2H8PD

Structure of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB heavy chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 18
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2h8pD00
4WY4A 1URQC 1URQD 5CCHC 3HD7A 5CCHD 2N1TB 2HG5D 3PP5A 1L4AB 1XTGB 1URQB 4JF7A 5CCGC 5CCGD 4WY4C 4WY4D 4W7ZA 3RL0B 3RK2B 2PP6A 1L4AC 4LGDE 1L4AD 3HD7C 3HD7D 5KJ7A 1KILA 4WY4B 3RL0C 1JTHA 3RK2C 3RL0D 3RK2D 2XDJA 3VOPA 3HD7B 1GL2A 3P8CE 1T3JA 1N7SA 2NPSA 3B5NA 4N78E 1N7SB 2WZ7A 4W80A 1SFCA 3KYQA 2KOGA 1GL2C 1GL2D 3HTKB 1N7SC 2NPSC 1KILB 1N7SD 2NPSD 1JTHB 4OH8B 2M8RA 1GL2B 4W7YA 3TSIA 5KJ7C 5KJ7D 3M0DC 1SFCC 1KILC 3RK3C 1SFCD 1KILD 3RK3D 2NPSB 2N1TA 1L4AA 1URQA 3B5NB 2H8PD 2YMYA 5CCHA 1SFCB 3RK3B 1HVVA 1NHLA 3B5NC 3B5ND 2HFED 2N1TC 5CCGA 2N1TD
chains in the Genus database with same CATH superfamily
4HH2A 1NKZB 1URQD 1FS0E 3AE1C 3AEFC 2WSFJ 1SQVE 1PPJE 5E79E 2WSCJ 1R5SA 2OQQA 2A06D 2P2UA 1GMJA 3BRTB 3O8ZA 3VMAA 3H1HE 2A06G 2WTYA 1S72P 1CZQA 1IO4A 2H88C 1HUCA 2NZ2A 3HD7C 1S5LE 2ZVNB 1Z56A 2BCCD 4XFJA 1JCCA 1EZVE 4DOJA 1JTHA 3RL0D 1M56D 2BCCG 2E75D 2QG4A 1DEBA 2V4HA 1T3JA 2NPSA 4PD4H 1BCCE 3WUVA 3CMEP 3I55P 1VQ4P 2R32A 4DT0A 3R4YA 2IFMA 2B87B 2W27A 1NKNA 5CJ0A 3N7NA 3M9BA 5KKZC 2K88A 1N7SD 1M90Q 4WBAA 3D70A 2K37A 1W2EA 3CCVP 1W5CE 3L75E 4EIJA 2M3EA 2YKQA 1YTZI 3CCJP 2QIWA 1FC2C 1VQPP 1BGYD 1JO5A 4ZKUA 2JP3A 1SQVJ 3CCUP 1KILE 1BGYG 5APUA 1EC5A 5AVRB 2OYHB 3V4QA 2WWWA 2KZJA 1IFNA 3AE7C 3AE3C 4R4LA 5AW0B 2WPQA 1MZ9A 1S4XA 5B66E 2HPCB 1NTME 1NYHA 2E74C 1SQXK 3S9OA 4D6TE 2L91A 3KXDA 1H0TB 1JY3N 4YXWH 3L71J 4LGDE 1Y9BA 3HD7D 1BCCJ 1AQ5A 4C7NA 2OTLP 3R2PA 2CPSA 2YIUB 5KLVK 3VP8A 1YIJP 2A45I 2QJYB 1Y47A 2FYZA 5DJUB 2M5AB 2JWAA 1KORA 1VQOP 3A0BE 4W80A 3CCSP 3L75J 2SPZA 4M3LA 3L70D 4L75A 4XE5B 1H88A 2R3CA 3M0AA 2M8RA 4GOFA 3L70G 1AFOA 1MFZA 4H0LB 4PD4D 1PIXA 3HE4A 3Q2YA 3V2NA 2BEZF 4DJGA 1FZCA 4GT1A 3Q1MA 1P84E 2N9BA 2OYIC 1HBWA 1OZHA 1KQGB 2RN0A 3GLMA 3S4RA 1ZXGA 4D6TJ 3SSUA 4RESB 1YQ4C 5KAIE 4WY4A 2QE7H 2PFXA 3V2PA 4I6MC 1LTJA 3RBZA 5AW1B 2Q6QA 5AW4B 1JY2N 4IL6X 2O1JA 2E74D 2D2CB 1KFMA 2BEQD 1SQPE 3D71A 2WVRA 1LTGC 3RK2B 2YIUC 2H7HA 3CLQA 1FZFA 2QJYC 2NRGA 3CC2P 3KPEA 1SP4A 2XV5A 1VPCA 1HTLC 3H1IE 2Z4EA 1NTKD 1RF1B 1NTZK 5BU5A 2HR3A 2WZ7A 2N9YB 2LR2A 3CCEP 3M91A 2C9NY 4H0LC 1OFCX 1EZVI 3LW5J 4IOIH 1L0LJ 5AW7B 3CX5I 4PJ0H 2AEFA 2E76B 3W68A 5AW2B 2RH0A 5KJ7C 1PP9E 2R3SA 3CI9A 1NO4A 3S1KA 4UB8H 3II6A 3AE4C 4Y28J 2Q9IA 1PGQA 1HVVA 3AE5C 3B5NC 1S2EA 1SQPJ 1PGOA 4EDFA 1LTSC 4N3YB 1MFTA 1RQVA 3CWBJ 3PRJA 1SQBJ 1IFMA 2FXMA 5AW8B 3H1JE 1FJPA 2ZT9B 2OTKE 2Q1KA 3G3ZA 3CCMP 3VMZA 1Q82Q 1SVFA 5APYA 1T6AA 5KLVE 1G2CA 5AVWB 1ZMEC 2LXCB 1IC2A 4EYYQ 1N7LA 2FYUD 3B8EB 2E76C 3HUSC 1RE3C 3CXHH 3C8VA 4H0LD 3BRVB 1LP1A 3HTKB 2YXQB 1KILB 2FYUG 1VQ7P 1FDMA 2E5YA 4OGQB 3KZIH 5AW9B 1K05A 4OVNF 2XU6A 2Y9ZA 5KJ7D 5TJHA 5TISE 3U1CA 5L8RJ 4KJMA 1DX7A 3A7OA 2A45G 3V6IA 1GD2E 1QGKB 3G6EP 1J2JB 2AXCA 3B5ND 2KXPB 4HJGH 1NJIQ 5CCGA 3G4SP 1AV1A 1X9VA 5BU8B 4IL6H 3H1JJ 1AA0A 3VTPC 1U7JA 1USEA 2FFDB 1VQ8P 3L73E 1JEKA 1LT9B 1VL2A 1N73B 1Q90D 3AE2C 1M57D 2P7JA 1N2DC 1A02F 1GW4A 1L4AC 1FOSE 3CCLP 1FE6A 2YMKA 1T8ZA 3C9IA 2KSEA 5KAFH 1U57A 1SQQE 4PV1B 4H13B 4Z1MH 2E76D 3ITKA 3TNUB 2KOGA 1NTZE 2HODA 4U3FE 1M1KQ 1H8AA 5GTHE 3UIAA 1RE4C 4Y99B 1YHQP 1RF0C 1KTMA 2ZJSE 1VDFA 5KLIC 3M0DC 2ZXXA 4QMAA 2DW3A 4GODA 1IK9A 4PJ0E 4RKUJ 2KS1B 3NTNA 2PRRA 3L73J 4LLHA 2YMYA 1EZVD 3Q5PA 2KZIA 2JEEA 1OW6A 3CX5D 4EOTA 1LT9C 1S9KE 4H44B 4UB8E 2IX7C 1EZVG 3L71D 4OWFA 1KB9E 2K1AA 3F89A 1BCCD 5CCHC 4JPZB 2W6BA 3L71G 2P58A 5AVQB 1GW3A 3PH0A 1IFDA 1NU1E 1DEEG 5AW6B 3U1AA 1RY3A 1AJYA 4HB1A 5AW5B 1L4AD 3IAOA 3JCUE 3AEEC 1SQQJ 3P8CD 1DIPA 1WMKA 2ZFCA 5M1BA 4PV1C 3L75D 1G1IA 3L72E 1Y8AA 2V7QH 3EWKA 2C0XA 3FWNA 4C7RA 1GL2A 2WSEH 1OIPA 3L75G 2OYIA 1DH3A 2PGDA 4N78E 2GUVA 3AE9C 3HE5A 4Y99C 1KZUB 2FYNC 1SS1A 2WT7A 2YXRB 2P1JA 3I56P 1FDOA 1OVUA 1H89A 4LC1A 3V2QA 