1G1IA

Crystal structure of the oligomerization domain from rotavirus nsp4
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
43
structure length
43
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the oligomerization domain of NSP4 from rotavirus reveals a core metal-binding site.
pubmed doi rcsb
molecule tags Metal binding protein
molecule keywords NON-STRUCTURAL GLYCOPROTEIN NSP4
total genus 19
structure length 43
sequence length 43
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1g1iA00
1G1JA 2WITA 2L5GB 4WB4A 4DOJA 2O1KA 4LLHA 4WBAA 2O1JA 4C7RA 1G1IA 4HH2A 3MIWA 3CI9A
chains in the Genus database with same CATH superfamily
3B5ND 3L73D 5CJ0A 3TK1A 1ZP0C 1BGYJ 2IFNA 1BE3D 2XV5A 1ZLLA 1ZMEC 1AQ5A 3Q1MA 2ZAEB 1FDIA 1KFMA 3CXHI 2Q7CA 1SFCC 3V2RA 1EZVG 2V7QJ 1N8RQ 2KSEA 1X22A 2E74C 1G2CA 3EQ2A 3G3ZA 1NTMJ 3H1JD 1NJIQ 3R4YA 1LNQA 2PP6A 1RY3A 2QJYC 2ZJSE 1QVGO 1OVUA 1HUCA 2YKPA 3CWBJ 3L74D 4U7JA 5APYA 1SQXJ 1L0NJ 1PP9G 3EFFK 1L0NE 4I2LC 4EI2A 3GF3A 4ZKUA 1ZN5A 1NU1G 1OW7A 2Y0CA 3GW6A 5APSA 2JO1A 3B5NA 2QRXA 1SQXK 3CCRP 1YQ4C 1FC2C 1NKNA 3L36A 4K3AA 1ZXGA 1AVOA 1T3JA 2Q3IA 2Q5UA 3KZIH 4I7ZB 4LC1A 1VQLP 1NTKD 1SQBD 2H8PD 4W7YA 3CCJP 2H43A 1KILA 1URQC 1Z56A 3P7KA 3Q5SA 5KAFH 4BXLA 2K37A 1R8EA 2QA4P 1KV4A 3ZDMA 1OW6A 4R4LA 4DCKA 2IBZD 3SFDC 4ZMDA 1EDJA 1JEKA 1IJDB 1S9KE 3CMEP 4AYCA 1RE4A 3RL0D 3TNUB 1BCCE 2JWAA 2LXCB 1FZAA 5CJ4A 4U3FG 3CC4P 2M3EA 1IK7A 4JF7A 3PJSK 1SFCD 2VRSA 3OAKA 3O8ZA 1LGHB 2FYZA 3KHUA 3B8EB 1MV8A 3TGUG 1Q7YQ 5CMZA 2O3JA 1M7LA 4Y99C 1J1EB 3H1ID 1JNMA 1GL2B 1FE6A 1L4AD 1NTZG 1L0LJ 1SQPG 2B87A 2KI7B 2KXPB 2WSCJ 5CCHC 2KSJA 1Q81Q 2SPZA 4L73A 3IN6A 2WT7A 3H1JE 1K73Q 2XNXA 1FS0E 4WB4A 5AVVB 5C39A 2C0WA 3BCCJ 1RF0A 1NTKK 1SQBK 4PD4E 2Q1KA 5AW8B 1KB9D 2BEZF 4IFMA 5KAFE 1YYCA 1J1DB 3JCUH 1P84E 4IL6H 1CW5A 2AXTH 2B88A 2HODB 2UWJE 5AW7B 3L72J 2FYNB 1DD3A 1FZBA 3H6PA 4ZNCA 5CCHA 4RJTA 3H1HJ 3L73E 3R2PA 2GM4A 2E75D 2Y9YA 5AVUB 4H13B 3GF7A 2N1TD 3FWLA 1YQ3C 2FYNC 1PL5A 3H1KD 2G8YA 2KS1B 3F5HA 4IFFA 3V5BA 4HH2A 1LT9A 1PPJD 4Y99B 1SQXG 1GTWA 4H13C 2ZXEB 3CX5I 1OW8A 3RK2C 3G4SP 1X9VA 1RE4C 1N2DC 1W5CE 2M3BA 2QJPC 3H1KJ 3G6EP 3V2PA 1RE3A 2Q6QA 1VPCA 3M0AA 3HD7C 3C1LA 1IFPA 2LKMA 3H1HD 4XE5B 1URQD 3Q3DA 3Q5PA 2Q9IA 3VP9A 2PRRA 1E79H 3L72D 2WZ7A 5APXA 3I5CA 3W68A 4W7ZA 3S1KA 2RMZA 1JY3N 1SQPE 4YXWH 5TISH 3NXSA 3CCEP 1AJYA 1VF5C 1Y8AA 1KORA 1NTME 3AE6C 1PGQA 1IZNB 3CXHD 3GHGB 2BCCE 1MFZA 5AW3B 1U7JA 1L0LD 2FY8A 2Y0EA 3BCCD 2YIUB 4BRYA 3NTNA 3PH0A 3AE3C 3AEEC 3OA7A 1PGPA 2WITA 2P10A 3M9BA 5EFWB 2NPSB 1AV1A 5H2FE 5KAIE 2PAJA 1RE3C 3M9QA 4AUWA 1KB9I 1Y47A 3BCCG 2WSSH 3RK2B 2IPPA 2HG5D 4U3FE 1RF1C 3L70G 1VQKP 1DIPA 1BCCG 2HODA 2WSEH 3N7NA 2HR3A 3AE1C 3H1KE 3HD7A 3KQGA 4NPDA 4XA4A 2OGUA 5AVXB 1Q86Q 4H13D 2QVAA 3L72G 1QLED 5APWA 3B4SA 2WSFH 1S5LE 5KTBA 4A7PA 3HUSC 4OVNF 3M06A 2M5AA 3B5NB 1XTGB 4EDFA 1YTZT 4PD4I 4B86A 1ZOYC 2O01N 1LT9B 3WU2H 1P84D 2YNYA 4GDOA 1Y9BA 5AVYB 3MD0A 2IYPA 4H44C 1KQFB 2BASA 1SVFA 3CX5E 2QSIA 4PD4H 1FZCC 1E5WA 2R5BA 3AE2C 2IZ0A 4O9BA 3HUSA 1M8OB 2WSCH 1SQXD 2H88C 4JQ0D 2E5TA 3L72E 4YTPC 1EXIA 4OGQB 2CPSA 5E79H 3UIAA 3ITKA 2KB7P 3H1KG 1KFNA 1KILB 1RF1B 1SQPJ 1NYHA 2E42A 1QEXA 1IC2A 1LTBC 1NTMD 2WVRA 3A0BE 3H1JJ 3L70E 3H1IJ 5AVWB 2BCCD 3T97A 1L2PA 3BCCE 4DZOA 1AVYA 5KLVK 3H32B 2MKVA 1FOSF 1JMBA 2K88A 3V4QA 2R3CA 3WMM0 3V6IA 2B87B 1SQQG 1BDDA 1N7SA 2ITAA 1WMKA 1DD4A 2OYIC 1PGOA 1NH4A 2ZVNB 1W2BO 1S3JA 2FXPA 3H1HE 3CI9A 3IFMA 3L73J 1UIXA 3LIEA 4UB8H 3MZWB 1SQPK 1WRGA 1H0TA 1SQVE 1KYOH 1JTHA 1KMIZ 4WVZA 3RBXA 3E1IA 3U1CA 2E76B 1SQPD 1NU1K 3CCQP 1EQ7A 1NTZD 2Z5HA 3F89A 2WTYA 2OTLP 1NTKJ 1SQBJ 2YIUC 2W83C 3FX0A 3H1IG 4N78D 4YXDC 3AECC 1N7SB 1S5LX 1L0LE 2P67A 3L75G 3PLNA 1KYOI 2NPSD 2QJPB 5APTA 1M1JB 1S1CX 1L0NK 2K9JB 3RK3E 4C7NA 3TGUD 3GG2A 2HPCB 