3L74G

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 18
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l74G00
3H1IG 1SQPG 1NTZG 3L72G 4U3FG 1BCCG 3L74G 3H1HG 2IBZG 2A06G 3CWBG 1SQVG 3CX5H 1P84H 3CXHH 3H1LG 3TGUG 1SQXG 5KLVG 1KB9H 1NTKG 3L70G 4D6TG 3H1KG 1EZVG 1L0LG 1PPJG 1SQBG 1NU1G 4PD4H 1L0NG 1BGYG 3L75G 3L73G 1BE3G 3BCCG 1PP9G 3L71G 3H1JG 1NTMG 1SQQG 2FYUG 1KYOH 2BCCG
chains in the Genus database with same CATH superfamily
2O1KA 1T3UA 2OQQA 2FY8A 1DIPA 2V7QJ 2K9JB 1SQBG 3TYYA 3H1ID 3CC7P 1VQNP 1NVOA 1YTZT 4IOIH 1NH4A 3L70J 1N73C 1K73Q 1NKNA 2XKMA 1QVFO 1EC5A 1RQUA 4WBAA 2ZYGA 4RKUJ 1KQFB 2IX7C 2JP3A 4WY4C 2UWJE 1SQBK 2ZXXA 3H1KD 2E75D 3NFQA 3I56P 2QJKB 4YTPC 5AW3B 1KYOI 3LW5J 3L70G 2OYHA 4W7YA 3Q2YA 3AE3C 3H1HJ 2H89C 5APQA 4N78E 1GTWA 2YIUB 3L71E 1DD4A 1GU5A 4I7ZB 2ZVOB 3D70A 3V2NA 3VMAA 2ZT9C 3SWFA 3CX5I 1GL2A 1H88A 4UB8H 4H0LC 3PRJA 1Q90D 1L0LE 1FDMA 3CC2P 3L75D 2M5AB 1H89A 2A45G 4K35A 1N73B 1RF0A 2G3AA 2I1KA 1SP4A 1HUCA 3CCJP 2JEEA 1AQ5A 1PV3A 2FYNC 4WY4B 1IC2A 1PP9E 1HWTC 1BE3D 2WSEH 2CPBA 2KI7B 2B88A 3L71J 1Q81Q 1WRGA 3BASA 2MJZA 1VQ8P 1KD1Q 1SQPD 2N1TC 1LT1A 1HVVA 4ZMDA 1QLED 1JTHA 1PPJE 1X79B 1RE3C 2WZ7A 2KSJA 1L0LJ 2OARA 1KB9H 2AXTE 1BCCD 1JB0J 1S9KD 3CL3D 2ZT9B 1NYHA 1H8AA 2LXCB 3TF5A 4PD4D 4PV1C 2HODB 1PP9J 1L4AA 2YO2A 3CXHE 2YNYA 3WUUA 2IPPA 3RL0g 3A5TA 2MKVA 3WU2E 2Y9YA 1QEXA 4HYTB 2FYNB 1SQQE 1L4AD 2E5YA 4NPFX 1NAFA 2M3BA 1PP9G 1L0LK 4RO0A 1FE6A 3HE5A 4RESB 3HD7A 1NU1D 1HJ0A 2PRRA 4HKZH 2WT7A 3AE5C 3H1JD 3H32A 1AFOA 1WT6A 2HPCB 1PPJG 2WPVB 2AEFA 3P8CD 2AEJA 1EQ7A 3HD7D 4L74A 1IJDB 1SS1A 1IFNA 1RE4C 1SVFA 2IFNA 3Q3DA 5GTHE 3I55P 1E5WA 3M9BA 1JY3O 1G2CA 1SQQJ 3L74E 1KQGB 1W5CE 3IAOA 3B5NC 4PJ0H 1YYCA 1SLQA 2KIKA 5APSA 5TISH 1SQXD 2R3SA 3MHVA 4IFMA 3G6EP 3VMXA 1W2EA 3VMZA 4BRYB 3FXDA 1LTJC 4M3LA 2K88A 2A06E 1R5LA 2XNXA 1KB9I 1OIPA 1NTKE 2IBZD 3V2QA 3RK2B 3CPWO 5E79H 1VQ9P 3MD0A 2NPSA 3WUVA 1VDFA 2Q6QA 1NKZB 