3GHGB 2H8PD 3VP9A 4H44C 3TGUE 3F5HA 3KZIE 3OW2O 2K9JA 3WU2H 3RK3B 3BCCJ 5APTA 1NU1J 1FDIA 1LJ2A 3TF5A 2QM8A 5GTIH 1J1DB 1ZRTE 3BATA 2J58A 5CCHD 4WWIA 3A2AA 2N1TB 3Q5SA 3PP5A 4JF7A 4IL6E 3L72J 1DD3A 4W7ZA 1L2PA 1QL2A 1E5WA 1GDTA 2A06E 1RQUA 1LWUA 3VMYA 5KJ7A 3H1HJ 2FXOA 1KQFB 4PV1D 4KT0J 1Q81Q 1YI2P 1JMMA 1L0LD 3A3YB 1VQ9P 3WMM0 3B5NA 1L0LG 1NTKK 1ZR2A 2RKLA 5KAFE 4YTPC 2B88A 1JTHB 3GHGC 1JNMA 1KQLA 4BWNA 1SQPD 3P32A 3RK3C 2NPSB 5APQA 2AEMA 1NAFA 2IYOA 3L4FA 4H44D 1WRGA 4JQ0D 3CWBD 4CPGA 1QL1A 1BE3E 1SQBD 2N1TC 1BGYE 1GU4A 2JR8A 3CWBG 3L74E 1GZLA 1SQBG 3MTUE 2OYHC 3P8MC 1MKMA 1L0NK 2K3RA 1IFIA 2Z5HA 3HUSA 2Z5IA 1LTBC 2UWJE 1NTMJ 4RO0A 2ZAEB 3TYYA 3KHUA 2Y0CA 2KYVA 3B4SA 2Y0DA 1X8YA 1KB9I 4AQRD 4WVZA 3MHVA 1R8EA 3VOPA 1KYOE 2WQYC 1LNQA 2O01J 2IBZI 3USSA 4L73A 1CI6A 4ZNCA 3B71A 2GA1A 3H32A 3GMAA 1SFCA 2FYUK 2NPSC 1LTAC 4C7NB 1ZOYC 1K04A 3H1LE 2A45H 4UB6H 3LIDA 3L70E 3E1RA 1BE3J 2R5DA 1AQTA 3RK3D 4YPCA 2OTJP 1ZLLA 2B9BA 1L4AA 1URQA 1NTKG 1JB0J 3L37A 1PGJA 3L74J 2LXBA 3KDPB 2KK7A 4GKGA 4PD4E 4NPEA 3O6QA 1M1JA 2WPVB 2N1TD 5B5EH 3WU2E 3FXDA 1HH0A 3HE4B 2XKMA 3ABVC 2C0WA 1FZCB 1OW8A 5GTIE 1UIIA 2KNCA 1BDDA 2D2CC 1RE4A 1Q86Q 1VQMP 1L0ND 4WY4B 3RK2C 1RHZB 2H89C 1LTJB 2JDIH 3OJAB 1TU3F 1L0NG 2WSEJ 3A0HH 3CCQP 1N7SA 3CPWO 1KC8Q 1FAVA 3H1IJ 5AVUB 3U59A 1SQXE 1IFPA 2I8DA 1KFNA 3H1LJ 2HLOA 1Q7YQ 1RF1C 2NPSD 4I7ZB 5E79H 1IJDB 3L73D 4OH8B 1SQVK 4DCKA 1GTWA 1FZBA 5AVXB 1YJWP 2ZYGA 3L36A 2L5GB 3WUUA 1PP9J 1NWQA 2KSJA 3W67A 2QVAA 2K9YA 2XZRA 1BSNA 3CX5H 1X22A 2HFED 1OXZA 3AECC 4IFDK 1X79B 1HF9A 3HD7A 3H6PA 3IF4A 3ZDMA 4I1LA 4WY4C 1UIXA 3RL0B 1GK4A 1LTTC 3GG2A 2E75B 2D2CD 1JY3O 1VQ6P 2WMMA 3HRNA 2R5BA 1OVVA 1SQXJ 3RK2D 5APSA 1J1EB 2ZT9C 3A5TA 1P84I 4I2LC 3WUTA 1N7SB 1CSBA 1LTIC 4N6JA 3TDKA 5KLVJ 1YQ3C 1S9KD 5CBNA 1KB9D 3FXEA 2Q5UA 5B66H 3EFGA 1KYOI 4EI2A 2FYUE 1FZGA 4ZKPA 3BCCD 1USDA 4W7YA 1NU1D 2IBZD 4TLFA 1KILC 2Y9YA 4OGQC 3V5BA 1HJBA 1G2CB 3BCCG 1NU1G 2IBZG 1Q2NA 3GF3A 4UB6E 1LGHB 2WPRA 1SQVD 1PPJD 2W90A 3CMAP 1LP1B 3Q3DA 1SLQA 3L72D 2AEJA 2O3JA 3H1KE 1SQVG 1PPJG 3H1HD 1HJ0A 3A0BH 5AVZB 2G8YA 4PD4I 3H1HG 2FFDC 4WY4D 3PJSK 3G71P 2B87A 1J1EC 3NFQA 1JY2O 1QX8A 2OARA 2O1KA 1FU1A 1N73C 3CC7P 2AXTH 2J5UA 2IDBA 1S3JA 2FBWC 3GW6A 2ZT9D 4YXDC 1BCCG 1L0LK 1CW5A 1M7LA 1PGPA 2KI7B 2OGUA 3NXSA 3SWKA 2YKPA 5AVSB 3A0HE 2OYHA 2QRXA 3FGAD 2QJKB 4H13C 1ZRTD 1VQLP 1NTZJ 1VQ5P 2ZYDA 4U3FJ 1N8RQ 2OYOA 1E79H 1OX3A 2KLUA 1KILD 2HPCA 1KV4A 4OGQD 1SQPK 4JBZA 3H1KJ 1VQNP 1H0TA 1OMIA 3P7KA 1FJKA 1PL5A 3QWOC 3VN0A 1IZNB 1NHLA 1K9MQ 1JMBA 2HODB 1OWAA 1NTMD 1DD4A 1EXIA 2H43A 1SQBK 4XA4A 4D6TD 3CXHE 2E74B 1EDJA 1YBKA 3MIWA 1NTMG 3D6YA 4D6TG 4KHXA 3CX5E 4DZOA 5APXA 5H2FH 5CCGC 3AEAC 3L71E 2M5AA 1EDIA 2E42A 1HWTC 2ZYAA 1HGVA 1MV8A 2VRSA 1ZP0C 1K73Q 4BRYA 1T2KC 1YITP 4O9BA 2QM7A 1ZW0A 5APVA 3P8CE 1NVOA 2QJKC 4JYCA 3RL0g 4HYTB 2W6AA 1BE3D 3Q5RA 1A02J 1KMIZ 1N86A 4GOEA 4IFMA 2CPBA 1BE3G 3L74D 4GDOA 4H13D 2GM4A 3NMDA 1QVFO 2BCCE 1P84D 5EFWB 3L74G 1GL2B 2I1JA 2Q7CA 2R44A 3MUDC 3VMXA 2OYIB 2YKOA 1HGZA 5CJ4A 2ZXEB 3QH9A 3E7KA 4R4MA 2KUBA 3C1LA 4U7JA 3HE5B 3TGUJ 5K5GB 2JO1A 1NOHA 2WT7B 1KYOD 1S1CX 4HKZH 5AVTB 2YNYA 1QLED 3JSVC 5CHXA 1IK7A 1D7MA 3H25A 2M0BA 3SFDC 2WSSH 4NPFX 1SQPG 3SWFA 2HG5D 1YJ9P 1RF1A 5BVZA 5CCGD 2YO2A 1M8OB 1J1DC 2K9JB 1S5LX 2PP6A 2E5TA 2GUSA 4ZMDA 3H1ID 1EXJA 2IPPA 1W2BO 3H1LD 2WPSA 1X0TA 2W83C 3FX0A 5TISH 2XDJA 3H1IG 1T2KD 3AE8C 1RE3A 2RMZA 3H1LG 4BRYB 3MZWB 4K3AA 2AXTE 3EQ2A 2BCCJ 1YTZT 1L0LE 3AEBC 2Y0EA 5AVYB 2KP8A 1GL2C 1LWUB 1KN7A 1PP9D 1EDLA 1RH5B 4MN4C 3RGUA 2M3BA 1PP9G 3M9QA 3B5NB 1WT6A 1T3UA 3IN6A 1G1JA 2PAJA 1VF5B 2B89A 4L74A 1BDCA 1GU5A 1AVOA 3OAKA 1BGYJ 1MUUA 3CWBE 2WSFH 3H1JD 2QEXP 1ZR4A 1SQBE 1SQXD 2WSCH 1SQQK 4L76A 5AW3B 3SFEC 3H1JG 1AVYA 3OA7A 4AUWA 1SQXG 3M9HA 4AYCA 1JCDA 5GTHH 2CK3H 3CXHI 3HTKA 5H2FE 1KQSO 1KILA 5KLVD 5KTBA 4TT3H 1YYCA 2E43A 5KLVG 3HUSB 2JJLA 1LWUC 2YO3A 2ZVOB 4A7PA 3JC22 