2H8PD

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB heavy chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2h8pD00
1SFCC 1KILC 2N1TB 1L4AC 1SFCB 3M0DC 1T3JA 1HVVA 3B5NA 1URQA 4OH8B 3HD7B 2NPSA 3B5ND 1URQD 4N78E 1XTGB 3B5NC 2KOGA 2M8RA 2HG5D 4WY4A 4WY4D 1KILB 4WY4C 1L4AB 3VOPA 3RK3D 3P8CE 1N7SA 1JTHA 4WY4B 3RK3C 1N7SD 2NPSD 5CCGA 1URQC 3RK3B 5CCGD 2NPSC 5CCHA 3KYQA 2WZ7A 3B5NB 5CCHD 5KJ7A 1URQB 2NPSB 3HTKB 1GL2A 1GL2D 2N1TA 2H8PD 1GL2C 2N1TD 1SFCA 1SFCD 4W7YA 2N1TC 1N7SC 4LGDE 3HD7A 2PP6A 4W7ZA 3RK2D 3PP5A 3HD7D 1N7SB 1JTHB 5CCGC 5KJ7D 3RL0D 2HFED 3RK2C 5CCHC 3HD7C 2XDJA 5KJ7C 3RL0C 3RK2B 4W80A 3TSIA 3RL0B 2YMYA 1KILA 4JF7A 1L4AA 1KILD 1NHLA 1GL2B 1L4AD
chains in the Genus database with same CATH superfamily
2FYZA 4U3FE 2WSEJ 5E79E 2IYOA 5AVTB 1NTZJ 3GHGA 3A0HE 1LWUB 1NTMK 1BGYD 1SQBE 1N8RQ 1SVFA 1NOHA 3QH9A 3PLNA 4WY4A 1M57D 1KD1Q 4IL6H 1QL2A 2YKOA 1VF5C 2Q6QA 3B8EB 4UB8H 1K04A 1BSHA 3V2PA 1G2CA 1CSBA 1SQBK 3H1JJ 1SQXG 2E75D 3H1LJ 1YITP 4NPDA 3MGNA 3L72E 3VYIA 4GDOA 1GD2E 4HB1A 1P84D 1GL2A 1FZFA 1HTLC 2IPPA 1RF1C 2OYOA 3ITKA 2W83C 4TT3H 3CLQA 1CW5A 1FJPA 4W7ZA 3WMM0 1BCCJ 1S5LE 1KILE 1L0LG 2FXOA 2E75B 4L75A 1NTKG 2G8YA 2O01H 1LTGC 1EDKA 4L73A 1VQ8P 5KKZC 3AE6C 2Y9ZA 3CCLP 4XE5B 1KYOI 2ZYGA 5KLVG 1N73C 5APXA 2IDBA 5L8RJ 2Z4EA 1L0NG 2GUVA 1URQD 4N78E 1ZP0C 1AQ5A 1N7LA 5B5EH 2FBWC 2JWDA 3IN6A 3O6QA 2WMMA 1NTMG 1U7MA 4I7ZB 1GW3A 3I5CA 4DZOA 2C9LY 2K9YA 4HJGH 2QM7A 2QVAA 3JC22 3CXHH 5CCHD 1URQB 4XFJA 2YO3A 1ZV8A 3TF5A 3CCVP 2FYNC 5KLIC 1RF1A 5AW8B 2N1TD 3IF4A 2ZT9D 1S72P 4W7YA 1SP4A 1JUNA 1PGJA 1OVUA 1NAYA 3VP8A 1BE3G 3GF7A 4RO0A 1X0TA 2XZRA 4JQ0D 1XTCC 1L4AD 1MV8A 1SS1A 2N1TB 4KT0J 1AVYA 2KLUA 2ZT9B 3F89A 1ZRTE 2YXRB 4RESB 3AEBC 3S1KA 1KORA 2Y0CA 5GTIE 1KFNA 2FYUG 3CCRP 3L73J 3LW5H 3TGUG 1YQ3C 5GTHH 1ZLLA 2P1JA 1IFPA 1L4AB 1MZ9A 1JY3O 1N7SD 3NTNA 3BCCD 4KHXA 2I1JA 1LNQA 5CJ4A 5CCGD 5CBNA 3CX5D 1KV4A 2NPSB 2E75C 4PD4H 3A0BH 4DCKA 1LTIC 3V2NA 3N4XA 2JEEA 5KAIH 1NU1J 1DEBA 1M1JB 4WWIA 2DW3A 4QMAA 1SFCD 2YKPA 1K73Q 1FZGA 1HWTC 1T6AA 5AW9B 1T2KC 1P84E 3CWBD 3ZDMA 4XA4A 5TJHA 1LWUA 3PP5A 1N7SB 3C8VA 2WQYC 1JB0J 2HFED 1S1CX 1SQXJ 4H44B 2PAJA 1SQQG 4PD4D 2H88C 5E79H 3MHVA 3RL0B 3KZIE 4NPEA 2O01N 3M9BA 1WMKA 3A0HH 3M0AA 2Q7CA 2IBZG 5AVZB 1DH3A 1RE3A 1LTJB 1HGVA 1N86A 1SFCB 1NTZG 2BCCD 2NRGA 2J58A 1FBMA 2Y9YA 1A02F 1L0LJ 4C46A 4U3FD 1NTKJ 3LW5J 2LXCB 2R44A 3Q5SA 5AVRB 3H1JG 3L71E 2QIWA 5AVYB 1HJ0A 2WITA 5KLVJ 5AW0B 1MUUA 1G1JA 4GOEA 5APVA 2R5BA 3AEAC 3VN0A 3RBZA 3BRVB 1K8AQ 1NTMJ 2H8PD 2QJKB 1S5LH 4CPGA 2B87A 3CCUP 3UIAA 4H0LD 2N1TC 1VL2A 3CXHI 1BDDA 2BCCJ 2QE7H 1BGYG 3VMAA 2GUSA 2QJPB 1VQMP 4UB6E 3P32A 2PGDA 4I1LA 1AA0A 1IFMA 3CC2P 5EFWB 1FDIA 1IZNB 2I1KA 1CI6B 3BASA 1J1DC 3TNUB 1SQBJ 4HKZH 3A3YB 3V6IA 1KILD 1L4AC 1M56D 2FFDB 4WVZA 1LGHB 1URQA 4GODA 4OH8B 4O9BA 2RH0A 3CCJP 1A02J 1VDFA 3GLMA 1VQNP 1PP9D 1L2PA 2IFMA 4N78D 4EIJA 3L72J 1M1JC 1KILB 2WT7B 3RBXA 5K5GB 3I55P 2WPRA 2OGUA 3GHGC 3RK3B 5CCHA 1LP1B 4Z1MH 4BRYA 1JY2P 2H89C 4K35A 1JNMA 2N1TA 2FXMA 1DX7A 3FGAD 4AUWA 3HE5A 1GDTA 2QM8A 2C0WA 1D7MA 4M3LA 3M0DA 2UWJE 2WTYA 3HD7D 1JTHB 5AW7B 3CD6P 2W90A 5AW3B 3HRNA 2KSJA 1YJNP 2KNCB 1L4AA 3TDKA 1Z56A 1JY3P 2JKVA 4R4MA 3F5HA 3HD7B 2NPSA 3EQ2A 3V4WA 2YNYA 1ZMEC 3L75E 3L70E 2W6JH 1OX3A 1EZVG 1VPCA 5DJUB 2HG5D 4IFDK 1M1JA 3H25A 3H1HE 1ZN5A 1N2DC 3A7OA 2QEXP 1N7SA 1Q7YQ 3H1ID 3MUDC 1YJWP 5CCGA 2E5TA 3D6ZA 2QJPC 2M3BA 2M3EA 4ZKPA 1KFMA 4YPCA 1S2EA 1P84H 3GW6A 1NU1G 3CL3D 1LTJA 3AE4C 1Y8AA 2HPCB 2V7QH 1SFCA 1FC2C 4AYCA 2POHA 2CK3H 2WVRA 1Q2NA 3KZIH 1FE6A 1LJ2A 4PJ0H 4H0LC 1UIIA 4C7NB 2RKLA 1GW4A 4YXWH 4H13B 5AVQB 3OW2O 2FKWB 1EXIA 2XU6A 3NFQA 3WU2E 1M90Q 1AQTA 4JYCA 1KB9I 3BCCG 1PV3A 1KILC 3QWOC 1GTWA 1BGYJ 3L74E 1RF0A 2ZYDA 5APSA 4ZNCA 5M1BA 1IFJA 2KIKA 1PPJE 1J1EB 3RK3E 4Y99B 4ASWA 3P8CD 1AV1A 1M8OB 2W6AA 3CWBG 1T8ZA 1JCCA 1UIXA 2E74C 3MUDA 5AVSB 1HJBA 1OW6A 1PP9E 