5AW2B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw2B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw2B02
2R3CA 2XV5A 1HWTC 1YYCA 3M06A 5AVRB 1G2CB 2VRSA 1IO4A 4I2LC 2YNYA 5AW2B 3TNUB 4I6MC 1CI6B 4HYTB 3LIDA 3TYYA 2WTYA 3V4WA 5AW4B 5AVVB 3UIAA 3HE5A 1J2JB 2P7JA 3P32A 2BASA 4KHXA 5APUA 5AVXB 5AVTB 2WT7A 3IR9A 2N9BA 3V5BA 4AYCA 2R32A 1GD2E 5CMZA 1A02F 2QM7A 2WPRA 3HTKA 5AW6B 5AW7B 4GT1A 3L37A 4EOTA 1GTWA 3O8ZA 3A7OA 5AW5B 1KQLA 2Z5IA 3HE5B 1H89A 5AW3B 5APWA 1MFZA 5APTA 3VTPC 1JUNA 3KDPB 3T97A 5APQA 4C7NA 1GK6A 3M91A 3SWFA 2WT7B 4LC1A 3L35A 4JYCA 3P8MC 1FAVA 3VMXA 2ZFCA 1FOSF 4GKGA 1X8YA 2Q3IA 1S9KD 3B8EB 2QM8A 3TK1A 1HUCA 3NMDA 3I5CA 3HE4A 2Q7CA 1H88A 3M9HA 3WGVB 4RESB 4DZOA 1MUUA 3MD0A 4XE5B 1A02J 2IPPA 4C7NB 3M0DA 3LIEA 3A5TA 2R5BA 2YO2A 1HJBA 2C9NY 3M0AA 3VN0A 4B86A 5AVWB 3A3YB 5AVYB 1GU4A 3A2AA 5AW9B 2Q5UA 5APXA 3V4QA 2Z5HA 2YO3A 1DH3A 5APYA 2ZXEB 4RETB 1CZQA 2P67A 1H8AA 2XZRA 1NAFA 3HE4B 1OWAA 3VYIA 1T2KC 1OXZA 3NTNA 1MV8A 3M9BA 5APSA 5AW1B 2C9LY 1SLQA 3WGUB 2WPSA 1S9KE 1GK4A 2WWWA 5AVQB 3VMZA 1SP4A 1GZLA 2R5DA 1HBWA 5AVUB 2JJLA 5AVZB 2E43A 5AW8B 3TNUA 1CI6A 3P7KA 2H7HA 3MGNA 4M3LA 3OAKA 1NWQA 5APVA 3L36A 1CSBA 3KQGA 2W6AA 2P2UA 2KP8A 3NXSA 5AW0B 1GU5A 4C46A 4AUWA 4AQRD 3NFQA 1FOSE 2WPQA 2E42A 3VMYA 1T2KD 1JNMA 5AVSB 4JYBA 2XU6A 2W27A
chains in the Genus database with same CATH superfamily
3C5SB 3OXRA 1UJ3A 1EDHA 1EEZA 5I15L 1B9ZA 4OQTH 4KJWD 3L48A 1YYMH 1UT9A 1NCIA 1U8OB 3DPDA 1RU9L 3ZMNA 1N12A 3C5SA 4WWKC 3BWSA 3QA3B 5I1GH 2NZ2A 1U8OA 4JM2A 4ODVL 3N1QC 5DFTA 2PPCA 1PTZA 4PJ8D 1KQFB 4O2FA 5KYYA 3CXHI 4PUBL 4JFEB 1BBJA 4NJ9L 5ALCH 4TNVF 3L4CA 4TSAH 2E6QA 5I1HH 5GGSY 3M46A 1N7ML 4KXBA 1L0NG 3QJZA 2VDQL 1HHKB 4JL1A 1AI1L 1D5ZA 2DM3A 4OCMC 3NMEA 5E9DA 2FBJH 4PGEA 4W7ZA 1JYNA 5E5UB 2IO5A 4R4ND 1UM4H 1EZLA 1E40A 5HGDA 4M6ML 4J3OF 4YE4L 3UYPB 3N5AA 5DYOB 2YMKA 4ZAKA 4EIGB 2ZVNB 1TJHL 2DKUA 5IKCB 3D50A 3SDYH 1NBZB 2ZX5A 1F8TL 3CIAA 1MW3A 5IKCA 3J2PA 3T2LA 5EULV 4LRIC 4XCNB 1FG2B 2R2HB 3H1JJ 1UWGH 1T0MA 2VDNH 3NJLA 2YRBA 3O41B 3VMAA 2DQGH 3RK2C 4P2QA 1E79H 3I5CA 4DGYL 3WEXB 4XP4L 1DBJH 1FNGB 3O41A 3LJ3A 2WXLA 3GI9L 3GMLA 5FYKD 3I3EA 2Y5EA 3ZW3A 2FR4A 2OXHB 2FYUJ 5TFSL 1X5FA 4B86A 2WWKO 1ZA6A 1XZ0B 1H0DB 2YPLE 1PX3A 3UAJC 2WWOA 2GJ6E 1KULA 2Z5HA 2OXHA 3EYOA 1NGQL 1TZIB 2IFNA 4PJ0E 1H0DA 4O2CB 5I0VA 4U6VH 5IVXF 3VWJB 1I82A 1ZA3B 2AEPH 3L70D 1PZ2A 3X1EA 5K69A 3VTTA 3VSTA 1TZIA 3QZBA 1KEGL 4PN6A 3GXTA 5EEYA 4IKLA 5JQIB 1XVSA 2QQNH 1AR1C 2VR9A 2CHNA 1XFPA 5DJ0B 5SWSD 1UOLA 2FL5B 4ZTEA 3IPBA 5I9QB 1CZ8H 4B7LA 4WIQA 1MKMA 3VG9C 1YQVL 2PMZA 1SVCP 4NSKB 3OSVA 5H37A 1NCNA 2WWKT 3QISA 1CFBA 1AGDA 1KBPA 3C5JA 3IDGA 3V52H 4AXWB 4NSKA 4HCRA 4CVXB 2J8HA 4B27A 1JNMA 3L2MA 5SX4H 4LNVA 1GCFA 3PWVB 1GW3A 4POUB 1LWUC 1E5UI 1A22B 2YFNA 3P69A 1VQ9P 3V7AG 4F7PA 3DMMA 4CVXA 4L0PB 3M8OH 3NSJA 2BFGA 3OMNB 5DHEA 1DQJA 1RK7A 5T1DL 3BGMB 4OGXL 1YZZA 1CGYA 1USDA 2HXAA 2ZXWB 2IEPA 4GXVL 3ARGB 2H1XA 5F7BA 3D0LB 3PQYA 4Z0XA 2ZKHL 5LBVA 2JVUA 3RG1C 2Y9ZA 3HFMH 2KLSA 1FZMB 4L3CB 3MRJB 3QI9A 4LSSL 4HJGB 3UYRL 1XH2A 2LAGB 2XWRA 4XZ4A 4ZXBB 4XN2A 4AG4L 4K0OA 1UB6A 1FZMA 4L3CA 4N2LA 5I73B 35C8H 4ODXB 5JOFB 5EU6D 4JFDA 1YEWA 4BH8B 4ZXBA 5CGMA 3O3UN 3FTGB 4LHUA 4NKDB 5L8KB 2FX7L 1BCIA 3BWUC 2FX8L 2B88A 1MPAL 2HR3A 1XR9A 2H2SD 2VCOA 1GYUA 4KMQA 1WBYB 1RHHA 4B6ZA 1JK8B 1F3JB 2IIJA 4JDVA 2MHAB 3L72E 5C9JA 1E8WA 2FJGA 3ARTA 1WBYA 3IDYB 3PJNA 1F3JA 5I0YA 1HH6B 3EJZD 4MCYA 5J06A 3GHGC 3DJSA 3F05A 1RJCA 2WXGA 5ABZA 1DD4A 4PJ9D 5E99L 1S7TA 1T1XB 4HU2A 2VLMD 1HH6A 2C4XA 5IZ7A 2LU7A 3OR6A 5ACZB 3OZ9L 4ZYKB 3L16A 4M9PA 3GSWA 1OB0A 3DVIA 1RJYA 4GP5B 5ACZA 1HILA 2VZ1A 4GXUN 3BC9A 2OW6A 1A7QH 5FIEA 1T4WA 1IT9H 3O4LB 1FFQA 2EDEA 3VFRA 4N3YB 1RQ5A 1NGXA 1CLCA 2D3VA 2OMTB 1FL5B 1J1OL 2ZSVB 1MAML 3T0BA 4J12A 5KZCD 2Q1EA 3V4UH 3EBGA 5EC1B 5FGBA 4R2GC 2OMTA 1F42A 2IBZX 2YGNA 4LASL 2ZSVA 1JNHA 3QUML 4XI5D 2DH2A 5FGRA 1LE5B 3G6JF 1QASA 1L0LJ 2OMYB 2NDFA 4RMVA 5LXVA 4Q6YA 4I0PC 1A4KA 3VH8B 1PGJA 3MCKA 2E9IA 2D7TH 1OMIA 1XGQB 2E27L 5AAMC 5GJSH 3OAKA 3TVMA 4IOFC 2DIBA 4X6CB 5CD5D 4JY6B 2NY6C 4A6YH 1MEXH 3UFIA 1G0DA 1SYVB 2VDNB 2XN9B 1AXTL 3ZE0E 2BWIA 5IF0A 2OTWA 4X6CA 1TUPA 3I9GL 1IGCH 2D7PA 4XNQB 2FY8A 2VZOA 3EYFA 2GIMA 4TNFA 1FS0E 4A04A 4DJMA 1CDCA 2BX5A 2XN9A 4W9GC 2RQEA 1HYSD 1DDHB 2K1AA 1UWEH 1URZA 2PN5A 1KYOH 4ZTOL 3L9EA 4IMLB 5F7EL 5GSRA 1TMCB 3QC5X 4G8AC 3WFDH 1JGIA 1GGCH 1BYPA 2XKNA 3CBJB 3VFOA 3FUIA 5C0AD 2XZQL 4FG2A 3SE8L 1HXKA 4IMLA 4QF1A 3X2QB 3LPPA 4F5CA 1CVRA 1JGVL 4KDTA 4ZO6A 5DEFA 4PJAF 5C0AE 2BW4A 3FQNB 1OSPH 2X38A 2NQCA 2OMZB 2KQMA 3KGTA 4QXGH 1A5FH 3S5ZA 3L70G 4KO9A 1AXTH 3D09A 3IFPB 1R5SA 5EOTA 2K4WA 3OVUB 5I15H 1OVUA 4XHQA 1G7PA 2OMZA 3NJJA 2ENJA 3QUXD 4HAFA 4KJYA 1ZT1B 1RU9H 3GC3A 4OH8B 4KRNA 3L3DB 3NH7L 4HGKC 1J8HB 1J48A 4U4BA 3GKWL 2HLAA 1KCLA 1DX7A 1ZT1A 3CPLB 3C9IA 2J58A 4ODVH 4UOQA 3L3DA 4LC1A 3HLKA 2K37A 4PTUB 1SLVA 5C2BL 3O6FC 4PUBH 1MI5D 4NJ9H 2X6UA 3RVVC 1G0YR 2EDDA 5C09A 1IMHC 2QTEA 4GKGA 3NJFA 3R06A 