1OW7A 1RF0A 3M0DA 2Q3EA 2I1KA 3KYQA 1GL2D 1KB9H 2KB7P 2V7QJ 2XNXA 3AEDC 2KIKA 2FFDA 1FOSF 2P10A 3BASA 2MJZA 1U7MA 1VF5C 1LT9A 1NU1K 3CD6P 2ITAA 1CI6B 3L70J 1N73A 3JCUH 2QJPB 3H32B 4IFFA 1NTKE 5AVVB 5CBOA 3AE6C 3G9RA 1IFJA 5CCHA 1SFCB 3RK3E 1NH4A 4C46A 1KD1Q 3KQGA 3FWLA 1PFIA 3L73G 3K5BA 2KLVA 1FZAA 1JY3P 1S5LH 4B86A 2POHA 4K35A 1L4AB 1XTGB 1URQB 1JM0A 1NGMB 2IZ0A 1FZCC 3CC4P 3TNUA 2IYPA 3O6QB 3LIEA 1M1JB 3EFFK 1PV3A 4NPDA 1JUNA 2JWDA 1SQQD 2W6JH 4ASVA 1QVGO 1SQQG 1L0NE 1NTZD 1LTJC 4U3FD 3IFMA 2IZ1A 2FXPA 2KS1A 1NTZG 2KNCB 4U3FG 3H1KD 1ZN5A 2XNDH 3V2RA 5KLIB 1GK6A 1QEXA 1NTKJ 3H1KG 5APWA 2QJPC 1LT1A 3TSIA 1SFCC 2FY8A 2IFNA 4I7ZC 4JYBA 1VF5D 3T97A 1XTCC 3GF7A 2J59M 3SWYA 2P67A 3PTZA 5C39A 3CL3D 3MP7B 1VQKP 2BASA 3V4WA 1OVRA 1URQC 1NTMK 2MKVA 1JY2P 3I5CA 1FZEA 1EDKA 2LKMA 3RBXA 1M1JC 3MGNA 3PHLA 3PLNA 1YJNP 2O01H 4ASWA 2G3AA 1EQ7A 1L0NJ 2JKVA 1NAYA 5CMZA 3BVHA 1PZQA 3MUDA 2W8ZA 3L72G 5DJTB 3RL0C 4BXLA 3E1IA 4N78D 2E75C 2QA4P 3HD7B 4GIFA 1FBMA 3TK1A 5B5EE 3L35A 3GHGA 2FYNB 4RJTA 3AEGC 2Q3IA 3VYIA 2O01N 3D6ZA 3CXHD 4WB4A 3LW5H 1N7SC 1R5LA 1P84H 3TGUD 2FKWB 1ZV8A 1JOCA 1SFCD 5KKZB 2FYUJ 2N1TA 3TGUG 3IR9A 3CCRP 2C9LY 3M06A 5KAIH 2QSIA 2HYNA 3T97B 3BCCE 2IBZE 1K8AQ 2WITA 3MD0A 1KYOH 3N4XA 1BSHA
chains in the Genus database with same CATH topology
2YNYA 5CHXA 1X9VA 4HH2A 5BU8B 1NKZB 1URQD 3VTPC 1HH0A 2FFDB 3HE4B 2XKMA 2C0WA 3SWFA 1LT9B 1FZCB 2HG5D 2P2UA 1RF1A 5BVZA 1N73B 5CCGD 2YO2A 1J1DC 3BRTB 2P7JA 3O8ZA 1N2DC 2PP6A 1A02F 2WTYA 2GUSA 1GW4A 1CZQA 1IO4A 1L4AC 1FOSE 1HUCA 3HD7C 1RE4A 2IPPA 1Z56A 2WPSA 1JCCA 4WY4B 4DOJA 1JTHA 3RK2C 3RL0D 2XDJA 1T2KD 1LTJB 1T8ZA 3C9IA 3OJAB 1RE3A 1DEBA 1T3JA 1N7SA 2NPSA 1FAVA 2R32A 5AVUB 3U59A 3EQ2A 2IFMA 1KFNA 1YTZT 2W27A 2HLOA 1NKNA 5CJ0A 5AVYB 3N7NA 3TNUB 2KOGA 2KP8A 1RF1C 1GL2C 1LWUB 3M9BA 2HODA 1N7SD 2NPSD 4WBAA 1IJDB 4OH8B 1H8AA 3UIAA 1SQVK 1W2EA 2M3BA 1FZBA 5AVXB 1GTWA 1RE4C 4Y99B 1RF0C 1VDFA 3M0DC 4EIJA 3M9QA 2YKQA 1YTZI 3L36A 2L5GB 1IK9A 3B5NB 1WT6A 1JO5A 1T3UA 3NTNA 4ZKUA 1G1JA 1NWQA 2KSJA 2PAJA 4LLHA 2YMYA 5APUA 2XZRA 2JEEA 5AVRB 2OYHB 3V4QA 2HFED 1OXZA 4EOTA 1LT9C 1S9KE 4IFDK 2IX7C 2WWWA 1X79B 1GU5A 1IFNA 3OAKA 1MUUA 5AW0B 2WPQA 1MZ9A 2WSFH 5CCHC 3HD7A 1ZR4A 2HPCB 2WSCH 1SQQK 2W6BA 3H6PA 1SQXK 5AW3B 5AVQB 1GW3A 4I1LA 1IFDA 4WY4C 5AW6B 3OA7A 4AUWA 1JY3N 3RL0B 1GK4A 1RY3A 3U1AA 1LTTC 3M9HA 4AYCA 5AW5B 1JCDA 4LGDE 1L4AD 3HD7D 1JY3O 3HTKA 3P8CD 3HRNA 2R5BA 1KILA 1AQ5A 4C7NA 2ZFCA 3RK2D 3R2PA 5APSA 1J1EB 2CPSA 5KLVK 1G1IA 5KTBA 2C0XA 3VP8A 3A5TA 1YYCA 4C7RA 2E43A 1GL2A 2WSEH 3HUSB 2A45I 4I2LC 2OYIA 2JJLA 1LWUC 1DH3A 2YO3A 2FYZA 4N78E 1N7SB 1CSBA 2GUVA 1LTIC 4N6JA 4W80A 1RF0A 1S9KD 3M0DA 3HE5A 2I1KA 3KYQA 4Y99C 1KZUB 4M3LA 1GL2D 2KB7P 4XE5B 1H88A 2R3CA 2WT7A 2XNXA 2P1JA 2Q5UA 3M0AA 3EFGA 2M8RA 1FZGA 1AFOA 4ZKPA 1MFZA 1H89A 2FFDA 4W7YA 3HE4A 1KILC 1FOSF 3BASA 2MJZA 4LC1A 3V2NA 3V5BA 1LT9A 1FZCA 1NU1K 1HJBA 4GT1A 3V2QA 3GHGB 1CI6B 1G2CB 1N73A 2H8PD 3VP9A 3H32B 4IFFA 5AVVB 2N9BA 1LGHB 2OYIC 1IFJA 5CCHA 2WPRA 1SFCB 1HBWA 3RK3B 1NH4A 4C46A 1SLQA 4RESB 5APTA 4WY4A 3V2PA 3KQGA 1PFIA 4I6MC 1LTJA 2QM8A 1J1DB 3BATA 5AW1B 2J58A 2KLVA 1FZAA 5CCHD 1JY3P 3A2AA 2N1TB 5AVZB 4B86A 5AW4B 1JY2N 2POHA 3PP5A 2O1JA 1L4AB 1XTGB 1URQB 4JF7A 1KFMA 2FFDC 4WY4D 4W7ZA 1J1EC 3NFQA 1LTGC 1JY2O 3RK2B 2H7HA 3CLQA 1FZCC 2OARA 1QL2A 2O1KA 1E5WA 3TNUA 1GDTA 1FU1A 1FZFA 1N73C 3LIEA 1LWUA 1M1JB 3VMYA 5KJ7A 1JUNA 3KPEA 1SP4A 2XV5A 1JMMA 1HTLC 1VPCA 2Z4EA 3A3YB 1L0LK 1RF1B 1LTJC 1NTZK 3IFMA 3WMM0 1CW5A 1M7LA 3B5NA 1NTKK 5BU5A 1ZR2A 2WZ7A 3NXSA 2YKPA 5AVSB 3M91A 2C9NY 2OYHA 1ZN5A 3V2RA 5AW7B 1JTHB 1GK6A 3GHGC 1JNMA 5APWA 5AW2B 1KQLA 5KJ7C 3TSIA 3P32A 1SFCC 3RK3C 2IFNA 1KILD 2HPCA 2NPSB 4JYBA 1SQPK 3CI9A 1NO4A 5APQA 3T97A 1NAFA 3II6A 1XTCC 3L4FA 2J59M 1WRGA 3P7KA 3SWYA 1FJKA 2P67A 2Q9IA 3CL3D 3VN0A 1HVVA 1NHLA 1QL1A 3B5NC 2HODB 1OWAA 2N1TC 2BASA 1GU4A 3V4WA 2H43A 1SQBK 4XA4A 1URQC 