2N1TB

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
72
structure length
72
Chain Sequence
b'SKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 31
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tB00
3VOPA 1JTHA 5CCGD 2N1TD 4WY4B 2PP6A 3B5NB 4WY4A 1L4AD 1KILD 1GL2A 1URQC 2HFED 2KOGA 1L4AB 3RK2B 5KJ7A 4WY4D 1GL2D 3B5NC 3RK3B 5CCHA 4OH8B 1NHLA 5CCGC 1T3JA 1GL2B 2N1TC 4LGDE 5KJ7D 1HVVA 3RK2D 1N7SA 3M0DC 3PP5A 1L4AC 3RK2C 1KILC 2NPSB 5CCHD 1SFCB 3P8CE 3RK3D 2NPSA 2WZ7A 1SFCA 4W80A 1XTGB 3RL0B 4W7YA 4WY4C 1GL2C 3HD7B 3HD7A 2NPSD 3KYQA 1SFCD 1N7SB 2YMYA 3RL0D 5KJ7C 2XDJA 1URQA 5CCHC 3HD7D 3RK3C 2M8RA 1N7SD 2H8PD 2HG5D 1N7SC 4N78E 3TSIA 1URQD 3B5NA 3HTKB 2NPSC 5CCGA 1SFCC 2N1TB 4W7ZA 2N1TA 3RL0C 1URQB 1KILB 1L4AA 4JF7A 1KILA 3B5ND 1JTHB 3HD7C
chains in the Genus database with same CATH superfamily
1WRGA 3H1IG 3KHUA 1LTIC 3NTNA 5KAIE 5AW6B 2QM7A 2OQQA 3L73D 1OX3A 1VQ9P 2KOGA 1OVVA 1SQVJ 1VQ6P 1Z56A 1YJNP 3RK2B 2XU6A 1T8ZA 1KB9E 1NTKE 4OH8B 4ZMDA 3MTUE 3CC4P 1BE3D 1JMMA 3TNUA 2IZ0A 1S5LH 3SWKA 5AVVB 2OYHB 1M57D 5KLVK 5KTBA 3C1LA 2R44A 2GA1A 1FDOA 4EDFA 2YXQB 4TT3H 3I55P 5AW5B 1MV8A 3BRVB 2QJPB 1XTCC 3CXHE 3L73G 1H89A 2HODB 4QMAA 2AEMA 2O01J 5APVA 1H8AA 1HBWA 2YKPA 4U7JA 1SQPD 1BE3G 1DEBA 1EZVE 2KS1A 3JC22 2UWJE 4AUWA 3AEFC 1IK9A 3OA7A 3CX5I 1TU3F 3IF4A 1QL1A 4RO0A 5AVQB 1EQ7A 3MUDC 1RQVA 1SQQE 1L4AA 3CC2P 1KILA 1IC2A 5L8RJ 1SQPG 1QLED 1OW7A 1G1IA 3SWFA 3A0HH 3HE4A 1LWUB 1VQNP 1L4AD 1NKZB 1KILD 1GL2A 1NAYA 3L71D 1FZGA 2ZAEB 1JO5A 1N86A 3L74J 2KZIA 1PP9J 4Z1MH 5AVXB 2HYNA 1KMIZ 1AJYA 1PFIA 1GL2D 1K04A 2PGDA 1Q7YQ 3BCCJ 5AW1B 1R8EA 1EDLA 5KAFE 3GHGA 3RK2C 3W67A 3KDPB 3VMAA 2YIUB 1AFOA 3L71G 1YTZT 1KQFB 1IFPA 1NTMD 2OYHC 3AEEC 1X22A 3KYQA 4OGQC 2Y9YA 2QVAA 4DT0A 2XNXA 3H1IJ 2QJPC 2ZVOB 2A45I 3H6PA 5AVWB 2ZYAA 3NMDA 1FOSF 2WT7B 3VP8A 2Y0EA 4L75A 5APSA 3AEAC 3WUTA 1M8OB 2WSEJ 3VP9A 3HTKA 1GK4A 2M5AA 2KSJA 3GF3A 3II6A 2IBZD 1EDIA 1A02F 1EXIA 3O6QA 2M0BA 1IFDA 1UIXA 1GMJA 1VQ4P 5M1BA 2XV5A 4U3FJ 1LWUC 2OYIC 1SVFA 2IBZG 1HJBA 1T3JA 3Q5PA 2QG4A 2I8DA 3WUVA 2V7QJ 4B86A 1YBKA 4IFFA 3H1HD 2Y9ZA 2C0WA 3T97B 1ZXGA 3MUDA 4IFMA 2GM4A 5TISE 1SQPK 3TGUE 2KLUA 2FY8A 1E5WA 1AVOA 2FYNB 1WMKA 3PLNA 1X0TA 1HF9A 2CPBA 3BRTB 2YIUC 1Y47A 2FBWC 3VMZA 5DJTB 2JO1A 3H1HG 3GMAA 4M3LA 3M9BA 4C7NB 1M7LA 3V6IA 4LLHA 2J58A 1HJ0A 2KK7A 3CCRP 1SFCC 2P1JA 1NO4A 1PGQA 2P58A 1URQB 2LKMA 3A0BH 2FXPA 2P67A 3H25A 3AE2C 4PV1D 2M3EA 1ZP0C 4H0LD 4UB8E 2BEQD 3L73E 1PGOA 2OYHA 1OIPA 3CCVP 3KQGA 3A3YB 1L2PA 1IZNB 1OVRA 3RK3B 4RJTA 1BE3E 4EIJA 3E7KA 1NHLA 2N9YB 1BCCG 4OGQD 3C8VA 1HVVA 2IYPA 3ABVC 1NYHA 1SQVD 4PD4H 1LNQA 1NTMJ 1OZHA 2Z5IA 4TLFA 1LT1A 1N73C 4DJGA 1SQPE 2GUVA 1JY3O 1FZCB 1P84H 4DZOA 1HH0A 3V2RA 3D71A 1VQ7P 1DEEG 1N7SD 2HG5D 2O1JA 4I7ZC 1SQVG 5APWA 1LWUA 2OYIA 4L74A 3CX5D 1IFMA 5B5EE 2MKVA 1S4XA 3UIAA 1NTZK 1KQGB 1KILE 3AE1C 3L71E 1LJ2A 3VMXA 1URQC 4GOFA 3H1LD 1OMIA 2QM8A 4JBZA 1J1DC 2ZXXA 2IBZI 3P7KA 5DJUB 2PFXA 3WMM0 2B89A 1FDMA 1VQMP 3H1JD 1D7MA 1FS0E 1SQXJ 2I1KA 4C7RA 3H1HJ 1SQBD 2WSSH 4H44B 1PPJD 3L70E 5AW8B 1SFCA 3CWBD 3L74D 1PP9D 3H1LG 2W83C 1BGYJ 1KFNA 3L37A 2WT7A 2JR8A 2DW3A 1S3JA 3BCCD 1ZR2A 1SFCD 3B8EB 2YO2A 1A02J 1LTBC 1Q2NA 2AEFA 3H1JG 3S9OA 1SQBG 3CMEP 2M8RA 3JSVC 3SSUA 2C9NY 1PPJG 1VQKP 3CWBG 3L74G 1FJKA 1PP9G 4YXWH 2J59M 2KP8A 3Q1MA 3FWNA 3VTPC 1IFNA 1FZCC 3B71A 1GW3A 3CCLP 3BCCG 4K3AA 1M1JB 3RL0C 1S72P 4WB4A 2SPZA 3KPEA 3VMYA 1JTHA 1YTZI 3A5TA 3AE4C 4NPDA 2G8YA 1NU1D 2IDBA 1DIPA 2A45G 1NTZE 3USSA 4C46A 2E76B 1N73A 1GDTA 3AE8C 1SP4A 2K9JA 1VPCA 1N2DC 2FYUJ 4H13B 3T97A 4ASWA 1KORA 2BCCE 1Y9BA 2W27A 1SQVK 4PD4D 2H88C 1LP1B 3PP5A 2Q3IA 1SS1A 1LGHB 1NU1G 3HE5B 1JUNA 1LTJB 3M9QA 2HPCB 4U3FD 1DX7A 1VF5C 4Y28J 4C7NA 5BVZA 4JQ0D 3BATA 1YITP 1U7JA 3L75D 1RF1B 4HKZH 1OW8A 1URQA 1PGPA 3IR9A 5H2FE 1YI2P 1KTMA 4UB6E 1LT9B 5APXA 1ZV8A 3A7OA 5GTHE 1URQD 4U3FG 2QSIA 2AXCA 3CMAP 1BCCE 3MGNA 5E79E 