2DY2A 4PTUA 5E95B 1N7MH 5EO0B 4AYID 4E0RA 1SFCC 4KBPA 1HXYA 2VDQH 2YWYA 1AI1H 2WKGA 3BP4B 3KYAA 3MRDB 4N2KA 3RX8A 5KG9A 1JGDB 3FOLB 5FKPB 4MZRA 3U59A 1U8JA 2AQSA 2DJMA 5CZRA 4DKFL 4XE5B 4M6MH 4KX7A 2X6AA 4YE4H 4CA4A 3NEEA 1LO0L 1JCVA 3M0DA 3BP4A 2ZSWB 3IGAA 3MCLL 1TJHH 1IC0A 3FOLA 3MRDA 5FKPA 1XB8A 2HJLA 3CL3D 3AREC 3F64A 4ASVA 4TSCL 2DAVA 4P2OB 4HOWA 1VADA 3OGCA 1F8TH 3NP4A 1EEQA 3ZDXE 1YY9C 3B3BA 1O6SA 3FTSA 2YUZA 3QFJD 4E9VA 5L2KD 2KS0A 1QVOB 2XTJC 3TO4A 1HL4A 1LP9B 1GJIA 4GKNB 4OZIA 1TCRA 1M53A 5GZNC 3BCCD 1H5BB 1QTSA 3M1OA 5CR8A 4PJHB 4WVZA 1QVOA 3G5VA 4DGYH 2J1XA 2X4RA 4RO0A 3TU6A 1H5BA 3GI9H 4EI5B 2VDLH 3DBSA 2E5EA 5B3SB 2YSTA 1ASPA 4HUXB 2R8SL 2N1TD 5TFSH 3PABB 2E43A 3RNKB 4PRIA 4EI5A 1K72A 1CI6A 1EX0A 1E9OA 3GMMB 3BEVB 3K6IA 1NGQH 1NBYB 3ZTJH 3AGVA 3I3DA 2VZVA 1NC2D 3QR0A 4A1RA 3BEVA 2W1NA 2Z8VC 1S3RA 3GGWB 3R4DA 2L3BA 1EGJH 2NZ9D 2P3YA 3L95A 3NIFF 2E9JA 1KEGH 4TN9A 3IFLL 4W9FC 4N0CD 2WLZA 5EOQH 2NCMA 5D7JC 4JG5A 2JKSA 1R3KA 4CMHB 2K9YA 5KVDE 4L8DA 4XVOA 3V79C 4RX4A 5IHWA 1OE2A 4XVSL 3DRQB 2VABA 4J3BA 4ZFZB 4Y4HD 1YQVH 3UZVA 3PL6B 4QTIL 1J2JB 4AEIL 3VQ2C 3DRQA 1LVEA 5LG1A 2O3JA 1P5VA 5CFHA 4ZFZA 4AV0A 4MNHB 4MAYA 2E74B 4X5WB 4POYA 3HVNA 2QT6A 4X6EA 1OTUD 4G6FB 4HPYL 4C56D 3K1DA 2BP5M 3MVSA 3L71D 2PABA 3KE0A 4NQXA 4X5WA 4FTVA 5CNHA 3QH3A 5LQBL 4OF0A 5FA4B 3LIZL 4DOHE 4P48A 1KMIZ 4YGAB 4LEOB 5T1DH 4OGXH 3L71E 5IT2L 3VGAC 3WD5L 2VUKA 1G1OA 1DLHB 3ZQ9A 4GXVH 3IJYA 1MG3C 2AV7A 4LEOA 2ZKHH 2GFBB 1G6RL 1E5CA 5J56B 5FYLL 2WQXA 2C7UA 1FDOA 3KPMA 4LSSH 3HMWL 1MCOL 3WO3B 3UYRH 4AG4H 2I9TB 5DS8B 5JHAA 3SPCA 5T3ZL 2IFGA 5BZZA 4UQBA 1V7NL 2OL3A 2I9TA 3QDGB 3I6GA 3BRDA 1CQYA 4DIXA 5LGJA 2FX7H 3WI9A 3T97B 1A02J 2QSCL 2PWEA 3ARVA 3I2CL 1I1AA 1MPAH 2FX8H 3EG9B 5GGUB 3VYNA 4K71B 5CLYA 5K9KB 2VLKA 3T4YA 1HCVA 2ZWKA 1QLED 3RHWF 3ZBMA 3MA9L 5LUMA 5HHOA 4LPCA 3W81A 4GINA 5K9KA 3ZHDA 3ULUF 3TIDB 5JW3L 4TUOB 2BCCJ 1G7QB 1T2KC 4YNYB 4PJFB 1U21A 4AYDC 1OWRM 3OL2A 4Y9GA 4ZMXA 3VVWA 1RFDL 3VUAA 5EB9A 3CFBB 3OZ9H 4DT2A 3JWNH 3UTQB 2CR6A 2CPCA 4PJFA 3WFZA 4W9HC 5DS2A 3TSIA 2HPTA 4ACTA 4OJYA 4D8PA 2C3VB 3CFKA 5KSAD 1ZKAA 3ARXA 1CJYA 3SKMA 4AV5A 3CH1B 1RZJC 3S7GA 3UTQA 5A2KH 5JHLA 3IXTA 4MB5A 2OGUA 2C3VA 2WXRA 4GQQA 4OCYL 3GHBL 1T3JA 4HJ1A 3UP1A 2I27N 4FYSA 3BO8B 2WLJA 4E41B 1J1OH 4YR6A 1Z5HA 1MAMH 3E2HB 1X4YA 2VDQB 4CVWA 1S7RB 3HFFA 3CVBA 2XACC 4LFHD 3QUMH 4Z7WE 3SDCB 4M9OA 4N6RB 2DMBA 3ES6B 3D05A 3MRRA 2F15A 3CN0A 1S7RA 3HBQA 4PS4L 3SYQA 5I8OL 2HX8A 5AW2B 2J4WL 4AV4A 5ACLA 2HVKB 4N6RA 1KB3A 1MWOA 1C08B 2IH1A 1I8KA 4U0RB 4NO2A 4UQ9A 2E27H 1GYWA 1BZ9B 4AVKA 4IFMA 3VOPA 1IKOP 1HVXA 4H0HB 4HF5L 5AB9A 2QKSA 1BZ9A 1AIZA 1L9NA 1I1RA 3I9GH 3VXME 3BCCG 4DH2A 1A66A 2WOBA 3HJ0A 2NY4B 3AEBC 4H5SA 5KVEE 4ZUTB 2NRGA 4FFWD 1HQ4B 4L8BB 3QXWA 4W7YA 3ARFC 1K6QL 4HAGA 4CW1B 4PLOB 4ZTOH 2VSDA 2P44B 5F7EH 5IW6A 3C60B 1KXHA 5HYFA 2PXYC 5D7IE 2QDWA 3FB7B 1DJWA 3U2SA 2GAZB 4L8BA 2GJ6B 1M42A 2XZQH 2C3GA 2WANA 1ETJA 5JYMA 3L35A 3LD8B 1JGVH 3GSVA 2YPLA 4GAGL 3FB7A 4L37A 5GRUL 4X4YB 1O5DT 1WZ1L 2GJ6A 3AAZB 3ZT6A 2UZPA 1WBXA 4I1NB 1EZVI 3X1BA 2VDOH 5EN3A 1WJ3A 1FZKA 1KG0B 1WLHA 2QM8A 1NTDA 5IVXE 3HMXA 1KLUB 4HIJB 4O4YL 5CP3H 2VRQA 1DHKA 4IIZA 3QORD 1U8HB 2V9QA 3FMGL 1KG0A 2Y2TA 2FSEA 3NH7H 4APQA 4KRPC 4HUVB 3GKWH 1U8HA 3QUHA 4L29B 4L5FL 2X4SA 5T5FL 1U8PB 4F7EB 1YMMD 4R26L 5AYQA 4MWFB 5CR1A 1OSZB 5C2BH 1F00I 3ENEA 4P5SA 1YJ9P 1A3LL 1J18A 3QPQC 1J0YA 2YO3A 2D0HA 3DROA 5ITFA 2G4EA 3FH7A 3PXHA 1T1WB 2DM2A 4MWFA 1OSZA 2AXTE 1Q4NX 1Y7VA 3CNKA 2WCGA 1UH2A 1XGRB 2EEBA 2NW2A 3HAEG 4PIBA 4N1EA 4AJ0A 3BZFA 4LKXA 1T1WA 3BHBB 4MB4A 5EU3A 4HWZA 3A0HH 4DKFH 3OJVC 4E5XG 4TL5A 1XGRA 1LO0H 3SJVB 3MCLH 2F7RA 1ESOA 3VMZA 1GZLA 3JV5A 5HPMB 1ZE3H 2AQPA 3CZNA 4TSCH 2KQNA 4FXKC 1A7NL 1Z0MA 1BDDA 4WHTA 5AW8B 2GSGA 2W95A 4TRPL 3WO4B 1EERB 5MEQA 4G1MB 4WU7B 2WOYA 4RWHA 1Z9LA 2X4QA 3OAZH 1RQUA 2EUWA 3ZO0A 4ONHB 1DBBL 3RZCC 1DJYA 4WU7A 3W37A 2QQKL 5EF3A 5IVNA 4QRTA 1I9JL 3AEDC 4ONHA 5KLVE 12E8L 1QOKA 2YXMA 4NQEE 3R4YA 1DBML 2B20A 3F7KA 2CJUH 4ZS6C 5FV2A 3C75A 3BWAB 3LNHA 2H3NB 1XEUA 2XX1A 1A4JA 3C5ZB 4NKOB 2FWLB 3IXAA 2H3NA 5DK2B 3LW5H 5MHSD 2R0ZL 3EBHA 4ABQA 4QRPD 4H8WC 4HQQH 1FC2D 5IESL 1JE6A 3GBEA 3IFLH 5GZOC 3VWKC 4MTMA 5HGAB 4L73A 1WRGA 1MCEA 3B9KB 4JFVA 1ODAA 1QX8A 5FHBL 5HI4C 1XQ4A 3O8ZA 2CBPA 5EF1A 2C9PA 1RJLB 2B15A 4XVSH 1CYXA 1OHZA 3MBWA 3JCUH 3B9KA 4Z1PA 1WBZB 4PJXE 4QTIH 1QLFB 1KFAH 4QHMA 2K8QA 4I1RA 4AEIH 4AYSA 3RWHA 3SWFA 5CN3A 2E5TA 3L13A 2M5AA 1QZNA 2AJSL 4G5AA 1QACA 3IRZA 5DS1A 3LHPL 3BCDA 2FZ3B 5E8OA 4HPYH 2KI7B 4P4RA 4TV3A 3B5TA 5CXPA 2YEVB 2PO6D 1YYLL 4LFHG 3V0VB 5LQBH 3MV8D 4KU1A 1ANUA 3U6XA 1WS8A 3LIZH 2ORBL 3FQWB 4N6JA 3D33A 3MRIA 3MODL 1ADWA 4FNLL 2IAMC 5E8PA 1Q72L 3WD5H 4N2MA 4ZPVA 4Z3GA 1JVOA 3HTLX 4DEUA 1T5WB 3TA3D 5C08B 2XV3A 3FQWA 5JZ7D 2K8MA 5FYLH 3QP3A 3FK3A 5AWNL 2LTQB 1MUJA 5BQ7B 1ADQA 2FGZA 1NGWA 1VF5B 3R1GL 2E5YA 1UJ3C 1BMGA 2UVEA 3FFDA 1MCOH 1O9WA 2GC4C 2GJRA 3HMWH 3NCJL 4G9FB 3D39D 2OSWA 3APNA 3SDXE 4UU9B 1CMOA 2XJLA 