 2VWEE 1OSZA 5E1AB 2FQGA 1F2QA 1OTUC 1L7TL 2EC8A 4OU3A 5AOJA 5F3HB 1UB6B 2VISA 4Y9GA 3NJXA 5KTEL 1BEYH 4LQ1A 2Z35A 3ALXA 3BVNA 1TTGA 4B9FA 3RIFK 1SYSA 3EO0A 2JKTM 1Y6MR 1W6LA 3F7QA 4ZBJA 1BQHA 5F88B 3LKPA 1U8KB 3SKMB 4FC3E 2BMKB 1XSIA 2XZZA 4CNIB 3D39A 2AJYL 3S35H 2AAAA 2OTUA 5KSAB 3H3BC 5A16B 3GD1C 1NC2D 2WPVB 4DK5A 1PBYA 2IGTA 1DJGA 3N1MC 1M1JB 1OCZB 4RA0C 3RA7L 4W6XB 3S9DB 3QFDB 2HT4D 4J3OC 3PWPD 3A21A 1IQDA 2BSBA 3T3MF 5A3IC 3GSVA 4ABUA 1XCXA 4WI9A 1JOIA 4WW2F 4RH4A 4YWGL 2YXMA 4OKVA 3OAUL 4NQCD 2BOLA 1DSFL 4R3SA 2D31A 4XAWH 3UYOD 3UACA 2ZX9A 3ZQXA 5DJUB 3BOVA 2DQDL 1JGDA 3CSPA 5T3XL 5KJRH 1OAYH 1TJGH 2XVGA 1AHMA 3V2QA 4XNUL 1NGWA 1IZKA 2YOCA 3QJFB 3L71J 3GW6A 3MYJB 3QFJD 3UX9B 3MRBB 4G9FE 3I56P 3TWYA 3OX8A 2HJKA 1U41A 3Q5OA 1HHKB 3BAWA 5DZNA 4YHYB 2ZWNA 4EUPH 5FECA 4CMHC 2FVNA 3BZEB 2YWZA 1ASOA 4Y9CA 3SQBA 3H9HA 4L1SA 2XZCH 1S6NA 5J0BA 1IAIL 4PD4J 3S8FB 4DKEH 3MFFA 4HUKB 4UZGA 1AQ5A 3IDMB 4B9ZA 4E5XA 5D8JH 4Y5XC 2BNQA 3DKHA 8PAZA 3BLBA 3STBA 1LD9B 1VFBA 3HNVL 3HZVA 4TUKL 5DDHA 2VXSH 3SKJH 1PV3A 1BZ8A 1HFUA 2UUDK 2J6EL 1P1VA 1X4YA 2A6JA 2CO7B 3Q1SL 5TH2A 1FDLH 1SVBA 3EJJX 3R7QA 4O2FA 3T0EA 3GLZA 1BZ7B 1KCVL 3NSJA 3TPUA 2X28A 2E5TA 2NZIA 3QNXA 4ANUA 3NSDA 3BVWA 4TLUA 2Y5EA 1PGJA 1A21A 1TJHL 2JNZA 3FAWA 4QRQB 3TEXA 2EVJA 1Y07A 5CCGC 3I9GL 1YY9C 5B7FA 2Q3XA 2UWEF 3HRZB 3X12B 1OVUA 3IDXH 5I8OH 1Y0LB 3BGAA 3THML 4HPHA 2CMRH 2KERA 5JR1L 3K1DA 1SBSL 4XX1G 1SRDA 3N91A 2KYVA 4FG0A 1SGKA 4XP1H 4UAOC 5IW1A 4JRYB 4PGZA 2ZYIA 4GMTL 3QXDB 4PS7A 2EH7L 4TVPH 2H4EA 15C8L 3DRQB 3L75J 1S9KD 1K72A 4DKFL 3BCCJ 2AABH 3BPCB 5IMLB 3CFEA 4QXUH 2EDDA 4L05A 4A2HA 4RJTA 1XDTT 3ARGD 4AQ1B 4CSSA 4DO5A 3KPRD 4RISH 5KYWB 2VDRL 4DGVL 1ZWIA 1KIRB 2ZTBA 3RJQB 1WYJA 4YDMA 2EH8L 1YUHB 3QG7L 5DZAA 1CTNA 1AY1L 1VGEH 2HVKA 3X3FL 1MCPH 2KLUA 2IH3A 1YQVH 3O6FD 1HNGA 4PIRF 3KPOA 3FUIA 4LL1A 2YEZA 2YD4A 4ZUVB 3LSOB 1FU1A 3QR1A 2GUYA 1HINH 2XNAA 4I48A 4LHUA 1LTGC 1PG7X 3ILQD 5FA3B 3B2PA 4KI5F 3KXDA 1VPOH 1XB3A 2ZXAA 1NOFA 3HZKA 5DSCB 1CI5A 5IR1B 3CBRA 3RU8H 1HYSD 1DUYB 1WZAA 3C2SA 5IJKC 4UOW1 1O6SB 1B4JH 1C1EL 3P11H 4U1LA 3UPRB 2CCVA 2Q87A 1I3GL 3QCUH 2J4WL 2PR9A 2FB4H 1TF4A 2E7BA 4L4VB 2LV4A 3O8XB 2BRRH 4MXQC 1XF3B 3QUXD 5KAIH 4HJGA 2HT3C 1FS0E 3MV01 3LNIA 2XWEA 4NEHB 