3CCJP 3D6ZA 3L75G 2YXRB 1NJIQ 3HD7C 4RKUJ 1AV1A 5KAIH 4L76A 3H1LJ 1M1JC 3I5CA 3L35A 3CCUP 4YTPC 2KI7B 1R5SA 1KB9H 3S1KA 4PJ0E 4A7PA 1HGVA 3H1JJ 1RY3A 3PRJA 2ZJSE 3HUSB 1SQBJ 1FJPA 4H13C 4R4LA 3CXHH 1SQVE 2YKQA 3CWBJ 1FZCA 4W7YA 4JYBA 3O8ZA 3G9RA 2L91A 5CBNA 3QWOC 1JMBA 2WQYC 4N6JA 2YMYA 3RL0D 4Y99B 3VYIA 3N7NA 2MJZA 1DD4A 1ZRTE 3AEDC 1N7LA 1JY3N 2Q1KA 3CX5E 5APYA 2N1TB 3IFMA 3BVHA 2HLOA 3SFDC 1LT9C 3W68A 2W6AA 5B66E 1GTWA 1NU1J 4WY4B 1GU5A 2LR2A 2H89C 2OTJP 1ZOYC 2P10A 1OFCX 1FZBA 4D6TJ 1NTMG 1K73Q 2R3SA 2D2CB 2PRRA 1VF5D 1BSHA 3H1JE 2WPSA 5KAFH 5AVYB 3HRNA 4GIFA 5KKZB 1ZR4A 2P2UA 1K05A 3AECC 1SLQA 1PPJE 4GDOA 5AW4B 2C0XA 2NPSB 1M56D 2KYVA 3L74E 1PP9E 1FAVA 2E75B 4DOJA 3CCMP 1KQSO 4BRYB 3BCCE 2QEXP 1AQTA 4PD4I 3HD7A 3KZIH 1VQLP 4R4MA 3L75J 1SQXD 2RH0A 3P32A 1M1JA 1QVGO 5AW7B 3D6YA 3HD7D 2WPVB 4KHXA 4RESB 1H0TA 1PZQA 2B87B 1MFTA 2K88A 3A0BE 1P84I 2W6BA 3CLQA 1BGYD 2ZFCA 4BWNA 1LTAC 1NGMB 1HUCA 4N78D 1MZ9A 2C9LY 4IL6E 3K5BA 5APTA 3H1IE 1JY2P 1JOCA 4JF7A 1KZUB 1SQXG 2Q7CA 3RBZA 1OVUA 3AE5C 3GF7A 1FC2C 1KYOI 1NTKD 3PTZA 2PP6A 1JY2O 4WWIA 4H13D 2KUBA 3MHVA 1BGYG 1E79H 5GTIE 1RQUA 3WUUA 3LIEA 1L0NJ 3E1IA 4HJGH 1UIIA 2K9YA 5CCGC 4K35A 2KZJA 2Q3EA 3LW5H 2N9BA 3RK2D 2E5TA 5TISH 1NTKG 2QRXA 1USDA 4U3FE 2QJYB 1XTGB 5KKZC 2FYUD 2K1AA 3L72J 2FFDB 1X79B 4ZNCA 1LT9A 4KJMA 2HODA 1YJ9P 1IFJA 2R3CA 1NTMK 2JEEA 1W2BO 1HTLC 1KQLA 2QE7H 2JWAA 5BU8B 1SQQD 2KS1B 2WPRA 2OGUA 2O3JA 2E5YA 2FYUG 3H1KJ 2IFMA 2OTLP 3M0AA 1X8YA 1VQPP 3CC7P 1L0LJ 4JYCA 4HYTB 1KILB 4UB8H 3G6EP 1YHQP 2FYNC 1SQQG 4XE5B 5AVTB 4GKGA 2ZYDA 3JCUE 1N8RQ 1EC5A 1AQ5A 2LXBA 5CJ0A 4DCKA 3U59A 1KYOH 3V4WA 5KLVD 3GG2A 3KXDA 3FWLA 4LGDE 2M3BA 4YXDC 3GHGB 3M0DC 2FXMA 1R5LA 2AXTE 1SQXK 3P8CD 3FXDA 1PGJA 4OVNF 1FE6A 2E74B 3TYYA 1FDIA 5AW9B 2WWWA 5KLVG 3CI9A 3CCSP 4CPGA 2QJYC 5AVSB 5APQA 1S1CX 2FFDC 1PV3A 3RK3C 3RGUA 2B9BA 3EFFK 3WU2H 2IPPA 2YO3A 1NTME 4GT1A 1JEKA 1RE4C 3N4XA 2J5UA 4LC1A 5B5EH 3HTKB 2M5AB 5CCGA 2H43A 1KV4A 4YPCA 3SFEC 1J2JB 3LIDA 5CCGD 1YJWP 1NTKJ 4AYCA 3B5NB 4NPFX 2K3RA 2Q9IA 2YNYA 3CPWO 2IBZE 1RHZB 5CBOA 1Q82Q 1IFIA 1KB9I 4BRYA 3AE6C 4WVZA 2XKMA 3PHLA 2FYUK 3H32B 4JPZB 1GW4A 2ZXEB 3V2QA 2GUSA 1S5LE 4D6TD 1Q86Q 3A2AA 2NZ2A 3CXHI 1T3UA 2B87A 2WSFH 1S9KD 1SQXE 2AEJA 3H1HE 3CL3D 1FOSE 1ZLLA 1BDCA 1EZVI 1SQQJ 1NH4A 2LXCB 3NXSA 2Z5HA 1BGYE 4D6TG 1W5CE 1DH3A 2E74C 5CHXA 4ASVA 1M1KQ 4N78E 1P84D 3GLMA 3ITKA 2Q5UA 2IX7C 2NRGA 4H44C 4PV1B 4L73A 1VQ5P 2JP3A 3AE7C 4H0LB 4I2LC 5AW0B 3M0DA 2XZRA 3G4SP 5AVZB 3AEGC 2RMZA 5TJHA 1NAFA 1KYOD 4GODA 1QEXA 3F5HA 4OGQB 1VDFA 3A0HE 1YYCA 3AE9C 2PAJA 3P8MC 3V4QA 5KLVJ 3B5NC 4GOEA 1JY2N 2FFDA 1DD3A 1CSBA 2WSCH 2IFNA 3PH0A 3CD6P 1RE4A 2A06D 3FX0A 3RK3D 3B4SA 2FYUE 2W6JH 1WT6A 1SQBK 3TF5A 1L0ND 3AE3C 2QIWA 2E76C 1N7SB 3R2PA 1LTGC 1ZN5A 5H2FH 2JKVA 4UB6H 2WITA 2H7HA 5CCHC 5GTHH 1OXZA 2A06G 1T6AA 3L72D 1BSNA 5E79H 2OYIB 1JNMA 4NPEA 3TK1A 3EFGA 1L0NG 3Q5SA 1QVFO 4ZKPA 1LTJC 1U57A 3S4RA 4IFDK 5C39A 3U1AA 1FZAA 3EQ2A 2KB7P 2L5GB 3Q2YA 4PV1C 1RF1C 4HH2A 2I1JA 1Q90D 4H0LC 3H1KD 3L72G 2HFED 3RL0g 3M91A 4PJ0H 1CW5A 1AVYA 1EDKA 1NU1K 1L0LD 3Q5RA 3LW5J 4IL6X 3L70D 2W8ZA 5AVRB 5KLVE 3M9HA 3QH9A 3TGUJ 1JM0A 1OWAA 2O1KA 3V2PA 1T2KC 3H1LE 1IK7A 3KZIE 1MKMA 1CI6B 1SFCB 3P8CE 1H88A 1KC8Q 3MD0A 3H1KG 2E74D 5AW3B 2CPSA 3ZDMA 1L0LG 3GW6A 2O01N 3L70G 2HR3A 4H44D 2KNCB 2ZT9B 1SQBE 2Y0CA 1LTSC 4BXLA 3I56P 3V2NA 2G3AA 3CWBE 2ZVNB 1X9VA 2O01H 3C9IA 3CX5H 2JWDA 1QX8A 1N7SC 3HUSC 3B5NA 3OAKA 1MFZA 3L73J 1NTZD 1YIJP 5AVUB 4ZKUA 5B66H 2VRSA 1YQ4C 2WMMA 3B5ND 3FXEA 1JTHB 1BE3J 2BCCD 3TDKA 1NVOA 3L36A 3CCQP 2FYZA 3H32A 4Y99C 2IZ1A 1N73B 4HB1A 2RN0A 2K9JB 1G2CB 2IYOA 3U1CA 1K9MQ 1NTZG 2KIKA 5CCHA 2QA4P 2YMKA 1NU1E 2E76D 1KB9D 4N3YB 1JCCA 2JJLA 4I7ZB 2N1TC 1L0NK 1SQPJ 1ZMEC 1LP1A 2BCCG 4D6TE 1NWQA 5CCHD 1KD1Q 1FZFA 1J1EB 1NKNA 4W80A 3RBXA 1USEA 1QGKB 2R5DA 3HE5A 3E1RA 1S9KE 1LTJA 4WY4C 2HPCA 1W2EA 3CXHD 3TNUB 2Z4EA 4PD4E 1FZEA 