1QX8A 2QJPB 3M0DC 4XFJA 3VOPA 5AW5B 2E76D 2JDIH 1EZVI 2D2CD 3RBXA 1P84E 2NPSD 3NXSA 2W6JH 3TSIA 2POHA 1T2KD 3Q1MA 1FOSF 3CC4P 4UB6E 1SQQK 3GLMA 2NZ2A 3WUTA 1GMJA 1ZW0A 3CWBE 4LC1A 2RN0A 1WMKA 3A0HE 1QVGO 1GD2E 1NTKJ 2W8ZA 3B5NB 5AW7B 3L74G 4YPCA 5CCGD 1H0TA 1LTAC 1M57D 4HH2A 4DCKA 1M56D 1TU3F 5B66H 4H44D 1LTJB 2B89A 5AW2B 1NOHA 3AEBC 2XNDH 4IL6E 1YQ4C 1FZEA 2A45H 2A06G 3PLNA 3A0BE 1FS0E 2QA4P 2QM7A 1N7SA 3CWBJ 1BDDA 1VL2A 2JJLA 1CSBA 2IZ1A 3BRVB 1NTMD 3EQ2A 1N2DC 3L72E 2FYUJ 3P7KA 1N7SD 1NTKK 3S9OA 1K8AQ 3E7KA 1S5LE 3KXDA 3BATA 1DEBA 2P2UA 1BGYE 1LT9A 2Q3EA 5KTBA 3WMM0 3MUDC 3RK3E 2KSEA 3H25A 1FZBA 1T3JA 1SQVE 1R8EA 1IFPA 3TGUE 3H1LD 2K37A 1A02J 2KS1A 1KILA 4KJMA 4YXDC 2R32A 1BSNA 4AUWA 4Y28J 3GHGB 4C7RA 3RK3C 3R2PA 4U3FE 2N9BA 3AEGC 3CD6P 2K9JA 1RHZB 1RF1B 1M8OB 1Z56A 1KILD 1ZMEC 3C8VA 1SFCC 4RJTA 1BGYJ 2FYUK 2JR8A 1OXZA 4PD4H 2E5TA 3FGAD 5KJ7C 1SQVJ 5AVYB 1L0NE 3TGUJ 2ZYDA 4DOJA 1SQBD 3BCCD 3L72G 1LJ2A 2L5GB 2KK7A 3EFFK 3VP9A 2OTJP 4GOEA 2A45I 3VTPC 1BDCA 3O8ZA 1KMIZ 1YJ9P 4N6JA 1BGYG 2GUSA 2I1JA 2FBWC 1KV4A 1DH3A 4D6TE 2IFMA 2FKWB 3PH0A 3G71P 1GK4A 3L36A 4OGQC 1JCCA 4H13B 4JYCA 3TGUG 3P8MC 2FYZA 1M1JC 3H1HE 3RK3B 4Z1MH 2LR2A 3BCCG 4LGDE 2J59M 1PGJA 4LLHA 3L70D 3KHUA 3A3YB 1L0NJ 4U3FG 2Y0CA 4ZKPA 2M5AA 3CCMP 1PZQA 3K5BA 4TT3H 1SFCB 3CLQA 1N73A 1RH5B 1SQVK 1OVVA 3GF3A 1ZR4A 1IFMA 2E75C 3MP7B 3IFMA 4D6TJ 4WY4A 3IN6A 2G8YA 4EDFA 1S4XA 3JCUE 2HLOA 3A7OA 1JO5A 2Y9ZA 1MFZA 4CPGA 1X0TA 5M1BA 2WPRA 1K04A 2OYIC 2WSCH 3S4RA 3V6IA 4WY4D 1HBWA 3V2PA 1JY2N 3H1KJ 2PGDA 2H88C 4C46A 2H43A 5AVTB 1USDA 1N8RQ 3D6ZA 4R4MA 3B4SA 1VQLP 4OGQB 5KLIC 3PJSK 3ZDMA 2XV5A 4MN4C 1M1JB 2YKQA 1L0NK 4PD4I 1AV1A 3U1AA 4ZKUA 3EFGA 3USSA 3S1KA 2E43A 1AJYA 3H1HG 2YXRB 2HODA 2QIWA 3LIEA 1KYOE 3AE9C 1GL2D 5APYA 5AW9B 1GDTA 2FXOA 1CI6B 5KLVE 1VPCA 2ZT9D 3N4XA 4N78D 4L75A 2ZAEB 4AQRD 2W90A 2BEQD 3L71D 2JWAA 4QMAA 3CX5E 1NHLA 1L0LD 2OYIB 1P84H 2QJYC 1RE3A 4GIFA 2RMZA 2HPCA 1YI2P 