3NXSA 1M7LA 1NKNA 1EXJA 4IL6X 4Y28J 2OYHB 3M9HA 3CI9A 1PGOA 1JO5A 3HUSC 2K3RA 2OTLP 2YIUC 3G71P 1R5LA 2D2CB 3L71D 3TNUA 3FWLA 3L4FA 3AEGC 2IBZI 4UB6H 3K5BA 3MP7B 2B89A 2V7QJ 5KAFE 3D71A 4JBZA 2WWWA 3AE7C 3PTZA 2BCCG 2FFDA 4JPZB 4WB4A 3V2QA 5C39A 3W67A 3H1KE 2PP6A 4U3FG 2XNXA 1OW8A 2NZ2A 4DT0A 1KYOE 5AW2B 3G3ZA 1SQVD 3M91A 3HD7C 2P2UA 1FS0E 1SQBG 3AE1C 3EWKA 1GK6A 1KILA 4KJMA 2ITAA 3OAKA 1AVOA 3VP9A 2JDIH 3FX0A 1T3JA 4ASVA 3BATA 3PRJA 2C9NY 1LWUC 1FAVA 3V2RA 1HVVA 3WUTA 1OZHA 3B5ND 1H8AA 3KDPB 2O1JA 2AEFA 2ZYAA 1LT9B 2WSCH 5DJTB 1QLED 3L72G 2JR8A 2ZFCA 1OXZA 4D6TE 1RE3C 1VQ9P 5B66E 1IFDA 3II6A 2IZ0A 1JTHA 3HUSA 3B4SA 3L35A 4AQRD 2NPSD 3CX5H 2QJYB 2O3JA 4BWNA 4N6JA 3S4RA 3B5NB 1VQPP 2Q5UA 2OQQA 1IJDB 1FZBA 3H1IE 3HTKB 2KP8A 1PGPA 1EDJA 5APUA 1S3JA 4HH2A 2VRSA 2KK7A 5AVVB 2AXTE 2Q3EA 5AVUB 1VQOP 4H44D 2JP3A 3HD7A 1H88A 2OTKE 1P84I 3RL0D 3H6PA 1K05A 1PP9G 1ZR4A 1DEEG 2GA1A 2P7JA 3RK2B 1NJIQ 3LIDA 1GMJA 4R4LA 3SWFA 1GU4A 3U1CA 1J1EC 4Y99C 1BSNA 4PV1D 1NHLA 2Z5HA 3PJSK 2P10A 1R5SA 2ZXEB 3CCSP 2K37A 2K88A 1PIXA 3Q2YA 2KS1B 4OWFA 2WSCJ 1VQLP 4IL6E 1MKMA 4IOIH 2HPCA 4I7ZC 1FZCB 2L5GB 3L75D 4PV1B 3AE8C 3L70D 3BCCJ 5APWA 1SLQA 3O8ZA 3P8CE 4C7NA 4WY4B 4GKGA 1W2BO 1YIJP 2ZVOB 1ZR2A 1URQC 3H1HD 2AXCA 4ZKUA 3GF3A 2OYIB 1G2CB 2W27A 3VMXA 3CWBJ 2YKQA 1WT6A 2KYVA 1IC2A 1PFIA 5AVWB 3P7KA 3WU2H 5CCHC 1FDOA 1M1KQ 1EZVI 3A2AA 2E5YA 3TSIA 3G6EP 3R4YA 2YMYA 2N9BA 1SQVE 2FY8A 3IFMA 3IAOA 1VQ4P 3L70J 1VQ7P 1BE3D 1NGMB 1RHZB 2ZT9C 5CHXA 1KQGB 1W5CE 3M0DC 3G4SP 4U3FJ 3H1HJ 1R8EA 1RY3A 5B5EE 2XKMA 3B5NC 3L74D 1BDCA 1SQVK 1X8YA 2M8RA 2IZ1A 1KZUB 2FXPA 3AE3C 1S9KD 1PPJD 1GZLA 2FYUD 1HBWA 3RK3D 1Y47A 3CXHE 3KPEA 1YTZI 3TGUD 1HH0A 1VF5B 3VMZA 2OTJP 5KAFH 2CPSA 1QX8A 2W8ZA 1PGQA 3V4QA 2NPSC 3KYQA 5KJ7A 1JM0A 5AW6B 1OIPA 1FDMA 3L36A 4U7JA 1OFCX 3GMAA 1KYOH 1X79B 1K9MQ 3CX5I 3C9IA 1JOCA 1N7SC 1PZQA 4EDFA 2PFXA 1RF1B 1SQXE 5CCGC 4H44C 4L74A 1J2JB 3CCQP 4LC1A 1RQUA 3RL0C 1SQPD 3AE9C 1LT9A 3H1KD 2B9BA 1IK7A 2R3CA 2O1KA 2W6BA 3SFDC 1KYOD 3N7NA 3D6YA 4LLHA 1LTJC 2HODB 2ZJSE 2J59M 1Q82Q 3V5BA 1SFCC 1SQQD 1NO4A 4PD4I 2I8DA 3TYYA 4I6MC 5APYA 5KKZB 3B5NA 3L71G 5APTA 1L0LE 1N73B 1JCDA 1PP9J 4HYTB 1NTZD 3WUVA 1LTBC 5GTIH 2A06D 1VQ5P 2BEZF 2Z5IA 3EFFK 1GK4A 3SWYA 1L0NE 4D6TD 1RF0C 2YXQB 2JO1A 2AXTH 3S9OA 1RQVA 3E7KA 2V4HA 1KMIZ 2QRXA 3AEFC 2Y0DA 3H1LD 2CPBA 2QJKC 2RN0A 5AW5B 2A45G 3LIEA 2FYNB 3WUUA 1W2EA 4GT1A 1L0NK 4H13D 3BRTB 3M06A 4IFFA 2LKMA 3CCMP 2IFNA 4BXLA 2KS1A 2E43A 2AEJA 1H89A 4W80A 1OVRA 1KC8Q 1BCCD 1FZCA 2M5AB 3MZWB 1VQKP 3ABVC 3MIWA 2FFDC 4C7RA 1DIPA 4IFMA 4D6TJ 1EDLA 1BE3E 2OYIA 4L76A 3HE4B 1U7JA 3P8MC 2IX7C 2YMKA 3CMAP 3Q3DA 2ZXXA 2HYNA 1FU1A 3H1IJ 1QGKB 4OGQD 3OJAB 1T2KD 2D2CD 3RK3C 1S9KE 2WPVB 2FYUE 1PL5A 4DOJA 1QL1A 2K1AA 3TGUE 2Y0EA 3TK1A 1EC5A 3JCUE 5BU8B 1KB9E 2G3AA 2JJLA 1IFNA 2P67A 4OGQB 1FOSE 2FYUK 1CI6A 2E42A 5KJ7D 3T97B 2WPQA 1JMMA 2B87B 1E79H 4A7PA 1KQSO 1TU3F 5H2FE 3L75G 3PH0A 3L70G 2H43A 3D70A 4I2LC 2SPZA 1HUCA 1IK9A 1SQPE 2A45H 3H1HG 3OA7A 1LTTC 3M9QA 1SQQE 1CZQA 5CJ0A 4DJGA 2OARA 5AW1B 2K9JB 3SSUA 3H32B 2P58A 3CC4P 3W68A 2WT7A 1HGZA 1DD4A 2IBZE 1SQPK 2YO2A 4YXDC 3L73D 1YI2P 1KQLA 1NTZE 3VOPA 1LP1A 3CPWO 1EZVD 1NYHA 1SQQK 2A06E 3L71J 4WBAA 2WZ7A 5TISE 3Q5PA 3CXHD 1JMBA 2HODA 1H0TB 2KZJA 1YTZT 3AEDC 1JEKA 1OW7A 1KN7A 1NTZK 4BRYB 3AE2C 3E1IA 2O01J 1X22A 3H1JE 1SQVJ 1JY2O 3H1LE 1NU1D 1E5WA 2Q9IA 3Q1MA 3RK2D 3L37A 1N73A 3L74G 4H13C 3HE5B 1JY2N 2KNCA 2QSIA 3I56P 1ZW0A 1YYCA 2BEQD 2PRRA 2ZAEB 4EYYQ 1SQXD 1PPJG 1J1DB 1MFTA 2KSEA 1BGYE 3PHLA 1BCCE 2E76D 2AEMA 2BASA 3U59A 3BVHA 1OWAA 1OVVA 1XTGB 2B88A 2KOGA 1JY3N 1L0LD 3CC7P 2LR2A 1NTKD 4YTPC 4WY4D 4TLFA 3R2PA 5CBOA 5APQA 2WSFH 3KXDA 3SFEC 2XV5A 2OYHC 1YQ4C 1T3UA 2E76B 4OGQC 1SQPG 3H1KG 1MFZA 2D2CC 1NVOA 1QVFO 3GHGB 3Q5RA 5KLVD 1L0ND 2M5AA 2WPSA 4UB8E 1GL2D 1LTSC 2KI7B 2LXBA 4GIFA 3KQGA 2KZIA 4PJ0E 1RE4C 1NTMD 5AW4B 4JYBA 2HR3A 1AJYA 