3F89A 2A45H 2YKOA 1M90Q 5KJ7C 1RF0C 2XDJA 1RF1A 2D2CC 3G71P 1BCCD 1J1DB 1JCDA 1EZVD 2V4HA 1G1JA 2ZYGA 4IL6H 1P84E 2ZT9C 1Y8AA 2E43A 5APUA 2R5BA 1RE3C 3L71J 3L75E 5KLIB 2B88A 2NPSC 5CJ4A 4KT0J 2E75C 1GK6A 1YQ3C 1KN7A 1KFMA 2WSEH 2ITAA 2Y0DA 1NOHA 3VOPA 3MZWB 1LTTC 1L0LK 1KYOE 1T2KD 2KLVA 1EZVG 1RH5B 5GTIH 1S2EA 5BU5A 2R32A 1L4AB 2WVRA 3L70J 2P7JA 2WTYA 3NFQA 1JY3P 3CCEP 3HE4B 3G3ZA 1GL2B 2A06E 3SWYA 1N7SA 3HUSA 2WSFJ 3RK3E 3EWKA 2XNDH 2QJKB 5AW2B 2WZ7A 3D70A 3RL0B 1AA0A 1L0NE 1QL2A 2V7QH 1Q81Q 1ZRTD 1EXJA 3WU2E 1HGZA 1PL5A 4IOIH 1J1EC 4MN4C 2OTKE 2W90A 1K8AQ 5EFWB 3VN0A 1VL2A 1PIXA 2Q6QA 3L72E 1S5LX 2H8PD 1BDDA 3TSIA 1EDJA 3IAOA 4OWFA 1NTZJ 1FU1A 1VQOP 1JB0J 2N1TA 1VQ8P 3OJAB 1CZQA 2OARA 2BCCJ 1GU4A 3OW2O 2N1TD 3JCUH 5KLIC 1VF5B 4WY4A 3H1KE 2FXOA 4EOTA 2WSCJ 1L0LE 1NTKK 4O9BA 2BEZF 1CI6A 5KJ7A 1U7MA 4WY4D 1RF0A 2KSEA 2K37A 3O6QB 3FGAD 3PJSK 3BASA 2AXTH 2KXPB 5KJ7D 2KNCA 2POHA 2WPQA 1L4AC 2D2CD 1KILC 2CK3H 4EI2A 4XA4A 1RE3A 1ZW0A 2NPSA 4I1LA 3MP7B 2ZT9D 1GL2C 3HD7B 2FKWB 3TGUD 1GZLA 2NPSD 1OW6A 3MIWA 4AQRD 2QJKC 2E75D 1BCCJ 2RKLA 5K5GB 1HWTC 3H1ID 3L4FA 4WBAA 1H0TB 1GD2E 4I6MC 5CMZA 4XFJA 3R4YA 3GHGC 1SQQK 1IJDB 1IO4A 2E42A 3Q3DA 4W7ZA 2JDIH 3TGUG 3AEBC 3V5BA 2BASA 1MUUA 1FBMA 3IN6A 1G2CA 4EYYQ 2OYOA 3M06A
chains in the Genus database with same CATH topology
1FZAA 1WRGA 3EQ2A 2KB7P 2L5GB 2PP6A 1LTIC 4HH2A 1RF1C 1JY2O 2I1JA 3VMXA 3NTNA 1URQC 2QM8A 2HFED 5AW6B 2QM7A 3M91A 1J1DC 1CW5A 3P7KA 1NU1K 2KOGA 1Z56A 3RK2B 2XU6A 1T8ZA 5AVRB 3LIEA 3M9HA 3WMM0 3E1IA 1FDMA 4OH8B 3MTUE 5CCGC 1JMMA 3TNUA 1OWAA 2O1KA 3V2PA 1T2KC 5AVVB 2OYHB 3LW5H 2N9BA 3RK2D 2I1KA 4C7RA 5KLVK 5KTBA 1CI6B 1SFCB 3P8CE 1H88A 5AW8B 1SFCA 5AW5B 1MV8A 1XTGB 3MD0A 3BRVB 1XTCC 5AW3B 2CPSA 1H89A 2FFDB 1KFNA 3L37A 2WT7A 1X79B 1LT9A 2HODB 1ZR2A 2HODA 5APVA 1IFJA 1SFCD 2R3CA 1H8AA 3B8EB 1HBWA 2YO2A 2YKPA 1LTSC 1A02J 1LTBC 1NTMK 2JEEA 3V2NA 1DEBA 1HTLC 1KQLA 5BU8B 1X9VA 2M8RA 2O01H 3C9IA 2WPRA 2C9NY 4AUWA 1N7SC 1IK9A 3HUSC 3OA7A 1FJKA 2J59M 3B5NA 3OAKA 1QL1A 2IFMA 1MFZA 2KP8A 5AVQB 3VTPC 1IFNA 1EQ7A 1FZCC 1GW3A 1X8YA 3M0AA 5AVUB 4ZKUA 4JYCA 1M1JB 2VRSA 3RL0C 4HYTB 1KILB 1L4AA 1KILA 4WB4A 1IC2A 3B5ND 3KPEA 1JTHB 3VMYA 1G1IA 1JTHA 1YTZI 3SWFA 3A5TA 3L36A 3HE4A 1LWUB 4XE5B 1L4AD 1NKZB 1KILD 1GL2A 2FYZA 3H32A 2A45G 4Y99C 4GKGA 5AVTB 4C46A 1N73B 1FZGA 1N73A 1GDTA 1JO5A 1AQ5A 1SP4A 1N86A 1N2DC 1VPCA 1G2CB 5CJ0A 5AVXB 3T97A 2HYNA 3U59A 3U1CA 1PFIA 1GL2D 3V4WA 5CCHA 2W27A 5AW1B 3U1AA 1SQVK 4N3YB 1JCCA 2JJLA 2N1TC 2M3BA 4LGDE 3GHGB 1L0NK 3M0DC 2FXMA 3PP5A 3GHGA 2Q3IA 3RK2C 3KDPB 1NWQA 5CCHD 1LGHB 1FZFA 1J1EB 1AFOA 1NKNA 4W80A 1SQXK 3P8CD 3HE5B 1JUNA 1LTJB 3M9QA 1YTZT 2R5DA 2HPCB 3HE5A 1S9KE 1LTJA 4WY4C 2HPCA 1DX7A 1W2EA 4C7NA 5BVZA 3TNUB 2Z4EA 2OYHC 1FZEA 3BATA 3KYQA 3TYYA 5AW9B 2WWWA 3CI9A 2A45H 2YKOA 1RF1B 5KJ7C 1RF0C 2XDJA 2XNXA 1RF1A 5AVSB 5APQA 1URQA 1J1DB 1JCDA 2A45I 2FFDC 3H6PA 5AVWB 3IR9A 3RK3C 3NMDA 2IPPA 2YO3A 1G1JA 1FOSF 2WT7B 3VP8A 4GT1A 5APSA 1LT9B 5APXA 1ZV8A 3A7OA 1RE4C 3N4XA 2E43A 5APUA 2R5BA 1URQD 4LC1A 1RE3C 3HTKB 3VP9A 2NPSC 3HTKA 1GK4A 5CCGA 2H43A 5CJ4A 3MGNA 2KSJA 3II6A 1GK6A 1J2JB 3LIDA 1KFMA 2WSEH 1A02F 3HD7C 1NOHA 3VOPA 5CCGD 1LTTC 1L0LK 4AYCA 1T2KD 1IFDA 2KLVA 3B5NB 1M1JC 2Q9IA 2YNYA 3I5CA 3L35A 5BU5A 2R32A 1L4AB 2XV5A 2P7JA 2WTYA 3NFQA 1JY3P 1IFIA 1LWUC 2OYIC 1HGVA 2XKMA 1SVFA 1HJBA 1T3JA 3HE4B 1RY3A 3G3ZA 2FYUK 1GL2B 3H32B 3HUSB 3SWYA 1N7SA 4B86A 3HUSA 4IFFA 1FJPA 1GW4A 2ZXEB 3V2QA 2GUSA 2YKQA 2C0WA 5AW2B 1FZCA 2WZ7A 3A2AA 3MUDA 4IFMA 3RL0B 2GM4A 4W7YA 4JYBA 3O8ZA 1SQPK 1T3UA 1QL2A 1E5WA 2WSFH 1S9KD 1HGZA 4N6JA 3CL3D 2YMYA 3RL0D 2CPBA 3BRTB 1J1EC 1FOSE 1ZLLA 4Y99B 3VYIA 3N7NA 2MJZA 3VMZA 3VN0A 1NH4A 3NXSA 2Z5HA 4M3LA 3M9BA 2H8PD 4C7NB 1DH3A 1M7LA 5CHXA 4N78E 3TSIA 1N7LA 1JY3N 4LLHA 2Q5UA 2J58A 2IX7C 5APYA 1SFCC 2N1TB 2P1JA 3IFMA 1FU1A 3BVHA 1NO4A 2N1TA 2HLOA 4I2LC 1URQB 5AW0B 3M0DA 2XZRA 2LKMA 3OJAB 