5KJ7A 3L70J 2FYUG 3D70A 4OH8B 2OTJP 1NTZJ 3CX5D 1VQPP 1IFIA 2ZYAA 1M1JA 2ZVOB 3VP8A 5AW0B 3CCLP 1T3UA 2XKMA 1NKZB 1X79B 3LIDA 1SQXE 1IFDA 2W6JH 3AEAC 3RK3C 2FFDA 2E75C 3NMDA 2IBZG 4EIJA 1YIJP 1NHLA 2WWWA 5H2FH 2KZJA 1VF5D 2W90A 2N1TB 1M1KQ 3VMAA 1GW3A 1AA0A 1BE3J 1K04A 1NOHA 1Q90D 2E75B 1DX7A 1LP1B 1RH5B 1GK4A 2BCCJ 1FZCA 2N1TA 1LWUC 3FXEA 1NU1D 2WPVB 1PIXA 1G2CB 1HF9A 2WPRA 5BU5A 5CCHD 5AW1B 3CC7P 2ZXXA 1L4AC 1M1JC 1SQQK 3VN0A 2IYOA 2YMYA 3VMYA 1JOCA 3H1JG 3BVHA 3MUDC 2IBZE 2O1KA 3M0DA 4XFJA 1LTIC 1EZVD 1SQQJ 4M3LA 2LR2A 1SLQA 1NWQA 5CHXA 2KOGA 4TT3H 1VQMP 5AVZB 2YO2A 1QX8A 2OYOA 2W8ZA 1BDCA 1OZHA 1HWTC 2WT7B 1FZGA 5AVSB 1HBWA 4WBAA 3RK3D 2A06E 1LWUA 1JB0J 1L4AA 2KNCB 3AE4C 1NAYA 1R5LA 2E5YA 2E74B 2AXCA 1YJNP 1JTHB 1J2JB 1KQGB 2WMMA 1RHZB 3AE5C 1USDA 1DEBA 1KYOD 1RQUA 4Z1MH 1FDMA 2KNCA 1R5SA 3NFQA 1HH0A 1P84I 2LXBA 4OGQC 3CPWO 4GODA 2YKQA 3RL0B 2M5AB 3A5TA 4KJMA 1H88A 3TSIA 2K9YA 2P7JA 2I1JA 1GU5A 3FXDA 2IBZI 2O1JA 1S9KD 2JR8A 1VL2A 1ZRTE 4HKZH 1HJBA 3D6ZA 3A0HE 1N7LA 1USEA 4I7ZC 5BVZA 4N78E 1FDOA 1KB9E 1VDFA 2QE7H 1LTSC 4UB8E 3P8CD 4WY4D 1SQQE 3CXHH 3S9OA 3D71A 3M9HA 1J1DC 3M91A 2RN0A 2YO3A 2IDBA 1VQ5P 2WPSA 1D7MA 3JC22 3QWOC 5AVRB 3G71P 2PGDA 3USSA 1RF1A 1PV3A 2D2CC 3BRTB 3JCUE 3CC2P 1LTJB 1W2EA 2AXTE 1NAFA 2JKVA 3BRVB 3MIWA 2K1AA 1OVVA 4WY4A 4DT0A 5B66H 1EC5A 3AE7C 1JCDA 2WSFJ 3G9RA 2GUVA 4GT1A 5KLVD 1T2KC 3D6YA 4NPEA 2CPBA 2YKOA 5DJTB 3P8MC 5KAIH 1ZR2A 3GLMA 3AEGC 4CPGA 3E1RA 1FZFA 2FYUD 2WSEJ 3CL3D 2O01J 2XNDH 4PJ0H 1VQ4P 3L75D 1FU1A 1RF0C 3EWKA 3U59A 1KILD 2AEFA 1KYOE 3MUDA 4H0LD 3A7OA 3HRNA 4HB1A 4IOIH 4LLHA 4RESB 1KN7A 2Y9ZA 4AQRD 2B9BA 1WT6A 2KIKA 1JMMA 1X0TA 3BATA 3V4WA 2DW3A 1PGJA 3PTZA 1FOSE 4PV1D 1GL2A 1ZRTD 2HPCA 1HGZA 1OXZA 1URQB 2L91A 3LW5J 4JYCA 4MN4C 1YITP 4U3FJ 1LTJC 4WY4B 2R5DA 1SQQD 3IR9A 3L35A 1KQSO 2JEEA 1SQVJ 2A45G 4EYYQ 1LT9C 1HTLC 4I6MC 4UB6E 2A06G 1LT1A 3W67A 3GHGA 1IO4A 2BCCG 1KC8Q 2OYIA 1BSHA 4DOJA 3HE5A 3U1AA 3OJAB 1NTMG 1A02F 1K8AQ 2HLOA 3RGUA 5TJHA 3CWBD 3L74J 3TYYA 3I56P 2J59M 2JP3A 3CLQA 4HJGH 4L74A 1CI6A 2BEQD 1ZW0A 1OFCX 1GZLA 2P1JA 2QM7A 1OWAA 5AW9B 4C7NB 1YI2P 3H25A 2KP8A 1U7MA 3M0DC 1FJPA 3A0HH 4EOTA 4C46A 1IFNA 5GTIH 1GU4A 2ZT9D 1EXJA 2OYHB 4H44B 2D2CB 1KQLA 1OMIA 1U57A 1BE3E 2IX7C 3QH9A 4N6JA 4WY4C 3L37A 2V7QH 2QM8A 2OYHA 1XTCC 2AEJA 2POHA 2P58A 3TGUJ 3PRJA 4HYTB 3RL0g 5KKZC 2PFXA 5AVTB 1BCCD 2NRGA 3TDKA 5KLIB 3L70D 1PFIA 1VQ7P 2M8RA 3CMAP 3RBZA 3L74E 1QGKB 4K35A 1EDKA 1L0ND 4JBZA 2FYUE 1CI6B 1N7SC 2W27A 2Z5IA 2L5GB 1M90Q 3OW2O 1LTAC 5KLIC 2KLUA 3L75E 1L0LG 1JCCA 1ZV8A 1MKMA 2W6BA 1KILE 1YBKA 1GW4A 3A0BH 2JDIH 3PP5A 1NTKE 1SQBE 1GK6A 2E76D 2R32A 3WUVA 1JY2P 1MUUA 3CCVP 2QJKB 3AE9C 1CSBA 2QIWA 3GHGC 1VQNP 3H1LJ 1SQVG 1KZUB 3H1LD 2OYHC 2KZIA 1NTZE 3H1HG 2WPQA 4YPCA 3C9IA 3MP7B 2C9NY 3KDPB 3VYIA 5CBNA 2CK3H 2I1KA 1DH3A 4I1LA 1VQ6P 3TGUE 1NO4A 4OWFA 3L71J 3Q5RA 2I8DA 3E7KA 1VQOP 2V4HA 5AW5B 4UB6H 3P32A 1N7SD 2OARA 3BASA 5M1BA 5B66E 3S4RA 4JPZB 5B5EH 1PPJG 2NPSC 3H1LG 2HYNA 2HFED 3HD7D 1SQVD 3CCUP 1VQ8P 3H32A 1JO5A 1JY3P 2QEXP 1JM0A 3HD7B 2K3RA 1M56D 1Q2NA 4NPFX 4PD4D 3HE4A 5CCGC 1GDTA 1DEEG 3HTKB 1GD2E 2N1TC 4IL6X 1T6AA 1LTGC 2JWDA 3HE5B 1OX3A 1IFJA 5APVA 3N4XA 1NU1E 2ZYGA 3C8VA 3HUSB 4H0LC 5BU8B 1L0NG 1MZ9A 1LTJA 1PP9E 1PP9J 2R44A 2GA1A 2JJLA 2KUBA 1QL1A 3L75J 4WWIA 5AVQB 4DJGA 1YJ9P 1IFMA 1N73A 3B71A 2B89A 2R3SA 4OGQD 2FBWC 1TU3F 3JSVC 4RKUJ 5APQA 3WU2E 3Q2YA 1EDIA 4N3YB 5AW2B 5CBOA 2XU6A 3H1LE 3HTKA 4KHXA 1EZVE 1LJ2A 1PPJE 3CX5H 4KT0J 5DJUB 4ASWA 5KLVJ 5AW6B 3AEBC 2ZT9C 4TLFA 2IFMA 1YJWP 4R4MA 3CXHE 2Z4EA 1H89A 2E74D 4GOFA 2A45I 1FBMA 4LGDE 1SP4A 3KZIE 1K05A 3SFEC 3V2QA 2C9LY 3RK3B 4ASVA 5TISE 2J5UA 2W6AA 3L71E 2K9JA 4U3FD 4PV1B 2M0BA 3CCSP 4GIFA 2H89C 3WUTA 1OVRA 1RQVA 3VMZA 2G3AA 5GTHE 2OYIB 2FKWB 2XZRA 5KKZB 4BRYB 3CWBG 