1NTMK 1JY2P 3I5CA 1GZLA 3MTUE 2OYHC 1FZEA 3MIWA 3P8MC 1LTSC 4N3YB 1L0NK 1IFIA 2Z5HA 4KHXA 3HUSA 4DZOA 2LKMA 5APXA 1M1JC 2Z5IA 3MGNA 5CCGC 1LTBC 1IFMA 2O01H 2FXMA 2E42A 5AW8B 3TYYA 1HWTC 1FJPA 1EQ7A 1HGVA 1MV8A 5CMZA 2KYVA 3G3ZA 3BVHA 2VRSA 1X8YA 3MUDA 4AQRD 3RL0C 3VMZA 1T2KC 1SVFA 3E1IA 4N78D 3VOPA 4O9BA 2QM7A 5APYA 3HD7B 4GIFA 1FBMA 3TK1A 5APVA 3P8CE 3L35A 4JYCA 3GHGA 1CI6A 1G2CA 5AVWB 4HYTB 2Q3IA 2W6AA 1IC2A 1A02J 3H32A 1N7LA 1N86A 3B8EB 3HUSC 3VYIA 1RE3C 1SFCA 2FYUK 4IFMA 2CPBA 4WB4A 3BRVB 3HTKB 3LW5H 1N7SC 1LTAC 2NPSC 1KILB 4C7NB 2GM4A 1FDMA 3NMDA 5AW9B 2A45H 2XU6A 3LIDA 1GL2B 2I1JA 2FKWB 1ZV8A 1JOCA 5KJ7D 2Q7CA 2R5DA 1SFCD 3VMXA 3RK3D 2OYIB 3U1CA 2N1TA 2YKOA 1HGZA 1ZLLA 3IR9A 1L4AA 5CJ4A 1DX7A 2C9LY 1URQA 3M06A 3A7OA 2ZXEB 2A45G 3L37A 2HYNA 3KDPB 4GKGA 1GD2E 3HE5B 1J2JB 2WITA 3MD0A 1NOHA 3B5ND 1M1JA 2WT7B 3N4XA 5CCGA 2N1TD 5AVTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WY4 A;  1URQ C;  1URQ D;  5CCH C;  3HD7 A;  5CCH D;  2N1T B;  2HG5 D;  3PP5 A;  1L4A B;  1XTG B;  1URQ B;  4JF7 A;  5CCG C;  5CCG D;  4WY4 C;  4WY4 D;  4W7Z A;  3RL0 B;  3RK2 B;  2PP6 A;  1L4A C;  4LGD E;  1L4A D;  3HD7 C;  3HD7 D;  5KJ7 A;  1KIL A;  4WY4 B;  3RL0 C;  1JTH A;  3RK2 C;  3RL0 D;  3RK2 D;  2XDJ A;  3VOP A;  3HD7 B;  1GL2 A;  3P8C E;  1T3J A;  1N7S A;  2NPS A;  3B5N A;  4N78 E;  1N7S B;  2WZ7 A;  4W80 A;  1SFC A;  3KYQ A;  2KOG A;  1GL2 C;  1GL2 D;  3HTK B;  1N7S C;  2NPS C;  1KIL B;  1N7S D;  2NPS D;  1JTH B;  4OH8 B;  2M8R A;  1GL2 B;  4W7Y A;  3TSI A;  5KJ7 C;  5KJ7 D;  3M0D C;  1SFC C;  1KIL C;  3RK3 C;  1SFC D;  1KIL D;  3RK3 D;  2NPS B;  2N1T A;  1L4A A;  1URQ A;  3B5N B;  2H8P D;  2YMY A;  5CCH A;  1SFC B;  3RK3 B;  1HVV A;  1NHL A;  3B5N C;  3B5N D;  2HFE D;  2N1T C;  5CCG A;  2N1T D; 
#chains in the Genus database with same CATH topology
 4HH2 A;  1NKZ B;  1URQ D;  1FS0 E;  3AE1 C;  3AEF C;  2WSF J;  1SQV E;  1PPJ E;  5E79 E;  2WSC J;  1R5S A;  2OQQ A;  2A06 D;  2P2U A;  1GMJ A;  3BRT B;  3O8Z A;  3VMA A;  3H1H E;  2A06 G;  2WTY A;  1S72 P;  1CZQ A;  1IO4 A;  2H88 C;  1HUC A;  2NZ2 A;  3HD7 C;  1S5L E;  2ZVN B;  1Z56 A;  2BCC D;  4XFJ A;  1JCC A;  1EZV E;  4DOJ A;  1JTH A;  3RL0 D;  1M56 D;  2BCC G;  2E75 D;  2QG4 A;  1DEB A;  2V4H A;  1T3J A;  2NPS A;  4PD4 H;  1BCC E;  3WUV A;  3CME P;  3I55 P;  1VQ4 P;  2R32 A;  4DT0 A;  3R4Y A;  2IFM A;  2B87 B;  2W27 A;  1NKN A;  5CJ0 A;  3N7N A;  3M9B A;  5KKZ C;  2K88 A;  1N7S D;  1M90 Q;  4WBA A;  3D70 A;  2K37 A;  1W2E A;  3CCV P;  1W5C E;  3L75 E;  4EIJ A;  2M3E A;  2YKQ A;  1YTZ I;  3CCJ P;  2QIW A;  1FC2 C;  1VQP P;  1BGY D;  1JO5 A;  4ZKU A;  2JP3 A;  1SQV J;  3CCU P;  1KIL E;  1BGY G;  5APU A;  1EC5 A;  5AVR B;  2OYH B;  3V4Q A;  2WWW A;  2KZJ A;  1IFN A;  3AE7 C;  3AE3 C;  4R4L A;  5AW0 B;  2WPQ A;  1MZ9 A;  1S4X A;  5B66 E;  2HPC B;  1NTM E;  1NYH A;  2E74 C;  1SQX K;  3S9O A;  4D6T E;  2L91 A;  3KXD A;  1H0T B;  1JY3 N;  4YXW H;  3L71 J;  4LGD E;  1Y9B A;  3HD7 D;  1BCC J;  1AQ5 A;  4C7N A;  2OTL P;  3R2P A;  2CPS A;  2YIU B;  5KLV K;  3VP8 A;  1YIJ P;  2A45 I;  2QJY B;  1Y47 A;  2FYZ A;  5DJU B;  2M5A B;  2JWA A;  1KOR A;  1VQO P;  3A0B E;  4W80 A;  3CCS P;  3L75 J;  2SPZ A;  4M3L A;  3L70 D;  4L75 A;  4XE5 B;  1H88 A;  2R3C A;  3M0A A;  2M8R A;  4GOF A;  3L70 G;  1AFO A;  1MFZ A;  4H0L B;  4PD4 D;  1PIX A;  3HE4 A;  3Q2Y A;  3V2N A;  2BEZ F;  4DJG A;  1FZC A;  4GT1 A;  3Q1M A;  1P84 E;  2N9B A;  2OYI C;  1HBW A;  1OZH A;  1KQG B;  2RN0 A;  3GLM A;  3S4R A;  1ZXG A;  4D6T J;  3SSU A;  4RES B;  1YQ4 C;  5KAI E;  4WY4 A;  2QE7 H;  2PFX A;  3V2P A;  4I6M C;  1LTJ A;  3RBZ A;  5AW1 B;  2Q6Q A;  5AW4 B;  1JY2 N;  4IL6 X;  2O1J A;  2E74 D;  2D2C B;  1KFM A;  2BEQ D;  1SQP E;  3D71 A;  2WVR A;  1LTG C;  3RK2 B;  2YIU C;  2H7H A;  3CLQ A;  1FZF A;  2QJY C;  2NRG A;  3CC2 P;  3KPE A;  1SP4 A;  2XV5 A;  1VPC A;  1HTL C;  