1LT9C 5AVZB 1CZQA 2W6AA 2P67A 2OARA 1GU4A 1GTWA 2N1TD 4WY4B 1GU5A 1NAFA 4WY4A 2OYHA 1FZBA 4EOTA 3KQGA 1VDFA 3A3YB 1NTKK 1YYCA 4O9BA 2PAJA 3P8MC 1CI6A 3V4QA 5KJ7A 4WY4D 1RF0A 3B5NC 3RK3B 1JY2N 2WPSA 5AVYB 4EIJA 3HRNA 4GIFA 1ZR4A 2FFDA 1CSBA 1NHLA 2WSCH 2IFNA 2P2UA 3BASA 1SLQA 5KJ7D 1HVVA 2POHA 1RE4A 2WPQA 1L4AC 1KILC 5AW4B 2C0XA 4XA4A 1RE3A 2NPSB 2KYVA 3RK3D 2NPSA 4I1LA 1FAVA 1WT6A 4DOJA 1SQBK 1GL2C 2Z5IA 3HD7B 2FKWB 1GZLA 3HD7A 1N73C 2NPSD 3R2PA 1N7SB 3MIWA 2GUVA 4AQRD 1LTGC 1ZN5A 1JY3O 3P32A 1HWTC 2WITA 1FZCB 2H7HA 1M1JA 5CCHC 3L4FA 5AW7B 3HD7D 1HH0A 4WBAA 4DZOA 1OXZA 3V2RA 4KHXA 4RESB 1GD2E 4I6MC 5CMZA 1N7SD 2HG5D 2W6BA 3CLQA 2O1JA 2ZFCA 1LTAC 3GHGC 5APWA 1SQQK 1HUCA 2OYIB 1IJDB 1JNMA 1LWUA 1MZ9A 4N78D 1IO4A 3TK1A 2OYIA 2C9LY 3EFGA 2E42A 5APTA 4W7ZA 1IFMA 4ZKPA 3V5BA 2BASA 1LTJC 1MUUA 1FBMA 1G2CA 1JY2P 1JOCA 4JF7A 4IFDK 1KZUB 2Q7CA 3UIAA 1NTZK 3M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOP A;  1JTH A;  5CCG D;  2N1T D;  4WY4 B;  2PP6 A;  3B5N B;  4WY4 A;  1L4A D;  1KIL D;  1GL2 A;  1URQ C;  2HFE D;  2KOG A;  1L4A B;  3RK2 B;  5KJ7 A;  4WY4 D;  1GL2 D;  3B5N C;  3RK3 B;  5CCH A;  4OH8 B;  1NHL A;  5CCG C;  1T3J A;  1GL2 B;  2N1T C;  4LGD E;  5KJ7 D;  1HVV A;  3RK2 D;  1N7S A;  3M0D C;  3PP5 A;  1L4A C;  3RK2 C;  1KIL C;  2NPS B;  5CCH D;  1SFC B;  3P8C E;  3RK3 D;  2NPS A;  2WZ7 A;  1SFC A;  4W80 A;  1XTG B;  3RL0 B;  4W7Y A;  4WY4 C;  1GL2 C;  3HD7 B;  3HD7 A;  2NPS D;  3KYQ A;  1SFC D;  1N7S B;  2YMY A;  3RL0 D;  5KJ7 C;  2XDJ A;  1URQ A;  5CCH C;  3HD7 D;  3RK3 C;  2M8R A;  1N7S D;  2H8P D;  2HG5 D;  1N7S C;  4N78 E;  3TSI A;  1URQ D;  3B5N A;  3HTK B;  2NPS C;  5CCG A;  1SFC C;  2N1T B;  4W7Z A;  2N1T A;  3RL0 C;  1URQ B;  1KIL B;  1L4A A;  4JF7 A;  1KIL A;  3B5N D;  1JTH B;  3HD7 C; 
#chains in the Genus database with same CATH topology
 1WRG A;  3H1I G;  3KHU A;  1LTI C;  3NTN A;  5KAI E;  5AW6 B;  2QM7 A;  2OQQ A;  3L73 D;  1OX3 A;  1VQ9 P;  2KOG A;  1OVV A;  1SQV J;  1VQ6 P;  1Z56 A;  1YJN P;  3RK2 B;  2XU6 A;  1T8Z A;  1KB9 E;  1NTK E;  4OH8 B;  4ZMD A;  3MTU E;  3CC4 P;  1BE3 D;  1JMM A;  3TNU A;  2IZ0 A;  1S5L H;  3SWK A;  5AVV B;  2OYH B;  1M57 D;  5KLV K;  5KTB A;  3C1L A;  2R44 A;  2GA1 A;  1FDO A;  4EDF A;  2YXQ B;  4TT3 H;  3I55 P;  5AW5 B;  1MV8 A;  3BRV B;  2QJP B;  1XTC C;  3CXH E;  3L73 G;  1H89 A;  2HOD B;  4QMA A;  2AEM A;  2O01 J;  5APV A;  1H8A A;  1HBW A;  2YKP A;  4U7J A;  1SQP D;  1BE3 G;  1DEB A;  1EZV E;  2KS1 A;  3JC2 2;  2UWJ E;  4AUW A;  3AEF C;  1IK9 A;  3OA7 A;  3CX5 I;  1TU3 F;  3IF4 A;  1QL1 A;  4RO0 A;  5AVQ B;  1EQ7 A;  3MUD C;  1RQV A;  1SQQ E;  1L4A A;  3CC2 P;  1KIL A;  1IC2 A;  5L8R J;  1SQP G;  1QLE D;  1OW7 A;  1G1I A;  3SWF A;  3A0H H;  3HE4 A;  1LWU B;  1VQN P;  1L4A D;  1NKZ B;  1KIL D;  1GL2 A;  1NAY A;  3L71 D;  1FZG A;  2ZAE B;  1JO5 A;  1N86 A;  3L74 J;  2KZI A;  1PP9 J;  4Z1M H;  5AVX B;  2HYN A;  1KMI Z;  1AJY A;  1PFI A;  1GL2 D;  1K04 A;  2PGD A;  1Q7Y Q;  3BCC J;  5AW1 B;  1R8E A;  1EDL A;  5KAF E;  3GHG A;  3RK2 C;  3W67 A;  3KDP B;  3VMA A;  2YIU B;  1AFO A;  3L71 G;  1YTZ T;  1KQF B;  1IFP A;  1NTM D;  2OYH C;  3AEE C;  1X22 A;  3KYQ A;  4OGQ C;  2Y9Y A;  2QVA A;  4DT0 A;  2XNX A;  3H1I J;  2QJP C;  2ZVO B;  2A45 I;  3H6P A;  5AVW B;  2ZYA A;  3NMD A;  1FOS F;  2WT7 B;  3VP8 A;  2Y0E A;  4L75 A;  5APS A;  3AEA C;  3WUT A;  1M8O B;  2WSE J;  3VP9 A;  3HTK A;  1GK4 A;  2M5A A;  2KSJ A;  3GF3 A;  3II6 A;  2IBZ D;  1EDI A;  1A02 F;  1EXI A;  3O6Q A;  2M0B A;  1IFD A;  1UIX A;  1GMJ A;  1VQ4 P;  5M1B A;  2XV5 A;  4U3F J;  1LWU C;  2OYI C;  1SVF A;  2IBZ G;  1HJB A;  1T3J A;  3Q5P A;  2QG4 A;  2I8D A;  3WUV A;  2V7Q J;  4B86 A;  1YBK A;  4IFF A;  3H1H D;  2Y9Z A;  2C0W A;  3T97 B;  1ZXG A;  3MUD A;  4IFM A;  2GM4 A;  5TIS E;  1SQP K;  3TGU E;  2KLU A;  2FY8 A;  1E5W A;  1AVO A;  2FYN B;  1WMK A;  3PLN A;  