5AW2B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw2B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw2B02
2BASA 1FOSF 4AYCA 1CI6A 1MFZA 2Q5UA 1X8YA 3HTKA 5AVUB 2WTYA 1SLQA 1H8AA 2N9BA 2Q7CA 3HE5A 5AVZB 3TK1A 3TNUA 5AVRB 5CMZA 3A7OA 4C46A 3M91A 3VMXA 1OXZA 1SP4A 3VMZA 2P7JA 3A2AA 3IR9A 2XZRA 3P32A 4B86A 4KHXA 4XE5B 5APQA 3MGNA 1CSBA 2R3CA 2YNYA 1A02F 4AQRD 3NMDA 4AUWA 4DZOA 3LIEA 2YO3A 3V4WA 2C9NY 1KQLA 1GU5A 3WGUB 2E42A 2Z5HA 1FAVA 5AW8B 1S9KD 1GK6A 1CZQA 3SWFA 3L35A 3VYIA 3VN0A 2H7HA 1HJBA 1HUCA 3VMYA 4C7NB 1MV8A 1NAFA 1GD2E 4LC1A 1S9KE 2WPSA 2KP8A 4M3LA 2YO2A 5APUA 1DH3A 3M0DA 3KDPB 3TYYA 1MUUA 2QM7A 2Z5IA 5APYA 5APWA 1FOSE 1J2JB 5AW3B 4C7NA 2XU6A 4I6MC 4RETB 4I2LC 1GZLA 3OAKA 5AW1B 3I5CA 2IPPA 3NFQA 3LIDA 5AW2B 3HE4B 1GK4A 2WT7B 4GKGA 4HYTB 3P7KA 5APVA 1GTWA 3KQGA 3A3YB 4EOTA 1OWAA 3WGVB 2WPQA 4GT1A 3L36A 5AVXB 1NWQA 3HE4A 1A02J 2QM8A 2WT7A 2P2UA 1JNMA 3NTNA 5AVYB 1G2CB 2JJLA 2P67A 2ZXEB 2E43A 2R32A 2Q3IA 3O8ZA 2C9LY 2W6AA 1JUNA 1YYCA 5AW5B 3A5TA 1T2KD 1HWTC 1GU4A 3B8EB 3M0AA 5APXA 3M9BA 5AW4B 5APSA 5AVVB 1H89A 1T2KC 3NXSA 3MD0A 3M9HA 3V5BA 3P8MC 5APTA 1HBWA 2R5BA 2W27A 3T97A 5AW7B 3VTPC 1H88A 3V4QA 2R5DA 5AVWB 2VRSA 3L37A 1CI6B 2ZFCA 4JYBA 5AVQB 2WWWA 5AW6B 4RESB 2XV5A 5AVTB 1IO4A 3HE5B 2WPRA 3M06A 5AVSB 5AW9B 3TNUB 5AW0B 3UIAA 4JYCA
chains in the Genus database with same CATH superfamily
4BH8A 1XZ0A 3BRGC 2QVIA 4JM4H 1D5BB 1T7WA 5I1GH 5DD6A 4Y4KC 5F89B 3W39B 1NTKD 4AYID 3HUJB 4LOVA 1U7MA 1P5VA 5E2TH 1LNUA 1SOSA 3R18A 1AFVH 3UAAA 2JQMA 3LJ3A 8FABB 5C70A 3CHOA 5LGKA 5J89A 2E7BA 4D9LL 4XNQA 1F56A 4DVRH 1TQBB 3LEYH 4ZMLA 2N0KA 4NM8L 1PGQA 2H43A 1E5YA 3POHA 4XP1H 5HGAB 4EE2A 4DK3A 2CO4A 5F1NA 5EFIA 4KWUA 4ZYKA 4A2GA 1MIMH 2XV3A 4MLIA 4X7TB 5DO8A 4FNTA 2GVYA 2ATPA 4NLHA 3KD4A 4RAUB 1G1JA 3PRJA 3AAZA 2BOCB 5IMOA 3SBWC 2UXGA 2ZXAA 3AXIA 4LSTH 2NNAA 2L7UA 2IPKB 2HX8A 1GD2E 3GJFB 4JHWH 5J3HD 2C3XA 1RF0C 1KCUH 2FWOA 2YGOA 3IGFA 2APWA 3RKDD 1BQLH 5DVPA 1BFOB 5GTHH 1D6VL 2FYUD 4KQ3L 3U0TA 1NEPA 1MLCA 3AT9A 4I6MC 5IJDC 2VDQB 4B9ZA 1LP9E 1CG9A 2B1HH 3PL6B 1PPJE 5D7KD 2DDQH 4LO9A 3C9NB 2H0FA 1YMHB 4EO5A 1N6QL 2RCSL 1E79H 1L7TH 4U7MA 3FQNA 2OZ4A 1AO7E 5I6XB 5IFJA 4OB5L 3ZHNA 3D48R 4IEFB 3NIDE 2QEXP 5CGBA 1R17A 2X3AA 2F1BA 3C8KB 5EIVA 4MNQA 4QHPA 2AXGA 5JOFA 5HDRA 4R5VA 1ITCA 5B1CA 4P5KB 3TP4A 5LQBH 5MHSD 1Q94B 2K6ZA 3FT3B 3T04D 2NY1D 3M1OA 4A38A 1GY2A 4G7RB 6FABL 4JO1H 1F6LL 1QX1A 2QJDA 1JHKH 4N68A 4QT5B 2XZAH 1TO4A 4WW2A 2H9GA 1NTMK 3QR1A 3LMJH 4PHZA 4G1EB 3SYCA 2C9LY 3O2DL 1UD2A 1TYEB 3E9TA 3ABGA 3ZDWA 5JXED 2M1KA 2OMXA 3O4OC 2DIBA 2H2PD 4D7PA 3LEVL 2DI7A 4JPWH 3RP1A 3BP4B 2NNFA 4TUUA 2QTEA 3FWNA 3JTTB 4KVNL 3EGXA 4WO0A 5E2WH 3TVMC 2PO6C 4F9LC 5APTA 2YLHA 1N67A 4M6NH 3D2UD 3SYPA 4N0CD 2CIKB 2BZ7A 2XBZA 2V7HB 3L5XL 3FO2B 4XXCA 1V3LA 3IJYA 5L2KB 1XXDC 1PPJG 4ODSL 2PTUA 2WQ8A 3BH4A 1S3RA 1U33A 3TH3T 1N4XL 4NQDE 4XTRC 3HNTL 2BNRD 5FGSA 3EYQD 4BK8A 3DSFL 4WUUE 2VWEC 4XOBA 2Q7CA 4OIBA 3HE5A 4OLUH 4UQ2B 3FKUS 3L1OH 1QEWB 4XC3H 3VFRA 3H7BB 1QUNA 4P5MA 2JKJA 5CMZA 2R83A 3ZDXE 3V0VA 3F6IA 1Q82Q 2ZKYA 5IF0A 2AQRA 2DM3A 5ICUA 2WVTA 3EO1B 5HYJD 1ILUA 2VXQH 3ZRSA 1SHMA 3B83A 3P30H 5EMYA 3HUJE 1F90H 4Z7AA 4Z7UE 3RGVB 3IN2A 4YJZL 1RF1B 3VXMD 5E2VH 2R3CA 4AIEA 2XYCA 5ADOL 1RY3A 3BC9A 1MRFL 1DVXA 5FDWB 1UXWA 2O6DA 3H1HJ 2H89C 3DHUA 5AAPA 2W91A 1IAIL 2WKLA 4WEUD 1SXSA 1ZWIA 2LGNA 4NBXB 3TPUB 1MJ7H 5DHVB 4OV5B 4U1JA 1JZ4A 3WHXB 4HZLA 4GB9A 4D3CH 4PJ7B 1KBWA 2AZUA 1DQJA 2HVKA 5ESAB 1OVZA 4XN4A 1IKOP 1KJ3H 3P4MA 1Q9KB 1XF1A 4PWJA 2EUZA 1AR1C 2V9TA 4MKMA 5ALCH 1X5GA 4AZ8A 4Z7IA 3R8BB 2C1PA 2OYKA 3UZVA 3NFQA 1L0LE 3IJHA 3BPNB 4AQZA 4BWTA 3FAXA 4B9YA 4O51B 2ZOKA 4NDMA 1RUKH 4FFZA 1IGCL 4M6ML 2OJEB 3IMVA 4BZ2H 4DP0X 4PJ0H 1CDYA 3GPSA 3B2UC 2BC4A 5FUCE 5FGBC 1XF4A 3PUUA 1COBA 2O4EA 3QJOA 5T5FH 1FZGA 2M2DA 3S3CB 3TFKC 1Q2NA 2A4CA 1UC6A 2X41A 5AAWA 1TSRA 4FXKA 4XX5A 5KBKA 3IN6A 4PS4L 4CMHB 4WNSA 3FQXA 4J3BA 4PJ9C 2JJLA 1LYQA 5E7FA 4BSWB 1F4YH 4DK6A 3SDAA 2R0KH 2V2WB 4Z3IA 3MRIA 1FVCB 2CDGB 4ATWA 2A4ZA 4IOFD 1JPGB 1L9TA 1MRDH 1URQA 2RHEA 2W95A 4MS8C 3BAEH 1BJ8A 1PNDA 4ZD3L 2VDPH 3CI9A 3B4NA 4X0KA 2XPZA 1X5JA 4EEEA 1BVKA 5KVDH 1C8QA 3HI6H 5IHUH 1FNHA 2NY4D 5D7JD 5DVKA 5DVMA 3GLDA 5FW6A 2WIMA 4TQHA 5AOZA 5KVMC 3U4KA 1L5GA 2VW7A 3TEZA 4MRCA 1ZA6B 2IG2H 1U92B 1JF5A 4HH9B 3N0AA 2OMWB 1RE4C 3GHGA 1VDFA 2JIXB 4QHNA 3RBXA 1CK0H 3HE7A 1BZ8A 3TNNB 1TF4A 2PXYC 3D25B 2WSDA 2NW2B 3M7FB 4G6JH 1SBBA 3RRQA 4XP9H 1L0LG 4ODVH 1QAWA 5KUMA 2BVYA 1PJ9A 4LSSL 3UC0H 2X40A 3GNML 4U4BA 4JFEA 3R7RA 1WYJA 4L3EA 4PY7B 4P8QA 2VLLB 5GGVH 5EIIB 3CDCA 4TQPA 3H1KD 5C7XH 5CEZL 2H6PB 3BUIA 2Q86B 5IOKA 4M4RB 5DT1H 5J6GA 1P2CA 1NTKJ 4QIRA 3TA3A 2YA0A 1P84I 2PCPA 4L9DA 4P2OB 1S7XA 5KSVB 4JR9L 3IR9A 2LLNA 1A21A 4OSUL 4P23C 3II3A 4XX1E 3QQNA 4X9FA 3KBPA 1CL7L 2ETWA 2EKSA 5BRZA 3DX7A 2J2ZB 4KY2A 2TSAA 3JVGC 3N40P 3QARA 4QI3A 4Y2OB 1MQKL 2EINB 2A9AA 2XFXA 2CRZA 3KS0H 4H44C 1C08A 2AABL 3GMLB 5EU4B 2ZUTA 4GXFA 1HHIB 1KBBA 4HKBA 3UPRA 4YHLH 3V55A 