3H1I E;  2Z4E A;  1NTK D;  1RF1 B;  1NTZ K;  5BU5 A;  2HR3 A;  2WZ7 A;  2N9Y B;  2LR2 A;  3CCE P;  3M91 A;  2C9N Y;  4H0L C;  1OFC X;  1EZV I;  3LW5 J;  4IOI H;  1L0L J;  5AW7 B;  3CX5 I;  4PJ0 H;  2AEF A;  2E76 B;  3W68 A;  5AW2 B;  2RH0 A;  5KJ7 C;  1PP9 E;  2R3S A;  3CI9 A;  1NO4 A;  3S1K A;  4UB8 H;  3II6 A;  3AE4 C;  4Y28 J;  2Q9I A;  1PGQ A;  1HVV A;  3AE5 C;  3B5N C;  1S2E A;  1SQP J;  1PGO A;  4EDF A;  1LTS C;  4N3Y B;  1MFT A;  1RQV A;  3CWB J;  3PRJ A;  1SQB J;  1IFM A;  2FXM A;  5AW8 B;  3H1J E;  1FJP A;  2ZT9 B;  2OTK E;  2Q1K A;  3G3Z A;  3CCM P;  3VMZ A;  1Q82 Q;  1SVF A;  5APY A;  1T6A A;  5KLV E;  1G2C A;  5AVW B;  1ZME C;  2LXC B;  1IC2 A;  4EYY Q;  1N7L A;  2FYU D;  3B8E B;  2E76 C;  3HUS C;  1RE3 C;  3CXH H;  3C8V A;  4H0L D;  3BRV B;  1LP1 A;  3HTK B;  2YXQ B;  1KIL B;  2FYU G;  1VQ7 P;  1FDM A;  2E5Y A;  4OGQ B;  3KZI H;  5AW9 B;  1K05 A;  4OVN F;  2XU6 A;  2Y9Z A;  5KJ7 D;  5TJH A;  5TIS E;  3U1C A;  5L8R J;  4KJM A;  1DX7 A;  3A7O A;  2A45 G;  3V6I A;  1GD2 E;  1QGK B;  3G6E P;  1J2J B;  2AXC A;  3B5N D;  2KXP B;  4HJG H;  1NJI Q;  5CCG A;  3G4S P;  1AV1 A;  1X9V A;  5BU8 B;  4IL6 H;  3H1J J;  1AA0 A;  3VTP C;  1U7J A;  1USE A;  2FFD B;  1VQ8 P;  3L73 E;  1JEK A;  1LT9 B;  1VL2 A;  1N73 B;  1Q90 D;  3AE2 C;  1M57 D;  2P7J A;  1N2D C;  1A02 F;  1GW4 A;  1L4A C;  1FOS E;  3CCL P;  1FE6 A;  2YMK A;  1T8Z A;  3C9I A;  2KSE A;  5KAF H;  1U57 A;  1SQQ E;  4PV1 B;  4H13 B;  4Z1M H;  2E76 D;  3ITK A;  3TNU B;  2KOG A;  1NTZ E;  2HOD A;  4U3F E;  1M1K Q;  1H8A A;  5GTH E;  3UIA A;  1RE4 C;  4Y99 B;  1YHQ P;  1RF0 C;  1KTM A;  2ZJS E;  1VDF A;  5KLI C;  3M0D C;  2ZXX A;  4QMA A;  2DW3 A;  4GOD A;  1IK9 A;  4PJ0 E;  4RKU J;  2KS1 B;  3NTN A;  2PRR A;  3L73 J;  4LLH A;  2YMY A;  1EZV D;  3Q5P A;  2KZI A;  2JEE A;  1OW6 A;  3CX5 D;  4EOT A;  1LT9 C;  1S9K E;  4H44 B;  4UB8 E;  2IX7 C;  1EZV G;  3L71 D;  4OWF A;  1KB9 E;  2K1A A;  3F89 A;  1BCC D;  5CCH C;  4JPZ B;  2W6B A;  3L71 G;  2P58 A;  5AVQ B;  1GW3 A;  3PH0 A;  1IFD A;  1NU1 E;  1DEE G;  5AW6 B;  3U1A A;  1RY3 A;  1AJY A;  4HB1 A;  5AW5 B;  1L4A D;  3IAO A;  3JCU E;  3AEE C;  1SQQ J;  3P8C D;  1DIP A;  1WMK A;  2ZFC A;  5M1B A;  4PV1 C;  3L75 D;  1G1I A;  3L72 E;  1Y8A A;  2V7Q H;  3EWK A;  2C0X A;  3FWN A;  4C7R A;  1GL2 A;  2WSE H;  1OIP A;  3L75 G;  2OYI A;  1DH3 A;  2PGD A;  4N78 E;  2GUV A;  3AE9 C;  3HE5 A;  4Y99 C;  1KZU B;  2FYN C;  1SS1 A;  2WT7 A;  2YXR B;  2P1J A;  3I56 P;  1FDO A;  1OVU A;  1H89 A;  4LC1 A;  3V2Q A;  3GHG B;  2H8P D;  3VP9 A;  4H44 C;  3TGU E;  3F5H A;  3KZI E;  3OW2 O;  2K9J A;  3WU2 H;  3RK3 B;  3BCC J;  5APT A;  1NU1 J;  1FDI A;  1LJ2 A;  3TF5 A;  2QM8 A;  5GTI H;  1J1D B;  1ZRT E;  3BAT A;  2J58 A;  5CCH D;  4WWI A;  3A2A A;  2N1T B;  3Q5S A;  3PP5 A;  4JF7 A;  4IL6 E;  3L72 J;  1DD3 A;  4W7Z A;  1L2P A;  1QL2 A;  1E5W A;  1GDT A;  2A06 E;  1RQU A;  1LWU A;  3VMY A;  5KJ7 A;  3H1H J;  2FXO A;  1KQF B;  4PV1 D;  4KT0 J;  1Q81 Q;  1YI2 P;  1JMM A;  1L0L D;  3A3Y B;  1VQ9 P;  3WMM 0;  3B5N A;  1L0L G;  1NTK K;  1ZR2 A;  2RKL A;  5KAF E;  4YTP C;  2B88 A;  1JTH B;  3GHG C;  1JNM A;  1KQL A;  4BWN A;  1SQP D;  3P32 A;  3RK3 C;  2NPS B;  5APQ A;  2AEM A;  1NAF A;  2IYO A;  3L4F A;  4H44 D;  1WRG A;  4JQ0 D;  3CWB D;  4CPG A;  1QL1 A;  1BE3 E;  1SQB D;  2N1T C;  1BGY E;  1GU4 A;  2JR8 A;  3CWB G;  3L74 E;  1GZL A;  1SQB G;  3MTU E;  2OYH C;  3P8M C;  1MKM A;  1L0N K;  2K3R A;  1IFI A;  2Z5H A;  3HUS A;  2Z5I A;  1LTB C;  2UWJ E;  1NTM J;  4RO0 A;  2ZAE B;  3TYY A;  3KHU A;  2Y0C A;  2KYV A;  3B4S A;  2Y0D A;  1X8Y A;  1KB9 I;  4AQR D;  4WVZ A;  3MHV A;  1R8E A;  3VOP A;  1KYO E;  2WQY C;  1LNQ A;  2O01 J;  2IBZ I;  3USS A;  4L73 A;  1CI6 A;  4ZNC A;  3B71 A;  2GA1 A;  3H32 A;  3GMA A;  1SFC A;  2FYU K;  2NPS C;  1LTA C;  4C7N B;  1ZOY C;  1K04 A;  3H1L E;  2A45 H;  4UB6 H;  3LID