2N1TB

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
72
structure length
72
Chain Sequence
SKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tB00
1N7SA 2NPSC 1KILD 2H8PD 3B5NC 3HTKB 4W7ZA 5CCGA 1L4AC 1KILB 1HVVA 4WY4A 1XTGB 1JTHB 1N7SC 3RL0C 3HD7A 5CCGC 5CCHD 3P8CE 4WY4C 3RK2C 2KOGA 1L4AA 1URQD 3HD7C 2NPSD 1GL2D 1URQB 4JF7A 3TSIA 2PP6A 2NPSB 2N1TA 1GL2B 3B5NB 2HG5D 4W80A 3RL0D 3RK3D 5CCGD 1N7SB 2N1TC 3RL0B 3RK3B 4WY4D 3RK2D 1SFCA 4WY4B 3RK2B 3PP5A 3B5ND 1L4AD 1SFCC 5KJ7A 1L4AB 3M0DC 1T3JA 4N78E 1N7SD 1URQA 5KJ7C 1GL2A 4W7YA 2XDJA 5CCHC 1NHLA 1KILA 1URQC 3HD7D 1JTHA 2HFED 4LGDE 1GL2C 3HD7B 1SFCD 1KILC 1SFCB 4OH8B 3VOPA 5CCHA 3RK3C 2N1TD 5KJ7D 3KYQA 2N1TB 2NPSA 3B5NA 2M8RA 2WZ7A 2YMYA
chains in the Genus database with same CATH superfamily
1LTAC 2NPSC 3L70E 4LC1A 3A7OA 5KLVJ 1SQQJ 4PV1B 1HVVA 3V5BA 5CCGC 1L4AA 1OMIA 4D6TD 4K35A 4RO0A 4N6JA 1SP4A 1LTBC 3C8VA 3I55P 1SQBJ 4BWNA 1QVFO 4W80A 5GTHH 1J1DC 1ZW0A 4N78D 3LIEA 2RKLA 2FYUG 5K5GB 2FYUK 1P84D 2QSIA 2OYOA 1SLQA 3TF5A 4TLFA 2M3BA 2QJPC 4WBAA 4HH2A 2OTLP 2WPSA 1EZVG 2D2CB 1NHLA 3MP7B 1KQLA 1J1EC 2ZYDA 4PD4E 1QVGO 1NYHA 1Q86Q 2YXRB 1M1JA 1NTZG 3A3YB 4GT1A 1S5LH 5CJ4A 5AW7B 2WPQA 1IFMA 1NTZK 3FWLA 4EDFA 2WZ7A 2YMYA 1IZNB 2KB7P 3MD0A 2B9BA 3B5NC 1XTGB 1N7SC 3D71A 3AE6C 3GG2A 1S9KE 1YBKA 4DT0A 4YPCA 1DEEG 2V7QJ 3H1LG 3ITKA 5KTBA 3AECC 1J2JB 1KYOI 1LGHB 1JMMA 1VQ5P 2OARA 1G2CA 3CCJP 3L72G 1BGYG 4Y28J 5AW4B 1NJIQ 2N1TC 4U3FG 1RHZB 1SQXG 4GOFA 2H43A 2J58A 3TGUE 1Y47A 1YTZT 3WU2E 3M91A 2Q3EA 1M8OB 1VQ6P 2O1KA 3I56P 2FYUD 4IL6H 1HH0A 1VF5D 4W7YA 5CCHC 5AW3B 1KFNA 1KILA 1HGZA 2KSEA 1UIIA 2WSCJ 3D6YA 1S5LX 2XNXA 3CWBE 3D6ZA 1EZVD 3L70G 3CXHI 1L2PA 1QL2A 1FZGA 1LTTC 1FC2C 4AYCA 2N1TB 1CW5A 1IFJA 3CCUP 1MFZA 4H44C 4PV1D 2H8PD 1BDCA 1KQFB 1NTZD 3PH0A 1L0LK 3GHGC 2O3JA 1NWQA 2OTJP 1H88A 4IFMA 2IBZG 1ZR2A 3CXHH 3VTPC 1LJ2A 3VYIA 3Q1MA 1R5SA 4C7NB 1SQVJ 3IR9A 4D6TE 3H1LD 5APSA 1TU3F 3C9IA 2IFMA 3AEDC 1N7LA 2V7QH 2LXBA 2Q9IA 3L72D 3TGUJ 1KYOD 4IL6X 1BGYD 4N78E 1GMJA 2D2CD 4U3FD 1FZEA 2R5BA 5AVYB 2QJYC 1SQXD 2W6BA 1ZRTD 1P84E 4NPFX 2JDIH 3CC4P 1LTSC 2BCCG 1PPJG 2R32A 2OYHA 1L4AC 1RH5B 2WSCH 1YHQP 4WY4A 1EC5A 2QRXA 5AVZB 4ASWA 2GUSA 2FFDA 2C9LY 3RGUA 2KOGA 3CCVP 1KORA 1RE4C 4OWFA 4JF7A 2LKMA 1OVUA 2FYNB 1L0LD 1BSNA 5KAIH 1AQ5A 1PV3A 3G71P 2QM7A 1DIPA 1FBMA 3H1JG 2IPPA 1KFMA 1NTMG 2IBZD 1K05A 1EDIA 1NTMK 4D6TJ 4GKGA 2WT7A 1NTKG 3B5ND 3A2AA 4HKZH 3N7NA 5APYA 3AEAC 1L4AB 1N7SD 4AQRD 2YIUC 1URQA 3AEEC 3LW5J 3FXEA 1AVYA 1L0NK 2KI7B 3U1CA 1GL2C 1R8EA 3L73J 2WVRA 2JR8A 3NMDA 4EYYQ 1HWTC 4KT0J 3L75G 2FYUE 2KZIA 4JYCA 5H2FE 2N1TD 3WU2H 5APXA 1N8RQ 5KAFE 3P7KA 2Y9YA 5AW8B 2HPCA 4OGQC 1HJ0A 3O6QA 4MN4C 1NH4A 3GLMA 1LT9C 1EZVE 1NOHA 1Z56A 1ZN5A 1BE3G 3HD7A 2BCCD 1HBWA 1PPJD 2C0WA 5CCHD 2XKMA 1AQTA 1YIJP 5GTIH 1M1JB 1W2BO 2E74B 3A0BE 1M1KQ 1NTZE 1GL2B 2QJKC 4YTPC 2P10A 1PGPA 2O01N 2WQYC 3GF3A 4H0LC 1VF5C 2KSJA 1SFCA 1USEA 2YO2A 1LTJC 1WT6A 3KQGA 4OGQB 4U7JA 3VP9A 3CX5H 1DEBA 2IYPA 3EFGA 1OX3A 3H1HJ 4K3AA 3H1LE 1NTMD 4Z1MH 1X79B 1M56D 1VQ7P 3L71G 1NTKD 4TT3H 1FJPA 1CSBA 4JYBA 3L72E 1KYOE 4ZKPA 3B4SA 2I8DA 1BGYE 1ZP0C 5APVA 1JO5A 3VMYA 1MUUA 4C46A 4U3FE 1Q82Q 3B8EB 1SQXE 1DX7A 5KJ7D 1VQOP 2WSSH 1ZRTE 2XV5A 4H0LB 3LW5H 4GODA 5CBNA 3FXDA 2WPRA 3NXSA 1LTJB 1EDKA 4N3YB 5EFWB 1Q81Q 3L75D 5AVQB 3G3ZA 1KILB 1P84H 1OXZA 1JMBA 1FDOA 2OYIA 3MTUE 3NTNA 2HODB 3USSA 1SQPK 3W68A 4DJGA 3A0HE 5AVUB 2R44A 1U7MA 5KKZB 1A02J 2B87A 2VRSA 4EI2A 1BE3D 2AXTH 1VQKP 1NTZJ 1OWAA 3VP8A 2D2CC 2YXQB 3QWOC 3U59A 3JCUE 1SS1A 1GU4A 2Z4EA 1L4AD 4NPEA 1L0LE 2K9JA 1RF1C 4PJ0E 1OFCX 3CCSP 1RE3A 1KB9H 1H0TA 4DZOA 1T3UA 3HTKA 1YI2P 2IBZE 1OW7A 2QA4P 2E76B 1GDTA 1FE6A 2K9YA 2WPVB 1K04A 3M9HA 1AV1A 3HE5A 2QEXP 3RK3C 1BGYJ 4H13C 1NU1K 4U3FJ 3L71D 3H1IG 3SFDC 1SQXJ 2M8RA 3CCEP 3BVHA 2BEZF 1KV4A 2FXOA 4W7ZA 1K73Q 1RF1B 2GA1A 5M1BA 2E74D 2W90A 3CMAP 5APUA 1EXJA 3IF4A 1GL2D 3S4RA 