3LKQA 3K5BA 1X9QA 2ID5A 3KW8A 5KUKA 1Y18B 3P77A 4JHAL 1LILA 1RQUA 1TZAA 5D4IA 2FYUJ 2AXCA 4KKNA 4CSSA 1HXKA 5ANMB 2VQTA 2EIDA 1DQML 1HSAB 3WEXA 3B34A 4BFIA 5GS0C 1BGYE 3CD4A 3Q2NA 4NKMA 3S48A 1IGIL 4HJIA 5F3HA 3ECUA 1PZAA 4EKJA 3GMMA 3KJ6H 4M7KL 3TIEB 2MIZA 1SQQE 3CFDB 2DQIH 3ZL2A 5I73B 3FT4A 3SPIA 1RD6A 1XGUA 3O6KH 3KPSB 5D1QD 2KI6A 3QZPA 5A6LA 2K3TA 2FQEA 2R0WL 4HKJA 5AZ2H 1OGTA 4PRID 1NMCC 4L9LA 25C8L 2K7PA 4XX1G 3T0EB 4YHZH 4MQ7B 3ZMRA 5DJ2B 2O3JA 5EF0A 1GW6A 4OZHA 3B71A 3MOQA 2FZ3A 3O9WA 4KV5E 3KAAA 1FDOA 1I8AA 2IH9A 2F61A 1FNSL 1BOGB 2ZUUA 2B2XL 1QPKA 3HE6C 2OULB 5JTWA 1JYXA 4Y4FB 1BZ9B 4OZFB 5E2UH 3VD1A 2XBTA 4WRLA 4UINH 3TV3L 4BWNA 1ZHBA 3OLIA 2G5UA 5B4MD 2F6AA 3TBWB 4ODUB 5KJ7E 5A2CA 1OSYA 1CICA 2J1KA 1XSJA 3ZE2F 3HD7A 2ADIA 1QR4A 1XIWC 2VSDA 3AEFC 2FFDB 1G0DA 1M05A 3ETTA 3OB0K 3QNYA 4M8RA 5GRVL 3Q1MA 3GRWH 1ET7A 4LKXA 4F57H 3QQ3A 1ODUA 5M1BA 5K9QI 2X1WL 5I76B 4EXPX 1QPPA 4LDCA 3ZLQC 5KBLA 5MENA 5TK4A 4TTGA 1NGYB 3ET9F 2DS4A 3ZPDA 1YYLL 4N28A 1BGYG 4L4JA 4NZRL 2CGRH 4RRPM 3CTTA 3X12A 2NXZB 4HLEA 4FCHA 4ZOCA 1CVSC 1E8ZA 2XYBA 3CCVP 1SQQG 1JG9A 4LVNC 3IFLL 2QHRH 5FO7A 4WV1B 1TQUA 2DW3A 5LUMA 5AUMA 5GRXG 5JHDA 2QPUA 4CVZB 1DZBA 3ZX1A 5KYNA 2EKJA 5F9OL 1N7MH 5D7LE 2OSLB 3DDGA 5TDOA 3V52L 1IC7L 4FQHB 4HCRL 2OMUB 2YEQA 4OJDH 3MBED 2WIIA 1M1JB 5EZLB 32C2B 4P4KA 3MNVB 4FQXD 2V3FA 1H15A 5J4MA 2QKIA 1Z5LB 5EUKA 1KDJA 1VQ9P 1CMOA 4E42A 1MW0A 4KTDL 4EI5C 1DN0A 1BREA 2PO6A 4HJTA 4HWBL 3O6LL 1EXUB 1G7QA 1GSMA 4E36A 2FX9L 2CR3A 1U36A 3OXSA 5H2FH 1YEGL 2BS8A 1NUDA 4YDJA 5J1AB 2CRMA 2WYHA 3FPYA 3QI9B 4PTUB 3BZFB 4K3JH 4KMLB 5EFWB 4LNRB 1CLYL 5AWNL 1F4XH 4HS8L 1H9VA 1CCZA 3Q1EA 4OQTH 2JQZA 2XA8L 2AKRA 3MYZA 5GJTH 1XBRA 2A74A 1QSED 2VXQA 1SYVB 4PJHA 4GOSA 4X6DB 1XR8A 5ANME 1CBVH 3M8OH 4Y0GA 4M5SA 1VZIA 4LDOB 3LKPA 1ORQB 3QDGD 3SDDC 2A6DA 3NK3A 2VN5A 2I5YL 2E5YA 3S9OA 3BGFC 4FYTA 3MLUH 2ZCHL 5EIIG 1S78D 1BVLB 3NVQA 3QORA 4OCXL 1AGBA 1U8KB 3IDNB 3LQAH 4HCIA 2IQAB 4UT6H 1XGRB 1I9RH 4S1DC 4F2MB 4PGEB 5HJDA 5F7DA 3KPSE 3ULVC 3OLDA 1G7JB 3HOGA 1DBAH 4R83A 2CR0A 5DUBB 2YN5A 1XBDA 4KKLC 1BHGA 1JZDC 1LT9C 4M93C 5HJ3A 1MZZA 5DR5H 3T0EE 1ZLUH 2UWJE 2YGQA 4YBLB 5F9WB 3V4UL 4PJ5A 2I60L 5GS1B 5MI0C 5T8IA 2BNUB 3NIFF 5IOPA 5CP7A 3IDJA 3PNRB 4XMZA 4DW2L 4XMTA 5HTSA 5JDSB 2D7MA 5E8PB 5CILL 1DVUA 4HJ0C 4DUXA 1YNTB 1H8OA 4ZRGA 4WFHD 3GKWL 3GSUA 5SWSE 5DGQA 2W65A 1KCWA 2N7SA 3MMEB 5IW1A 2Y0CA 2EC8A 1T7ZA 1XGYH 3TFBA 4PJBE 4UT7H 3BMVA 3PGFL 4BZ2A 3DDFA 4WHYG 1G9NC 2EDRA 4R97C 5I1AA 4TPRH 2D9QB 1W0VB 2V7QH 1AZCA 5J8OA 4FL4B 3NFSL 2LU7A 43C9B 3BD3A 4PRNB 4LLWA 4LSRL 1SQXG 3B1TA 5T5FA 4NNXB 3NABL 3T77B 4FEMA 3U7WH 1ZLWK 3QB7C 4U6XA 4L1TA 2NUPA 1CFQA 1I31A 2BFVL 1R3HA 4GODA 1A47A 3RPKA 3FU6A 1VQMP 4HIIA 4TVPH 1UJTA 2VDMH 4MDJB 1YAZA 2NDGA 5FB8A 3HRNA 4LAQH 4NPKA 3CX5K 4UDUA 2FYNC 3RK2C 2CXKA 3KGSA 5DHMC 1KYOE 4JQIA 4ALAC 5HYSB 2VR8A 3A4DA 3QO1A 2FECL 2OPCA 3F5WA 4LL4A 4YFLI 3PU7A 2HT2C 3O2WL 3FH7A 3OLEA 2QIWA 1KLUB 1X7TA 2GSGB 3Q3GB 1SYSB 1JY2P 5HVFB 3Q7JA 1JF1B 4JDTL 3QFJA 1R0AH 4U6YB 1IBHA 2RQ8A 2MRYA 5APUA 2KZ1B 3X1GA 1QFWI 1X5IA 1LK3H 2OMBA 3VDAA 4C7RA 1KGUA 3VI4F 1A4KB 4IKLA 1T0MA 1KQSO 1GJIA 3V0WL 1ZGLB 1CE1L 1ML0A 2J6WA 3AW5A 4A7UA 4G6ML 4EPSA 5HHXH 4OZFG 4GIFA 1NBCA 3BCDA 3F12A 3L3OB 5K39A 1TQCB 3IDUA 2WJ5A 4GMSL 3SYAA 3WJLA 4P3WA 5L88L 4RRPA 5GSRA 1AXSB 3LY6A 3QAQA 3HI5H 5HXMA 2EIBA 3KPRB 1KXVA 4J4PD 1SXZA 4QKXB 4M62L 1A7PH 4U1NA 5KZCD 5F7HA 1T0OA 2UX6A 3JXAA 4Z7OB 3F04A 4JPVH 5IVNA 1P69B 3BH8A 4L2LA 5KN5A 5DJDA 3VP8A 4KJPC 2AXTH 1EHNA 4GRMB 5KW9L 3TBYA 1QA9B 4ONGL 1EDQA 1BMWA 3QYMA 1RV6X 4I0PA 5C0BA 4X5XA 4R4ND 3B1UA 4X6DE 2VOTA 3HLAB 2NY1C 1J11A 2WBKA 2A06D 5T3XH 4J3VA 5CCHE 2ZX9A 4M7JL 4IBSA 1AQKH 1F6FB 5F1SA 3UAJA 2OQJB 3QJXA 2VXUH 5FUZL 4BZ1L 1UM5L 1EV2E 1NAKH 4KQ0A 3V4LA 2H2PC 1F1DA 3EYUL 1D2OA 3Q05A 3OR7A 4NT6B 3D69A 1NDMB 4F2ME 1HEHC 3GIZH 2X2JA 4JPKH 3JVFC 2YPLB 3HUSA 1K3IA 4L0PB 3CC4P 4LFHD 4QRRA 4L37B 3PDOB 1W72B 1WICA 1KPUA 2O5XH 1KACB 2WXGA 3NEXA 3VGDA 4MMYA 4NSKA 4JGJA 1UASA 3B7YA 4LQFH 5F7UA 2F5BL 4NWUH 4P57B 2ZOUA 3UTTA 1MFZA 4RZKA 2Q8AH 1T3FB 4OF7A 4J3TA 4WW1B 4NZUL 1JGVL 2CO6A 1TU2B 5F8RC 1BAFL 1I4FA 5AVZB 3QJZA 1FV1A 3RDTC 2J88H 3L73E 4GW5B 4JFPB 2H45A 1E3FA 4JFFD 3ZRFC 4G72B 4PVNA 2MKWA 4LK4A 3M1BB 4CVXA 1V7NH 4KKBC 2IAND 4NUPA 1JZ3A 3RTQD 4XNDA 1YRKA 1JTPA 2C1OB 4XCNB 1VFOA 4AUWA 4HBCL 1YUKB 4NCC1 2DZEA 1OZHA 1J88A 2K9JA 2E42A 4LLVB 3CFJA 5GGRA 4TULH 5JPNB 1B4JL 3TYFB 3VFGH 3DC0A 3BWUF 5FA4B 5FO9B 4EIUA 5I5MA 2FB4H 1D5IL 3GRWA 2YO2A 5DHYA 5E6IA 3SCMC 4YDKL 5TF1L 2B08A 4NC2B 3DURB 2BSDA 2EYRA 3VMAA 3DGGB 4U1GB 2JNZA 3LEXA 4J3OF 3BLKA 4OGYH 1AHWB 3VE0A 3QP3A 2PTTB 4Y9CA 3L4FA 3HZYB 3GXDA 3HHSB 4U33A 3KR3H 1H6EA 4B96A 5B39B 4IMLA 2WKGA 3FQ1A 4L4TA 4LMQI 2QPEB 5F88A 2QZQA 2CM5A 3L73G 4ZMQA 1T83A 3P0VH 2Z31B 1EQ7A 1VQ4P 1IGTA 3UTSD 2ODIA 4FFYH 3NK4A 1E30A 3KPRE 4AVHA 3ZDZB 3SDAD 1AQMA 1KXTB 3KHOA 4Z7OE 1JGDA 5GGUB 3N9GH 3CFUA 4TOYL 4Y5VA 2VT0A 1OLLA 3HS0A 1M9SA 1UT1A 1U8LA 2GI7A 3VWKB 