5E00A 3BRGC 1LGVA 3GJFK 2DLTA 2R2HB 4L76A 1VEOA 4XPFL 3SPHA 1A02N 4GINA 4ODWA 2IZ1A 2ESVB 2BLFA 2XFXA 2K6YA 3MRPA 3MMEB 4LSTL 3AS0A 1S9VB 1YNKL 1J10A 3G3LA 4KRPD 5AQ0A 5EWIH 1I82A 3FB7A 3QQDA 3QZPA 2PO6D 4P23A 4JFQB 3MGNA 3U9WA 3WDHA 1OO2A 3C6SB 1G1YA 2HTKD 5EHFA 1CICD 1P1ZB 1SLWA 3GUFA 1BD2E 3HMWH 4PI0A 1KGWA 2CUMA 1O9WA 2A6DB 3BSZH 4M1CC 3OLIA 4GSQA 2BVOA 1NU1G 2ZFCA 4N8VA 5HJBA 4Y5VC 3T5WA 2VW7A 3G9AB 4PJ8C 3TJPA 4D9RD 2ATKA 1I9RH 1U3HC 5HYQA 1BIIB 5EU7E 1SLXA 2QZ5A 2ZF8A 3RDJA 2ZT9B 2XQYG 1D5ZB 3MV11 4KHXA 4BZ2H 3K0YA 4J2XA 4XBEL 3V4PL 1J8SA 4Z3IA 3ZHFA 1YPZA 3O9WB 4IRSD 5FOJA 5C07B 4KTDH 2IADA 3RB7A 1BQUA 5C0AE 4YHNA 4PV1D 1QP1A 3EJZC 3PWUA 4Z0BH 4QJ5B 2WMMA 1MCKA 3TJHC 2G2RA 2V2TB 5AZUA 4EIJA 1NCDL 3P40A 4N25A 4ZAKC 3UTSB 3AEBC 1YITP 3BHBB 3W2DL 4NT6A 4D94A 3ISYA 5AB1A 4WLCA 4Z6AT 2V9UA 2DLGA 1OSZB 1G7LA 4J28A 4OV6F 4QTFA 1FNEB 3ULUF 1JTHA 3GRBA 3BSGA 4L23A 3P32A 3P7KA 3ET9F 4XTRC 3US9A 3FT4B 2PYEE 3P3RA 3GSNA 3WEXA 3L81A 1AO7E 2AI0L 5BRZA 5I1CH 1BSNA 3DOIA 2Z35B 1FNHA 4UDTB 2D0HA 1I7UA 1RJYB 2DM7A 1XVSA 4MJJA 5IQNA 5BOJA 5EFIA 3DSFL 3HN3A 1YRKA 1SYSB 1S5LX 3IGLA 4BCXA 1BQHB 2P49B 3NMEA 1LEIA 3RURA 1NH6A 5DJCA 3MLWH 4YR6A 3PJLA 4QWWD 5HGBA 3TO4C 5C0JB 3TFKD 3BO8A 1N3NB 2QR0A 1G7JB 1DUZA 3OMNB 3OPUA 3SDXE 1YYLH 4F80A 3WKML 1TKWB 3MLRH 5I75B 3PXJA 3QULA 5FA4A 5BVZA 1IQDB 2X4QA 1H3PL 3B5NA 3GDCA 3GSVB 3N7NA 3U1AA 1HQ4B 4R3SB 2WYHA 4U3FG 4JPWL 1BM3L 1R3HA 1D9KC 5G5DA 1JGDB 5LGJA 1MRDH 1TO4A 1SQVG 2HMIC 4OIBA 1QOKA 3HI1A 3LKSA 1TPXC 1W72H 2OZ4H 1NGWB 1UA7A 4NKIL 5SX5K 3QK0A 3DNKA 4ZUTA 1SQXJ 4OCWL 1T1YA 4HJTA 1SUHA 2J7LA 2EEAA 1BVOA 3LCYA 2L7QA 4O51B 1FC1A 1YEGL 3FNKA 3D4YA 4BQCA 1L0LE 3SQBB 3UJIL 1ZGLM 3H9HB 3NBNA 4OLVH 1J9QA 4R6UA 2VR5A 1L9TA 4MCMA 3L35A 3EHBC 1JGEB 3SDDA 1ZOYC 1C5CH 4ZNCD 3QPXL 4B9PA 5C0DB 2BNQB 4YLQT 2QJPC 3A6BL 4FG2A 3HZVB 4MS8C 4WUKH 4O00A 5DDHB 4QYOA 4J3XA 2WANA 4GRWH 2A6JB 3VFPA 1JE6A 3CDCA 3PPSA 5DURB 4P9HC 3VFMA 5FO2A 3HBGA 4O2FB 3T0EB 1HWHB 2FLRT 3QI9B 3J8F7 5AG9A 1RE3C 3WNKA 3QNXB 3SPGA 2WLIA 1HKLL 2VR3A 4XHQA 1I8KB 4IOFD 3WDJA 3GF7A 1LO3L 2YRLA 2Q76A 2QQQA 2VRKA 1MY5A 2ZAGA 1HNYA 3FTZA 4PV9A 1VKXB 1QW8A 2IWEA 2XQBH 5B66E 4H8WH 5EZIL 1AQ8A 4ZMVA 2A0LD 1XH3A 1WFUA 1IV8A 3NQKA 3VP9A 3V0AC 4TNWK 