1PIXA 1IFIA 1SQQG 5KLVK 1SQQK 1Y9BA 2OYHB 2BCCE 3AE7C 1PPJE 3L70J 3RK3B 1SQPD 2ZFCA 2G8YA 4EOTA 4H13B 2K3RA 1HTLC 5DJUB 3KZIH 4WY4B 1YJWP 3M0DA 4OGQD 1JCDA 1PZQA 2JJLA 1VPCA 1EDJA 2FFDB 2OTKE 2Y9ZA 3MUDA 1SQBK 3TYYA 3A0BH 1LWUC 1S3JA 2IZ0A 2ZJSE 3OW2O 1NAYA 2YKPA 1CI6B 2A45H 3QH9A 1JTHA 1JM0A 5AW2B 5AVTB 3Q3DA 3HUSA 1FS0E 1EXIA 3H1JE 1NGMB 2WT7B 1NTME 4H0LD 3H32A 2KUBA 1NTKE 3P32A 2WSFJ 3Q5RA 2B89A 1LTIC 1GTWA 1KILD 3V6IA 1VQ8P 3CC2P 3S1KA 1YQ3C 4EIJA 5APQA 3FX0A 1RF0C 3H1ID 4WWIA 1LWUB 1PGOA 2YNYA 3FGAD 1FZCC 2P2UA 4QMAA 1A02F 3B71A 1PP9G 1W5CE 3L75E 1YITP 1Q7YQ 1U7JA 4BRYB 2PAJA 2HPCB 5AW0B 5DJTB 1L0LG 5BU5A 3O6QB 5E79E 2FXMA 1GZLA 2BCCJ 3RK2B 1SQQD 3R4YA 1AFOA 1AA0A 1BE3E 1RQVA 2JO1A 5AW5B 2C0XA 3CL3D 2YKQA 2RMZA 1DD3A 1S1CX 3SWFA 3A0HH 2E76D 5KJ7C 1FZCB 3W67A 1QX8A 2UWJE 4YXDC 5AVVB 2K37A 2JWDA 2Q7CA 1SFCB 1N73C 3IFMA 5B66E 2GUVA 2HYNA 3G4SP 3I5CA 2NPSA 3H1JJ 4PJ0H 2AXCA 1SVFA 3UIAA 3V2RA 2OQQA 3ABVC 5C39A 1NTKJ 2B88A 2FKWB 5CCGA 2FYNC 4UB8E 4C7RA 1YYCA 3V2PA 1K8AQ 3SFEC 3L71E 1VDFA 2XNDH 3CWBJ 4HB1A 2Q5UA 2MKVA 1G1JA 5AVRB 3OAKA 1GK4A 1GW4A 2WSFH 2XU6A 1E79H 1N73B 2KLUA 3L75J 3RK3D 3AE4C 3Q2YA 4H13D 4PD4H 3CXHD 1RE3C 4WY4D 2IZ1A 1PP9D 3V2NA 4RJTA 2KK7A 2OYIB 2ZYGA 2J59M 1SQVG 2Q1KA 3Q5SA 1BE3J 5APWA 5TISE 1SQVK 2B87B 4I7ZB 4DOJA 1NKNA 1VQNP 1GD2E 5AW6B 1AVOA 3MHVA 4OH8B 2W8ZA 3H6PA 3AEBC 1L0NG 2K9JB 2QIWA 1M1JC 3B5NA 3VN0A 1VQ9P 3KDPB 2E74C 1FAVA 1H0TB 1N7SA 1ZMEC 4XA4A 3KXDA 3HTKB 2YKOA 3TDKA 2Z5IA 2QE7H 2Y0DA 1WRGA 2M5AA 2JP3A 3C1LA 3HE5B 1BCCG 3L71J 1KILE 3TSIA 1LT1A 1OW8A 2O01J 2N1TA 2FYZA 2R3CA 3H1KG 1NVOA 2PRRA 2ZAEB 3H1IE 1JY3P 1X8YA 3RK2D 2Q3IA 3CX5I 2E75B 1D7MA 1JEKA 2KZJA 4LLHA 3ZDMA 3EQ2A 1T2KC 2JWAA 1AJYA 2ZT9B 4JPZB 2E43A 4YXWH 3TNUA 1HJBA 1SQQE 1KZUB 3M06A 1R5LA 2WMMA 5E79H 1SFCD 2I1KA 1KILC 4B86A 4IFFA 1SQVD 3L74G 3L4FA 3BCCG 3WUTA 2O1JA 1PL5A 2JKVA 1G2CB 1JB0J 1P84I 2KYVA 1NO4A 3AE1C 3P8CD 4A7PA 1VQ4P 4IL6E 3GMAA 5KKZC 1JY2P 3GHGA 1M7LA 4L74A 3PLNA 1JTHB 1OVVA 1L0ND 1OZHA 2R5DA 2IYOA 1FDIA 2FYUJ 3AEGC 4ASVA 2WSEJ 3T97A 3RBXA 5B66H 5TJHA 1X22A 3R2PA 4L76A 3H32B 2JEEA 3OJAB 4GOEA 3RL0B 2A06G 1IK9A 1KTMA 1BCCD 2E76C 3H1IJ 4UB8H 1KB9I 1SQPG 3PHLA 1IO4A 3TK1A 1S2EA 3H1KD 1FDMA 3RK3E 1T3JA 2O01H 4ZMDA 3U1AA 3CXHE 1JCCA 2L5GB 5AVWB 4GIFA 1PP9E 2J5UA 3F89A 5AVSB 1MV8A 3CX5D 1K9MQ 3MGNA 5AVXB 2YO3A 3MZWB 2YMKA 1YQ4C 1MZ9A 2KLVA 1FOSF 3H1HG 1KD1Q 3KYQA 3O8ZA 5KLIB 1PGJA 3H1LJ 4ZKUA 3D70A 1ZOYC 5TISH 1W2EA 3L74D 3BASA 2LR2A 2OYHC 3V4WA 3BCCD 3L72J 1RE4A 3G9RA 1CZQA 1NU1G 3M9QA 4I1LA 3MIWA 2ZVOB 3WUVA 4WY4C 1IFDA 3L73D 4JQ0D 2CPSA 3KHUA 5B5EE 2FFDC 3G6EP 3CD6P 2AEJA 2NPSB 3P8MC 3SSUA 2L91A 1EZVI 3CI9A 2H88C 3S9OA 2E75D 1IK7A 3F5HA 4GDOA 2WTYA 1IFNA 1LP1A 2Y0CA 3PP5A 1H89A 2CK3H 5H2FH 3LIDA 2WSEH 1ZV8A 5CHXA 5KLVG 2KXPB 5BVZA 3WMM0 4KHXA 3L36A 2ZT9D 2A45I 5KAFH 1EQ7A 3RL0g 2KNCA 2ZVNB 2A06D 1J1DB 2A45G 1GL2A 2FY8A 1XTCC 5KAIE 3GW6A 1URQC 1KB9D 3BRTB 3A5TA 4L75A 1PP9J 3CCMP 1KMIZ 2N9BA 1SQBG 2W6JH 1NAFA 2QJPB 2N9YB 4R4LA 3RBZA 4AUWA 3AE8C 3IN6A 3JSVC 1JNMA 3E7KA 1L0LJ 4IOIH 3HE4A 2ZXXA 1LT9A 2H89C 1YTZI 1JOCA 1J1EB 1N86A 4WB4A 1T2KD 1SQVE 4OVNF 2E42A 2ZXEB 1OW6A 3H1HD 4HJGH 4Y99C 3IAOA 1VQMP 1RY3A 1OVRA 1LTGC 5L8RJ 1DD4A 3P8CE 3RK2C 3CC7P 1SQXK 2W83C 3HD7C 1URQB 2AEMA 4IFDK 2KS1A 4WVZA 3NFQA 1KQSO 3B5NB 1NU1D 1L0NE 1YJNP 3RL0D 1N7SB 1FU1A 1BSHA 1LTJA 1KYOH 3BRVB 3CPWO 1USDA 1HGVA 2M5AB 2SPZA 5GTIE 1SFCC 2M3EA 1DH3A 4RESB 2HODA 3E1RA 1KQGB 4Y99B 3KPEA 4UB6E 1BCCE 3AE3C 3EFFK 2XDJA 1H8AA 2HFED 5KLVD 3H1KE 4LGDE 3HD7B 2AEFA 3VMXA 1BDDA 2ZYAA 1QL1A 1QGKB 1FJKA 1ZLLA 1G1IA 2IBZI 3CX5E 2P58A 4I6MC 2KIKA 2H7HA 1SQBD 5APTA 1X0TA 3V2QA 4BXLA 3TNUB 1S4XA 2QVAA 1FOSE 3JCUH 3PTZA 1N2DC 1NKZB 2FBWC 1YJ9P 1WMKA 1LNQA 1T6AA 4I2LC 1NTMJ 2NPSD 1VL2A 1JY3N 4PD4I 3L74E 3Q5PA 2PP6A 2OYIC 4H44B 3M9BA 2HG5D 4XFJA 3BCCE 5CMZA 1RQUA 5CCGD 2NZ2A 3EWKA 4ZNCA 1Q90D 3FWNA 1L0NJ 3GHGB 