A;  3L70 E;  3E1R A;  1BE3 J;  2R5D A;  1AQT A;  3RK3 D;  4YPC A;  2OTJ P;  1ZLL A;  2B9B A;  1L4A A;  1URQ A;  1NTK G;  1JB0 J;  3L37 A;  1PGJ A;  3L74 J;  2LXB A;  3KDP B;  2KK7 A;  4GKG A;  4PD4 E;  4NPE A;  3O6Q A;  1M1J A;  2WPV B;  2N1T D;  5B5E H;  3WU2 E;  3FXD A;  1HH0 A;  3HE4 B;  2XKM A;  3ABV C;  2C0W A;  1FZC B;  1OW8 A;  5GTI E;  1UII A;  2KNC A;  1BDD A;  2D2C C;  1RE4 A;  1Q86 Q;  1VQM P;  1L0N D;  4WY4 B;  3RK2 C;  1RHZ B;  2H89 C;  1LTJ B;  2JDI H;  3OJA B;  1TU3 F;  1L0N G;  2WSE J;  3A0H H;  3CCQ P;  1N7S A;  3CPW O;  1KC8 Q;  1FAV A;  3H1I J;  5AVU B;  3U59 A;  1SQX E;  1IFP A;  2I8D A;  1KFN A;  3H1L J;  2HLO A;  1Q7Y Q;  1RF1 C;  2NPS D;  4I7Z B;  5E79 H;  1IJD B;  3L73 D;  4OH8 B;  1SQV K;  4DCK A;  1GTW A;  1FZB A;  5AVX B;  1YJW P;  2ZYG A;  3L36 A;  2L5G B;  3WUU A;  1PP9 J;  1NWQ A;  2KSJ A;  3W67 A;  2QVA A;  2K9Y A;  2XZR A;  1BSN A;  3CX5 H;  1X22 A;  2HFE D;  1OXZ A;  3AEC C;  4IFD K;  1X79 B;  1HF9 A;  3HD7 A;  3H6P A;  3IF4 A;  3ZDM A;  4I1L A;  4WY4 C;  1UIX A;  3RL0 B;  1GK4 A;  1LTT C;  3GG2 A;  2E75 B;  2D2C D;  1JY3 O;  1VQ6 P;  2WMM A;  3HRN A;  2R5B A;  1OVV A;  1SQX J;  3RK2 D;  5APS A;  1J1E B;  2ZT9 C;  3A5T A;  1P84 I;  4I2L C;  3WUT A;  1N7S B;  1CSB A;  1LTI C;  4N6J A;  3TDK A;  5KLV J;  1YQ3 C;  1S9K D;  5CBN A;  1KB9 D;  3FXE A;  2Q5U A;  5B66 H;  3EFG A;  1KYO I;  4EI2 A;  2FYU E;  1FZG A;  4ZKP A;  3BCC D;  1USD A;  4W7Y A;  1NU1 D;  2IBZ D;  4TLF A;  1KIL C;  2Y9Y A;  4OGQ C;  3V5B A;  1HJB A;  1G2C B;  3BCC G;  1NU1 G;  2IBZ G;  1Q2N A;  3GF3 A;  4UB6 E;  1LGH B;  2WPR A;  1SQV D;  1PPJ D;  2W90 A;  3CMA P;  1LP1 B;  3Q3D A;  1SLQ A;  3L72 D;  2AEJ A;  2O3J A;  3H1K E;  1SQV G;  1PPJ G;  3H1H D;  1HJ0 A;  3A0B H;  5AVZ B;  2G8Y A;  4PD4 I;  3H1H G;  2FFD C;  4WY4 D;  3PJS K;  3G71 P;  2B87 A;  1J1E C;  3NFQ A;  1JY2 O;  1QX8 A;  2OAR A;  2O1K A;  1FU1 A;  1N73 C;  3CC7 P;  2AXT H;  2J5U A;  2IDB A;  1S3J A;  2FBW C;  3GW6 A;  2ZT9 D;  4YXD C;  1BCC G;  1L0L K;  1CW5 A;  1M7L A;  1PGP A;  2KI7 B;  2OGU A;  3NXS A;  3SWK A;  2YKP A;  5AVS B;  3A0H E;  2OYH A;  2QRX A;  3FGA D;  2QJK B;  4H13 C;  1ZRT D;  1VQL P;  1NTZ J;  1VQ5 P;  2ZYD A;  4U3F J;  1N8R Q;  2OYO A;  1E79 H;  1OX3 A;  2KLU A;  1KIL D;  2HPC A;  1KV4 A;  4OGQ D;  1SQP K;  4JBZ A;  3H1K J;  1VQN P;  1H0T A;  1OMI A;  3P7K A;  1FJK A;  1PL5 A;  3QWO C;  3VN0 A;  1IZN B;  1NHL A;  1K9M Q;  1JMB A;  2HOD B;  1OWA A;  1NTM D;  1DD4 A;  1EXI A;  2H43 A;  1SQB K;  4XA4 A;  4D6T D;  3CXH E;  2E74 B;  1EDJ A;  1YBK A;  3MIW A;  1NTM G;  3D6Y A;  4D6T G;  4KHX A;  3CX5 E;  4DZO A;  5APX A;  5H2F H;  5CCG C;  3AEA C;  3L71 E;  2M5A A;  1EDI A;  2E42 A;  1HWT C;  2ZYA A;  1HGV A;  1MV8 A;  2VRS A;  1ZP0 C;  1K73 Q;  4BRY A;  1T2K C;  1YIT P;  4O9B A;  2QM7 A;  1ZW0 A;  5APV A;  3P8C E;  1NVO A;  2QJK C;  4JYC A;  3RL0 g;  4HYT B;  2W6A A;  1BE3 D;  3Q5R A;  1A02 J;  1KMI Z;  1N86 A;  4GOE A;  4IFM A;  2CPB A;  1BE3 G;  3L74 D;  4GDO A;  4H13 D;  2GM4 A;  3NMD A;  1QVF O;  2BCC E;  1P84 D;  5EFW B;  3L74 G;  1GL2 B;  2I1J A;  2Q7C A;  2R44 A;  3MUD C;  3VMX A;  2OYI B;  2YKO A;  1HGZ A;  5CJ4 A;  2ZXE B;  3QH9 A;  3E7K A;  4R4M A;  2KUB A;  3C1L A;  4U7J A;  3HE5 B;  3TGU J;  5K5G B;  2JO1 A;  1NOH A;  2WT7 B;  1KYO D;  1S1C X;  4HKZ H;  5AVT B;  2YNY A;  1QLE D;  3JSV C;  5CHX A;  1IK7 A;  1D7M A;  3H25 A;  2M0B A;  3SFD C;  2WSS H;  4NPF X;  1SQP G;  3SWF A;  2HG5 D;  1YJ9 P;  1RF1 A;  5BVZ A;  5CCG D;  2YO2 A;  1M8O B;  1J1D C;  2K9J B;  1S5L X;  2PP6 A;  2E5T A;  2GUS A;  4ZMD A;  3H1I D;  1EXJ A;  2IPP A;  1W2B O;  3H1L D;  2WPS A;  1X0T A;  2W83 C;  3FX0 A;  5TIS H;  2XDJ A;  3H1I G;  1T2K D;  3AE8 C;  1RE3 A;  2RMZ A;  3H1L G;  4BRY B;  3MZW B;  4K3A A;  2AXT E;  3EQ2 A;  2BCC J;  1YTZ T;  1L0L E;  3AEB C;  2Y0E A;  5AVY B;  2KP8 A;  1GL2 C;  1LWU B;  1KN7 