3FO0L 4R0LB 4I2LC 5KLVD 1L0YA 3L71E 2MOGA 1O0VA 3MUUA 3EAKA 4WSJA 3TYGL 1NUFA 1G9ML 4JFYA 4UQCA 2O6DA 3OHXC 3BN9C 3P30H 3RDTC 1MVYA 3FQ4A 3SWYA 3EFOB 4BSVA 4G1EB 1LMKA 3FSOA 2IFFL 3MHZA 3SE8H 4AUJA 4EUPA 1QTYT 4HKZA 2IH3B 1ED3B 4AGOA 1T1XB 3KPOB 2OAAA 5AB9A 4O2CB 5KSUA 1GAFL 4PD4E 1YJDH 4UOQA 1IC2A 1J11A 1DEEB 2CDEA 2AEOA 4I18C 5KJ4A 3RBZA 1Q86Q 1KY7A 4I48B 4ZS6D 3JTSA 2DL2A 5KYXA 3D12B 5BV7B 3MLYH 3HZKB 4BK8A 4JRYD 1RUMH 3H1JJ 4ZO6A 5TDPA 1AHWA 3CCHA 4BFIA 5GS2H 3QP3A 3SD5A 1YNLL 4EMZA 3JWDC 1BZDA 5GQBA 3VSVA 3B2UC 1UFUA 2XPZA 5CFAA 3IPBA 3KYNA 3PNRB 1NFIB 1DBKL 1UZ6E 5KBDA 4JCWA 2JSFA 2ZCLL 2WZPD 4LPWA 1QBML 2IGFH 1GMEA 1LO4L 3LQAH 4KX9A 1KNOA 4HJGB 1X5ZA 3QWQB 2WO4A 3IGKA 2H2PD 1NCBH 4UT6A 4YL9A 3M91A 2MQGA 2R1WA 1KYFA 2XFXB 3E0GA 4LRIA 4MD0A 5AB0A 1J5DA 2PNDA 2VC2H 3G6JE 4K3GA 4B0MM 4DQAA 3L75E 5CP3H 3FB7B 4K5OA 1MJUL 3UOAB 4P23B 3BCCE 3GJFB 3LPFA 4E2OA 1UD2A 3HMXH 3CXHD 1BYPA 1CTMA 2R5DA 3ARPA 2AQ2A 4XR8C 1UQSA 1T7WA 5HVWA 1GGIH 4LSRH 2WQRA 4L4VD 2XTJE 3O8XD 3HNTH 3IPFA 5D6DA 1VADB 5F6HI 4F2ME 2AQTA 3CVHL 2FBJH 1DQQB 4H7VA 4NNXA 3CLFL 2ATKB 3CZJA 2NRGA 5B5EE 3MR9A 1FO0L 2OL3L 4N0UE 3STZB 1ZMYA 2ESVD 2XY2A 2CZNA 2IDUA 3VQMA 4HJ0C 3ETBJ 4JZOB 2IADB 2WZAA 1FZAA 4JK0D 1LK2B 2VLKB 4PJGB 4MDJA 5BUPA 4DPCX 4IQHA 3FU8A 3TBTA 43CAB 5GS0D 2NXYC 3RLSA 5CMAA 4AITA 5I0XA 3PS6A 3A0BH 3EBIA 2O6EA 3HI6H 3B8EB 1BHGA 4KTEL 4DP4X 4JRXE 5IB1A 3M0DA 1GW4A 4LP4A 5FUZL 2OMWA 5SWSE 1BJMA 5KJ7C 5HXMA 4AQEB 1G7LB 2A83A 4DK3A 2YD8A 4GIFA 2FH8A 5DF0A 1JTHB 1WZMA 5KTEH 1RUQL 5AW4B 5D2LE 1UD8A 4ASVA 2BX5A 2ZOWA 5IFJA 1A6WH 4GDOA 2ZT9D 4HZAA 4H1LG 3L7FA 1C8PA 2B14A 3ROLB 5D1XB 5EFIB 1ZP0C 3LPPA 5C07D 2POHA 4X80L 3O2VH 4KK8C 4AMKL 4AEHL 1LEIB 2YKKA 5DJ0A 3P54A 5CXPA 4WFFE 2EO1A 4ACTA 1DSYA 4RX4A 1RULL 3BJLA 2NLJA 4NSKB 3CLWA 3TZVA 3KVQA 4WCYL 1U33A 3RA7H 4TUJA 3BSZA 5A2CA 1E5ZA 1DUZB 3RUGA 1WICA 4B5ZA 2ZOUA 4ABVA 2BS8A 4YDVA 3QULB 4MJ6A 3VWKD 3AU1A 1S3KL 4GB9A 2X4QB 3B5NB 4KX7A 3OAUH 3L3OC 2Q3IA 1DSFH 1JJUA 4N2IA 5DJXA 5JUEH 1UD5A 2E74C 3CZNA 3ABMB 3KLKA 4FYQA 3BAXA 2DQDH 2YPLA 5T3XH 5IW3A 4AM0A 5EOQL 4LASL 3CC1A 1QTPA 1R3HB 1F6AA 3QNFA 1P53A 3TH2T 1T83C 4XNUH 2HA1A 1QSFA 3L48A 3C6LC 4JKNA 4OZHA 3PL6C 3HI1B 3LKSB 4Y99B 1F1DA 4BZ1L 5IIEB 1E79H 1BOYA 2L7EA 