3HE4A 2QG4A 3A5TA 3FXDA 5KJ7C 3AECC 3FWNA 2MKVA 2Q3IA 1USDA 2A06G 1Y9BA 2N9YB 1GL2B 1ZXGA 4MN4C 1EQ7A 1SQBD 4D6TG 4B86A 4NPFX 2WSSH 1X9VA 1IFIA 2QA4P 3H1LG 1YJ9P 1LT9C 1KQFB 1L0NJ 4K3AA 3L75J 1HF9A 2A45I 5CMZA 1Q90D 2MJZA 1USEA 3H1IG 2OYHA 2WSFJ 1VF5D 1AFOA 5AVXB 3KHUA 2H7HA 3AEEC 1Q86Q 2QJYC 3T97A 2R3SA 3L72D 4EOTA 3JCUH 3FXEA 3L73E 1FOSF 1KB9H 1BCCG 3U1AA 1S4XA 4RKUJ 1EZVE 2M0BA 4GOFA 2XNDH 3E1RA 1Q81Q 2GM4A 3O6QB 1RE4A 2IYPA 1NWQA 5H2FH 1QVGO 2HLOA 3EFGA 3MD0A 2K9JA 1KB9D 4H0LB 3USSA 3JSVC 3RK2C 2JWAA 3H32A 2L91A 1NU1E 2R5DA 1BE3J 4ZMDA 1FZEA 3MTUE 2R32A 1LTAC 4JF7A 3CMEP 1EDIA 4EI2A 1S5LX 2E74D 1LT1A 3SWKA 1OMIA 1YHQP 5BU5A 4OVNF 2E76C 2WSEH 3L74J 1U57A 1NU1K 1NH4A 1H0TA 3NMDA 4N3YB 3B71A 2FYUJ 3C1LA 1FZCC 2C0XA 1G1IA 2Q1KA 4PV1C 3BCCE 2KB7P 1WRGA 5TISH 5BVZA 2KLVA 3TGUJ 1SQXK 4WY4C 3CX5E 2E74B 3RGUA 1QEXA 2IBZD 1NTKE 5B66H 5GTHE 3HTKA 3VTPC 2OYIC 3HUSB 2YIUB 3CCEP 3AE5C 3CWBE 1FZAA 3VMYA 1NKZB 1SQVG 2ZVNB 5KLVE 1GL2C 3GG2A 1L0LK 1NTKK 1ZOYC 4PD4E 1YBKA 2J5UA 3A0BE 2RMZA 4LGDE 1KTMA 1SQPJ 3H1KJ 5KAIE 3G9RA 1GU5A 3H1JD 2KUBA 1RH5B 2XDJA 4RJTA 1NTME 1FJKA 1SQQJ 3L73G 1ZRTD 1IO4A 1VQ6P 5KLVK 2BCCE 3IR9A 5KLIB 5KTBA 1NAFA 1DD3A 2KXPB 3RL0g
chains in the Genus database with same CATH topology
2A45H 1L4AC 2FYZA 2ZXEB 2FFDB 1LGHB 5AVTB 3OA7A 1LTTC 1URQA 3GHGA 3M9QA 4OH8B 4O9BA 1LWUB 1CZQA 1NTMK 5CJ0A 2OARA 5AW1B 1SVFA 1NOHA 3H32B 1A02J 2WT7A 1VDFA 1HGZA 4WY4A 2HPCA 1SQPK 2IFMA 4N78D 1FZCB 2YO2A 2L5GB 1QL2A 4EIJA 5APWA 1M1JC 1KILB 2WT7B 1SLQA 1KQLA 3VOPA 2YKOA 3O8ZA 3P8CE 4C7NA 4WY4B 3B8EB 4GKGA 1SQQK 3V2PA 1G2CA 2WPRA 1CSBA 1SQBK 1ZR2A 1URQC 3GHGC 3RK3B 4WBAA 5CCHA 2WZ7A 4ZKUA 2OYIB 3MGNA 1JY2P 1G2CB 2HODA 3VYIA 1GD2E 2W27A 3VMXA 1GL2A 1YTZT 1JNMA 1FZFA 1HTLC 2YKQA 1NTZK 2FXMA 1WT6A 2N1TA 1DX7A 2KYVA 4AUWA 3E1IA 3HE5A 2IPPA 1GDTA 2QM8A 1IC2A 2C0WA 4M3LA 1JY2O 1PFIA 1RF1C 3M0DA 1E5WA 2Q9IA 3CLQA 2WTYA 1CW5A 1FJPA 5AVWB 4W7ZA 3RK2D 3HD7D 3L37A 1JTHB 3P7KA 3WMM0 1N73A 3HE5B 1JY2N 5CCHC 5AW7B 3A2AA 5AW3B 3TSIA 1YYCA 3HRNA 2YMYA 2KSJA 2N9BA 3IFMA 1J1DB 1L4AA 1Z56A 2O01H 1JY3P 1LTGC 5CHXA 3M0DC 2BASA 3U59A 3BVHA 4XE5B 1OWAA 1N73C 5APXA 1RY3A 2Z4EA 3HD7B 2NPSA 3EQ2A 2GUVA 1URQD 2XKMA 3V4WA 4N78E 2YNYA 1AQ5A 1XTGB 3B5NC 1N7LA 1SQVK 1X8YA 2KOGA 1VPCA 1JY3N 2M8RA 2HG5D 4IFDK 1KZUB 1M1JA 4WY4D 1S9KD 3R2PA 1GW3A 1GZLA 1ZN5A 1N2DC 5APQA 1HBWA 2WSFH 3A7OA 3RK3D 3I5CA 2XV5A 2OYHC 1N7SA 3KPEA 1YTZI 1T3UA 4DZOA 2C9LY 1HH0A 3VMZA 2CPSA 5CCGA 1MFZA 2M3BA 3V4QA 2QM7A 2NPSC 4ZKPA 3KYQA 5KJ7A 5CCHD 1KFMA 1URQB 2YO3A 3GHGB 5AW6B 1FDMA 1ZV8A 3L36A 3CL3D 2WPSA 1GL2D 1LTJA 1LTSC 4GIFA 1X79B 1RF1A 3KQGA 2HPCB 5AW8B 2N1TD 1SFCA 4AYCA 4W7YA 1SP4A 1JUNA 2POHA 3C9IA 1JOCA 1RE4C 1N7SC 5AW4B 4JYBA 1RF1B 4C7NB 3HE4A 5CCGC 1GW4A 1J2JB 3A5TA 3VP8A 4LC1A 5KJ7C 3RL0C 5AVQB 2Q3IA 1LT9A 2R3CA 2FKWB 2O1KA 2W6BA 3N7NA 2XU6A 2XZRA 3NFQA 4LLHA 1LTJC 2HODB 2J59M 1XTCC 1GL2B 1L4AD 1MV8A 4JYCA 3V5BA 1SFCC 1NO4A 1KILC 1EQ7A 2N1TB 4B86A 1GTWA 3TYYA 4RESB 4I6MC 1X9VA 5APYA 3B5NA 1IFIA 5APTA 1RF0A 1N73B 1JCDA 5APSA 4HYTB 1KFNA 1IFJA 1LT9C 1J1EB 4Y99B 2A45I 3LW5H 5CMZA 3P8CD 1LTBC 2MJZA 2W6AA 1ZLLA 2P1JA 1T8ZA 2OYHA 1JCCA 1AFOA 1L4AB 5AVXB 2Z5IA 3MUDA 5AVSB 1HJBA 1MZ9A 2H7HA 3NXSA 1GK4A 1JY3O 1M7LA 1N7SD 1NKNA 3NTNA 3SWYA 3T97A 2OYHB 3M9HA 4KHXA 4EOTA 2I1JA 3CI9A 5CJ4A 1JO5A 3HUSC 5CCGD 1RF0C 1FOSF 3U1AA 2NPSB 3TNUA 1LTIC 3L4FA 3V2NA 2CPBA 3N4XA 2GM4A 2JEEA 5AW5B 2A45G 1DEBA 2WWWA 3LIEA 1RE4A 1M1JB 2FFDA 1SFCD 1W2EA 4WB4A 2YKPA 3V2QA 1NWQA 1FZGA 1HWTC 5AW9B 1T2KC 4GT1A 1L0NK 4XA4A 3BRTB 2PP6A 3M06A 1LWUA 2HLOA 2XNXA 3PP5A 4IFFA 1N7SB 3EFGA 2LKMA 3MD0A 3G3ZA 5AW2B 2IFNA 2HFED 3M91A 3RK2C 3H32A 3HD7C 2E43A 2P2UA 2PAJA 1H89A 4W80A 2R5DA 3RL0B 1FZEA 3MTUE 1FZCA 2R32A 1LTAC 1GK6A 3M9BA 1KILA 4JF7A 3M0AA 2Q7CA 3MIWA 5AVZB 3OAKA 1DH3A 1RE3A 2FFDC 1LTJB 4C7RA 1HGVA 3VP9A 1N86A 1SFCB 1T3JA 5BU5A 4IFMA 3BATA 2C9NY 1LWUC 1FAVA 