2N9YB 3IAOA 3RL0C 1LWUB 1S2EA 1FZCB 3KPEA 2KLVA 1NTKG 1SQBG 2O01H 2QJYB 4L75A 3WUUA 5GTIE 1BGYE 2J58A 4PJ0E 1JY2N 2FYUK 1SS1A 2Q3EA 3GMAA 4L76A 3RK2D 3A2AA 1FAVA 1S4XA 2A06D 1KILC 1URQA 1QL2A 3FWNA 3T97B 1G1JA 1NVOA 2FYUJ 2ZT9B 1IK9A 1PP9D 5CCGA 2FFDB 2QG4A 1FZEA 3L74G 1S5LH 1KTMA 4GOEA 1LTTC 2FFDC 2QJKC 1KB9H 1VQ9P 3KYQA 1NTZK 2OTKE 2FXMA 2NZ2A 3V2NA 1UIIA 1EDLA 5KJ7D 1OIPA 2WQYC 2GUSA 5B5EE 1VF5B 2KK7A 1ZR4A 3EFGA 3IF4A 5KLVE 2YXRB 3L4FA 3K5BA 2KS1A 2N9BA 1BE3G 3PHLA 2E43A 3L73G 1Q82Q 4D6TE 3MTUE 2D2CD 2FXOA 2C0XA 3MGNA 1HJ0A 2IZ1A 5GTHH 3P8CE 1AFOA 1GMJA 2P2UA 2ZFCA 1MFTA 2E76C 3TNUA 1HGVA 1SQVK 2XDJA 2ZYDA 3L71D 4D6TG 1T2KD 3CD6P 3II6A 3TF5A 1N86A 2YXQB 1FJKA 5KLVG 1EZVI 1NGMB 1GL2C 1NU1J 3CCMP 4RO0A 2RH0A 2H7HA 5K5GB 1QVFO 3AEDC 3B5NC 2YMKA 1JY2O 4GKGA 3VMXA 1X8YA 2A45H 2NPSA 3SWKA 1BGYD 1HVVA 2KYVA 4QMAA 4Y28J 5KJ7C 1PZQA 1N73B 3FGAD 4H0LB 4C7RA 1SFCB 1G1IA 2RKLA 3VOPA 3KXDA 3AEFC 3I55P 1A02J 1K9MQ 4PV1C 1H0TB 1AQTA 3SWFA 1M57D 4D6TJ 1BGYG 4W80A 1YHQP 3H1IE 1LP1A 1N73C 1SFCA 1J1EC 4ZKPA 1JY3O 1T8ZA 1H8AA 3HE4B 3CWBE 5AW4B 2OQQA 2MJZA 1L0LK 3SWYA 1JUNA 3LW5H 1BCCJ 1S72P 1CZQA 4H44D 3SSUA 3O6QA 1L4AB 1P84H 2Y0DA 1GL2D 1NTMK 3AE8C 2AEMA 4IL6E 5E79E 5L8RJ 3L71G 4D6TD 1KD1Q 3VTPC 5APUA 1BSNA 3A3YB 4IFDK 3ABVC 3MHVA 3O6QB 5CCGD 4BWNA 1YTZI 4JYBA
chains in the Genus database with same CATH topology
3B5ND 5CJ0A 3TK1A 2IFNA 2XV5A 1ZLLA 1AQ5A 2Q7CA 1KFMA 3V2RA 1SFCC 1G2CA 3EQ2A 3G3ZA 2PP6A 1RY3A 1HUCA 2YKPA 5APYA 4I2LC 4ZKUA 1ZN5A 5APSA 3B5NA 1SQXK 1NKNA 3L36A 2Q3IA 1T3JA 2Q5UA 4LC1A 2H43A 2H8PD 4W7YA 1KILA 1URQC 1Z56A 3P7KA 1IJDB 1S9KE 4AYCA 1RE4A 3RL0D 3TNUB 1FZAA 5CJ4A 4JF7A 1SFCD 2VRSA 3OAKA 3O8ZA 1LGHB 2FYZA 3B8EB 1MV8A 5CMZA 1M7LA 4Y99C 1J1EB 1JNMA 1GL2B 1L4AD 5CCHC 2KSJA 2WT7A 2XNXA 4WB4A 5AVVB 2C0WA 1RF0A 1NTKK 1SQBK 5AW8B 4IFMA 1YYCA 1J1DB 1CW5A 2HODB 5AW7B 1FZBA 3H6PA 5CCHA 2GM4A 3R2PA 5AVUB 2N1TD 3V5BA 4IFFA 4HH2A 1LT9A 4Y99B 1GTWA 2ZXEB 3RK2C 1X9VA 1RE4C 1N2DC 2M3BA 3V2PA 1RE3A 1VPCA 3M0AA 3HD7C 2LKMA 2Q9IA 4XE5B 1URQD 3VP9A 2WZ7A 5APXA 3I5CA 4W7ZA 1JY3N 3NXSA 5AW3B 3GHGB 1MFZA 3NTNA 3OA7A 2WITA 3M9BA 2NPSB 2PAJA 1RE3C 3M9QA 4AUWA 3RK2B 1RF1C 2IPPA 2HG5D 2HODA 2WSEH 3N7NA 3HD7A 3KQGA 4XA4A 5AVXB 5APWA 2WSFH 5KTBA 3HUSC 3M06A 3B5NB 1XTGB 1YTZT 4B86A 1LT9B 2YNYA 5AVYB 3MD0A 2BASA 1SVFA 1FZCC 1E5WA 2R5BA 4O9BA 3HUSA 2WSCH 2CPSA 3UIAA 2KB7P 1KFNA 1KILB 1RF1B 2E42A 1IC2A 1LTBC 5AVWB 3T97A 4DZOA 5KLVK 3H32B 1FOSF 3V4QA 2R3CA 3WMM0 1N7SA 2OYIC 1NH4A 3CI9A 3IFMA 3LIEA 1SQPK 1WRGA 1JTHA 3E1IA 3U1CA 1NU1K 1EQ7A 2Z5HA 2WTYA 2FFDC 4N78D 1HBWA 1N7SB 2P67A 5APTA 2NPSD 2HPCB 1M1JB 1L0NK 4C7NA 5KJ7A 4OH8B 1IFIA 3VP8A 1M1JA 5AW0B 1T3UA 2XKMA 1NKZB 1X79B 3LIDA 1IFDA 3RK3C 2FFDA 3NMDA 1NHLA 2WWWA 2N1TB 1GW3A 1NOHA 1DX7A 1FZCA 1GK4A 2N1TA 1LWUC 1G2CB 2WPRA 5BU5A 5CCHD 5AW1B 1L4AC 1M1JC 1SQQK 3VN0A 2YMYA 3VMYA 1JOCA 3BVHA 2O1KA 3M0DA 1LTIC 4M3LA 1NWQA 1SLQA 5CHXA 2KOGA 5AVZB 2YO2A 1HWTC 2WT7B 1FZGA 5AVSB 4WBAA 3RK3D 1LWUA 1L4AA 1JTHB 1J2JB 1DEBA 1FDMA 3NFQA 1HH0A 2YKQA 3RL0B 3A5TA 1H88A 3TSIA 2P7JA 2I1JA 1GU5A 2O1JA 1S9KD 1HJBA 1N7LA 5BVZA 4N78E 1VDFA 1LTSC 3P8CD 4WY4D 3M9HA 1J1DC 3M91A 2YO3A 2WPSA 5AVRB 1RF1A 3BRTB 1LTJB 1W2EA 3BRVB 1NAFA 3MIWA 4WY4A 1JCDA 1T2KC 4GT1A 2GUVA 2CPBA 2YKOA 1ZR2A 3P8MC 1FZFA 3CL3D 1FU1A 1RF0C 3U59A 1KILD 3MUDA 4EIJA 3A7OA 3HRNA 4LLHA 4RESB 4AQRD 1WT6A 1JMMA 3BATA 3V4WA 1FOSE 1GL2A 2HPCA 1HGZA 1OXZA 1URQB 4JYCA 1LTJC 4WY4B 2R5DA 3IR9A 3L35A 2JEEA 2A45G 1LT9C 1HTLC 4I6MC 3GHGA 1IO4A 2OYIA 4DOJA 3HE5A 3U1AA 3OJAB 1A02F 2HLOA 3TYYA 2J59M 3CLQA 1CI6A 2P1JA 1GZLA 5AW9B 2QM7A 1OWAA 4C7NB 2KP8A 3M0DC 1FJPA 4EOTA 4C46A 1IFNA 1GU4A 2OYHB 4N6JA 1KQLA 2IX7C 4WY4C 3L37A 2QM8A 2OYHA 1XTCC 2POHA 4HYTB 1PFIA 5AVTB 2M8RA 1CI6B 1N7SC 2W27A 2Z5IA 2L5GB 1LTAC 1JCCA 