5EU6A 3CCRP 3IS1X 3HFFA 2ED6A 4JZNA 4BIKA 2Y7SA 3UIZA 1L3NA 2WO4A 5K9JL 4IOFC 4E41B 5TE4H 1C1EH 1O0VA 1TJMA 2A99A 2XACC 4PJEF 3SDXB 1HZLA 4MA8L 5IVZA 4BQ8A 3CMAP 3EYVA 4FNPA 2G2RA 3IT8D 3PXHA 2VNCA 3VXUA 2FWSA 5KBPA 2NY4C 1GC1H 5D7JC 2X6BA 2DQCH 3LRLA 3KZ8A 4LCWA 1IBDA 1UFUA 2X4TB 5B3JE 2GUOA 4AEFA 2W9EL 4E9RA 4ZFQA 3LKOB 4DPAX 2Y5EA 1RPQA 4OQTA 2YPLE 3CFMA 4JFED 3D4CA 2C7UA 5FECB 3OKOB 1ETB1 1M6UA 2D0GA 2YMXL 5J12C 2Z4QA 1P84D 5AVUB 5EN3A 1JZJA 5L9DL 1SQPK 2XJKA 2PPAA 3H25A 2UWEF 2O6FA 4QGYA 5C0JA 1XEUA 3HRZA 2XZZA 5CN3A 1ACXA 1SJEA 1X9LA 3KWWA 1AZVA 4UT6A 5DUPH 4Z5RB 3SGKC 3EWKA 1INDH 4AWJC 1QLFB 1NLDH 1WEJH 3VSVA 1IGYB 1RP8A 4IGBD 3GMRA 4P5TC 2OSWA 2WBJC 3FSZA 4HAFA 5HP5A 2AQNA 3VX1A 5INCA 4J28A 3IDMA 1KQLA 3FT1A 3GPEA 4PRAB 5EG6C 1SFDA 1DSFL 1S3KL 1GYAA 4KTEL 4HCFA 4ODBD 4ZW6A 1YMMA 5I2IA 1HJBA 4DZ8B 4Q9QL 3SSUA 4LCIH 3CSBA 4HU8A 3H85A 2PETA 4NQSA 3SPVB 2ZKMX 2HUHA 4PWKA 3BKJH 3L3KB 2Z0BA 1LGHB 4CKQA 3GIVA 2A77L 2PCFB 3FONB 3G5WA 3CH1A 4CDGC 4N0UE 3UZQB 2HG5A 4DSYA 4LNVA 2P5ED 4XCFH 2VLME 3Q1SL 1TVBA 1SN0A 2GABA 2ZOWA 3KVPA 4M61B 4GG6F 1IC2A 1H3VA 3BIBX 4ZUWA 3ECVA 4R4FL 2R2EA 3H0TB 1A6PA 4XMPH 3HFML 1IARB 2R4RL 2DH3A 1LK2B 5L6YH 3A6CH 2B88A 3CFCH 3LS5L 4K5LA 2XT1B 5E8DL 2FD6L 2X4QA 1VCBC 2AJVH 3C5SA 1U58B 5BZDB 4ZNCA 1CFNA 3B5TA 5JW5A 1HNGA 2K1MA 2A73A 3SQRA 4TLSA 1Z9MA 3IFNH 5DRWA 4ZMNA 1UWXH 4IHOB 2J5LB 2UVEA 2NY3B 4YHOL 5TJWK 2KNCB 5IHZB 1NEZA 4EN3B 4LLMB 3N43F 3C6LA 5SV3A 2ATKB 1R33A 4LF3B 5MERB 3ZDZE 4DETA 3P73A 5I0WA 3M88A 4XOAA 2IO5A 2ICCA 3RZCB 4TN9A 5GGSA 2NZ9C 3V6BR 5C7ZA 1BIIB 4B3EA 5ACZB 1TDQA 3CUPA 3GC3A 4MMXB 4OKDA 1CICD 1FFNB 3CXHK 2EO9A 3G6DH 1JRHL 2J6EA 3HD7D 2QLYA 3BPOB 1OAUH 1KZQA 1ZHKB 3MRDA 4N5UA 2DWEB 1I3RB 4MNGE 1RK7A 1WHOA 4WU7A 2OYHA 4Y7OC 5IKCB 4XRCB 4E41E 4YPCA 3LKRA 3BE1L 2IPTL 5MEND 1TCRA 1OSZA 2XWBB 3CK0L 2UUDK 3P69A 1S7WB 2TRYA 2AK1L 4X7SL 5MEPA 5DI8A 2EYTB 4P2RA 3AXHA 1MEXL 1ET5A 5DD1L 3ZE1B 1RZGA 2F7PA 1YY9D 3DYPA 3QXAA 3T2LA 1IT9L 3MOBL 4IRZL 4P49A 1C16A 4PJIB 4GQPH 3TK1A 1ZT1A 5HY9A 3ARFA 1H5BC 3PWJA 2VO5A 1NGQH 2EIMB 5BXFB 2DTML 1CLOL 3DIDA 4GS7B 1NU1D 5J13C 5DJUB 4NQCA 5E7BA 1KNOA 4O2EB 5B39G 3TBTB 2W90A 3JTSB 3ES6A 4BQCA 1QL2A 1TJIH 4PBXA 2ZKHL 4P4KD 4UIKL 1QI3A 3OPZH 4OZ4B 3VAEA 3KYNA 4MAUL 1G7IB 4I7ZC 3TN0A 3G6JF 3I2CL 4H26B 1JGUL 3SYQA 2ZCLH 3V6OC 4UU9B 4OD2A 2Z7YA 5BUPA 5CGTA 3CNKA 3GI9L 3Q8FA 3UCRA 2ORBL 3ZUNC 2FJHA 2BJML 3VFVA 3WJJA 3DMMB 4TTDD 3ARRA 1TKWB 2H5UA 1K8IB 4QHUA 1SN5A 5J6HA 4X7EC 3EYFA 4ZK8A 1T0PB 4QDGA 1RJCA 4P06A 1EDJA 1OTSC 2JV6A 2X4UB 3CVDA 3O45A 4IRJA 3ZZQA 3LKSB 1RK1B 3RIFF 1N73A 1ZDSA 5T1KB 1UXSB 4OZIF 1KXQA 4P2QB 2AC0A 3M86A 1HOCA 1IKFH 2BERA 2EDKA 5HD8D 2GY5A 3LN9A 4YAQA 4I13B 3BZEB 1OK8A 4ZTEA 1E6OL 5DD0L 3LVTA 4BE6A 4G9FA 3CWBE 3MUHL 5GGTH 2WY3B 4PJGE 1SHSA 4AIOA 2HWZL 3PGDB 2OXHB 1S78C 2WPGA 5I1KH 2JWYA 3IGAA 4NS0A 2Q7YA 4CC0A 1YEJH 3D3VA 4PJ5D 1J0HA 3W68A 2OXGA 3F58H 2OW7A 2I9TB 2G5RA 4FZEH 3G3ZA 1RUMH 3M9HA 2OZNA 1KENL 3RAJL 1PTZA 4EIJA 1U3YA 3NGBB 1S9YA 4XN7A 1R24A 1TTBA 1RK0B 3C5JB 3VWJC 2DMHA 4B7LA 2J58A 2R5DA 2A45H 3OBAA 4HBQA 3APDA 4ZMXA 2ATAA 1ZS8B 4WI2A 4XNZB 3MLWH 1I8IA 1WF5A 4IFFA 4P48A 2GK0A 2YR3A 1EZVI 3QUZB 1MAKA 1FG2A 2WLLB 3N5AA 3AEDC 2X10A 4GQQA 5CZVH 1CI6A 4H2CA 2MPAL 3FAWA 5IR1B 4G7YH 4GKOA 1UGKA 1ZMYA 4FFYA 4WWKB 6PCYA 3MGTB 1S9WA 3TO2A 1DUYB 3JCUE 4BHUA 3F7RA 3KGUA 1P84J 3B3IA 1R34A 3U6RA 1XH3B 4ZUVB 4TVUA 2NNCA 4ZODA 4EQ3A 5G5DB 5KJRL 3BZ4A 3SDYH 4BHUI 4GSRA 3QH3B 3GJEA 5FOBA 4PVBA 2FJSA 1FH2A 4JM2C 3CWBG 3MLRL 3E8VA 3GSWB 4B86A 5APQA 3KPTA 3QWNA 3FW6A 4Y9EA 1UXMA 2AXHA 1A02F 3EFDL 1Z66A 3GHEL 3ZDYB 3H1JE 2V17L 1LEIB 4FHJA 4XPAH 4WSGA 3EOAB 3HG5A 1E4KC 2EYSB 4NN5C 3RGHA 3U36A 4H13B 3L75E 1NINA 1FLRH 2OMZB 3HG0A 3II1A 5HDWA 2JB6B 1XGTB 2CU9A 3LW5H 3S4SA 3KPOB 3DTXA 2EDBA 3H3PL 1MUUA 4KJMA 2V3DA 3GZPA 1J9RA 5F0JB 4N8PA 1TZGL 3BFOA 1J2JB 3B7UX 1AIFA 2BNQB 1X79B 1SNRA 2G3MA 4J3OH 4PP1D 3QUYB 1PKOA 1SM3L 1R3KB 3FQRB 4LSVH 1P9MC 1L0XA 4AEHL 4X50A 4EXKA 1EXIA 5K9OA 5IVXF 4JQ0D 4Q6YA 3LB6C 3WAJA 1H6TA 2CKBB 4Z8FH 1MCFA 5G2NA 2VH5L 4GT1A 3TEYA 4J4PC 2ZXBA 2VSCA 4I0PD 5C0BD 2OCFD 1CZ8H 1EK3A 1XCQB 4M8UA 4P2QE 1RJZB 4XGZA 1OPGH 2OARA 2W59A 3QIUC 3V0JA 4QXGH 5DS8A 1MCOH 1THCA 1RHHB 5I8EA 3W1ZA 4G5AA 1O6VA 5FA3A 3UAJD 3CZFB 4D0CA 1VKXB 4WWNA 5BQDA 4D0DA 1FO0L 2XQBH 3IJEA 4R4NC 5DZ9A 3UO1L 3H1JG 1M57B 1MCRA 1E7UA 4FQ1H 2HRHA 4ELKA 1F11B 3WU2H 2EE2A 4HJGB 2GBAA 1TCMA 3MLTA 3FRPG 4ZFGL 3I9AA 4S1SH 1Y6KR 3VXNB 1MHEB 1KILA 1N9PA 2X0WA 3NOIA 3L6FA 5A6IA 3L75G 2DLGA 1JE6A 2JQAA 4FQJH 4JFTA 3UG3A 1ZP0C 3JYCA 5EBLB 3GO1L 1F3DH 5F7LB 2H1PL 2P46B 4FDWA 3QA3B 5F7WC 4U1MB 2WD0A 4M1GL 4POZC 1KZYA 1LL1A 4G8GA 2GUYA 2ZUQB 1EAQA 1EAOA 1M56B 1PZUB 2V4LA 1K6QL 2O5YL 3P11H 4Y1AA 1GMEA 3BVNB 5DUML 3CC2P 3VXQB 1PFCA 4JO8A 5EC1A 3FL7A 3RWGA 1U95A 1MF2L 3IMRA 3TZVD 3KYOA 4MCMA 2PCXA 2QV2A 3B6SA 3HNSL 3RHWF 5BVJB 3X3FL 3B56A 5E94B 1NTZJ 1VESA 1OHQA 2D3LA 5CUSH 3RVXD 1Z3RA 4NJAH 5E1AA 1F18A 1EC5A 3ZGIA 4DP8X 1G7PB 1LP9F 