A;  1PP9 D;  1EDL A;  1RH5 B;  4MN4 C;  3RGU A;  2M3B A;  1PP9 G;  3M9Q A;  3B5N B;  1WT6 A;  1T3U A;  3IN6 A;  1G1J A;  2PAJ A;  1VF5 B;  2B89 A;  4L74 A;  1BDC A;  1GU5 A;  1AVO A;  3OAK A;  1BGY J;  1MUU A;  3CWB E;  2WSF H;  3H1J D;  2QEX P;  1ZR4 A;  1SQB E;  1SQX D;  2WSC H;  1SQQ K;  4L76 A;  5AW3 B;  3SFE C;  3H1J G;  1AVY A;  3OA7 A;  4AUW A;  1SQX G;  3M9H A;  4AYC A;  1JCD A;  5GTH H;  2CK3 H;  3CXH I;  3HTK A;  5H2F E;  1KQS O;  1KIL A;  5KLV D;  5KTB A;  4TT3 H;  1YYC A;  2E43 A;  5KLV G;  3HUS B;  2JJL A;  1LWU C;  2YO3 A;  2ZVO B;  4A7P A;  3JC2 2;  1OW7 A;  1RF0 A;  3M0D A;  2Q3E A;  2I1K A;  3KYQ A;  1GL2 D;  1KB9 H;  2KB7 P;  2V7Q J;  2XNX A;  3AED C;  2KIK A;  2FFD A;  1FOS F;  2P10 A;  3BAS A;  2MJZ A;  1U7M A;  1VF5 C;  1LT9 A;  1NU1 K;  3CD6 P;  2ITA A;  1CI6 B;  3L70 J;  1N73 A;  3JCU H;  2QJP B;  3H32 B;  4IFF A;  1NTK E;  5AVV B;  5CBO A;  3AE6 C;  3G9R A;  1IFJ A;  5CCH A;  1SFC B;  3RK3 E;  1NH4 A;  4C46 A;  1KD1 Q;  3KQG A;  3FWL A;  1PFI A;  3L73 G;  3K5B A;  2KLV A;  1FZA A;  1JY3 P;  1S5L H;  4B86 A;  2POH A;  4K35 A;  1L4A B;  1XTG B;  1URQ B;  1JM0 A;  1NGM B;  2IZ0 A;  1FZC C;  3CC4 P;  3TNU A;  2IYP A;  3O6Q B;  3LIE A;  1M1J B;  3EFF K;  1PV3 A;  4NPD A;  1JUN A;  2JWD A;  1SQQ D;  2W6J H;  4ASV A;  1QVG O;  1SQQ G;  1L0N E;  1NTZ D;  1LTJ C;  4U3F D;  3IFM A;  2IZ1 A;  2FXP A;  2KS1 A;  1NTZ G;  2KNC B;  4U3F G;  3H1K D;  1ZN5 A;  2XND H;  3V2R A;  5KLI B;  1GK6 A;  1QEX A;  1NTK J;  3H1K G;  5APW A;  2QJP C;  1LT1 A;  3TSI A;  1SFC C;  2FY8 A;  2IFN A;  4I7Z C;  4JYB A;  1VF5 D;  3T97 A;  1XTC C;  3GF7 A;  2J59 M;  3SWY A;  2P67 A;  3PTZ A;  5C39 A;  3CL3 D;  3MP7 B;  1VQK P;  2BAS A;  3V4W A;  1OVR A;  1URQ C;  1NTM K;  2MKV A;  1JY2 P;  3I5C A;  1FZE A;  1EDK A;  2LKM A;  3RBX A;  1M1J C;  3MGN A;  3PHL A;  3PLN A;  1YJN P;  2O01 H;  4ASW A;  2G3A A;  1EQ7 A;  1L0N J;  2JKV A;  1NAY A;  5CMZ A;  3BVH A;  1PZQ A;  3MUD A;  2W8Z A;  3L72 G;  5DJT B;  3RL0 C;  4BXL A;  3E1I A;  4N78 D;  2E75 C;  2QA4 P;  3HD7 B;  4GIF A;  1FBM A;  3TK1 A;  5B5E E;  3L35 A;  3GHG A;  2FYN B;  4RJT A;  3AEG C;  2Q3I A;  3VYI A;  2O01 N;  3D6Z A;  3CXH D;  4WB4 A;  3LW5 H;  1N7S C;  1R5L A;  1P84 H;  3TGU D;  2FKW B;  1ZV8 A;  1JOC A;  1SFC D;  5KKZ B;  2FYU J;  2N1T A;  3TGU G;  3IR9 A;  3CCR P;  2C9L Y;  3M06 A;  5KAI H;  2QSI A;  2HYN A;  3T97 B;  3BCC E;  2IBZ E;  1K8A Q;  2WIT A;  3MD0 A;  1KYO H;  3N4X A;  1BSH A; 
#chains in the Genus database with same CATH homology
 2YNY A;  5CHX A;  1X9V A;  4HH2 A;  5BU8 B;  1NKZ B;  1URQ D;  3VTP C;  1HH0 A;  2FFD B;  3HE4 B;  2XKM A;  2C0W A;  3SWF A;  1LT9 B;  1FZC B;  2HG5 D;  2P2U A;  1RF1 A;  5BVZ A;  1N73 B;  5CCG D;  2YO2 A;  1J1D C;  3BRT B;  2P7J A;  3O8Z A;  1N2D C;  2PP6 A;  1A02 F;  2WTY A;  2GUS A;  1GW4 A;  1CZQ A;  1IO4 A;  1L4A C;  1FOS E;  1HUC A;  3HD7 C;  1RE4 A;  2IPP A;  1Z56 A;  2WPS A;  1JCC A;  4WY4 B;  4DOJ A;  1JTH A;  3RK2 C;  3RL0 D;  2XDJ A;  1T2K D;  1LTJ B;  1T8Z A;  3C9I A;  3OJA B;  1RE3 A;  1DEB A;  1T3J A;  1N7S A;  2NPS A;  1FAV A;  2R32 A;  5AVU B;  3U59 A;  3EQ2 A;  2IFM A;  1KFN A;  1YTZ T;  2W27 A;  2HLO A;  1NKN A;  5CJ0 A;  5AVY B;  3N7N A;  3TNU B;  2KOG A;  2KP8 A;  1RF1 C;  1GL2 C;  1LWU B;  3M9B A;  2HOD A;  1N7S D;  2NPS D;  4WBA A;  1IJD B;  4OH8 B;  1H8A A;  3UIA A;  1SQV K;  1W2E A;  2M3B A;  1FZB A;  5AVX B;  1GTW A;  1RE4 C;  4Y99 B;  1RF0 C;  1VDF A;  3M0D C;  4EIJ A;  3M9Q A;  2YKQ A;  1YTZ I;  3L36 A;  2L5G B;  1IK9 A;  3B5N B;  1WT6 A;  1JO5 A;  1T3U A;  3NTN A;  4ZKU A;  1G1J A;  1NWQ A;  2KSJ A;  2PAJ A;  4LLH A;  2YMY A;  5APU A;  2XZR A;  2JEE A;  5AVR B;  2OYH B;  3V4Q A;  2HFE D;  1OXZ A;  4EOT A;  1LT9 C;  1S9K E;  4IFD K;  2IX7 C;  2WWW A;  1X79 B;  1GU5 A;  1IFN A;  3OAK A;  1MUU A;  5AW0 B;  2WPQ A;  1MZ9 A;  2WSF H;  5CCH C;  3HD7 A;  1ZR4 