1VQKP 1E79H 5H2FH 5KAIE 4UB6H 1U7JA 3L71G 3V4WA 5KLIB 5B5EE 5KLVJ 1PGPA 4JPZB 4H0LB 3U59A 5CBNA 1PP9D 4ASVA 4Y99C 3SFDC 1JCDA 3SSUA 1L0LG 2R5DA 1GW3A 2Z5HA 3TNUB 2XZRA 1PPJD 1L4AC 1EDKA 1K9MQ 1LTBC 3L37A 5KLVG 1T6AA 2IBZI 4BRYA 3F89A 5CMZA 3H6PA 3PP5A 1KORA 1W2BO 2JKVA 3V5BA 3L73E 1Q7YQ 2N1TB 5AVQB 3AEFC 3MZWB 2O01J 2B87A 1UIXA 2ZJSE 3AEDC 5AW0B 1FZFA 1SQPK 5DJUB 1NTZE 5AVUB 2B9BA 2QJYB 2ZFCA 3HD7C 5KLVK 1LWUC 3RK2D 3CXHD 2JWDA 2E74C 2FFDC 1S5LH 1UIIA 1RE4A 2OTLP 1SQQD 4PV1B 1FJKA 2Z4EA 4GT1A 3GF7A 1FZCC 4Y99B 2WSFJ 3II6A 5APTA 2QM8A 4GODA 1USEA 3B5NA 3L73J 2NRGA 3M91A 4UB8E 3E1IA 4BXLA 3ITKA 2BCCE 1X8YA 2C9NY 1NTZJ 1LTJA 3SWYA 3R4YA 1SQQG 5AVRB 4DT0A 2B87B 5GTIH 5BU8B 2E76C 3HUSC 1FDIA 2D2CC 1AA0A 2O1JA 3BRTB 1L2PA 2NPSC 2V7QH 1NGMB 1VQMP 3L74D 1OX3A 1T2KC 3M0DA 1BSHA 1FZGA 1Q82Q 1GU4A 3AEAC 3VYIA 1LWUB 5C39A 1FOSE 2E74B 2Q7CA 1MKMA 2FFDB 1JMMA 1S1CX 2BCCJ 2RH0A 3KQGA 3RBZA 2A06D 1X9VA 2CPSA 4HB1A 1KB9E 1FZCB 1NTKD 5CCGC 5DJTB 3V2RA 2K3RA 3E1RA 1FBMA 2BASA 2YKOA 2FYUE 3GW6A 1NTZK 4H44C 5CJ0A 4C7NA 1ZRTD 3EWKA 4AYCA 1SQXK 4ASWA 3W67A 1FU1A 4KT0J 3LW5H 2WSEJ 1RQVA 1EZVE 1P84D 1AVOA 5KAFE 1KTMA 2O3JA 3AE4C 1NTME 1PGQA 3M9HA 1YJWP 1OWAA 3GHGA 2WVRA 1NTKG 1OVUA 1YHQP 1DD3A 2QSIA 3CCVP 3QH9A 3KZIE 3HUSB 1ZV8A 1RF1A 3CWBD 2D2CB 3V4QA 5TJHA 2KNCB 1Q86Q 1JEKA 3OA7A 5EFWB 1S2EA 1YJNP 2E42A 1DX7A 1VF5D 2BEZF 4WVZA 2J58A 3L35A 3N7NA 2W27A 1NJIQ 3NMDA 2OYOA 1VQ6P 3B71A 1CZQA 3MTUE 3CWBG 3OW2O 1FAVA 1KFMA 4C7NB 1NTMJ 2M8RA 1PGOA 1GK6A 2N9YB 3TK1A 2KXPB 2Q5UA 3AE1C 2SPZA 4WB4A 2V4HA 2RKLA 2FYUG 5AVZB 2Z5IA 1ZOYC 5AVSB 2WPQA 1DEEG 4PJ0E 3RL0D 1N86A 1EZVG 1OW6A 1QL1A 3L72D 1URQC 4XE5B 1IZNB 3H1LJ 3T97B 1KN7A 1U57A 5AVXB 1BGYD 4DZOA 1LNQA 2XU6A 4H13D 5E79E 2KZJA 3JC22 1SFCA 3RK3D 2WTYA 3IF4A 1SQVD 2R3CA 3TGUD 1KFNA 3HE4B 5KJ7A 1NTMK 2YXQB 3CX5H 1SFCD 3CCLP 3H1IE 2KB7P 5CCHC 3L4FA 4U3FD 5BVZA 5CHXA 5KJ7D 3M0AA 2QEXP 2AXTH 3FX0A 3KPEA 1HGVA 1SQVG 3AECC 