2D2OA 3C09C 2AF2A 3OQRA 2CO7A 1FORH 4JB9H 4PV9B 4W6WB 1VGKB 3A4AA 2BCKA 1MFAH 1ZMEC 2HPOA 2QEJA 4L48A 2E4TA 4KBPA 3HA0A 4GO8A 2QFRA 3ARUA 2Z3FA 3HS8A 3L8QA 4JKPH 4CADB 2JB5L 4OGQC 3CFNA 3DETC 2WVSA 1NU1J 1NGZB 3B2XA 3NIDF 4NIYE 1IE4A 1NAMH 2G2PA 4LSQH 2Q9IA 5LJYH 4L8SB 5CCJA 3RTQC 3Q8AA 5CCGD 2IIJA 1A7RL 5ESQA 4NNYA 3ASOB 4MMZB 3PWVA 4H8PA 4A66A 3WSQH 4P4RB 2I07B 1GPOL 1AXTH 2BX5A 3FXEA 2WKOF 2JJTC 2YPKB 3HLKA 3NZ8B 1CFSB 4HC1L 4TSCH 1UZ8A 2WZPA 1FZOB 3ZDYE 1WZ1L 3VSQA 3MLYH 5L4MA 1T20A 3IJ7A 1JHTB 1IFGA 3SJVA 1N8ZA 2GTWB 2HJLB 2X4SA 2JKLA 5HGDA 1N18A 3WIHA 5AG9A 1M8OB 4N2FA 2XU6A 3C6SB 3MRCB 1ZLSH 3VD4A 4K94L 2BY0A 4U1LB 3MR9A 1ACYL 5A2JH 2PN5A 1SQBK 4NJ9L 5ETUA 3P1VA 4L4TD 1K4CA 4HHAA 1UB5A 2BNQE 2IADA 2K0RA 3F7YB 5KVEE 2N1TA 1LO5B 4Y1SA 2SODB 3IS0X 4AH2A 1NBYA 3CDGB 3B5NC 7PCYA 3L71D 2B87B 3CVBA 3QYNA 5EZPA 2P4AB 2X4RA 3U46A 1OZUA 1HH6B 3M17B 1N7SC 5DEGB 4NQTA 1DDHA 1RZPA 1I7UB 5D1ZB 5EU6D 4F7MA 1P4UA 5DD3H 3INUL 4DGIH 4HJEA 2J71A 5GZOA 2EIZA 4MZIA 3IMBA 2ADJB 3KEDA 4F9PA 1JTHB 1R5SA 3GLEA 3VI4A 1R3JB 3EYSH 3HUJF 3FTGB 2VXTH 3VXUD 2A38A 2GTQA 1UD6A 1KQGB 3C5ZC 4QR7A 3V5HA 2K3HA 1S9VA 1T2QH 3PLNA 2WJ7A 2PYEE 4PGDB 4LCWD 3KWTA 2X6UA 2EIKB 4ZUSB 3PWLA 2LTQB 4YO0B 4LCCC 4CC4A 4BXSV 4DNLA 4DP2X 1QSFA 4K9EC 2XTJB 4L1DA 4N3TA 4JRXB 4XVTL 2R3SA 4AKQA 1FGVH 2GIXA 1HGVA 4TQIA 2PUQT 5DJAB 1IZNB 1NH4A 4XMKL 3TNUB 4XMLH 5DXWA 5C09B 3US9A 2H6UA 4A39A 3QG6A 3WIFA 3PAYA 9CGTA 1KJMB 1M7LA 3N42F 3K74B 1NA8A 1OP5K 1IGFL 3QPQC 1QWUA 3BVWA 5AZUA 3HNVH 4OCSH 1P6AB 1IC5H 4DVBA 2W0LA 1WCBB 3VRJA 1KBKA 3QDJA 4H8WC 3CX5E 5GGTA 5BW7A 5F3BA 2BHZA 4Q0XH 4ZFFB 1A6VH 1E4XL 4LSUL 3G4SP 1X7QB 3NFPA 4EAEA 4ZMZA 4YZFE 1RFDH 2QQKH 3WS6C 2OQQA 3PWNA 2YSSB 4IGBC 2DD8H 3DIFB 2R15A 1YMMD 4ZQKA 3KYMB 4R7DB 5GHWL 1R5IA 1I1AA 1KJVA 4JLRB 4LU5L 1G1IA 2WQSA 4UM9A 3CFQA 1TYJA 2HRPL 4DOJA 3UJJH 4H8VA 3B9KB 2QJKB 1S9KE 2QQLL 3RU8H 3GGWB 4L76A 4OJAA 3VXRB 2HG5D 1URLA 2XX1A 1LHZA 3FZUD 3VXSD 4YMPA 4NENB 3WXWL 1V27A 2XLLA 2A45I 4E9SA 3QEUA 4R8WL 4B9JA 3GBLA 4WI7A 1HEZB 4TLFA 1KWKA 1J0ZA 3E80A 3AADB 3L3IA 1E6JL 1IFRA 3BYTA 1IL1B 2BW4A 2HAZA 3H1LD 1D6EA 4A6YL 4KMQA 3KPNB 1MIEH 4YIQA 4YOKA 1VA9A 5DMKA 3L2NA 4TVPD 4AMWA 4ZNCD 2HR3A 1YY8A 1HIML 1X5HA 3QUXB 5A2BA 5C0RH 4YHYC 2FCBA 1H0TA 5T3ZH 4UAHA 1TQVA 1NC2B 7CGTA 4U1IA 4DCQA 2KSEA 4IL6H 4Z3TA 3MUZ1 1PEWA 1J1DB 3FB6A 1RUAL 3EJJX 4NQVB 4ZKUA 3WNOA 3IKCA 2GA1A 4QXVA 3D39D 4ZNEE 3C6LD 1Q72L 3OHXB 4YSRA 1CFTA 1MI5A 2W88A 4XC1L 2E43A 2K4WA 1RPUA 3DVNB 1LE9A 1BFVH 2OZ4L 3O3BA 3VM7A 1NUNB 4RBPH 3MC0A 1T04A 5TFSL 4RGOL 1N10A 2WXIA 3ULUE 1UOLA 3A5VA 3GMNB 4JDVB 5F70A 1MZYA 5I1HH 3MCLL 3ZDMA 4HMCA 4NQXA 2JCCB 2W6JH 2DQHL 4RAVA 4NZJA 4LIQL 2Q8BH 3T97A 4BRYB 5KYYA 1EA9C 2AJUH 3MBWB 4P2RD 1WAAF 3CFBA 3SKNB 3VB9A 3VFNA 3VVVA 1J5DA 1BIHA 3OGOE 3AS3A 1DQQA 5E99L 2XETA 3I55P 2VDRL 5EULV 2Z4TA 2DYPA 1EJ8A 1JV2A 3O4LD 1XSOA 4KXCA 5EPMA 4TXVB 4L0YA 1AGFB 4FI6A 4NUGH 2XTJE 2IOMA 3GSOA 4JRXE 4KXZH 3SKJL 1JS4A 1PGPA 3ARFD 5C08A 2WXNA 4IRSD 1FS0E 4UQ3B 3L72E 3OKDA 4FQIL 3B7TA 2YRPA 1ZDQA 1JFHA 1YY9C 1Z1WA 1FDMA 5T3XD 3P4OB 4PJ7F 1CDGA 5C09E 3WJMB 1F2QA 1XGQA 2ARJA 3FF7A 2R8SL 5GJSL 1QPXA 3RA7L 4MA7L 3H3KA 3PP3H 1CLZH 4AT6B 3VMZA 5I8CB 4WU5B 2V7NA 2V5YA 3TWYA 5ILTH 3MBXL 3D8MA 4N2GA 5EA0L 4PJEA 3VJ6B 1MLBA 4PJ8A 3TN0D 4E9VA 5CZXD 1SBSH 3V4WA 4RJTA 1NM9A 4WGVB 5IM7A 2XUWA 4ZUUA 4U6TA 4HXBH 4MXWL 3ARYA 1JAEA 3DBXA 2F53B 5I6PA 1MV8A 3VMPA 3W2DH 4R4BB 4AGOA 2VLJE 3FU9A 1GZPA 5ERWB 1TOXA 1G7LA 4QKTA 4KV5F 1NJ9A 3L5JA 4V1DB 2IXQB 4RGND 3X1NA 3PHQB 4KUCD 4LPTA 3T6WA 5I74B 1KEML 4IIQB 5KAQG 4IRJD 2N7AA 3CCHB 3OB8A 4H20H 3EDKA 4WI8A 4XNBA 1BG9A 4AYBA 4NZTH 2PP6A 3VXRE 2UWEA 2MQGA 5FYLD 1QWNA 1VLXA 3SKMB 2VIRB 3T1FB 3P7KA 1HQRB 3L72G 4AL8H 5DQDH 1ZTXL 2X1QA 1D7MA 4X6CB 1BLNB 4X98B 3VFSA 4G7SB 1E90A 2Y06L 2W8CA 4RISL 4FMVA 5KVFH 1NAMA 1Z0NA 4BH8B 1JMBA 1M2OA 4E9TA 3QJRB 3KHQA 3LZOA 1B0GB 1OAQH 4AM0B 1HHHB 1HILA 3ARDD 5IG7B 4FA8A 4OCYH 1PKQB 2WXHA 1HHGA 4KVCH 4NHUB 3D3VD 1E2ZA 4Z76A 1VENA 4G59C 1Q0YL 4JGUA 4HOZA 1SGKA 4OLEA 1KZUB 1MAJA 3VSTA 1U3HD 4OH2A 1CU4H 4LP4A 3K7UA 2XVKA 3W0WA 1BMZA 1JMXA 1LTJB 3N4XA 3PLYA 4A68A 4GAYB 4PD4K 1BZDA 4HFUH 1EZVD 2IH3B 2YARA 3DXAB 4XE0A 1NOAA 4ADGA 4GAJH 4GG6A 4AJWA 3TESA 1EDLA 3O6FD 2IGFL 3J7HA 5IZ7A 4NFBA 2XG4A 3QZMA 2PPFA 5IMOB 3AAZB 4KKZA 1GOFA 4A2EA 3R06A 3MNMA 3ZT7A 1J8HB 1WLHA 4X8XA 1SQPE 1HTYA 2JCCE 3WNKA 3QEGH 1FZMA 2VL5B 5KTEH 1HXMA 2VC2B 3WN6A 3AEGC 2B9BA 3V6FB 3ZYJA 4DESA 5HYFA 3GMQA 1F13A 5ICYB 3MNZA 4AEIH 1ZT4B 1YSOA 2FJGA 2ZKWA 2Y3NA 3NTCH 3BDXA 2G0LA 3HCVA 2EABA 4TS6A 1W15A 2YIUC 1MLCB 4BUGA 1KBGL 1HVVA 3BRFA 3V5DB 1U9KA 1OAJA 4QHMA 1XF5A 2WV3A 4X4XB 4XCEA 1UD3A 2J72A 3TYGH 4DP4X 3GXPA 4L3AA 2EVHA 1Q1JL 1QYGL 2A6KA 2NRDA 2PR9A 1N7SA 5EBWB 4PLKD 5D1XD 4D94A 2JJUA 4HPYH 3RB5A 4G83A 2K45A 3EHBB 4HUWA 3HZMB 1OY3B 2VTFA 4OD3H 4TKWA 4QPEA 3UCQA 3RFZA 1HYRC 5AW8B 4XNMA 4DZBB 2O93L 1CBJA 3ULSB 4HGMA 3SD2A 3CVHB 4KQ4H 3HG1B 1AD0B 2EDEA 1MWAB 3C5ZA 1JCVA 3IFMA 3M0DA 1UD5A 2G9KA 