2N1TB

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
72
structure length
72
Chain Sequence
SKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 31
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tB00
3TSIA 3HD7A 2N1TA 1JTHB 1N7SC 1NHLA 1URQB 2KOGA 3HD7B 2NPSD 2N1TB 3RL0C 5CCGD 1KILC 1SFCC 3RK2B 1GL2A 3B5NC 5KJ7A 2NPSA 3KYQA 1N7SA 1KILD 1GL2B 1URQD 2NPSB 3HD7D 4W7ZA 2N1TD 3P8CE 1N7SB 1KILA 3RK2D 1SFCA 1HVVA 3B5NA 3RL0B 2HFED 1KILB 3VOPA 1GL2D 1SFCB 2WZ7A 5KJ7D 3B5NB 3RK3C 1N7SD 2HG5D 3RL0D 1L4AC 1SFCD 5CCHC 3B5ND 4W7YA 2M8RA 3RK3B 1L4AA 4WY4C 5CCHA 1L4AB 3HTKB 4LGDE 3RK3D 3M0DC 4OH8B 4JF7A 5CCGC 4WY4A 1L4AD 1XTGB 5CCHD 3PP5A 4WY4B 2PP6A 1URQC 2XDJA 3HD7C 2N1TC 5CCGA 3RK2C 4N78E 1T3JA 2H8PD 4WY4D 1JTHA 1GL2C 4W80A 5KJ7C 2NPSC 1URQA 2YMYA
chains in the Genus database with same CATH superfamily
2KZIA 1Q81Q 3FX0A 1N7SC 3AE4C 4EOTA 3H1LG 2KOGA 3HD7B 2NPSD 3GHGC 2YO2A 2WSEJ 4D6TD 2BCCG 3BVHA 5CBOA 5AW4B 3A0HH 1JO5A 1URQD 3EFGA 1JUNA 4RJTA 2FYNB 2R5BA 1ZMEC 3AEBC 4N3YB 4H0LB 3H1ID 2XU6A 2YIUC 3L36A 1SFCB 2M5AA 5KLVK 1SQQE 2HYNA 3TGUJ 1SQXD 1N7SD 1HGZA 3CD6P 4I7ZC 3CWBE 1N86A 1G2CA 3A5TA 1HJBA 3CX5E 1YJNP 3VMAA 1GD2E 1L0NE 4EDFA 4W7YA 3JC22 1IO4A 2M8RA 1VL2A 2OYIC 1NTZD 3LIEA 2P1JA 2E74C 2NZ2A 3CCMP 1X79B 1NTKG 2K1AA 3TNUA 4U7JA 2KB7P 2V7QH 3H1HJ 1FZGA 3M9HA 3H32A 1MV8A 3L75J 1NTMG 2XDJA 3HD7C 1N2DC 1S5LX 1ZRTD 3TF5A 3N7NA 3CX5H 2PRRA 2H8PD 2WPRA 2OYHA 1RE3A 2E74D 3JSVC 2KUBA 3AE1C 2FYNC 1FZAA 2P2UA 1QGKB 4H0LC 1VPCA 1AA0A 4M3LA 1SFCC 3L74D 1VQ5P 5AW9B 1K8AQ 3ABVC 3HD7D 3T97B 1HH0A 1PPJG 1NH4A 3H1HE 1L0LG 1HVVA 3RGUA 3L75E 1NU1G 3L71G 3MHVA 2QJPB 3MGNA 4C7RA 3M9BA 5APXA 2C0WA 2E76B 1SFCD 2ZYAA 1BSNA 3A3YB 4GT1A 4Z1MH 5CMZA 1IFIA 1L4AB 1SQBJ 4ASVA 1GMJA 2P67A 1KILE 4BRYB 4RKUJ 2G3AA 5KAIE 5APTA 1XTGB 5AW3B 3ITKA 1HGVA 1FJPA 1KB9D 2HPCB 1NTKK 2YMYA 3LW5J 1W2EA 4RO0A 3L72J 3I5CA 3H1KJ 1DEBA 5APYA 4CPGA 1NTMK 1KQGB 2QJPC 3AE7C 1OVUA 2CPBA 3P8CE 5GTHE 1R5LA 3BCCD 1SQVG 2E76C 1USDA 1Y9BA 5KAIH 2P7JA 2WSCJ 1FC2C 2WPQA 3WUVA 3II6A 2M0BA 1LTAC 1JM0A 2XV5A 2ZVOB 3L73G 4R4LA 4U3FG 2PGDA 1YI2P 1L4AC 1HBWA 1KC8Q 4D6TJ 4DJGA 3A0BE 2MKVA 5AVTB 4PJ0E 3O8ZA 1BCCJ 4O9BA 2Z5HA 1L0LK 1QEXA 1Q2NA 2LKMA 3H1IJ 3H1KE 1Z56A 5CJ4A 2UWJE 1YYCA 5GTHH 1K05A 2C9LY 1PP9G 2FFDB 1FE6A 3V2QA 1KN7A 1SQQD 3SFEC 4PV1B 2RMZA 1L4AD 3PP5A 4PD4E 3CWBD 3AE6C 1WT6A 4H44B 4BXLA 5CCGA 3CX5D 1L0ND 3WMM0 1OIPA 3CCQP 4H13B 4AQRD 2WPSA 5KJ7C 3QWOC 3I56P 3TSIA 3AEFC 3KPEA 2WTYA 1VQ6P 2IYOA 1KB9I 1BCCE 2M3BA 2JEEA 1S5LE 1SQPG 3Q5RA 2H88C 1DX7A 1YTZI 1H89A 1FDIA 1VF5B 4PD4H 3RL0B 3U1CA 2E75B 5KJ7D 2J5UA 2FYUG 2IX7C 3M9QA 3L74J 5CCHC 3CI9A 4TT3H 2R3SA 3HE4B 5APWA 2JO1A 2FFDC 4IL6E 2ZVNB 2JWAA 3HE5B 4PV1C 1GW4A 1SQVK 3HUSB 3NFQA 5BVZA 1S5LH 1YIJP 4H44C 3H1HD 2VRSA 5K5GB 2IFNA 2FY8A 2W6BA 2KXPB 3L75D 2Y9YA 4H13C 3KQGA 1U7MA 5APSA 1W2BO 4HYTB 5CCHD 5BU8B 1PPJE 3P7KA 3GG2A 1FOSE 2WVRA 2YXRB 1OXZA 4PV1D 3BRVB 1NU1E 3M91A 4IL6H 1LP1B 4H44D 1HJ0A 3AECC 1ZR2A 1IFJA 1VF5C 1JEKA 3RL0C 4NPDA 4H13D 2E75C 1HWTC 3RBZA 1BGYG 1RF1B 1EQ7A 1KILD 2NPSB 1FOSF 5KLVG 2XZRA 2KNCA 5APQA 3B5NB 5C39A 1KQSO 3HUSC 3RL0D 2E75D 2R5DA 2K9JA 4ASWA 1KORA 5CJ0A 1LT1A 1RY3A 2HODA 1OWAA 5B66E 3OJAB 2YNYA 1OW6A 3P8CD 1H0TA 1ZXGA 3VYIA 2AEMA 2Q9IA 1VQKP 2ZT9B 3R4YA 4JF7A 3V4WA 1LT9A 2FYUK 3W67A 3U1AA 1VQLP 1X8YA 3RL0g 2A06G 1RE4C 2ITAA 2W90A 2QIWA 3U59A 3IAOA 1RF1C 2IYPA 3L70G 1M90Q 2NPSC 1URQA 2V7QJ 4U3FE 3CL3D 2Q3EA 2YO3A 4EYYQ 3H1KD 2N1TB 2IBZE 3Q1MA 2BASA 3B5NC 4ZKPA 3C8VA 1VQ7P 1CSBA 1N7SA 3SFDC 1SS1A 4PD4D 1L0NJ 3GHGA 2HLOA 3G4SP 1PV3A 1VQ4P 1PP9E 1YITP 3VP9A 1ZV8A 3HRNA 4UB6E 2V4HA 1HUCA 1RHZB 3L37A 1QL1A 3H25A 3B5ND 1IFMA 2ZT9C 5AVSB 1BCCD 2KZJA 1CI6A 2JJLA 3JCUE 3HTKB 4AYCA 3CCEP 4LGDE 5AW2B 2ZJSE 5DJTB 2OYIA 2O01H 4EI2A 4KT0J 1LGHB 1MZ9A 2IFMA 2OYOA 1SQPE 2ZT9D 2N1TC 4UB6H 3CC2P 3M0AA 5KAFH 1HTLC 1CZQA 1P84I 2XNDH 5GTIE 4N78E 3SWFA 2R32A 3HD7A 