1ZV8A 2W6BA 1GW4A 3PP5A 1GK6A 2R32A 1JY2P 1MUUA 3GHGC 1CSBA 1KZUB 2OYHC 2WPQA 3C9IA 2C9NY 3KDPB 3VYIA 2I1KA 1DH3A 4I1LA 1NO4A 5AW5B 3P32A 1N7SD 2OARA 3BASA 2NPSC 1JO5A 2HYNA 2HFED 3HD7D 3H32A 1JY3P 3HD7B 5CCGC 3HE4A 1GDTA 3HTKB 1GD2E 2N1TC 1LTGC 3HE5B 1IFJA 5APVA 3N4XA 3HUSB 5BU8B 1MZ9A 1LTJA 5AVQB 2JJLA 1QL1A 1N73A 1IFMA 5APQA 4N3YB 5AW2B 2XU6A 4KHXA 3HTKA 5AW6B 2IFMA 2Z4EA 1H89A 2A45I 1FBMA 4LGDE 1SP4A 3V2QA 2C9LY 3RK3B 2W6AA 4GIFA 3VMZA 2OYIB 2FKWB 2XZRA 3RL0C 1LWUB 1FZCB 3KPEA 2KLVA 2O01H 2J58A 1JY2N 2FYUK 3RK2D 3A2AA 1FAVA 1KILC 1URQA 1QL2A 1G1JA 5CCGA 1IK9A 2FFDB 1FZEA 1LTTC 3KYQA 1NTZK 2FXMA 3V2NA 5KJ7D 2GUSA 1ZR4A 3EFGA 3L4FA 2E43A 2N9BA 3MTUE 3MGNA 2C0XA 1AFOA 3P8CE 2P2UA 2ZFCA 3TNUA 1HGVA 1SQVK 2XDJA 1T2KD 3II6A 1N86A 1FJKA 1GL2C 2H7HA 3B5NC 4GKGA 1JY2O 3VMXA 1X8YA 2A45H 2NPSA 1HVVA 2KYVA 5KJ7C 1N73B 4C7RA 1SFCB 1G1IA 3VOPA 1A02J 3SWFA 4W80A 1N73C 1SFCA 1J1EC 4ZKPA 1JY3O 1T8ZA 1H8AA 3HE4B 5AW4B 2MJZA 1L0LK 3SWYA 1JUNA 3LW5H 1CZQA 1L4AB 1GL2D 1NTMK 3VTPC 5APUA 4IFDK 3A3YB 5CCGD 1YTZI 4JYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G1J A;  2WIT A;  2L5G B;  4WB4 A;  4DOJ A;  2O1K A;  4LLH A;  4WBA A;  2O1J A;  4C7R A;  1G1I A;  4HH2 A;  3MIW A;  3CI9 A; 
#chains in the Genus database with same CATH topology
 3B5N D;  3L73 D;  5CJ0 A;  3TK1 A;  1ZP0 C;  1BGY J;  2IFN A;  1BE3 D;  2XV5 A;  1ZLL A;  1ZME C;  1AQ5 A;  3Q1M A;  2ZAE B;  1FDI A;  1KFM A;  3CXH I;  2Q7C A;  1SFC C;  3V2R A;  1EZV G;  2V7Q J;  1N8R Q;  2KSE A;  1X22 A;  2E74 C;  1G2C A;  3EQ2 A;  3G3Z A;  1NTM J;  3H1J D;  1NJI Q;  3R4Y A;  1LNQ A;  2PP6 A;  1RY3 A;  2QJY C;  2ZJS E;  1QVG O;  1OVU A;  1HUC A;  2YKP A;  3CWB J;  3L74 D;  4U7J A;  5APY A;  1SQX J;  1L0N J;  1PP9 G;  3EFF K;  1L0N E;  4I2L C;  4EI2 A;  3GF3 A;  4ZKU A;  1ZN5 A;  1NU1 G;  1OW7 A;  2Y0C A;  3GW6 A;  5APS A;  2JO1 A;  3B5N A;  2QRX A;  1SQX K;  3CCR P;  1YQ4 C;  1FC2 C;  1NKN A;  3L36 A;  4K3A A;  1ZXG A;  1AVO A;  1T3J A;  2Q3I A;  2Q5U A;  3KZI H;  4I7Z B;  4LC1 A;  1VQL P;  1NTK D;  1SQB D;  2H8P D;  4W7Y A;  3CCJ P;  2H43 A;  1KIL A;  1URQ C;  1Z56 A;  3P7K A;  3Q5S A;  5KAF H;  4BXL A;  2K37 A;  1R8E A;  2QA4 P;  1KV4 A;  3ZDM A;  1OW6 A;  4R4L A;  4DCK A;  2IBZ D;  3SFD C;  4ZMD A;  1EDJ A;  1JEK A;  1IJD B;  1S9K E;  3CME P;  4AYC A;  1RE4 A;  3RL0 D;  3TNU B;  1BCC E;  2JWA A;  2LXC B;  1FZA A;  5CJ4 A;  4U3F G;  3CC4 P;  2M3E A;  1IK7 A;  4JF7 A;  3PJS K;  1SFC D;  2VRS A;  3OAK A;  3O8Z A;  1LGH B;  2FYZ A;  3KHU A;  3B8E B;  1MV8 A;  3TGU G;  1Q7Y Q;  5CMZ A;  2O3J A;  1M7L A;  4Y99 C;  1J1E B;  3H1I D;  1JNM A;  1GL2 B;  1FE6 A;  1L4A D;  1NTZ G;  1L0L J;  1SQP G;  2B87 A;  2KI7 B;  2KXP B;  2WSC J;  5CCH C;  2KSJ A;  1Q81 Q;  2SPZ A;  4L73 A;  3IN6 A;  2WT7 A;  3H1J E;  1K73 Q;  2XNX A;  1FS0 E;  4WB4 A;  5AVV B;  5C39 A;  2C0W A;  3BCC J;  1RF0 A;  1NTK K;  1SQB K;  4PD4 E;  2Q1K A;  5AW8 B;  1KB9 D;  2BEZ F;  4IFM A;  5KAF E;  1YYC A;  1J1D B;  3JCU H;  1P84 E;  4IL6 H;  1CW5 A;  2AXT H;  2B88 A;  2HOD B;  2UWJ E;  5AW7 B;  3L72 J;  2FYN B;  1DD3 A;  1FZB A;  3H6P A;  4ZNC A;  5CCH A;  4RJT A;  3H1H J;  3L73 E;  3R2P A;  2GM4 A;  2E75 D;  2Y9Y A;  5AVU B;  4H13 B;  3GF7 A;  2N1T D;  3FWL A;  1YQ3 C;  2FYN C;  1PL5 A;  3H1K D;  2G8Y A;  2KS1 B;  3F5H A;  4IFF A;  3V5B A;  4HH2 A;  1LT9 A;  1PPJ D;  4Y99 B;  1SQX G;  1GTW A;  4H13 C;  2ZXE B;  3CX5 I;  1OW8 A;  3RK2 C;  3G4S P;  1X9V A;  1RE4 C;  1N2D C;  1W5C E;  2M3B A;  2QJP C;  3H1K J;  3G6E P;  3V2P A;  1RE3 A;  2Q6Q A;  1VPC A;  3M0A A;  3HD7 C;  3C1L A;  1IFP A;  2LKM A;  3H1H D;  4XE5 B;  1URQ D;  3Q3D A;  3Q5P A;  2Q9I A;  3VP9 A;  2PRR A;  1E79 H;  3L72 D;  2WZ7 A;  5APX A;  3I5C A;  3W68 A;  4W7Z A;  3S1K A;  2RMZ A;  1JY3 N;  1SQP E;  