3JT0A 4GI8A 4PWEA 2ZXCA 2VDKB 1OSPL 2P47B 1MCLA 1MH5A 4YSQA 4IJ3B 2F53E 3GXIA 2ZNWA 2G4EA 1ND0B 4G8FA 1BECA 4LCCA 5DA4A 3U79A 4C4KO 2ZX7A 1OW6A 2CLVA 1Z9SA 1KFNA 1SQPG 2V7QJ 1BSIA 2QADB 4WO4B 2Q6WB 1AI1H 3QWOC 1G1OA 3LRKA 4N22A 4V1DE 5E1IA 1JGLH 4PP1C 4ZSOB 1K8DA 3RK3B 3T3PB 1JY3P 2VZUA 4F5CE 4OJEH 4RGMB 3KMDA 1QI4A 1SMDA 4MCYA 3H1LJ 2QSIA 3P9LA 1FUNA 1JVOA 4TRPH 4FADA 1RMFL 3GXTA 1O6SA 3D87B 2BZCA 1PZCA 4ZW7A 1AGDB 3LV3B 5I1GL 3DUSB 4GKZA 4X6CE 2AV1B 3G6JA 5F0PB 2CCLA 2IALB 5E2TL 3VFTB 5IHHA 2WQWA 3CXHE 4QRTA 1AFVL 2Q0ZX 4PGJA 1OCWH 1KILD 2Q7AA 4PRPE 1PG7W 4JY6A 1NAYA 4KHXH 3IFPA 4DVRL 3OZKA 5BZXA 1PKQE 3LEYL 5D96B 3AMLA 1U8HA 5ABDE 4XP1L 2Z35A 1LVEA 3FOLA 4NYLA 4E5XA 2YC1A 4Y19A 1M4KA 4R0LA 5A43C 3CC5A 3KPMA 4G6AD 1LWUC 2O6CA 1RZFL 3EDDA 3TU6A 1I8LA 1KY6A 3OAYK 3IGLA 1G9EA 3CSYA 4OZIA 3NAAH 4IHBA 1M7IB 3S88H 1ZWIB 4K3EH 4LSTL 4HGWA 1OX3A 5IB2A 2FR4B 4QNPE 3DXAE 4PVMA 3QEQA 1KCUL 1N59B 1RZ8A 5APYA 2XCMC 3NUKA 3P4NB 4YDVB 1DJGA 3GJFH 4JFYA 3TZVC 1VQPP 1J8HE 4XXDB 1H8AA 4PP2A 1IVLA 2APSA 3E9UA 3OF6A 2CK2A 4RX4A 3RVXC 4CVWA 4M8QA 1I7TB 5D6CB 5AVRB 4AZ8B 2B1HL 3IETA 3MUGA 2DDQL 3H42H 2NPSD 2A6IA 3UZVB 1KIUA 3IJHB 2VDQH 4YDIH 1KUMA 4OLYH 4U1HB 3LZNA 4D9QD 5L2JA 4Y99B 2WTRA 4PGBA 3D18A 1SJHA 1CSBA 3DI3B 1BCIA 3U1SH 5F7BA 1KN4H 1KORA 1KLFB 2X9YA 3BXNB 2N7BA 1KGWA 3MRBA 5F6HI 2W6BA 3MRMB 3CBRA 1FZCC 2QQNH 4KO6A 2XFGB 4CGUB 1FBIL 3B9AA 2WZPD 2CHXA 5CCGC 1GS8A 1IKNC 2DEYX 3EADA 3W57A 2V5SA 4PG9B 4X6DF 3ILDA 1AP2B 5C0IA 1JHKL 4GKSA 3SJVD 4ZMPA 2XZAL 2YUXA 4XVSH 3IU4H 3VQLA 4ASVA 3LMJL 4WDIA 2DYSB 4F15C 2E86A 3CFKA 5DJ8B 1BVNT 3ENEA 3KJ4B 2G75A 5F8QC 1KB9I 2VABB 3SE9L 5CJ0A 3VFOA 3HG1E 3NJNA 4XHQA 1Q9WA 3MOAH 2DLFH 3SIKA 1EFXA 5E2WL 3KXFA 1YN6A 1Z3GH 2N1TD 1NTKK 2HLAB 4KXZI 3EBGA 1YEHL 4DIXA 4M6NL 2R44A 3MJGX 3RWCB 2IMMA 1VADA 4KKAD 1BQHB 2P8LA 3VB8A 4ZSOE 3FQUA 3RK3E 4N2KA 1FL5A 3WFCH 1S7QB 5DJXB 1RH5B 1RERA 4MVBD 1YNTF 2BY2A 5ACMA 5GZOD 2XPGA 5G4MA 5H2BA 1AG0A 2YMTA 1JBJA 4XC3L 4PH8A 3X17A 3L1OL 2QMKA 3PJSK 4PTTB 4PRHA 1UH4A 3C5XA 3EH3B 3FUFA 5TGBA 5AW5B 1P2CB 5J6GB 1QR1B 2ADFH 4NPYB 2VXQL 2WNWA 3P30L 2IC2A 3CZKA 1F90L 3F2LA 5DSCA 3J27A 1EDYA 2LABA 5PCYA 4IBVA 1QSFD 2CD0A 2UZXA 3V0GA 1PMYA 4XHJD 4GFXA 4TSAH 3TH2T 5BRZB 4N6RB 1XTMA 2WQVA 1GR7A 4PV1D 2BXYA 3HB3C 4Y7MA 3ZKXB 5HHPB 4K73A 5BMFH 1TJGL 4MJIA 5IVXA 2BSBA 1VF5D 1PG7X 3IF4A 4Z3FA 1MOEA 3IK2A 3BKYH 4MD5A 4ODWB 4U49A 1MJ7L 2NX5A 5KSUA 4F37F 5D5MB 1UIXA 2BIMA 5DLMH 2ROXA 5KLVK 1CFVH 3LRGA 5DHVH 3GW6A 3QDJD 1KJ3L 2IX7C 2HFED 5TQ2H 4ADIA 4OIFA 1QW8A 2YD4A 2ZXGA 3CZLA 3N1PC 4UUJB 1ZK5A 5JOEA 4OGAC 1GL2A 3I9GH 5K1JA 2IVFC 3NCYS 4UNVA 4NRZB 1BVZA 3C60D 1RQ5A 2WP3T 5AB0A 1RUKL 1WGVA 4PGZA 1KFGA 3GUTA 3T65A 4BZ2L 4GJTB 3Q9QA 4OCWH 1I1AD 4Y4KB 1EXHA 3DX6B 4NO0A 1ZHLA 4X5WB 4KDTC 4UM9D 4RAHA 5HI5C 1N70A 1DUZA 2XWXA 3NJJA 4Z7OF 3TURA 3LZRA 1M90Q 5DJZA 3MRQB 3LPOA 3MROB 1F4YL 1B3IA 2BVEA 2V3EA 1IGJA 2R0KL 1ZVYA 2NMSA 5DK2B 2E74C 3O9WB 1WJ3A 1MRDL 2A9MH 3IRPX 2BP8B 5HGHA 3BAEL 3KW7A 4PW9A 2VDPL 3ESVF 2CDEB 4PLNC 1M6OB 2A1WL 2HFFA 3HI6L 5IHUL 4HZ1A 2YEZB 1LP9A 2XWDA 5I5JA 4AEEA 5E9DD 1CQKA 3BAKA 3GTVA 1KTBA 2IBZE 5EUOE 5C3LD 5B3JF 2IG2L 1EJOL 1DBJH 2FEDC 2YN3A 3ALPA 2F15A 4FNQA 4ICWA 5IMMA 5E8NA 1ZS2A 4MCZB 3RNKB 2W9LA 2WO2B 2YOAA 5EC2A 4Y5YA 1CK0L 4HX1B 4ODTH 5C0GB 1N3NA 1BJ1H 1HI6B 3RVWC 4G6JL 4D2NA 1N6VA 1WZKA 4XP9L 1RZIA 1UWFA 2OL3L 4ODVL 3FK3A 4W9ZA 2GHWB 1LTBC 3D85B 1AZBA 4JZJC 1B90A 1HSBB 1DEBA 2KS0A 2P26A 3WHE0 3BZ5A 3DA0A 5CJQH 1SXBA 5DFTA 1IVTA 1I7RB 1SPDA 3OAZK 2WKOA 2P5WE 5C7XL 1KY7A 2ZWKA 1HL4A 2BFGA 5J57B 4N3YB 3CPWO 5DT1L 3HVNA 1TMQA 3DUHA 1GU4A 5GXBB 4RQQA 3K80A 1U8MB 3GI8H 2V8MA 3V2AR 3T8XB 3MD0A 2NSMA 2MCAA 4K8RD 3Q5SA 5AKVA 2J1ZA 4BFOA 4YPGA 5BU5A 1FNLA 3O2VL 3HC2A 2E75C 3VGAC 1VFMA 2DYPD 2P24B 5D2NC 5DC0A 1JNHB 2WVVA 2XN9B 3FCSB 3O4OB 1KTDB 1JOIA 4TUJA 2YKKA 1UM4H 2IWGA 5C08D 2F54D 4GMTH 3RI5K 4ZDHB 4MQSB 5EOTB 5C6WH 2IBZG 1TIUA 2FGWH 1HESA 4RDQG 3TVMB 2PO6B 4DKDC 4NQDA 4G11A 4YHLL 2FL5A 5I71C 4WUUA 2WZ0A 1BAGA 1CE6A 3S5LG 4YDJB 4TF4A 4NCC2 2AQ3A 3O11A 4HIJB 4Z95H 5D5ME 4TLKA 4JE4B 1D5BA 1BWMA 2ENSA 5CEZE 2BSRB 4XCYB 4D9RE 1GGUA 5KAFE 1BQHG 1VQLP 4LPXA 3W39A 9PCYA 4PJ8D 3FUNA 1BYPA 3HUJA 4KRMB 2CBPA 4KHXA 1MAMH 4J27A 4Z7UA 3GBML 3KJ6L 8FABA 4DHLA 3W67A 3NQIA 4HUCA 1PJWA 1IILE 1RCYA 3KLKA 3L35A 5HGAA 1NC4B 5ITFB 1DEEB 2J8OA 2KI7B 2D4DA 3FB5B 3L13A 2K9YA 4X7TA 3E1RA 4XPHH 4YHZL 5LCVH 1LJ2A 1MFMA 3ZDZF 1VQ7P 5FKPB 2BOCA 3UBXG 2WVRA 1NYHA 4RIRB 3TWCH 4OGXH 3QCTL 5DRXA 2PR4L 5HJ3B 2IPKA 3GJFA 4XA4A 4QOKB 5E2UL 4ZPTB 1A1OB 1EO8H 4UINL 5ID1B 4FD0A 2EACA 1OO2A 3F83A 1RPKA 4IDLA 2AQ1A 3PH0A 4IKIA 4OZFH 3SDXF 3PPEA 4UNUA 1AVOA 2XIDA 4MKTA 2YQ3A 3EJZD 3O3AB 4OKVB 3UP6A 1MY5A 2BIIA 3WENA 3GRWL 4JFHD 3PAUA 4Z77B 3PL6A 2R9HC 4F57L 1AR1B 3HPJB 2W0FB 2KK7A 3BEVB 1KV4A 3C9NA 3ZY7A 1YMHA 3GF7A 3L74D 2DEXX 2I1KA 3VD5A 3WG7B 2NY0C 4CKVX 5E51A 4X2UA 2X4NB 1YEKH 3M6DA 2B8OT 4ELME 4Z7NB 1NCIA 2EDYA 3MPCA 2CGRL 4IEFA 4IU2B 12E8H 3TX4A 3NZHH 4NI6A 