5AW2B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 85 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
molecule tags Hydrolase/transport protein
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw2B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw2B02
3SWFA 2WT7B 3A7OA 2JJLA 4HYTB 1SLQA 2YNYA 5AVXB 2C9NY 5AVRB 2WPRA 1HJBA 5APXA 1MFZA 1IO4A 3O8ZA 3IR9A 4AUWA 3VYIA 1FOSE 4M3LA 4KHXA 2YO2A 5AW8B 3HE4B 3MGNA 3P32A 5AW6B 3L36A 3HE5B 3LIEA 1CI6B 3OAKA 5APVA 1MV8A 3NFQA 2Q7CA 1H8AA 3T97A 3TK1A 2WPQA 2N9BA 1X8YA 3M0DA 4AQRD 3VTPC 3LIDA 1GU5A 4EOTA 1HWTC 4LC1A 1GTWA 1HBWA 5AVUB 4I6MC 4C46A 4JYCA 2YO3A 5AW9B 1FAVA 2E43A 3L35A 5AW3B 5AW5B 5AW2B 5APUA 3A5TA 2WPSA 1GK6A 3P8MC 1H88A 1FOSF 5AW1B 1OWAA 2QM7A 2P2UA 2ZFCA 2WT7A 1JUNA 3NXSA 1S9KD 2W6AA 5AW0B 3M06A 2ZXEB 2XV5A 1GK4A 1A02F 2R3CA 3NTNA 3WGVB 5APTA 5AVYB 1T2KD 3VMZA 3TNUA 5APYA 2Q5UA 1CI6A 4AYCA 1S9KE 3V4QA 5CMZA 3VMYA 3KDPB 5AVVB 1GZLA 1OXZA 3P7KA 3VMXA 3V4WA 3M9HA 4GT1A 3I5CA 3M91A 5APSA 2P67A 5AW7B 1SP4A 1GU4A 1MUUA 2H7HA 3VN0A 5APWA 4I2LC 5AVTB 3TYYA 1T2KC 1H89A 4C7NB 3TNUB 2WTYA 1DH3A 3B8EB 3L37A 2KP8A 2VRSA 2C9LY 4XE5B 3KQGA 2WWWA 3NMDA 5AVSB 4RETB 3A2AA 3HE5A 3A3YB 3V5BA 2XZRA 2R5DA 3MD0A 4GKGA 2Q3IA 5AVZB 2Z5IA 1KQLA 2R5BA 3M0AA 2XU6A 5APQA 5AW4B 3HE4A 1NAFA 3WGUB 1J2JB 2W27A 1HUCA 1A02J 1CZQA 3M9BA 2IPPA 2R32A 1NWQA 5AVQB 4RESB 4JYBA 1GD2E 2P7JA 1CSBA 2QM8A 1YYCA 2E42A 4B86A 2Z5HA 3UIAA 5AVWB 4C7NA 1JNMA 4DZOA 3HTKA 2BASA 1G2CB
chains in the Genus database with same CATH superfamily
5BZXA 4I48B 1WZKA 5FM5O 2PF6A 4NO0B 5C0AA 4MJ5B 5IK3B 3VGAB 1QSFA 1ZT7A 5HY9B 3ZE0F 5IB1B 2IPTL 4XVSL 1JGLH 1BSIA 4XC1L 3AS3A 4G8EA 2OTPA 5I6KA 4ZMQA 2HRLA 3T4YA 3CCMP 5E5MA 3FB7A 1JWUB 3FUKA 4Z5RA 3VGBA 2WCPA 3QUMB 4CMMB 3MRIA 3V6ZA 5FW6A 3EFDH 5JW5A 1FZKA 1S9WB 4CKQA 5TH2B 1ZSDA 5JOPE 4BJLA 4Z8FL 3RK3D 3G6JF 2NW2B 4MQ7A 3MX0A 1N7SD 3QIUB 5F1NB 7TAAA 4KQ3L 2ATPA 1LD9B 2BWQA 1KNOB 3N85H 2C1OB 1H88A 3QEHA 5E8PA 1J8HD 4JO3L 5D71L 4UU9B 1NCAL 2FECI 2A9CA 1DQLL 4U0QB 2VLJA 2WWOA 4OCRL 4DKAA 1FDLL 3T97B 1QZNA 2GHWB 4MHHI 1H5BB 4YHPB 4HMCA 4U3HA 3NAAH 4LEEA 5KUKA 1NL0H 5BNXD 4ODUB 1DVQA 1KFGA 4H2CA 4PPTA 3S8GB 4XCFL 3V4VA 1WFJA 5E2VL 1MQ8A 2WXJA 2UX7A 4YXDC 4D0CB 3KHUA 1OXZA 1ZHBB 3OKDB 5D1ZI 1LTJA 5ESQB 4QJ5B 4HUVA 4MWFA 1NH6A 4TSBH 2E9IA 3T04D 3HFMH 5D7JC 4XPTL 2NPLX 2WSSH 3DOHA 3SQOL 5I30H 4X8JB 1Q2NA 1AO7A 4HALA 4F2ME 5CBEB 1AKJD 3GSQB 5I0DA 3F04A 1XFPA 1T0PB 2VR5A 2CUMA 3LKRA 3L74J 3P3UA 1QUPA 3QVAA 5JDSB 3L3DA 2OJEA 5E9DD 4ENED 3RPIA 1I75A 1WRFA 3RY5A 2AXGB 4QT5B 5DJ2B 3F5WA 2DQEH 2KL6A 2Z93B 3MUJA 1M1KQ 2BCCE 5AB9A 1Y0LA 5GZOA 1E9QB 3UAEA 5CHNB 4IBTA 1YEJL 2W9DL 4K2UH 3F12A 1U3HB 2XFXB 1X5FA 5EIQA 1ZLVK 5DMYA 2DIAA 1OGTB 2EDEA 3D8MA 3IFNL 3VXTA 1NOAA 5A16B 3WG7B 4B9JA 4G3YL 3V4PH 2V3EA 3DA0A 3FMGH 2KZBA 2W27A 2K9JB 1INDH 1IJDB 2IJ0C 2YKLH 5D6DA 2VLMD 4L23A 4JRXB 3MV11 1D5ZB 2POHA 3QWRA 2ZXDA 1UWGH 1MCWW 1ZCRA 1PS3A 4NQXA 4B86A 3BH9A 4Q4IA 2WINB 4U1KA 3HI6H 2R1WB 4GAGH 1D9KA 2M3BA 5DWUL 4X5WB 2C9NY 1DVFC 2IAAC 4HJ1A 4KC3B 4ZKPA 4PRIA 4XMKL 4P2YA 1MFAH 1GL2C 2NZIA 2VWEC 4LIQL 1RK0A 3U36B 1C08B 4UTCA 5DT1H 3Q3DA 3CZUB 4IDJL 1XR8A 4OIAA 4QGYA 1JHTA 3EHBB 2ICCA 4NO3B 3BRFA 4XP1L 4N24A 4XA4A 4MNGA 5DMGC 2NTSP 5CD3A 1C12B 1SY6H 3KAAA 2JCCB 4N0CC 4FX5A 4E68A 1YMHB 4CDGC 3AXIA 1TQTA 3QB7C 1MKMA 4JKPH 5HDBE 2R51A 2CDEB 1UOVA 1V5JA 1PLGH 5IW1A 3ISWA 1FO0A 5AW3B 3MRPA 1F3DJ 4S1DC 1DEEG 5FYKE 3SDCC 2AJVH 1BLIA 1LMKA 4RFOL 3SPVA 4Y5VA 1NCBL 3GKWH 1OKEA 1T22A 4L76A 1QSFE 4Y16B 3F7YA 3QUYD 4URTB 5I8OL 5KBDA 2PXYA 4DEWA 1FYHB 5CBEA 2CM5A 3O4OB 5DEGB 4LSQL 4PGBA 5FHBH 3KDMA 2M26A 5IFHL 4XPAL 1E30A 5AOMA 3UAFA 4Y99C 4LKCB 1IT9L 3M9QA 3A6BL 1M7XA 3QP3A 4CVXB 3EYUH 5B4MC 5H2FE 5C2UB 4GP4B 3BAYA 1A25A 1S9YB 1A6VL 4FKHA 2Q3EA 3VW3H 3FQ2A 3PGCB 4A7TA 2D7QA 5K69A 4I5BB 3VMXA 1S7WB 5FW7A 1JGDB 5KANG 3VM7A 6PCYA 5CKGA 4OGQB 3GWJA 2BY0A 3INUH 1EXUA 5A16A 3ATAA 3ULVE 4KUZL 2E75D 1JY3N 4FNRA 1M90Q 2X4UB 3SYAA 4LCCC 1XTLA 3RIFK 5IV2B 4U3FJ 3OC8A 4A63A 3MV7A 5J6GA 5ALBL 2VZVA 1VCAA 4DKFL 2NNXA 2PLTA 5BCAA 1DQQA 1BM7A 3W82A 5T8IA 3TEWA 1I1AA 4LLUB 5E79H 3NH7H 2H2PC 4G7QB 4WO4C 5JPMA 3FB5A 5M95B 3BKYH 2BNRA 4AQZA 2XZRA 4LCIH 2QVIA 2DH2A 1E8XA 4OCXL 1LWUA 4A2FA 2BZCA 3WLWC 4AZ8A 1PVHA 2IDFA 4CBPA 4MB5A 5EO0A 4LSTH 3QYCA 4OFYD 3C2SA 3OJMB 5EFWB 1OCWL 4FQXC 2O6CA 3A6CL 3Q6FA 2F7PA 4N2MA 4PW4A 4KROD 1R17A 2YXVA 1ZPUA 2WQXA 3CQPA 4F2MA 3DTDA 2PKDA 3LEXA 5E9NA 5I6MA 5C0CA 2EIJB 5FV1L 3STBA 3UTZB 3O3EB 1JCDA 1QTYT 4ABQA 4WTQA 3C2AH 4XBPB 4BH8B 3VXQB 2UZPA 2E56A 1I8LC 2VYRE 1I7UA 2ZWSA 5KTEH 1XH3A 1NTKD 4PUBH 5JTWA 3G08A 1UEMA 3VTTA 3V0WH 2WPVB 4UWQB 2V33A 2VL5A 1VHPA 5GS0D 1KCSH 3AUVA 3LHPH 3EOYG 2EQDA 5K9OA 1KTBA 3SE6A 1FVDB 1NEZG 1TQBC 4WHDA 3PWVA 5FKPB 4YL4A 2PW2B 4TV3A 4ZW3A 2APSA 4CC1A 4LC1A 5D2NB 2PXYD 3O8XB 4BWWA 2OTWA 3CHQA 1WFNA 2J12B 3FU7B 3PGCA 3OHXA 5B1JA 4NHUB 1WWBX 4KDWA 4TLTA 4HIEA 4NZUL 3SJVA 1T89A 4YS4A 5DUPH 4KI1A 4OSUH 3IFNH 1J1DC 3QNZA 5PCYA 5D5ME 1G2CA 2JWAA 2FZ3B 