5DGRA 5T3ZH 1DSWA 2EEXA 5APSA 4M61A 4R4BB 5D7KD 1V7NH 4DW2L 3D39E 4UU9A 1VPCA 3MOBL 4G8FB 4JM2C 3MC0A 1HCZA 1NIDA 4MD4B 4UNTA 2QSCH 5FOJA 1MH5A 4XNZB 3I2CH 3L5IA 3OKNA 2WLYA 2D31A 2CLRB 1IFJA 3KPEA 3PLNA 4JUSA 4NEHB 4ZUVB 3LOWA 4MD4A 3B1UA 3KCPA 3KYOA 5HDBF 1S4XA 2ZXXA 3T4AB 3MGNA 3MA9H 4FNSA 4CU6A 1M1SA 5C0DA 3CZJA 1KJMB 2Y3AA 3I84A 1FH2A 3L36A 5FGCB 1N86A 1Q1PA 5EUOB 1Z56A 1QP1A 4P2RB 3H6JA 2ARJQ 5C0AA 3WIFB 1VQNP 4E36A 4MMYB 3SHSA 1IBZA 3WHE1 1VQ4P 1RFDH 4PR5A 2V2XB 4X9FA 5GRVL 4EVNB 2E56A 5FR3A 2H9GB 1XWVA 4MMYA 1TJMA 3CX5D 5FK9A 2V2XA 2K3TA 1KTBA 3B5ND 3QUZD 1W0WB 4HIHB 2H9GA 3H1IJ 2VE6B 5FDYA 4NQTA 1CE6B 1IGFL 3RWIB 1QEWA 1FCGA 3WU2H 4OCYH 4YMPA 3GHBH 5I71B 3QUXA 4YSQA 4HIHA 2VE6A 3D0AA 5K5GB 3RWIA 1F86A 1BCCG 3ECQA 5CU9A 3TURA 1QWUA 3AITA 2XN2A 4AYCA 3EBAA 3TNMA 1GD2E 1MFEL 1IC7L 3U36B 1PNCA 4UTBA 1ZLVH 3RDTA 1QFUL 3REVA 3FQXA 3T0XA 4B53A 2NY3D 3BKCL 1PD1A 4TNGA 3VFNA 3LKOB 2VT0A 2W65B 2X70B 3FU7A 3TL5A 4ATWA 5JHDD 4PS4H 5JIIA 5CHNB 2CK3H 2JKRM 4Y16D 4HJ0D 3ZDXB 3HE6D 3WJJA 4PG9B 2R29H 4YSCA 3WIAA 4O9HL 3GSOB 1A3ZA 4M6AA 2LVCA 5DK0A 2F8XC 2IOIA 1AGEB 3DXAD 1AQ5A 3VWJC 1CFSA 2ADIB 4NQSB 4UTAL 2ZX6A 5JIKA 5KWYC 2WLHA 4KVNL 3KDMA 3L5WB 4UZGA 2GB2A 3DXAE 4NQSA 4U49A 4X6DF 1HUCA 1TEYA 1TQBC 1YMHA 4WJ5B 5KS9F 3MOAL 3P0GB 3IYLW 1G0XA 4ISVB 1ORQB 4JRXD 4ZZKA 1K6QH 5GQBA 5JO5B 5KUKA 1THCA 1Z9OA 2KNCA 1R5WB 4WW1A 4PJGE 2WVVA 4ISVA 3TGUE 2OARA 4MNGB 5IB2A 4ZTPH 3NDYE 5HYSB 4N0FA 3HN8A 1O6TA 4GAGH 3I55P 4D7PA 5GRUH 2GCYA 1WZ1H 1WA1X 4NHUA 1L6XA 4KQ4L 2CUHA 4NZ8A 3W9DB 3QBTB 2E7MA 3MDJA 3TT3L 3AECC 5J11C 4EAEA 2V8LA 3S5YA 4O4YH 4LPTA 3J07A 3G7TA 5F1SA 4NXKA 3FMGH 2D7OA 2J8UB 4RMUA 4XHJD 1IFMA 1VIWA 3VSQA 4CU8A 3QI9C 1FZOB 1A8ZA 2B2XL 2IH8A 1L0QA 3QO0B 5I0XA 4L5FH 2DWTA 5T5FH 2ARJB 1VAHA 3BP6A 4ODSL 4KNSA 4R26H 3VVVA 5JXAL 2B08A 1FZOA 2JKXA 1ZGLM 1A3LH 3FONB 2WD0A 4ZXBC 2ARJA 1N7LA 1BAFL 1T66D 5BNXD 3QJVB 2DLTA 5D6CB 1L0YA 3N1GC 4M3KB 4WSKA 3H4HA 5JUEL 3L2LA 4N9GB 5FX3A 4F8LA 2V7NA 3VGBA 1ZT7A 3UDWA 1BWMA 2V8MA 3M45A 1BE3G 4Q9BA 15C8L 1BF2A 1QFWI 2CLZB 3WNMA 4UQEA 3ROLB 2DLFH 3EJUA 1XR8A 3TNUB 1U8NB 1MNUL 3LVTA 5TE6L 1CO1A 1A7NH 3RWJB 1G6RB 4TRPH 4MYWB 3IDYC 2I07B 3ZU8A 1GKOA 3CLEL 1U2CA 4PBVC 3DOIA 3ULSB 2DBLL 2I07A 3VG0L 4JREC 1DBBH 4WNSA 2QQKH 3ULSA 5AW6B 5JW4M 1FZFA 1I9JH 4TVPL 2UX7A 2Z93B 4WDIB 4D6TD 3GXIA 1NTMJ 1AR2A 2RTTA 12E8H 2X7LB 3MFFA 2CR0A 3V2NA 1DBMH 4AVHA 2QEJA 3DX7B 1N8ZA 3B2VL 3CSPA 4OCNC 4WDIA 2QHLA 4FL4C 1LTAC 3FAXA 4KI5C 3WAJA 4MS8D 1QSED 5INCB 5FGBC 3OM3B 1U95B 3WMQA 3CZKA 3GPEA 2JCWA 4LK4A 3Q43A 3QUYA 2MKWA 2PNDA 4GS7B 1EO8L 4MCZA 4QXTB 3ZRFC 3MLSL 4F27A 3K5SA 2R0ZH 1U7MA 1HINL 3DYPA 3O45A 5EFIA 3ULUL 5IESH 3C1LA 1AA0A 3L54A 3OJDA 5I6KA 1BQRA 4FNPA 5FHBH 4L2LA 2VAAB 1N6UA 3TVMC 1H19A 1JZ2A 2J25A 3IF1B 4GOSA 2BNUB 3NRPA 5E08L 5DXWA 2YXVA 3HD7B 3IF1A 3MLXL 2J6EA 2GSMB 2B77A 3VGEA 5GGSB 2AJSH 1A6ZB 3LHPH 3B2MA 2V7QH 3UTTE 3VTMA 4OZ4B 4AVJA 3RK3E 4DGIL 3L74J 1YYLH 2LW3A 1KOAA 5C0NC 1A7RL 1SS1A 3PWLB 2F68X 2EXYD 2ORBH 2ZG2A 4Z7WA 1QHPA 1RURL 3MODH 2ICEB 4FNLH 4UMGA 4BSVB 1Q72H 5C1MB 4KDTC 1TTRA 2BWQA 5HY9B 3PRZA 4G42B 3RA7L 4GKSB 3STLA 5IHZB 4OLXL 1NAML 1RUQL 4IL6E 1JK9A 5AWNH 5HY9A 1HHHA 1KBWA 4M3LA 3R1GH 2C9QA 3DBXB 1JWMB 3NCJH 1TVBA 3ARRA 1FVCB 3BFWA 3SODB 3CVHA 1M57D 3DBXA 4FGMA 1JWMA 2V5YA 2VKXA 1QABA 3VXMA 4DW2H 2YIUC 3CSBA 2YGQA 3MOBH 1D5BB 4PQXA 3PP3K 3WUVA 5LG6A 3P0VL 3FTVA 4LLWB 1COBA 3T0VA 1FZCA 1PU0A 1RF0A 2CDGA 4JFYB 1TETL 1QTPA 4NPJA 5FKAA 3UZQB 5IFAH 1D5BA 1L7TL 2IV8A 4G80A 4YHZL 4RGND 3MRHB 1HT6A 1JTTA 1R5VB 1MZZA 5D7IA 1HS6A 1KCSL 3TCLA 3UZQA 1SQQJ 2M1KA 1L9OA 3MGOB 3WEOA 4OCSH 2UY7A 3L9YA 5JORA 4E42B 4ALAC 3J27A 5IFJA 3DRTB 5IVXB 2EC9T 2H32H 3VXUE 2MCAA 3PWPB 3DJRA 1IM9B 3MRNA 2CU9A 2JJVA 5IVXA 1TITA 4XTRD 5HDQL 5HPOA 4WUUE 1TYJA 4AGMA 4UT9A 1BLNB 3IMVA 4JZOA 4LSPL 4U7SA 1IFPA 4P2OC 1L9MA 3TO4C 4TLUA 1IGFH 4P5KB 2EO1A 5E6IB 3NCWA 2LLNA 3QHZL 2X44D 4MMZB 3QORA 4L3EB 3BP7B 3AUWB 4GRWF 4K55A 1MHPL 1FFRA 3K2MC 3ZT7A 3KCWA 3MXVL 1SJXA 3KAAA 5D71L 1UFGA 1H5BC 4XPFL 5DRWB 4X7EC 4K5MA 4OLYL 5F3HB 1A64A 2X53A 4JGMA 5DRNB 3VB8A 3TF4A 1MFEH 4YOKA 3IE9A 1QFUH 4ES8A 1FL3B 3BKCH 4EI5C 3EF7A 3HE4A 1H88A 2P48B 1MLBB 1F56A 1RZKL 4UT7H 2OQJA 1XF4B 3QEHB 4HC1A 5DJ8B 1DANT 2BNRE 2XICA 3MV9D 1GGBL 1T1ZB 3MLVL 5DJYB 2CDFA 3Q1MA 1VZGA 4XPHL 5FFGA 4O9HH 3QEHA 2YKOA 1WCBA 2COQA 4N2IA 1KTRL 2KERA 5GIRB 4P46A 4UTAH 1CLVA 4LGPB 2ICWI 3MUZ1 1QR1A 4KVNH 1DVFA 4XN5A 1RLBA 3EH3B 3UYOD 2J59M 3QIWD 2JB5L 1IGTB 4AVIA 4CMHC 3EYQD 4PH8A 3MOAH 4D6TG 4M62L 1SQXK 3N9GL 2X9YA 4J28A 4ZO8A 2VXQA 1OFCX 1SQVE 3V0WL 4GDOA 4XA4A 1WHPA 5IB2B 2W0LA 1CICB 1THAA 3C6LB 4QRRB 3EBIA 4NQEA 3RWCB 1N0XL 1N9PA 4FI6A 3T04D 3RIKA 2R7EB 3C6LA 1VGKB 5I1LB 3E7KA 1E6OL 3BJ91 5DDHB 2W88A 4KQ4H 4TLKA 3B7SA 2IDSA 3TT3H 4M43L 3QXAB 2X2IA 1UJTA 2E8YA 3UIYA 1JAEA 1VGKA 4HS8L 3ZYOA 5I1LA 1NZRA 1TR7A 5DDHA 2PW2B 2AJ3A 3QXAA 1F1GA 2R56L 1I1YA 3QFGA 5HYQB 1MW2A 4XNMB 2B2XH 2AI0L 3O2VL 1GSMA 3QZOA 5I6LA 4AK2A 2Y7SA 2IAND 2HTKC 