2WSEH 1HVVA 3V2RA 2J58A 1NU1K 3B5ND 1FBMA 1NH4A 1H8AA 3KDPB 2OYIA 1A02F 3HE4B 3P8MC 4C46A 3NMDA 2O1JA 4N3YB 1LT9B 2WSCH 1FZCC 2IX7C 2C0XA 1G1IA 2ZFCA 5AVRB 2KB7P 1WRGA 1OXZA 5BVZA 2KLVA 2HYNA 1SQXK 1RE3C 1FU1A 4WY4C 1IFDA 3II6A 3OJAB 1JTHA 3HUSA 1T2KD 3L35A 3RK3C 4AQRD 2NPSD 5AVYB 2WITA 1S9KE 3HTKA 5AW0B 3VTPC 1MUUA 4N6JA 2OYIC 4DOJA 1G1JA 3B5NB 5APVA 1QL1A 3HUSB 2R5BA 2Q5UA 1IJDB 1FZBA 3VN0A 3HTKB 3TK1A 3BRVB 2KP8A 1FZAA 3VMYA 1NKZB 2H8PD 1GL2C 5APUA 5BU8B 4HH2A 2VRSA 5AVVB 1L0LK 5AVUB 2JJLA 1IFNA 1NTKK 3UIAA 2N1TC 2P67A 4LGDE 2GUSA 3HD7A 1FOSE 1H88A 2FYUK 1CI6A 2E42A 5KJ7D 3P32A 3RL0D 4I1LA 2WPQA 1JMMA 1GU5A 3H6PA 2XDJA 1IFMA 1ZR4A 2P7JA 3RK2B 3LIDA 2I1KA 1FJKA 3SWFA 1CI6B 3BASA 1J1DC 1GU4A 3U1CA 1J1EC 2H43A 4Y99C 4I2LC 3TNUB 1IO4A 3A3YB 3IR9A 5KLVK 5KTBA 1HUCA 1IK9A 1KILD 1NHLA 1NAFA 2Z5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFC C;  1KIL C;  2N1T B;  1L4A C;  1SFC B;  3M0D C;  1T3J A;  1HVV A;  3B5N A;  1URQ A;  4OH8 B;  3HD7 B;  2NPS A;  3B5N D;  1URQ D;  4N78 E;  1XTG B;  3B5N C;  2KOG A;  2M8R A;  2HG5 D;  4WY4 A;  4WY4 D;  1KIL B;  4WY4 C;  1L4A B;  3VOP A;  3RK3 D;  3P8C E;  1N7S A;  1JTH A;  4WY4 B;  3RK3 C;  1N7S D;  2NPS D;  5CCG A;  1URQ C;  3RK3 B;  5CCG D;  2NPS C;  5CCH A;  3KYQ A;  2WZ7 A;  3B5N B;  5CCH D;  5KJ7 A;  1URQ B;  2NPS B;  3HTK B;  1GL2 A;  1GL2 D;  2N1T A;  2H8P D;  1GL2 C;  2N1T D;  1SFC A;  1SFC D;  4W7Y A;  2N1T C;  1N7S C;  4LGD E;  3HD7 A;  2PP6 A;  4W7Z A;  3RK2 D;  3PP5 A;  3HD7 D;  1N7S B;  1JTH B;  5CCG C;  5KJ7 D;  3RL0 D;  2HFE D;  3RK2 C;  5CCH C;  3HD7 C;  2XDJ A;  5KJ7 C;  3RL0 C;  3RK2 B;  4W80 A;  3TSI A;  3RL0 B;  2YMY A;  1KIL A;  4JF7 A;  1L4A A;  1KIL D;  1NHL A;  1GL2 B;  1L4A D; 
#chains in the Genus database with same CATH topology
 2FYZ A;  4U3F E;  2WSE J;  5E79 E;  2IYO A;  5AVT B;  1NTZ J;  3GHG A;  3A0H E;  1LWU B;  1NTM K;  1BGY D;  1SQB E;  1N8R Q;  1SVF A;  1NOH A;  3QH9 A;  3PLN A;  4WY4 A;  1M57 D;  1KD1 Q;  4IL6 H;  1QL2 A;  2YKO A;  1VF5 C;  2Q6Q A;  3B8E B;  4UB8 H;  1K04 A;  1BSH A;  3V2P A;  1G2C A;  1CSB A;  1SQB K;  3H1J J;  1SQX G;  2E75 D;  3H1L J;  1YIT P;  4NPD A;  3MGN A;  3L72 E;  3VYI A;  4GDO A;  1GD2 E;  4HB1 A;  1P84 D;  1GL2 A;  1FZF A;  1HTL C;  2IPP A;  1RF1 C;  2OYO A;  3ITK A;  2W83 C;  4TT3 H;  3CLQ A;  1CW5 A;  1FJP A;  4W7Z A;  3WMM 0;  1BCC J;  1S5L E;  1KIL E;  1L0L G;  2FXO A;  2E75 B;  4L75 A;  1NTK G;  2G8Y A;  2O01 H;  1LTG C;  1EDK A;  4L73 A;  1VQ8 P;  5KKZ C;  3AE6 C;  2Y9Z A;  3CCL P;  4XE5 B;  1KYO I;  2ZYG A;  5KLV G;  1N73 C;  5APX A;  2IDB A;  5L8R J;  2Z4E A;  1L0N G;  2GUV A;  1URQ D;  4N78 E;  1ZP0 C;  1AQ5 A;  1N7L A;  5B5E H;  2FBW C;  2JWD A;  3IN6 A;  3O6Q A;  2WMM A;  1NTM G;  1U7M A;  4I7Z B;  1GW3 A;  3I5C A;  4DZO A;  2C9L Y;  2K9Y A;  4HJG H;  2QM7 A;  2QVA A;  3JC2 2;  3CXH H;  5CCH D;  1URQ B;  4XFJ A;  2YO3 A;  1ZV8 A;  3TF5 A;  3CCV P;  2FYN C;  5KLI C;  1RF1 A;  5AW8 B;  2N1T D;  3IF4 A;  2ZT9 D;  1S72 P;  4W7Y A;  1SP4 A;  1JUN A;  1PGJ A;  1OVU A;  1NAY A;  3VP8 A;  1BE3 G;  3GF7 A;  4RO0 A;  1X0T A;  2XZR A;  4JQ0 D;  1XTC C;  1L4A D;  1MV8 A;  1SS1 A;  2N1T B;  4KT0 J;  1AVY A;  2KLU A;  2ZT9 B;  3F89 A;  1ZRT E;  2YXR B;  4RES B;  3AEB C;  3S1K A;  1KOR A;  2Y0C A;  5GTI E;  1KFN A;  2FYU G;  3CCR P;  3L73 J;  3LW5 H;  3TGU G;  1YQ3 C;  5GTH H;  1ZLL A;  2P1J A;  1IFP A;  1L4A B;  1MZ9 A;  1JY3 O;  1N7S D;  3NTN A;  3BCC D;  4KHX A;  2I1J A;  1LNQ A;  5CJ4 A;  5CCG D;  5CBN A;  3CX5 D;  1KV4 A;  2NPS B;  2E75 C;  4PD4 H;  3A0B H;  4DCK A;  1LTI C;  3V2N A;  3N4X A;  2JEE A;  5KAI H;  1NU1 J;  1DEB A;  1M1J B;  4WWI A;  2DW3 A;  4QMA A;  1SFC D;  2YKP A;  1K73 Q;  1FZG A;  1HWT C;  1T6A A;  5AW9 B;  1T2K C;  1P84 E;  3CWB D;  3ZDM A;  4XA4 A;  5TJH A;  1LWU A;  3PP5 A;  1N7S B;  3C8V A;  2WQY C;  1JB0 J;  2HFE D;  1S1C X;  