1X0T A;  1HF9 A;  2CPB A;  3BRT B;  2YIU C;  1Y47 A;  2FBW C;  3VMZ A;  5DJT B;  2JO1 A;  3H1H G;  3GMA A;  4M3L A;  3M9B A;  4C7N B;  1M7L A;  3V6I A;  4LLH A;  2J58 A;  1HJ0 A;  2KK7 A;  3CCR P;  1SFC C;  2P1J A;  1NO4 A;  1PGQ A;  2P58 A;  1URQ B;  2LKM A;  3A0B H;  2FXP A;  2P67 A;  3H25 A;  3AE2 C;  4PV1 D;  2M3E A;  1ZP0 C;  4H0L D;  4UB8 E;  2BEQ D;  3L73 E;  1PGO A;  2OYH A;  1OIP A;  3CCV P;  3KQG A;  3A3Y B;  1L2P A;  1IZN B;  1OVR A;  3RK3 B;  4RJT A;  1BE3 E;  4EIJ A;  3E7K A;  1NHL A;  2N9Y B;  1BCC G;  4OGQ D;  3C8V A;  1HVV A;  2IYP A;  3ABV C;  1NYH A;  1SQV D;  4PD4 H;  1LNQ A;  1NTM J;  1OZH A;  2Z5I A;  4TLF A;  1LT1 A;  1N73 C;  4DJG A;  1SQP E;  2GUV A;  1JY3 O;  1FZC B;  1P84 H;  4DZO A;  1HH0 A;  3V2R A;  3D71 A;  1VQ7 P;  1DEE G;  1N7S D;  2HG5 D;  2O1J A;  4I7Z C;  1SQV G;  5APW A;  1LWU A;  2OYI A;  4L74 A;  3CX5 D;  1IFM A;  5B5E E;  2MKV A;  1S4X A;  3UIA A;  1NTZ K;  1KQG B;  1KIL E;  3AE1 C;  3L71 E;  1LJ2 A;  3VMX A;  1URQ C;  4GOF A;  3H1L D;  1OMI A;  2QM8 A;  4JBZ A;  1J1D C;  2ZXX A;  2IBZ I;  3P7K A;  5DJU B;  2PFX A;  3WMM 0;  2B89 A;  1FDM A;  1VQM P;  3H1J D;  1D7M A;  1FS0 E;  1SQX J;  2I1K A;  4C7R A;  3H1H J;  1SQB D;  2WSS H;  4H44 B;  1PPJ D;  3L70 E;  5AW8 B;  1SFC A;  3CWB D;  3L74 D;  1PP9 D;  3H1L G;  2W83 C;  1BGY J;  1KFN A;  3L37 A;  2WT7 A;  2JR8 A;  2DW3 A;  1S3J A;  3BCC D;  1ZR2 A;  1SFC D;  3B8E B;  2YO2 A;  1A02 J;  1LTB C;  1Q2N A;  2AEF A;  3H1J G;  3S9O A;  1SQB G;  3CME P;  2M8R A;  3JSV C;  3SSU A;  2C9N Y;  1PPJ G;  1VQK P;  3CWB G;  3L74 G;  1FJK A;  1PP9 G;  4YXW H;  2J59 M;  2KP8 A;  3Q1M A;  3FWN A;  3VTP C;  1IFN A;  1FZC C;  3B71 A;  1GW3 A;  3CCL P;  3BCC G;  4K3A A;  1M1J B;  3RL0 C;  1S72 P;  4WB4 A;  2SPZ A;  3KPE A;  3VMY A;  1JTH A;  1YTZ I;  3A5T A;  3AE4 C;  4NPD A;  2G8Y A;  1NU1 D;  2IDB A;  1DIP A;  2A45 G;  1NTZ E;  3USS A;  4C46 A;  2E76 B;  1N73 A;  1GDT A;  3AE8 C;  1SP4 A;  2K9J A;  1VPC A;  1N2D C;  2FYU J;  4H13 B;  3T97 A;  4ASW A;  1KOR A;  2BCC E;  1Y9B A;  2W27 A;  1SQV K;  4PD4 D;  2H88 C;  1LP1 B;  3PP5 A;  2Q3I A;  1SS1 A;  1LGH B;  1NU1 G;  3HE5 B;  1JUN A;  1LTJ B;  3M9Q A;  2HPC B;  4U3F D;  1DX7 A;  1VF5 C;  4Y28 J;  4C7N A;  5BVZ A;  4JQ0 D;  3BAT A;  1YIT P;  1U7J A;  3L75 D;  1RF1 B;  4HKZ H;  1OW8 A;  1URQ A;  1PGP A;  3IR9 A;  5H2F E;  1YI2 P;  1KTM A;  4UB6 E;  1LT9 B;  5APX A;  1ZV8 A;  3A7O A;  5GTH E;  1URQ D;  4U3F G;  2QSI A;  2AXC A;  3CMA P;  1BCC E;  3MGN A;  5E79 E;  3CCJ P;  3D6Z A;  3L75 G;  2YXR B;  1NJI Q;  3HD7 C;  4RKU J;  1AV1 A;  5KAI H;  4L76 A;  3H1L J;  1M1J C;  3I5C A;  3L35 A;  3CCU P;  4YTP C;  2KI7 B;  1R5S A;  1KB9 H;  3S1K A;  4PJ0 E;  4A7P A;  1HGV A;  3H1J J;  1RY3 A;  3PRJ A;  2ZJS E;  3HUS B;  1SQB J;  1FJP A;  4H13 C;  4R4L A;  3CXH H;  1SQV E;  2YKQ A;  3CWB J;  1FZC A;  4W7Y A;  4JYB A;  3O8Z A;  3G9R A;  2L91 A;  5CBN A;  3QWO C;  1JMB A;  2WQY C;  4N6J A;  2YMY A;  3RL0 D;  4Y99 B;  3VYI A;  3N7N A;  2MJZ A;  1DD4 A;  1ZRT E;  3AED C;  1N7L A;  1JY3 N;  2Q1K A;  3CX5 E;  5APY A;  2N1T B;  3IFM A;  3BVH A;  2HLO A;  3SFD C;  1LT9 C;  3W68 A;  2W6A A;  5B66 E;  1GTW A;  1NU1 J;  4WY4 B;  1GU5 A;  2LR2 A;  2H89 C;  2OTJ P;  1ZOY C;  2P10 A;  1OFC X;  1FZB A;  4D6T J;  1NTM G;  1K73 Q;  2R3S A;  2D2C B;  2PRR A;  1VF5 D;  1BSH A;  3H1J E;  2WPS A;  5KAF H;  5AVY B;  3HRN A;  4GIF A;  5KKZ B;  1ZR4 A;  2P2U A;  1K05 A;  3AEC C;  1SLQ A;  1PPJ E;  4GDO A;  5AW4 B;  2C0X A;  2NPS B;  1M56 D;  2KYV A;  3L74 E;  1PP9 E;  1FAV A;  2E75 B;  4DOJ A;  3CCM P;  1KQS O;  4BRY B;  3BCC E;  2QEX P;  1AQT A;  4PD4 I;  3HD7 A;  3KZI H;  1VQL P;  4R4M A;  3L75 J;  1SQX D;  2RH0 A;  3P32 A;  1M1J A;  1QVG O;  5AW7 B;  3D6Y A;  3HD7 D;  2WPV B;  4KHX A;  4RES B;  1H0T A;  1PZQ A;  2B87 B;  1MFT A;  2K88 A;  3A0B E;  1P84 I;  2W6B A;  3CLQ A;  1BGY D;  2ZFC