3AE9C 4I7ZC 3L73E 1RF1A 2IFNA 3AE5C 4XE5B 5CBOA 3JC22 1VQLP 1UIXA 1QLED 1M57D 1VQPP 1GW3A 3CCRP 1Y8AA 3T97B 3CCLP 2ITAA 1KN7A 5B5EH 2WWWA 2AXTE 1BCCJ 1PGQA 2DW3A 3CMEP 2P67A 1QEXA 3L70D 2R3SA 3L35A 1MKMA 1GU5A 1OIPA 3H1KJ 2A06E 1FZAA 1SQPE 2QJYB 2WITA 1JY2N 1KC8Q 1KB9E 2HR3A 3AEFC 4L73A 5GTHE 1GK6A 3TGUG 2MJZA 2IDBA 1CI6A 2P1JA 1X9VA 4R4MA 2BASA 3M0AA 2W6AA 4KJMA 2RN0A 4CPGA 2E75C 1URQD 4NPDA 3H25A 1S72P 2BEQD 2G3AA 2K1AA 1Q2NA 5BU8B 3H1HE 1NTKK 3CLQA 3L74J 2ZT9C 2KP8A 3CWBG 3BCCJ 1IJDB 2LXCB 1S5LE 1LWUA 1JY3O 4PD4D 1NU1E 2NRGA 2C9NY 3M0DC 3BATA 2XZRA 4DCKA 2Z5HA 3MUDC 2W27A 4BRYA 1MFTA 1ZR4A 3HD7D 2RH0A 2PFXA 3KZIE 5CCHA 1LP1B 1IC2A 2YIUB 2Y0EA 1U57A 2HLOA 3L37A 3II6A 3VMAA 1S9KD 3HUSC 2POHA 5KLVE 1HF9A 1SQPJ 2KNCB 1HUCA 4D6TG 4UB6H 4C7NA 2E5TA 1RF0A 3VMZA 2K88A 2IX7C 1FZCA 5AW9B 1ZXGA 3AE2C 1EDLA 3RL0C 2P7JA 1JY2O 4RKUJ 3WUUA 1SQBE 3TGUD 4H44D 3E1IA 3L73G 3HE4B 2PGDA 3K5BA 1LT9B 3H1JD 1E5WA 2Q6QA 3HUSB 2QM8A 2FXPA 3V4QA 2V4HA 1PFIA 1JUNA 4PV1C 2CPBA 1FZFA 1FZBA 4M3LA 5KJ7A 3PRJA 3SWYA 2QJKB 2GM4A 2OGUA 3CWBD 1NU1J 5AW1B 2KS1B 1VF5B 3N4XA 5KLIC 4HYTB 3CCQP 1N73A 3PJSK 2QG4A 2M0BA 3OA7A 5CJ0A 2E5YA 3VOPA 1T8ZA 1M90Q 3GF7A 3SWKA 4JBZA 2I1JA 4O9BA 3HRNA 1IFPA
chains in the Genus database with same CATH topology
1LTAC 1YTZI 1JOCA 1J1EB 1N86A 4WB4A 2NPSC 1NH4A 4LC1A 3A7OA 2FKWB 5CCGA 1T2KD 2E42A 4C7RA 1LT9C 1YYCA 2ZXEB 3V2PA 1NOHA 1Z56A 1HVVA 4Y99C 1ZN5A 1RY3A 3V5BA 3HD7A 5CCGC 1HBWA 2C0WA 1VDFA 5CCHD 1LTGC 2XKMA 2Q5UA 3P8CE 1G1JA 1M1JB 5AVRB 1L4AA 3RK2C 3OAKA 1SQXK 4N6JA 3HD7C 1URQB 4IFDK 1SP4A 1LTBC 1GK4A 3NFQA 1GW4A 1GL2B 2WSFH 3B5NB 2XU6A 4W80A 1N73B 1J1DC 3RL0D 3RK3D 4N78D 1N7SB 1FU1A 1LTJA 3LIEA 1RE3C 3BRVB 4WY4D 2KSJA 1SFCA 2YO2A 3V2NA 2FYUK 1LTJC 1WT6A 1SLQA 3KQGA 1HGVA 2M3BA 3VP9A 2OYIB 1SFCC 4WBAA 1DH3A 4RESB 4HH2A 2HODA 2J59M 2WPSA 1DEBA 3EFGA 4Y99B 3KPEA 5APWA 1SQVK 2XDJA 1X79B 4DOJA 1NHLA 1H8AA 1NKNA 2HFED 1KQLA 1FJPA 1CSBA 4JYBA 1J1EC 1GD2E 4LGDE 3HD7B 4ZKPA 5AW6B 3VMXA 5APVA 1JO5A 4OH8B 3VMYA 1MUUA 3H6PA 4C46A 1M1JA 1QL1A 3A3YB 1FJKA 3B8EB 4GT1A 1DX7A 5CJ4A 5AW7B 2WPQA 5KJ7D 1IFMA 1NTZK 1ZLLA 1G1IA 2XV5A 3B5NA 1M1JC 3VN0A 4I6MC 3LW5H 2WZ7A 3KDPB 2YMYA 2H7HA 1FAVA 5APTA 2WPRA 2KB7P 1N7SA 4XA4A 3MD0A 3NXSA 3V2QA 1LTJB 3HTKB 3B5NC 2YKOA 4N3YB 3TNUB 5AVQB 3G3ZA 1KILB 2Z5IA 1OXZA 1XTGB 1N7SC 1FOSE 1S9KE 1WRGA 1N2DC 1NKZB 2OYIA 3MTUE 3NTNA 3HE5B 2HODB 4I2LC 5KTBA 1SQPK 2NPSD 1J2JB 1JY3N 5AVUB 3TSIA 2OYIC 1LGHB 2PP6A 1JMMA 2N1TA 2FYZA 2OARA 3M9BA 1G2CA 1A02J 2HG5D 2R3CA 5CMZA 2VRSA 1OWAA 5CCGD 3VP8A 5AW4B 2N1TC 1JY3P 3GHGB 1X8YA 3RK2D 2Q3IA 2H43A 2J58A 1RF1A 2IFNA 3U59A 1GU4A 1YTZT 4XE5B 3M91A 4LLHA 2Z4EA 1L4AD 1RF1C 3EQ2A 1T2KC 1RE3A 2O1KA 1GW3A 2WWWA 4DZOA 1HH0A 1T3UA 4W7YA 3HTKA 2E43A 5CCHC 3TNUA 5AW3B 1KFNA 1GDTA 1KILA 1HJBA 1HGZA 1KZUB 3M06A 2P67A 1SFCD 2I1KA 2XNXA 1KILC 3L35A 4B86A 1GU5A 4IFFA 3M9HA 3HE5A 3L4FA 1FZAA 1QL2A 3RK3C 1FZGA 1LTTC 2O1JA 4AYCA 1NU1K 2WITA 1JY2N 2N1TB 1CW5A 1G2CB 1IFJA 2KYVA 2M8RA 1MFZA 1NO4A 3BVHA 3P8CD 1GK6A 2MJZA 2H8PD 4W7ZA 1JY2P 3GHGA 1CI6A 1M7LA 1RF1B 2P1JA 1X9VA 1JTHB 2BASA 3M0AA 2W6AA 2R5DA 1L0LK 3GHGC 1NWQA 1H88A 1URQD 4IFMA 3T97A 5APUA 1GL2D 1ZR2A 3R2PA 5BU8B 1IFIA 3VTPC 3H32B 1NTKK 3CLQA 5KLVK 3VYIA 1SQQK 2JEEA 2OYHB 2KP8A 4C7NB 3OJAB 3RL0B 3RK3B 2ZFCA 1IK9A 3IR9A 4EOTA 1HTLC 5APSA 1IJDB 3C9IA 2IFMA 4WY4B 3M0DA 1JCDA 1N7LA 1IO4A 2JJLA 2Q9IA 1LWUA 1VPCA 3TK1A 1JY3O 2FFDB 3MUDA 1FDMA 1SQBK 2C9NY 3M0DC 1T3JA 2O01H 4N78E 3TYYA 3BATA 2XZRA 3U1AA 1LWUC 1FZEA 2R5BA 5AVYB 1JCCA 2L5GB 2Z5HA 2W6BA 2W27A 5AVWB 4GIFA 2YKPA 1CI6B 5AVSB 1MV8A 2A45H 3HD7D 3MGNA 5AVXB 1ZR4A 1JTHA 2YO3A 5AW2B 5AVTB 3HUSA 1MZ9A 5CCHA 1IC2A 2KLVA 1FOSF 2WT7B 1LTSC 3KYQA 2HLOA 3L37A 3II6A 1S9KD 3HUSC 3O8ZA 3H32A 2POHA 3P32A 2R32A 1HUCA 2OYHA 1LTIC 4C7NA 4ZKUA 1GTWA 1KILD 1RF0A 1W2EA 3VMZA 1L4AC 2IX7C 1FZCA 5AW9B 3BASA 2WSCH 2OYHC 3V4WA 4WY4A 1RE4A 1CZQA 