4HH2A 1VQNP 1KQFB 2WQYC 1SQXG 3JCUH 1NWQA 1KQLA 1UIIA 1HF9A 4W7ZA 2N1TD 2OTKE 1PPJD 5BU5A 4JPZB 1SFCA 1NTZG 2Y0EA 3D6ZA 2JKVA 1S9KE 2E43A 2WZ7A 4JYBA 3C1LA 1NU1D 5GTIH 4PD4I 2KP8A 3F5HA 2GA1A 3V2RA 5H2FE 1EZVE 4GODA 2LXBA 2ZYGA 2W8ZA 4ZKUA 3WU2E 2D2CD 3CPWO 1D7MA 4Y28J 3OAKA 3M0DC 3PH0A 4OH8B 1FZFA 1ZW0A 1BGYE 3B8EB 4XFJA 2LXCB 4MN4C 2O1JA 5KLVE 3AE2C 2W83C 5H2FH 1T3JA 3WU2H 4NPFX 4DZOA 1IC2A 3V5BA 1VQMP 2HR3A 4KJMA 1T3UA 1IZNB 3T97A 3ZDMA 2O1KA 2I8DA 1GL2B 3R2PA 2CK3H 1X9VA 5TISE 1PFIA 5AVYB 1USEA 5AW6B 1SQVD 3Q2YA 1PZQA 1PGPA 3VOPA 1GU5A 2KIKA 3CCSP 3S1KA 3LIDA 3H1LJ 4GIFA 2A06E 1SQXK 4U3FD 1QVFO 3H1JG 3CXHH 1RQVA 2A45G 2BCCJ 3AE3C 4R4MA 2B87B 2IBZD 1BE3G 1XTCC 1KTMA 2QG4A 1L4AA 1LTSC 2WWWA 1NTZK 5EFWB 3EWKA 1A02J 5TISH 4BRYA 4OGQB 2KS1B 1AFOA 4TLFA 1PP9D 3IFMA 4BWNA 1T2KC 3V6IA 4A7PA 5CHXA 3BASA 1EXJA 3FWLA 3H1LE 1SVFA 2HPCA 3BCCG 1G1IA 3IF4A 1G1JA 1Q82Q 3UIAA 1GL2C 1NTKJ 2BCCE 2I1JA 1JY3O 1JTHB 1NO4A 1SP4A 1X0TA 2Q6QA 3Q5PA 2O01N 3RK2B 2YMKA 5KJ7A 1T2KD 1OFCX 4WVZA 1NTMJ 2KLUA 1MUUA 2WSFH 5TJHA 1SQPD 2MJZA 1YTZT 3BRTB 2GUVA 1ZR4A 2GM4A 1LTGC 2O3JA 1KILB 1GL2D 4HB1A 2B9BA 2C9NY 1JCDA 4N78D 2R44A 1AJYA 2L5GB 2JR8A 5CBNA 4UB8E 1SQQG 1SLQA 2E5YA 2IPPA 1K04A 4L75A 1JCCA 2WT7B 4OGQC 1NTKE 1FJKA 3CWBG 1Q7YQ 1A02F 1LNQA 1Y8AA 3E1RA 1GU4A 5CCHA 1E5WA 1L0LJ 3CCLP 2IBZI 2IDBA 2FFDA 1NTME 2RH0A 5KLIB 2ZFCA 1NU1J 3L71J 4WBAA 1LWUB 1S9KD 3VMYA 3VN0A 2P58A 5KTBA 3PRJA 3EFFK 4OGQD 4LLHA 1NAYA 3RBXA 1EZVD 5AVXB 4UB8H 3RK2C 1N7LA 1ZN5A 2QM7A 4WWIA 2PFXA 1LTJB 1N73B 3TGUG 5AW5B 3KZIE 2QRXA 3H6PA 3TYYA 1KILC 1JMBA 1L0LE 4GOEA 1M1JB 2E5TA 1BGYD 1M8OB 1RF0C 3L71E 3MUDC 1QX8A 5AW1B 3RK2D 3AE9C 5KLVD 3C9IA 4N6JA 3CX5I 3G6EP 5B5EE 3O6QB 2HG5D 3E1IA 1YQ3C 5L8RJ 3L75G 3HE4A 1WRGA 3D70A 3TDKA 3Q5SA 5KLIC 3KZIH 2Q5UA 1LTTC 3HE5A 1LWUC 3CLQA 3P32A 1OMIA 3HUSA 5AVVB 3GF7A 3E7KA 1IFNA 1SQVJ 4C7NB 3SWYA 4K3AA 1DD3A 3CCVP 2Y9ZA 4IOIH 2OTJP 4Y99B 1JY3N 1FZCB 4YXDC 3L73J 1FU1A 4U3FJ 4WB4A 2BEZF 2QSIA 4AUWA 2Q3IA 3SSUA 1LTJC 5E79E 1N73C 1SQQK 1RH5B 5B5EH 4WY4B 3CMAP 2A06D 2G8YA 4HJGH 1ZOYC 4GOFA 2XKMA 4ZNCA 2H7HA 1MKMA 1LP1A 3CC7P 1M1JC 1RE4A 2FXPA 2O01J 1M57D 1NHLA 1EZVI 1PGQA 3H1JE 5AW8B 1N8RQ 1PP9J 1RF1A 3GF3A 3G71P 1SQVE 1BE3E 1OVVA 2NPSA 4L74A 1IFDA 3AEDC 4DT0A 3N4XA 1DD4A 3S9OA 5E79H 1H8AA 3L73E 2QA4P 4YPCA 3B5NA 2SPZA 1EC5A 1SQBG 3AEAC 5AW0B 3H1LD 1NVOA 2W6JH 4KHXA 2M5AB 2C0XA 2LR2A 1FZEA 3FWNA 3D71A 2BCCD 1LTIC 3A2AA 4Y99C 1G2CB 1FZCC 1T6AA 1SQPJ 2A45H 1JY2O 2QEXP 3KXDA 4WY4C 1YQ4C 1Q86Q 3NMDA 3MIWA 2D2CB 5KAFE 1DIPA 3AEGC 5M1BA 3TNUB 3AE5C 5APVA 2FYUJ 3L72G 3GLMA 3H1KG 4C46A 4L73A 3M06A 3H32B 2WMMA 2QJYB 1FBMA 1PIXA 2QJKB 3G3ZA 3MTUE 4B86A 1NTKD 4WY4D 1EDIA 2KLVA 3NXSA 1GW3A 2OYHB 2N1TA 1VDFA 5APUA 3BATA 1YBKA 3OW2O 1J2JB 1NTMD 4D6TG 3MP7B 1PGOA 3KYQA 2K37A 1BCCG 2KSEA 3IN6A 2FYUE 5AVWB 3H1IG 3RK3E 3KDPB 2WSSH 1R8EA 3CCUP 1OW8A 1FAVA 1JNMA 2FYZA 2L91A 2D2CC 2FXMA 1J1DB 4JYCA 1BGYJ 2R3CA 4L76A 2NRGA 3FXEA 1NAFA 2J58A 1L0LD 3HTKA 1DH3A 5KLVJ 3TGUE 1AV1A 1EDLA 3PHLA 3L71D 2YXQB 1IJDB 1SQBK 2QJYC 1Y47A 2QJKC 1S4XA 1FS0E 1X22A 4NPEA 3Q3DA 5AVUB 5AVRB 1BDDA 2OYHC 1RE3C 4OWFA 2WSEH 3M0DA 1YHQP 1UIXA 4JQ0D 3AEEC 1K9MQ 1IFPA 4W80A 1OZHA 2FBWC 4IL6X 1M56D 1VQOP 5AVQB 1KYOE 2WPVB 1EXIA 3L74G 1ZP0C 2POHA 4H0LD 1NKNA 1GDTA 2GUSA 2KYVA 5DJUB 1S2EA 1KFNA 1JY2N 1J1DC 3CXHE 2DW3A 1NGMB 3L70J 1NOHA 4YTPC 3CCRP 1FDMA 1GK4A 2WSFJ 3H1JD 1AQTA 1KYOH 1L2PA 3MZWB 3VP8A 1EDKA 1JY2P 1BE3D 1QLED 3RK3B 2Z4EA 3CCJP 1BSHA 3I55P 1KMIZ 1W5CE 3L73D 2KSJA 3USSA 3L35A 3CMEP 2AEFA 2H43A 3V4QA 1VQ9P 3L70E 2JWDA 2PP6A 2K9YA 3VTPC 1T8ZA 1J1EB 1Q90D 1SQBE 4GKGA 1OW7A 2B88A 2BEQD 2IZ0A 2QE7H 2Y0DA 3V2PA 2Z5IA 3P8MC 4LC1A 2WITA 2AXCA 1P84E 1WMKA 4HKZH 1GL2A 4I6MC 2QM8A 2AEJA 2IBZG 2AXTE 2E76D 3D6YA 3RK3C 3L72E 2M3EA 3TK1A 3VMXA 2W27A 1NU1K 1E79H 1SQXJ 2B87A 1GK6A 4DCKA 1S72P 1S3JA 1P84H 4IFMA 2W6AA 1GTWA 3WUUA 1NTZJ 2A45I 1KD1Q 2KS1A 