4YXW H;  5TIS H;  3NXS A;  3CCE P;  1AJY A;  1VF5 C;  1Y8A A;  1KOR A;  1NTM E;  3AE6 C;  1PGQ A;  1IZN B;  3CXH D;  3GHG B;  2BCC E;  1MFZ A;  5AW3 B;  1U7J A;  1L0L D;  2FY8 A;  2Y0E A;  3BCC D;  2YIU B;  4BRY A;  3NTN A;  3PH0 A;  3AE3 C;  3AEE C;  3OA7 A;  1PGP A;  2WIT A;  2P10 A;  3M9B A;  5EFW B;  2NPS B;  1AV1 A;  5H2F E;  5KAI E;  2PAJ A;  1RE3 C;  3M9Q A;  4AUW A;  1KB9 I;  1Y47 A;  3BCC G;  2WSS H;  3RK2 B;  2IPP A;  2HG5 D;  4U3F E;  1RF1 C;  3L70 G;  1VQK P;  1DIP A;  1BCC G;  2HOD A;  2WSE H;  3N7N A;  2HR3 A;  3AE1 C;  3H1K E;  3HD7 A;  3KQG A;  4NPD A;  4XA4 A;  2OGU A;  5AVX B;  1Q86 Q;  4H13 D;  2QVA A;  3L72 G;  1QLE D;  5APW A;  3B4S A;  2WSF H;  1S5L E;  5KTB A;  4A7P A;  3HUS C;  4OVN F;  3M06 A;  2M5A A;  3B5N B;  1XTG B;  4EDF A;  1YTZ T;  4PD4 I;  4B86 A;  1ZOY C;  2O01 N;  1LT9 B;  3WU2 H;  1P84 D;  2YNY A;  4GDO A;  1Y9B A;  5AVY B;  3MD0 A;  2IYP A;  4H44 C;  1KQF B;  2BAS A;  1SVF A;  3CX5 E;  2QSI A;  4PD4 H;  1FZC C;  1E5W A;  2R5B A;  3AE2 C;  2IZ0 A;  4O9B A;  3HUS A;  1M8O B;  2WSC H;  1SQX D;  2H88 C;  4JQ0 D;  2E5T A;  3L72 E;  4YTP C;  1EXI A;  4OGQ B;  2CPS A;  5E79 H;  3UIA A;  3ITK A;  2KB7 P;  3H1K G;  1KFN A;  1KIL B;  1RF1 B;  1SQP J;  1NYH A;  2E42 A;  1QEX A;  1IC2 A;  1LTB C;  1NTM D;  2WVR A;  3A0B E;  3H1J J;  3L70 E;  3H1I J;  5AVW B;  2BCC D;  3T97 A;  1L2P A;  3BCC E;  4DZO A;  1AVY A;  5KLV K;  3H32 B;  2MKV A;  1FOS F;  1JMB A;  2K88 A;  3V4Q A;  2R3C A;  3WMM 0;  3V6I A;  2B87 B;  1SQQ G;  1BDD A;  1N7S A;  2ITA A;  1WMK A;  1DD4 A;  2OYI C;  1PGO A;  1NH4 A;  2ZVN B;  1W2B O;  1S3J A;  2FXP A;  3H1H E;  3CI9 A;  3IFM A;  3L73 J;  1UIX A;  3LIE A;  4UB8 H;  3MZW B;  1SQP K;  1WRG A;  1H0T A;  1SQV E;  1KYO H;  1JTH A;  1KMI Z;  4WVZ A;  3RBX A;  3E1I A;  3U1C A;  2E76 B;  1SQP D;  1NU1 K;  3CCQ P;  1EQ7 A;  1NTZ D;  2Z5H A;  3F89 A;  2WTY A;  2OTL P;  1NTK J;  1SQB J;  2YIU C;  2W83 C;  3FX0 A;  3H1I G;  4N78 D;  4YXD C;  3AEC C;  1N7S B;  1S5L X;  1L0L E;  2P67 A;  3L75 G;  3PLN A;  1KYO I;  2NPS D;  2QJP B;  5APT A;  1M1J B;  1S1C X;  1L0N K;  2K9J B;  3RK3 E;  4C7N A;  3TGU D;  3GG2 A;  2HPC B;  5KJ7 A;  3L70 J;  2FYU G;  3D70 A;  4OH8 B;  2OTJ P;  1NTZ J;  3CX5 D;  1VQP P;  1IFI A;  2ZYA A;  1M1J A;  2ZVO B;  3VP8 A;  5AW0 B;  3CCL P;  1T3U A;  2XKM A;  1NKZ B;  1X79 B;  3LID A;  1SQX E;  1IFD A;  2W6J H;  3AEA C;  3RK3 C;  2FFD A;  2E75 C;  3NMD A;  2IBZ G;  4EIJ A;  1YIJ P;  1NHL A;  2WWW A;  5H2F H;  2KZJ A;  1VF5 D;  2W90 A;  2N1T B;  1M1K Q;  3VMA A;  1GW3 A;  1AA0 A;  1BE3 J;  1K04 A;  1NOH A;  1Q90 D;  2E75 B;  1DX7 A;  1LP1 B;  1RH5 B;  1GK4 A;  2BCC J;  1FZC A;  2N1T A;  1LWU C;  3FXE A;  1NU1 D;  2WPV B;  1PIX A;  1G2C B;  1HF9 A;  2WPR A;  5BU5 A;  5CCH D;  5AW1 B;  3CC7 P;  2ZXX A;  1L4A C;  1M1J C;  1SQQ K;  3VN0 A;  2IYO A;  2YMY A;  3VMY A;  1JOC A;  3H1J G;  3BVH A;  3MUD C;  2IBZ E;  2O1K A;  3M0D A;  4XFJ A;  1LTI C;  1EZV D;  1SQQ J;  4M3L A;  2LR2 A;  1SLQ A;  1NWQ A;  5CHX A;  2KOG A;  4TT3 H;  1VQM P;  5AVZ B;  2YO2 A;  1QX8 A;  2OYO A;  2W8Z A;  1BDC A;  1OZH A;  1HWT C;  2WT7 B;  1FZG A;  5AVS B;  1HBW A;  4WBA A;  3RK3 D;  2A06 E;  1LWU A;  1JB0 J;  1L4A A;  2KNC B;  3AE4 C;  1NAY A;  1R5L A;  2E5Y A;  2E74 B;  2AXC A;  1YJN P;  1JTH B;  1J2J B;  1KQG B;  2WMM A;  1RHZ B;  3AE5 C;  1USD A;  1DEB A;  1KYO D;  1RQU A;  4Z1M H;  1FDM A;  2KNC A;  1R5S A;  3NFQ A;  1HH0 A;  1P84 I;  2LXB A;  4OGQ C;  3CPW O;  4GOD A;  2YKQ A;  3RL0 B;  2M5A B;  3A5T A;  4KJM A;  1H88 A;  3TSI A;  2K9Y A;  2P7J A;  2I1J A;  1GU5 A;  3FXD A;  2IBZ I;  2O1J A;  1S9K D;  2JR8 A;  1VL2 A;  1ZRT E;  4HKZ H;  1HJB A;  3D6Z A;  3A0H E;  1N7L A;  1USE A;  4I7Z C;  5BVZ A;  4N78 E;  1FDO A;  1KB9 E;  1VDF A;  2QE7 