5AVZB 4EIJA 3RL0C 5APQA 1RF0C 3M9QA 2P7JA 1LWUB 4I1LA 2YNYA 2GUSA 3MIWA 1FZCC 2FFDA 1JY2O 2C9LY 4WY4C 2KOGA 1IFDA 1RE4C 2P2UA 2CPSA 1A02F 3E1IA 4JF7A 2FFDC 2NPSB 2LKMA 3P8MC 3HE4B 3CI9A 2PAJA 2HPCB 1LT9B 5AW0B 1AQ5A 2QM7A 5BU5A 2FXMA 1E5WA 1GZLA 1FBMA 2IPPA 3HUSB 1KFMA 2QM8A 3RK2B 2WTYA 1IFNA 3V4QA 3PP5A 1PFIA 1JUNA 1H89A 1NTMK 2WT7A 4GKGA 3LIDA 2WSEH 3B5ND 1ZV8A 3A2AA 3N7NA 5CHXA 5APYA 2CPBA 1FZFA 1AFOA 1FZBA 4M3LA 5KJ7A 5BVZA 3SWYA 3WMM0 4KHXA 3L36A 1L4AB 2A45I 1EQ7A 1N7SD 2GM4A 4AQRD 5AW5B 1J1DB 1URQA 2C0XA 2YKQA 3CL3D 5AW1B 3SWFA 2A45G 5KJ7C 1GL2A 1XTCC 1L0NK 1FZCB 3N4XA 4HYTB 5AVVB 1N73A 1URQC 3U1CA 3BRTB 3A5TA 1GL2C 2N9BA 1NAFA 3OA7A 5CJ0A 2Q7CA 1SFCB 3NMDA 3VOPA 3IFMA 1N73C 4AUWA 1T8ZA 1HWTC 4JYCA 1JNMA 2GUVA 2N1TD 2HYNA 2I1JA 3I5CA 2NPSA 5APXA 4O9BA 3P7KA 3HE4A 3HRNA 5AW8B 1SVFA 3UIAA 3V2RA 2HPCA 1LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7S A;  2NPS C;  1KIL D;  2H8P D;  3B5N C;  3HTK B;  4W7Z A;  5CCG A;  1L4A C;  1KIL B;  1HVV A;  4WY4 A;  1XTG B;  1JTH B;  1N7S C;  3RL0 C;  3HD7 A;  5CCG C;  5CCH D;  3P8C E;  4WY4 C;  3RK2 C;  2KOG A;  1L4A A;  1URQ D;  3HD7 C;  2NPS D;  1GL2 D;  1URQ B;  4JF7 A;  3TSI A;  2PP6 A;  2NPS B;  2N1T A;  1GL2 B;  3B5N B;  2HG5 D;  4W80 A;  3RL0 D;  3RK3 D;  5CCG D;  1N7S B;  2N1T C;  3RL0 B;  3RK3 B;  4WY4 D;  3RK2 D;  1SFC A;  4WY4 B;  3RK2 B;  3PP5 A;  3B5N D;  1L4A D;  1SFC C;  5KJ7 A;  1L4A B;  3M0D C;  1T3J A;  4N78 E;  1N7S D;  1URQ A;  5KJ7 C;  1GL2 A;  4W7Y A;  2XDJ A;  5CCH C;  1NHL A;  1KIL A;  1URQ C;  3HD7 D;  1JTH A;  2HFE D;  4LGD E;  1GL2 C;  3HD7 B;  1SFC D;  1KIL C;  1SFC B;  4OH8 B;  3VOP A;  5CCH A;  3RK3 C;  2N1T D;  5KJ7 D;  3KYQ A;  2N1T B;  2NPS A;  3B5N A;  2M8R A;  2WZ7 A;  2YMY A; 
#chains in the Genus database with same CATH topology
 1LTA C;  2NPS C;  3L70 E;  4LC1 A;  3A7O A;  5KLV J;  1SQQ J;  4PV1 B;  1HVV A;  3V5B A;  5CCG C;  1L4A A;  1OMI A;  4D6T D;  4K35 A;  4RO0 A;  4N6J A;  1SP4 A;  1LTB C;  3C8V A;  3I55 P;  1SQB J;  4BWN A;  1QVF O;  4W80 A;  5GTH H;  1J1D C;  1ZW0 A;  4N78 D;  3LIE A;  2RKL A;  2FYU G;  5K5G B;  2FYU K;  1P84 D;  2QSI A;  2OYO A;  1SLQ A;  3TF5 A;  4TLF A;  2M3B A;  2QJP C;  4WBA A;  4HH2 A;  2OTL P;  2WPS A;  1EZV G;  2D2C B;  1NHL A;  3MP7 B;  1KQL A;  1J1E C;  2ZYD A;  4PD4 E;  1QVG O;  1NYH A;  1Q86 Q;  2YXR B;  1M1J A;  1NTZ G;  3A3Y B;  4GT1 A;  1S5L H;  5CJ4 A;  5AW7 B;  2WPQ A;  1IFM A;  1NTZ K;  3FWL A;  4EDF A;  2WZ7 A;  2YMY A;  1IZN B;  2KB7 P;  3MD0 A;  2B9B A;  3B5N C;  1XTG B;  1N7S C;  3D71 A;  3AE6 C;  3GG2 A;  1S9K E;  1YBK A;  4DT0 A;  4YPC A;  1DEE G;  2V7Q J;  3H1L G;  3ITK A;  5KTB A;  3AEC C;  1J2J B;  1KYO I;  1LGH B;  1JMM A;  1VQ5 P;  2OAR A;  1G2C A;  3CCJ P;  3L72 G;  1BGY G;  4Y28 J;  5AW4 B;  1NJI Q;  2N1T C;  4U3F G;  1RHZ B;  1SQX G;  4GOF A;  2H43 A;  2J58 A;  3TGU E;  1Y47 A;  1YTZ T;  3WU2 E;  3M91 A;  2Q3E A;  1M8O B;  1VQ6 P;  2O1K A;  3I56 P;  2FYU D;  4IL6 H;  1HH0 A;  1VF5 D;  4W7Y A;  5CCH C;  5AW3 B;  1KFN A;  1KIL A;  1HGZ A;  2KSE A;  1UII A;  2WSC J;  3D6Y A;  1S5L X;  2XNX A;  3CWB E;  3D6Z A;  1EZV D;  3L70 G;  3CXH I;  1L2P A;  1QL2 A;  1FZG A;  1LTT C;  1FC2 C;  4AYC A;  2N1T B;  1CW5 A;  1IFJ A;  3CCU P;  1MFZ A;  4H44 C;  4PV1 D;  2H8P D;  1BDC A;  1KQF B;  1NTZ D;  3PH0 A;  1L0L K;  3GHG C;  2O3J A;  1NWQ A;  2OTJ P;  1H88 A;  4IFM A;  2IBZ G;  1ZR2 A;  3CXH H;  3VTP C;  1LJ2 A;  3VYI A;  3Q1M A;  1R5S A;  4C7N B;  1SQV J;  3IR9 A;  4D6T E;  3H1L D;  5APS A;  1TU3 F;  3C9I A;  2IFM A;  3AED C;  1N7L A;  2V7Q H;  2LXB A;  2Q9I A;  3L72 D;  3TGU J;  1KYO D;  4IL6 X;  1BGY D;  4N78 E;  1GMJ A;  2D2C D;  4U3F D;  1FZE A;  2R5B A;  5AVY B;  2QJY C;  1SQX D;  2W6B A;  1ZRT D;  1P84 E;  4NPF X;  2JDI H;  3CC4 P;  1LTS C;  2BCC G;  1PPJ G;  2R32 A;  2OYH A;  1L4A C;  1RH5 B;  2WSC H;  1YHQ P;  4WY4 A;  1EC5 