2JQAA 1XH3B 4ODSH 4PD4K 5JXAH 4ZI8A 1FAIL 4XNMA 4HULB 5A2CA 4JB9L 4PJXA 1YY8A 1U9KA 4NP4L 4X8CA 4U3FJ 1JNLL 1SQPK 2P10A 1M3JA 2DMHA 2G2PA 4FG6D 1LEKA 4BH7A 1BAFH 4U4IA 1TG8A 2E0PA 3D7PA 2OA9A 3DHPA 4LVNC 1I1AC 5JUEH 3PHQA 4GRMB 3WN5B 3WUWG 1KD1Q 3VQLA 3BT2L 1FL6A 3D85B 5B21A 5IK3B 1JJUA 3RNQB 3OTTA 2QPDB 15C8H 3G6JB 5AOMA 3S98A 3WN5A 4K71C 1SQXD 2OLDA 3AS0A 3LX9A 1CXLA 4IMKA 5DD1L 3BLPX 2XG4B 1YAZA 2QVFB 5C0GA 1MNUH 3EUDA 3G6JA 2JKNA 3CCVP 1UCBL 2BMKA 3K4AA 2XYCA 1L0NE 3S4SG 5F7UA 1XZWA 4PLJC 2G9KA 3CLEH 3D48R 3GJFB 1SOKA 2AP2A 2NY5C 2VQ4A 3LZOA 3FFOA 2DBLH 3UJIL 5GS2H 2VN7A 2YXRB 2HKAA 1DIPA 1ZP0C 1SVFA 1VZIA 2NX5D 2VR5A 2XIBA 1R3LB 3TA3A 3SQRA 3C9NB 3H7LA 4F3FA 1MHHB 3SDXA 4LPXA 4M56A 5HYJE 4BV1A 1QMUA 4TVPH 1A1OA 3QWQB 3EHBB 4CNIB 1R3LA 2D8KA 2XG5A 3ZDWA 1KJ2A 2HLFC 2UY6B 2WPVB 2ZYIA 3D39A 4LVOB 3B2VH 1S1CX 5D1XE 4RZCB 4IRSD 1ZLSL 4OGQD 4B0MB 4YSUA 3CCJP 5DJTB 1QQDB 2BRRL 4PD4D 2XU9A 1YUHB 4RVBA 3RURA 1UWXH 5ERWB 1MDAA 3P73B 3E2HC 5HDBE 2Q5UA 1SQPD 1EO8H 2CM5A 2V7HB 5J6SA 2WYHA 3MLSH 2V9UA 3CH8A 4R0LB 1FDMA 3ULUH 4PJAB 5MERA 1HWGB 1NH4A 2H32B 4PEEA 2XZRA 2UZIH 5KYNA 1OAXL 5EMYA 5FGSA 3MLWL 1SQPE 3L45A 2V6HA 4PJAA 4YDJB 4JRLA 4XXDB 4XCEB 1ZMEC 3VD3A 2HFFA 4ZS7L 5AQ0A 3LMJL 1YEDB 1Z9SA 4LT7A 3G08A 4NO0D 3G5YB 1FN4B 1U4FA 4PJDF 4U0RC 1AQKL 3DWTA 4LLYB 4XCEA 4DTGL 1SP4A 1HBWA 5E08H 5I23A 5KKZB 3MRQB 3BN9D 3GEWB 4WKZB 3A23A 1IZKA 3B9EA 5CUSL 3BD3A 4ANXA 1JNNL 1IFHL 4CSTA 3WXVL 4CJ0A 3WUZA 3MZWB 3QUZA 1UM5L 4FERA 4TKWA 1MCKA 1KMGA 4N24A 3BKJL 2NY4C 1B88A 3B34A 4ZNCA 4DGIH 3UPCA 4H0IA 2NMSA 3APFA 3OR7B 2ZD0A 1A7RH 2XXMB 4G59C 2XV5A 4F7MB 1RURH 2CKBA 1DFBH 2GVYA 3BPCB 3QPKA 3CWBG 1OSYA 1ZANL 3D0VB 4OZHB 4M8UA 4K5OA 1IC2A 1XIWB 2C9AA 4WJKB 3RA7H 4XBPB 4OLXH 3LD8C 3L7FA 1NAMH 1RK0A 1CGVA 1RUQH 1SQBJ 3D0VA 4JPSA 4NB7A 1OAZL 4Q2ZA 2EDFA 3CDYA 5EIQA 4M7LL 1UWFA 1ZOXA 4HLZG 4LNRA 5DQ9B 1S7WB 3L75E 3CCRP 2ZAHA 1BF5A 3F6LA 5H94B 1L7IL 3TOPA 4APQC 3AABA 1S7WA 2QLYA 5BO1L 2P8LB 5E8DL 2B87A 2GEQA 5DJXB 4I4WA 2NY2D 2P52A 3DXAA 4KVCH 5H94A 3RLSA 3H6PA 3P0VH 1FFTB 5GTHH 1T3FA 2HFTA 5C3LD 5KS9E 1TETH 2FB4L 4WSGA 5BV7L 3P9MB 2IBZI 1L7TH 2CNYA 1U0QA 4YHZH 4PJGA 1SDDB 4UV4L 4XNXL 4DVBA 5LGYA 1KCSH 3CLWA 4WI3A 4DPRA 3P9MA 3SKOA 4HV8B 4PP1D 4PRPD 3BEWA 2JB6B 2VMJA 1OOAA 3HVDA 5AUMA 1ZW0A 1R17A 3MNWB 2N7AA 4WU5A 1HX0A 5IHLB 3NIFB 2JB6A 3W38A 2QQLL 5I76A 1Q81Q 1OGTB 4X9YA 2FEDD 2WBJD 4J1UB 3LXBA 4HZLB 5HDQH 3HI5L 3GKZA 1KGJA 3BIKB 4HHWA 1JF1B 4WV1B 1OIOA 3ZMRA 2WLMA 3WO4C 4YDIL 1HCYA 5HJ3B 5FYJL 2X9ZA 4AZ8B 1M7IA 3QS2A 2ZX8A 5TH2B 4PJ5D 3BIKA 3QHZH 4G11A 4PGZA 3MRKB 4WY4D 5DRZA 1JF1A 1BJ8A 5AG9A 1EHNA 4WV1A 4XP9L 4Y19D 3OWRA 2P5PA 1MHPH 3D3VD 4Z95L 2IOOA 5D71H 5APXA 5J7CC 3QDMD 4XPFH 1VGEL 3SDDD 3RU8L 3CV5A 4OLYH 4XX1G 4OU3A 1JHTA 4NO5A 5JOEA 5HVWA 3QG6A 3QDME 3UABA 2NCEA 1BPLB 1XF3B 3CN1A 1RZKH 3N04A 1SQXG 2A2QT 3B2UC 1H8SA 1S7XB 3BIBX 2XI9A 4N2OA 1X5JA 1VQ6P 1GGBH 3MLVH 2BW5A 1QSFD 3C5ZC 4XPHH 3TPUB 2I1JA 4WFED 4FQ1L 3S3BB 1TU3F 4F33A 3GUFA 1U8CB 2X6CA 3KWUA 4MNQD 5ID1B 4N85A 2WSFJ 4AQ1A 1E6JL 3KYKL 1CPUA 5E6YA 2FK9A 3TPUA 4ESKA 5BMFL 3IF4A 5F9JB 5J1AB 3TIEB 2FYUK 1HH0A 4H13C 2JB5H 5I8EA 3T2QA 4KK5C 1TCMA 4KC3B 3B9KC 2H26A 5AVSB 3QFDB 3Q3DA 1XCTB 4ORZC 4D8OA 2FE0A 4KXZI 4M62H 4P5RA 4UBDC 3KL3A 2BVTA 32C2A 1AZUA 1SDAB 4FI8A 3V0WH 1EDQA 1AOHA 3OKEB 3QFDA 1IM3B 5HHQA 5DU7A 4EZLA 3QIBB 3LKRA 4CVZA 5KN5A 1TO5A 3S3PA 3GZOA 2A9ML 3H2WA 3OKEA 3ZX1A 3R2PA 1E6OH 5FYKL 2FTAA 3QNYA 3SBPA 1NU1J 3QEQD 1KDIA 1JP5A 4M43H 1A6TB 2V0AA 3CDGB 5GGRA 5CM1A 4FQ2L 4HS8H 1CGSL 4AQAA 1NDMB 4LVEA 3BKYL 3ZKSD 5ECJE 5LLIC 3CDGA 4E9WA 4P9ML 2YEQA 4I48A 2VERN 2DWDA 2C9RA 3K8MA 3E6FB 2Y1VA 2AI0H 3H1JD 3FT3B 4MJ5B 3HC3L 1B6UA 3Q0HA 2Z4QA 4B9IA 5F6HI 4IRZL 2X3CA 1X9LA 2BM3A 3LKPA 1FAIH 3LPGA 1VF5C 3NIGF 4JB9H 4NP4H 4UAOC 1JNLH 2FXPA 2ZAEB 2AEIT 5E6RB 4DOJA 5DD3L 4G8GE 2JIXB 3F12A 1TYRA 1UQSA 4IJ3B 4WJG3 1JMZA 2FYUD 3OB0K 1X3DA 5LAXA 1TVDA 3UTTA 5H2BB 3BT2H 1UENA 4PGBB 4LLDA 3GINA 3ET9F 1RIHL 5C39A 3CLQA 1C5DA 5DD1H 5H2BA 2AQ3A 2C3XA 3GMOA 4C4UA 3WLBA 3VDBA 1NDTA 3WHXB 2RCSL 3ZIYA 4FZEL 1UCBH 1ZK9A 3WE6B 1NJ9B 5HHMD 2X0VA 2EYRB 4G6AC 4O02A 1EMTL 1WPCA 2B59A 4MA1B 1N4XH 3RIAF 3UJIH 3WE6A 2E75D 2J5UA 3U48A 3RL1B 4WWPA 4FMKA 3TEUA 1WVZA 4YDVB 3VYPA 1AKPA 2QJDA 2FX9L 3A21A 1VKXB 2ZZUT 3TBWB 2CSPA 2BXYA 1UT2A 3NESA 1EBPA 4IKNA 1EIBA 1NKNA 3L6FB 3QPXL 3WGUB 5BCAA 3MU3A 1A4BA 1ZLSH 4Z0BL 2C4FT 2YAPA 1YEJL 3ZKXB 1IVLA 3VO0A 4MDJB 1LT9B 2EZ0C 5L2JA 3POHA 3RDTC 1KXQE 5ABAA 3RB5A 2IJ0C 3U9UA 4CMMB 4M1CC 3IDIB 4PWEA 2D7NA 3RL2A 1OCCB 1UGNA 1CFQA 1OAXH 3FO2B 3IDIA 3IJHA 4FXGB 1ZTMA 2EDWA 3GSUA 3LN5B 3VXUA 1ES0B 3NP3A 2X4PB 1S7VB 3P8CD 4ZS7H 1PGQA 3FO2A 2IPKA 1TPXB 2CG9X 4FXGA 4J4PD 4RGOL 3LN5A 1ES0A 4DTGH 4WUUA 5CCGD 2QDVA 1YVLA 2HN7B 4KMTL 4ACPA 5EZPA 2HFEB 3QWOB 3F6IA 3T08A 5CUSH 1JNNH 1IFHH 1L0LK 4OJAA 2HN7A 3U0TB 4YSSA 2XYBA 3WXVH 2J5LB 4L9LB 1UM5H 3QWOA 4GRWE 2NPLX 2X1XR 2YIHA 3BKJH 5CEYA 3IR9A 3K4ZA 1JM0A 1VJSA 5DJDA 5JW4Q 2PW1A 2JFCA 4AL8L 