3EQ2A 3V2NA 2FYUD 3RK3D 1J1EC 3A0BH 2AXTH 4K35A 4D6TE 1FZBA 2IZ1A 3LW5H 4PJ0H 5CCGC 3G9RA 1AVOA 1OX3A 3AE8C 2YKOA 1IK9A 1RQUA 1NYHA 1DEEG 3H1IE 1L0NG 1KFMA 2Y0CA 4JBZA 4I2LC 1SQXE 3WUTA 1H88A 1JTHA 2CPSA 2WSCH 4YXWH 3TGUD 4EIJA 2QVAA 3PJSK 2JDIH 3GW6A 4OVNF 5CCGD 1S1CX 1NTZE 3PTZA 3FXDA 1KILA 3QH9A 1JOCA 2JP3A 2HFED 1RF0A 2KK7A 2KNCB 4IFFA 1QL2A 1EDJA 3MUDA 1QVGO 1M7LA 2WT7A 1LTBC 1BDCA 1ZRTE 3IR9A 1KYOD 1JMMA 4XE5B 5KKZB 2K9JB 3KHUA 1PGJA 3GMAA 1OVRA 2ZXEB 2HODB 1EZVG 3FGAD 2OARA 3H1HG 1LWUA 3S4RA 3CXHD 1H0TB 3L74E 2FKWB 3NTNA 4QMAA 1CW5A 1VQPP 1LT9B 2OTLP 1GZLA 2XNXA 4XA4A 3H1JJ 1FDOA 2H89C 3L4FA 1BE3J 1MFZA 2Q7CA 1KV4A 1IK7A 1JB0J 1LTJA 1N73A 3OA7A 4ZMDA 3MD0A 1URQB 2OGUA 2E42A 2J59M 2ZYDA 3PLNA 4RESB 2P10A 1M1JA 2PAJA 4DOJA 1VF5D 2K88A 3VMZA 2N9BA 3F89A 1TU3F 1L0NK 1N7SB 3L70D 1SQPK 1LJ2A 1JY3P 1VQ8P 5KKZC 1AVYA 3BCCJ 3GHGB 3O6QA 1SQBD 2B89A 1ZLLA 2Q1KA 1M1KQ 1MFTA 1YJ9P 1NKZB 2FXOA 2N9YB 3CC4P 3A7OA 2K3RA 2ZXXA 1P84D 1KB9E 2YIUB 3W68A 5AW7B 4C7NA 1LT9C 1NJIQ 2ZAEB 5AVZB 3B4SA 4IFDK 4I7ZB 3K5BA 1KYOI 1CI6B 2RN0A 1FZCA 2KI7B 3A0HE 1R5SA 2YKPA 1K73Q 2I1KA 2YKQA 4GDOA 4WY4A 2OYIB 3L72D 5B66H 1PL5A 1SQQJ 3BCCE 1AQ5A 2E74B 3CXHI 1URQC 1U7JA 4I1LA 3CWBJ 2RKLA 1YJWP 3B71A 1U57A 1KZUB 3SWKA 2OQQA 1KB9H
chains in the Genus database with same CATH topology
2I1JA 1JY3O 1JTHB 1N7SC 1NO4A 4EOTA 1ZR2A 1IFJA 5AVQB 2KOGA 1SP4A 3HD7B 2NPSD 3RL0C 3GHGC 1HWTC 2POHA 3RK2B 2YO2A 5KJ7A 1T2KD 3BVHA 5AW4B 1RF1B 1EQ7A 1JO5A 1KILD 1NKNA 1MUUA 2WSFH 1URQD 2GUSA 3EFGA 2NPSB 1GDTA 2KYVA 1JUNA 2MJZA 1FOSF 1YTZT 3BRTB 1KFNA 2GUVA 1ZR4A 1JY2N 2R5BA 1J1DC 2GM4A 1LTGC 4N3YB 2XZRA 2XU6A 1KILB 5APQA 1NOHA 3L36A 1GL2D 1SFCB 5KLVK 3B5NB 2HYNA 2C9NY 1JCDA 4N78D 1N7SD 1FDMA 3HUSC 1HGZA 2L5GB 1GK4A 1N86A 3RL0D 1G2CA 2R5DA 1SLQA 3A5TA 2IPPA 1JCCA 1HJBA 5CJ0A 1GD2E 2WT7B 4W7YA 3VP8A 1IO4A 1FJKA 1JY2P 1RY3A 2HODA 2M8RA 3RK3B 2Z4EA 2OYIC 1A02F 1OWAA 1GU4A 3LIEA 2P1JA 3OJAB 2YNYA 5CCHA 1E5WA 3P8CD 1X79B 3VYIA 3TNUA 2Q9IA 2FFDA 2ZFCA 2KB7P 4WBAA 1LWUB 2KSJA 4JF7A 3V4WA 1S9KD 1LT9A 2FYUK 3VMYA 3L35A 3U1AA 3VN0A 1FZGA 3M9HA 1X8YA 3H32A 2H43A 1MV8A 3V4QA 5KTBA 2PP6A 1RE4C 2XDJA 3HD7C 4LLHA 1N2DC 3VTPC 1T8ZA 3N7NA 3U59A 1J1EB 5AVXB 3RK2C 1N7LA 4GKGA 1RF1C 1ZN5A 2H8PD 2WPRA 2OYHA 1RE3A 2QM7A 2NPSC 1LTJB 1N73B 1URQA 3CL3D 5AW5B 3V2PA 2Z5IA 2YO3A 3P8MC 4LC1A 1FZAA 2N1TB 2P2UA 2WITA 3H6PA 3TYYA 1VPCA 1KILC 4M3LA 1SFCC 1GL2A 2BASA 3B5NC 4ZKPA 4I6MC 5AW9B 1CSBA 1M1JB 2QM8A 1N7SA 1RF0C 3HD7D 1HH0A 1NH4A 5AW1B 3GHGA 3RK2D 1HVVA 3C9IA 2HLOA 4N6JA 3RK3C 3VP9A 3TK1A 1ZV8A 2HG5D 3E1IA 3HRNA 3MGNA 3VMXA 4C7RA 2W27A 1NU1K 1HUCA 3M9BA 3HE4A 5APXA 1WRGA 3L37A 2C0WA 1SFCD 1GK6A 1QL1A 3B5ND 1IFMA 2Q5UA 1LTTC 3HE5A 5AVSB 1LWUC 3CLQA 3P32A 3HUSA 3A3YB 4GT1A 5AVVB 4IFMA 5CMZA 1CI6A 1IFNA 2W6AA 1GTWA 2JJLA 1IFIA 4C7NB 3SWYA 1L4AB 3HTKB 2A45I 4AYCA 3EQ2A 3V2NA 4LGDE 5AW2B 4Y99B 3RK3D 1J1EC 1JY3N 2OYIA 1FZCB 2O01H 1FZBA 3LW5H 1FU1A 5CCGC 2P67A 4WB4A 1LGHB 1MZ9A 2IFMA 4AUWA 2Q3IA 1LTJC 1N73C 5APTA 1XTGB 1SQQK 5AW3B 2YKOA 4WY4B 1IK9A 1HGVA 2N1TC 1FJPA 3M0AA 1HTLC 1KFMA 1CZQA 2XKMA 2H7HA 4I2LC 4N78E 1M1JC 1H88A 1JTHA 3SWFA 1RE4A 2HPCB 2CPSA 2WSCH 1NTKK 2YMYA 2R32A 3HD7A 4HH2A 1W2EA 4EIJA 1NHLA 5AW8B 1RF1A 5CCGD 3I5CA 1DEBA 5APYA 2NPSA 1NWQA 1NTMK 1KQLA 1IFDA 4W7ZA 2N1TD 3P8CE 2CPBA 3N4XA 1KILA 5BU5A 1H8AA 2P7JA 1SFCA 1JOCA 3B5NA 2WPQA 2HFED 1S9KE 2E43A 5AW0B 2WZ7A 1RF0A 3II6A 4JYBA 1LTAC 4IFFA 2XV5A 4KHXA 2C0XA 1QL2A 2KP8A 3MUDA 1FZEA 1M7LA 1L4AC 3V2RA 2WT7A 1LTIC 1HBWA 1LTBC 3A2AA 3IR9A 4Y99C 1JMMA 4XE5B 1G2CB 1FZCC 4ZKUA 5AVTB 3O8ZA 2ZXEB 2A45H 1JY2O 4O9BA 2HODB 2Z5HA 1L0LK 4WY4C 2LKMA 2OARA 1Z56A 3OAKA 3NMDA 1LWUA 3MIWA 5CJ4A 1YYCA 3M0DC 4OH8B 2FKWB 3NTNA 1FZFA 3TNUB 2C9LY 2FFDB 5APVA 3V2QA 1CW5A 3B8EB 1L4AD 4C46A 1LT9B 1GZLA 2XNXA 3M06A 4XA4A 3PP5A 3H32B 2O1JA 3L4FA 1WT6A 1FBMA 1MFZA 2Q7CA 3G3ZA 5CCGA 3MTUE 4B86A 3WMM0 1LTJA 1N73A 1T3JA 