A;  4BWN A;  1LTA C;  1NGM B;  1HUC A;  4N78 D;  1MZ9 A;  2C9L Y;  4IL6 E;  3K5B A;  5APT A;  3H1I E;  1JY2 P;  1JOC A;  4JF7 A;  1KZU B;  1SQX G;  2Q7C A;  3RBZ A;  1OVU A;  3AE5 C;  3GF7 A;  1FC2 C;  1KYO I;  1NTK D;  3PTZ A;  2PP6 A;  1JY2 O;  4WWI A;  4H13 D;  2KUB A;  3MHV A;  1BGY G;  1E79 H;  5GTI E;  1RQU A;  3WUU A;  3LIE A;  1L0N J;  3E1I A;  4HJG H;  1UII A;  2K9Y A;  5CCG C;  4K35 A;  2KZJ A;  2Q3E A;  3LW5 H;  2N9B A;  3RK2 D;  2E5T A;  5TIS H;  1NTK G;  2QRX A;  1USD A;  4U3F E;  2QJY B;  1XTG B;  5KKZ C;  2FYU D;  2K1A A;  3L72 J;  2FFD B;  1X79 B;  4ZNC A;  1LT9 A;  4KJM A;  2HOD A;  1YJ9 P;  1IFJ A;  2R3C A;  1NTM K;  2JEE A;  1W2B O;  1HTL C;  1KQL A;  2QE7 H;  2JWA A;  5BU8 B;  1SQQ D;  2KS1 B;  2WPR A;  2OGU A;  2O3J A;  2E5Y A;  2FYU G;  3H1K J;  2IFM A;  2OTL P;  3M0A A;  1X8Y A;  1VQP P;  3CC7 P;  1L0L J;  4JYC A;  4HYT B;  1KIL B;  4UB8 H;  3G6E P;  1YHQ P;  2FYN C;  1SQQ G;  4XE5 B;  5AVT B;  4GKG A;  2ZYD A;  3JCU E;  1N8R Q;  1EC5 A;  1AQ5 A;  2LXB A;  5CJ0 A;  4DCK A;  3U59 A;  1KYO H;  3V4W A;  5KLV D;  3GG2 A;  3KXD A;  3FWL A;  4LGD E;  2M3B A;  4YXD C;  3GHG B;  3M0D C;  2FXM A;  1R5L A;  2AXT E;  1SQX K;  3P8C D;  3FXD A;  1PGJ A;  4OVN F;  1FE6 A;  2E74 B;  3TYY A;  1FDI A;  5AW9 B;  2WWW A;  5KLV G;  3CI9 A;  3CCS P;  4CPG A;  2QJY C;  5AVS B;  5APQ A;  1S1C X;  2FFD C;  1PV3 A;  3RK3 C;  3RGU A;  2B9B A;  3EFF K;  3WU2 H;  2IPP A;  2YO3 A;  1NTM E;  4GT1 A;  1JEK A;  1RE4 C;  3N4X A;  2J5U A;  4LC1 A;  5B5E H;  3HTK B;  2M5A B;  5CCG A;  2H43 A;  1KV4 A;  4YPC A;  3SFE C;  1J2J B;  3LID A;  5CCG D;  1YJW P;  1NTK J;  4AYC A;  3B5N B;  4NPF X;  2K3R A;  2Q9I A;  2YNY A;  3CPW O;  2IBZ E;  1RHZ B;  5CBO A;  1Q82 Q;  1IFI A;  1KB9 I;  4BRY A;  3AE6 C;  4WVZ A;  2XKM A;  3PHL A;  2FYU K;  3H32 B;  4JPZ B;  1GW4 A;  2ZXE B;  3V2Q A;  2GUS A;  1S5L E;  4D6T D;  1Q86 Q;  3A2A A;  2NZ2 A;  3CXH I;  1T3U A;  2B87 A;  2WSF H;  1S9K D;  1SQX E;  2AEJ A;  3H1H E;  3CL3 D;  1FOS E;  1ZLL A;  1BDC A;  1EZV I;  1SQQ J;  1NH4 A;  2LXC B;  3NXS A;  2Z5H A;  1BGY E;  4D6T G;  1W5C E;  1DH3 A;  2E74 C;  5CHX A;  4ASV A;  1M1K Q;  4N78 E;  1P84 D;  3GLM A;  3ITK A;  2Q5U A;  2IX7 C;  2NRG A;  4H44 C;  4PV1 B;  4L73 A;  1VQ5 P;  2JP3 A;  3AE7 C;  4H0L B;  4I2L C;  5AW0 B;  3M0D A;  2XZR A;  3G4S P;  5AVZ B;  3AEG C;  2RMZ A;  5TJH A;  1NAF A;  1KYO D;  4GOD A;  1QEX A;  3F5H A;  4OGQ B;  1VDF A;  3A0H E;  1YYC A;  3AE9 C;  2PAJ A;  3P8M C;  3V4Q A;  5KLV J;  3B5N C;  4GOE A;  1JY2 N;  2FFD A;  1DD3 A;  1CSB A;  2WSC H;  2IFN A;  3PH0 A;  3CD6 P;  1RE4 A;  2A06 D;  3FX0 A;  3RK3 D;  3B4S A;  2FYU E;  2W6J H;  1WT6 A;  1SQB K;  3TF5 A;  1L0N D;  3AE3 C;  2QIW A;  2E76 C;  1N7S B;  3R2P A;  1LTG C;  1ZN5 A;  5H2F H;  2JKV A;  4UB6 H;  2WIT A;  2H7H A;  5CCH C;  5GTH H;  1OXZ A;  2A06 G;  1T6A A;  3L72 D;  1BSN A;  5E79 H;  2OYI B;  1JNM A;  4NPE A;  3TK1 A;  3EFG A;  1L0N G;  3Q5S A;  1QVF O;  4ZKP A;  1LTJ C;  1U57 A;  3S4R A;  4IFD K;  5C39 A;  3U1A A;  1FZA A;  3EQ2 A;  2KB7 P;  2L5G B;  3Q2Y A;  4PV1 C;  1RF1 C;  4HH2 A;  2I1J A;  1Q90 D;  4H0L C;  3H1K D;  3L72 G;  2HFE D;  3RL0 g;  3M91 A;  4PJ0 H;  1CW5 A;  1AVY A;  1EDK A;  1NU1 K;  1L0L D;  3Q5R A;  3LW5 J;  4IL6 X;  3L70 D;  2W8Z A;  5AVR B;  5KLV E;  3M9H A;  3QH9 A;  3TGU J;  1JM0 A;  1OWA A;  2O1K A;  3V2P A;  1T2K C;  3H1L E;  1IK7 A;  3KZI E;  1MKM A;  1CI6 B;  1SFC B;  3P8C E;  1H88 A;  1KC8 Q;  3MD0 A;  3H1K G;  2E74 D;  5AW3 B;  2CPS A;  3ZDM A;  1L0L G;  3GW6 A;  2O01 N;  3L70 G;  2HR3 A;  4H44 D;  2KNC B;  2ZT9 B;  1SQB E;  2Y0C A;  1LTS C;  4BXL A;  3I56 P;  3V2N A;  2G3A A;  3CWB E;  2ZVN B;  1X9V A;  2O01 H;  3C9I A;  3CX5 H;  2JWD A;  1QX8 A;  1N7S C;  3HUS C;  3B5N A;  3OAK A;  1MFZ A;  3L73 J;  1NTZ D;  1YIJ P;  5AVU B;  4ZKU A;  5B66 H;  2VRS A;  1YQ4 C;  2WMM A;  3B5N D;  3FXE A;  