2HB0A 5IB5A 4M7KL 1NIFA 3QARA 4IKJA 4KO5A 5CCHD 4PY8J 4N0UB 2BNRB 1ZANH 2OMBA 5KLIB 1KTKE 5KOMC 3ME0B 3SDAB 5KW9L 4Q9QL 2Z5IA 1F4HA 4YUEL 2QIWA 3RVUD 3B3IB 4BIKA 1AOZA 2EJ1A 2BNRA 5DVOA 5CCHE 2VLRD 1OAZH 2WXIA 1SM3L 2KOGA 2K1MA 4KGLA 4M7LH 2YMYA 5I19L 4Q9RL 3ZL1A 3B3IA 2O5NA 3DJ9A 1CD9B 1T7VA 1AGBB 1IZNB 1L7IH 2Q1KA 4Y2DD 2QGEA 5BO1H 4OGAD 1A2YB 3B8EB 2PYFA 5E8DH 3CFJB 5SX4I 3N7NA 3LV3B 3RGBA 3VFPA 1USEA 2FB4H 5B38B 5BJTB 3QZLA 2CCWA 5BV7H 5F9WB 5TDPA 3QDJD 3T3ME 5A6IA 1TU2B 2J1KA 1JO5A 3AMKA 1WCQA 3LV3A 4UV4H 4XNXH 1HKLL 3BPOC 2R0KL 2W9LA 2WXFA 2BRQA 2H47C 2NDGA 3HG4A 4AENA 3CZSA 1X7TA 5KTBA 1TU2A 1UWYA 1L0LD 3GUTA 4RWYL 3UDWC 3NRFA 5E2JA 4MDIB 1E30A 4PRNA 2QFPA 3FHAA 1I7RB 4F9PA 4HWBA 1ZVHA 4WZ9A 2N0KA 1S5HB 2R1XA 5AYTA 4ELMF 1Q9WA 3HBGA 3NDZE 3HI5H 4N6QA 4YQXL 3G3LA 5F72S 2D2CB 2Y7QB 1EK3A 3QJUB 4OJFL 4YDIH 5FYJH 4X4ME 4UM9A 1ZGLA 2Y7QA 3CSGA 1M6OA 1UM6L 1SY6A 4MRBA 3K71B 3IPEA 4XP9H 3KMDA 3VFUB 1EXGA 3N85L 4Z95H 4HIQA 2CBMA 1HZHL 1PP9J 5E5LA 2MCG1 1VGEH 1X9RA 3K71A 3RU8H 1QTYT 3VFUA 2FYUG 1PPJD 3H56A 2V4LA 4XAKD 5D6DA 2ZUWA 3V6FB 1DCEA 5E1IA 2QV4A 5I0ZA 1GZPB 1HEZA 1P4LB 4N20A 4EIUA 1RE3A 3KGRA 2PETA 4JJOA 1PPJE 1R19A 3QUYC 3V6FA 4XAKE 4E2OA 5INDA 5SWQB 4IL6X 5LDSA 3VI3F 1FZGA 3SYAA 3SB3A 3CHRA 2PP7A 2XPYA 4JO4L 1YRKA 1WAAF 3D4ZA 4I9WE 3VFGL 4QEGA 4ZFGL 4FQ1H 4GS7C 4NUQA 5SWQA 3RVXD 4YFDB 3VE0B 1FAKT 2V3EA 4HMCA 3RL0B 4BJLA 3ATDA 1E6JH 3KYKH 5HHVL 5BMFH 3QGVA 1ZHNB 1J5DA 4XMWA 2K9JA 1ZHNA 4KDVA 1LILA 3ARYA 3U1SL 2O1AA 5HYJA 4L0YA 4AMWA 3DPBB 5D1XB 3RL0g 4JKPL 1NBVL 2YKKA 3HUJE 4RDQG 4HZ1A 3UAEA 2V2TB 4BE5A 1P7KA 1J1EB 1CDHA 5IWLC 3HD7C 3FU6A 5FDWB 5D1XA 1Z9MA 1LEGA 1T0NB 2F54E 2R0LL 5DVKA 5HDBB 1S5LE 5KSUB 5F9DC 1KFMA 3D18B 3V10A 4CU7A 2DBJA 4N2HA 1U2YA 5FYKH 2HSIA 4N1CA 3DIDA 4JN2B 5FDWA 4HCFA 2COVD 1FNAA 5KSUA 4IRSA 4S10A 3KZ8A 3VRIB 1CGSH 5E4OA 3TA4D 3BKYH 1P1ZB 2H6OA 3HE7D 4OF7A 4JN2A 2ICEC 3UROR 4JPWL 4N8VA 2DQIL 4J3OC 5DJCA 2IPUK 4P9MH 3VRIA 4XBMA 1NKGA 1BBDL 1P1ZA 3WFHB 3ZPDA 1DSFH 4OZFA 4PBWD 5FV1L 3ESMA 1PPIA 3HC3H 1OWWA 2KT6A 5KVDL 4FLRA 3VGDA 3EO0B 3ZSTA 4JFFD 1S5IH 2VQ1A 4X99B 1KYOI 4FFTA 1AXSB 1WYJA 1N2RB 4MXQD 3VXNB 1T6WA 2YBRA 3DX6A 1F6LL 5DD3H 3ZDMA 2WNKA 5DURD 4O5LL 2CUAA 2Q76B 2CM6A 2IADA 4MRCA 2GTQA 3UBFA 4D7BA 4WWID 4DO4A 5A3IC 5DSCB 4U2YA 3GK8L 3MI6A 1FZCC 2JCCF 1RF0C 2FNWA 5CINL 3WIIL 1X5HA 3H1HJ 1D9KB 2YD7A 5EBGA 1N7SB 1VQPP 4ELKA 5DSCA 3OAYK 4OF6A 1JPFA 1FA4A 1HHGA 3HG1E 1JTOA 1RZ7L 1RIHH 1DQTA 2UYLA 3W0WE 2CDEB 1D9KA 4GAAA 1GL4B 2RCSH 2QJYB 2C1PB 1KXTB 4FZEH 3MRFB 5AVQB 1E9PB 5ICYA 4UQ2B 2JJLA 1KCRL 1H3VA 3CD6P 1KYUA 1EMTH 2P24B 1AQDB 1FUNA 1CF8L 3MNZA 3IDJA 1KQSO 1ETZA 1E9PA 3OF6D 3HKZA 1NWQA 4PWGA 2P24A 2Y7NA 1W72A 2FX9H 1Z1WA 3FRPG 3FUKA 4IM8A 2WSEJ 4PB9L 1CI3M 4JX0A 4X6DB 2XWEA 2XV0A 4S0SD 5KS9B 2QGCA 2BK8A 3QPXH 3PGDA 5E24E 3A6CL 2CK0H 1BHGA 3CCSP 2BS9A 4KUZL 5C0CE 4Z0BH 4MMZC 5KS9A 1YEJH 1O6VA 1C1EL 1L3WA 3G71P 3SOTA 5EO1B 4ES9A 5FOBB 3QQ3B 2DQEL 3ARQA 2BY2A 2XWJB 3SYCA 1KILD 1FJ1B 5F7AA 2H88C 1ZWIA 2WIIB 3VSUA 4IBUA 2WT7A 2VXUL 3QQ3A 1OT4A 1LTJB 1L9RA 2NR6A 5FOBA 4Z6AT 5B3NA 1JZ8A 1OQOA 1QLEL 3HC0A 5GGRY 1DBKL 4PRDB 3DJTA 3N40P 2WIIA 4GQ9L 2JKIS 3QXTA 2IQAA 2JKJA 4RGOH 1CTNA 1TJIL 4P46C 2UXTA 3IJSB 4LL9A 3QIUB 1A6VL 2G75A 4KMTH 1DVFC 4DZ8B 1MOEA 3V5KA 3MJ7A 1O0VA 1KIUB 3W39B 3M88A 3QIUA 1MZ9A 3DVGB 4XX5A 2W6JH 2F18A 4F1SA 2QJKC 2VSMB 3ZY7A 1E90A 3MR9B 4JFXA 1G1IA 4S1DC 3UADA 2NXYB 3GS4A 5C8JA 3JBG7 1ZSDB 4YX2L 3WFEL 4AL8H 1P5UA 3VFWB 5FO8B 2UZYA 4KZCA 1IFGA 4Z5RA 4XMKL 3QDMA 2AEOA 1FJPA 5IQ9B 2A6DB 1ZSDA 3NJMA 5C0BE 1SLUA 3C6LC 3ISWA 3UEZA 1VFBB 3IDXH 1M1KQ 3KJ4B 5FO8A 2QGDA 5KW9H 1ZD6A 2JLLA 4H25A 4HS3B 4Q9QH 1PLAA 1HQRA 4YUEH 2BCCD 2DEXX 2ZYHA 4OWFA 3BDXA 4I77L 3WNNA 1SM3H 4XB7A 5E00B 5I19H 2CHZA 4Q9RH 1BQLL 4OLVL 2OJ1A 1OX3A 1PY4A 1HL9A 4IBSA 1E2ZA 1GRWA 5I8CA 2W0PA 4ONFH 5T1LD 1ZXGA 4GSUA 5EORL 3TEYA 1R5LA 1TZGL 1W6WA 1EXUA 1NAFA 4YAQB 1Z5YD 5CGYD 2B5IB 1U58A 3ZE2F 1HXMB 4M8VA 2IBBA 3GBLA 4LIQL 4DP2X 3EFGA 5DO2C 1RV6X 3FT1A 1WFUA 1I53A 2IBGA 3LZFL 1HXMA 4DUXA 2CMRL 1HKLH 1T20B 5D7JA 3BOVA 3NT0A 3WY4A 2NT1A 4Z7NE 1F3DJ 3ETBF 4S2SB 3TBYB 2DWXA 5EDSA 4RWYH 1T20A 1HTLC 2FD6H 4KAQL 1RQVA 3WN5C 4NNPL 2R2EA 1USZA 1FYHB 5GS0C 1YN6A 5F9AC 2KBGA 3E1F1 4YQXH 1XAKA 2HZHA 1OZTG 1MCDA 1FFPB 1Z6JT 3CDCA 2DW3A 4MZ3A 4OJFH 5D2NE 2VRSA 5IQNA 1IIIA 1IE4A 1M8OB 4GUOA 1JPEA 1JY3N 3KPRD 5T3XD 1FFPA 3SD2A 4ZW5A 1UM6H 2B4CC 3CHPA 4LP5A 5SWSB 3N85H 3UIAA 2WXQA 4G8GB 3BXNA 4FTDA 4ABUA 1HZHH 2ESVE 4MQXC 3MTRA 4G8IA 4PJIF 2I60L 1Z0NA 5IMMB 1QG3A 2J2ZB 4KVPA 3V9CA 1AD0B 4G8GA 3P4NB 5JYLA 4TQEL 4CDGC 1VZHA 4HMDA 4PWFA 4UYQA 3PF2A 1JVLA 2Z31A 4W9ZA 4AUUA 1UZ6F 1P9MA 2FCBA 1H6FA 2BSED 3AG2B 2XZAL 1BCCE 1F4YL 1JZ3A 4FNQA 4J2XA 1AQMA 1N10A 3KPTA 4KKQA 4AEFA 1R3HB 1QKZL 2IZ1A 4JO4H 4O2EA 1RF1B 2Y5QA 3IKCA 3VFGH 4BKLA 1FNSL 2B89A 1NOAA 4R0LC 4HDIA 2Y5TA 1AZRA 5HHVH 2BVYA 3FC8A 5B8CB 5ES4B 4XWGL 4W9DC 1A21A 2E8ZA 3FN0L 2QQQA 5TD4A 2C8NA 3U1SH 3LSOA 5D1ZB 4F7CB 4F93B 1IK9A 