1HSAA 4PJ7E 2G3ZA 2XBDA 4H88H 1QW9A 4ZUTB 3RWIA 2P9RA 1T1YB 1ZLVH 2XDHA 3LNEA 3CH1B 3D39D 3WIFA 1TLMA 2VL5A 3U83A 1YI2P 3QHZL 1DDTA 4HIIA 4DKDC 3VTMA 5CSGA 5ANME 4MXWL 2PPEA 3GHPA 3BQUC 2EXYC 3B2MA 4LCWE 4LMQE 3SDDB 3TDKA 2QSVA 3EJPA 5T5FL 3HG5A 2ZXEB 2C1OA 1ZXQA 3B5HA 3HNVH 4HSAC 4QGTA 2R59A 5K69A 1FGVL 5LNGA 2CO2A 1LTJC 1UA6L 1RPKA 4KKBC 1S9WB 3AAZA 4QYOB 3Q1SH 3Q9QA 3VXOB 5FKAA 1ICTA 1NIFA 4PW4A 1SMDA 4IU3A 2FT6A 2KDYA 5D2NA 4PCYA 3VFMB 4L8CB 2WVVA 3Q3DA 3MA7B 4A7SA 1V05A 3D4ZA 5JIQA 1J5CA 1HIML 1MVUB 1E9QA 1DDHB 1TJHH 3MBXL 3O6KH 5JZ7D 2WLIB 3HE4A 4KNSA 1NEZA 5FX3A 2QA4P 3AQDA 5DC4B 5IMOA 3MRJA 5MEPA 4LKCB 5JR1H 3AE6C 3V6OE 1SBSH 3KPPA 2Q76B 4H0HB 3D51A 4JN1L 4XAKD 3BC9A 1WAAE 4GMTH 1IE5A 4G6AD 4H8HA 5D93B 4I1PA 15C8H 1A4KA 2NY4C 2DI7A 5HYJE 2BNQD 3OKDA 5IWLC 3TIEB 4DKFH 2QLYA 2C9QA 2EXSA 4HSQA 5H35B 2OZ4A 4OGAC 4K07A 4IS6B 3KXFE 4IJ3C 4DGVH 4QNPE 5B8CC 2YMKA 2WSCH 2FWOB 2XXGA 4JFYB 1SQXE 3CX2A 2EH8H 1B4TA 3QG7H 3T0ED 1AY1H 3QI9D 3X3FH 4Q9QH 3Q2VA 4M02A 3CWBJ 3ULAB 3WKPA 3HFFA 5EORH 1F5WA 2XXCB 2V7QJ 1OE2A 3APCA 4I1RA 2IDCA 4HEPA 5A7BA 4Q9CA 3IXAA 1JY2O 2BIPA 2Y7QA 1Z9PA 4XVUD 4GO8A 5ILTL 3E1RA 5CCHC 3EYFB 3ILEA 3QSKB 1EDKA 3FFCE 1LWUA 2GM4A 1UJ3C 3BMVA 2YA0A 1MRCL 3CCHB 5K59F 1NICA 1ORQA 4WV1C 3FXDA 2KZIA 1CZ8L 1CXKA 1U8PA 1IJ9A 2QKIA 3H2WA 4NBYB 5G55A 2L7UA 4O02H 2FY8A 1NL0L 1QO3A 2NOYA 1OCWL 1JHKL 3DUUA 5IBUG 3PP3K 2CRYA 3V0FA 1Y47A 4XPFH 3ULUL 5JIKA 3JWOC 4FXLA 1P4BH 2G3XA 4HMEA 1A5FL 1JYWA 1Z2KA 1CXFA 4JFFB 2B8OT 2NY3D 4OJFL 3BEVB 4V1DE 2WZ6A 2ZUSA 4LSTH 5F7FA 2B5IC 2ZKWA 2O5NA 2DBJA 4MD0B 5LBGA 1XH2A 2D2CB 4EN2A 3H3PL 1OV8A 3HC0A 3LEYH 3MJ9H 1SQPK 1YTZT 2M5AB 1JNHA 1H8LA 3S6CA 3TN0A 2O1KA 4XI5D 1J48A 3CSTA 4FQLL 1UQSB 4UNVA 4G8GE 2P67A 1BPLB 3LH2L 4PGCA 1BECA 5EN3A 4ZUUA 2B20A 3UZEA 1MHCA 4ENED 2QDVA 2FX9H 2ZAEB 1W91A 2O4EA 2YAQA 3CDZA 4NNXB 1LDSA 4F8OA 2FJSA 9CGTA 4LVHC 1H3XA 2WV3A 3H42L 3QUML 4LSDA 4Z8FH 4XPTL 5KN5A 2ZKMX 5APQA 1VRSA 3AUWB 4HUNB 4IGBA 1M90Q 3UIAA 3AE8C 2B9AA 3QEUA 3QO0B 4XBEH 1WITA 2DQFB 3KLSA 3TBSA 1J8RA 2FSEB 3SBWA 1TQWA 4BQ8A 3H1JE 2QM8A 4XBPB 3VI4E 2EINB 4IBQA 1N73C 5DT1L 1NCDH 4MDJB 2D7PA 1TYJA 3TBTB 5LN8A 5IQ9A 4P23D 2PN5A 5CMAB 3V9EA 3UTOA 1SJHA 2DTML 1LTAC 1XCWA 4HWBL 1ZKAA 1KTKE 3WY3A 4D0CB 