1JTH B;  1BE3 J;  2BCC D;  3TDK A;  1NVO A;  3L36 A;  3CCQ P;  2FYZ A;  3H32 A;  4Y99 C;  2IZ1 A;  1N73 B;  4HB1 A;  2RN0 A;  2K9J B;  1G2C B;  2IYO A;  3U1C A;  1K9M Q;  1NTZ G;  2KIK A;  5CCH A;  2QA4 P;  2YMK A;  1NU1 E;  2E76 D;  1KB9 D;  4N3Y B;  1JCC A;  2JJL A;  4I7Z B;  2N1T C;  1L0N K;  1SQP J;  1ZME C;  1LP1 A;  2BCC G;  4D6T E;  1NWQ A;  5CCH D;  1KD1 Q;  1FZF A;  1J1E B;  1NKN A;  4W80 A;  3RBX A;  1USE A;  1QGK B;  2R5D A;  3HE5 A;  3E1R A;  1S9K E;  1LTJ A;  4WY4 C;  2HPC A;  1W2E A;  3CXH D;  3TNU B;  2Z4E A;  4PD4 E;  1FZE A;  3F89 A;  2A45 H;  2YKO A;  1M90 Q;  5KJ7 C;  1RF0 C;  2XDJ A;  1RF1 A;  2D2C C;  3G71 P;  1BCC D;  1J1D B;  1JCD A;  1EZV D;  2V4H A;  1G1J A;  2ZYG A;  4IL6 H;  1P84 E;  2ZT9 C;  1Y8A A;  2E43 A;  5APU A;  2R5B A;  1RE3 C;  3L71 J;  3L75 E;  5KLI B;  2B88 A;  2NPS C;  5CJ4 A;  4KT0 J;  2E75 C;  1GK6 A;  1YQ3 C;  1KN7 A;  1KFM A;  2WSE H;  2ITA A;  2Y0D A;  1NOH A;  3VOP A;  3MZW B;  1LTT C;  1L0L K;  1KYO E;  1T2K D;  2KLV A;  1EZV G;  1RH5 B;  5GTI H;  1S2E A;  5BU5 A;  2R32 A;  1L4A B;  2WVR A;  3L70 J;  2P7J A;  2WTY A;  3NFQ A;  1JY3 P;  3CCE P;  3HE4 B;  3G3Z A;  1GL2 B;  2A06 E;  3SWY A;  1N7S A;  3HUS A;  2WSF J;  3RK3 E;  3EWK A;  2XND H;  2QJK B;  5AW2 B;  2WZ7 A;  3D70 A;  3RL0 B;  1AA0 A;  1L0N E;  1QL2 A;  2V7Q H;  1Q81 Q;  1ZRT D;  1EXJ A;  3WU2 E;  1HGZ A;  1PL5 A;  4IOI H;  1J1E C;  4MN4 C;  2OTK E;  2W90 A;  1K8A Q;  5EFW B;  3VN0 A;  1VL2 A;  1PIX A;  2Q6Q A;  3L72 E;  1S5L X;  2H8P D;  1BDD A;  3TSI A;  1EDJ A;  3IAO A;  4OWF A;  1NTZ J;  1FU1 A;  1VQO P;  1JB0 J;  2N1T A;  1VQ8 P;  3OJA B;  1CZQ A;  2OAR A;  2BCC J;  1GU4 A;  3OW2 O;  2N1T D;  3JCU H;  5KLI C;  1VF5 B;  4WY4 A;  3H1K E;  2FXO A;  4EOT A;  2WSC J;  1L0L E;  1NTK K;  4O9B A;  2BEZ F;  1CI6 A;  5KJ7 A;  1U7M A;  4WY4 D;  1RF0 A;  2KSE A;  2K37 A;  3O6Q B;  3FGA D;  3PJS K;  3BAS A;  2AXT H;  2KXP B;  5KJ7 D;  2KNC A;  2POH A;  2WPQ A;  1L4A C;  2D2C D;  1KIL C;  2CK3 H;  4EI2 A;  4XA4 A;  1RE3 A;  1ZW0 A;  2NPS A;  4I1L A;  3MP7 B;  2ZT9 D;  1GL2 C;  3HD7 B;  2FKW B;  3TGU D;  1GZL A;  2NPS D;  1OW6 A;  3MIW A;  4AQR D;  2QJK C;  2E75 D;  1BCC J;  2RKL A;  5K5G B;  1HWT C;  3H1I D;  3L4F A;  4WBA A;  1H0T B;  1GD2 E;  4I6M C;  5CMZ A;  4XFJ A;  3R4Y A;  3GHG C;  1SQQ K;  1IJD B;  1IO4 A;  2E42 A;  3Q3D A;  4W7Z A;  2JDI H;  3TGU G;  3AEB C;  3V5B A;  2BAS A;  1MUU A;  1FBM A;  3IN6 A;  1G2C A;  4EYY Q;  2OYO A;  3M06 A; 
#chains in the Genus database with same CATH homology
 1FZA A;  1WRG A;  3EQ2 A;  2KB7 P;  2L5G B;  2PP6 A;  1LTI C;  4HH2 A;  1RF1 C;  1JY2 O;  2I1J A;  3VMX A;  3NTN A;  1URQ C;  2QM8 A;  2HFE D;  5AW6 B;  2QM7 A;  3M91 A;  1J1D C;  1CW5 A;  3P7K A;  1NU1 K;  2KOG A;  1Z56 A;  3RK2 B;  2XU6 A;  1T8Z A;  5AVR B;  3LIE A;  3M9H A;  3WMM 0;  3E1I A;  1FDM A;  4OH8 B;  3MTU E;  5CCG C;  1JMM A;  3TNU A;  1OWA A;  2O1K A;  3V2P A;  1T2K C;  5AVV B;  2OYH B;  3LW5 H;  2N9B A;  3RK2 D;  2I1K A;  4C7R A;  5KLV K;  5KTB A;  1CI6 B;  1SFC B;  3P8C E;  1H88 A;  5AW8 B;  1SFC A;  5AW5 B;  1MV8 A;  1XTG B;  3MD0 A;  3BRV B;  1XTC C;  5AW3 B;  2CPS A;  1H89 A;  2FFD B;  1KFN A;  3L37 A;  2WT7 A;  1X79 B;  1LT9 A;  2HOD B;  1ZR2 A;  2HOD A;  5APV A;  1IFJ A;  1SFC D;  2R3C A;  1H8A A;  3B8E B;  1HBW A;  2YO2 A;  2YKP A;  1LTS C;  1A02 J;  1LTB C;  1NTM K;  2JEE A;  3V2N A;  1DEB A;  1HTL C;  1KQL A;  5BU8 B;  1X9V A;  2M8R A;  2O01 H;  3C9I A;  2WPR A;  2C9N Y;  4AUW A;  1N7S C;  1IK9 A;  3HUS C;  3OA7 A;  1FJK A;  2J59 M;  3B5N A;  3OAK A;  1QL1 A;  2IFM A;  1MFZ A;  2KP8 A;  5AVQ B;  3VTP C;  1IFN A;  1EQ7 A;  1FZC C;  1GW3 A;  1X8Y A;  3M0A A;  5AVU B;  4ZKU A;  4JYC A;  1M1J B;  2VRS A;  3RL0 C;  4HYT B;  1KIL B;  1L4A A;  1KIL A;  4WB4 A;  1IC2 A;  3B5N D;  3KPE A;  1JTH B;  3VMY A;  1G1I A;  1JTH A;  1YTZ I;  3SWF A;  3A5T A;  3L36 A;  