3D6YA 4W80A 2O01H 5B5EH 1HH0A 3RGUA 4BWNA 2YIUC 1NWQA 1Y47A 4I6MC 1M1JA 3H1KE 3SFEC 1URQB 1LTTC 1L0ND 1OZHA 3HTKB 3CXHH 1ZP0C 4IFFA 1JM0A 4OGQD 3WU2H 1YQ3C 3H1IJ 2LKMA 2O01N 1CI6A 4D6TD 2WSFH 3FWNA 1T8ZA 2HR3A 1AVYA 4JF7A 1G1JA 2QE7H 3GG2A 1PIXA 1L0NG 4B86A 3H1HD 4ZNCA 2KP8A 3M06A 5AVVB 2C0WA 2K9YA 1VQOP 2Y0DA 3B8EB 3L75E 1JY2P 2VRSA 2CK3H 3H1IG 2OYIA 1LP1B 3CCUP 2OYHC 1IFIA 3UIAA 3VMYA 2WITA 1VQPP 4A7PA 4D6TG 3KYQA 3O6QB 1ZLLA 3PTZA 1RY3A 3IR9A 5GTHH 2WPSA 1Q2NA 1BE3E 1Y8AA 2KUBA 4JQ0D 1ZR2A 1GL2C 2YO3A 1LTGC 3G4SP 2WQYC 1FZAA 2W6BA 5APUA 4XA4A 1SQPE 1ZXGA 3H1KG 2K1AA 1IK9A 1YITP 4YXWH 1XTGB 4EIJA 1RF0C 4H0LD 1HJBA 3TNUA 2E75B 3L75J 2FXPA 1BCCE 1S9KE 3NTNA 5K5GB 3I5CA 4PD4E 2WSSH 2N1TA 1BE3J 1AQTA 2KLUA 2OYHB 2YKPA 3L75G 1KYOD 3CXHI 1YIJP 3CCEP 1SQPJ 2PAJA 4OH8B 1JMBA 2GUVA 2H8PD 5KLVD 1IFJA 2N1TD 3OAKA 4W7ZA 1R5SA 3A0HH 3CI9A 1GL2B 1BE3G 4GKGA 3SWKA 1BCCJ 3CX5D 1NU1E 4U7JA 1SQPG 3H1JE 1LTIC 2AEMA 2OGUA 3Q5SA 1FC2C 2KLVA 4PV1D 2P10A 2QG4A 4OWFA 3P8CE 4IL6H 5KAFH 2AXCA 3A0BH 2KOGA 4N3YB 1BCCG 3KZIH 3P32A 3AE6C 2FXMA 4JBZA 3RK2C 4L76A 1SQXE 1EDIA 1JTHB 4KHXA 1M1KQ 1G1IA 3CCRP 1HTLC 5AVWB 3W68A 2P1JA 2H7HA 1NU1J 1LWUA 2QJPC 3AE8C 3H1JJ 2FFDA 4IL6X 1J2JB 2IBZE 2ZVNB 1FZCA 3G3ZA 4R4LA 3L73D 2E74D 2M3EA 1KZUB 3CCSP 1U7MA 3Q5RA 2R5BA 5BU5A 1L4AB 1NU1G 1NTZD 4WWIA 1P84I 1JNMA 3H1JG 2WWWA 1J1DC 3AE7C 5APXA 1SQXJ 2W83C 3B5ND 1IFDA 1PFIA 1KC8Q 1S5LX 2R44A 2IDBA 2WSCJ 3LIDA 3L73G 2GA1A 2L91A 3HUSA 1KQSO 1NU1K 3HE5B 3HD7B 1J1EC 1MV8A 2KNCA 2KZIA 3ABVC 1NTZG 2WT7B 3GMAA 1ZRTE 3H32B 4I2LC 2DW3A 4HJGH 1SQXG 1IO4A 4O9BA 2HG5D 2BCCD 3C9IA 3AE2C 3L74J 2ITAA 4EYYQ 2Q3IA 3FXEA 5H2FE 1QGKB 5AW8B 5AW1B 1MUUA 2IBZG 2ZXEB 5CJ4A 5CCGA 2IYPA 2HFED 1G2CB 2P58A 1GW4A 1M90Q 2LXBA 1VQ5P 2QRXA 2JO1A 2QVAA 1EDJA 4EI2A 3MIWA 2OTKE 4K3AA 2BCCG 1OVRA 4EOTA 1J1DB 2Q9IA 3G9RA 3CCQP 2C9LY 2IYOA 2WMMA 1YTZI 2E76B 4NPEA 2HYNA 1FJPA 1EXIA 4L73A 2NPSB 3GHGC 1KB9D 3T97A 3M9QA 1J1EB 