H;  1LTS C;  4UB8 E;  3P8C D;  4WY4 D;  1SQQ E;  3CXH H;  3S9O A;  3D71 A;  3M9H A;  1J1D C;  3M91 A;  2RN0 A;  2YO3 A;  2IDB A;  1VQ5 P;  2WPS A;  1D7M A;  3JC2 2;  3QWO C;  5AVR B;  3G71 P;  2PGD A;  3USS A;  1RF1 A;  1PV3 A;  2D2C C;  3BRT B;  3JCU E;  3CC2 P;  1LTJ B;  1W2E A;  2AXT E;  1NAF A;  2JKV A;  3BRV B;  3MIW A;  2K1A A;  1OVV A;  4WY4 A;  4DT0 A;  5B66 H;  1EC5 A;  3AE7 C;  1JCD A;  2WSF J;  3G9R A;  2GUV A;  4GT1 A;  5KLV D;  1T2K C;  3D6Y A;  4NPE A;  2CPB A;  2YKO A;  5DJT B;  3P8M C;  5KAI H;  1ZR2 A;  3GLM A;  3AEG C;  4CPG A;  3E1R A;  1FZF A;  2FYU D;  2WSE J;  3CL3 D;  2O01 J;  2XND H;  4PJ0 H;  1VQ4 P;  3L75 D;  1FU1 A;  1RF0 C;  3EWK A;  3U59 A;  1KIL D;  2AEF A;  1KYO E;  3MUD A;  4H0L D;  3A7O A;  3HRN A;  4HB1 A;  4IOI H;  4LLH A;  4RES B;  1KN7 A;  2Y9Z A;  4AQR D;  2B9B A;  1WT6 A;  2KIK A;  1JMM A;  1X0T A;  3BAT A;  3V4W A;  2DW3 A;  1PGJ A;  3PTZ A;  1FOS E;  4PV1 D;  1GL2 A;  1ZRT D;  2HPC A;  1HGZ A;  1OXZ A;  1URQ B;  2L91 A;  3LW5 J;  4JYC A;  4MN4 C;  1YIT P;  4U3F J;  1LTJ C;  4WY4 B;  2R5D A;  1SQQ D;  3IR9 A;  3L35 A;  1KQS O;  2JEE A;  1SQV J;  2A45 G;  4EYY Q;  1LT9 C;  1HTL C;  4I6M C;  4UB6 E;  2A06 G;  1LT1 A;  3W67 A;  3GHG A;  1IO4 A;  2BCC G;  1KC8 Q;  2OYI A;  1BSH A;  4DOJ A;  3HE5 A;  3U1A A;  3OJA B;  1NTM G;  1A02 F;  1K8A Q;  2HLO A;  3RGU A;  5TJH A;  3CWB D;  3L74 J;  3TYY A;  3I56 P;  2J59 M;  2JP3 A;  3CLQ A;  4HJG H;  4L74 A;  1CI6 A;  2BEQ D;  1ZW0 A;  1OFC X;  1GZL A;  2P1J A;  2QM7 A;  1OWA A;  5AW9 B;  4C7N B;  1YI2 P;  3H25 A;  2KP8 A;  1U7M A;  3M0D C;  1FJP A;  3A0H H;  4EOT A;  4C46 A;  1IFN A;  5GTI H;  1GU4 A;  2ZT9 D;  1EXJ A;  2OYH B;  4H44 B;  2D2C B;  1KQL A;  1OMI A;  1U57 A;  1BE3 E;  2IX7 C;  3QH9 A;  4N6J A;  4WY4 C;  3L37 A;  2V7Q H;  2QM8 A;  2OYH A;  1XTC C;  2AEJ A;  2POH A;  2P58 A;  3TGU J;  3PRJ A;  4HYT B;  3RL0 g;  5KKZ C;  2PFX A;  5AVT B;  1BCC D;  2NRG A;  3TDK A;  5KLI B;  3L70 D;  1PFI A;  1VQ7 P;  2M8R A;  3CMA P;  3RBZ A;  3L74 E;  1QGK B;  4K35 A;  1EDK A;  1L0N D;  4JBZ A;  2FYU E;  1CI6 B;  1N7S C;  2W27 A;  2Z5I A;  2L5G B;  1M90 Q;  3OW2 O;  1LTA C;  5KLI C;  2KLU A;  3L75 E;  1L0L G;  1JCC A;  1ZV8 A;  1MKM A;  2W6B A;  1KIL E;  1YBK A;  1GW4 A;  3A0B H;  2JDI H;  3PP5 A;  1NTK E;  1SQB E;  1GK6 A;  2E76 D;  2R32 A;  3WUV A;  1JY2 P;  1MUU A;  3CCV P;  2QJK B;  3AE9 C;  1CSB A;  2QIW A;  3GHG C;  1VQN P;  3H1L J;  1SQV G;  1KZU B;  3H1L D;  2OYH C;  2KZI A;  1NTZ E;  3H1H G;  2WPQ A;  4YPC A;  3C9I A;  3MP7 B;  2C9N Y;  3KDP B;  3VYI A;  5CBN A;  2CK3 H;  2I1K A;  1DH3 A;  4I1L A;  1VQ6 P;  3TGU E;  1NO4 A;  4OWF A;  3L71 J;  3Q5R A;  2I8D A;  3E7K A;  1VQO P;  2V4H A;  5AW5 B;  4UB6 H;  3P32 A;  1N7S D;  2OAR A;  3BAS A;  5M1B A;  5B66 E;  3S4R A;  4JPZ B;  5B5E H;  1PPJ G;  2NPS C;  3H1L G;  2HYN A;  2HFE D;  3HD7 D;  1SQV D;  3CCU P;  1VQ8 P;  3H32 A;  1JO5 A;  1JY3 P;  2QEX P;  1JM0 A;  3HD7 B;  2K3R A;  1M56 D;  1Q2N A;  4NPF X;  4PD4 D;  3HE4 A;  5CCG C;  1GDT A;  1DEE G;  3HTK B;  1GD2 E;  2N1T C;  4IL6 X;  1T6A A;  1LTG C;  2JWD A;  3HE5 B;  1OX3 A;  1IFJ A;  5APV A;  3N4X A;  1NU1 E;  2ZYG A;  3C8V A;  3HUS B;  4H0L C;  5BU8 B;  1L0N G;  1MZ9 A;  1LTJ A;  1PP9 E;  1PP9 J;  2R44 A;  2GA1 A;  2JJL A;  2KUB A;  1QL1 A;  3L75 J;  4WWI A;  5AVQ B;  4DJG A;  1YJ9 P;  1IFM A;  1N73 A;  3B71 A;  2B89 A;  2R3S A;  4OGQ D;  2FBW C;  1TU3 F;  3JSV C;  4RKU J;  5APQ A;  3WU2 E;  3Q2Y A;  1EDI A;  4N3Y B;  5AW2 B;  5CBO A;  2XU6 A;  3H1L E;  3HTK A;  4KHX A;  1EZV E;  1LJ2 A;  1PPJ E;  3CX5 H;  4KT0 J;  5DJU B;  4ASW A;  5KLV J;  5AW6 B;  3AEB C;  2ZT9 C;  4TLF A;  2IFM A;  1YJW P;  4R4M A;  3CXH E;  2Z4E A;  1H89 A;  2E74 D;  4GOF A;  2A45 I;  1FBM A;  4LGD E;  1SP4 A;  