3HE4 A;  1LWU B;  4XE5 B;  1L4A D;  1NKZ B;  1KIL D;  1GL2 A;  2FYZ A;  3H32 A;  2A45 G;  4Y99 C;  4GKG A;  5AVT B;  4C46 A;  1N73 B;  1FZG A;  1N73 A;  1GDT A;  1JO5 A;  1AQ5 A;  1SP4 A;  1N86 A;  1N2D C;  1VPC A;  1G2C B;  5CJ0 A;  5AVX B;  3T97 A;  2HYN A;  3U59 A;  3U1C A;  1PFI A;  1GL2 D;  3V4W A;  5CCH A;  2W27 A;  5AW1 B;  3U1A A;  1SQV K;  4N3Y B;  1JCC A;  2JJL A;  2N1T C;  2M3B A;  4LGD E;  3GHG B;  1L0N K;  3M0D C;  2FXM A;  3PP5 A;  3GHG A;  2Q3I A;  3RK2 C;  3KDP B;  1NWQ A;  5CCH D;  1LGH B;  1FZF A;  1J1E B;  1AFO A;  1NKN A;  4W80 A;  1SQX K;  3P8C D;  3HE5 B;  1JUN A;  1LTJ B;  3M9Q A;  1YTZ T;  2R5D A;  2HPC B;  3HE5 A;  1S9K E;  1LTJ A;  4WY4 C;  2HPC A;  1DX7 A;  1W2E A;  4C7N A;  5BVZ A;  3TNU B;  2Z4E A;  2OYH C;  1FZE A;  3BAT A;  3KYQ A;  3TYY A;  5AW9 B;  2WWW A;  3CI9 A;  2A45 H;  2YKO A;  1RF1 B;  5KJ7 C;  1RF0 C;  2XDJ A;  2XNX A;  1RF1 A;  5AVS B;  5APQ A;  1URQ A;  1J1D B;  1JCD A;  2A45 I;  2FFD C;  3H6P A;  5AVW B;  3IR9 A;  3RK3 C;  3NMD A;  2IPP A;  2YO3 A;  1G1J A;  1FOS F;  2WT7 B;  3VP8 A;  4GT1 A;  5APS A;  1LT9 B;  5APX A;  1ZV8 A;  3A7O A;  1RE4 C;  3N4X A;  2E43 A;  5APU A;  2R5B A;  1URQ D;  4LC1 A;  1RE3 C;  3HTK B;  3VP9 A;  2NPS C;  3HTK A;  1GK4 A;  5CCG A;  2H43 A;  5CJ4 A;  3MGN A;  2KSJ A;  3II6 A;  1GK6 A;  1J2J B;  3LID A;  1KFM A;  2WSE H;  1A02 F;  3HD7 C;  1NOH A;  3VOP A;  5CCG D;  1LTT C;  1L0L K;  4AYC A;  1T2K D;  1IFD A;  2KLV A;  3B5N B;  1M1J C;  2Q9I A;  2YNY A;  3I5C A;  3L35 A;  5BU5 A;  2R32 A;  1L4A B;  2XV5 A;  2P7J A;  2WTY A;  3NFQ A;  1JY3 P;  1IFI A;  1LWU C;  2OYI C;  1HGV A;  2XKM A;  1SVF A;  1HJB A;  1T3J A;  3HE4 B;  1RY3 A;  3G3Z A;  2FYU K;  1GL2 B;  3H32 B;  3HUS B;  3SWY A;  1N7S A;  4B86 A;  3HUS A;  4IFF A;  1FJP A;  1GW4 A;  2ZXE B;  3V2Q A;  2GUS A;  2YKQ A;  2C0W A;  5AW2 B;  1FZC A;  2WZ7 A;  3A2A A;  3MUD A;  4IFM A;  3RL0 B;  2GM4 A;  4W7Y A;  4JYB A;  3O8Z A;  1SQP K;  1T3U A;  1QL2 A;  1E5W A;  2WSF H;  1S9K D;  1HGZ A;  4N6J A;  3CL3 D;  2YMY A;  3RL0 D;  2CPB A;  3BRT B;  1J1E C;  1FOS E;  1ZLL A;  4Y99 B;  3VYI A;  3N7N A;  2MJZ A;  3VMZ A;  3VN0 A;  1NH4 A;  3NXS A;  2Z5H A;  4M3L A;  3M9B A;  2H8P D;  4C7N B;  1DH3 A;  1M7L A;  5CHX A;  4N78 E;  3TSI A;  1N7L A;  1JY3 N;  4LLH A;  2Q5U A;  2J58 A;  2IX7 C;  5APY A;  1SFC C;  2N1T B;  2P1J A;  3IFM A;  1FU1 A;  3BVH A;  1NO4 A;  2N1T A;  2HLO A;  4I2L C;  1URQ B;  5AW0 B;  3M0D A;  2XZR A;  2LKM A;  3OJA B;  1LT9 C;  5AVZ B;  1CZQ A;  2W6A A;  2P67 A;  2OAR A;  1GU4 A;  1GTW A;  2N1T D;  4WY4 B;  1GU5 A;  1NAF A;  4WY4 A;  2OYH A;  1FZB A;  4EOT A;  3KQG A;  1VDF A;  3A3Y B;  1NTK K;  1YYC A;  4O9B A;  2PAJ A;  3P8M C;  1CI6 A;  3V4Q A;  5KJ7 A;  4WY4 D;  1RF0 A;  3B5N C;  3RK3 B;  1JY2 N;  2WPS A;  5AVY B;  4EIJ A;  3HRN A;  4GIF A;  1ZR4 A;  2FFD A;  1CSB A;  1NHL A;  2WSC H;  2IFN A;  2P2U A;  3BAS A;  1SLQ A;  5KJ7 D;  1HVV A;  2POH A;  1RE4 A;  2WPQ A;  1L4A C;  1KIL C;  5AW4 B;  2C0X A;  4XA4 A;  1RE3 A;  2NPS B;  2KYV A;  3RK3 D;  2NPS A;  4I1L A;  1FAV A;  1WT6 A;  4DOJ A;  1SQB K;  1GL2 C;  2Z5I A;  3HD7 B;  2FKW B;  1GZL A;  3HD7 A;  1N73 C;  2NPS D;  3R2P A;  1N7S B;  3MIW A;  2GUV A;  4AQR D;  1LTG C;  1ZN5 A;  1JY3 O;  3P32 A;  1HWT C;  2WIT A;  1FZC B;  2H7H A;  1M1J A;  5CCH C;  3L4F A;  5AW7 B;  3HD7 D;  1HH0 A;  4WBA A;  4DZO A;  1OXZ A;  3V2R A;  4KHX A;  4RES B;  1GD2 E;  4I6M C;  5CMZ A;  1N7S D;  2HG5 D;  2W6B A;  3CLQ A;  2O1J A;  2ZFC A;  1LTA C;  3GHG C;  5APW A;  1SQQ K;  1HUC A;  2OYI B;  1IJD B;  1JNM A;  1LWU A;  1MZ9 A;  4N78 D;  1IO4 A;  3TK1 A;  2OYI A;  2C9L Y;  3EFG A;  2E42 A;  5APT A;  4W7Z A;  1IFM A;  4ZKP A;  3V5B A;  2BAS A;  1LTJ C;  1MUU A;  1FBM A;  1G2C A;  1JY2 P;  1JOC A;  4JF7 A;  4IFD K;  1KZU B;  2Q7C A;  3UIA A;  1NTZ K;  3M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...