A;  2QRX A;  5AVZ B;  4ASW A;  2GUS A;  2FFD A;  2C9L Y;  3RGU A;  2KOG A;  3CCV P;  1KOR A;  1RE4 C;  4OWF A;  4JF7 A;  2LKM A;  1OVU A;  2FYN B;  1L0L D;  1BSN A;  5KAI H;  1AQ5 A;  1PV3 A;  3G71 P;  2QM7 A;  1DIP A;  1FBM A;  3H1J G;  2IPP A;  1KFM A;  1NTM G;  2IBZ D;  1K05 A;  1EDI A;  1NTM K;  4D6T J;  4GKG A;  2WT7 A;  1NTK G;  3B5N D;  3A2A A;  4HKZ H;  3N7N A;  5APY A;  3AEA C;  1L4A B;  1N7S D;  4AQR D;  2YIU C;  1URQ A;  3AEE C;  3LW5 J;  3FXE A;  1AVY A;  1L0N K;  2KI7 B;  3U1C A;  1GL2 C;  1R8E A;  3L73 J;  2WVR A;  2JR8 A;  3NMD A;  4EYY Q;  1HWT C;  4KT0 J;  3L75 G;  2FYU E;  2KZI A;  4JYC A;  5H2F E;  2N1T D;  3WU2 H;  5APX A;  1N8R Q;  5KAF E;  3P7K A;  2Y9Y A;  5AW8 B;  2HPC A;  4OGQ C;  1HJ0 A;  3O6Q A;  4MN4 C;  1NH4 A;  3GLM A;  1LT9 C;  1EZV E;  1NOH A;  1Z56 A;  1ZN5 A;  1BE3 G;  3HD7 A;  2BCC D;  1HBW A;  1PPJ D;  2C0W A;  5CCH D;  2XKM A;  1AQT A;  1YIJ P;  5GTI H;  1M1J B;  1W2B O;  2E74 B;  3A0B E;  1M1K Q;  1NTZ E;  1GL2 B;  2QJK C;  4YTP C;  2P10 A;  1PGP A;  2O01 N;  2WQY C;  3GF3 A;  4H0L C;  1VF5 C;  2KSJ A;  1SFC A;  1USE A;  2YO2 A;  1LTJ C;  1WT6 A;  3KQG A;  4OGQ B;  4U7J A;  3VP9 A;  3CX5 H;  1DEB A;  2IYP A;  3EFG A;  1OX3 A;  3H1H J;  4K3A A;  3H1L E;  1NTM D;  4Z1M H;  1X79 B;  1M56 D;  1VQ7 P;  3L71 G;  1NTK D;  4TT3 H;  1FJP A;  1CSB A;  4JYB A;  3L72 E;  1KYO E;  4ZKP A;  3B4S A;  2I8D A;  1BGY E;  1ZP0 C;  5APV A;  1JO5 A;  3VMY A;  1MUU A;  4C46 A;  4U3F E;  1Q82 Q;  3B8E B;  1SQX E;  1DX7 A;  5KJ7 D;  1VQO P;  2WSS H;  1ZRT E;  2XV5 A;  4H0L B;  3LW5 H;  4GOD A;  5CBN A;  3FXD A;  2WPR A;  3NXS A;  1LTJ B;  1EDK A;  4N3Y B;  5EFW B;  1Q81 Q;  3L75 D;  5AVQ B;  3G3Z A;  1KIL B;  1P84 H;  1OXZ A;  1JMB A;  1FDO A;  2OYI A;  3MTU E;  3NTN A;  2HOD B;  3USS A;  1SQP K;  3W68 A;  4DJG A;  3A0H E;  5AVU B;  2R44 A;  1U7M A;  5KKZ B;  1A02 J;  2B87 A;  2VRS A;  4EI2 A;  1BE3 D;  2AXT H;  1VQK P;  1NTZ J;  1OWA A;  3VP8 A;  2D2C C;  2YXQ B;  3QWO C;  3U59 A;  3JCU E;  1SS1 A;  1GU4 A;  2Z4E A;  1L4A D;  4NPE A;  1L0L E;  2K9J A;  1RF1 C;  4PJ0 E;  1OFC X;  3CCS P;  1RE3 A;  1KB9 H;  1H0T A;  4DZO A;  1T3U A;  3HTK A;  1YI2 P;  2IBZ E;  1OW7 A;  2QA4 P;  2E76 B;  1GDT A;  1FE6 A;  2K9Y A;  2WPV B;  1K04 A;  3M9H A;  1AV1 A;  3HE5 A;  2QEX P;  3RK3 C;  1BGY J;  4H13 C;  1NU1 K;  4U3F J;  3L71 D;  3H1I G;  3SFD C;  1SQX J;  2M8R A;  3CCE P;  3BVH A;  2BEZ F;  1KV4 A;  2FXO A;  4W7Z A;  1K73 Q;  1RF1 B;  2GA1 A;  5M1B A;  2E74 D;  2W90 A;  3CMA P;  5APU A;  1EXJ A;  3IF4 A;  1GL2 D;  3S4R A;  1PIX A;  1IFI A;  1SQQ G;  5KLV K;  1SQQ K;  1Y9B A;  2OYH B;  2BCC E;  3AE7 C;  1PPJ E;  3L70 J;  3RK3 B;  1SQP D;  2ZFC A;  2G8Y A;  4EOT A;  4H13 B;  2K3R A;  1HTL C;  5DJU B;  3KZI H;  4WY4 B;  1YJW P;  3M0D A;  4OGQ D;  1JCD A;  1PZQ A;  2JJL A;  1VPC A;  1EDJ A;  2FFD B;  2OTK E;  2Y9Z A;  3MUD A;  1SQB K;  3TYY A;  3A0B H;  1LWU C;  1S3J A;  2IZ0 A;  2ZJS E;  3OW2 O;  1NAY A;  2YKP A;  1CI6 B;  2A45 H;  3QH9 A;  1JTH A;  1JM0 A;  5AW2 B;  5AVT B;  3Q3D A;  3HUS A;  1FS0 E;  1EXI A;  3H1J E;  1NGM B;  2WT7 B;  1NTM E;  4H0L D;  3H32 A;  2KUB A;  1NTK E;  3P32 A;  2WSF J;  3Q5R A;  2B89 A;  1LTI C;  1GTW A;  1KIL D;  3V6I A;  1VQ8 P;  3CC2 P;  3S1K A;  1YQ3 C;  4EIJ A;  5APQ A;  3FX0 A;  1RF0 C;  3H1I D;  4WWI A;  1LWU B;  1PGO A;  2YNY A;  3FGA D;  1FZC C;  2P2U A;  4QMA A;  1A02 F;  3B71 A;  1PP9 G;  1W5C E;  3L75 E;  1YIT P;  1Q7Y Q;  1U7J A;  4BRY B;  2PAJ A;  2HPC B;  5AW0 B;  5DJT B;  1L0L G;  5BU5 A;  3O6Q B;  5E79 E;  2FXM A;  1GZL A;  2BCC J;  3RK2 B;  1SQQ D;  3R4Y A;  1AFO A;  1AA0 A;  1BE3 E;  1RQV A;  2JO1 A;  5AW5 B;  2C0X A;  3CL3 D;  2YKQ A;  2RMZ A;  1DD3 A;  1S1C X;  3SWF A;  3A0H H;  2E76 D;  5KJ7 C;  1FZC B;  3W67 A;  1QX8 A;  2UWJ E;  4YXD C;  5AVV B;  2K37 A;  2JWD A;  2Q7C A;  1SFC B;  1N73 C;  3IFM A;  5B66 E;  