1DVTA 1XIWC 1IGJA 4YDIH 2JCCF 3AU0A 1UWGH 4KKAD 3ZE0E 4Z3TA 4Y1TA 4RBPK 2A83B 3VNZA 4JANA 4G8FB 4KKLD 5FYLH 4PCTA 4XWGL 2VDQB 2AI0H 3WNOA 5ESQA 2FX8L 3PGCA 5IFJB 4DOJA 1I8IB 1S7RB 4OLUH 4AC4A 3DSFH 1EZVE 3TCLB 1KEMH 4MBOA 5GS3A 5CP3A 4HUCA 2GSMB 3TS8A 1OOAA 2NYZA 4XCYA 5DA0B 1QVFO 1UB5B 2HG5A 4ZO9A 1WPCA 4R9HA 5F8QC 4K7PX 1HZHH 1KXQA 2VZSA 2YR3A 1KB5H 4NI6A 4V2CB 4S1QH 5DJ0B 2W1NA 4ZSOE 2BJMH 3NABL 1SLUA 2IYPA 5F1NB 2NDFA 5F9OL 2NLJB 5ACZB 2OMVA 1OVVA 3LRMA 2GJRA 5I74C 2G0LA 4I85A 4PM1A 4UINH 4TUJB 3ZOAA 1CBVH 3P77A 5KANI 1ZY9A 1KC5L 1KFGA 1HOCA 3QUYC 4A04A 4MJ6B 5EOTA 3EFGA 1CGVA 3AU1B 3UBXG 1WJ3A 3B2XA 5JPMA 2HT4C 3G5XA 5DJXB 4TUOA 2YD5A 2OYPA 1N0LB 3OGCA 2YPLB 1HZKA 1TJMA 4NJ9L 2CLRA 3GI9L 2Q5UA 5BRZD 5C0FA 1ZHNA 1QSFB 4H8QA 4OZHB 5D1XD 5GSRA 3WKQA 2O6FA 4MX7A 1E5WA 2W94A 5HGGS 5DK2A 3DX7A 1HSAB 4OCWH 2ATAA 4YDLC 2R23B 1SXBA 3RWIB 1NC4B 1YEGH 4MJ2A 2XG4A 2VL5B 3RIAF 4PJEE 3UJIH 4QRRA 4NO5B 4QHPA 3QZWA 4R4LA 3GKZA 4UZSA 4QAMB 3FKUS 3BP6A 2E59A 3QPXH 4Z78A 3B5ND 3ISWA 3SJVA 1AXTL 5KSVA 3SKOA 1T7VA 1EQ7A 3N40P 3OAYH 3UTTA 3AAZB 3WTSA 5FWQA 5B38B 3E38A 5CN1A 4DO4A 1DBBH 3C12A 1TEFA 2JMRA 2V37A 2QJYC 4X5XA 5DVNA 3HLAA 5B3NA 1K6QL 4J8RA 1IGFL 2BOCA 2YD1A 4TSAL 5BS0A 4RAVB 1HKLH 1ZEAL 4XNYH 1E9QB 3BATA 3HE4B 3RL0B 1NEZB 1A0QL 4G6FB 1J0ZA 2L91A 4WJG3 1BAGA 5I1HL 2FWLB 3MRJB 2FFDA 4OFYA 4WO4A 1GW6A 1IBBA 5MEPB 3DRTA 3KPPB 2WCPA 5BNXD 3HC3H 4LBEB 3GMLB 5D7KD 4F9LC 3L1OL 5JLZB 3L74J 5EZIH 1M2OA 2N9YB 3RIKA 4PCKA 5I1EH 2HCZX 3ATDA 2QJKC 1A4KB 4YZWA 3SDDD 3H1LG 1H15A 3HJ0A 3OKDB 1UENA 3SE3C 1Z1WA 3AM8A 2F74A 5B7EA 3TYGH 4X7DC 2ZCKL 3L72G 2ED6A 3ZGIA 2W88A 1PY9A 2WPSA 4DWHA 4E9TA 2HFFA 1I8UA 2I1JA 2YD6A 2LLLA 5E8EB 2IFFH 3HW7A 3UP6A 1P4LA 1YEHH 4JE4B 4C54A 2EDJA 2VB5A 2A06E 2HSIA 4F91B 4QRUA 1S7WA 3N43F 2VE6A 1P84I 4IFFA 1P5VA 3PGFL 3PHQA 3VFVA 3PP4L 2CR6A 4PWJA 2Y7QB 3TNMB 3MI6A 3EJYD 4HFUL 1N10A 4WVZA 2J6EA 2R5BA 1NA8A 4L9LA 3L36A 1F3DH 1YNLH 1LWUB 1NBVH 3E6FA 3IGUA 3RGUA 4PBXA 4NFCA 4QI3A 1ORQB 4A6YA 2K1MA 4UMSA 1DBKH 1HYSC 3M86A 3BKYL 3PFQA 2AXGB 2K4WA 2ZCLH 2BFVL 3I6GA 4LESA 3K2MC 4TNVF 4LCUB 1G87A 1U8PB 2QKIB 1XTCC 2WTYA 4HCRH 4N2EA 4OCRL 3V6IA 3SSGA 4DPBX 5E4EC 5T33L 1QO3B 3DUUB 1BXVA 1D5MB 4J8QA 1QEWA 4X6DE 2Z7UA 3O3AB 1Y8AA 1D5XA 