1SQX J;  4H44 B;  2PAJ A;  1SQQ G;  4PD4 D;  2H88 C;  5E79 H;  3MHV A;  3RL0 B;  3KZI E;  4NPE A;  2O01 N;  3M9B A;  1WMK A;  3A0H H;  3M0A A;  2Q7C A;  2IBZ G;  5AVZ B;  1DH3 A;  1RE3 A;  1LTJ B;  1HGV A;  1N86 A;  1SFC B;  1NTZ G;  2BCC D;  2NRG A;  2J58 A;  1FBM A;  2Y9Y A;  1A02 F;  1L0L J;  4C46 A;  4U3F D;  1NTK J;  3LW5 J;  2LXC B;  2R44 A;  3Q5S A;  5AVR B;  3H1J G;  3L71 E;  2QIW A;  5AVY B;  1HJ0 A;  2WIT A;  5KLV J;  5AW0 B;  1MUU A;  1G1J A;  4GOE A;  5APV A;  2R5B A;  3AEA C;  3VN0 A;  3RBZ A;  3BRV B;  1K8A Q;  1NTM J;  2H8P D;  2QJK B;  1S5L H;  4CPG A;  2B87 A;  3CCU P;  3UIA A;  4H0L D;  2N1T C;  1VL2 A;  3CXH I;  1BDD A;  2BCC J;  2QE7 H;  1BGY G;  3VMA A;  2GUS A;  2QJP B;  1VQM P;  4UB6 E;  3P32 A;  2PGD A;  4I1L A;  1AA0 A;  1IFM A;  3CC2 P;  5EFW B;  1FDI A;  1IZN B;  2I1K A;  1CI6 B;  3BAS A;  1J1D C;  3TNU B;  1SQB J;  4HKZ H;  3A3Y B;  3V6I A;  1KIL D;  1L4A C;  1M56 D;  2FFD B;  4WVZ A;  1LGH B;  1URQ A;  4GOD A;  4OH8 B;  4O9B A;  2RH0 A;  3CCJ P;  1A02 J;  1VDF A;  3GLM A;  1VQN P;  1PP9 D;  1L2P A;  2IFM A;  4N78 D;  4EIJ A;  3L72 J;  1M1J C;  1KIL B;  2WT7 B;  3RBX A;  5K5G B;  3I55 P;  2WPR A;  2OGU A;  3GHG C;  3RK3 B;  5CCH A;  1LP1 B;  4Z1M H;  4BRY A;  1JY2 P;  2H89 C;  4K35 A;  1JNM A;  2N1T A;  2FXM A;  1DX7 A;  3FGA D;  4AUW A;  3HE5 A;  1GDT A;  2QM8 A;  2C0W A;  1D7M A;  4M3L A;  3M0D A;  2UWJ E;  2WTY A;  3HD7 D;  1JTH B;  5AW7 B;  3CD6 P;  2W90 A;  5AW3 B;  3HRN A;  2KSJ A;  1YJN P;  2KNC B;  1L4A A;  3TDK A;  1Z56 A;  1JY3 P;  2JKV A;  4R4M A;  3F5H A;  3HD7 B;  2NPS A;  3EQ2 A;  3V4W A;  2YNY A;  1ZME C;  3L75 E;  3L70 E;  2W6J H;  1OX3 A;  1EZV G;  1VPC A;  5DJU B;  2HG5 D;  4IFD K;  1M1J A;  3H25 A;  3H1H E;  1ZN5 A;  1N2D C;  3A7O A;  2QEX P;  1N7S A;  1Q7Y Q;  3H1I D;  3MUD C;  1YJW P;  5CCG A;  2E5T A;  3D6Z A;  2QJP C;  2M3B A;  2M3E A;  4ZKP A;  1KFM A;  4YPC A;  1S2E A;  1P84 H;  3GW6 A;  1NU1 G;  3CL3 D;  1LTJ A;  3AE4 C;  1Y8A A;  2HPC B;  2V7Q H;  1SFC A;  1FC2 C;  4AYC A;  2POH A;  2CK3 H;  2WVR A;  1Q2N A;  3KZI H;  1FE6 A;  1LJ2 A;  4PJ0 H;  4H0L C;  1UII A;  4C7N B;  2RKL A;  1GW4 A;  4YXW H;  4H13 B;  5AVQ B;  3OW2 O;  2FKW B;  1EXI A;  2XU6 A;  3NFQ A;  3WU2 E;  1M90 Q;  1AQT A;  4JYC A;  1KB9 I;  3BCC G;  1PV3 A;  1KIL C;  3QWO C;  1GTW A;  1BGY J;  3L74 E;  1RF0 A;  2ZYD A;  5APS A;  4ZNC A;  5M1B A;  1IFJ A;  2KIK A;  1PPJ E;  1J1E B;  3RK3 E;  4Y99 B;  4ASW A;  3P8C D;  1AV1 A;  1M8O B;  2W6A A;  3CWB G;  1T8Z A;  1JCC A;  1UIX A;  2E74 C;  3MUD A;  5AVS B;  1HJB A;  1OW6 A;  1PP9 E;  3NXS A;  1M7L A;  1NKN A;  1EXJ A;  4IL6 X;  4Y28 J;  2OYH B;  3M9H A;  3CI9 A;  1PGO A;  1JO5 A;  3HUS C;  2K3R A;  2OTL P;  2YIU C;  3G71 P;  1R5L A;  2D2C B;  3L71 D;  3TNU A;  3FWL A;  3L4F A;  3AEG C;  2IBZ I;  4UB6 H;  3K5B A;  3MP7 B;  2B89 A;  2V7Q J;  5KAF E;  3D71 A;  4JBZ A;  2WWW A;  3AE7 C;  3PTZ A;  2BCC G;  2FFD A;  4JPZ B;  4WB4 A;  3V2Q A;  5C39 A;  3W67 A;  3H1K E;  2PP6 A;  4U3F G;  2XNX A;  1OW8 A;  2NZ2 A;  4DT0 A;  1KYO E;  5AW2 B;  3G3Z A;  1SQV D;  3M91 A;  3HD7 C;  2P2U A;  1FS0 E;  1SQB G;  3AE1 C;  3EWK A;  1GK6 A;  1KIL A;  4KJM A;  2ITA A;  3OAK A;  1AVO A;  3VP9 A;  2JDI H;  3FX0 A;  1T3J A;  4ASV A;  3BAT A;  3PRJ A;  2C9N Y;  1LWU C;  1FAV A;  3V2R A;  1HVV A;  3WUT A;  1OZH A;  3B5N D;  1H8A A;  3KDP B;  2O1J A;  2AEF A;  2ZYA A;  1LT9 B;  2WSC H;  5DJT B;  1QLE D;  3L72 G;  2JR8 A;  2ZFC A;  1OXZ A;  4D6T E;  1RE3 C;  1VQ9 P;  5B66 E;  1IFD A;  3II6 A;  2IZ0 A;  1JTH A;  3HUS A;  3B4S A;  3L35 A;  4AQR D;  2NPS D;  3CX5 H;  2QJY B;  2O3J A;  4BWN A;  4N6J A;  3S4R A;  3B5N B;  1VQP P;  2Q5U A;  2OQQ A;  1IJD B;  1FZB A;  3H1I E;  3HTK B;  2KP8 A;  1PGP A;  1EDJ A;  5APU A;  1S3J A;  4HH2 A;  2VRS A;  2KK7 A;  5AVV B;  2AXT E;  2Q3E A;  5AVU B;  1VQO P;  4H44 D;  2JP3 A;  3HD7 A;  