3OA7A 4WY4D 4AQRD 2WPSA 2KLVA 5KJ7C 3NXSA 3TSIA 1GW3A 2OYHB 2N1TA 3MD0A 4DZOA 1IC2A 1VDFA 5APUA 3V5BA 3KPEA 2WTYA 1URQB 3BATA 2E42A 2J59M 4RESB 1M1JA 1J2JB 2PAJA 2M3BA 4DOJA 1T3UA 2JEEA 3T97A 2O1KA 3VMZA 2N9BA 3KYQA 1GL2B 1DX7A 1YTZI 3R2PA 1H89A 1X9VA 1L0NK 1N7SB 1PFIA 5AVYB 5AW6B 1SQPK 5AVWB 1JY3P 3KDPB 3RL0B 3U1CA 3GHGB 3VOPA 1GU5A 5KJ7D 1ZLLA 3LIDA 1NKZB 4GIFA 2IX7C 1SQXK 1FAVA 1JNMA 2FYZA 3M9QA 2FXMA 5CCHC 1J1DB 3CI9A 2A45G 3A7OA 4JYCA 3HE4B 2R3CA 5APWA 1XTCC 2FFDC 1NAFA 2J58A 3HE5B 5AW7B 4C7NA 1GW4A 1LT9C 1L4AA 1LTSC 1SQVK 3HTKA 3HUSB 1DH3A 3NFQA 5BVZA 5AVZB 4IFDK 2WWWA 1NTZK 1IJDB 1CI6B 1SQBK 1FZCA 2VRSA 1A02J 2IFNA 2W6BA 2YKPA 1AFOA 3IFMA 3KQGA 5AVUB 2I1KA 2YKQA 4WY4A 2OYIB 5APSA 5AVRB 1T2KC 4HYTB 2OYHC 5CHXA 1RE3C 5CCHD 5BU8B 1AQ5A 3P7KA 3BASA 2WSEH 1URQC 3M0DA 1FOSE 4I1LA 1OXZA 1SVFA 2HPCA 1KZUB 3BRVB 1G1IA 1G1JA 3UIAA 1GL2C 4W80A 3M91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSI A;  3HD7 A;  2N1T A;  1JTH B;  1N7S C;  1NHL A;  1URQ B;  2KOG A;  3HD7 B;  2NPS D;  2N1T B;  3RL0 C;  5CCG D;  1KIL C;  1SFC C;  3RK2 B;  1GL2 A;  3B5N C;  5KJ7 A;  2NPS A;  3KYQ A;  1N7S A;  1KIL D;  1GL2 B;  1URQ D;  2NPS B;  3HD7 D;  4W7Z A;  2N1T D;  3P8C E;  1N7S B;  1KIL A;  3RK2 D;  1SFC A;  1HVV A;  3B5N A;  3RL0 B;  2HFE D;  1KIL B;  3VOP A;  1GL2 D;  1SFC B;  2WZ7 A;  5KJ7 D;  3B5N B;  3RK3 C;  1N7S D;  2HG5 D;  3RL0 D;  1L4A C;  1SFC D;  5CCH C;  3B5N D;  4W7Y A;  2M8R A;  3RK3 B;  1L4A A;  4WY4 C;  5CCH A;  1L4A B;  3HTK B;  4LGD E;  3RK3 D;  3M0D C;  4OH8 B;  4JF7 A;  5CCG C;  4WY4 A;  1L4A D;  1XTG B;  5CCH D;  3PP5 A;  4WY4 B;  2PP6 A;  1URQ C;  2XDJ A;  3HD7 C;  2N1T C;  5CCG A;  3RK2 C;  4N78 E;  1T3J A;  2H8P D;  4WY4 D;  1JTH A;  1GL2 C;  4W80 A;  5KJ7 C;  2NPS C;  1URQ A;  2YMY A; 
#chains in the Genus database with same CATH topology
 2KZI A;  1Q81 Q;  3FX0 A;  1N7S C;  3AE4 C;  4EOT A;  3H1L G;  2KOG A;  3HD7 B;  2NPS D;  3GHG C;  2YO2 A;  2WSE J;  4D6T D;  2BCC G;  3BVH A;  5CBO A;  5AW4 B;  3A0H H;  1JO5 A;  1URQ D;  3EFG A;  1JUN A;  4RJT A;  2FYN B;  2R5B A;  1ZME C;  3AEB C;  4N3Y B;  4H0L B;  3H1I D;  2XU6 A;  2YIU C;  3L36 A;  1SFC B;  2M5A A;  5KLV K;  1SQQ E;  2HYN A;  3TGU J;  1SQX D;  1N7S D;  1HGZ A;  3CD6 P;  4I7Z C;  3CWB E;  1N86 A;  1G2C A;  3A5T A;  1HJB A;  3CX5 E;  1YJN P;  3VMA A;  1GD2 E;  1L0N E;  4EDF A;  4W7Y A;  3JC2 2;  1IO4 A;  2M8R A;  1VL2 A;  2OYI C;  1NTZ D;  3LIE A;  2P1J A;  2E74 C;  2NZ2 A;  3CCM P;  1X79 B;  1NTK G;  2K1A A;  3TNU A;  4U7J A;  2KB7 P;  2V7Q H;  3H1H J;  1FZG A;  3M9H A;  3H32 A;  1MV8 A;  3L75 J;  1NTM G;  2XDJ A;  3HD7 C;  1N2D C;  1S5L X;  1ZRT D;  3TF5 A;  3N7N A;  3CX5 H;  2PRR A;  2H8P D;  2WPR A;  2OYH A;  1RE3 A;  2E74 D;  3JSV C;  2KUB A;  3AE1 C;  2FYN C;  1FZA A;  2P2U A;  1QGK B;  4H0L C;  1VPC A;  1AA0 A;  4M3L A;  1SFC C;  3L74 D;  1VQ5 P;  5AW9 B;  1K8A Q;  3ABV C;  3HD7 D;  3T97 B;  1HH0 A;  1PPJ G;  1NH4 A;  3H1H E;  1L0L G;  1HVV A;  3RGU A;  3L75 E;  1NU1 G;  3L71 G;  3MHV A;  2QJP B;  3MGN A;  4C7R A;  3M9B A;  5APX A;  2C0W A;  2E76 B;  1SFC D;  2ZYA A;  1BSN A;  3A3Y B;  4GT1 A;  4Z1M H;  5CMZ A;  1IFI A;  1L4A B;  1SQB J;  4ASV A;  1GMJ A;  2P67 A;  1KIL E;  4BRY B;  4RKU J;  2G3A A;  5KAI E;  5APT A;  1XTG B;  5AW3 B;  3ITK A;  1HGV A;  1FJP A;  1KB9 D;  2HPC B;  1NTK K;  2YMY A;  3LW5 J;  1W2E A;  4RO0 A;  3L72 J;  3I5C A;  3H1K J;  1DEB A;  5APY A;  4CPG A;  1NTM K;  1KQG B;  2QJP C;  3AE7 C;  1OVU A;  2CPB A;  3P8C E;  5GTH E;  1R5L A;  3BCC D;  1SQV G;  2E76 C;  1USD A;  1Y9B A;  5KAI H;  2P7J A;  2WSC J;  1FC2 C;  2WPQ A;  3WUV A;  3II6 A;  2M0B A;  1LTA C;  1JM0 A;  2XV5 A;  2ZVO B;  3L73 G;  4R4L A;  4U3F G;  2PGD A;  1YI2 P;  1L4A C;  1HBW A;  1KC8 Q;  4D6T J;  4DJG A;  3A0B E;  2MKV A;  5AVT B;  4PJ0 E;  3O8Z A;  1BCC J;  4O9B A;  2Z5H A;  1L0L K;  1QEX A;  1Q2N A;  2LKM