4AYBA 1PD1A 2NZ9D 2YN5A 3MV7B 4LXFA 4K71B 3IPEA 1JF1A 3RVXC 4OCYL 3T1FA 1UASA 1A64A 4YDIH 1N0LA 5HXMA 3TA4D 2V5RA 3PWPA 3I6KB 2W90A 2D2CC 1S9KE 1AIFA 2YAFA 1O6VA 4PI2A 4PJBE 4PQXA 3L74E 2P5WE 2C7UA 3K4DA 4JPVH 1OEZW 3LD8C 2V7NB 4JJHA 5TJWK 4I1LA 1Y18B 2XWTA 4OZGE 4UAOC 4V11A 3CI9A 5GGRB 3VG0H 5F9JA 4W70A 1JNNH 3HA0A 2AQTA 1EAPA 1AGBA 3L70E 1AJYA 2TSBA 3KPLB 4A7UA 2JKWA 1O9VA 2VMCA 4GW5B 1RPKA 1VQLP 3Q44A 1H6FA 2FYNC 4KK9D 5CLTA 4OF7A 3LZNA 4L4TB 2NXYD 2GFBB 3FQXB 4YFLI 1VF5D 1MFCL 1YEFH 3FDWA 3HRPA 5K5YA 4X9YA 1WAAE 4OCNC 5T33H 1CU4H 1TZHA 3Q5TA 5C0CD 2AHIA 3SO5A 5JIQA 4H44D 3F58H 4PJ7B 5I8KL 3VXSE 1SQPK 1B2YA 3MROB 1E9OB 4M1DH 2X9ZA 5EWIL 2QE7H 2V17H 1IGCH 3H3PL 4GDOA 4KH9A 5C07B 2ZP0T 5F89A 5F6IC 4W9CC 1JPSL 1PBYA 5IY5B 3KYKH 5EMYA 1Q0EA 2J1XA 4R2GD 3B83A 3KLHC 3DMMC 3QA3A 3ENEA 2OMTB 4IJ3B 3EIFA 3HBZA 5BVPL 4B9KC 3S2CA 2HJKB 1MCLA 2DQTL 4BQBA 1YY8A 4GQRA 4G43A 1PG7W 4OV5B 3O3DB 1EFXB 3WNPA 4ILDA 3E1F1 2H0JA 3OKOA 3B6SB 3F5WB 2JJLA 3N06B 2WSFH 2DKUA 4N6JA 1CLYL 3WENA 2XSKA 1BGXH 4QRRE 4PU2A 2WLYA 4NM8L 4YBQD 2Y5TA 4GMSL 5JHLH 3OBAA 4XN9A 4M3LA 2IEPA 3BSZH 3CZLA 3MRMA 1ZS8A 5AW6B 3MSPA 4Y4KD 4P2QA 3FU3A 2ZG2A 5CSGA 3NFQA 4OZFH 3PIQB 1YEHL 5I19L 5IROD 1Q81Q 3CVHH 2R23A 1XEDA 4RAHA 4DP7X 4IGBA 3OR6B 3MODL 2H8PA 3QEQE 4TLSA 2VDRL 2F6AA 4O2FB 2XI9A 2NY4C 5E1IA 4IMLB 5KYWA 4ZXBD 4ZS7H 3L9YA 3ZR6A 3GNMH 5CUSH 3IFOB 4PS3A 4Z7WA 3L1OH 5CCKL 3EYOB 2CKBB 4H0GA 4HOMA 5TDOA 5EIIB 3E9TA 2PCYA 1U42A 3D71A 3MLZH 4G8IB 5ISZB 3WS6A 1OW8A 1J05B 5I1CH 3DXAD 5I8CA 1F4HA 1SDAB 5EC1B 1EQWA 4NAQA 1ZLDA 2OZ4L 3H32A 3V5HB 5K33A 3PAVA 4JLRA 2EDBA 4Q6IB 3V7AG 3KM2A 1UZ8B 4R96A 1PAZA 2P28B 3D12B 2YK1H 5TF1H 3IVKA 2X12A 3DIFB 3UO1H 2AJSH 3MJGX 4GXUM 3UAJC 2XV6B 5EBLB 2EDDA 3V95A 3QCTH 1Q1JH 4NNPH 4UOQA 4F8TA 1P9MC 4HCRH 1ZD6A 4HLZH 5L6YL 3NPZB 4K5LA 3BQUC 4EI6B 5JQ6H 4MN4C 4ZO8A 1CU4L 2Q5BA 2VXQA 1GIGH 3QR0A 4AL8H 3MFGB 4KGLA 3VN0A 4YSAA 1LEKB 2YXWA 3MXWL 3MRFA 1EDLA 3PWUB 1MZ9A 5ADPH 1Q1PA 3LIUA 4X0KB 3OXSA 5EBWB 2AABL 1P2CB 3Q1MA 4NP9A 1J8KA 3V2PA 1MFBH 4U6YB 5I16B 4L1TA 1UM6L 4ODBD 4ZMZA 4WEEA 4BGDA 1G9NC 2QQLH 3OXRA 2QV2A 4F3FA 1OAKL 2B5IB 3VCLA 1BVOA 1D6VL 4MS8C 5IJVA 2PGDA 2ZF9A 3JSSA 5FUCE 1UOKA 1WRGA 1U8LA 4ENZA 3CDFA 3D25A 2K1MA 4KO9A 4Y5VB 5KZCB 4GG6A 4K73A 5DA4A 1KXQA 3B4SA 1CD8A 5HHNA 2F61A 5I17B 4R97B 2Z31B 1ROCA 3QIBA 5F0LB 4JFEB 3WHE0 2XZQL 2VRAA 4BK8A 4L0YA 2P5WD 4BZ2A 1JDDA 2J5LB 3KR3L 3P0VL 1CLZL 4OLZH 3U0PB 5EZJB 3HN5A 2ZWKA 3HNSL 4MXVF 4U1LB 3R0NA 1HJBA 1L4AD 2CNZA 1MFZA 2WLLB 3OB8A 5CCJA 3ZT5A 3F65A 3VFNB 3AE6C 2LABA 3NZSA 1BOYA 3NTCL 3WFZA 3T0XA 1P4LA 4NN5C 4NENA 2HVBA 4AEHL 2LAGB 4RMSA 3SPIA 1WMKA 4OLWL 4AUJA 2LU7A 5GHWH 4MRCA 4D0DA 4ZXBA 5DVKA 2A6KB 2Y22A 2RD0A 3OPUA 4NN6C 3RGBA 2ZXXA 1QSEE 1PKOA 2CJ3A 3L1OL 3FUJA 2ETWA 3RUGF 1EZVD 1HNFA 1VADB 4UM9D 1FDOA 3PP4H 3D0LB 5JQHC 3TA3B 1ROWA 1SDDA 2XXFA 4NUJA 4YMPA 3KZIE 1JCVA 4XBPA 3KPQA 4LHUB 5HBBA 3BE1L 2OYLA 4MXQC 1VDGA 4LLVB 4NLHA 4ANVA 4KZDL 3CPLA 3TP4A 1QEWB 4LLAA 4APQA 4KHTH 3NCFB 3CZFA 4KJYA 3DGCR 1NBQA 3BAEL 3D06A 3I50H 4IBVA 4JZJC 1MQKH 1D9KC 5C39A 4UBDD 3UYPB 2H0PA 3TPKA 2XTJE 1KGJA 4JVWA 1N12A 1C5DA 1F6LL 4F24A 3CXHI 4GRMA 2ICWA 3WFEL 3WFBL 3ZL2A 1CDCA 4MNQA 1PZDA 4RJTA 2DQGL 2QEJA 1VPOL 4I1NB 4JVUA 4GW4B 2VW7A 3KYNB 3MXWH 3R8QA 1BXUA 5C2BL 5L88H 2FJHB 3MRNB 3VXOA 1QNZH 3MACH 1BZQK 3WIHA 3UP1A 1ZGLA 4UYPA 4YEFA 1DJYA 4NIYE 1VZHA 5FHAL 3U9PH 1KYOJ 3K80A 2GI0A 1UOWA 4IK6A 3WD5L 3DO3A 4LOUC 3FRPA 4AT6B 5I30L 3OKKA 2IQAA 5IMMA 5KAIE 4YXKH 1UD6A 3VWKD 5LO7A 1FGVH 1QR1A 4NKQB 4X83A 1G7MB 1WBZB 4LCWE 4NSKB 5HDLA 1E5WA 1DHKA 1GPOL 2Y4SA 3N1QC 4U1MA 2PWDA 2YUWA 1T83C 5KAQG 1FZJB 5D1XA 1II4E 2AGJH 5F7NC 3HRZB 1SJEA 1OHZA 1IBHA 4NC0B 1LVEA 1TU2B 4PTUB 2MCPH 1M2OA 3GM0A 4E5XB 2YD4A 1M1XB 5IESL 5L8JB 1S7XA 4GAJL 2N3JA 2I07B 3K8KA 2BHYA 1RSYA 3CMOL 2KMWA 2OJZH 1RURL 4D0DB 4LK4A 2F1AA 4PI0A 1B4TA 1FDLH 4QHLA 4X4ZA 1WBXB 2VW6A 5F8QC 4IIQB 1M7DA 3VXUA 1UB5B 4KI5D 1AGBB 3FCSB 1L0NG 2PCFA 4M6OL 4MD4B 1MCNA 2HFED 5D8JL 4O02A 2CHDA 2VXUL 1YDPB 3PAYA 4MA3A 4B60A 1M53A 5KG9B 3KL3A 1N73C 2DYRB 3NFSL 2Z4QA 4IMKA 3IN6A 3W56A 3UTPE 1R0AL 1J0YA 1N2RA 2HPTA 1HEZB 2PTTA 3L72D 1PLBA 1QEWA 5ITBH 3I6KA 1K8DB 4HH8A 5DU7A 4GS7B 2BWIA 5CJ4A 1AQTA 4HGWA 4IHOA 1ZLVH 5APVA 3QDME 4G6ML 5I15H 5I1AA 5CZXD 2R83A 5ELIA 2K6WA 4KY1L 1TUPA 3EWKA 4XCFH 4L4JA 4DUWA 4UCFA 5D4IA 2GJ6A 4FJYA 3VGEA 1J1EC 3VNZA 2E4TA 3FOLB 3S2AA 3EFGA 2B87B 1G84A 2YAHA 2ZWZA 3FQRB 1E0OB 3WUUA 1EAPB 1YEHH 2UWEA 2XJLA 3P77A 4XNDA 1AY1H 3ZRSA 3P2BA 1YUHA 3K7UA 3N0AA 2Z6FA 3R06B 1TTUA 2C0WA 3REVA 2H1PH 4KH2A 1GC1C 2PW1B 3DSFL 4XP5L 4CU8A 1MFTA 1VL2A 1IIIA 4AKPA 3ARYA 4Z77A 1A14H 3FQNA 3K72B 2NCEA 4POZC 1ZHKA 3H3KA 3SE4A 2NSXA 1SQPD 1SOSA 3QHFH 3REWA 3U4BL 5B38G 3FTVA 3TYGH 1S7VA 1D5MB 5EZLB 2IV8A 5L2KE 3I02B 3HAEG 4TNVF 4G7VH 1FL3A 1MRDH 1H15A 5A1AA 1AS7A 4X9BA 2CO3A 5D2LF 4ONFL 5L2KB 2AK4B 1URZA 1PP9G 2WSEH 1A6WL 4B9PA 2FYVA 2GUOA 4QY8A 5A3IC 3NFPB 4P9MH 1ZHNB 5EDSA 5HGBA 4NNYA 4N8UA 3N4XA 4AC4A 1IZKA 4Y99B 4WFGD 