1H88 A;  2OTK E;  1P84 I;  3RL0 D;  3H6P A;  1K05 A;  1PP9 G;  1ZR4 A;  1DEE G;  2GA1 A;  2P7J A;  3RK2 B;  1NJI Q;  3LID A;  1GMJ A;  4R4L A;  3SWF A;  1GU4 A;  3U1C A;  1J1E C;  4Y99 C;  1BSN A;  4PV1 D;  1NHL A;  2Z5H A;  3PJS K;  2P10 A;  1R5S A;  2ZXE B;  3CCS P;  2K37 A;  2K88 A;  1PIX A;  3Q2Y A;  2KS1 B;  4OWF A;  2WSC J;  1VQL P;  4IL6 E;  1MKM A;  4IOI H;  2HPC A;  4I7Z C;  1FZC B;  2L5G B;  3L75 D;  4PV1 B;  3AE8 C;  3L70 D;  3BCC J;  5APW A;  1SLQ A;  3O8Z A;  3P8C E;  4C7N A;  4WY4 B;  4GKG A;  1W2B O;  1YIJ P;  2ZVO B;  1ZR2 A;  1URQ C;  3H1H D;  2AXC A;  4ZKU A;  3GF3 A;  2OYI B;  1G2C B;  2W27 A;  3VMX A;  3CWB J;  2YKQ A;  1WT6 A;  2KYV A;  1IC2 A;  1PFI A;  5AVW B;  3P7K A;  3WU2 H;  5CCH C;  1FDO A;  1M1K Q;  1EZV I;  3A2A A;  2E5Y A;  3TSI A;  3G6E P;  3R4Y A;  2YMY A;  2N9B A;  1SQV E;  2FY8 A;  3IFM A;  3IAO A;  1VQ4 P;  3L70 J;  1VQ7 P;  1BE3 D;  1NGM B;  1RHZ B;  2ZT9 C;  5CHX A;  1KQG B;  1W5C E;  3M0D C;  3G4S P;  4U3F J;  3H1H J;  1R8E A;  1RY3 A;  5B5E E;  2XKM A;  3B5N C;  3L74 D;  1BDC A;  1SQV K;  1X8Y A;  2M8R A;  2IZ1 A;  1KZU B;  2FXP A;  3AE3 C;  1S9K D;  1PPJ D;  1GZL A;  2FYU D;  1HBW A;  3RK3 D;  1Y47 A;  3CXH E;  3KPE A;  1YTZ I;  3TGU D;  1HH0 A;  1VF5 B;  3VMZ A;  2OTJ P;  5KAF H;  2CPS A;  1QX8 A;  2W8Z A;  1PGQ A;  3V4Q A;  2NPS C;  3KYQ A;  5KJ7 A;  1JM0 A;  5AW6 B;  1OIP A;  1FDM A;  3L36 A;  4U7J A;  1OFC X;  3GMA A;  1KYO H;  1X79 B;  1K9M Q;  3CX5 I;  3C9I A;  1JOC A;  1N7S C;  1PZQ A;  4EDF A;  2PFX A;  1RF1 B;  1SQX E;  5CCG C;  4H44 C;  4L74 A;  1J2J B;  3CCQ P;  4LC1 A;  1RQU A;  3RL0 C;  1SQP D;  3AE9 C;  1LT9 A;  3H1K D;  2B9B A;  1IK7 A;  2R3C A;  2O1K A;  2W6B A;  3SFD C;  1KYO D;  3N7N A;  3D6Y A;  4LLH A;  1LTJ C;  2HOD B;  2ZJS E;  2J59 M;  1Q82 Q;  3V5B A;  1SFC C;  1SQQ D;  1NO4 A;  4PD4 I;  2I8D A;  3TYY A;  4I6M C;  5APY A;  5KKZ B;  3B5N A;  3L71 G;  5APT A;  1L0L E;  1N73 B;  1JCD A;  1PP9 J;  4HYT B;  1NTZ D;  3WUV A;  1LTB C;  5GTI H;  2A06 D;  1VQ5 P;  2BEZ F;  2Z5I A;  3EFF K;  1GK4 A;  3SWY A;  1L0N E;  4D6T D;  1RF0 C;  2YXQ B;  2JO1 A;  2AXT H;  3S9O A;  1RQV A;  3E7K A;  2V4H A;  1KMI Z;  2QRX A;  3AEF C;  2Y0D A;  3H1L D;  2CPB A;  2QJK C;  2RN0 A;  5AW5 B;  2A45 G;  3LIE A;  2FYN B;  3WUU A;  1W2E A;  4GT1 A;  1L0N K;  4H13 D;  3BRT B;  3M06 A;  4IFF A;  2LKM A;  3CCM P;  2IFN A;  4BXL A;  2KS1 A;  2E43 A;  2AEJ A;  1H89 A;  4W80 A;  1OVR A;  1KC8 Q;  1BCC D;  1FZC A;  2M5A B;  3MZW B;  1VQK P;  3ABV C;  3MIW A;  2FFD C;  4C7R A;  1DIP A;  4IFM A;  4D6T J;  1EDL A;  1BE3 E;  2OYI A;  4L76 A;  3HE4 B;  1U7J A;  3P8M C;  2IX7 C;  2YMK A;  3CMA P;  3Q3D A;  2ZXX A;  2HYN A;  1FU1 A;  3H1I J;  1QGK B;  4OGQ D;  3OJA B;  1T2K D;  2D2C D;  3RK3 C;  1S9K E;  2WPV B;  2FYU E;  1PL5 A;  4DOJ A;  1QL1 A;  2K1A A;  3TGU E;  2Y0E A;  3TK1 A;  1EC5 A;  3JCU E;  5BU8 B;  1KB9 E;  2G3A A;  2JJL A;  1IFN A;  2P67 A;  4OGQ B;  1FOS E;  2FYU K;  1CI6 A;  2E42 A;  5KJ7 D;  3T97 B;  2WPQ A;  1JMM A;  2B87 B;  1E79 H;  4A7P A;  1KQS O;  1TU3 F;  5H2F E;  3L75 G;  3PH0 A;  3L70 G;  2H43 A;  3D70 A;  4I2L C;  2SPZ A;  1HUC A;  1IK9 A;  1SQP E;  2A45 H;  3H1H G;  3OA7 A;  1LTT C;  3M9Q A;  1SQQ E;  1CZQ A;  5CJ0 A;  4DJG A;  2OAR A;  5AW1 B;  2K9J B;  3SSU A;  3H32 B;  2P58 A;  3CC4 P;  3W68 A;  2WT7 A;  1HGZ A;  1DD4 A;  2IBZ E;  1SQP K;  2YO2 A;  4YXD C;  3L73 D;  1YI2 P;  1KQL A;  1NTZ E;  3VOP A;  1LP1 A;  3CPW O;  1EZV D;  1NYH A;  1SQQ K;  2A06 E;  3L71 J;  4WBA A;  2WZ7 A;  5TIS E;  3Q5P A;  3CXH D;  1JMB A;  2HOD A;  1H0T B;  2KZJ A;  1YTZ T;  3AED C;  1JEK A;  1OW7 A;  1KN7 A;  1NTZ K;  4BRY B;  3AE2 C;  3E1I A;  2O01 J;  1X22 A;  3H1J E;  1SQV J;  1JY2 O;  3H1L E;  1NU1 D;  1E5W A;  2Q9I A;  3Q1M A;  3RK2 D;  3L37 A;  1N73 A;  3L74 G;  4H13 C;  3HE5 B;  1JY2 N;  2KNC A;  2QSI A;  3I56 P;  1ZW0 A;  1YYC