A;  3H1I J;  3H1K E;  1Z56 A;  5CJ4 A;  2UWJ E;  1YYC A;  5GTH H;  1K05 A;  2C9L Y;  1PP9 G;  2FFD B;  1FE6 A;  3V2Q A;  1KN7 A;  1SQQ D;  3SFE C;  4PV1 B;  2RMZ A;  1L4A D;  3PP5 A;  4PD4 E;  3CWB D;  3AE6 C;  1WT6 A;  4H44 B;  4BXL A;  5CCG A;  3CX5 D;  1L0N D;  3WMM 0;  1OIP A;  3CCQ P;  4H13 B;  4AQR D;  2WPS A;  5KJ7 C;  3QWO C;  3I56 P;  3TSI A;  3AEF C;  3KPE A;  2WTY A;  1VQ6 P;  2IYO A;  1KB9 I;  1BCC E;  2M3B A;  2JEE A;  1S5L E;  1SQP G;  3Q5R A;  2H88 C;  1DX7 A;  1YTZ I;  1H89 A;  1FDI A;  1VF5 B;  4PD4 H;  3RL0 B;  3U1C A;  2E75 B;  5KJ7 D;  2J5U A;  2FYU G;  2IX7 C;  3M9Q A;  3L74 J;  5CCH C;  3CI9 A;  4TT3 H;  2R3S A;  3HE4 B;  5APW A;  2JO1 A;  2FFD C;  4IL6 E;  2ZVN B;  2JWA A;  3HE5 B;  4PV1 C;  1GW4 A;  1SQV K;  3HUS B;  3NFQ A;  5BVZ A;  1S5L H;  1YIJ P;  4H44 C;  3H1H D;  2VRS A;  5K5G B;  2IFN A;  2FY8 A;  2W6B A;  2KXP B;  3L75 D;  2Y9Y A;  4H13 C;  3KQG A;  1U7M A;  5APS A;  1W2B O;  4HYT B;  5CCH D;  5BU8 B;  1PPJ E;  3P7K A;  3GG2 A;  1FOS E;  2WVR A;  2YXR B;  1OXZ A;  4PV1 D;  3BRV B;  1NU1 E;  3M91 A;  4IL6 H;  1LP1 B;  4H44 D;  1HJ0 A;  3AEC C;  1ZR2 A;  1IFJ A;  1VF5 C;  1JEK A;  3RL0 C;  4NPD A;  4H13 D;  2E75 C;  1HWT C;  3RBZ A;  1BGY G;  1RF1 B;  1EQ7 A;  1KIL D;  2NPS B;  1FOS F;  5KLV G;  2XZR A;  2KNC A;  5APQ A;  3B5N B;  5C39 A;  1KQS O;  3HUS C;  3RL0 D;  2E75 D;  2R5D A;  2K9J A;  4ASW A;  1KOR A;  5CJ0 A;  1LT1 A;  1RY3 A;  2HOD A;  1OWA A;  5B66 E;  3OJA B;  2YNY A;  1OW6 A;  3P8C D;  1H0T A;  1ZXG A;  3VYI A;  2AEM A;  2Q9I A;  1VQK P;  2ZT9 B;  3R4Y A;  4JF7 A;  3V4W A;  1LT9 A;  2FYU K;  3W67 A;  3U1A A;  1VQL P;  1X8Y A;  3RL0 g;  2A06 G;  1RE4 C;  2ITA A;  2W90 A;  2QIW A;  3U59 A;  3IAO A;  1RF1 C;  2IYP A;  3L70 G;  1M90 Q;  2NPS C;  1URQ A;  2V7Q J;  4U3F E;  3CL3 D;  2Q3E A;  2YO3 A;  4EYY Q;  3H1K D;  2N1T B;  2IBZ E;  3Q1M A;  2BAS A;  3B5N C;  4ZKP A;  3C8V A;  1VQ7 P;  1CSB A;  1N7S A;  3SFD C;  1SS1 A;  4PD4 D;  1L0N J;  3GHG A;  2HLO A;  3G4S P;  1PV3 A;  1VQ4 P;  1PP9 E;  1YIT P;  3VP9 A;  1ZV8 A;  3HRN A;  4UB6 E;  2V4H A;  1HUC A;  1RHZ B;  3L37 A;  1QL1 A;  3H25 A;  3B5N D;  1IFM A;  2ZT9 C;  5AVS B;  1BCC D;  2KZJ A;  1CI6 A;  2JJL A;  3JCU E;  3HTK B;  4AYC A;  3CCE P;  4LGD E;  5AW2 B;  2ZJS E;  5DJT B;  2OYI A;  2O01 H;  4EI2 A;  4KT0 J;  1LGH B;  1MZ9 A;  2IFM A;  2OYO A;  1SQP E;  2ZT9 D;  2N1T C;  4UB6 H;  3CC2 P;  3M0A A;  5KAF H;  1HTL C;  1CZQ A;  1P84 I;  2XND H;  5GTI E;  4N78 E;  3SWF A;  2R32 A;  3HD7 A;  4HH2 A;  1VQN P;  1KQF B;  2WQY C;  1SQX G;  3JCU H;  1NWQ A;  1KQL A;  1UII A;  1HF9 A;  4W7Z A;  2N1T D;  2OTK E;  1PPJ D;  5BU5 A;  4JPZ B;  1SFC A;  1NTZ G;  2Y0E A;  3D6Z A;  2JKV A;  1S9K E;  2E43 A;  2WZ7 A;  4JYB A;  3C1L A;  1NU1 D;  5GTI H;  4PD4 I;  2KP8 A;  3F5H A;  2GA1 A;  3V2R A;  5H2F E;  1EZV E;  4GOD A;  2LXB A;  2ZYG A;  2W8Z A;  4ZKU A;  3WU2 E;  2D2C D;  3CPW O;  1D7M A;  4Y28 J;  3OAK A;  3M0D C;  3PH0 A;  4OH8 B;  1FZF A;  1ZW0 A;  1BGY E;  3B8E B;  4XFJ A;  2LXC B;  4MN4 C;  2O1J A;  5KLV E;  3AE2 C;  2W83 C;  5H2F H;  1T3J A;  3WU2 H;  4NPF X;  4DZO A;  1IC2 A;  3V5B A;  1VQM P;  2HR3 A;  4KJM A;  1T3U A;  1IZN B;  3T97 A;  3ZDM A;  2O1K A;  2I8D A;  1GL2 B;  3R2P A;  2CK3 H;  1X9V A;  5TIS E;  1PFI A;  5AVY B;  1USE A;  5AW6 B;  1SQV D;  3Q2Y A;  1PZQ A;  1PGP A;  3VOP A;  1GU5 A;  2KIK A;  3CCS P;  3S1K A;  3LID A;  3H1L J;  4GIF A;  2A06 E;  1SQX K;  4U3F D;  1QVF O;  3H1J G;  3CXH H;  1RQV A;  2A45 G;  2BCC J;  3AE3 C;  4R4M A;  2B87 B;  2IBZ D;  1BE3 G;  1XTC C;  1KTM A;  2QG4 A;  1L4A A;  1LTS C;  2WWW A;  1NTZ K;  5EFW B;  3EWK A;  1A02 J;  5TIS H;  4BRY A;  4OGQ B;  2KS1 B;  1AFO A;  4TLF A;  1PP9 D;  3IFM A;  4BWN A;  1T2K C;  3V6I A;  4A7P A;  5CHX A;  3BAS A;  1EXJ A;  3FWL A;  3H1L E;  1SVF A;  2HPC A;  3BCC G;  1G1I A;  3IF4 A;  1G1J A;  1Q82 Q;  3UIA