1E4HA 4BRJA 4XO4A 1GGCL 3C8KA 2H1XA 1FZKB 2NYYD 3ARDC 3W0WD 1N64H 1K73Q 1YEIH 2GBTA 4GO9A 2QHRL 4J2QA 2B5IC 3ZZLA 1M1XB 4OJFH 4P5KA 3FT3A 3VG0H 3EO0B 3JQOB 2YGPA 3HTLX 4U7KA 1ILSA 3VG9C 1NFKA 1KYOH 2VW4A 3GWJA 4M1CC 4PIRF 4QT5A 1FZBA 1U3HC 5FB8B 1N7ML 3C87A 3S37H 4G1EA 2BVQA 3TF4A 2ZIDA 3QNZB 2HRLA 4I1LA 3QUMB 4PJ9B 3L5WB 3MGAA 1OHZA 2AI0H 1DE4B 5CU9A 1M42A 1UA3A 5K9KB 3BP4A 2X70B 5I18H 3T2OA 2BMKB 3JTTA 3ZMEA 4AC4A 2B7DT 1EEYB 1F00I 3O41A 3QFJB 1ADQH 3OHMB 3MRPB 3S3BB 3T0BA 3UIAA 1ZRTD 1DVFD 2BIQA 4EUPB 2CIKA 3QIWC 1DJXA 2XN9E 2V7HA 4F27A 5J5EA 3FO2A 2N9BA 5I5IA 4GBXC 1VQOP 5L2KA 1FFPB 3TF5A 4MYWB 2OMYB 1XX9C 1NKNA 2CPUA 4K3JL 2IDBA 5FFLA 1F4XL 1IQWH 2PXYB 4TUKH 3H32B 4UQ2A 3BSHA 3HMXA 5AOLA 1QEWA 5CCHC 5GJTL 3H7BA 1N0LB 1NCBH 3A4FA 3APMA 1LQBC 5B66E 2AQ2A 3LH2H 1M53A 2NXYC 3JV5A 2GBUA 1CBVL 5D1XC 3M8OL 4G42B 4MQXD 3ZZSA 1Z9LA 1WBYB 4YXWH 2CO1A 3EO1A 1L0NG 1GC1C 3SEPA 3TNMB 3CXDH 1YJDH 4FTDA 4GIPD 2X9XA 1EZLA 1SDDB 1WAAA 1ZR2A 3MLUL 2C5DC 1A6TB 4M43H 3RGVA 1RF1A 1KLGB 1L9SA 2ZYAA 2V2XA 2VWEE 3FS9A 4UQ9A 5AKRA 3LQAL 2X9WA 4X7DC 5B38G 4UT6L 3KM1A 1I9RL 2O6PA 2ZCKH 4P23B 5FDWA 2ZWNA 3U1CA 4N2DA 4Q6KA 1KPVB 1WO2A 2C34A 3GMPB 4BK5C 5F21B 2X53A 3TPUA 4N90E 3ULAB 2C9XA 5DR5L 4YPJA 4OV5A 2NY5C 3WHXA 2YGNA 3CDYA 2WXKA 2XZQH 4PJ7A 1P4IH 5ESAA 1IQDB 2VM4A 4M6OH 4FI8A 1Q9KA 3RL1B 4GFTB 4H44B 4JG0H 1GDTA 1JGEB 5I1CL 4I88A 4F2FA 1KPUB 4FZ8H 4WJ5B 5CR8A 4MMYB 1XGYL 4KI5F 4UT7L 5FHAH 4L8DB 4UV4H 2Z64C 2HVJB 4TPRL 4O51A 1DSYA 5D4HA 4GOFA 1U6AH 1NBZB 1JNMA 1U30A 1OANA 3MLSL 3NTNA 1QACA 2OJEA 4L4VB 1IV8A 1XB6A 4R96B 3RB7A 4EMZA 1OM3H 4XP6H 1OGAD 4I1NB 5ECJE 3U7WL 3ZE1F 5IGXH 2BVOB 5C0AE 2DM2A 5CHXA 1Y6MR 4PJIF 2MCG1 2DWYA 1H0DB 2AHIA 3G5VB 2WZAA 3LW5J 3UG4A 3V4PL 4TVPL 4BSWA 2VDML 4JPZB 2V2WA 4LAQL 4F80A 1GW4A 4KFMA 1FVCA 2CDGA 1FH5H 4PG2C 4F7CB 1JPGA 4ONOA 4DERA 1NMCB 5KJ7A 2E3VA 5E95B 1H88A 2YAHA 3QEQD 5HYIA 1DEEG 4G6AC 2CPBA 4FQLH 3D70A 2WN2A 3PWPB 2M3EA 3HE6B 1R0AL 4ODHH 3AWGA 2ZOTA 5DHYB 1ZA6A 4AQ8A 1U92A 3X1EA 4HH9A 4RX4D 1NIEA 1DBMH 2PWEA 2KLSA 2OMWA 1L4AD 1UXLA 4AKPA 4AQEB 2ZQKA 5HHXL 5HI4D 3TNNA 2JIXA 2P80D 3D25A 1XIWB 2D3NA 5E0FA 2NW2A 1I85C 2YXQB 4ZJ9A 1BZ7A 3UH8A 1RZ7H 1KEGH 3NSDA 4Z7QB 1GY1A 4PY7A 3HI5L 2NPSC 3KPEA 2KZWA 2VLLA 3ARBD 3PS6A 1GCFA 5EIIA 1BD2D 3QZBA 1A7PL 5DK0B 1PAMA 2H6PA 2Q86A 4JPVL 4M4RA 2NZ1A 1DVSA 3GEWB 4LOUD 5KJ4A 3WGUB 4P2OA 1FRGH 4LVNB 2XWJA 4ERSH 5KSVA 5M95B 1T5WB 2POHA 4GT0A 1ZLVK 4FYSA 1B4LA 2F74B 1ZANH 1HGZA 2FBWC 1UWYA 3BDYH 4WSKA 2HODB 5T3XL 5DTFB 2CJSA 2EE0A 1BOYA 3GRBA 1MREH 3VGBA 4M29A 5AEAA 1AQKL 4LPYA 4Y2OA 3USSA 1NAKL 1IFNA 4I2LC 3GMLA 5EU4A 3EYVB 4NWTH 2EO1A 2G2RB 5JIKA 1HHIA 1FPTH 1ICTA 4Z3HA 2WTOA 2WAHA 3ALWA 1YEEH 2JCWA 2YXMA 5CJXA 4XNUH 4U3HA 1GTWA 4H0LD 1Y18A 2OTUB 4EI5B 8CGTA 4TSBH 5AAMC 1J9TA 2O5XL 5JLZB 1C5BH 3D5OF 4OH8B 1RZJH 3LOWA 1XSIA 1OK0A 1T7YA 4EUPG 4KKAC 3H9SB 4LQFL 1W72H 3AREC 5ANMA 3SKUD 3BUYB 1HSAA 2CA3A 2MJZA 4NWUL 2APXA 4NKOB 2BSED 1FNGB 4OJYA 3LNHA 3F7KA 1AQHA 2Q8AL 2MTAA 4A2DA 3GSNH 4MVBC 3L74J 4FRWA 3TIEA 3H53A 3CFDA 3DTUB 5E1HB 4YXKH 2J88L 2ZUWA 4HQQL 4PD4E 4R3SB 1PL3A 2RMNA 5AB9A 3MSPA 1UCTA 3KPSA 2VXSH 4N26A 5FYLL 3OVUB 2H8PB 5LCVA 1MG2C 2Y7LA 1BE3J 4N6JA 3LVEA 3IJ9A 4L4VE 4MB5A 1V7NL 3SDDB 4Q9RH 2K9FB 4LLYB 3T0EA 1LE5B 4MQ7A 3BGFB 5DC2A 2VLRB 4KJWC 4RSVA 3VXPB 2IAAC 5D72H 1CWVA 1T0NB 4HB1A 1WUZA 3PFUA 4XAKD 4XZUB 3WFDH 1M9WA 1LDPH 1UADC 1BOGA 1WWBX 3ESNA 4XHJC 5AG8A 3U7YH 3CLWA 2WQAA 2JKVA 2NX5D 4Y4FA 4JS7A 4HPOH 1BZ9A 2CRIA 2ENYA 4OZFA 2CBOA 2R1WB 3QIBD 4I9WD 1IO4A 3O81A 4M93B 4TULL 3ZDYF 4DEWA 1LT9B 3VFGL 1GSKA 3TBWA 2C9AA 3QJFB 1G4MA 1P7HL 4PJBA 3JWOH 4NGHH 3U82B 1P4BH 1CUOA 4Y16D 5ITBH 1E28B 1JWMA 3VUAA 1A14H 3QCVH 2FFDA 5MI0B 4N9OB 5C07B 3CH1B 3BSGA 1GL2D 2YD9A 3ABMB 4P2CG 3PWPE 4WKXA 1RSYA 4QMAA 3CLFH 3OKEA 1ZGLM 2GIMA 2HG0A 3RYMA 1XAKA 5I76A 4OGYL 5I6LA 3A7OA 1NGYA 1UA7A 4S2SB 1CVRA 3PFQA 4J12A 4JMXA 1QBBA 2O5NA 4MBRA 4X6EB 5ES4B 2WM0A 3L3DA 2R69L 4KNTA 3VFPB 4FHKA 4NO0D 5A1AA 4R97B 3N1GC 2OMVB 2AP2A 2RIKA 3RL2A 3C60C 2VERN 1DVYA 5FW8A 4WV1A 1CFNB 3P0VL 5JHBA 1X5MA 4WY4C 1PGJA 4FFYL 2A73B 3UXFA 1GYVA 3BCFA 3O3DB 1KYOI 2I9LB 3L1GA 4RMWA 4CVZA 5EEWA 1IFIA 1YA5A 1FHNA 2OSLA 4O4YL 1MFNA 3N9GL 4Z0BH 4FQHA 4W9KC 4AV5A 2W81C 3RWFB 4YE4L 2OMUA 2WWOA 2L04A 2GJ6E 4TNVK 3W38A 2OAAA 3KDPB 2FYNB 3RK2B 4AYMC 1PP9J 1M1JA 1ADQA 2Z7ZA 3P73B 5EZLA 32C2A 4ADJA 3MNVA 3RQ3A 3IFOB 4X83A 5TE4L 1C1EL 2E76D 1Z5LA 3CMGA 3FT0A 2YKQA 2VN3A 1QHQA 1CD1B 3TGUE 2VYRE 2BSTB 1CB4A 2K78A 3NP3A 1BPVA 1TEFA 4YL4A 2FATL 1GC1L 1EXUA 1LO4H 2DQCL 3PJSB 5DZJA 5KANI 3NCEB 1GMIA 1P7BA 4LP8A 5F7EH 5J1AA 3QI9A 2WOYA 3WFEH 1XB3A 4PTUA 5KS9B 4JL1A 3K71B 3BZFA 3UJTH 3QFGA 4HG4J 3R0NA 4LNRA 2WCPA 4KK9C 2WQXA 4XPBH 4YS4A 3QXAB 4UZSA 1JXFA 4IIZA 3U0WH 1SYVA 1UTDA 4X6DA 4LL9A 4XP5H 3S4RA 1MCDA 2DWTA 4MCNA 3KLHD 2FT7A 2MKLC 1ORQA 3FU3A 4NQCB 4G7QB 2RJMA 5DUPL 3FH5A 5TPWL 4YHNB 1INDL 4EZLA 1P7QB 1BVLA 2PMZA 3RIAK 3UZEA 4ACPA 1NLDL 1U8KA 1WEJL 3IDNA 4XP4H 2VKXA 2WUBH 