A;  2BEQ D;  2PRR A;  2ZAE B;  4EYY Q;  1SQX D;  1PPJ G;  1J1D B;  1MFT A;  2KSE A;  1BGY E;  3PHL A;  1BCC E;  2E76 D;  2AEM A;  2BAS A;  3U59 A;  3BVH A;  1OWA A;  1OVV A;  1XTG B;  2B88 A;  2KOG A;  1JY3 N;  1L0L D;  3CC7 P;  2LR2 A;  1NTK D;  4YTP C;  4WY4 D;  4TLF A;  3R2P A;  5CBO A;  5APQ A;  2WSF H;  3KXD A;  3SFE C;  2XV5 A;  2OYH C;  1YQ4 C;  1T3U A;  2E76 B;  4OGQ C;  1SQP G;  3H1K G;  1MFZ A;  2D2C C;  1NVO A;  1QVF O;  3GHG B;  3Q5R A;  5KLV D;  1L0N D;  2M5A A;  2WPS A;  4UB8 E;  1GL2 D;  1LTS C;  2KI7 B;  2LXB A;  4GIF A;  3KQG A;  2KZI A;  4PJ0 E;  1RE4 C;  1NTM D;  5AW4 B;  4JYB A;  2HR3 A;  1AJY A;  3HE4 A;  2QG4 A;  3A5T A;  3FXD A;  5KJ7 C;  3AEC C;  3FWN A;  2MKV A;  2Q3I A;  1USD A;  2A06 G;  1Y9B A;  2N9Y B;  1GL2 B;  1ZXG A;  4MN4 C;  1EQ7 A;  1SQB D;  4D6T G;  4B86 A;  4NPF X;  2WSS H;  1X9V A;  1IFI A;  2QA4 P;  3H1L G;  1YJ9 P;  1LT9 C;  1KQF B;  1L0N J;  4K3A A;  3L75 J;  1HF9 A;  2A45 I;  5CMZ A;  1Q90 D;  2MJZ A;  1USE A;  3H1I G;  2OYH A;  2WSF J;  1VF5 D;  1AFO A;  5AVX B;  3KHU A;  2H7H A;  3AEE C;  1Q86 Q;  2QJY C;  3T97 A;  2R3S A;  3L72 D;  4EOT A;  3JCU H;  3FXE A;  3L73 E;  1FOS F;  1KB9 H;  1BCC G;  3U1A A;  1S4X A;  4RKU J;  1EZV E;  2M0B A;  4GOF A;  2XND H;  3E1R A;  1Q81 Q;  2GM4 A;  3O6Q B;  1RE4 A;  2IYP A;  1NWQ A;  5H2F H;  1QVG O;  2HLO A;  3EFG A;  3MD0 A;  2K9J A;  1KB9 D;  4H0L B;  3USS A;  3JSV C;  3RK2 C;  2JWA A;  3H32 A;  2L91 A;  1NU1 E;  2R5D A;  1BE3 J;  4ZMD A;  1FZE A;  3MTU E;  2R32 A;  1LTA C;  4JF7 A;  3CME P;  1EDI A;  4EI2 A;  1S5L X;  2E74 D;  1LT1 A;  3SWK A;  1OMI A;  1YHQ P;  5BU5 A;  4OVN F;  2E76 C;  2WSE H;  3L74 J;  1U57 A;  1NU1 K;  1NH4 A;  1H0T A;  3NMD A;  4N3Y B;  3B71 A;  2FYU J;  3C1L A;  1FZC C;  2C0X A;  1G1I A;  2Q1K A;  4PV1 C;  3BCC E;  2KB7 P;  1WRG A;  5TIS H;  5BVZ A;  2KLV A;  3TGU J;  1SQX K;  4WY4 C;  3CX5 E;  2E74 B;  3RGU A;  1QEX A;  2IBZ D;  1NTK E;  5B66 H;  5GTH E;  3HTK A;  3VTP C;  2OYI C;  3HUS B;  2YIU B;  3CCE P;  3AE5 C;  3CWB E;  1FZA A;  3VMY A;  1NKZ B;  1SQV G;  2ZVN B;  5KLV E;  1GL2 C;  3GG2 A;  1L0L K;  1NTK K;  1ZOY C;  4PD4 E;  1YBK A;  2J5U A;  3A0B E;  2RMZ A;  4LGD E;  1KTM A;  1SQP J;  3H1K J;  5KAI E;  3G9R A;  1GU5 A;  3H1J D;  2KUB A;  1RH5 B;  2XDJ A;  4RJT A;  1NTM E;  1FJK A;  1SQQ J;  3L73 G;  1ZRT D;  1IO4 A;  1VQ6 P;  5KLV K;  2BCC E;  3IR9 A;  5KLI B;  5KTB A;  1NAF A;  1DD3 A;  2KXP B;  3RL0 g; 
#chains in the Genus database with same CATH homology
 2A45 H;  1L4A C;  2FYZ A;  2ZXE B;  2FFD B;  1LGH B;  5AVT B;  3OA7 A;  1LTT C;  1URQ A;  3GHG A;  3M9Q A;  4OH8 B;  4O9B A;  1LWU B;  1CZQ A;  1NTM K;  5CJ0 A;  2OAR A;  5AW1 B;  1SVF A;  1NOH A;  3H32 B;  1A02 J;  2WT7 A;  1VDF A;  1HGZ A;  4WY4 A;  2HPC A;  1SQP K;  2IFM A;  4N78 D;  1FZC B;  2YO2 A;  2L5G B;  1QL2 A;  4EIJ A;  5APW A;  1M1J C;  1KIL B;  2WT7 B;  1SLQ A;  1KQL A;  3VOP A;  2YKO A;  3O8Z A;  3P8C E;  4C7N A;  4WY4 B;  3B8E B;  4GKG A;  1SQQ K;  3V2P A;  1G2C A;  2WPR A;  1CSB A;  1SQB K;  1ZR2 A;  1URQ C;  3GHG C;  3RK3 B;  4WBA A;  5CCH A;  2WZ7 A;  4ZKU A;  2OYI B;  3MGN A;  1JY2 P;  1G2C B;  2HOD A;  3VYI A;  1GD2 E;  2W27 A;  3VMX A;  1GL2 A;  1YTZ T;  1JNM A;  1FZF A;  1HTL C;  2YKQ A;  1NTZ K;  2FXM A;  1WT6 A;  2N1T A;  1DX7 A;  2KYV A;  4AUW A;  3E1I A;  3HE5 A;  2IPP A;  1GDT A;  2QM8 A;  1IC2 A;  2C0W A;  4M3L A;  1JY2 O;  1PFI A;  1RF1 C;  3M0D A;  1E5W A;  2Q9I A;  3CLQ A;  2WTY A;  1CW5 A;  1FJP A;  5AVW B;  4W7Z A;  3RK2 D;  3HD7 D;  3L37 A;  1JTH B;  3P7K A;  3WMM 0;  1N73 A;  3HE5 B;  1JY2 N;  5CCH C;  5AW7 B;  3A2A A;  5AW3 B;  3TSI A;  1YYC A;  3HRN A;  2YMY A;  2KSJ A;  2N9B A;  3IFM A;  1J1D B;  1L4A A;  1Z56 A;  2O01 H;  1JY3 P;  1LTG C;  5CHX A;  3M0D C;  2BAS A;  3U59 A;  3BVH A;  4XE5 B;  1OWA A;  1N73 C;  5APX A;  1RY3 A;  2Z4E A;  3HD7 B;  2NPS