1ZRTD 2KS1B 3GZQA 4LOUD 1M53A 4AYDC 3KWWA 3S34H 2WB1A 3KWXA 3C6EA 4S1DD 4A63A 4GXFA 3T9WA 1AHKA 2Z5IA 5C0ND 4DOHB 1IFHL 4TF4A 4HGKC 1MJUH 2WSCJ 1MQ8A 1SBBA 2P5WA 3HC0B 3QRGL 4PR5A 4MASA 1NAKH 3LRSA 3OKKA 3BI9X 2VDPB 2R1XA 5FGBC 1COBA 1MREL 1JNHB 3ZKXB 3TN0B 4UM9A 2PO6C 1QYGH 3K5BA 1JO5A 2ZYHA 3MHVA 4WHYG 1RXLA 2BXYA 2NUTB 1OZUA 4BBWA 2NW2A 1L9NA 3FN3A 1CICC 3MV9E 2KNCA 4ZUUB 5F8RC 4M29A 1ETZA 2EVGA 3RTLA 4AMXA 3CWBE 1EO8H 3ENEA 3CDZB 4Q6IA 2Y06L 2WLMA 1AKPA 1MCJA 2NZ1A 3H8NA 4DPAX 2DLHA 5KN5B 5AW7B 1QQDA 2AQNA 4JFFD 5KVFL 3TEUA 3QEUB 4KKPA 3MLXL 1EDLA 4L1TA 3BUQA 4MJ4A 4GAAA 1MQKL 2J25A 2YQBA 2BVYA 4M3JA 4B9CA 2D2CD 4N6RA 1Q4NX 3V0VB 4ZK8A 2VWEC 4FMKA 4IRSC 3K3QA 4GYBA 5BW7A 3QORA 1XGTA 2BY1A 5IQ9B 4I3RL 4I0KA 2CGYA 4J1UA 2Z65C 3KCPA 3RY6C 1ZOXA 4KNQA 3WHE1 1TTCA 4Q4IA 4XH2B 4FFWD 1QRNA 4MNQE 4JFUA 1IRAY 2BOBA 1V54B 1N5AA 1X8YA 2B15A 2ROXA 2HP4A 3AVEA 1QI5A 4IRJB 5F1IA 3FT3A 1RUQH 3TVMC 4KK5D 4BINA 1TZAA 1N67A 4NN7C 2DQGH 3C8VA 2E6PA 2HRPL 5ESQB 1JCVA 3PGCB 5DRXB 2W80C 2WWWA 3ZTEA 1OARH 3HKFA 2Y2WA 2DY2A 3H1KJ 3VD1A 4X80H 2WXLA 4BWNA 4AMKH 1T21B 2QGDA 4X9YA 2ZVNB 3QDGB 2WPQA 4NXKA 4ZTOL 2WW8A 2HG5B 5SWZE 1JY3P 2VSCA 2FSDA 4JNXA 2MRYA 1PKQE 3FUNA 1ZIAA 4Z5RA 1NANH 2LU7A 5HDBF 3M1BA 2NX5E 2YKPA 3KWUA 3ZYZA 3H4FA 3N0AA 4WNQA 4K7PY 4MAUL 4XC3L 1B0WA 3P77B 3LN4A 3BYTA 1F4WL 1F41A 1YZZA 3ULVL 4QMAA 1AZZC 3TBBA 1KWGA 1PZDA 1IGML 3WUTA 3O8ZA 3G5XB 2A45G 4TUOB 3V4PA 5EOQH 1PU0A 4WWPA 3OGCB 5C6WH 2ICES 2Y0CA 3CXHI 1LEGA 2CLRB 3QJQB 1I3RB 5GGVL 5BQ7A 5C0FB 4HD9A 3UGUA 4JO3L 1VFAB 2X4UB 1ZHNB 3CFBB 4J4PA 1DFXA 2D9CA 5GSRB 2EUZA 4Y89A 1CGSL 2H0JA 3ZHNA 1NGPH 3AY4C 3Q01A 3MLVH 4IKLA 2GI0A 2J55A 4RX4D 4GOSA 4C59B 3AEAC 1NJ9A 4NC0B 4U6VH 3QHZH 2ZJSL 3TZVD 4OF3A 4MBRA 2XG4B 1PD0A 4ERSL 2P5EB 1OW8A 4QRRB 1NGQL 4WI4A 3W11D 4MXWH 4Z7NE 4N6JA 1YCSA 1KMGA 4DUXA 4PJXF 5T5FH 4PJAA 3UBGA 3VM5A 4BHUA 1INQB 2ILLA 4Z78B 3SGKC 1FGVH 4QCIA 3SWKA 1UA6H 1Q38A 5KSVB 2YPLD 5DEFA 4DN4L 2R32A 3OWEA 1G6RL 3UTTB 2CO1A 3GJEA 1FOSE 5IMKB 4EDWL 2JK5A 5ENWB 5KANG 2YD0A 1QSFD 2B1AL 5DQJA 3D85A 1B0GB 3CVCA 3HLAB 5BS0B 3T2PA 3NJIA 4Y9FA 1OGPA 1HIMH 4IIQA 4CPGA 3AEEC 3MBXH 3ZU8A 1E6OH 1FL6A 4KUZL 3CC4P 1FCCA 4NNYA 2VSDA 5F72S 1ZS2A 3WO4B 2R44A 2AV7A 4W9IC 4KO9A 4JN1H 