2JQAA 4LCWD 1NFDF 5FFOA 5AALA 4XN7A 3X11B 1N5YL 5D7JB 5EPMB 4TSCL 3V2RA 2ADYA 2RCSL 3N1MC 2Q2EB 1ECYA 4ENEC 5APWA 3FFDA 4H26A 3VGHA 3WKPA 4WJKB 3QCVL 1UUNA 4Z78B 2D31B 2J25A 1SVCP 2N7BA 2F5BH 4OGQC 2O6FA 1YMMA 3TXAA 1WUNT 5T1MB 3TVMB 4K3AA 4Z3EA 3TONA 2XPZA 2UWJE 4MJ5A 1RURH 1HOEA 3CZNA 4NX0A 1NDTA 4PJ8A 1J8HE 5HY9A 4JN1L 5C09B 4URKA 3W0WD 3KS0J 4YSOA 3FT2A 3VXUD 1XF2B 3QT2A 2WUBL 4WUKL 3TN0B 2N9YB 4LSRL 2H32A 4HEPG 4TSBL 4W81A 3T71A 1DJGA 2XTLA 3LXAA 5IHZA 3PQYD 3SFEC 2SODB 3IJEB 3AEBC 3M8OL 4GMTL 2CIIA 2XDJA 2FWOB 5DZVA 3BP7B 3EDJA 2X6AA 2IADA 4X8JA 3ISRA 5ID0A 2AF2A 2WZ5A 3L4TA 3VFTA 2NW2A 3NQIA 4MQ7B 1HHIB 3RL1A 2QADC 4M7LL 5IWLC 5F7AA 3KZIH 3H1IG 1IAOA 1UXSA 5F9AC 3H9ZA 1J05A 3BDYL 2J5UA 1CE1H 3NIGF 1FVCB 3GUTA 2FYYA 2J1ZA 2JH2A 1JXKA 1QACA 1U4EA 2OULB 4MCZB 3RWDB 2YZ1A 3INUL 4DCQB 4D9RE 5E94A 4J8QA 1HXMA 4AQ1C 1NGQH 5JW3H 4BZ1H 1MZZA 2EZ0D 2R2CA 4APQC 3L95B 3L1EA 5DYFA 4F3FB 1PL5A 5LGHL 1KG0B 2IBZG 2A77L 2BSRA 2ICWJ 3SIKA 5IEKA 1EXJA 1RZIA 2GBVA 3P0GB 2GSIA 4JO8A 4X2UA 3CFNA 1QRNB 1RUQL 3JV4B 3QFDA 1AHKA 3BT2L 2Z8RA 1T8ZA 1R3KA 4Q9BA 4YNYB 1GK6A 3GJFA 3D6ZA 2HB0A 1YJ9P 4P23D 4JANB 1ZVNA 3ZZQA 1KQFB 4XMKH 4UZSA 3L3IB 3WY2A 4R7NA 4CADA 3PWJB 2AXGA 3BE1H 3HNTL 3FNKA 4OLVL 1FUNA 2GJPA 3GKWL 3MYJB 1WICA 4XP1H 4CVWA 4CMHB 1WS7A 3GW6A 4V1DA 2E7HA 1OM3H 1XR8B 4M6OH 3T0VA 1V7MH 4JFUA 2NY1C 5GISH 3O2WH 4RNRA 3SZKC 5K1JA 4BWTA 1RZ8A 1FRGL 3HCVB 1DVFD 5D7IE 2FEDC 4HWZA 3GUFA 3V6BR 1IUZA 2FAUA 3TL5A 4MAZA 4KXZH 1VPOH 5E8NB 2XWBB 3CPUA 1JFQL 1NGXA 3O3BB 2ZIDA 1OPGL 1A5FH 2R4SL 5EFIB 3Q7JA 2VDKB 4IBZA 5DJDB 4ZQKA 5F1KC 2M0BA 2QHLA 3ZYZA 4MJ6A 3RGVB 2EEDA 4GKLA 4PRHD 4LCCB 3AM8C 3WTWA 1BQUA 3IGAA 3PQYA 5C0DB 3N44F 1OARL 4IS6B 2PNDA 3ESOA 4YHLH 5SV4A 4PLNC 3SYPA 5IJDC 1A6UH 5HYSG 4OLEA 1EAJA 4RETB 3T65A 4AC2A 4Z7NF 3FBKA 4G7YL 1OVVA 3BPNB 4P59L 3ESVF 1XXFC 3L70J 3T8XA 3ZSTA 1MCJA 5D9SA 3VG9B 4MLSA 4CNIB 5AWNL 4BD4A 3NSYA 1YCSA 5T1KB 3K4AA 2VL4A 5JIPA 4RGMB 3IDMB 2YARA 2R7EA 4KMTL 5LWYL 4ZDHB 4W1TA 4D0BB 1IFPA 4F8QA 2AEQH 1CICD 3D18B 4AEFA 1BQHB 4Z23A 4NKDA 3C6EA 5F7EL 1KGCD 4JO1L 5EF1A 5LAXB 5JLZB 3FGAD 2FCBA 3WN5A 4EI5A 3QPXL 3LQZA 4QHNA 3GXNA 4AGQA 5T5NG 2VQ1B 3QFDB 1EZVY 3UERA 1KIQA 1NGQL 1DQQB 2WP3T 4GI9A 5DGRA 3TV3H 1KMIZ 1RFDH 4B6ZA 5FCUL 3HE6C 3WY1A 1GHFL 1AO7E 4WFGE 3IFPA 3I6GB 5E03A 2FWLB 2ATKB 3GG2A 4WUUA 3WELA 1WFMA 3RY4A 4FABH 4IIZA 4FQQA 4IRZA 3RIAK 4WV1B 4OZIB 4U1SA 4G1EA 4BKSC 2QGDA 3MUDC 4MNQB 4RWHA 3UTSD 3MODH 1EXHA 2YKQA 3APNA 4BK5A 1XB3A 3LQAH 3M7FB 4FG2A 5F7LB 1ADQL 2OMVB 4PJ9B 3VTAA 3H1LE 2QHRH 2E43A 1KTLA 3O6LH 4JFHE 1X6NA 4LPVA 2Y0DA 2OV0A 5IOPA 2GEEA 3DGGA 4A55A 2P44B 4JN1H 2WITA 3IBEA 3BLKA 5ITFA 4F8OA 2JI3A 1ICTA 3FZUD 3GXMA 3VXME 4EIBA 1JNNL 2QSQA 2R69H 5HYSA 4DF9A 5JPMC 3U1CA 1MCHA 3WE6A 4FTVE 5I0WA 3X3GL 4M02A 1IGCL 3H3PH 3GI8H 1U57A 4R4FL 4OFKA 1TJHL 2GUYA 2W65A 5IV2A 1U41A 3U7WL 1D5XA 3LH2H 4JFDB 3FB5B 4DQOH 1JWUA 1EDHA 3ARVA 3BUTA 3LRSB 4J3TA 3IFLH 4LCCA 2XACC 5DHDA 4KRMB 5DRXA 3T2NL 2Q1KA 5FPIA 1JERA 1QWHA 2EE6A 2E27L 4P4KB 5HJGA 1BDDA 1E4XI 4PRIE 4ERSH 1QFWL 1MRDL 2C1OA 3TOPA 3DROB 3VFVA 4LSSH 1EDQA 5DUPL 4UANA 5F7DB 4B53A 4R4BB 1A4AA 2B59A 4QRFA 1IQWH 1RHZB 2F1BA 1WG3A 2DIJA 1F3JB 1NCNA 3LN9A 1FV1B 4MA3B 1SNRA 3U46A 5CD5D 1AI1H 5KAFH 2FZ3A 4L4VD 4PGJA 5KSUB 3FTSA 5E2UL 1E28B 2FHCA 2C3XA 3AE3C 4IBSA 3U6XA 4TULL 3A3YB 2WKOF 3OAYH 2AJZB 1K6QL 1MH5B 1NCTA 1J12A 2BSTA 3NJVA 2F53B 3KGTA 4PP1C 5DI8A 3RVWC 4Z18A 2WBJB 4ZUSB 2IFFL 5B3JF 3QBTB 5BO1L 5I0YA 2P5ED 4NNYB 5D2NA 3KLHD 1QLEL 1NAFA 5C86A 2OAAA 3BZFB 3H6AA 3QDAA 4U33A 3PWVB 4HDIA 3HZVA 2PO6B 2WM0A 3GLDA 3VX1A 5A7BA 5DMIH 3V0WL 3RK3C 1G7LA 3LH9A 4ZTPH 3AREB 2OZ4H 3AY4C 2H9GB 1G2CB 3L3KA 5HHME 4QT5A 1J0HA 4ZS7L 4R26L 3G6DL 1JMXA 3S36L 4KPHH 4ZNCA 2P5WA 3DTXA 4JRWA 1WQVT 4WEUD 5T1LD 3RGUA 3L9BA 1BF2A 4J6RL 4KAQL 1WVZA 2YFOA 4JFXA 4PRAB 3N41B 1VQ5P 4J2QA 3L7FA 5EWIH 2XZCH 1KILB 3VYNA 2AVFA 4RQQB 1U8HA 1N0LB 1SBSL 3T5WA 3UGUA 4LGSB 2NY2D 4X6FB 3N43F 3HB3B 1YVLA 1HINL 2CMRH 4QOKD 1KEMH 4N2CA 3I9GH 4JHUA 5JIHA 1YEEL 3VXMB 1R5IB 3MCYA 4UT6L 1PEZA 5TFSH 1JVKA 3QXWA 3E8UL 5I9QC 5F9JB 2C9VA 1S4IA 4CC0A 3MC0A 1ZP0C 5C0BD 4BH7A 3NXSA 2B88A 1RK1A 4FFYH 5JHLL 4EVNB 2K9FB 1LTXA 4YJZL 4YOKA 2XV5A 1IBDA 3V0VA 1WITA 2R3CA 1SHWA 4AKQA 4TNWK 2DEYX 4X4ME 4AJVA 1IK7A 4M7ZB 4WF7A 3D70A 1A02N 2ORBL 1AKPA 2N1TB 2CK0L 2ZWLT 1KJ3H 4E0RA 3QQ4B 2HZHA 4JEGB 3C60B 5DXWA 3KDPB 1NFDA 4A6YL 1CGWA 1SVBA 2GJ6E 2ZUVA 3EH5B 3GSNA 3HZYB 4U1NA 1E67A 1L6XA 4IGBB 4K0OA 4X8XA 1N8RQ 1AI1L 3DYMA 4WRLA 3CGTA 3UZQB 4FA6A 1MCRA 4PD4H 3GMRB 2E5TA 3E2HC 5JUEL 1TZIA 1D7FA 1RULH 3QHZH 4JO2L 4JO4L 3RX8A 5IMOB 4M7KH 3RVTC 2H1XA 1GZHA 4ZUUB 4A6YB 2BNQE 1IKFL 2APFA 2J21A 4ATTA 1DO6A 1E65A 1UT9A 3VXRB 4LEXH 4UQBA 4HCRL 4PGEA 1T89C 2Y5TB 1X5LA 3PHQB 3L71G 5IBLC 4QAMB 4BFGA 2VAAB 2YD3A 3RHWK 4UDTB 1JGDA 2ICWI 5GS1C 3MRCA 2C9AA 1OK8A 4K07A 2HKHH 1CFSA 3GO1L 4C4KT 4DGYH 4X9GA 1EHAA 1LMIA 3LH2L 1EVTC 3NABL 1G9NL 1F1AA 4J6IA 1JGUL 3J27A 1BMZA 1UJ3B 3EAKA 3Q2LA 4AW4A 3U48A 2VRQA 3ULUL 4YFLF 