3KZI E;  1K05 A;  3SFE C;  3V2Q A;  2C9L Y;  3RK3 B;  4ASV A;  5TIS E;  2J5U A;  2W6A A;  3L71 E;  2K9J A;  4U3F D;  4PV1 B;  2M0B A;  3CCS P;  4GIF A;  2H89 C;  3WUT A;  1OVR A;  1RQV A;  3VMZ A;  2G3A A;  5GTH E;  2OYI B;  2FKW B;  2XZR A;  5KKZ B;  4BRY B;  3CWB G;  2N9Y B;  3IAO A;  3RL0 C;  1LWU B;  1S2E A;  1FZC B;  3KPE A;  2KLV A;  1NTK G;  1SQB G;  2O01 H;  2QJY B;  4L75 A;  3WUU A;  5GTI E;  1BGY E;  2J58 A;  4PJ0 E;  1JY2 N;  2FYU K;  1SS1 A;  2Q3E A;  3GMA A;  4L76 A;  3RK2 D;  3A2A A;  1FAV A;  1S4X A;  2A06 D;  1KIL C;  1URQ A;  1QL2 A;  3FWN A;  3T97 B;  1G1J A;  1NVO A;  2FYU J;  2ZT9 B;  1IK9 A;  1PP9 D;  5CCG A;  2FFD B;  2QG4 A;  1FZE A;  3L74 G;  1S5L H;  1KTM A;  4GOE A;  1LTT C;  2FFD C;  2QJK C;  1KB9 H;  1VQ9 P;  3KYQ A;  1NTZ K;  2OTK E;  2FXM A;  2NZ2 A;  3V2N A;  1UII A;  1EDL A;  5KJ7 D;  1OIP A;  2WQY C;  2GUS A;  5B5E E;  1VF5 B;  2KK7 A;  1ZR4 A;  3EFG A;  3IF4 A;  5KLV E;  2YXR B;  3L4F A;  3K5B A;  2KS1 A;  2N9B A;  1BE3 G;  3PHL A;  2E43 A;  3L73 G;  1Q82 Q;  4D6T E;  3MTU E;  2D2C D;  2FXO A;  2C0X A;  3MGN A;  1HJ0 A;  2IZ1 A;  5GTH H;  3P8C E;  1AFO A;  1GMJ A;  2P2U A;  2ZFC A;  1MFT A;  2E76 C;  3TNU A;  1HGV A;  1SQV K;  2XDJ A;  2ZYD A;  3L71 D;  4D6T G;  1T2K D;  3CD6 P;  3II6 A;  3TF5 A;  1N86 A;  2YXQ B;  1FJK A;  5KLV G;  1EZV I;  1NGM B;  1GL2 C;  1NU1 J;  3CCM P;  4RO0 A;  2RH0 A;  2H7H A;  5K5G B;  1QVF O;  3AED C;  3B5N C;  2YMK A;  1JY2 O;  4GKG A;  3VMX A;  1X8Y A;  2A45 H;  2NPS A;  3SWK A;  1BGY D;  1HVV A;  2KYV A;  4QMA A;  4Y28 J;  5KJ7 C;  1PZQ A;  1N73 B;  3FGA D;  4H0L B;  4C7R A;  1SFC B;  1G1I A;  2RKL A;  3VOP A;  3KXD A;  3AEF C;  3I55 P;  1A02 J;  1K9M Q;  4PV1 C;  1H0T B;  1AQT A;  3SWF A;  1M57 D;  4D6T J;  1BGY G;  4W80 A;  1YHQ P;  3H1I E;  1LP1 A;  1N73 C;  1SFC A;  1J1E C;  4ZKP A;  1JY3 O;  1T8Z A;  1H8A A;  3HE4 B;  3CWB E;  5AW4 B;  2OQQ A;  2MJZ A;  1L0L K;  3SWY A;  1JUN A;  3LW5 H;  1BCC J;  1S72 P;  1CZQ A;  4H44 D;  3SSU A;  3O6Q A;  1L4A B;  1P84 H;  2Y0D A;  1GL2 D;  1NTM K;  3AE8 C;  2AEM A;  4IL6 E;  5E79 E;  5L8R J;  3L71 G;  4D6T D;  1KD1 Q;  3VTP C;  5APU A;  1BSN A;  3A3Y B;  4IFD K;  3ABV C;  3MHV A;  3O6Q B;  5CCG D;  4BWN A;  1YTZ I;  4JYB A; 
#chains in the Genus database with same CATH homology
 3B5N D;  5CJ0 A;  3TK1 A;  2IFN A;  2XV5 A;  1ZLL A;  1AQ5 A;  2Q7C A;  1KFM A;  3V2R A;  1SFC C;  1G2C A;  3EQ2 A;  3G3Z A;  2PP6 A;  1RY3 A;  1HUC A;  2YKP A;  5APY A;  4I2L C;  4ZKU A;  1ZN5 A;  5APS A;  3B5N A;  1SQX K;  1NKN A;  3L36 A;  2Q3I A;  1T3J A;  2Q5U A;  4LC1 A;  2H43 A;  2H8P D;  4W7Y A;  1KIL A;  1URQ C;  1Z56 A;  3P7K A;  1IJD B;  1S9K E;  4AYC A;  1RE4 A;  3RL0 D;  3TNU B;  1FZA A;  5CJ4 A;  4JF7 A;  1SFC D;  2VRS A;  3OAK A;  3O8Z A;  1LGH B;  2FYZ A;  3B8E B;  1MV8 A;  5CMZ A;  1M7L A;  4Y99 C;  1J1E B;  1JNM A;  1GL2 B;  1L4A D;  5CCH C;  2KSJ A;  2WT7 A;  2XNX A;  4WB4 A;  5AVV B;  2C0W A;  1RF0 A;  1NTK K;  1SQB K;  5AW8 B;  4IFM A;  1YYC A;  1J1D B;  1CW5 A;  2HOD B;  5AW7 B;  1FZB A;  3H6P A;  5CCH A;  2GM4 A;  3R2P A;  5AVU B;  2N1T D;  3V5B A;  4IFF A;  4HH2 A;  1LT9 A;  4Y99 B;  1GTW A;  2ZXE B;  3RK2 C;  1X9V A;  1RE4 C;  1N2D C;  2M3B A;  3V2P A;  1RE3 A;  1VPC A;  3M0A A;  3HD7 C;  2LKM A;  2Q9I A;  4XE5 B;  1URQ D;  3VP9 A;  2WZ7 A;  5APX A;  3I5C A;  4W7Z A;  1JY3 N;  3NXS A;  5AW3 B;  3GHG B;  1MFZ A;  3NTN A;  3OA7 A;  2WIT A;  3M9B A;  2NPS B;  2PAJ A;  1RE3 C;  3M9Q A;  4AUW A;  3RK2 B;  1RF1 C;  2IPP A;  2HG5 D;  2HOD A;  2WSE H;  3N7N A;  3HD7 A;  3KQG A;  4XA4 A;  5AVX B;  5APW A;  2WSF H;  5KTB A;  3HUS C;  3M06 A;  3B5N B;  1XTG B;  1YTZ T;  4B86 A;  1LT9 B;  2YNY A;  5AVY B;  3MD0 A;  2BAS A;  1SVF A;  1FZC C;  1E5W A;  2R5B A;  4O9B A;  