A;  1GL2 C;  1NTK J;  2BCC E;  2I1J A;  1JY3 O;  1JTH B;  1NO4 A;  1SP4 A;  1X0T A;  2Q6Q A;  3Q5P A;  2O01 N;  3RK2 B;  2YMK A;  5KJ7 A;  1T2K D;  1OFC X;  4WVZ A;  1NTM J;  2KLU A;  1MUU A;  2WSF H;  5TJH A;  1SQP D;  2MJZ A;  1YTZ T;  3BRT B;  2GUV A;  1ZR4 A;  2GM4 A;  1LTG C;  2O3J A;  1KIL B;  1GL2 D;  4HB1 A;  2B9B A;  2C9N Y;  1JCD A;  4N78 D;  2R44 A;  1AJY A;  2L5G B;  2JR8 A;  5CBN A;  4UB8 E;  1SQQ G;  1SLQ A;  2E5Y A;  2IPP A;  1K04 A;  4L75 A;  1JCC A;  2WT7 B;  4OGQ C;  1NTK E;  1FJK A;  3CWB G;  1Q7Y Q;  1A02 F;  1LNQ A;  1Y8A A;  3E1R A;  1GU4 A;  5CCH A;  1E5W A;  1L0L J;  3CCL P;  2IBZ I;  2IDB A;  2FFD A;  1NTM E;  2RH0 A;  5KLI B;  2ZFC A;  1NU1 J;  3L71 J;  4WBA A;  1LWU B;  1S9K D;  3VMY A;  3VN0 A;  2P58 A;  5KTB A;  3PRJ A;  3EFF K;  4OGQ D;  4LLH A;  1NAY A;  3RBX A;  1EZV D;  5AVX B;  4UB8 H;  3RK2 C;  1N7L A;  1ZN5 A;  2QM7 A;  4WWI A;  2PFX A;  1LTJ B;  1N73 B;  3TGU G;  5AW5 B;  3KZI E;  2QRX A;  3H6P A;  3TYY A;  1KIL C;  1JMB A;  1L0L E;  4GOE A;  1M1J B;  2E5T A;  1BGY D;  1M8O B;  1RF0 C;  3L71 E;  3MUD C;  1QX8 A;  5AW1 B;  3RK2 D;  3AE9 C;  5KLV D;  3C9I A;  4N6J A;  3CX5 I;  3G6E P;  5B5E E;  3O6Q B;  2HG5 D;  3E1I A;  1YQ3 C;  5L8R J;  3L75 G;  3HE4 A;  1WRG A;  3D70 A;  3TDK A;  3Q5S A;  5KLI C;  3KZI H;  2Q5U A;  1LTT C;  3HE5 A;  1LWU C;  3CLQ A;  3P32 A;  1OMI A;  3HUS A;  5AVV B;  3GF7 A;  3E7K A;  1IFN A;  1SQV J;  4C7N B;  3SWY A;  4K3A A;  1DD3 A;  3CCV P;  2Y9Z A;  4IOI H;  2OTJ P;  4Y99 B;  1JY3 N;  1FZC B;  4YXD C;  3L73 J;  1FU1 A;  4U3F J;  4WB4 A;  2BEZ F;  2QSI A;  4AUW A;  2Q3I A;  3SSU A;  1LTJ C;  5E79 E;  1N73 C;  1SQQ K;  1RH5 B;  5B5E H;  4WY4 B;  3CMA P;  2A06 D;  2G8Y A;  4HJG H;  1ZOY C;  4GOF A;  2XKM A;  4ZNC A;  2H7H A;  1MKM A;  1LP1 A;  3CC7 P;  1M1J C;  1RE4 A;  2FXP A;  2O01 J;  1M57 D;  1NHL A;  1EZV I;  1PGQ A;  3H1J E;  5AW8 B;  1N8R Q;  1PP9 J;  1RF1 A;  3GF3 A;  3G71 P;  1SQV E;  1BE3 E;  1OVV A;  2NPS A;  4L74 A;  1IFD A;  3AED C;  4DT0 A;  3N4X A;  1DD4 A;  3S9O A;  5E79 H;  1H8A A;  3L73 E;  2QA4 P;  4YPC A;  3B5N A;  2SPZ A;  1EC5 A;  1SQB G;  3AEA C;  5AW0 B;  3H1L D;  1NVO A;  2W6J H;  4KHX A;  2M5A B;  2C0X A;  2LR2 A;  1FZE A;  3FWN A;  3D71 A;  2BCC D;  1LTI C;  3A2A A;  4Y99 C;  1G2C B;  1FZC C;  1T6A A;  1SQP J;  2A45 H;  1JY2 O;  2QEX P;  3KXD A;  4WY4 C;  1YQ4 C;  1Q86 Q;  3NMD A;  3MIW A;  2D2C B;  5KAF E;  1DIP A;  3AEG C;  5M1B A;  3TNU B;  3AE5 C;  5APV A;  2FYU J;  3L72 G;  3GLM A;  3H1K G;  4C46 A;  4L73 A;  3M06 A;  3H32 B;  2WMM A;  2QJY B;  1FBM A;  1PIX A;  2QJK B;  3G3Z A;  3MTU E;  4B86 A;  1NTK D;  4WY4 D;  1EDI A;  2KLV A;  3NXS A;  1GW3 A;  2OYH B;  2N1T A;  1VDF A;  5APU A;  3BAT A;  1YBK A;  3OW2 O;  1J2J B;  1NTM D;  4D6T G;  3MP7 B;  1PGO A;  3KYQ A;  2K37 A;  1BCC G;  2KSE A;  3IN6 A;  2FYU E;  5AVW B;  3H1I G;  3RK3 E;  3KDP B;  2WSS H;  1R8E A;  3CCU P;  1OW8 A;  1FAV A;  1JNM A;  2FYZ A;  2L91 A;  2D2C C;  2FXM A;  1J1D B;  4JYC A;  1BGY J;  2R3C A;  4L76 A;  2NRG A;  3FXE A;  1NAF A;  2J58 A;  1L0L D;  3HTK A;  1DH3 A;  5KLV J;  3TGU E;  1AV1 A;  1EDL A;  3PHL A;  3L71 D;  2YXQ B;  1IJD B;  1SQB K;  2QJY C;  1Y47 A;  2QJK C;  1S4X A;  1FS0 E;  1X22 A;  4NPE A;  3Q3D A;  5AVU B;  5AVR B;  1BDD A;  2OYH C;  1RE3 C;  4OWF A;  2WSE H;  3M0D A;  1YHQ P;  1UIX A;  4JQ0 D;  3AEE C;  1K9M Q;  1IFP A;  4W80 A;  1OZH A;  2FBW C;  4IL6 X;  1M56 D;  1VQO P;  5AVQ B;  1KYO E;  2WPV B;  1EXI A;  3L74 G;  1ZP0 C;  2POH A;  4H0L D;  1NKN A;  1GDT A;  2GUS A;  2KYV A;  5DJU B;  1S2E A;  1KFN A;  1JY2 N;  1J1D C;  3CXH E;  2DW3 A;  1NGM B;  3L70 J;  1NOH A;  4YTP C;  3CCR P;  1FDM A;  1GK4 A;  2WSF J;  3H1J D;  1AQT A;  1KYO H;  1L2P A;  3MZW B;  3VP8 A;  1EDK A;  1JY2 P;  1BE3 D;  1QLE D;  3RK3 B;  2Z4E A;  3CCJ P;  1BSH A;  3I55 P;  1KMI Z;  1W5C E;  3L73 D;  2KSJ A;  3USS A;  