2ZXBA 4MS6A 4M6NL 4K23L 1JD7A 2B9BA 3DRTB 3T71A 2V8LA 2NY0B 3IMVA 4GJTB 1UT9A 2KL6A 4MD4A 4R8WH 4TTGA 1KSRA 1IT9L 1PPIA 1SOKA 5FO8B 2H89C 1H15B 3F8UB 1SQBJ 1QD0A 2XWXA 2YK1L 1GC1L 2GBAA 3A0BE 2A0LC 3PDOB 2F74B 2E27H 5F1OB 3U1CA 3B7YA 2A1WL 3FULA 3T0BA 1KT2A 3L95B 4Q4EA 5C0BE 4W9KC 3FTUA 4X83A 4YC2B 2FQEA 2G60H 4N2NA 3VGAC 4QXWA 4NKOA 2OYHC 3RL0D 2X1XR 4QRUB 4G6FD 4HJUA 5AL0A 1ZSDA 3LKNB 4OT1L 5DHDA 1A6PA 3PHQB 3X3GH 1CFSA 3AREC 5ILTH 3HRZC 4EDFA 4L0ZA 2EDKA 2K6ZA 3TP4A 5IESL 4L8DA 4ZS6C 5F9AC 4ZODA 4MJIA 4K5LA 3FH7A 2WD0A 1JTPA 2FYYA 3E6FB 4GBXA 4DP0X 5JQIB 3H1HD 2BXZA 4A6YB 1LE9A 4JM2A 2Y25A 1A47A 1F00I 5I76A 1ZLDA 1Q9WA 1SY6H 3I6GB 1BVKB 3QRBA 1JHKH 2X4TB 1Q82Q 2Z8RA 5DLML 4I7ZC 3FQXA 5I6LA 3ULUH 1ZS8A 4LPCA 1DBMH 2GJ6B 4RWYH 1YN7A 1MV8A 1QEWB 1A5FH 4EI2A 2EIZA 2X40A 4MRBA 1D5XB 5T3XE 4OJFH 3UO8B 5AVQB 1JFQL 1DH3A 3D8MA 1ORSA 3OR6B 3L74E 2H2PC 3ZR6A 2D4FA 3H3PH 5C3TA 4YLBA 1FE6A 1E3XA 2C4FT 2AF2A 1WZ1H 4Z7VA 4M6OL 2WBWB 5F0JB 2GUOA 4OJYA 5E6IA 2P5WB 5AZEH 4PR5B 5DEZA 3LRSB 1KV7A 1U2HA 3P9LA 3AE2C 2R1XB 3S96B 1KYAA 4KK9D 2E7DA 2I26N 4HIXL 2VDRB 1LO5B 4YDZA 1BE3D 1BCIA 1JWMA 4OWFA 1NMBH 1ZT1A 3LH2H 3D09A 1B2WL 4KK6C 5L4FA 1PZ2A 4TNEA 4YO0A 3TT1L 1OGTA 2FBRA 5C8JA 1MFDL 1ETZB 4Z95L 1QGKB 4YBLB 5JIPA 4IOIA 4N2CA 3QUMH 4E42B 3F04A 2RJMA 4Q6IB 3I6LE 2CPBA 1GGTA 2EXWD 3L3KA 3OKEB 1F3DJ 4WEBL 1H89A 1RE4C 4UILL 3EOBB 3MGAA 3DX1A 1DVYA 5FAAA 3IF4A 2ARJB 3B5GA 5J1TC 2N56A 4D6TD 5DT1H 1FZFA 1ETA1 2L04A 4U6XB 2VM4A 1JK8A 1XCQA 2V9TA 5KLIC 1GK6A 1HYRC 4KJQC 2DTMH 3QISA 4WRLA 4WHDA 4PV8A 3TN0D 1GZLA 3HR5A 4Y4KB 1AV1A 2JKNA 2BOBB 1N5AB 3TNUB 5C0IB 3T6ZA 4B27A 2NXZB 3FT3B 2J8OA 5AVRB 2AJUL 2I25N 2FX8H 2YC1A 4NUJA 4W4OA 4JO2H 2PYEA 3DYOA 1SQPD 1AFVL 3IPEA 4ES8A 4O2EB 1U4EA 4UQ2A 1XB8A 4HKXA 3APNA 2KIKA 4WEMB 2BPBA 2AQPA 3IMBA 4QXTA 1I3VA 2N7BA 2OI9B 4DVBA 3KBPA 4RSYA 3NABH 3NZSA 4YGAB 4FCHA 3ZYIA 3VVWA 1DCLA 5JQ6L 2H41A 5HJGA 3TH3T 4ZXBB 3RX8A 2AEMA 3CVHA 5KLVG 1PMYA 3VUAA 4OZGF 1NFDE 1KC5H 3DC0A 3C09C 4HUMB 4UQ3B 4X8GA 4WW2A 3V0EA 1X5KA 3HS8A 4X5WA 1FO0A 2H26B 5ABAA 2OL3A 4IRJD 1PIXA 1HHHB 1TCRA 5HI5D 2CNZA 3ZE1F 3V4PB 3VWKC 4NJ9H 4NRZA 3PXHA 5EU4B 3A3YB 1LEGB 4R7VA 1L4AA 4X4KA 5BQ7B 5I15H 2C3HA 2ZKYA 3MDJA 1L0LK 3CFMA 5I1JL 3RPBA 3S35X 4TTDD 