3S9OA 1B2WH 4QF1B 5TK4A 5EB9A 2YEZA 1NDGA 5C6PB 1A9VA 3GIVA 5IK3A 1T0OA 2BNUA 4QYAA 1OP5K 2NXZD 3MYJA 5FM4A 2QPUA 1BD2E 3OKMB 4Y2NA 1BLNB 2PPAA 2V9TA 4YPGB 3WMQA 2WN3A 1XGYL 5C0EB 2WO4A 3CK0L 5L2JB 1JNJA 1CL7I 1RZKH 2FQGA 3QNYA 3C87A 3TCXA 3GPEA 1SVFA 1DIPA 4M48H 1T20B 1ZLWH 43C9A 1SY6A 1K4DA 4G8GD 3AY4A 1SOXA 4R4NC 5J1SC 4HC1A 1MAMH 1ZT4A 4EUPH 5FYLD 1NSNH 3V4UH 5KAIH 4UYQA 5FM8A 5TDNA 1UWGL 2IGTA 2PN5A 5EIIG 1O6TA 5D7IF 3DO4A 5EBLA 3KW7A 3T3MF 4U49A 5I17A 4C57C 4XZ4A 4TUKH 2G2RB 3C9NA 5L88L 3SJVD 3U0WH 2FE0A 2ORBH 5I2IB 3WNNA 5AENA 2X6CA 1NIDA 3BP4B 3PP4L 1H19A 5IHLB 5IMKB 3H1HE 5IVNA 2QFRA 4A6YH 2PYEA 3AROA 1ZPLA 2XETA 4FQ2L 3DIDA 3QCTL 4FRWA 4AOFA 1XVSA 2UUDK 3OL2A 4G6FD 4JZJB 4KKBD 4ODXA 5L4MA 1TLMA 1M1JC 4TNWF 3W57A 5I1DA 5B1CA 3WLWD 3SDDB 1G1JA 2HFGH 3N2JA 4B5EA 3VD3A 5G5DA 3GSUA 3VFMB 2OMVA 5HJDA 1P7KB 4KXDA 5FW8A 3UABA 1CFQA 1OCOB 3MP7B 2GC7C 3FU8A 4K9EL 1VADA 4ODTH 1Z7JA 2DQDH 3HI1A 3B9KD 1EBPA 2BWDA 3MUUA 2H0EA 2QSCH 2FATH 3MLRH 1R5SA 5SX5H 5DQDH 5HGDA 3CWBJ 1AH1A 4ODWA 1H89A 3VD0A 1IGYA 1UWEL 2DQCH 2EYRB 2CMRL 3B8EB 5DD1L 1OPOA 1QLRB 5EU7C 3BUPA 4AL8C 1AIFB 1U8KA 3AABA 3QC5X 1YN7A 2ERJC 4UT7L 4UIKL 1N3NB 3Q3GA 3APCA 4O9BA 1ZTXE 3KE0A 3TNNA 4ABUA 3W2DH 2F5BL 4O51A 4L8BA 1MCQA 1U93B 2DQJL 3FO1A 4OJEH 1HE8A 1M57B 1X7QA 4GKZB 5KN5B 3QJFB 3RILA 4YHMH 1NAML 2CNYA 1QI5A 5SWSE 3X13A 2E42A 1D9KD 1Y6NR 3VSUA 3WUZA 5T1DL 3WD5H 2EXYD 3D51A 3L08A 2ITEA 2YR3A 2LFGA 5IJBC 2BH0A 3WEBA 1QI3A 3ESNA 1RVFH 1WHPA 1KTMA 4OD2A 4IL6X 4UQIM 4Y5YB 3TCLA 1OALA 3FYEB 1XMEB 1A14L 3OGCA 4MHHG 4L0ZA 1R3HA 5HGAB 2H41A 4LF3B 5TGBA 4BE5A 4KVCH 2FWUA 5KS9F 3HE5B 1U8OB 4N86A 2OXHA 2GTWA 1HHKB 4FQIL 1FLTX 1D3CA 1RIHH 3MRBB 5EOCJ 2P47B 3IXAB 3H6JA 2YLHA 3TEYA 4JKNA 2JV6A 3IWVA 5JORA 4B5ZA 2WXPA 3JWNH 2V2TA 1B0WA 4AYFA 3P54A 1NTMG 1XGUB 1SLVA 3KPPA 3Q8FA 4G6MH 4QHLB 5AW2B 4J3XA 2CCLA 2WZAA 4Q74A 2CBPA 4QPEA 3SZ6A 3TSIA 2ODHA 1I1AC 4KVNH 4OJDH 3UBXA 3VD2A 5BRZE 2FUTA 2E86A 1QSZA 1B4LA 1HH6A 4UQCA 2ZYGA 4PCTA 3V4PA 5GTIE 3LD8B 5FO9B 3QDGE 4MXWH 2H1PL 4JFOB 3M8OH 3POCA 4GMTH 4N5UA 2DQGH 4AGMA 1V3MA 2O5ZH 4DN4L 1NFIB 4WUUE 2VH5H 1NCAH 2EZ0C 5FGRA 5APYA 3RTLA 5IMMB 1KF9B 1BXAA 3IAOA 1NTDA 1YEDA 5F3HA 4NC1E 1V3LA 1I7TA 1GKEA 3KBPA 5C8JB 1CURA 1P84K 3TJEH 3C8HA 3V0FA 2Y07H 1XGQB 3PPSA 2JCWA 4HWEL 4B9CA 4N0UB 3MUDA 1JPST 1ZT1B 5LLIC 3DDGA 3FHEA 2DQCL 4F57H 2WB7A 3HOGA 4NZUH 5FF6B 1RK1B 4ZMWA 3G6AB 5AKRA 4KX7A 1G6VK 4IIQA 4NDMB 1AD9A 1JV5B 5F6IB 2DQTH 4WI7A 2WQSA 2BINA 1WC7B 3VXSB 2BRRL 3CL3D 5G4NA 4J27A 3FH7A 1KYUA 4YDIL 1EJOH 4GBXA 5CJXA 4L9DA 3W1ZA 2COQA 1H5BA 1MY5A 2Z4TA 3A0OA 1G7JA 3H42H 4MAUH 3QFJB 3TVMC 3HI5L 4JGJA 2H5UA 1UOLA 4IFDK 4FMFA 5GGTA 3LW5J 4EXKA 3OKLA 3ESPA 4NNXB 3K8LA 3FT4A 5D7LE 3RNQA 2IDCA 3JYCA 4OLXL 5AQ0A 4ZPVB 3IFMA 3VI4F 1S7QB 5E2WL 4NZ8A 4DN3L 4NHCH 1JP5A 1FHNA 4LARH 1MRCH 3BEWA 5DURD 2H45A 3UZQA 5JDSA 5GZOC 1KB5B 4YDZA 3O2DL 5FUOH 1EHNA 4PIRF 1OB1B 3AXLB 4ANXA 4H88H 4PY8I 1Y0LB 1P5VB 3EGXA 4M61A 8PAZA 2PW1A 5HPMA 3LV3B 2FD6H 4ASVA 3KPOA 3CHPA 3TO4B 1URLA 3UYRH 4ABVA 4XNBA 5KSAD 3ZE2E 2ENQA 1BVNP 3IU4H 5CLZA 1QPXA 1HHJA 3SQBA 1VQ9P 2KPWA 2HFFA 5EU3B 2V5TA 3O9WC 1MREH 3EJQA 4N9GA 5C09A 3SGKC 3TT1L 3TF4A 4HD9A 4LSUH 2MPVA 5H94B 1F41A 2XBZA 1OPGH 4HKBA 2IAMB 3VQ1C 4LPUA 4BCZA 1J0IA 1CG9B 1JXDA 1N59A 5D2NE 4I87A 3GQFA 5HHNB 2XWCA 5EBMA 4PRNB 1GZQA 1F3RB 3U2SA 1F3DH 1FQ9C 4UT7H 4M5ZL 3D6YA 5HGHB 5LG6A 3WFDH 3HKFA 4Z7IA 1DBML 2CJUL 1R24B 4N0CD 1ADQA 3BAJA 3GT6A 1EH9A 4OZHE 1ADQH 4CU7A 2ZFCA 1RF1A 2AZUA 5BOPA 4NENB 4KJQD 1ZK5A 2CLRB 2Y7QB 3CCHA 2ZKWA 4IM8A 4PJ9C 4XVUD 3MTRA 2VQUA 2GC4C 2RMZA 1Z9SB 2Y6TE 3BP6A 4IRZL 3T4AA 3ZQXA 8FABA 1OW0C 3LNGA 3S35L 1QKZH 1U3HA 2XFXA 3SN6N 2CO6A 3NA9L 3VD4A 1NUGA 1FYTE 2JIXA 1A1NB 1WIUA 1UIXA 1Z5LA 4BFJA 1A4JB 1KV4A 3DSNB 3EJTA 1T7WA 3B7UX 3O41A 4YBHA 3TN0A 3RU8L 3GMOB 1V7ML 4WFFE 4OKDA 4YGVB 5F89B 1IAIL 3BD5A 4XCCL 1ZOXA 4XOEA 2DM2A 1XZ0A 3VH8B 4ZX3A 2CALA 4DHLA 2G0LA 3BMWA 2H3NA 3QARA 1BX2B 1MKFA 3L73D 1QL1A 5DK0B 5I8EB 1IX2A 1N0XL 2BJML 2CJSA 3UADA 1KSRA 2PTUA 1Q0YL 1A3RH 2PWEA 2QPSA 1ZV9A 2UZXA 3F01A 4ZFOL 4JDVA 3CWBD 4UB8H 3KXFE 2DTMH 5AL0A 3HD7B 1A5FL 2R4SH 4HKXB 4B9IA 3ZO9A 1AGEB 2Q1EA 5EC2B 4GAYA 1XF3B 1GCYA 1PQZB 2EECA 1OAZH 2JCCA 1H8SA 2CHXA 3BUYB 2C9RA 4HFUL 4P05A 3IAGC 1PX3A 4YDLC 2I7OA 5E2UH 4DK5A 2QSIA 3TGUJ 1CICC 4WO0A 2HT2D 3FFCA 3VG9C 4MNGE 1P5UB 4XVJH 3BKYL 3QRLA 2H2PD 4IJTA 1QASA 1T1YA 3AE5C 5E6YA 1DBKL 4NQSA 2J44A 5TTRA 4U1GB 1OCZB 5JYLA 4MBRA 5KANI 4IKIA 5GGTL 4R8WL 3KNBB 1IB5A 4J4PA 5T1JA 3SDXA 3RVUC 3GMQA 4O4YL 3WS6C 2WXOA 5HDBF 3ARDB 5EZPA 4KROC 2YPVA 3GD1C 2HJFB 4TSAH 3IKCB 4PGBB 2E27H 1BGYG 1J1XL 5B66H 3RL0C 1T21A 4XR8C 1KILE 3BYYA 5BS0B 2HPCA 1QR4A 4K8RL 3ZKND 4PTUA 1JHLH 1TTCA 4YSUA 5TDOB 5KLIB 1JPGB 4ODXB 4R26H 3PJSA 4EOWL 1KJVA 4ZMPA 3OJDA 4TXVB 2E7LA 3FMGL 4M5ZH 3E1RA 3CDYA 1D6VH 2AV7A 5D72H 2QLYA 2D3NA 2CJUH 4HUXA 4JHZA 2V9UA 3RWJA 3D30A 2NR6C 1J8HA 4HXAH 1EA9C 1VEPA 3RX9A 3WY4A 5GTHE 3AECC 3D09A 3MO1B 4ELMF 3HCVA 5KVEE 2VQ4A 3P8MC 1LK3H 3WN5B 