2W8ZA 2IPUG 4HK3J 1LGHB 4JKPH 4X8GA 1NBVH 3VNZA 1UKSA 4PTTB 3FO9B 5CBEA 4P9HH 3NQIA 3H54A 5EU6B 2R0LH 5EBWA 1HJBA 4H26B 2Q87A 1VHPA 1IJ9A 1AY1L 1RSFA 1WZKA 2XXCB 5AVYB 3GMPB 4P5MB 4PTTA 2R23B 1WA2X 4WNJA 1KXQA 4H26A 4JQXA 4U1SB 5HI3D 1W80A 1RHZB 3PUCA 3HZVA 2R23A 3BGFB 7PAZA 5ID0B 2YN3A 4MKMA 5KAIH 1S7SA 2DQIH 3EJYC 4YO0B 5DA4A 2C9LY 4CN4A 1BBDH 1XIWC 4U1KB 1SLQA 2WTOA 3QNFA 1OKEA 2AXFB 4FQCL 1TTCA 4PJ9B 3DO3A 2VB5A 5KVDH 1U93B 5HI5C 2PAJA 3BAJA 4GH7B 5GGTA 5AVUB 2VWEE 4U1KA 4EN2A 3L08A 1M90Q 2BVQB 3V4PL 3ASWA 1IQDA 4OD2B 4GRWB 2R69A 3DUUB 4L18A 3LRSB 4L4VE 2YOAA 4O5LH 4TPRL 5IT2H 2EH7L 2BVQA 3WIIH 5CINH 4OM0L 1V5JA 4U6HB 1ZLEA 5BZXA 2X4OA 1PCXA 4ZUWA 1RZ7H 1PZ5B 2AXJA 4HX1B 4BSJA 3IBOA 4U6HA 1RJZB 2HG5D 4LOUC 2ZP8A 3LCYA 2BCCG 1PZ5A 3LNIA 5EIIG 3UBXG 2D7MA 1KCRH 3TZVD 1N0LB 3EW3B 5KUMA 2Q10A 4JW3A 1FFNA 4ZMTA 1CF8H 5CCHA 4JGJA 1BE3E 2Z34A 3ZYZA 5CBAB 4PLNC 4GBXB 2AS5M 4XAWL 4AIOA 3T09A 2TRYA 1JOIA 4KK8C 3CUPB 4H8HA 2W9DL 2CO7A 4M4RB 4PB9H 3UAFA 2E9WA 4OFDA 4UM8B 2CRIA 4Z7VE 5I30L 1MCPH 5DJZA 1HWHB 3CUPA 5D55A 3X1NA 4WV1C 4S1RL 5L8RJ 3A6CH 1BIHA 2P5WD 1V54B 3U4AA 4WO4D 4KUZH 4GI9A 4E68A 4XXWC 5DJ6B 1C1EH 1F6FB 1GCYA 1PAMA 2DQFA 3NSDA 2BSRB 2IXQB 3LKQB 4DUVA 4XT1C 2DQEH 1GY2A 2NRDA 5I6XB 5DJ6A 4TT3H 3K72B 3D9AL 2P49B 2IXQA 2HKFL 2VXUH 3MA7A 3HTKB 3DETD 4OY9A 1M7DA 1YJDL 1QLEH 1EAPB 3MO1A 1PD6A 2IH3B 3K72A 4OB5L 1KIQA 4GQ9H 4GAFB 3BZ5A 5GSVB 3Q5SA 3X17A 4B41A 5MI0C 1J05B 2ATKA 1D5XB 1TJIH 4OGYL 5AOIA 4ELME 2OMVA 4AQ1C 2IH3A 2FQGA 2JF1A 1A6VH 4LBEB 4MQ7B 5ADPL 1D5XA 1S9WA 1MCSA 2GTWB 4WBAA 2OXGA 1AP2B 4UUJB 4X4MA 4AQEB 5EEZA 1TF4A 3RTQA 4U7MA 2WPGA 3NJIA 4Z7OF 1BD2E 2GTWA 4K3HA 1R3JB 1AP2A 3B4NA 3HB3D 4HOXA 1CFTA 1PZAA 5DLLA 3Q2WA 3GXNA 3WFEH 1G7LA 3DX8B 1HCFX 1MI5B 4XMKH 5I5MA 4JG0L 2OPCA 1G7IA 3QIBC 4AIZA 3ARDA 3DX8A 2FHBA 2XETA 2AMUA 1WGVA 1UIXA 1DQDL 1S9XA 4MB3A 1OK8A 3WMM0 4M93B 2RBLA 3N42F 5FO9B 1EHXA 4R7VA 1KGIA 4U1JB 5IMLB 1CBVL 1BQLH 3FUNA 4OLVH 1R3IH 4EDXA 1OVRA 6FABL 4F8QA 1QRND 2I7SA 4U1JA 5IMLA 4IFFA 2J7LA 1Y0LB 1TZGH 3H1ID 2LV4A 4FFVC 2JJSA 3VFMA 2YRZA 1I8AA 3QZMA 3DYMA 2YAFA 3QFJB 4WGKA 1JSYA 5L2KB 5J12C 4LIQH 2BP0B 5KVEH 1WE5A 1PLGH 5IEHA 2CJTA 1M7XA 3M06A 1OLLA 4R7NB 4A7GF 4BZ1A 3LZFH 3G5ZB 5AOJA 2PYED 2X41A 4JFOB 2CMRH 5KJ4A 2BP0A 2NYYD 3AROA 3L4YA 3DVFA 2AJXL 4RMTA 5B4MC 3KWVA 3CZLA 2EH8L 4JO5A 1RAMA 4LLAA 3G5ZA 4JFOA 2F54A 4NOFA 3RK3C 3OZKA 4IJ3C 4HXAL 4EN3A 4KAQH 1PGPA 2N1TB 1L9TA 2P8MB 2XXFA 4UT6A 1G6VK 5EC2A 5E9AA 3A5VA 4FLQA 1CD0A 1OAYH 2OKMA 4P23D 1XTGB 4FFYA 1REIA 3VGGA 2C5DC 3L72J 1DDTA 3D2UB 3S8WA 4GAYB 4Q58C 3IU3A 3QULB 3LKSB 1NC2B 1BXXA 4YHIA 4UZUA 4DP9X 3D2UA 1F4WH 3JWDL 4G6JL 4PJDB 3CHQA 4JKMA 4W9KC 4XNUH 4C58B 4MA1C 3NGBB 3B6SA 3ULVE 2EEAA 4OI8A 4U3SB 5GRYA 4N2NA 2PCFA 4NYLB 4WWKD 4NNXB 1Z5LA 4HUUB 3S35L 5FB8B 3ZHFA 3T3PE 2VL4A 3BPLC 4Y4HB 3I6LE 5D1QB 4NYLA 4Z3TA 5H4ZA 2YA1A 2ZFCA 4TQEH 1EZVE 4H4NA 2ZUUA 2JCCE 3W0WB 3KYNA 4KV5F 1VACB 4GODA 1W9XA 2XZAH 2HLOA 1F4YH 3HG1A 3W0WA 4C56B 1LE9B 1HHJA 1WTGT 4CKVX 1QKZH 3HAEB 5JPMB 1LT9C 3U46B 2ZKXA 1RE4A 1FNSH 3EYVB 3EZJB 3OKKB 4LVHB 4M5YL 4JS7A 4MD0A 5D7HA 4P99A 3SZKC 4E5XB 1LM8V 4U1LB 4F9LC 2XWTB 1KV3A 1NTMK 2V3FA 4WAFA 4HXBL 2UV3A 4XWGH 3NVQA 3OKKA 5H8DA 3RAJL 2Z91A 5FS5A 4FXGC 2J73A 4U1LA 2XWTA 3WKML 3FN0H 1AYOA 3BD4A 5CJBA 1ED3B 3VQ1C 4JBZA 1TPXC 3TT1H 5J4MA 1KY7A 3RK2D 2VXQH 4TUJB 1OOWA 4Z3EA 4WI7A 5K59E 2IX7C 3RGUA 1QFPA 4DQOL 5TJHA 3QWOC 1DTUA 3U4EA 3CVIL 1PW3A 3NPSB 2G60L 1MZYA 3Q8CA 5HVGB 3S96B 5KSVA 1U8MA 2R5DA 3W56A 3PP4L 4JDEB 5C0CA 1JD7A 1AY1H 1YAIA 4NRXA 5J6HA 3LN4B 4L9LC 2FFDB 2Z3FA 3PNWB 4L1LA 2ATPB 3BVXA 1QFWM 3H9HA 3BQUD 2EDYA 1URQB 3UAJD 4N78D 4TTGA 2QVIA 5JIPA 4G7VL 4POZC 1CT8B 4UQ3B 4R7DB 1URQA 5IHBA 3SDAC 4V2BA 4N78E 4K2UL 5DCCA 4AI7A 2WXHA 4PRBB 4OKDA 1UA6L 4FQCH 4EQ2A 1AR1D 5EEXA 4Y5YA 2UUDK 2A3TA 3PV6B 4OLZL 4X8JB 4HEPA 3V4PH 3MAWA 1R1CA 1F13A 5DUBA 4I5BB 1NTMD 2WITA 4MN4C 2F9BT 4R7LA 4TPRH 3STZB 2EH7H 3O4OB 5DLML 4X8JA 3WS6A 4DCQA 4U6YB 1PBYA 1OP9A 1OE3A 1HHIA 4OM0H 2XIDA 3D25B 3STZA 5GS1A 1NCAH 3CDZA 5IOPA 5SWZE 3B2XA 2F08A 4U6YA 4K9JA 4KJPD 1SXZA 4AQ8A 3DOSB 4PB0L 3O6KL 5F9WC 2VMEA 5C0BA 2H8PB 1YQ4C 1CFVL 2KS1B 1B2WL 1NGMB 3GF3A 3SE6A 1I1CA 1XGUA 4PCSA 2YPVA 4WFFE 5LO7A 2H8PA 2EIBA 1D6VH 5ENWB 5MEOA 1VB9A 2ITCB 2OJEA 1NCOA 5BZWB 4HBCL 4NLAA 2BP8B 4XAWH 1DEBA 3DTXB 1QZ1A 2QJPB 2W0FB 2W9DH 5F2FA 1ZGLP 2EIZB 4JO2L 2KYVA 4JHUA 5T1KB 4A2FA 3UH8A 5BZWA 5I30H 4MKTA 4ELDA 2R2BB 2D2CC 1SQQK 2HFGH 1XGPA 2ZONA 1N2DC 3VXRE 3KXFD 2EIZA 4S1RH 4FAAB 1UADC 5LN4A 2H6PB 3TEXA 3F00A 3GRWA 3S5LB 5LCVA 3Q9PA 1CIUA 1PDKA 3HRZB 2DQTL 2H6PA 5ABDE 3L74D 3VD2A 3NFPB 3S5LA 2EYTB 4UNVA 1SOQA 1ZRTE 3HRZA 3CCLP 4XCYA 1KB9J 3H9SE 2YFOA 1RE3C 2LQRA 2HKFH 1U3HA 1PZUB 2D7QA 1SN2A 4KTGA 4B9CA 3WSQL 1HYRC 4V11A 4YDNA 4OB5H 4NERA 3PHLA 4C59B 3MNMA 3EGDA 5D2NB 4OGYH 4BD4A 4D9RD 4BEIA 3MMEB 4X9HA 1MHEA 2BSSB 5AZUA 1I7UB 1Q82Q 5ADPH 2K6WA 3T8MA 4AUJA 5D2NA 1K5NA 5BO0D 1IKNA 1J88A 3NIGB 1I7UA 3FOMA 2KK7A 4W6WB 1XF5B 3G9VA 