3L35 A;  3CME P;  2AEF A;  2H43 A;  3V4Q A;  1VQ9 P;  3L70 E;  2JWD A;  2PP6 A;  2K9Y A;  3VTP C;  1T8Z A;  1J1E B;  1Q90 D;  1SQB E;  4GKG A;  1OW7 A;  2B88 A;  2BEQ D;  2IZ0 A;  2QE7 H;  2Y0D A;  3V2P A;  2Z5I A;  3P8M C;  4LC1 A;  2WIT A;  2AXC A;  1P84 E;  1WMK A;  4HKZ H;  1GL2 A;  4I6M C;  2QM8 A;  2AEJ A;  2IBZ G;  2AXT E;  2E76 D;  3D6Y A;  3RK3 C;  3L72 E;  2M3E A;  3TK1 A;  3VMX A;  2W27 A;  1NU1 K;  1E79 H;  1SQX J;  2B87 A;  1GK6 A;  4DCK A;  1S72 P;  1S3J A;  1P84 H;  4IFM A;  2W6A A;  1GTW A;  3WUU A;  1NTZ J;  2A45 I;  1KD1 Q;  2KS1 A;  3EQ2 A;  3V2N A;  2FYU D;  3RK3 D;  1J1E C;  3A0B H;  2AXT H;  4K35 A;  4D6T E;  1FZB A;  2IZ1 A;  3LW5 H;  4PJ0 H;  5CCG C;  3G9R A;  1AVO A;  1OX3 A;  3AE8 C;  2YKO A;  1IK9 A;  1RQU A;  1NYH A;  1DEE G;  3H1I E;  1L0N G;  1KFM A;  2Y0C A;  4JBZ A;  4I2L C;  1SQX E;  3WUT A;  1H88 A;  1JTH A;  2CPS A;  2WSC H;  4YXW H;  3TGU D;  4EIJ A;  2QVA A;  3PJS K;  2JDI H;  3GW6 A;  4OVN F;  5CCG D;  1S1C X;  1NTZ E;  3PTZ A;  3FXD A;  1KIL A;  3QH9 A;  1JOC A;  2JP3 A;  2HFE D;  1RF0 A;  2KK7 A;  2KNC B;  4IFF A;  1QL2 A;  1EDJ A;  3MUD A;  1QVG O;  1M7L A;  2WT7 A;  1LTB C;  1BDC A;  1ZRT E;  3IR9 A;  1KYO D;  1JMM A;  4XE5 B;  5KKZ B;  2K9J B;  3KHU A;  1PGJ A;  3GMA A;  1OVR A;  2ZXE B;  2HOD B;  1EZV G;  3FGA D;  2OAR A;  3H1H G;  1LWU A;  3S4R A;  3CXH D;  1H0T B;  3L74 E;  2FKW B;  3NTN A;  4QMA A;  1CW5 A;  1VQP P;  1LT9 B;  2OTL P;  1GZL A;  2XNX A;  4XA4 A;  3H1J J;  1FDO A;  2H89 C;  3L4F A;  1BE3 J;  1MFZ A;  2Q7C A;  1KV4 A;  1IK7 A;  1JB0 J;  1LTJ A;  1N73 A;  3OA7 A;  4ZMD A;  3MD0 A;  1URQ B;  2OGU A;  2E42 A;  2J59 M;  2ZYD A;  3PLN A;  4RES B;  2P10 A;  1M1J A;  2PAJ A;  4DOJ A;  1VF5 D;  2K88 A;  3VMZ A;  2N9B A;  3F89 A;  1TU3 F;  1L0N K;  1N7S B;  3L70 D;  1SQP K;  1LJ2 A;  1JY3 P;  1VQ8 P;  5KKZ C;  1AVY A;  3BCC J;  3GHG B;  3O6Q A;  1SQB D;  2B89 A;  1ZLL A;  2Q1K A;  1M1K Q;  1MFT A;  1YJ9 P;  1NKZ B;  2FXO A;  2N9Y B;  3CC4 P;  3A7O A;  2K3R A;  2ZXX A;  1P84 D;  1KB9 E;  2YIU B;  3W68 A;  5AW7 B;  4C7N A;  1LT9 C;  1NJI Q;  2ZAE B;  5AVZ B;  3B4S A;  4IFD K;  4I7Z B;  3K5B A;  1KYO I;  1CI6 B;  2RN0 A;  1FZC A;  2KI7 B;  3A0H E;  1R5S A;  2YKP A;  1K73 Q;  2I1K A;  2YKQ A;  4GDO A;  4WY4 A;  2OYI B;  3L72 D;  5B66 H;  1PL5 A;  1SQQ J;  3BCC E;  1AQ5 A;  2E74 B;  3CXH I;  1URQ C;  1U7J A;  4I1L A;  3CWB J;  2RKL A;  1YJW P;  3B71 A;  1U57 A;  1KZU B;  3SWK A;  2OQQ A;  1KB9 H; 
#chains in the Genus database with same CATH homology
 2I1J A;  1JY3 O;  1JTH B;  1N7S C;  1NO4 A;  4EOT A;  1ZR2 A;  1IFJ A;  5AVQ B;  2KOG A;  1SP4 A;  3HD7 B;  2NPS D;  3RL0 C;  3GHG C;  1HWT C;  2POH A;  3RK2 B;  2YO2 A;  5KJ7 A;  1T2K D;  3BVH A;  5AW4 B;  1RF1 B;  1EQ7 A;  1JO5 A;  1KIL D;  1NKN A;  1MUU A;  2WSF H;  1URQ D;  2GUS A;  3EFG A;  2NPS B;  1GDT A;  2KYV A;  1JUN A;  2MJZ A;  1FOS F;  1YTZ T;  3BRT B;  1KFN A;  2GUV A;  1ZR4 A;  1JY2 N;  2R5B A;  1J1D C;  2GM4 A;  1LTG C;  4N3Y B;  2XZR A;  2XU6 A;  1KIL B;  5APQ A;  1NOH A;  3L36 A;  1GL2 D;  1SFC B;  5KLV K;  3B5N B;  2HYN A;  2C9N Y;  1JCD A;  4N78 D;  1N7S D;  1FDM A;  3HUS C;  1HGZ A;  2L5G B;  1GK4 A;  1N86 A;  3RL0 D;  1G2C A;  2R5D A;  1SLQ A;  3A5T A;  2IPP A;  1JCC A;  1HJB A;  5CJ0 A;  1GD2 E;  2WT7 B;  4W7Y A;  3VP8 A;  1IO4 A;  1FJK A;  1JY2 P;  1RY3 A;  2HOD A;  2M8R A;  3RK3 B;  2Z4E A;  2OYI C;  1A02 F;  1OWA A;  1GU4 A;  3LIE A;  2P1J A;  3OJA B;  2YNY A;  5CCH A;  1E5W A;  3P8C D;  1X79 B;  3VYI A;  3TNU A;  2Q9I A;  2FFD A;  2ZFC A;  2KB7 P;  4WBA A;  1LWU B;  2KSJ A;  4JF7 A;  3V4W A;  1S9K D;  1LT9 A;  2FYU K;  3VMY A;  3L35 A;  3U1A A;  3VN0 A;  1FZG A;  3M9H A;  1X8Y A;  3H32 A;  2H43 A;  1MV8 A;  3V4Q A;  5KTB A;  2PP6 A;  1RE4 C;  2XDJ A;  3HD7 C;  4LLH A;  1N2D C;  3VTP C;  1T8Z A;  3N7N A;  3U59 A;  1J1E B;  5AVX B;  3RK2 C;  1N7L A;  4GKG