1OTTC 2MHAB 3O9WA 3QO0A 5DCCA 4U6XB 5GIRA 2ITAA 2EP6A 5DHMC 5KSBE 5JOFA 4H44C 1U8JB 2VL5B 2WW8A 5E1HB 4DFIA 1XGPB 5I6XB 1T0NA 5JPMB 1ZGLM 1T7XA 2KZWA 2CK0H 2Q76B 5FO8A 1SQVJ 1B88A 1R3HB 5DEZA 5HGAA 2BPBA 3BAWA 1UKTA 2IANA 4MMXA 3QSKB 5EULV 5DJ0B 5JHDB 3BPCA 4XC3L 4HETA 3MRBA 4XPBL 2F9BT 1N6QL 1MF2H 1JK8A 2OA9A 4ODVL 3VD1A 4GKOA 4U6YA 2ZKYA 2HWZL 1QHPA 3EDDA 3RVXD 4HT1L 4HH9A 5T1KA 3I5CA 3EYSH 2Y36H 1KBGL 2AS5M 5IOPB 3FQNB 3K72A 4QRUB 4ERSL 3F84A 4XVOA 3JWNC 1OFCX 3NUKA 4IKKA 4YBQC 3DX9B 4OGXH 3N43B 1K73Q 2KBGA 4HLJA 2CCVA 2LAAA 4GIOA 5AOZA 2VE6A 3MJ7B 1TZOA 4H8VA 1ZLWK 4DTGH 2Y2YA 3TBBA 3ZBMA 2VDOH 1UATA 2DMHA 1H8NA 3NSDA 3HUJE 5DWPA 5CEZE 1HX0A 1SYVB 2X4RB 1NWPA 4J8RA 1HSBB 4GKGA 1EEQA 4LLMB 4N0UA 3SKNA 4FTVD 3ZX1A 4Z1PA 2BZDA 4J4PD 5KYUB 2XQ0A 3D9AH 2GY5A 1NAMA 1JF6A 3SDYL 3RRQA 2VLRB 3ALPA 2P24B 2WBJC 4LPCA 4QRQA 4EYYQ 1AQDB 5T3ZH 4GI8A 4U3XA 4NFCA 4QTFA 4DGIL 1W6LA 3P73B 3TS8A 2XA8L 2Y6SD 1NTZK 3FQXA 4MA1C 1KEML 4PJHB 5CLWA 5LXVA 1L9OA 4QWWD 1WC7A 3M46A 5ESAB 4HZ1A 4DKFH 3O3UN 5C0CE 3U9PL 3ULUC 3O3AA 1ECZA 2ZUXA 4CL7A 1LEIA 2HLOA 5JPNB 3BCCJ 5DUMH 1LDPL 3CSTA 3GTNA 3Q2CA 4ZTPL 4DZ8A 1V7NH 2JCCE 5D72L 4OI7A 3EGDB 3HAEA 4XBGB 4NNXA 1JZ5A 3NJHA 3ES6B 4OCYH 4MZIA 2FX8L 1KPUA 1XGRA 4HUKB 3HHSA 1HIMH 1XF5B 4A7VA 3NPSB 4QJ4B 3CVCA 3V0GA 1E8ZA 2FIKB 4GAJH 4HIJB 2RR3A 3PYCA 3OJAB 2V7NA 2CDGA 1GOHA 3VI4A 1MAJA 1DQDL 1QFUH 4Y0GA 1OB1A 2G5UA 4DP4X 1NCGA 4KJPD 2B1OA 3WE1A 2WBKA 1AZBA 1S3JA 1FNAA 1NCCL 2OMWA 5J8OA 3DUSA 4JY6A 1NM4A 3D4YA 1N6UA 5DVPA 1XCXA 4HSQA 1IKOP 2A4CA 4AQOA 4JRYD 1HZLA 2ZG3A 3V4VH 3LTVA 1XAUA 1DBKH 2EKSA 1QSFB 1ZT7B 4C56E 3NTNA 2I1JA 1DSWA 1AKJB 2VZUA 3SDAD 3MRLA 3IRCA 4QRRD 5ITBL 4CSTA 2YD5A 2CUHA 1JI1A 4JMNA 2VDOB 3B7YA 4B95C 1QFWM 3U4KA 2WLMA 1UCBL 4Q9QH 4PRPB 2R1XA 3K1DA 2ED7A 4OB5L 5ESVA 3GJFB 4GO8A 2FYUD 2EINB 5IVXA 1U3HD 4UT6H 1TQCC 5D1ZB 3QIUA 5F1NA 1MFEL 2EDKA 5APSA 2MH4A 2BSCA 4QKTA 3BVNB 4MXVE 1DBBL 4ZAKB 1JGUH 2UY6B 3RU8H 4FA8A 3N5AA 5KYWB 4IGBC 4OLUL 2H7HA 2VT0A 1MCSA 5KEZA 1NOLA 1S5LE 3ULUH 2P7TB 4LPYA 2WYHA 4H13B 4LOEA 3SDDC 4LSTL 4BH7B 4HBQA 5I1LB 2AK1L 1U7MA 1QVOB 4PV1D 1OVRA 1SF3A 2OMYA 1A1NA 3BIKA 2KLRA 2XJKA 3H54A 3MA9H 1K5NB 2Z4QB 3GMNA 1ZAGA 4QJ3B 2IAMA 2UXFA 2WUCH 4FGMA 3HUSB 4LL9A 3SPHA 2F1EA 4PRAA 3B5NB 4JFTA 5E1AB 3T6ZA 4A2GA 3MTXA 4XC1H 3CSYA 1KB9D 3GJEB 3HR5A 2HN7B 2HG5B 2X38A 1G6RH 3M9BA 3MX0B 3TX4A 1KFNA 1EJ8A 4M6NL 4YSSA 3CDZA 1VKXA 4KMLB 1QSEB 2PCPA 2HKHL 2GIMA 1IC5L 3GO1H 4DGYL 3OAUL 1RZGA 2VDMB 2Y3NA 1BZ7B 1Q82Q 2HRGA 4FI8A 2ZONA 1J5DA 3ARSA 4AIXA 3GXPA 3KD4A 1A0QH 4NPYA 3CCVP 4AWJC 1AR1B 1RZ7L 2BSDA 1XF3A 3IAQA 4FYTA 3QYMA 3D3VB 3ZDXE 2CXGA 3DRQB 3NEOA 4HKXA 1AVAA 4H25B 4RMRA 5B8CB 1H8AA 3C60A 3MGOA 4Y2DA 2Z64C 3REWB 1FZCC 2N7SA 4ATWA 5L7XH 3MHVA 4JJOA 3KCWA 4TLKA 3EUDA 4TF4A 3UACA 1QW8A 3E6FA 3JV6B 2DS4A 1GW0A 4JPIB 1NTKJ 2GYSA 1FZMA 2FLBT 1ZXKA 3D4ZA 4JRXA 3D2UA 5APUA 3TZVD 5I6LA 4I88A 1X3DA 4LRNH 1AXIB 2MKWA 4JFFA 5FYJH 3VWKC 4FXKC 4X4KA 4AK1A 3KLQA 4ADJA 3FWLA 4YSTA 5E8EB 4ELKB 5IVXB 3GSOB 1BIIA 4A7SA 1IM3D 4G9FA 3SKJL 2ATKA 4WUUB 4AL8L 2XRAH 4QHMB 2QGCA 3CVDA 1I4FA 4MA7L 3ZTDC 1OSZA 5H4ZA 1VQ4P 3WNMA 4DP2X 2H43A 3FUHA 4JRFA 1P4LB 2OJEB 3ULVD 15C8H 4A2HA 1HQ4B 1B0GA 1SQBK 3CLEL 3DLQR 2XV0A 4R6UA 4HJEA 4N6QA 1IEHA 2AK4E 1K4DB 1CR9H 1RULL 3QHZL 1DBBH 4JO4H 3T6VA 4OF6A 4AXWA 4OD3H 3VSVA 4BZ2L 4OM0L 4A04A 1I8LA 1I1YB 4Z8FH 2FL5B 4BKLA 4L0PB 3FXEA 4NQEA 4DETA 4OJFH 1Q9LB 1ITCA 4X7SL 4KO6A 2OQQA 2Y07L 4PYGA 3MA9L 4JDZA 5CBAA 1T04A 3VFUB 3VNYA 2NX5E 1JRHL 2K7QA 4JRLA 1OO2A 5F9OL 4M00A 5AAWA 1RUPL 5BV7C 3TYFA 3ILPB 5E2TL 4Z0XB 5IBTL 1SQVD 1F90H 1YQVH 4C83B 5AKSA 3NN8B 3KXFD 4DN3H 3AMLA 2DZEA 1IK9A 3QDJE 1N7LA 1NKZB 5DR5L 4H2AA 4ZMDA 4HH9B 3LEVL 3M1BB 2F53E 3MLWL 3CCRP 2YA1A 5D2LB 2XWZA 4S1RH 2PXYB 4B9GA 5TDNB 2W60A 3L73J 1NC4A 4YLQT 4YHZH 4F5CA 4XT1C 4KJYB 2Y2TA 3WFCL 2X3CA 5ICYB 2NY5L 5ACZA 1HTLC 2EIEA 2LXBA 2Q76A 3HRZA 3KJ6H 1B4JH 2EH7H 3VYIA 3T0WA 5FO8B 1J0JA 3H4FA 1S5LH 3L3IA 4NSKA 3ULUE 3H1HG 4R7NB 2K4AA 1ML0A 4X4XB 3ZU8A 4JQ0D 2ZYIA 3N44B 1AMYA 4MCMA 1R5VB 2IOOA 1FNHA 1I3GL 2ZXCA 1OE1A 3TNNB 3QUZD 2WTRB 3MNVA 3O81A 3HPLB 3MXVH 3QORC 3QUYA 4G3YH 3WTUA 3VQLA 3QK0A 4YPCA 1CFQB 3OR7B 1GCFA 3X2QB 2UVFA 1FJPA 4YDJA 1JGIA 1OD7A 5EDXA 3E6HB 3VQ2C 5C71A 2GY7B 5TF0A 3SDXE 1ZE3H 4X6DB 4KZCA 1YTZT 3L45A 4MMYB 1O7SA 2A83A 2DLFL 3H25A 2ZXEB 1ZXGA 1CTMA 2BVPA 2G60L 3ME0A 3MOBH 4FFZA 4IRSA 5F1IB 5J13C 5EEUA 3N85L 5DJDA 4ZQKB 2L7JA 2R9HD 3HMXH 4BRVA 5LGKA 5APTA 2FT7A 4JQIA 1QEXA 2VIRA 1G7IA 3FUDA 3VFOA 3VSQA 5EORH 4ZODA 4AYDC 4WI6A 1TFHA 3QH9A 4QYOA 1PZ5B 4P48A 4JREB 1MI5B 2W83C 5EIVA 2O5ZL 1K6QH 1ZS2A 2FATL 2XWDA 2GJ6B 2WV3A 3MLYH 4WIQA 2X6UA 2OZNA 4OZGB 3ZZ1A 1Z3GH 3VI4B 3P73A 1MVFA 1UWEH 1IEBB 4L8BB 1TVBB 1EBAA 1RJLA 1UURA 2WZ0A 5KYXA 2F8OA 5DEJA 4NQDE 2BNRD 1AZRA 1WFUA 2ZOKA 1SQPE 2R69L 3QH3B 5J1AB 1QLED 1USQA 2H2SC 3HZ3A 4PB0H 2A3TA 4BKTC 2YKKA 4LMQI 3TT1H 4ZNEA 5ERWB 4R2GB 5GJTL 5LGJB 2BHZA 1OZUA 1RMFH 4J3WA 2CUAA 2G3ZA 5E2TH 1MJ7H 3F83A 4XXWA 4DZ8B 1SS1A 