A;  3EQ2 A;  2GUV A;  1URQ D;  2XKM A;  3V4W A;  4N78 E;  2YNY A;  1AQ5 A;  1XTG B;  3B5N C;  1N7L A;  1SQV K;  1X8Y A;  2KOG A;  1VPC A;  1JY3 N;  2M8R A;  2HG5 D;  4IFD K;  1KZU B;  1M1J A;  4WY4 D;  1S9K D;  3R2P A;  1GW3 A;  1GZL A;  1ZN5 A;  1N2D C;  5APQ A;  1HBW A;  2WSF H;  3A7O A;  3RK3 D;  3I5C A;  2XV5 A;  2OYH C;  1N7S A;  3KPE A;  1YTZ I;  1T3U A;  4DZO A;  2C9L Y;  1HH0 A;  3VMZ A;  2CPS A;  5CCG A;  1MFZ A;  2M3B A;  3V4Q A;  2QM7 A;  2NPS C;  4ZKP A;  3KYQ A;  5KJ7 A;  5CCH D;  1KFM A;  1URQ B;  2YO3 A;  3GHG B;  5AW6 B;  1FDM A;  1ZV8 A;  3L36 A;  3CL3 D;  2WPS A;  1GL2 D;  1LTJ A;  1LTS C;  4GIF A;  1X79 B;  1RF1 A;  3KQG A;  2HPC B;  5AW8 B;  2N1T D;  1SFC A;  4AYC A;  4W7Y A;  1SP4 A;  1JUN A;  2POH A;  3C9I A;  1JOC A;  1RE4 C;  1N7S C;  5AW4 B;  4JYB A;  1RF1 B;  4C7N B;  3HE4 A;  5CCG C;  1GW4 A;  1J2J B;  3A5T A;  3VP8 A;  4LC1 A;  5KJ7 C;  3RL0 C;  5AVQ B;  2Q3I A;  1LT9 A;  2R3C A;  2FKW B;  2O1K A;  2W6B A;  3N7N A;  2XU6 A;  2XZR A;  3NFQ A;  4LLH A;  1LTJ C;  2HOD B;  2J59 M;  1XTC C;  1GL2 B;  1L4A D;  1MV8 A;  4JYC A;  3V5B A;  1SFC C;  1NO4 A;  1KIL C;  1EQ7 A;  2N1T B;  4B86 A;  1GTW A;  3TYY A;  4RES B;  4I6M C;  1X9V A;  5APY A;  3B5N A;  1IFI A;  5APT A;  1RF0 A;  1N73 B;  1JCD A;  5APS A;  4HYT B;  1KFN A;  1IFJ A;  1LT9 C;  1J1E B;  4Y99 B;  2A45 I;  3LW5 H;  5CMZ A;  3P8C D;  1LTB C;  2MJZ A;  2W6A A;  1ZLL A;  2P1J A;  1T8Z A;  2OYH A;  1JCC A;  1AFO A;  1L4A B;  5AVX B;  2Z5I A;  3MUD A;  5AVS B;  1HJB A;  1MZ9 A;  2H7H A;  3NXS A;  1GK4 A;  1JY3 O;  1M7L A;  1N7S D;  1NKN A;  3NTN A;  3SWY A;  3T97 A;  2OYH B;  3M9H A;  4KHX A;  4EOT A;  2I1J A;  3CI9 A;  5CJ4 A;  1JO5 A;  3HUS C;  5CCG D;  1RF0 C;  1FOS F;  3U1A A;  2NPS B;  3TNU A;  1LTI C;  3L4F A;  3V2N A;  2CPB A;  3N4X A;  2GM4 A;  2JEE A;  5AW5 B;  2A45 G;  1DEB A;  2WWW A;  3LIE A;  1RE4 A;  1M1J B;  2FFD A;  1SFC D;  1W2E A;  4WB4 A;  2YKP A;  3V2Q A;  1NWQ A;  1FZG A;  1HWT C;  5AW9 B;  1T2K C;  4GT1 A;  1L0N K;  4XA4 A;  3BRT B;  2PP6 A;  3M06 A;  1LWU A;  2HLO A;  2XNX A;  3PP5 A;  4IFF A;  1N7S B;  3EFG A;  2LKM A;  3MD0 A;  3G3Z A;  5AW2 B;  2IFN A;  2HFE D;  3M91 A;  3RK2 C;  3H32 A;  3HD7 C;  2E43 A;  2P2U A;  2PAJ A;  1H89 A;  4W80 A;  2R5D A;  3RL0 B;  1FZE A;  3MTU E;  1FZC A;  2R32 A;  1LTA C;  1GK6 A;  3M9B A;  1KIL A;  4JF7 A;  3M0A A;  2Q7C A;  3MIW A;  5AVZ B;  3OAK A;  1DH3 A;  1RE3 A;  2FFD C;  1LTJ B;  4C7R A;  1HGV A;  3VP9 A;  1N86 A;  1SFC B;  1T3J A;  5BU5 A;  4IFM A;  3BAT A;  2C9N Y;  1LWU C;  1FAV A;  2WSE H;  1HVV A;  3V2R A;  2J58 A;  1NU1 K;  3B5N D;  1FBM A;  1NH4 A;  1H8A A;  3KDP B;  2OYI A;  1A02 F;  3HE4 B;  3P8M C;  4C46 A;  3NMD A;  2O1J A;  4N3Y B;  1LT9 B;  2WSC H;  1FZC C;  2IX7 C;  2C0X A;  1G1I A;  2ZFC A;  5AVR B;  2KB7 P;  1WRG A;  1OXZ A;  5BVZ A;  2KLV A;  2HYN A;  1SQX K;  1RE3 C;  1FU1 A;  4WY4 C;  1IFD A;  3II6 A;  3OJA B;  1JTH A;  3HUS A;  1T2K D;  3L35 A;  3RK3 C;  4AQR D;  2NPS D;  5AVY B;  2WIT A;  1S9K E;  3HTK A;  5AW0 B;  3VTP C;  1MUU A;  4N6J A;  2OYI C;  4DOJ A;  1G1J A;  3B5N B;  5APV A;  1QL1 A;  3HUS B;  2R5B A;  2Q5U A;  1IJD B;  1FZB A;  3VN0 A;  3HTK B;  3TK1 A;  3BRV B;  2KP8 A;  1FZA A;  3VMY A;  1NKZ B;  2H8P D;  1GL2 C;  5APU A;  5BU8 B;  4HH2 A;  2VRS A;  5AVV B;  1L0L K;  5AVU B;  2JJL A;  1IFN A;  1NTK K;  3UIA A;  2N1T C;  2P67 A;  4LGD E;  2GUS A;  3HD7 A;  1FOS E;  1H88 A;  2FYU K;  1CI6 A;  2E42 A;  5KJ7 D;  3P32 A;  3RL0 D;  4I1L A;  2WPQ A;  1JMM A;  1GU5 A;  3H6P A;  2XDJ A;  1IFM A;  1ZR4 A;  2P7J A;  3RK2 B;  3LID A;  2I1K A;  1FJK A;  3SWF A;  1CI6 B;  3BAS A;  1J1D C;  1GU4 A;  3U1C A;  1J1E C;  2H43 A;  4Y99 C;  4I2L C;  3TNU B;  1IO4 A;  3A3Y B;  3IR9 A;  5KLV K;  5KTB A;  1HUC A;  1IK9 A;  1KIL D;  1NHL A;  1NAF A;  2Z5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...