1AH1A 3JWDC 3RJDA 5AVVB 2ODHA 2IQAA 3AQXA 2F68X 3ES6B 1XGRA 3DYOA 3UGXA 4F2MA 4PGEA 1ZGLP 1Q1PA 1G7JA 1WBXB 4B0MM 2NY1B 5DUBA 5JYLA 1USZA 3CBJB 4ES8A 4YGVB 4K8RC 4KHTH 1UM6L 2Q3XA 2LHAA 4X80H 3ROLB 3VYPA 3P3SA 3ARWA 3G7TA 3GSQB 4NZFA 3UYPB 2VLRE 3WL9B 3GM8A 4LCIL 3TGUG 1O75A 5GS1A 2MOQA 2BNUA 4DGUA 2DL2A 4U0QB 5FV1L 2FJHB 2GPZA 5JDSA 2DN7A 5IQNA 5A2IH 2Q7NA 5E8PA 3BKJL 3H1HG 1YNTA 2VISB 5DWPA 1MCHA 4MX7B 3MMEA 1ECZA 3OTTA 4HKZB 4XCFL 1K2DA 3AQYA 2XKNB 3D2UB 1R5LA 4ZXBD 3HS9A 1W0VA 3D4GA 1TJHH 5C07E 2B89A 2YA2A 2XY1A 4P5RA 4PRNA 43C9A 6TAAA 5KWYC 5DJYA 1Z7JA 4AQAB 5L6YL 3A6CL 3CFCL 5F6HJ 2XZRA 4H7VA 4NNXA 4WFFD 3SDCC 3T77A 2YUVA 5DK3A 1ZVSB 2AJVL 2NYKA 3A21A 4AW4A 1IAMA 2BNRB 3KYKL 3Q6GH 3RDTB 3JV4B 2XOTA 4UTAH 1SFCC 3EZJB 4XAWH 2A4EA 3IFNL 1U3ZA 3ZT5A 4MDJA 1SN2A 1RJLB 4G9FB 3PV6B 5HYSA 4GRWB 2CLZB 5AQ0A 1F4WH 2AJZB 4UZUA 5CEYB 3V8OA 4AUJA 3WTSA 1S7UB 4UI2A 2AEOA 5HYJB 2Y0EA 4Q56A 2QSVA 1NTKE 2Q7YB 1GRWA 1KLUA 1M3JA 2GSGA 3Q3GA 1SYSA 4YVUA 1VQ6P 1JF1A 3ZHLA 2J57A 3G6DL 2G3AA 3ZN6A 1A4KA 4N8UA 3B43A 1XH0A 1BQKA 2J8UB 1ZGLA 4W4OA 1L7IH 5KAQF 4GNKB 3SCMB 3L3OA 3LIUA 4HK3J 5E6RB 3LH9A 3EJZC 1UHVA 2VSKB 3REVB 2W5PA 3VD3A 2XSKA 4K5OA 4NM4H 1AXSA 1A02J 1U8NB 5ENWB 1E8YA 3KPRA 2KQMA 3JCUH 1DVTA 5KS9E 2HA1A 2MQCA 4OT1H 5LG1A 2CG9X 2ZT9C 3SN6N 4B3VA 3VO0A 1NKRA 3AY4C 2WLHA 4GRMA 1PW3A 2PABA 3W81A 2QGBA 3B5GA 3UMTA 2NCMA 2NYYC 1QA9A 2DMCA 4AJYV 1HH0A 3ZZ1A 1TPXC 1OWRM 5D7KE 4WJG3 2B1AH 3HLAA 4F7TB 3FMGH 3WU1A 3UDWC 3PAZA 1TJIL 7TAAA 3VU2A 5K1NA 3GHBH 5BO1L 3Q06A 4PBWD 2OQJA 4RFEB 1NTKG 3R1GH 3OPZL 3UTPD 2N0MA 5TQ0H 5K93A 2ZCLL 5TE6H 1OW0C 4NT6A 1NDMA 3PE9A 5MHSE 2R1XB 5D7SH 1T8ZA 2XY2A 2YPLA 3CC1A 2YZ1A 4ZOAA 5FPIA 4UB6E 2Q1EA 2RMZA 4L37A 3PDOA 3QJTB 5L2KD 2JF1A 1TQWA 1W72A 1NGPL 2NY4B 1DVFC 1GH7A 4XB8A 5D7JB 4ASWA 5AOKA 2X42A 1BM3H 4JDZB 5EEXA 4QTHA 2P1YA 4LE8A 5H35B 3TPKA 2FQFA 4P57A 4PCKA 3L4ZA 4PJCB 1W0WB 5IJCC 3WI9A 1T3FA 4WW1A 1C7TA 1TU2A 2D7TH 1HINH 3N04A 4JO4H 2VKWA 4QXTB 3VNYA 5J12B 2VDOH 2A5UA 1KB9K 4GW5A 4JFPA 3RWEB 2UY6B 3UX9B 3VH8B 2DL9A 3FDWA 2J7LA 4LASH 2BWDA 3VFMB 2BRRH 4GEIA 1TITA 3M1BA 1Y07A 4LPCA 4HF5L 4JEGB 4YSTA 4MQXC 4O5LH 2MCMA 4APQC 2C1OA 1P5UC 2WGNB 1Q9OB 2EDHA 1MVFA 5GGTL 1B0WA 1SF3A 2V6HA 1NGWB 2VZOA 3I50L 2HSIA 4XCNA 4D0CB 5IFHL 5K59F 2IEPA 1O9ZA 2BNRE 4P5TB 3CHSA 5LXGH 2WBJB 1M7DB 4RZCB 3E6FB 5I1KL 4PJAB 2O01N 3P0YL 1YEJL 1NCTA 3AU1B 2CE6A 5A7BA 5DZVA 3BVVA 3OB0H 4LLVA 5CF3A 3VD9A 1O5DT 5JPNA 4GRWE 3I84A 3F58L 1SUHA 2NDFA 3FQTB 3TYFA 1KJ2A 5FA4A 5FO9A 1TTFA 5CKAA 4EDWL 4R26H 5HYJE 1IM9B 1Q7YQ 4FZEL 1RUML 3T0DA 5MEOB 3MV9B 5B22A 3DURA 3NFNB 4RWHA 1OZTG 1S5HB 3HZVB 2SEBB 3VXME 3DGGA 1EEUA 3FPXA 5JIQA 3P40A 3MLWL 2JCCF 4H5SB 1AHWA 5D6DC 1NLBH 3EFOB 4L1HA 1J9SA 1U95B 2PTTA 2FSEB 3UEZA 3MRNB 4TUOB 1TQSA 2DMBA 4LHUD 1IEBB 3HZYA 3HHSA 5EF1A 3WNJA 4HWNA 1NFIB 5CZVL 2KLUA 1NCAL 5B39A 4EJ1C 4NKIH 2KH2B 4WI5A 4BGLA 4HLZH 4AMXA 4TV3A 5D4QA 3S3JA 3ATEA 2DBJA 3V6ZB 1YQVH 4AGLA 4PCSA 2PYFB 4OZGB 2XDJA 2EDTA 2Z31A 5JQ6H 1JIBA 3QPXH 3WEOA 4MAYA 2B20A 1JD9A 1KXTA 1U4FA 3SDYL 3KVQA 5GGUA 1HWTC 3IB4A 2HUEA 5BS0D 3VWKA 1UEYA 4M7LH 4JMNA 5JXAH 3PP5A 1I3VA 4H0HB 2EVFA 2R5BA 3CFIC 3QO0B 3GQFA 2HYMA 3GZQA 4TL4A 4E41A 3SDXA 5I1JH 5E08H 5GSVB 2QPDB 4MS6A 2A9DA 2VRKA 1FLRL 1FC2D 4DQAA 2YXFA 2JIXD 2EH8L 4AYCA 2OMTB 2X4TA 4XH2B 4N2AA 4B5ZA 3JUYA 4LCVA 2C9UA 1L4AC 3NA9H 4W4NA 2EJ1A 5HI4C 1MFEH 2I69A 3UYRH 4LSVL 3OKOA 5FECA 1UOKA 4TQEH 5KVEH 4K8RL 1BBDH 3GLMA 1A2YA 4B60A 4HHAB 1TZHA 3C75A 5CZRA 4YXLH 3IU3B 3VMOA 4DN3H 1HTLC 1CDUA 4BQ6A 3MTXA 3K2UL 4CN1A 3S34H 1WWCA 3ARBC 4NBYB 4O9HH 4DWHA 2ITDB 4XFJA 1M1KQ 2CKBH 2OTWB 1Q0XH 2YD1A 4PJCE 5FLUA 4W9CC 2X87A 4Z5RA 3ZTNH 1CZ8L 1H5BB 2YIHA 1GKEA 1IGYA 1OPGL 4LOUC 4X6CF 3W56A 5J13B 4QXGL 3U4EB 4U3FD 1MCOL 1U93B 5IMKB 2PRRA 3CHQA 2WLNA 3IRCA 2XQBL 1JNJA 3K4DA 4PRAA 4AG4H 4FQ1L 3DJRA 3H1KE 4OI8A 4DGYH 3TT3H 4DZ8A 4S1SL 5JYMA 2MJWA 3V5HB 2YD0A 5DDHB 5I30H 3SPVA 4HJGH 1V5JA 4FQJL 4I7ZB 4TT3H 5LO7A 5BV7C 4AC2A 3MJ9H 3L3KA 5FM5M 2DQFB 3MX0B 2PCFA 3FONA 3N91A 1C5CL 3ZW3A 3UZQA 2H7WA 1IEAB 3RWDB 5A3ID 5DMYA 1X7SA 3P11L 2ARJQ 4GP8B 4M61A 1ZLWH 5M94B 3MV9E 1NCCH 3B2DC 1P53A 3DYMA 3H0TA 1YUHB 2X1PA 1PVHA 2X2UA 3O6QB 1YQ3C 1LK2A 2HX9A 3AB0C 5CUSL 1SF5A 3U48A 1JWUB 4DPCX 3PIQB 1ES0B 3BWZA 3CX5H 3R2PA 4UTAA 1MHHB 4PJFB 1E8WA 2VDNB 4G80B 1U58A 3N3EA 4JB9L 5BZDA 3VM5A 1MHPH 3VI3B 4KK5C 3MNDA 4I18C 1SLWA 2OGUA 2E7LA 1P4LB 2Z91A 1RHFA 3NRPA 5SWZB 4IHOA 4P07A 2KNCA 2EDMA 5IHZA 4OF5A 4DKFH 3VH8G 4EN3A 2UX7A 4LSQL 2ATKA 2MH4A 3CIAA 4LF3A 1CD8A 4QRSB 3WE1A 3FH8A 3KBHE 4Q58C 5MERA 2FLRT 3RZCA 2QPFA 4BFJA 5KBNC 2M8RA 3ZSTA 5ACZA 3H1KG 1BIIA 3A6BH 2B59B 3WSQL 4QF1B 1FFNA 3D07A 3QZNA 4LLUB 2NY7H 1HT6A 3LYRA 4TSCL 5GGVY 1ZHKA 1MCWW 3B4SA 1I3RA 5D1QE 4W9GC 3QIBC 2Q5BA 3MLYL 2MTPA 2BASA 5IKCA 4XRCA 4PRIE 3WDHA 4PMFA 4F7EB 3TH4T 1YBKA 3PG2A 4Y16C 5FYJU 3T4AC 3VWJB 4HVBA 1S7WA 2NY6C 2KDYA 4NPJA 2EYTA 1ZLSL 5TF0A 2JXMB 4NAMA 3SE3A 3VX0A 1CI5A 2F19H 1JHLH 1WFOA 2DQGH 1XCXA 4LEOB 1EJ6A 