3GSWB 1OAZL 1QHQA 4HFUH 4JFOA 4LRNL 5D6CA 3HUJB 2F8XC 2X4OA 3WFEH 4WWIA 1J1PL 2BS71 5DR5H 3WFBH 5TQ2H 2AQSA 3AREC 5ESVB 1L0LK 1G9HA 3SKJH 2Q9IA 1LP9B 1EMTL 4U3SB 4WI5A 2FXMA 4JHBA 1BM3L 2DJ4A 2W07A 3TBCA 3AEGC 5DK2A 1KOAA 3KPPB 2IIJA 5IMOA 4QY8B 3FXDA 1O6SA 1SFCD 4KXCA 5IHUL 1ETZB 1OTUD 2WSKA 3QPKA 2AQPA 5I1LA 2KERA 1NTME 1C1EH 1IAKB 1LTTC 2NMSA 4C4UA 1MCEA 1E4KC 3S97C 4OD3L 2J8UE 2VLME 4JFWA 1NTZG 4UDTA 3KGSA 2GKIA 3ECVA 1K3IA 4FFTA 1U95A 1LE9A 1WE5A 1OGTA 3VXTB 2V3FA 4KKRA 3MGNA 2BY1A 1BG9A 2Y5QA 5E1GA 3PWPE 3RK2D 4IU2B 5I1EH 3TNMA 4PJ8B 3VXNB 1JF1B 4WY7H 1OTSC 1X4YA 2NNCA 1ZANL 4JKKA 1BCCG 1IGIH 1TR7A 3FU9A 1E9OA 2FIRT 2X4TB 2IFGA 3GMNB 4P5SA 4D2NA 3FO9A 1OCWH 1XGQA 4GAAA 5DRXB 2JQZA 1R5LA 2QJYC 1I9IL 3BPOC 2X4NA 1BXVA 4LBEA 1FAVA 3BUQA 4OSUL 3VU1A 2V4HA 3RWFA 2FEJA 2DOCA 4G72B 4Q58C 4Z95H 5HDOA 3AEAC 1FOSF 1YY8B 4OV5A 3ABLB 5AW1B 4RFEB 4APQD 4J3OH 5L2JA 1J5CA 4F2EA 5A2LH 1MRFH 2OR8A 4NGHL 2IPUG 1N6VA 4NKOA 4TNEA 2AJVL 1NC2D 4I9WE 1RUQH 1JEKA 1GY1A 4M7KL 1RPQA 1YY9C 4UOW1 4XVJL 3UC2A 3ATEA 3X3FH 3C6LD 4GBXB 4HIQA 5B8CA 1DD4A 5J6HB 1WISA 4XCNA 3TPUA 4ACTA 3OWRA 4L8DB 1PP9E 3C2AL 4LDLB 3VXSA 3WDJA 5ENWB 1QP1A 4YDKH 1OTSD 4PS4H 1GGBH 3S5YA 1LE5A 5HPOA 5IFHH 4WO4D 2Q86A 2YPKA 4YHIB 2XC8A 3JV4A 4ISVA 4YTPC 5FHAH 1MIEH 4GXFA 3L6FB 3TBVB 4AQAB 1P7BA 1SYSA 2YBRA 1U92A 1MNUL 5C07A 2O30A 4GQ9H 1SQVE 4BZ2H 3RNQB 1P7HL 5DFVD 3R1GL 3QO1B 4NEHB 3N3EA 4I2XE 3HZVB 3RWHB 3RL1B 3FH5A 1IAII 2D3JA 1O6SB 4MXQD 4NLAA 1Q0XL 5BRZD 3KPOB 5KZCD 3GUTB 2J2ZB 5ICZB 1BMWA 3FS9A 4WNJA 2WOBA 4GSDL 1PV3A 1DVTA 2D3LA 4NO0A 3ZO0A 3P3TA 2P5WB 3DTXB 5I1GL 2KK7A 2WPGA 2AEFA 5H35B 1FWXA 3A0HE 3NESA 1M71A 3U30B 1PZSA 2GAZA 3TIEB 1NLDH 1E9PB 4J3OF 4AXWB 2NPSD 1ETB1 3BLPX 4JW3A 3T0EB 4KDTC 5D4QA 4OJCA 2F58L 4N0YL 4RISL 4FNPA 5DFVC 2VMFA 5E8EA 3UFIA 5JIKA 2X0VA 3BDXA 4BEIA 1QLRA 1ZA6B 4M5TA 4Y8DC 4N78E 1MREL 1CFTA 3WKYA 2VDRB 1K72A 4HIIA 3IN0A 2XICA 3OQRA 5HHQA 5IFJB 5DD0H 3MCKB 3A6OA 3TYFB 3IR9A 2FX8H 2MQGA 4TLFA 3QFJE 4A7GF 2YD6A 3BW9A 4AY0A 2K6ZA 4B97A 3VRIB 2CKBH 1K8AQ 3WFCH 4WZ9A 2O61A 3Q6FB 1SM3H 2Q87A 3HEIB 5KBMA 4B3EA 1FFPA 4S1QH 4D9LL 1P0SE 1LDPH 4RNRB 3S9DB 5AAPA 1Z5YD 2D8KA 3HPJB 1L5GB 2E59A 3OXRB 1ZR4A 2NR6D 1G43A 4TVUA 4EUPA 3EDKA 3PTZA 2E76B 3EADA 4UAHA 1IC7L 4YVNA 1Q94A 1DQMH 4QWWC 3RKDD 2VKXA 1A4JA 3OHMB 3BZ4A 4DVBA 2C9SA 4OZGF 3EYSL 4U1NB 1H0TB 2XTJD 3EJUA 1KYOD 1EO5A 4JY4B 3WUWA 4G80B 4M1DL 1OIPA 2AMUA 5KOVC 2W94A 2A74B 3SQRA 2ED6A 1KTDA 4DO6A 3SBRA 4W9EC 4XMPL 2GSGA 1WTLA 2C3WA 5C0NC 2MOVA 3R4YA 1RZKL 4JG0H 4Z3IA 2DKMA 3A22A 3FTXA 4UB8E 2HLFC 3S96B 4E9QA 2JKLA 1RU9L 4FNLH 4HB1A 3BVUA 2IO5A 3TM6A 1ERNA 3WSQH 2N0MA 3DARA 4Z76A 3ULSB 2IH8A 4Z7QF 3D25B 4PJDE 1CUOA 2WQAA 4GKSB 1ESOA 3EH2A 1ZEAL 5D7IB 1F6AA 4LEOB 1F97A 4Z7OE 4LE8A 4PWEA 1V7NL 2CXKA 4XMLL 2Y5EA 4JFEA 2XWJA 2Y24A 1IFMA 3TA3A 5DMJB 4DGIH 3B2PA 3FCGA 4YQXL 1KZYA 4N2KA 1QFWH 1JV2B 2Y06H 1DN2A 4G9FE 2YPLB 4P0DA 1CMOA 2JR8A 3CPLB 4NN7C 3WNLA 4JZOA 2AI0L 1P84D 4K3DH 1QQDA 1BGYJ 3EFDL 1KCBA 1RZJC 1KJMB 3QEQD 2VDRH 3E1IA 1MI5E 1M05B 2VDKL 4PRIB 1CLCA 1E3ZA 1KCUH 4JM4L 4OKVB 3ZVVA 5CD5C 3GTVA 2JEEA 3QIBD 2NQCA 1YC8A 4RISH 1JPGA 4NPKA 5C07E 4H13C 3JTTB 3O6FA 3JT0A 1U3HC 1CZ8H 1I1RA 5KYXB 4L2LA 2AKRA 5A3ID 2YBGA 1ZJAA 3ETTA 4ZPTB 4GY4A 2HUHA 4OZGA 2MSPA 4PP1D 5DLML 2DQDL 3D9AL 4NQEE 3ZSSA 3KZ8A 3BRDA 4XE0A 5A43C 5L8KB 5A6IA 5CMZA 1BAWA 4F58L 3KPSE 4PR5A 4F92B 5ACLA 1LT9C 5D6CB 4FNQA 1TCRA 4R0LB 5DLLA 1V8HA 1MCOL 3H9SD 2IDQA 3QI9C 3V4VL 7FABL 2IX7C 1YN6B 5DZOA 3CXHE 1Z9PA 4PRBB 1YC7A 1IZNB 1NMBL 1BMGA 5KSAA 2FLMA 2LW3A 3EH3B 3RG1C 4DZBA 4QCIB 4F1ZA 3TK1A 1MWAL 2FR4B 4P5TB 4LMQE 2ZOUA 4H8UA 2DQJH 4HK0B 1J5OH 1KLFB 2J5WA 1PKQE 4EAEA 1S9XA 5B7EA 4LVOB 2RAMA 1CB4A 4HDIB 4N2IA 1A6TA 4XNXH 4WI2A 9PCYA 1K3ZA 1VRSA 4PJ5B 4DEPC 2APBA 5SWZD 4NWTH 4P2RA 1X5ZA 3FONB 2M2DA 2VABB 3F6JA 4F7TB 5ESAA 1M2VA 2R2HA 1P7KA 2OMXB 4LFHG 2WUCL 4N6RB 4OZ4B 4ZSOE 3ZKSD 4MQXD 3VXPA 2W0KA 1ZLSL 4L2YA 4YHNA 2PYED 4MX7A 4L75A 3U1QA 3HG1E 3QI9D 3HIZA 5E5MB 2Z4EA 1TKWA 2AK1H 1BCCE 3IDNA 3SKNB 3KYOA 4ONGH 5HYJA 4WHTA 1NANH 3CDGB 1HSAA 1VFBA 4DK3A 3QJXA 3RHWF 3W11D 3QZLA 1CLZH 4OLZL 2QBWA 2AEMA 4Z7UE 1F56A 2BMKA 5LNEA 3ABKB 3AE4C 15C8L 3JUZA 1JUFA 1LYQA 2NY3B 5G2NA 4EN3C 3BQVA 1MIEL 4PD4J 3TN0D 3VACA 3ZIYA 2GITB 3AREA 5AW7B 5EUOB 4C4KO 4UILH 4F8NA 5I75B 2P45B 5GHWL 5ISZA 3I6SA 1OAYH 1Z9NA 3ROOB 5J6HA 4GW1B 5DMGD 1PPJE 2VKWA 3S5LA 4X9HA 3FCSA 3PXLA 3GXFA 2E8ZA 3O6FD 3MCLL 5F0JB 3M6DA 1I7UB 1MWAB 2EEXA 1T6VN 1N8ZB 3BAEH 3NMDA 3FK3A 2W5PA 3MJ8A 3TCLB 5JMOC 2AEOA 2BW4A 1X9LA 2DMCA 3GLEA 4IKNA 3AE7C 1BG1A 1RZFL 4QDGA 1SYSB 2OI9B 1NU1J 2WMPB 3HLAA 5GS0L 4ZFOA 4KQ4L 2YPKB 4H8HA 1Q72L 3O4LB 3P4MB 5CAYB 2V7HB 3RZCB 1HKLH 5ESQA 1YYMH 3ZUNC 3B5NC 2WQVA 5DEFB 4FJ6A 3CXHH 4XNZB 3H9SE 4C56A 5C2BH 4RX4D 3AB0B 3LX9A 1QRKA 4MMZC 1W5CE 5CN1A 3OMNB 3HTKA 2R0WH 1U58B 1IT9H 3A6BH 1SLQA 3PLNA 5IW6A 2NPSA 1SDYA 1NMAH 3O8ZA 3F12B 3L5XH 2HLEB 3D3VE 3H7BB 2Y9YA 3KYMB 1UEYA 5TE7H 4B7IA 2I5YL 5A6MA 1AR1C 1TZGL 1BF5A 5CINL 1IGMH 1KC5L 