1VF5C 2M0BA 1RF1C 4GDOA 2J5UA 3AEEC 3C1LA 1N7SC 2FYUD 1HGZA 5AW4B 4I1LA 3HRNA 1JY3P 1EDLA 1OW8A 1S3JA 1JY3N 4OVNF 3H1LE 3CMAP 1A02F 3TDKA 3JCUH 1NAYA 2IZ0A 3Q5PA 2P67A 1EZVD 3HE4A 2W6AA 3F5HA 1OMIA 3CMEP 1LT9C 3JSVC 1KILE 4H44B 3MUDA 2Y0EA 4DJGA 1FDOA 3RL0C 4IFDK 2GM4A 1H0TB 1XTCC 5KKZC 1QL2A 5TISE 3PHLA 1PL5A 2YMYA 1LTSC 1KILC 3FWLA 1GZLA 1HF9A 1JY2O 3BVHA 2Q1KA 1NTMG 1JOCA 4JYBA 1SQBE 1X22A 4H13C 3BCCE 1K05A 1D7MA 1KYOH 1URQA 1OW7A 4NPDA 2XDJA 1KQLA 5CBOA 5APVA 3MGNA 1MFTA 3HTKA 1S72P 1M7LA 4GOFA 1JUNA 1VF5B 5GTIE 3L72J 1N7SB 2P7JA 1URQD 1LGHB 3KDPB 1CW5A 1OFCX 3H1LG 1ZN5A 1VQ4P 2YMKA 2PP6A 2C0XA 2ZYAA 2I8DA 3A2AA 3OJAB 1EXJA 5APWA 3L70E 2KYVA 1NO4A 3U1CA 1LT9B 5CCHA 1IK7A 1Y9BA 2QJKC 5L8RJ 2PFXA 1SQBJ 3QWOC 3BCCJ 5KAIH 3RL0B 1LP1A 3VN0A 3VP8A 5AW6B 5KKZB 1YBKA 1N7LA 1VQ7P 4U3FJ 3O6QA 5CCHD 2KS1B 1KILB 3D71A 4I7ZC 4TLFA 1MZ9A 5B66E
chains in the Genus database with same CATH topology
3H1IG 1SQPG 1NTZG 3L72G 4U3FG 1BCCG 3L74G 3H1HG 2IBZG 2A06G 3CWBG 1SQVG 3CX5H 1P84H 3CXHH 3H1LG 3TGUG 1SQXG 5KLVG 1KB9H 1NTKG 3L70G 4D6TG 3H1KG 1EZVG 1L0LG 1PPJG 1SQBG 1NU1G 4PD4H 1L0NG 1BGYG 3L75G 3L73G 1BE3G 3BCCG 1PP9G 3L71G 3H1JG 1NTMG 1SQQG 2FYUG 1KYOH 2BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I G;  1SQP G;  1NTZ G;  3L72 G;  4U3F G;  1BCC G;  3L74 G;  3H1H G;  2IBZ G;  2A06 G;  3CWB G;  1SQV G;  3CX5 H;  1P84 H;  3CXH H;  3H1L G;  3TGU G;  1SQX G;  5KLV G;  1KB9 H;  1NTK G;  3L70 G;  4D6T G;  3H1K G;  1EZV G;  1L0L G;  1PPJ G;  1SQB G;  1NU1 G;  4PD4 H;  1L0N G;  1BGY G;  3L75 G;  3L73 G;  1BE3 G;  3BCC G;  1PP9 G;  3L71 G;  3H1J G;  1NTM G;  1SQQ G;  2FYU G;  1KYO H;  2BCC G; 
#chains in the Genus database with same CATH topology