3HUS A;  2WSC H;  2CPS A;  3UIA A;  2KB7 P;  1KFN A;  1KIL B;  1RF1 B;  2E42 A;  1IC2 A;  1LTB C;  5AVW B;  3T97 A;  4DZO A;  5KLV K;  3H32 B;  1FOS F;  3V4Q A;  2R3C A;  3WMM 0;  1N7S A;  2OYI C;  1NH4 A;  3CI9 A;  3IFM A;  3LIE A;  1SQP K;  1WRG A;  1JTH A;  3E1I A;  3U1C A;  1NU1 K;  1EQ7 A;  2Z5H A;  2WTY A;  2FFD C;  4N78 D;  1HBW A;  1N7S B;  2P67 A;  5APT A;  2NPS D;  2HPC B;  1M1J B;  1L0N K;  4C7N A;  5KJ7 A;  4OH8 B;  1IFI A;  3VP8 A;  1M1J A;  5AW0 B;  1T3U A;  2XKM A;  1NKZ B;  1X79 B;  3LID A;  1IFD A;  3RK3 C;  2FFD A;  3NMD A;  1NHL A;  2WWW A;  2N1T B;  1GW3 A;  1NOH A;  1DX7 A;  1FZC A;  1GK4 A;  2N1T A;  1LWU C;  1G2C B;  2WPR A;  5BU5 A;  5CCH D;  5AW1 B;  1L4A C;  1M1J C;  1SQQ K;  3VN0 A;  2YMY A;  3VMY A;  1JOC A;  3BVH A;  2O1K A;  3M0D A;  1LTI C;  4M3L A;  1NWQ A;  1SLQ A;  5CHX A;  2KOG A;  5AVZ B;  2YO2 A;  1HWT C;  2WT7 B;  1FZG A;  5AVS B;  4WBA A;  3RK3 D;  1LWU A;  1L4A A;  1JTH B;  1J2J B;  1DEB A;  1FDM A;  3NFQ A;  1HH0 A;  2YKQ A;  3RL0 B;  3A5T A;  1H88 A;  3TSI A;  2P7J A;  2I1J A;  1GU5 A;  2O1J A;  1S9K D;  1HJB A;  1N7L A;  5BVZ A;  4N78 E;  1VDF A;  1LTS C;  3P8C D;  4WY4 D;  3M9H A;  1J1D C;  3M91 A;  2YO3 A;  2WPS A;  5AVR B;  1RF1 A;  3BRT B;  1LTJ B;  1W2E A;  3BRV B;  1NAF A;  3MIW A;  4WY4 A;  1JCD A;  1T2K C;  4GT1 A;  2GUV A;  2CPB A;  2YKO A;  1ZR2 A;  3P8M C;  1FZF A;  3CL3 D;  1FU1 A;  1RF0 C;  3U59 A;  1KIL D;  3MUD A;  4EIJ A;  3A7O A;  3HRN A;  4LLH A;  4RES B;  4AQR D;  1WT6 A;  1JMM A;  3BAT A;  3V4W A;  1FOS E;  1GL2 A;  2HPC A;  1HGZ A;  1OXZ A;  1URQ B;  4JYC A;  1LTJ C;  4WY4 B;  2R5D A;  3IR9 A;  3L35 A;  2JEE A;  2A45 G;  1LT9 C;  1HTL C;  4I6M C;  3GHG A;  1IO4 A;  2OYI A;  4DOJ A;  3HE5 A;  3U1A A;  3OJA B;  1A02 F;  2HLO A;  3TYY A;  2J59 M;  3CLQ A;  1CI6 A;  2P1J A;  1GZL A;  5AW9 B;  2QM7 A;  1OWA A;  4C7N B;  2KP8 A;  3M0D C;  1FJP A;  4EOT A;  4C46 A;  1IFN A;  1GU4 A;  2OYH B;  4N6J A;  1KQL A;  2IX7 C;  4WY4 C;  3L37 A;  2QM8 A;  2OYH A;  1XTC C;  2POH A;  4HYT B;  1PFI A;  5AVT B;  2M8R A;  1CI6 B;  1N7S C;  2W27 A;  2Z5I A;  2L5G B;  1LTA C;  1JCC A;  1ZV8 A;  2W6B A;  1GW4 A;  3PP5 A;  1GK6 A;  2R32 A;  1JY2 P;  1MUU A;  3GHG C;  1CSB A;  1KZU B;  2OYH C;  2WPQ A;  3C9I A;  2C9N Y;  3KDP B;  3VYI A;  2I1K A;  1DH3 A;  4I1L A;  1NO4 A;  5AW5 B;  3P32 A;  1N7S D;  2OAR A;  3BAS A;  2NPS C;  1JO5 A;  2HYN A;  2HFE D;  3HD7 D;  3H32 A;  1JY3 P;  3HD7 B;  5CCG C;  3HE4 A;  1GDT A;  3HTK B;  1GD2 E;  2N1T C;  1LTG C;  3HE5 B;  1IFJ A;  5APV A;  3N4X A;  3HUS B;  5BU8 B;  1MZ9 A;  1LTJ A;  5AVQ B;  2JJL A;  1QL1 A;  1N73 A;  1IFM A;  5APQ A;  4N3Y B;  5AW2 B;  2XU6 A;  4KHX A;  3HTK A;  5AW6 B;  2IFM A;  2Z4E A;  1H89 A;  2A45 I;  1FBM A;  4LGD E;  1SP4 A;  3V2Q A;  2C9L Y;  3RK3 B;  2W6A A;  4GIF A;  3VMZ A;  2OYI B;  2FKW B;  2XZR A;  3RL0 C;  1LWU B;  1FZC B;  3KPE A;  2KLV A;  2O01 H;  2J58 A;  1JY2 N;  2FYU K;  3RK2 D;  3A2A A;  1FAV A;  1KIL C;  1URQ A;  1QL2 A;  1G1J A;  5CCG A;  1IK9 A;  2FFD B;  1FZE A;  1LTT C;  3KYQ A;  1NTZ K;  2FXM A;  3V2N A;  5KJ7 D;  2GUS A;  1ZR4 A;  3EFG A;  3L4F A;  2E43 A;  2N9B A;  3MTU E;  3MGN A;  2C0X A;  1AFO A;  3P8C E;  2P2U A;  2ZFC A;  3TNU A;  1HGV A;  1SQV K;  2XDJ A;  1T2K D;  3II6 A;  1N86 A;  1FJK A;  1GL2 C;  2H7H A;  3B5N C;  4GKG A;  1JY2 O;  3VMX A;  1X8Y A;  2A45 H;  2NPS A;  1HVV A;  2KYV A;  5KJ7 C;  1N73 B;  4C7R A;  1SFC B;  1G1I A;  3VOP A;  1A02 J;  3SWF A;  4W80 A;  1N73 C;  1SFC A;  1J1E C;  4ZKP A;  1JY3 O;  1T8Z A;  1H8A A;  3HE4 B;  5AW4 B;  2MJZ A;  1L0L K;  3SWY A;  1JUN A;  3LW5 H;  1CZQ A;  1L4A B;  1GL2 D;  1NTM K;  3VTP C;  5APU A;  4IFD K;  3A3Y B;  5CCG D;  1YTZ I;  4JYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...