3CX5H 1BPVA 2A7BA 2DTSA 2ESVA 3DIVA 1HZKA 3DLQR 4OKVA 2WTRB 3JWOC 3RPIA 1W5CE 1IJDB 2WVRA 2QR0A 3TBVB 1BV8A 1K04A 1QPKA 2OR9L 5D1XC 3AB0B 2WYTA 1SQQD 2R1WB 3FSZA 4JG0H 4J3VA 4R2GD 2EO7A 5CP7B 1SJEA 4Z9KB 3LPOA 3TBVA 4A38A 4XNDA 5GJTL 1J1EC 4ABVA 4CKQA 1DQDH 1YDPA 3FB6A 1MVUB 1T21B 1OIPA 1J1PL 5EDXA 1KB5L 1CBVH 4I0PD 4D9QD 3L4FA 2P28B 2K70A 3L71J 4OFKA 6FABH 2IQ9L 4NN6B 4YHNA 4G43A 1OGAB 5F7NC 1T21A 1JDDA 2OTPA 4IOFD 1WUZA 3T2PA 4BRYA 2NY6D 3GB7A 1E4KA 2DI9A 1H9DA 1B4TA 2O4EA 4N8PA 2SEBB 5C6PB 1J1DB 5JDJA 4KNQA 4PSPA 1RZIA 1HDMA 3LRLA 3HIZA 2BCKA 3JV6B 1JZDC 3RJOA 3MRCB 2XNDH 4YFLI 2CRYA 1BGYE 2AJXH 1AXIB 4JG1L 2AXWA 2EH8H 3FHQA 2YN5A 3JV6A 5ETUB 4GG6F 1JCDA 4IBZA 5FLVA 4WGVB 2ZOKA 4K9EC 4HXAH 1W2BO 2DQJL 4BZ2A 5IB3B 3HI1B 5L7XL 4J3SA 5D96B 1D9KC 4X9IA 2K6YA 4Y5VA 1MRDL 2CHDA 1ZJAA 4Y1AE 1D5MA 3N91A 3Q13A 4HZAA 5G4NA 3RWEB 1BMWA 3IKKA 1NEZA 2PKDA 4FQXA 4HWBL 5FA3A 3WIHA 2EIMB 1UOWA 3KLDA 3PAUA 5BVJB 2QJYC 1SJVA 3RWEA 3EJSA 4G6JH 3JWDH 1J11A 3I75B 4Q14A 1Z7JA 4Z7QE 1MREL 3O8XA 4HKXA 5EPMB 3U30B 5BVJA 1MNNA 3DIFB 4NT6B 4KZEL 5EZIL 2FQEA 3V4PB 1LD9A 4L05A 2XWBA 3S35H 2YD0A 5E5MB 5EPMA 3DTDA 1NTMG 2O1JA 4NT6A 3CK0H 2G2NA 4L4VA 2ZUXA 2DJUA 3O6FD 2VOTA 1X7QA 1YO4A 3HG5A 3OBAA 3OC5A 3RVVD 3SYPA 1GGIL 2K9FB 4WI0B 4HGWB 1VQLP 1WWCA 3W9EB 4PW4A 3AXLB 3SKNB 1OF0A 3MQIA 1E0OB 5ECGA 5EO9B 4NQVB 2XKSA 4FG0A 4KUCF 3W9EA 2PO6B 3DYOA 4M5YH 3SKNA 3DURB 3MCYA 2NR6C 3BVVA 2FT7A 5CWSB 2P47B 3ARED 1GS8A 4RFNB 1I4FA 4HXBH 2IFMA 3FUJA 1E3FA 3B5GA 3RAJH 2NZ1A 3NIDF 1YY9D 3MROB 2JK5B 3WKMH 2UXGA 5DTFA 5E2VL 2XTJD 3GF7A 5AW0B 2BY0A 4J8RB 1IEBB 5I5JA 4KKLC 4MXVF 4KHTL 3FAWA 5GZND 5C9KA 4U3FD 5F1NA 2JK5A 4Z7VA 2I1KA 2BY3A 4QMEA 3WEBA 5AKRA 3QIUC 3TJEL 3OQRA 3TBSA 2OMXB 4DQOH 1IO4A 3GYRA 1SXSA 3CVIH 3NJHA 2G60H 4UNIA 4FRWA 1GSKA 4I6MC 3FTXA 3PP4H 3L74G 1SFDA 4ODHL 4HLEA 1MW0A 1P5UC 4V2CB 3S36L 4G7QB 1A6AB 2NXYC 5K93A 3OMZA 2O5YL 4L4TD 4N4YB 3MRPB 2DYPB 3K74B 4WO4A 2EE3A 2PCYA 2X4UB 4XGZB 1FNEB 4MASA 4G7VH 3P4MB 4LCUA 4MJ4A 1YQ3C 1E8XA 2DYPA 4WCYL 5KVMC 3KJ4C 2OBGA 4K2UH 4N28A 1FNEA 4ELMB 3P4MA 5ICUA 4D2NA 4ELMA 2DF3A 3MUGB 4OLZH 3OWEA 1L6PA 2ZNWA 3G6AB 1BD2B 2C1OA 3MUY1 4JFHE 4MJID 4Q6IB 1BAGA 3CFIC 3B5NB 4GQZA 5DLMH 2FHCA 1AGFB 1BD2A 3BAYA 4JFWA 1IBBA 3FFCB 1CD8A 1JTHB 2FWSA 1SQBK 2Q3IA 1IV8A 4I18A 1SQQG 2XPGB 1EFXB 3IGUA 3O6KH 3TK1A 4ILDA 4NWTL 4PB0H 3MOQA 3B7TA 2AMGA 3GXFA 1IAKB 3VI3B 1CFVH 4YEEA 5E70A 1WIUA 1B2WH 5JDSA 1A02N 2X6VA 2NY3B 5JHDB 1BA9A 2B9BA 1IAKA 3A4EA 4XWOD 1DUYB 3AW5A 2YPKA 3BH4A 3QJHB 4HBCH 4HKZA 4LCWD 3V95A 4OFVA 2MJWA 2VLJE 4Z7IA 1RPKA 5I1DA 4JO2H 4MD5B 4R7XA 3M07A 4F37K 1DUYA 3WS3A 1S7UB 1NUGA 4YSEA 2YC1A 1HFUA 3FCUB 3GG2A 2XOTA 4JRYE 5F96L 3OD3A 5ESVA 1NTKE 1PYWB 2GSIB 1S7UA 4LGRB 4YIQA 5BQDA 4KJMA 1DEEA 1P4UA 1W0VB 4KITB 2KUBA 2DQTH 2ADGA 1U8LB 3CMGA 1XTMA 2YRPA 5TF1L 1S8DA 1Z32X 4ZSOE 4JRXB 4R96B 5KSBF 2Z31C 4XE0A 1KACB 5KLVJ 3I02B 3L1EA 1P9MC 4NNYA 1T4KA 3NN8A 4BFIA 3L3IA 2BIHA 1U8LA 3GTVA 3LQMA 4NPDA 1A4CA 2D03H 1JPSL 2I25N 2WO2B 4I89A 3RIFK 3WSQH 4N2GA 4QHKI 4P3DB 2AW2A 2FJFA 3AUVA 1FOSE 1SQBD 3HN5A 3L1FA 4HHGA 5C0FA 1T2KD 2YEZB 5HJGA 2OQQA 3GO1L 3OA7A 3O3BB 3GSRB 4NCDA 4Y5XA 3ZRCC 1E7VA 4MMXA 1YHPA 4WTQA 5I6MA 3FQTA 1MWAL 1YNTA 3D34A 2OYMA 2X2UA 4WHYG 5I24A 4P23A 5EWIL 4IK7A 4M7LT 4JF7A 3O3BA 3AT0A 4A7VA 3RY5A 4HYTB 2LAAA 5B8CC 3QQ4A 4RISH 4DF9A 3GM0A 1N3NB 4GW5A 2P5EE 4UOJA 5E51A 2JCCB 4OV5A 4FLSA 1YEHL 4OSUL 5D1ZC 2ZKYA 4QCIA 2OR9H 1MXDA 3VSVA 3LIUA 43C9B 4X98A 1A02F 3BVDB 4NQUA 2WPRA 4UB0L 2JCCA 5E6UB 1MJ8L 5GJTH 1PQZB 3FQ4A 1ZLWK 2OYKA 2H43A 2J44A 4ZKPA 3DDFA 5IM7B 3ZT5A 4JQXC 2VR4A 2ZUYA 3PWNB 4WEEA 1QO3B 4YK4B 3FB8B 1J1PH 4IOIH 1DYZA 3PRJA 1KB5H 2Q3EA 3PP3H 1KV7A 4ASWA 3CFEB 4LOEA 4ECNA 2EVJA 1R5IB 1XBDA 2IQ9H 3PWNA 3AE2C 4WI4A 5DEZA 2ZXCA 2QE7H 3U0PA 4R97B 5CZXC 3GF8A 3RWDB 4IBWA 3CFEA 2OMUA 1E5AA 3K1KC 3PGFL 3WENA 5KAFH 5DZVA 4IW4C 2DKSA 2HRLA 4HLZH 4NQDD 2M83A 4OAWB 4U3FG 5CIPH 1NU1K 3ESOA 3LEXA 2DQCL 2EILB 1RZ8B 4FN0A 4DESA 4JKLA 2NPSB 2WXMA 3ATFA 3LEVH 5FFLA 1MUUA 2OZ4A 4NQDE 3IT8D 5AL8A 5J5EA 2O61B 1URIA 4JJHA 3D4GA 4JG1H 3ELAT 1Q0XL 4YDLB 2A6KA 3F5HA 2LFEA 3HC4L 2XV2A 2ZUVA 2PXYD 3GLEA 1UVQA 4UANA 2DQJH 4ANVA 1XF2A 2O61A 1D6EB 4JDZB 3DHJA 4DNLA 1LLAA 4JDTL 3WY1A 4WFGD 1MRDH 3X1GA 3ROOA 2DLHA 1H15B 1D6EA 4HWBH 1UC6A 2OYPA 4QHLB 2CIKA 2ROYA 4RIRB 1EJOL 3RI5F 4DN4L 4XC1L 1K05A 4JBSA 3CJJA 4QHLA 2CCVA 2ZOLB 1MREH 2W90A 1EAQA 2L04A 1IBFA 4KZEH 5EZIH 3E7JA 3K2IA 1OARL 4WFHE 1FGNL 2XBZA 3OXSA 4GBXC 4UQAA 5C0EA 2ADJB 4YZFF 3OZLA 2RFXB 3QDAA 4AIEA 2BOCB 3VXSE 3A6BL 3QPQD 4NENB 2BSTB 2YKQA 4NUMA 4M1GH 3K6OA 3M9QA 4XPGL 3V0JA 4C46A 1BDCA 1GGIH 1BZDA 1ET5A 2BOCA 1GPOL 5SWZA 2DMGA 1NU1D 1CLOL 3IAPA 1G5AA 2FYNB 2QHRL 3T8VA 1I8MB 5DC2A 4WNQB 5IUCA 1UCTA 2OSXA 1NU1E 2PTTB 5I6XC 2BIMA 3TN0A 3TC9A 3P3TA 2CGZA 5CMAB 3FU5A 4HSAC 4WNQA 1L9SA 3DX9B 5HVHB 3GXUB 1KGCE 2PTTA 3VXQB 2Y6TE 3S4SB 5E2VH 5I75B 3VXRB 4JUTA 4OTXL 4LU5L 3MX0A 2H0FA 3O3DB 2ZJSL 4KHTH 4J3XA 5EZJA 3RZCD 2BNQE 1ICTA 