2GUV A;  2HYN A;  3G4S P;  3I5C A;  2NPS A;  3H1J J;  4PJ0 H;  2AXC A;  1SVF A;  3UIA A;  3V2R A;  2OQQ A;  3ABV C;  5C39 A;  1NTK J;  2B88 A;  2FKW B;  5CCG A;  2FYN C;  4UB8 E;  4C7R A;  1YYC A;  3V2P A;  1K8A Q;  3SFE C;  3L71 E;  1VDF A;  2XND H;  3CWB J;  4HB1 A;  2Q5U A;  2MKV A;  1G1J A;  5AVR B;  3OAK A;  1GK4 A;  1GW4 A;  2WSF H;  2XU6 A;  1E79 H;  1N73 B;  2KLU A;  3L75 J;  3RK3 D;  3AE4 C;  3Q2Y A;  4H13 D;  4PD4 H;  3CXH D;  1RE3 C;  4WY4 D;  2IZ1 A;  1PP9 D;  3V2N A;  4RJT A;  2KK7 A;  2OYI B;  2ZYG A;  2J59 M;  1SQV G;  2Q1K A;  3Q5S A;  1BE3 J;  5APW A;  5TIS E;  1SQV K;  2B87 B;  4I7Z B;  4DOJ A;  1NKN A;  1VQN P;  1GD2 E;  5AW6 B;  1AVO A;  3MHV A;  4OH8 B;  2W8Z A;  3H6P A;  3AEB C;  1L0N G;  2K9J B;  2QIW A;  1M1J C;  3B5N A;  3VN0 A;  1VQ9 P;  3KDP B;  2E74 C;  1FAV A;  1H0T B;  1N7S A;  1ZME C;  4XA4 A;  3KXD A;  3HTK B;  2YKO A;  3TDK A;  2Z5I A;  2QE7 H;  2Y0D A;  1WRG A;  2M5A A;  2JP3 A;  3C1L A;  3HE5 B;  1BCC G;  3L71 J;  1KIL E;  3TSI A;  1LT1 A;  1OW8 A;  2O01 J;  2N1T A;  2FYZ A;  2R3C A;  3H1K G;  1NVO A;  2PRR A;  2ZAE B;  3H1I E;  1JY3 P;  1X8Y A;  3RK2 D;  2Q3I A;  3CX5 I;  2E75 B;  1D7M A;  1JEK A;  2KZJ A;  4LLH A;  3ZDM A;  3EQ2 A;  1T2K C;  2JWA A;  1AJY A;  2ZT9 B;  4JPZ B;  2E43 A;  4YXW H;  3TNU A;  1HJB A;  1SQQ E;  1KZU B;  3M06 A;  1R5L A;  2WMM A;  5E79 H;  1SFC D;  2I1K A;  1KIL C;  4B86 A;  4IFF A;  1SQV D;  3L74 G;  3L4F A;  3BCC G;  3WUT A;  2O1J A;  1PL5 A;  2JKV A;  1G2C B;  1JB0 J;  1P84 I;  2KYV A;  1NO4 A;  3AE1 C;  3P8C D;  4A7P A;  1VQ4 P;  4IL6 E;  3GMA A;  5KKZ C;  1JY2 P;  3GHG A;  1M7L A;  4L74 A;  3PLN A;  1JTH B;  1OVV A;  1L0N D;  1OZH A;  2R5D A;  2IYO A;  1FDI A;  2FYU J;  3AEG C;  4ASV A;  2WSE J;  3T97 A;  3RBX A;  5B66 H;  5TJH A;  1X22 A;  3R2P A;  4L76 A;  3H32 B;  2JEE A;  3OJA B;  4GOE A;  3RL0 B;  2A06 G;  1IK9 A;  1KTM A;  1BCC D;  2E76 C;  3H1I J;  4UB8 H;  1KB9 I;  1SQP G;  3PHL A;  1IO4 A;  3TK1 A;  1S2E A;  3H1K D;  1FDM A;  3RK3 E;  1T3J A;  2O01 H;  4ZMD A;  3U1A A;  3CXH E;  1JCC A;  2L5G B;  5AVW B;  4GIF A;  1PP9 E;  2J5U A;  3F89 A;  5AVS B;  1MV8 A;  3CX5 D;  1K9M Q;  3MGN A;  5AVX B;  2YO3 A;  3MZW B;  2YMK A;  1YQ4 C;  1MZ9 A;  2KLV A;  1FOS F;  3H1H G;  1KD1 Q;  3KYQ A;  3O8Z A;  5KLI B;  1PGJ A;  3H1L J;  4ZKU A;  3D70 A;  1ZOY C;  5TIS H;  1W2E A;  3L74 D;  3BAS A;  2LR2 A;  2OYH C;  3V4W A;  3BCC D;  3L72 J;  1RE4 A;  3G9R A;  1CZQ A;  1NU1 G;  3M9Q A;  4I1L A;  3MIW A;  2ZVO B;  3WUV A;  4WY4 C;  1IFD A;  3L73 D;  4JQ0 D;  2CPS A;  3KHU A;  5B5E E;  2FFD C;  3G6E P;  3CD6 P;  2AEJ A;  2NPS B;  3P8M C;  3SSU A;  2L91 A;  1EZV I;  3CI9 A;  2H88 C;  3S9O A;  2E75 D;  1IK7 A;  3F5H A;  4GDO A;  2WTY A;  1IFN A;  1LP1 A;  2Y0C A;  3PP5 A;  1H89 A;  2CK3 H;  5H2F H;  3LID A;  2WSE H;  1ZV8 A;  5CHX A;  5KLV G;  2KXP B;  5BVZ A;  3WMM 0;  4KHX A;  3L36 A;  2ZT9 D;  2A45 I;  5KAF H;  1EQ7 A;  3RL0 g;  2KNC A;  2ZVN B;  2A06 D;  1J1D B;  2A45 G;  1GL2 A;  2FY8 A;  1XTC C;  5KAI E;  3GW6 A;  1URQ C;  1KB9 D;  3BRT B;  3A5T A;  4L75 A;  1PP9 J;  3CCM P;  1KMI Z;  2N9B A;  1SQB G;  2W6J H;  1NAF A;  2QJP B;  2N9Y B;  4R4L A;  3RBZ A;  4AUW A;  3AE8 C;  3IN6 A;  3JSV C;  1JNM A;  3E7K A;  1L0L J;  4IOI H;  3HE4 A;  2ZXX A;  1LT9 A;  2H89 C;  1YTZ I;  1JOC A;  1J1E B;  1N86 A;  4WB4 A;  1T2K D;  1SQV E;  4OVN F;  2E42 A;  2ZXE B;  1OW6 A;  3H1H D;  4HJG H;  4Y99 C;  3IAO A;  1VQM P;  1RY3 A;  1OVR A;  1LTG C;  5L8R J;  1DD4 A;  3P8C E;  3RK2 C;  3CC7 P;  1SQX K;  2W83 C;  3HD7 C;  1URQ B;  2AEM A;  4IFD K;  2KS1 A;  4WVZ A;  3NFQ A;  1KQS O;  3B5N B;  1NU1 D;  1L0N E;  1YJN P;  3RL0 D;  1N7S B;  1FU1 A;  1BSH A;  1LTJ A;  1KYO H;  3BRV B;  3CPW O;  1USD A;  1HGV A;  2M5A B;  2SPZ A;  5GTI E;  1SFC C;  2M3E A;  1DH3 A;  4RES B;  2HOD A;  3E1R A;  1KQG B;  4Y99 B;  3KPE A;  4UB6 E;  1BCC