5DWUL 3V0GA 3HUJA 5I1AA 2ZUQB 4CC0A 3FQ1A 1A7QH 4MJHA 3T0XA 4I77L 2HG5D 1HGZA 4PWKA 5APTA 4Z7WF 4MMXA 3TWCH 4OCSL 3HPLA 3CCJP 1SUJA 4X9GA 1A9BA 1IEHA 1HX0A 3FXIC 5B1BB 1NJ9B 4YXLH 2DBLL 4OV5A 3KNBA 1HHJA 2E7HA 1N68A 1O7DC 4IBZA 2Y0SA 4XZUA 4JW3A 1GRWA 2IAMB 3GBDA 4TVUA 1Q72L 1DE4A 3G5VA 5ECJE 4PGJA 5EUOF 2JQZA 4N0CC 5DEFB 4U49A 4EDXA 3ETTA 3H1KE 2VQ4A 4KKCC 2EO7A 3AC0A 3KL5A 1I1CA 1NTMG 2JK5B 4G59C 3KW8A 1Q94A 3S37H 3L5JA 3GMPA 4J3UA 5DQJB 1K6QH 3D85B 4FF9A 4TSAH 5C0CA 3RP1A 3TBVB 1HK6A 4YLCA 4LU5L 5C7ZA 3MRHA 4IIQB 5C9JA 4AYBA 2FJHA 3MJ8A 5I2IA 1FL6B 2UWEA 1A0QH 4RRPA 1HTYA 4PP1C 2BP8A 1LNQA 3KHQA 5CUSH 3U4KA 2PWGA 4NNYB 4PRDB 1M1XA 5T1DL 3KLHD 3PWVA 4QRSA 2P5ED 4ZKUA 1KCRH 2GITA 3L1OH 4QRRD 4YBHA 4P2RE 1VLXA 3N6YA 3QC5X 2X4SA 4AEEA 3HD7A 2HFGL 3EYUH 4NQVA 1TTRA 1UWYA 3NGBB 1CDYA 4JR9L 2QPSA 2V7HB 1DQVA 2ICWB 1XF2B 3K4AA 4MVBD 4BZ1A 3QBTB 1ZA6B 4PD4K 3UTTD 3DXAE 2HZHA 5JA9A 1VZHA 1DQTA 1OQOA 1U4FA 2OZNA 4RMTA 2DIEA 3L1GA 4HUXB 3IFOA 5CSZA 1KT2B 1EXHA 2ZOTA 3VXMA 5FYLE 4K94C 3LD8B 5BS0D 4PY8I 3CJJA 1A64A 3X17A 3CXDL 2AXTH 4WU7A 5CJ0A 2VN5A 4RFNB 4JFHE 3GS7A 3GHBH 4NKOB 1HS6A 4J7RA 4KQ3H 4E9RA 1UWEH 4HIQA 2J43A 3L4TA 1PVHA 1S3JA 1KELL 3ARSA 3FU0A 1ZSDB 3PP4H 2OR9L 3AECC 3QH9A 1MDTA 3JWNE 4OFYD 1D5BB 4WO4D 3B5TA 2IQAA 1RZJC 2IVFC 1E6JL 2NY0D 1NTDA 5EC2A 5KVDE 3PUUA 3MODL 1XGZA 3MX0A 1YO4A 2ADGA 1JXDA 2XWBA 4MJIB 1GY2A 2CO6A 3NJFA 3QUHA 4FLQA 4GBXB 4Q74A 1IKNC 3FN0L 3BKYH 4YAQA 1LE9B 1UOWA 3HVNA 4JM2B 4PJDF 4LSVL 4WKZA 1Q9WB 2QGCA 1QABA 4OCRH 3ES6A 3C60A 4FQIL 3VXUA 3H4HA 1GCFA 4M00A 3FQXB 1OPOA 4HMCA 4UTAL 1YN7B 5TDNA 3WMPA 1N4XL 1S3RA 2WN2A 5IGXH 2EKSA 4U05A 1AR1B 4BEIA 1ORSB 3RL0g 2WTOA 4FXTA 2P10A 2NY3C 3QRGH 3TONA 3G6JA 1UXWB 1V3JA 4QIRA 4Z7VB 5I1LA 1SQBE 2GUOB 1MREH 1ZPUA 4JB9L 4HIEA 4E9SA 2G9HB 1J12A 1OLZA 3E6HA 3MACL 1SDDB 5MEOA 3RK2B 3IWVA 4RZCA 4DZBA 2M3BA 1XF4A 1JWMB 4X6CF 1BD2B 5FLVA 3MCG1 3D71A 2P48B 1BQHG 1SOQA 3QEGH 2CBTA 5IBLC 4YO0B 1OGTB 5C8JB 2Y06H 4IOIB 1NBCA 2DRUA 2GJ6D 1JYXA 4PLKD 4TKWA 2F1BA 3L3KB 1KBKA 1ZT7A 5JYLA 2XWCA 5KVFH 5TE6H 1GR7A 1A4JA 2XNDH 3Q6GH 4N0UA 1MQKH 2DIBA 2V5TA 2WAQA 4KZEL 1Q90A 2AVGA 1NQBA 4LCYA 1JRHI 2SPZA 3EDFA 3L9RA 4LCCA 3B9AA 2P5WD 1UATA 4I3RH 2WVSA 5I9QB 3SOBL 3APMA 2R69L 4OGQB 3QG6A