3FF8A 3ZE2B 3S4SA 1JZHA 4EXPX 3MV01 3RTQC 3CSFA 3TJEH 2KPWA 5EF2A 3VXRA 3ARBA 1M57B 5A6LA 3O3DA 3LQAL 1SXBA 1F90L 3BCFA 2F7OA 4Z78B 2WMPB 1KGYE 4D94A 2LU4A 2R44A 3HKFA 4IGBA 1EJ8A 4ODHH 3S36H 5KVGE 5KANI 3B5HA 4ZS6D 1VQKP 1KBKA 5DD6B 2QVTA 5FF6B 2VN4A 3B7UX 1HAUA 1YA5A 2O5YH 1IAIL 2NNAA 5SV3A 2OULB 2AGJL 4M4PA 4ODWB 3TGUJ 1VQ8P 3H9SA 4OVUA 4MCNA 4RGNB 5DD6A 2DB8A 5FF6A 5IQMA 1NFIB 4PD4H 3LNEA 2P9RA 3QB7C 3QQDA 4WCYH 2VXSL 3DO7B 2CBTA 1SQBG 3M17B 4IS6B 2RGSA 3VM7A 3K6DA 1TSRA 5GZOD 1TVHB 5F7HA 3VWKD 1J9RA 3BZ4B 4OZFH 4RA0C 1YLBB 3WGVB 2V9TA 3BSZA 1M2VA 5HI4D 3P02A 2YAMA 4OIIL 4NRZB 3S35X 3X12B 2A99A 2JLPA 4UOW0 4E9XA 3OJ2C 5ACMA 3A5TA 3D8MA 2OYHB 1HESA 3TCTA 3Q3GB 4PJIB 1BM7A 4HD5A 3B7RL 4Q74A 1M05A 3RFZB 1FORL 2YD8A 1KORA 5G55A 2EACA 5ICZB 3MJ9L 1ET7A 1M71B 4ONOA 3KNBB 3QJFA 1EA9C 5D7LD 4QYAA 2XX0A 2GBVA 1RZGB 5ICZA 4NWTH 4Y1TA 3VJ6B 1JV5B 4QKXB 4FXLA 4EN3C 3W67A 3P2TA 1FG9C 3UTSE 1JZ7A 1LEIA 5ICXB 5EBMB 1S9KE 1GZQA 2F53E 2IAMD 1UXLA 4YHPB 3KLHC 1KB5B 4IOIB 4IEFA 4MA3A 5AOLA 3PREA 3MRBA 4Y0GA 5EBMA 5ICXA 2L8AA 2YA2A 2KB7P 1PSKL 1SF5A 1MG2C 3IRPX 3I9IA 3MV9B 4K3AA 1MSPA 3QXDB 3VFSA 3U2IA 3KYQA 2A5UA 3CXDL 4PWIA 5F0PB 4N3UA 4JNXA 4BE6A 4HKJA 3ALPA 4NQQA 4BUQA 1AZBA 2M8XA 1ZV8A 5D70L 1O9ZA 4L0ZA 5F96H 4QRSA 4LL4A 2OYLA 3FTYA 4M8QB 3QIWB 4JM2D 1K8DA 3RY4A 5FXCH 3MRMA 2FJSA 5T1MA 3HNTL 2ZE0A 4D3CL 2LABA 4TVUA 1J8KA 5TF1H 1U41A 4B97A 3HS8A 4Y4HC 3MJ8A 5D1QC 4GG6E 4PG2A 4YJZL 1T04B 3O11A 1CLZL 1JPSH 2F1BA 1SUJA 3I85A 1H3WM 3M1CA 1RE4C 4JFEE 1XTLA 4Y1AA 3GO1H 2AAVA 1IEAB 4YE0A 4ZAKD 3QUKB 1L6ZA 5JIDA 1MWAH 5JPMC 1IGJB 2G3NA 1BVLA 1WFMA 4X8XA 5EWIH 4GUQA 4HGMA 1P6FA 2CZNA 1FVEB 3BRTB 1E27A 2ZX9A 4HUWB 1QR4A 5EZLA 4QWWC 1AD9B 2E59A 5GRJL 4DP5X 2IBZE 4NFDA 1JY2P 1IGJA 4JHAL 4RFEB 4U6XA 4LP4A 5MENB 1ETB1 4GIAA 4WI6A 1AD9A 1BFVL 3SFDC 3G9AB 1GAFL 1QSVA 2IANB 5I26A 1YEHH 5I28A 2YZ1A 4OSUH 4D0BB 1JPGB 2PGDA 4ZUSB 1MJ8H 3FQRB 5F88A 1SHWA 2WQRA 3VXOB 3MACH 4D0BA 4K5LA 4OZGF 5IMOB 3NPSC 1BW8A 4FF9A 5FW8A 3RKPA 3N2JA 3CGTA 4G72B 1X0TA 3MJ6A 4LCYB 4JPZB 1BVKB 5IG7B 2X05A 3RX9A 5IEKA 1SFCA 2F74A 2XNAB 1URQC 1VENA 3BUYB 5EUKA 3ZR5A 3WEMA 2X4NB 4X5RA 1DVSA 1T6BX 5G5DB 2APTA 2XNAA 4HSQA 3V4QA 4O58L 4H44D 1ZDQA 3O3AB 3PGFH 2G3AA 2GJZB 5C0IA 4LEXL 1H8AA 5G5DA 3VGFA 4ZOEA 4AM0A 2MNWA 2A45H 2HX7A 3AE9C 1PIGA 2HWZH 3O3EB 4JLRA 3HRPA 1PP9D 2DQCH 1EUUA 1LL1A 2GJZA 5ESQB 2G5UA 2A6JA 1J1XH 1UATA 3WS6C 4MDRA 4OF5A 1T1YA 3QZPA 4PJEF 3DK2A 5ESQA 4P2CG 1K2DB 3A4DA 3HC4H 3RYMA 1G7JB 2V2WA 3O4OC 4ODTL 4FE9A 1H3PL 2H0EA 5CSZB 4GG8A 1G9MC 2VXVL 3G9RA 3GSNL 4JDTH 5BVZA 4LGSB 1KENL 1G7JA 3DMMD 2CGYA 3EYUL 1JN6B 1NC4B 2G9HA 2GJJA 4BZYA 2JO1A 1R24B 2J12B 4PVMA 1EJOH 4A2HA 4DN4H 3LB6C 3OX8B 3ZTNL 5HBBA 4XC1H 4RMBA 2NW3B 1R24A 3VA6A 3HC2A 2ZWZA 2POHA 3VP8A 4BM7A 4Q6KA 1PFOA 4R3SB 1JGLL 5C2UB 2NW3A 4RAVB 1OARH 2ITDB 3QI9D 2DD8L 3EGXA 5BZDB 1GL2B 3PGCA 2E3VA 4NO0B 4R3SA 3KPQB 4Z7OB 3T65A 1BFOB 3ORJA 3SIKA 3A6BH 1NM9A 4PS7A 4ZXBD 1GL2A 3FYEB 4JFDD 2DIAA 4LHUD 3V0HA 4XPGH 5BVPL 1SGKA 1B4RA 2LOEA 2WZ5A 3WJMB 1BFOA 2WLLA 1BYNA 1GPOH 1CLOH 3HRZC 4H1LB 3FT4A 3SQBB 5CJOL 1OANA 3BP5B 3N0PB 4UQIM 2J72A 2DI8A 1HEJC 1C5CL 3N42B 4H1LA 1WHOA 4WO0A 4HIPA 4C7NA 4Y8AA 1ITCA 5D7SL 1B3JA 5I1EL 2OYOA 3FX0A 4KPHL 2VLJA 4OTXH 1S9YB 4LU5H 5D2NC 4JRYB 2EDJA 3FWLA 1H3GA 1MQ8A 2ZJSH 3QQXA 4LLQB 4L74A 1IKNC 2Y69B 2W60A 1S9YA 4JRYA 1A65A 3ELQA 3LQAH 4UB6E 1F90H 2DQMA 5IJDC 3KPLB 4NN5C 3S8GB 1JMBA 2D0FA 1SYSB 3H1HD 1DSYA 1LK2B 2NY2B 4HJSA 1I3RB 4JZNA 3BVUA 1FDLH 1SQVJ 3O4LD 2VLLB 4KI5D 2GEEA 1EHKB 3T2NL 4ZSOA 4DO6A 1IAIH 3HZMB 3IDMB 4FKEA 2XPZA 4JKNA 2AGJH 2FH8A 1BG9A 1IFIA 3INOA 2MCMA 4UDTA 3F2LA 5E2TL 2Y4SA 4UF7C 2ALAA 2X89A 3O4LE 3AB0C 1KLGB 2VXSH 2Y1AA 4HIEA 3NCXA 3IFNL 5DMYA 3TV8A 1OXZA 3CZGA 3MYJB 3QQ9C 3SO3B 4KKCC 3WG7B 4OIIH 2A77H 3GT6A 3OB0H 2HRGA 3D1MC 3TVMD 1PCSA 1HSBA 3H4FA 4WI9A 1E4KC 3AEAC 3V0EA 5DMKB 5E8EA 3LQZB 1N70A 4HUKB 4NN6C 2QFRA 2OI9B 4AH2A 4NQCE 5AVZB 2GKIA 2GT9B 1UOKA 4ZJ9A 1WAEA 3FCBA 4YR6B 1G43A 2V17L 1OB1B 3PDDA 4NO3B 1FORH 3LQZA 4JQIA 1LYQA 2XN9D 4PJ5B 1HE8A 1LO3L 1QWHA 5APVA 3CDFA 3VXTA 3NUKA 4X9GA 4Y19B 4H0LC 2P5EA 3DHMA 2P2UA 3CFTA 3D3VB 4UOW1 1AGCA 1QBAA 4NO3A 5LJYH 3DV4A 1U8KA 1UGKA 4ZMPA 2QADB 3G5WA 3WV0A 4GB9A 1HWTC 3FB5B 1PD0A 3DGGA 4BHUI 2YNYA 1GS7A 2NNXA 4Y5VC 4G71B 3TBCA 3H1LE 1K9TA 5I2IB 1B0RB 1ITBB 2Q2LA 1GOHA 1PKQB 4FQXC 5D96C 1PSKH 4H0GA 2L5GB 1ACCA 3CQFA 1JZFA 1QSFB 4JFPB 4WB4A 1G94A 1B0RA 3CXDH 5AVXB 3MRLB 4YGVB 1L0NJ 1BQSA 4D0CB 2J21A 2LXBA 5J89A 3O8XC 4MNQB 3X11A 1T0PB 2OSLA 3Q2YA 3ISYA 5D70H 5DD0H 3HNSL 3WDIA 2XLLA 2YD4A 1PP9G 4Y1SA 1A9BA 4N2FA 3U30C 5FHAH 4LCIL 2WQUA 3HNTH 3UCRA 1J8HD 4D3CH 5CEZD 1AANA 5H37G 2B39A 3AS1A 3F89A 5CEXA 2WXNA 3L8QA 4NQDA 4PIRF 4Y4KB 5C09D 4PY7B 1J8HE 5LGHL 3RWFB 1MXGA 3V6BR 3KPNB 2ICWB 4Y4KA 5DZOA 1CLZH 4U05A 3BWUF 3ARFA 3D07A 5F1IB 1AHWB 3V4VL 1BQ5A 3JTBA 3P77A 2WVSA 1UXSA 3KPNA 2ICWA 5TE4L 3B71A 4N2AA 2WSCJ 2BIPA 4GLRH 4I13B 4LLMA 1EEUA 3L3GB 5IBTL 5DRXB 3MN8A 1D3CA 3ECUA </