4XXWC 2BP3A 5DHYA 3BT0A 4U6TA 3FUMA 3EUUA 1F02I 1H8LA 1IGJA 3IF4A 3BVDB 4P2OA 2APTA 2NXZC 5B8CC 2WKGA 2GJJA 1NH4A 3QUKB 1IC5H 4IYKA 3A4DA 3EFOA 4ODSH 1L9QA 4HV8A 5GSVB 4JDTH 4YSQA 3NH7L 3MRQB 5EUKB 4YSCA 2VJXA 4HWBH 4LO9A 4EBQH 1GH7A 3MAWA 3LXCA 1KD1Q 1IEAB 4PGEB 4HS6B 5F97E 5EO9A 2R8SH 1E40A 3KVDD 4HIIB 5E99H 2A06G 1IAOB 1UXSB 3WKMH 1FFPB 3EJYD 4JHWL 3C5XA 4PJIB 3BC9A 1AHWC 5FLUA 5C0IA 3RGHA 5HVFB 3L75J 4X7FC 2VJ8A 4ANUA 1NCJA 1ZTXL 2XN1A 3ALXA 1IBBA 4GQQA 3VWJC 1BQKA 3BVVA 1EV2E 1L9MA 2DL2A 5HDBB 3TEUA 3E1ZA 4IRJD 4U1HA 2KLTA 2OYIB 1KYFA 4DJGA 1SXBA 3L3GB 2IQ9L 4P2AA 1EDYA 5DYOA 1AFOA 3P4NB 4LU5L 5KSVB 1VKXB 5F7YC 3KJ6L 1YMMD 1B3IA 2BXZA 2Y23A 4ZD3L 3Q48A 3FB8B 3O8XD 1TQSA 2AJXH 2OFQA 3HBPA 4G1MB 4K9EC 5BRQA 5T1KD 5IEHB 4XP6H 2FWOA 4YUEL 4E9LA 2O5XH 3OLEA 3P9LB 2VC2H 3DBXB 3WUWB 5IIEA 4EDFA 5DJ6A 2D7TH 4H20H 1B0IA 4R4LA 2FBOJ 2L5GB 1P5UC 3OKMA 5BO1H 5C0EA 1L7IH 2NNAA 2E7DA 1S7RA 2VISA 4BSWB 1WF5A 2NY5H 32C2A 1CF8L 1E4WL 4C58B 2EUVA 4C56D 1AY1L 2GVYA 3NT0A 3MV7D 4ZOAA 1S7UB 2V2WB 2CLVA 1BM3H 3AACA 5D7SH 3SPCA 1KQLA 2AW2A 2P1YA 1GW4A 1SN0A 3FQUA 4Z7UA 3HE4A 2JI1A 4G8AC 3E6FB 3JV6A 2Y3AA 3VWKA 1SHXA 1FF5A 4XNQB 2VZ3A 4UDUB 2GSIB 3L73G 4TVPH 3VP9A 5HHOE 1FORL 1JV2A 3ZKXB 2FL5A 1YJDL 1IGYB 2EYRA 4JY4A 3V7AE 5EORL 2EUZA 1KYDA 2E7CA 2RCSH 2RJMA 2GK0A 5MEND 2Y9ZA 4BSVA 2E7BA 2X3AA 4F7EB 4F8PA 5A40E 3TF5A 4X8CA 2VUYA 4RMQA 4Z7WB 1GS8A 4OKVA 3QWOC 2DLFH 3EGSA 3DC0A 1VF5B 1U8CA 1F11B 1UM4L 3FU5A 4TVSa 4K5NA 2I07A 3GRBA 4QHMA 4QEGA 2CSPA 1QMUA 2OYKA 3WN5C 3A4FA 2I85A 4GUCA 5C0CB 1TTBA 4WI3A 5E7FA 3MBWB 4C8XA 4JFDD 4MKTA 2FO8A 1HBWA 2ZUQC 2A9BA 3W67A 3DHPA 4ES8A 4HWBL 3CFJA 3IF1B 3JVGA 4AVHA 4DP6X 4PJBB 2ZYSA 4FQIH 3BJLA 4ZPTA 3W38A 1JGVH 2FYUG 1I3GH 1SJHA 2VQTA 3HS8A 4FFZH 4O00A 3WL9B 1BA9A 3ESUF 4FULA 2EH8L 4K9EH 3GMOA 4ODTL 4P4KD 3RE0A 3QDMB 4O4YH 5T5NF 3WFHB 2X1WL 4MJHA 4Q0XL 5JQIB 1JUNA 1TVHA 3P4OB 4OGZA 2KPNA 1L6PA 3I6LD 4XBGA 4XAKD 1MCIA 3ZGIA 5EF3A 4P2OC 2CD0A 1OSYA 3BPOB 4H8WL 5K9OB 1F58H 3DETC 1JWSA 1KJMA 2VC2B 3C6SA 2CRZA 2WAQA 4LSVH 2BIOA 1Z66A 1J0ZA 1RP9A 3G5WA 4IKJA 3BOVA 1KMGA 3EO1A 5C0DA 3RWGB 4L4VB 1W16A 4KZEL 4DW2H 2K4WA 3LOWA 1MEXL 1X9RA 3CFMA 5EC2A 5K1VA 4X4YB 5HHVH 2JXMB 4Y2OB 4WSJA 4J4PC 5KLVK 3Q9PA 2MPAL 1BQHA 1QL2A 4UTBA 5MEQA 2F53D 3NJGA 4JREC 3WEXB 3AAZA 4ELMB 4H20L 4F7TA 3IETA 4AYFB 1BDCA 3RYMA 3DVIA 5K9JH 2R7EB 4G6KH 1INQB 1OLZA 4AVKA 1BZ9A 1AZNA 3K5RA 3W9DB 1HZHH 3S34L 3QDJD 4PD4D 2Y6SC 3LKOB 4RAUB 5FOJA 1OARH 4L3ED 2G60H 3MOBL 4W68A 3T1FB 5IVZA 2MQ0A 3BWAA 2E4FA 2WK2A 3I02A 3EZ8A 5IBTH 3ULUD 3QPXH 2DM4A 2F74B 1LP1A 5AVSB 3QJOA 5GGSB 3ARED 1KTRL 1NIBA 1TKWB 5MP6H 5BQ7B 2PR9A 5C8JA 4U1SB 1FCGA 2XPGB 2AEJA 3B2UC 4JFZL 5ISZD 1XH2A 1M3JA 4EBQL 2O1AA 5M94B 1DEDA 3GMAA 3I6GA 4MD5B 2YGNA 3QQ9C 1ND0A 2CQVA 3T0EE 3TC9A 2E9BA 2I32A 3CH1A 2OTWB 2YAPA 1JZHA 1ETJA 1J2JB 1NA8A 2BP8B 2ZXGA 4J1UA 3INOA 4ZAKA 5MEPB 3RVVD 3WKML 5DJXB 1GL2B 1KCVH 4QRPE 5ID1A 4Z7VB 3HS0C 5IKCA 1RHHA 1RJLB 5GTIH 3UBXB 5IQOA 1JNMA 3RUGA 3TVMA 2YNYA 2OMYB 3O2WL 4IRSB 1Q9KA 3PRZA 1AD9B 2EABA 5APXA 2DF3A 3LVTA 1NO4A 1KCRH 5E56A 1BREA 5EF2A 2WMPA 1F18A 3HLAB 2I25N 1FYTD 2NX5D 2R59A 3SE9H 1SN5A 1TITA 5CEZL 1QLFA 4POUB 1CI6B 3KLAB 4KI5F 3AZUA 3APDA 2PCXA 3ZE1E 4CN4A 2N9BA 4AYSA 1DE4B 4O9HL 1GU5A 1OXYA 1MXDA 1IFDA 2BCCG 4LDEB 5FXCH 3CTTA 1O5PA 1K9TA 2QVMA 4NQDD 3DX6A 4Y88A 4G70B 4P57B 5FF6A 2PAJA 1OT4A 1UCBH 4Q9QL 5GGUA 5JO5B 4FEIA 1IAKA 2YXQB 4W4OC 5BZDB 3CN0A 2R39A 4Y9FA 1NZRA 4PJCB 1YY9D 1DQTA 1G7QB 2F54E 3WHXA 4IGBD 4RBPH 2JB6B 1RFDL 2OLDA 1Y9BA 5DDHA 2WSCJ 5EEVA 1X5AA 3BQUA 4QRTA 3MRMB 4L73A 3TNUA 2F58H 1DZ0A 2VGLM 1U36A 1UCTA 1SVZA 4P46A 2L4OA 4PJFF 3VXRD 4F5CE 3V9FA 2BCCJ 2WSFJ 1AVYA 3VMYA 4KJQC 4XVUC 2GUSA 1X5KA 1LXMA 3OTTA 4WWPA 5DWUH 3RWIA 3PL6B 5F71A 1HSBA 4NQUA 5FCSH 5CZVL 3C08L 1DQDH 2P3YA 5DJZA 3FULA 3CD6P 1EX0A 4X50A 5D7LA 2IZ0A 2ALAA 2H8PB 2Z0UA 3SE8L 4E2OA 4N2AA 5KVEL 3HFFA 4G9FB 4J3SA 4QRQB 2JFCA 1ZIBA 1KNOA 1G6RL 4LOUD 5IBUG 4QD2E 2O1KA 2MRYA 2X6BA 4PJIA 1LO0H 3LS4L 4DKTA 4FQXB 1G7LB 4NKIH 4X5PA 1UGNA 4NB7A 2HTKD 2CO6B 4DN4H 4UM8B 4HD5A 4C4BA 3C8VA 1UZ8A 4R96B 5IMLB 1JXFA 3BO8A 2EE3A 2OXGB 4TUOA 3IU4L 1U95B 5K9QI 2VUOA 3CV5A 1S9WA 3UZEA 4I0CC 2C34A 3L2LA 1IM9D 5I1GH 2VDKH 5A2KH 3B37A 1KJ2B 1YNTF 3K3QA 2MCMA 4DP0X 1AGCA 3E7KA 3QXUA 3M45A 4QRSB 1Q0XH 4A39A 2OL3L 4AMXA 3CFKB 3QZOA 5GGUB 4A6YA 4O2CA 4IBLT 5D2NC 1E8WA 1O0VA 3MRGA 4JVPA 3SCMB 1SJVA 3NACH 3T4AB 3RPIB 4YHPA 3GHGB 3S8FB 4HJUA 5AW8B 3WHE1 3OXSB 1ZMEC 3ATBA 1CGYA 4QR7A 4DIXA 2OL3B 3GLAA 4GSUA 4K3JH 3X17A 1XR9A 4GNKB 1FZEA 5JHLA 3D69A 3VI3A 3WNIA 3OMAB 1HWTC 3D33A 4QXTB 2XXCB 3G5ZB 4IDJH 3H1HJ 3Q0HA 4HK3N 2AXTH 3NJLA 4LARL 5ICXB 3QJVB 5CM1A 3ZT7A 1S78C 4TULH 1FNGA 3NQKA 4KNQA 1OAXH 3L9RB 5EV7A 3F64A 5FWQA 1KENL 1AS8A 1L2PA 1OWAA 4I0PB 5HDQH 3ARDA 4FDWA 4M3JA 4YC2B 3WTVA 1RQUA 1S7SB 5A2CA 3TCTA 4ZUTA 2A73B 2LVCA 2NY6D 2P8PB 4Q4EA 2R0KH 1SM3L 3S88H 1ZRTE 3J8F7 3LEYL 2FGWH 2AV7B 3X3GH 5DMIL 1BJ1H 5LQBH 4NUGL 1JVOA 3ULVL 1M6OB 12E8H 1GGYA 1C12A 3GRWH 