3JSSA 3K6OA 3EGDA 4YC2C 2K8MA 3BPCB 4PJIA 3E1IA 1NMAH 3MODH 1L0PA 3BT2L 2FUTA 1YY8B 1MN4A 2AXFB 5J7CC 3Q3DA 1ORSB 4WI0B 3T3PF 3VQMA 5BXFA 3ZKND 1V3KA 2HFGH 2OI9C 2F8VA 3T6VA 3TBTA 4O2EA 5E5RB 3CVIH 3ULUC 5B7FA 4JRWA 1EIBA 5D7IB 3OAUH 4YK4C 3S8FB 1J87A 4AZUA 1GAFH 1VAHA 4ZX4A 2CCWA 4Y2DD 5DD3L 3PWUB 4X6FB 1L0LK 2LU3A 3E38A 4JM2B 2ZYHA 3I6LD 1ASQA 5F97E 2IV8A 4OZ4A 2UXFA 1G7IA 2W92A 4H26A 3EYSL 4UU9A 2VXTL 3WNLA 5KAIH 2PAJA 3FTUA 4A6YB 4Z0XB 1T2QL 4YZWA 4JRYD 1GZLA 4NN5B 1HCYA 3DMMA 2F7IA 3L2MA 3QI9D 4I1RA 1OD9A 1TKWA 1K8IA 3IDXL 1U2YA 1LMKA 3F7PC 3MI6A 1FGVL 3V6OE 5IMLB 1NVOA 2X4UA 2P3YA 3BCCD 2ENQA 3K2KA 3LKSA 1RK1A 4XMLL 2EDXA 5T1KA 3FCTB 3JTBA 4P2QA 4N2HA 4M4PA 5FWRA 3X2QB 1AKPA 3ILQC 3K0WA 3HNVL 4OCSL 1IC5L 2Y9RT 3BD4A 3EH5B 3QJVB 1RZKC 3BZEA 2WLYA 3DECA 1XGQB 1XTGB 1ERNA 5I8KH 4Q0XL 5CSBA 3IWVA 4UDTB 4J7RA 1T4WA 5GGRY 2BP5M 3BWAA 4PJFE 3LPGA 4XI5D 3UOAB 1S1CX 1RFDL 2OXHA 2QQKL 2RACA 3PGDA 5FOJA 3QIUB 3VI3E 1TTGA 4YH6A 1CXLA 4MJ5B 5L0QC 4NRXB 1DQKA 1TQTA 2CBTA 2DD8L 4YSOA 5SWZE 2QJYC 3G5YB 5EDXA 3L16A 3BT0A 4CU8A 1FFOB 2ITCB 3ZTDC 2H2SD 4HJUA 4ZTOL 5E6UB 4RMSA 3UJJL 1AYOA 1HZHH 5DO2D 3RU8L 1Z9NA 3C5JA 1RK0A 2WVUA 1NJ9B 4HUVB 4IOSA 2GKIA 4N87A 4F92B 3B37A 1JV5B 2FHBA 1T1YB 4FE9A 1BJ1J 1ZS8A 2F0CA 4HMEA 5JZ7D 3L73D 1AQ5A 2DJMA 2GJJA 2IAMD 1THAA 1EDIA 1KTLB 1PZ3A 1Q38A 3WIAA 3QUZA 3O6MH 2OK0H 5IROA 4OFYD 2WLLA 1AJ7H 4L5FH 3M91A 1TYRA 2WAQA 2H26B 3FJTA 1ESOA 3ZKMD 5IR1A 2K37A 2O6EA 4ZXBC 1NFDE 4WWKA 3MGTA 1DO5A 1DUYA 5FW7A 1AQDB 3K46A 4H25B 2XXGA 5C0RL 4RFNC 3OMZA 1XH3A 5ABZA 3SE8H 2FSDA 4ZUVA 1B4RA 4IMKA 4ZBJA 2VMCA 5G5DA 1G7MA 3C09B 4P2YA 1KULA 3QH3A 4WFHE 2I8DA 1RH8A 2J20A 2ZYIA 2B4CC 2LLLA 3BRVB 3OSVA 3B7SA 4IK7A 3U6XS 3GSWA 1SOXA 3WMM0 5D93C 3B9EA 4BA0A 2J1YA 3RY6C 2ZJSH 3WEMA 2C0WA 2FEEI 4N24A 3SGEH 2JJSA 1GZHC 3LPWA 4JFFB 5E5UB 2J4WL 1PSKH 3ILEA 4OGQB 3ISRA 4M3KB 4BUQA 3BRDA 4ONHB 1LEIA 1QLEB 1BFVL 2FKWB 1MVUB 4A7SA 3C2SA 3EOAA 3WUVA 2EYSA 2IANB 1MVYA 1MFBH 2M8XA 2F08A 1B3JA 2H4EA 1JI1A 3DSNB 3NSCA 1J86A 4FC3E 2Y07L 3RTQB 1SQQK 2OMZA 2R4SH 2JB6A 5I1HL 5ISZD 1KG0B 5CMAB 1XGTA 3UEQA 1T1WB 3KPOA 4HT1L 4L73A 5TTRA 1CGYA 5AW2B 2G9HB 3G6EP 2Q8BL 5J11C 2AJUL 2BNQA 5C39A 2XWTB 3QUYA 4K23L 5HBBA 1RIHL 1R3KA 2Y4SA 3FQRA 2IOOA 1LTIC 3KPRD 3FHEA 1G43A 1FJPA 1FL6B 2H41A 1MFCH 2E5EA 4MDRA 4NUGL 4QRPD 5IHBA 1KB5L 2G5BB 5I6XC 3TF7C 3HAEG 4ZTPH 2CKBA 2C8NA 1HF9A 4Z78A 2RBLA 5EU7C 1YVLA 1G2CB 4ELDA 4FAAB 2CLRB 1WS8A 4XPGL 5D5MF 5BV7L 5DYFA 1FP5A 2KBGA 4QHMB 4HIHB 1A6AA 2OJZH 2V4HA 1XCQA 4O2FB 3B5NB 3QK0A 1KCVH 3TT1H 2I24N 1CLZL 3ESMA 5IBUB 2F1EA 1OVRA 2XQYK 3NPZB 4JBSA 5ILTL 2BM3A 1BLIA 1RHHA 2YD2A 1N7SB 1L6PA 1N26A 3CZFA 1T22A 1VKXA 2CHZA 3QPKA 2BP3A 4GI6A 3UTSB 4HEME 4F20A 1HBWA 4LGPB 1EMTH 1F11A 1SBSL 4HJGA 4KKQA 4NN6C 1J1XL 3OG4B 3WUUA 5IEKB 2J25A 2VR7A 3HR5B 1NDGB 3VXNA 1MHEA 1VFUA 2ITFA 3CCJP 2EAEA 2YPLD 2ZX5A 3F6JA 3MJ9A 4HXBL 4JQVC 4MA1C 4LIQE 3W2DL 2EH7H 1O6TA 3G5XB 4KTYA 2QMJA 5B1AB 1HHJB 5EBLA 5LWYH 4LL1A 3C5ZB 3L4VA 3QA3A 4ETYA 4U1MA 4JYCA 5T5NG 5B5EH 3BVNA 4TVSa 3VXQA 2G3NA 4LCCB 2LR4A 3G9AB 4FLQA 2C26A 4H20L 4Q97A 2WLJA 2OTLP 1CPUA 3QBTB 4NZTL 4BJLA 4MA3B 1WAPA 3TCTA 3NZSA 5I17A 1ZIAA 5BVJA 2ZYGA 3IE4A 5E94A 3V0IA 1BFSA 4DFHA 1E67A 4AXWB 1AAJA 1J5OH 3CX5I 1D9KD 2OW6A 1HYSC 2EEBA 1K8AQ 4YWGH 4AL8L 4PV9A 5DQDL 5CGYD 1UZGA 2CPSA 1VGKA 4I48B 1WRGA 4JGMA 43CAB 1KYOJ 1TTRA 1TLMA 2DQJL 3LIEA 4KROD 5H4ZA 4JO3H 5KVFL 5GGSY 3B3BA 5CD5D 1QL1A 5LVEA 1GK6A 1OAQL 1NGZA 1MXGA 4BBWA 5IQ9B 2HXAA 2YD7A 3CXHH 3ZTJH 4OCYL 5I15H 4WVRA 4L8SA 1SEBB 3SKOB 2FHFA 4O02B 4X6BB 2Y2WA 1D5XB 5FM5O 4UMGA 1Q0EA 3CIQA 1WS7A 3DJTA 4N5EC 2FX7H 4MMZA 4U3SB 1UH2A 4IGBB 1MRCH 2I07A 1SQXK 4P4RA 1CU4L 2EDWA 2UUDH 3NZ8A 1ZN5A 1CFSA 1WTGT 3LXBA 4JFFE 1FZOA 1OT4A 1RLBA 1QEXA 1ZVNA 3ZGHA 1U3JA 4HFUL 2Z1KA 1JHTA 5A16B 2IANE 4H40A 3UC2A 4GAJL 2HJLA 3S37X 2X0UA 3LIZA 5AYTA 3ILPA 4MFHA 3QR0A 4LXFA 3C6SA 3MRCA 1A65A 1XQ4A 5EO9B 2QHLA 1NTMD 4FYQA 3TJEH 4U1LA 2GJZB 1OXYA 2D2CD 3KE0A 3QEGL 2K7QA 3BUPA 3D1MC 4PY8J 3RWIB 5KTEL 4L8CB 1TU3F 4N9GB 3K6DA 6PAZA 4AEIL 3F7YA 1FNEB 2J44A 2P5EB 2Q9OA 1LO5A 3CJJA 3NTCL 3TCLB 1Z5HA 3QUKB 2VC2H 4LP5A 1A5FL 4ZNEA 5DMGD 3UTZA 3CDGA 1T66D 4OCRH 4XXWC 2EDOA 2B87A 4FJZA 1NBQA 1Z9PA 1HH6A 2CJUL 4YHYB 5DEGA 1PGOA 3TYGL 1G5AA 1I7UA 2C3VB 5D1ZA 5JQIB 3CU1A 3ABZA 3VXOB 4JNXA 3RKPA 4FP8L 1TZOA 2OTKE 5IB1B 1MFVA 1SJHB 5D1ZI 1GW0A 1L0QA 2ADJA 3BWSA 4HPYL 1JTHA 3UPCA 4E41D 1T03H 1R3JA 4OD3L 2I7SA 3FTGA 5LAXB 2X0VA 3S35L 1BZOA 2X89A 1AKJD 1SRDA 4PGDA 3UTSE 4GW1B 1QVFO 4KQ4L 4ZUSA 4QHLB 2GTZB 1SLXA 3MACH 4MD0B 3CPLB 4UIMB 4YO0A 3CVHH 4JRXA 4GRLC 1MWAH 1JY2N 4CJ0A 2I32A 2EXWC 5EZIH 2JP3A 5DJAA 2VDKH 3RWHB 3TNUA 1SQ2N 3FB7B 5C09A 4U6VL 2WANA 1AI1L 2OX5B 3IMTA 4RO0A 2ESVB 3EZ8A 3L73J 3FO9A 3U4BL 4Z18A 3A47A 2W9DH 3G9VA 3I3EA 3CN1A 5SWQB 1CGXA 4LRIA 1XWVA 2Q2EB 4OIAA 3D08A 2XTSA 1FVEB 3KWUA 3Q2CA 1WCBA 4TRPL 3STBA 4JUSA 2GK2A 1H6FA 3D9AH 2EXSA 4YUEH 4ZFFA 5EN2B 4A7GF 2IYOA 1X7QA 3BUTA 4D6TD 1AVAA 5GZNA 5CLZA