A;  2HPC B;  2WSC H;  1SQQ K;  2W6B A;  3H6P A;  1SQX K;  5AW3 B;  5AVQ B;  1GW3 A;  4I1L A;  1IFD A;  4WY4 C;  5AW6 B;  3OA7 A;  4AUW A;  1JY3 N;  3RL0 B;  1GK4 A;  1RY3 A;  3U1A A;  1LTT C;  3M9H A;  4AYC A;  5AW5 B;  1JCD A;  4LGD E;  1L4A D;  3HD7 D;  1JY3 O;  3HTK A;  3P8C D;  3HRN A;  2R5B A;  1KIL A;  1AQ5 A;  4C7N A;  2ZFC A;  3RK2 D;  3R2P A;  5APS A;  1J1E B;  2CPS A;  5KLV K;  1G1I A;  5KTB A;  2C0X A;  3VP8 A;  3A5T A;  1YYC A;  4C7R A;  2E43 A;  1GL2 A;  2WSE H;  3HUS B;  2A45 I;  4I2L C;  2OYI A;  2JJL A;  1LWU C;  1DH3 A;  2YO3 A;  2FYZ A;  4N78 E;  1N7S B;  1CSB A;  2GUV A;  1LTI C;  4N6J A;  4W80 A;  1RF0 A;  1S9K D;  3M0D A;  3HE5 A;  2I1K A;  3KYQ A;  4Y99 C;  1KZU B;  4M3L A;  1GL2 D;  2KB7 P;  4XE5 B;  1H88 A;  2R3C A;  2WT7 A;  2XNX A;  2P1J A;  2Q5U A;  3M0A A;  3EFG A;  2M8R A;  1FZG A;  1AFO A;  4ZKP A;  1MFZ A;  1H89 A;  2FFD A;  4W7Y A;  3HE4 A;  1KIL C;  1FOS F;  3BAS A;  2MJZ A;  4LC1 A;  3V2N A;  3V5B A;  1LT9 A;  1FZC A;  1NU1 K;  1HJB A;  4GT1 A;  3V2Q A;  3GHG B;  1CI6 B;  1G2C B;  1N73 A;  2H8P D;  3VP9 A;  3H32 B;  4IFF A;  5AVV B;  2N9B A;  1LGH B;  2OYI C;  1IFJ A;  5CCH A;  2WPR A;  1SFC B;  1HBW A;  3RK3 B;  1NH4 A;  4C46 A;  1SLQ A;  4RES B;  5APT A;  4WY4 A;  3V2P A;  3KQG A;  1PFI A;  4I6M C;  1LTJ A;  2QM8 A;  1J1D B;  3BAT A;  5AW1 B;  2J58 A;  2KLV A;  1FZA A;  5CCH D;  1JY3 P;  3A2A A;  2N1T B;  5AVZ B;  4B86 A;  5AW4 B;  1JY2 N;  2POH A;  3PP5 A;  2O1J A;  1L4A B;  1XTG B;  1URQ B;  4JF7 A;  1KFM A;  2FFD C;  4WY4 D;  4W7Z A;  1J1E C;  3NFQ A;  1LTG C;  1JY2 O;  3RK2 B;  2H7H A;  3CLQ A;  1FZC C;  2OAR A;  1QL2 A;  2O1K A;  1E5W A;  3TNU A;  1GDT A;  1FU1 A;  1FZF A;  1N73 C;  3LIE A;  1LWU A;  1M1J B;  3VMY A;  5KJ7 A;  1JUN A;  3KPE A;  1SP4 A;  2XV5 A;  1JMM A;  1HTL C;  1VPC A;  2Z4E A;  3A3Y B;  1L0L K;  1RF1 B;  1LTJ C;  1NTZ K;  3IFM A;  3WMM 0;  1CW5 A;  1M7L A;  3B5N A;  1NTK K;  5BU5 A;  1ZR2 A;  2WZ7 A;  3NXS A;  2YKP A;  5AVS B;  3M91 A;  2C9N Y;  2OYH A;  1ZN5 A;  3V2R A;  5AW7 B;  1JTH B;  1GK6 A;  3GHG C;  1JNM A;  5APW A;  5AW2 B;  1KQL A;  5KJ7 C;  3TSI A;  3P32 A;  1SFC C;  3RK3 C;  2IFN A;  1KIL D;  2HPC A;  2NPS B;  4JYB A;  1SQP K;  3CI9 A;  1NO4 A;  5APQ A;  3T97 A;  1NAF A;  3II6 A;  1XTC C;  3L4F A;  2J59 M;  1WRG A;  3P7K A;  3SWY A;  1FJK A;  2P67 A;  2Q9I A;  3CL3 D;  3VN0 A;  1HVV A;  1NHL A;  1QL1 A;  3B5N C;  2HOD B;  1OWA A;  2N1T C;  2BAS A;  1GU4 A;  3V4W A;  2H43 A;  1SQB K;  4XA4 A;  1URQ C;  1NTM K;  1JY2 P;  3I5C A;  1GZL A;  3MTU E;  2OYH C;  1FZE A;  3MIW A;  3P8M C;  1LTS C;  4N3Y B;  1L0N K;  1IFI A;  2Z5H A;  4KHX A;  3HUS A;  4DZO A;  2LKM A;  5APX A;  1M1J C;  2Z5I A;  3MGN A;  5CCG C;  1LTB C;  1IFM A;  2O01 H;  2FXM A;  2E42 A;  5AW8 B;  3TYY A;  1HWT C;  1FJP A;  1EQ7 A;  1HGV A;  1MV8 A;  5CMZ A;  2KYV A;  3G3Z A;  3BVH A;  2VRS A;  1X8Y A;  3MUD A;  4AQR D;  3RL0 C;  3VMZ A;  1T2K C;  1SVF A;  3E1I A;  4N78 D;  3VOP A;  4O9B A;  2QM7 A;  5APY A;  3HD7 B;  4GIF A;  1FBM A;  3TK1 A;  5APV A;  3P8C E;  3L35 A;  4JYC A;  3GHG A;  1CI6 A;  1G2C A;  5AVW B;  4HYT B;  2Q3I A;  2W6A A;  1IC2 A;  1A02 J;  3H32 A;  1N7L A;  1N86 A;  3B8E B;  3HUS C;  3VYI A;  1RE3 C;  1SFC A;  2FYU K;  4IFM A;  2CPB A;  4WB4 A;  3BRV B;  3HTK B;  3LW5 H;  1N7S C;  1LTA C;  2NPS C;  1KIL B;  4C7N B;  2GM4 A;  1FDM A;  3NMD A;  5AW9 B;  2A45 H;  2XU6 A;  3LID A;  1GL2 B;  2I1J A;  2FKW B;  1ZV8 A;  1JOC A;  5KJ7 D;  2Q7C A;  2R5D A;  1SFC D;  3VMX A;  3RK3 D;  2OYI B;  3U1C A;  2N1T A;  2YKO A;  1HGZ A;  1ZLL A;  3IR9 A;  1L4A A;  5CJ4 A;  1DX7 A;  2C9L Y;  1URQ A;  3M06 A;  3A7O A;  2ZXE B;  2A45 G;  3L37 A;  2HYN A;  3KDP B;  4GKG A;  1GD2 E;  3HE5 B;  1J2J B;  2WIT A;  3MD0 A;  1NOH A;  3B5N D;  1M1J A;  2WT7 B;  3N4X A;  5CCG A;  2N1T D;  5AVT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...