E;  3AE3 C;  3EFF K;  2XDJ A;  1H8A A;  2HFE D;  5KLV D;  3H1K E;  4LGD E;  3HD7 B;  2AEF A;  3VMX A;  1BDD A;  2ZYA A;  1QL1 A;  1QGK B;  1FJK A;  1ZLL A;  1G1I A;  2IBZ I;  3CX5 E;  2P58 A;  4I6M C;  2KIK A;  2H7H A;  1SQB D;  5APT A;  1X0T A;  3V2Q A;  4BXL A;  3TNU B;  1S4X A;  2QVA A;  1FOS E;  3JCU H;  3PTZ A;  1N2D C;  1NKZ B;  2FBW C;  1YJ9 P;  1WMK A;  1LNQ A;  1T6A A;  4I2L C;  1NTM J;  2NPS D;  1VL2 A;  1JY3 N;  4PD4 I;  3L74 E;  3Q5P A;  2PP6 A;  2OYI C;  4H44 B;  3M9B A;  2HG5 D;  4XFJ A;  3BCC E;  5CMZ A;  1RQU A;  5CCG D;  2NZ2 A;  3EWK A;  4ZNC A;  1Q90 D;  3FWN A;  1L0N J;  3GHG B;  3AE9 C;  4I7Z C;  3L73 E;  1RF1 A;  2IFN A;  3AE5 C;  4XE5 B;  5CBO A;  3JC2 2;  1VQL P;  1UIX A;  1QLE D;  1M57 D;  1VQP P;  1GW3 A;  3CCR P;  1Y8A A;  3T97 B;  3CCL P;  2ITA A;  1KN7 A;  5B5E H;  2WWW A;  2AXT E;  1BCC J;  1PGQ A;  2DW3 A;  3CME P;  2P67 A;  1QEX A;  3L70 D;  2R3S A;  3L35 A;  1MKM A;  1GU5 A;  1OIP A;  3H1K J;  2A06 E;  1FZA A;  1SQP E;  2QJY B;  2WIT A;  1JY2 N;  1KC8 Q;  1KB9 E;  2HR3 A;  3AEF C;  4L73 A;  5GTH E;  1GK6 A;  3TGU G;  2MJZ A;  2IDB A;  1CI6 A;  2P1J A;  1X9V A;  4R4M A;  2BAS A;  3M0A A;  2W6A A;  4KJM A;  2RN0 A;  4CPG A;  2E75 C;  1URQ D;  4NPD A;  3H25 A;  1S72 P;  2BEQ D;  2G3A A;  2K1A A;  1Q2N A;  5BU8 B;  3H1H E;  1NTK K;  3CLQ A;  3L74 J;  2ZT9 C;  2KP8 A;  3CWB G;  3BCC J;  1IJD B;  2LXC B;  1S5L E;  1LWU A;  1JY3 O;  4PD4 D;  1NU1 E;  2NRG A;  2C9N Y;  3M0D C;  3BAT A;  2XZR A;  4DCK A;  2Z5H A;  3MUD C;  2W27 A;  4BRY A;  1MFT A;  1ZR4 A;  3HD7 D;  2RH0 A;  2PFX A;  3KZI E;  5CCH A;  1LP1 B;  1IC2 A;  2YIU B;  2Y0E A;  1U57 A;  2HLO A;  3L37 A;  3II6 A;  3VMA A;  1S9K D;  3HUS C;  2POH A;  5KLV E;  1HF9 A;  1SQP J;  2KNC B;  1HUC A;  4D6T G;  4UB6 H;  4C7N A;  2E5T A;  1RF0 A;  3VMZ A;  2K88 A;  2IX7 C;  1FZC A;  5AW9 B;  1ZXG A;  3AE2 C;  1EDL A;  3RL0 C;  2P7J A;  1JY2 O;  4RKU J;  3WUU A;  1SQB E;  3TGU D;  4H44 D;  3E1I A;  3L73 G;  3HE4 B;  2PGD A;  3K5B A;  1LT9 B;  3H1J D;  1E5W A;  2Q6Q A;  3HUS B;  2QM8 A;  2FXP A;  3V4Q A;  2V4H A;  1PFI A;  1JUN A;  4PV1 C;  2CPB A;  1FZF A;  1FZB A;  4M3L A;  5KJ7 A;  3PRJ A;  3SWY A;  2QJK B;  2GM4 A;  2OGU A;  3CWB D;  1NU1 J;  5AW1 B;  2KS1 B;  1VF5 B;  3N4X A;  5KLI C;  4HYT B;  3CCQ P;  1N73 A;  3PJS K;  2QG4 A;  2M0B A;  3OA7 A;  5CJ0 A;  2E5Y A;  3VOP A;  1T8Z A;  1M90 Q;  3GF7 A;  3SWK A;  4JBZ A;  2I1J A;  4O9B A;  3HRN A;  1IFP A; 
#chains in the Genus database with same CATH homology
 1LTA C;  1YTZ I;  1JOC A;  1J1E B;  1N86 A;  4WB4 A;  2NPS C;  1NH4 A;  4LC1 A;  3A7O A;  2FKW B;  5CCG A;  1T2K D;  2E42 A;  4C7R A;  1LT9 C;  1YYC A;  2ZXE B;  3V2P A;  1NOH A;  1Z56 A;  1HVV A;  4Y99 C;  1ZN5 A;  1RY3 A;  3V5B A;  3HD7 A;  5CCG C;  1HBW A;  2C0W A;  1VDF A;  5CCH D;  1LTG C;  2XKM A;  2Q5U A;  3P8C E;  1G1J A;  1M1J B;  5AVR B;  1L4A A;  3RK2 C;  3OAK A;  1SQX K;  4N6J A;  3HD7 C;  1URQ B;  4IFD K;  1SP4 A;  1LTB C;  1GK4 A;  3NFQ A;  1GW4 A;  1GL2 B;  2WSF H;  3B5N B;  2XU6 A;  4W80 A;  1N73 B;  1J1D C;  3RL0 D;  3RK3 D;  4N78 D;  1N7S B;  1FU1 A;  1LTJ A;  3LIE A;  1RE3 C;  3BRV B;  4WY4 D;  2KSJ A;  1SFC A;  2YO2 A;  3V2N A;  2FYU K;  1LTJ C;  1WT6 A;  1SLQ A;  3KQG A;  1HGV A;  2M3B A;  3VP9 A;  2OYI B;  1SFC C;  4WBA A;  1DH3 A;  4RES B;  4HH2 A;  2HOD A;  2J59 M;  2WPS A;  1DEB A;  3EFG A;  4Y99 B;  3KPE A;  5APW A;  1SQV K;  2XDJ A;  1X79 B;  4DOJ A;  1NHL A;  1H8A A;  1NKN A;  2HFE D;  1KQL A;  1FJP A;  1CSB A;  4JYB A;  1J1E C;  1GD2 E;  4LGD E;  3HD7 B;  4ZKP A;  5AW6 B;  3VMX A;  5APV A;  1JO5 A;  4OH8 B;  3VMY A;  1MUU A;  3H6P A;  4C46 A;  1M1J A;  1QL1 A;  3A3Y B;  1FJK A;  3B8E B;  4GT1 A;  1DX7 A;  5CJ4 A;  5AW7 B;  2WPQ A;  5KJ7 D;  1IFM A;  1NTZ K;  1ZLL A;  1G1I A;  2XV5 A;  3B5N A;  1M1J C;  3VN0 A;  4I6M C;  3LW5 H;  2WZ7 A;  3KDP B;  2YMY A;  