A;  1RF1 C;  1ZN5 A;  2H8P D;  2WPR A;  2OYH A;  1RE3 A;  2QM7 A;  2NPS C;  1LTJ B;  1N73 B;  1URQ A;  3CL3 D;  5AW5 B;  3V2P A;  2Z5I A;  2YO3 A;  3P8M C;  4LC1 A;  1FZA A;  2N1T B;  2P2U A;  2WIT A;  3H6P A;  3TYY A;  1VPC A;  1KIL C;  4M3L A;  1SFC C;  1GL2 A;  2BAS A;  3B5N C;  4ZKP A;  4I6M C;  5AW9 B;  1CSB A;  1M1J B;  2QM8 A;  1N7S A;  1RF0 C;  3HD7 D;  1HH0 A;  1NH4 A;  5AW1 B;  3GHG A;  3RK2 D;  1HVV A;  3C9I A;  2HLO A;  4N6J A;  3RK3 C;  3VP9 A;  3TK1 A;  1ZV8 A;  2HG5 D;  3E1I A;  3HRN A;  3MGN A;  3VMX A;  4C7R A;  2W27 A;  1NU1 K;  1HUC A;  3M9B A;  3HE4 A;  5APX A;  1WRG A;  3L37 A;  2C0W A;  1SFC D;  1GK6 A;  1QL1 A;  3B5N D;  1IFM A;  2Q5U A;  1LTT C;  3HE5 A;  5AVS B;  1LWU C;  3CLQ A;  3P32 A;  3HUS A;  3A3Y B;  4GT1 A;  5AVV B;  4IFM A;  5CMZ A;  1CI6 A;  1IFN A;  2W6A A;  1GTW A;  2JJL A;  1IFI A;  4C7N B;  3SWY A;  1L4A B;  3HTK B;  2A45 I;  4AYC A;  3EQ2 A;  3V2N A;  4LGD E;  5AW2 B;  4Y99 B;  3RK3 D;  1J1E C;  1JY3 N;  2OYI A;  1FZC B;  2O01 H;  1FZB A;  3LW5 H;  1FU1 A;  5CCG C;  2P67 A;  4WB4 A;  1LGH B;  1MZ9 A;  2IFM A;  4AUW A;  2Q3I A;  1LTJ C;  1N73 C;  5APT A;  1XTG B;  1SQQ K;  5AW3 B;  2YKO A;  4WY4 B;  1IK9 A;  1HGV A;  2N1T C;  1FJP A;  3M0A A;  1HTL C;  1KFM A;  1CZQ A;  2XKM A;  2H7H A;  4I2L C;  4N78 E;  1M1J C;  1H88 A;  1JTH A;  3SWF A;  1RE4 A;  2HPC B;  2CPS A;  2WSC H;  1NTK K;  2YMY A;  2R32 A;  3HD7 A;  4HH2 A;  1W2E A;  4EIJ A;  1NHL A;  5AW8 B;  1RF1 A;  5CCG D;  3I5C A;  1DEB A;  5APY A;  2NPS A;  1NWQ A;  1NTM K;  1KQL A;  1IFD A;  4W7Z A;  2N1T D;  3P8C E;  2CPB A;  3N4X A;  1KIL A;  5BU5 A;  1H8A A;  2P7J A;  1SFC A;  1JOC A;  3B5N A;  2WPQ A;  2HFE D;  1S9K E;  2E43 A;  5AW0 B;  2WZ7 A;  1RF0 A;  3II6 A;  4JYB A;  1LTA C;  4IFF A;  2XV5 A;  4KHX A;  2C0X A;  1QL2 A;  2KP8 A;  3MUD A;  1FZE A;  1M7L A;  1L4A C;  3V2R A;  2WT7 A;  1LTI C;  1HBW A;  1LTB C;  3A2A A;  3IR9 A;  4Y99 C;  1JMM A;  4XE5 B;  1G2C B;  1FZC C;  4ZKU A;  5AVT B;  3O8Z A;  2ZXE B;  2A45 H;  1JY2 O;  4O9B A;  2HOD B;  2Z5H A;  1L0L K;  4WY4 C;  2LKM A;  2OAR A;  1Z56 A;  3OAK A;  3NMD A;  1LWU A;  3MIW A;  5CJ4 A;  1YYC A;  3M0D C;  4OH8 B;  2FKW B;  3NTN A;  1FZF A;  3TNU B;  2C9L Y;  2FFD B;  5APV A;  3V2Q A;  1CW5 A;  3B8E B;  1L4A D;  4C46 A;  1LT9 B;  1GZL A;  2XNX A;  3M06 A;  4XA4 A;  3PP5 A;  3H32 B;  2O1J A;  3L4F A;  1WT6 A;  1FBM A;  1MFZ A;  2Q7C A;  3G3Z A;  5CCG A;  3MTU E;  4B86 A;  3WMM 0;  1LTJ A;  1N73 A;  1T3J A;  3OA7 A;  4WY4 D;  4AQR D;  2WPS A;  2KLV A;  5KJ7 C;  3NXS A;  3TSI A;  1GW3 A;  2OYH B;  2N1T A;  3MD0 A;  4DZO A;  1IC2 A;  1VDF A;  5APU A;  3V5B A;  3KPE A;  2WTY A;  1URQ B;  3BAT A;  2E42 A;  2J59 M;  4RES B;  1M1J A;  1J2J B;  2PAJ A;  2M3B A;  4DOJ A;  1T3U A;  2JEE A;  3T97 A;  2O1K A;  3VMZ A;  2N9B A;  3KYQ A;  1GL2 B;  1DX7 A;  1YTZ I;  3R2P A;  1H89 A;  1X9V A;  1L0N K;  1N7S B;  1PFI A;  5AVY B;  5AW6 B;  1SQP K;  5AVW B;  1JY3 P;  3KDP B;  3RL0 B;  3U1C A;  3GHG B;  3VOP A;  1GU5 A;  5KJ7 D;  1ZLL A;  3LID A;  1NKZ B;  4GIF A;  2IX7 C;  1SQX K;  1FAV A;  1JNM A;  2FYZ A;  3M9Q A;  2FXM A;  5CCH C;  1J1D B;  3CI9 A;  2A45 G;  3A7O A;  4JYC A;  3HE4 B;  2R3C A;  5APW A;  1XTC C;  2FFD C;  1NAF A;  2J58 A;  3HE5 B;  5AW7 B;  4C7N A;  1GW4 A;  1LT9 C;  1L4A A;  1LTS C;  1SQV K;  3HTK A;  3HUS B;  1DH3 A;  3NFQ A;  5BVZ A;  5AVZ B;  4IFD K;  2WWW A;  1NTZ K;  1IJD B;  1CI6 B;  1SQB K;  1FZC A;  2VRS A;  1A02 J;  2IFN A;  2W6B A;  2YKP A;  1AFO A;  3IFM A;  3KQG A;  5AVU B;  2I1K A;  2YKQ A;  4WY4 A;  2OYI B;  5APS A;  5AVR B;  1T2K C;  4HYT B;  2OYH C;  5CHX A;  1RE3 C;  5CCH D;  5BU8 B;  1AQ5 A;  3P7K A;  3BAS A;  2WSE H;  1URQ C;  3M0D A;  1FOS E;  4I1L A;  1OXZ A;  1SVF A;  2HPC A;  1KZU B;  3BRV B;  1G1I A;  1G1J A;  3UIA A;  1GL2 C;  4W80 A;  3M91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...