3N04A 5GGVH 3JBG7 4XNQA 3ETBF 2JDIH 1XF2A 1SEBB 4F7CA 3H1JG 1E6JL 1YPZE 3RNKA 5HHXL 2GAZB 2QT6A 4RDBA 1INEL 1T4WA 1X5GA 4W6YB 3KLKA 3TIEA 1G1IA 4C59B 4F37F 1MF2L 3VX0A 3FU6A 2BY3A 3N0PB 2JF1A 5KVDE 2Y1VA 3C8KB 2UXVA 1N64H 1YNLL 5AYQA 3AS0A 1I8MB 3WFHA 2BNUB 4NC2B 3TBSA 3BH9B 2Y1YA 5BRPA 1DH3A 1X7TA 3KMDA 4EDWH 5EU4A 1DUZA 4HZLA 1J1XH 3B34A 4F7MB 1NKNA 1R34A 3H9HA 4IOIA 3OG4B 1JPSH 1BYNA 5FYKL 1H3GA 1PYWB 4YBLB 5HI5C 2Z1PA 4S1DD 3BESR 4FLOA 2ZCHH 1PIXA 4UTAH 1JHTB 3VGGA 1FFOA 4JPKL 3PP3H 2OL3H 5CKAA 4Z1MH 3UAJD 5L2KD 1MHEB 3IMWA 3QIWC 5GRYA 2HKAA 1JY2N 1MFDH 1ZV5A 1L7TL 2GK2A 1INQA 2P5EA 1MWOA 1E3XA 4RX4A 4X5LA 4APXB 4LIQE 1DCLA 4DVRL 1HKLL 4HIXL 2KI6A 4G8GA 3M86A 1RUAL 4EO5A 3LRMA 1HDMB 3IK2A 4NQCE 3L4YA 5CINH 2IQAB 4QI3A 3UX9B 3SDCA 4YSEA 4PJCE 4DPBX 2NLJB 3IS0X 4D7PA 1FNSH 4Y2DD 1KT2A 3MI6A 3G6DH 3S36H 5HHMD 4N1HB 1P7QA 1CYGA 1NBYB 1CZ8L 4EQ3A 4L3FA 1FP5A 2JXMA 2BNQD 4HLZG 2QIWA 4MZ2A 1KB9J 2VDML 3MLSH 1S9YA 2O6PA 5IUCA 4WI4A 5GGQH 5LBGA 4F2FA 4TLUA 4P5TC 4U1JB 2QSVA 2NYKA 3MHZA 3QQDA 5TISH 3FT9A 2H88C 4ZMOA 1X5MA 1JG9A 3E38A 2BVYA 1DL7L 1I1YA 1T03H 3WKQA 3AU1A 3DHUA 3PNWB 1XT5A 3LEYH 1P84E 1D5IH 3OKKB 1NIEA 5E8NA 1H5BC 3WTYA 1MCWM 4JZOB 3LPGA 3N41F 5F7UA 1HYSD 2QSCL 1UD2A 1XF5A 4A1RA 3LKSA 2FFDA 4KJPC 4AQ8C 1KN4L 3LNEA 1TG8A 4HIHA 2IGFL 4TL5A 5I18L 1ZEAH 1SQPG 5DD1H 3US0A 1CI6A 1CL7L 4WFEE 1HHGA 1L9PA 2DLTA 2DQUL 2I26N 2EJ1A 2ZSVA 2QR0B 3T65B 4AITA 3ABGA 2XIIA 2KS1A 3QCUH 1C5BH 3GIZH 3BGMB 4XN4A 4XO4A 4ZJ9A 4G6JH 1X7QB 4GKZA 4NQED 3PFQA 2B15A 5L9DH 3CAFA 4RFEA 4PJHA 5FS5A 4DUXA 1FIGH 5TE7L 3ZTNH 1E8YA 2A38A 2IOIA 4LLDB 5K1NA 4O58L 3RUGB 4K3JL 1GRWA 1YI2P 1B3JA 1DJWA 3TTYA 4EI2A 3MGTB 3JXAA 2OK0L 4BZ1A 4XCYB 4DGVH 4PJGB 1GYAA 4NIKB 1VDFA 2L7QA 3EHBD 2W80C 3LQZB 4QHNB 5I75C 4CBZA 1ZHLA 1DANT 2XT1B 1NMAL 1KGWA 2WWWA 1BP3B 2ZX6A 4TYUA 4HWNA 1X44A 3KLAA 4K94C 2GTWB 2O5XL 4NZJA 1BE3E 2E74D 5LDUA 2Z1KA 1G0YR 4KK5D 3L6FA 1NGWB 1B9KA 3TBVA 2UZIL 4AQAA 1JCCA 1TZGH 5TGBB 3MCLH 1GYUA 4FG4A 4FFVC 4N3TA 1YJNP 1A7QH 5CP7B 2V9QA 1RZJH 1MFDL 3CLWA 3GC3A 3TO4D 3WXWH 1NVOA 2B87A 1OSPH 1CFVL 3L5HA 4I18B 3CZSA 5A2AA 1ZANH 2IPPA 3BKJL 4ODHL 2QRXA 4ONHB 3GF3A 3CCLP 1EZUA 4KGJA 4OQTA 3IDYB 4Y16D 4U6VL 4OFDA 3S4SB 3OJVC 3NJIA 4F33A 5GS0H 3HBGA 7FABH 1ANUA 2O26U 2H26B 4ZKUA 1ZTXH 5CU9A 4XNZC 5BJTB 3IGKA 5HHOB 3Q05A 2WXLA 3WDHA 1ZHKB 4QHKJ 1S6NA 1IM9A 3K6FA 1WZAA 4WGKA 2EILB 3H0TA 4HJSA 4W9LC 4YDNA 3VD7A 5MENA 5KYYA 2IVFC 4IQHA 1SQQD 1BD2B 4IBQA 4GG8A 2HUEA 4HKJA 4PJAF 3DRTA 4O02H 1KBBA 3T08A 5LHDA 1RZPA 5DQJB 3HG1B 4AZUA 1SQVG 4XNXL 1PLAA 1I7TB 3CSPA 3V52H 3ARFA 1NLBL 4AE0A 4FS0A 3T0EA 1LNUB 4YIQA 4X5RA 1TENA 1E5BA 3ZDYB 4WW1B 5D1XC 2DY2A 2XUWA 1GKOA 2OJ1A 4Q6KA 1IC4L 4X98B 4QRPA 2I1KA 1MI5A 2YAOA 1WGVA 3QA3B 3AT9A 5CZRA 4BWUA 1AGCB 4I3SL 2DQEL 2OCJA 3ARGA 5ANHA 1TVBA 4MAYC 5EU6B 4MS6A 2OR9H 1URIA 2HODB 2EXWC 1RJYA 2ZCKL 3B9KC 2G9HA 5A6LA 3P9MB 1PPJG 1CXFA 1FFRA 3V4PL 3BISA 1U7JA 2QLVB 1U8QB 3CQFA 2VN5A 5DZNA 3U0WL 3NGBC 3RWDA 2HSIA 2UV3A 4EUPB 2YLKA 2K3HA 3I2CH 5E1AA 3GSXA 1JMBA 3WIFB 2MPAH 3TV8A 4JO1H 2A6JA 3TWYA 3UIZA 5AVVB 4WY4C 4KK8D 4P2OB 1R3KB 3JWNE 2YQ2A 1T22B 1OAJA 1KBWA 3H8NA 3SO3C 3ZKQD 5CP7A 1B9ZA 3AQXA 4Q56A 5IEKB 4LVNC 1D7CA 1EUTA 2XKUA 2ZXWB 2NPSC 3BWSA 4M6NH 4XX5A 1RZGB 2YK1L 5BO0D 1N70A 1D7DA 4OLXH 2VLKD 4PJDF 4Y4KC 2NW3A 5FECB 4MASA 2R0LL 4HX1B 3BH8B 4NNPL 2BIMA 3AS1A 4L3EA 1DEEB 1FNLA 5BJTA 1S7SA 3CXHK 1SQBE 3II2A 4WWID 2V3DA 4JO3H 5D71H 1A7PH 2VOTA 1PZBA 1CDIA 1MSPA 4H25A 4JR9L 4NP4H 1JGVL 5DJUB 1HH0A 3OA7A 5C09E 2A9DA 4HKBB 5E2VH 3SE4C 1W0WA 1SXAA 5D7IA 5DT1L 3WCYA 4HIPA 4WY4D 4Q0XH 1VA9A 4PWKA 2ZXBA 3HG1A 1JI2A 4OZHF 1ZGLP 4H8WH 1WIOA 4LHJB 4AYGA 1S3KH 1TJHH 4F57L 2P7JA 3BAIA 1NGPL 2KNCB 3MLUH 4HUUA 4OF8A 3VH8A 4E41A 2W0FA 4LLHA 1DDHA 2DWXA 3KJ4C 3CHSA 2VR3A 2BSSA 2A45H 4EI0A 4XN5A 4ETYA 1H3VA 5I1HH 2EVHA 5H37A 2H3XC 2V9RA 5F7FA 3B3IA 5B3JE 3SGDH 3OAZK 4CNIA 3UMNA 3MLWH 4ANKA 3P32A 4ACPA 5KBPA 2NQDA 4QXUL 5D5MF 4ZUWB 2IBZX 3DURA 3T97A 4FNTA 1HC1A 2JJUA 1E43A 3H85A 3SKUD 1FZFA 4R9HA 2WBJD 1ACZA 1LO5B 4C46A 3N1FC 5FO2A 3SPGA 1F4AA 3EBIA 2EYTB 5HHVL 5J9PB 3GBLA 2XWBA 3IVKB 1CC3A 3HB3C 1YJDC 4HHAB 1EJOL 4LCUB 3UOAB 1QZ1A 1X5HA 2EIBA 3A47A 4WK2B 5ACZB 1T66C 2DDQH 3KNBA 4QXWA 1NC2A 5IR1B 1RZ7H 4B96A 1ODAA 3DETD 2WT7A 2MCPL 2VMDA 4LLYA 4FYRA 5LCVH 1JTPA 2P8MA 1DUZB 1KELH 3GMMA 4HZLB 2N0KA 4P3DB 5I9QB 2X28A 1P9MA 3ILEA 1WBYA 3S4RA 2FR4A 2IFMA 1CGUA 1JRHH 4P49A 1N8OE 5DRZB 1VQKP 3FN3A 4C47A 4X6BB 5ETUB 1KCLA 4L4VE 5D6DC 4FQLL 1SQ2N 4AVIA 4Z3FA 1ADWA 2N4IA 3DYPA 3FWNA 4NHUA 1C8PA 1PNCA 1MAKA 3GHEH 1KTJA 3EYFA 4WU7B 4FCAA 2IDUA 1JTHA 1I7ZA 2UZYB 5ABAA 1JNHB 3NIDF 3BSZA 1ETA1 2ICES 2NY2B 4KX8A 3RVTD 3WU1A 1HH6B 3LS4H 1XDTT 1NLBH 5A2JH 1GU4A 1WDAA 4N5EC 4XWGH 1TT6A 3KPQB 3AEDC 2XRAL 3ZTNL 4J3OG 4FLRA 5KVEH 5SX5K 4ZT1A 4PRDB 4XRCA 2JJTC 3NCYP 4GJTB 3T3PB 3WUWG 3EF4A 3ARTA 3BVHA 3CFEB 4TSAL 4XNYL 4ZK8A 2H6PA 3CLEH 3IM1A 1A6ZB 4RBPK 1HQRA 4NKIL 5A2IH 1UWXK 2OR9L 3L5WA 4AI7A 3KBFA 3QG6A 4FXGA 4I1RA 5I5MA 3MFFA 5F7DA