2H7H A;  1FAV A;  5APT A;  2WPR A;  2KB7 P;  1N7S A;  4XA4 A;  3MD0 A;  3NXS A;  3V2Q A;  1LTJ B;  3HTK B;  3B5N C;  2YKO A;  4N3Y B;  3TNU B;  5AVQ B;  3G3Z A;  1KIL B;  2Z5I A;  1OXZ A;  1XTG B;  1N7S C;  1FOS E;  1S9K E;  1WRG A;  1N2D C;  1NKZ B;  2OYI A;  3MTU E;  3NTN A;  3HE5 B;  2HOD B;  4I2L C;  5KTB A;  1SQP K;  2NPS D;  1J2J B;  1JY3 N;  5AVU B;  3TSI A;  2OYI C;  1LGH B;  2PP6 A;  1JMM A;  2N1T A;  2FYZ A;  2OAR A;  3M9B A;  1G2C A;  1A02 J;  2HG5 D;  2R3C A;  5CMZ A;  2VRS A;  1OWA A;  5CCG D;  3VP8 A;  5AW4 B;  2N1T C;  1JY3 P;  3GHG B;  1X8Y A;  3RK2 D;  2Q3I A;  2H43 A;  2J58 A;  1RF1 A;  2IFN A;  3U59 A;  1GU4 A;  1YTZ T;  4XE5 B;  3M91 A;  4LLH A;  2Z4E A;  1L4A D;  1RF1 C;  3EQ2 A;  1T2K C;  1RE3 A;  2O1K A;  1GW3 A;  2WWW A;  4DZO A;  1HH0 A;  1T3U A;  4W7Y A;  3HTK A;  2E43 A;  5CCH C;  3TNU A;  5AW3 B;  1KFN A;  1GDT A;  1KIL A;  1HJB A;  1HGZ A;  1KZU B;  3M06 A;  2P67 A;  1SFC D;  2I1K A;  2XNX A;  1KIL C;  3L35 A;  4B86 A;  1GU5 A;  4IFF A;  3M9H A;  3HE5 A;  3L4F A;  1FZA A;  1QL2 A;  3RK3 C;  1FZG A;  1LTT C;  2O1J A;  4AYC A;  1NU1 K;  2WIT A;  1JY2 N;  2N1T B;  1CW5 A;  1G2C B;  1IFJ A;  2KYV A;  2M8R A;  1MFZ A;  1NO4 A;  3BVH A;  3P8C D;  1GK6 A;  2MJZ A;  2H8P D;  4W7Z A;  1JY2 P;  3GHG A;  1CI6 A;  1M7L A;  1RF1 B;  2P1J A;  1X9V A;  1JTH B;  2BAS A;  3M0A A;  2W6A A;  2R5D A;  1L0L K;  3GHG C;  1NWQ A;  1H88 A;  1URQ D;  4IFM A;  3T97 A;  5APU A;  1GL2 D;  1ZR2 A;  3R2P A;  5BU8 B;  1IFI A;  3VTP C;  3H32 B;  1NTK K;  3CLQ A;  5KLV K;  3VYI A;  1SQQ K;  2JEE A;  2OYH B;  2KP8 A;  4C7N B;  3OJA B;  3RL0 B;  3RK3 B;  2ZFC A;  1IK9 A;  3IR9 A;  4EOT A;  1HTL C;  5APS A;  1IJD B;  3C9I A;  2IFM A;  4WY4 B;  3M0D A;  1JCD A;  1N7L A;  1IO4 A;  2JJL A;  2Q9I A;  1LWU A;  1VPC A;  3TK1 A;  1JY3 O;  2FFD B;  3MUD A;  1FDM A;  1SQB K;  2C9N Y;  3M0D C;  1T3J A;  2O01 H;  4N78 E;  3TYY A;  3BAT A;  2XZR A;  3U1A A;  1LWU C;  1FZE A;  2R5B A;  5AVY B;  1JCC A;  2L5G B;  2Z5H A;  2W6B A;  2W27 A;  5AVW B;  4GIF A;  2YKP A;  1CI6 B;  5AVS B;  1MV8 A;  2A45 H;  3HD7 D;  3MGN A;  5AVX B;  1ZR4 A;  1JTH A;  2YO3 A;  5AW2 B;  5AVT B;  3HUS A;  1MZ9 A;  5CCH A;  1IC2 A;  2KLV A;  1FOS F;  2WT7 B;  1LTS C;  3KYQ A;  2HLO A;  3L37 A;  3II6 A;  1S9K D;  3HUS C;  3O8Z A;  3H32 A;  2POH A;  3P32 A;  2R32 A;  1HUC A;  2OYH A;  1LTI C;  4C7N A;  4ZKU A;  1GTW A;  1KIL D;  1RF0 A;  1W2E A;  3VMZ A;  1L4A C;  2IX7 C;  1FZC A;  5AW9 B;  3BAS A;  2WSC H;  2OYH C;  3V4W A;  4WY4 A;  1RE4 A;  1CZQ A;  5AVZ B;  4EIJ A;  3RL0 C;  5APQ A;  1RF0 C;  3M9Q A;  2P7J A;  1LWU B;  4I1L A;  2YNY A;  2GUS A;  3MIW A;  1FZC C;  2FFD A;  1JY2 O;  2C9L Y;  4WY4 C;  2KOG A;  1IFD A;  1RE4 C;  2P2U A;  2CPS A;  1A02 F;  3E1I A;  4JF7 A;  2FFD C;  2NPS B;  2LKM A;  3P8M C;  3HE4 B;  3CI9 A;  2PAJ A;  2HPC B;  1LT9 B;  5AW0 B;  1AQ5 A;  2QM7 A;  5BU5 A;  2FXM A;  1E5W A;  1GZL A;  1FBM A;  2IPP A;  3HUS B;  1KFM A;  2QM8 A;  3RK2 B;  2WTY A;  1IFN A;  3V4Q A;  3PP5 A;  1PFI A;  1JUN A;  1H89 A;  1NTM K;  2WT7 A;  4GKG A;  3LID A;  2WSE H;  3B5N D;  1ZV8 A;  3A2A A;  3N7N A;  5CHX A;  5APY A;  2CPB A;  1FZF A;  1AFO A;  1FZB A;  4M3L A;  5KJ7 A;  5BVZ A;  3SWY A;  3WMM 0;  4KHX A;  3L36 A;  1L4A B;  2A45 I;  1EQ7 A;  1N7S D;  2GM4 A;  4AQR D;  5AW5 B;  1J1D B;  1URQ A;  2C0X A;  2YKQ A;  3CL3 D;  5AW1 B;  3SWF A;  2A45 G;  5KJ7 C;  1GL2 A;  1XTC C;  1L0N K;  1FZC B;  3N4X A;  4HYT B;  5AVV B;  1N73 A;  1URQ C;  3U1C A;  3BRT B;  3A5T A;  1GL2 C;  2N9B A;  1NAF A;  3OA7 A;  5CJ0 A;  2Q7C A;  1SFC B;  3NMD A;  3VOP A;  3IFM A;  1N73 C;  4AUW A;  1T8Z A;  1HWT C;  4JYC A;  1JNM A;  2GUV A;  2N1T D;  2HYN A;  2I1J A;  3I5C A;  2NPS A;  5APX A;  4O9B A;  3P7K A;  3HE4 A;  3HRN A;  5AW8 B;  1SVF A;  3UIA A;  3V2R A;  2HPC A;  1LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...