 2O1K A;  1T3U A;  2OQQ A;  2FY8 A;  1DIP A;  2V7Q J;  2K9J B;  1SQB G;  3TYY A;  3H1I D;  3CC7 P;  1VQN P;  1NVO A;  1YTZ T;  4IOI H;  1NH4 A;  3L70 J;  1N73 C;  1K73 Q;  1NKN A;  2XKM A;  1QVF O;  1EC5 A;  1RQU A;  4WBA A;  2ZYG A;  4RKU J;  1KQF B;  2IX7 C;  2JP3 A;  4WY4 C;  2UWJ E;  1SQB K;  2ZXX A;  3H1K D;  2E75 D;  3NFQ A;  3I56 P;  2QJK B;  4YTP C;  5AW3 B;  1KYO I;  3LW5 J;  3L70 G;  2OYH A;  4W7Y A;  3Q2Y A;  3AE3 C;  3H1H J;  2H89 C;  5APQ A;  4N78 E;  1GTW A;  2YIU B;  3L71 E;  1DD4 A;  1GU5 A;  4I7Z B;  2ZVO B;  3D70 A;  3V2N A;  3VMA A;  2ZT9 C;  3SWF A;  3CX5 I;  1GL2 A;  1H88 A;  4UB8 H;  4H0L C;  3PRJ A;  1Q90 D;  1L0L E;  1FDM A;  3CC2 P;  3L75 D;  2M5A B;  1H89 A;  2A45 G;  4K35 A;  1N73 B;  1RF0 A;  2G3A A;  2I1K A;  1SP4 A;  1HUC A;  3CCJ P;  2JEE A;  1AQ5 A;  1PV3 A;  2FYN C;  4WY4 B;  1IC2 A;  1PP9 E;  1HWT C;  1BE3 D;  2WSE H;  2CPB A;  2KI7 B;  2B88 A;  3L71 J;  1Q81 Q;  1WRG A;  3BAS A;  2MJZ A;  1VQ8 P;  1KD1 Q;  1SQP D;  2N1T C;  1LT1 A;  1HVV A;  4ZMD A;  1QLE D;  1JTH A;  1PPJ E;  1X79 B;  1RE3 C;  2WZ7 A;  2KSJ A;  1L0L J;  2OAR A;  1KB9 H;  2AXT E;  1BCC D;  1JB0 J;  1S9K D;  3CL3 D;  2ZT9 B;  1NYH A;  1H8A A;  2LXC B;  3TF5 A;  4PD4 D;  4PV1 C;  2HOD B;  1PP9 J;  1L4A A;  2YO2 A;  3CXH E;  2YNY A;  3WUU A;  2IPP A;  3RL0 g;  3A5T A;  2MKV A;  3WU2 E;  2Y9Y A;  1QEX A;  4HYT B;  2FYN B;  1SQQ E;  1L4A D;  2E5Y A;  4NPF X;  1NAF A;  2M3B A;  1PP9 G;  1L0L K;  4RO0 A;  1FE6 A;  3HE5 A;  4RES B;  3HD7 A;  1NU1 D;  1HJ0 A;  2PRR A;  4HKZ H;  2WT7 A;  3AE5 C;  3H1J D;  3H32 A;  1AFO A;  1WT6 A;  2HPC B;  1PPJ G;  2WPV B;  2AEF A;  3P8C D;  2AEJ A;  1EQ7 A;  3HD7 D;  4L74 A;  1IJD B;  1SS1 A;  1IFN A;  1RE4 C;  1SVF A;  2IFN A;  3Q3D A;  5GTH E;  3I55 P;  1E5W A;  3M9B A;  1JY3 O;  1G2C A;  1SQQ J;  3L74 E;  1KQG B;  1W5C E;  3IAO A;  3B5N C;  4PJ0 H;  1YYC A;  1SLQ A;  2KIK A;  5APS A;  5TIS H;  1SQX D;  2R3S A;  3MHV A;  4IFM A;  3G6E P;  3VMX A;  1W2E A;  3VMZ A;  4BRY B;  3FXD A;  1LTJ C;  4M3L A;  2K88 A;  2A06 E;  1R5L A;  2XNX A;  1KB9 I;  1OIP A;  1NTK E;  2IBZ D;  3V2Q A;  3RK2 B;  3CPW O;  5E79 H;  1VQ9 P;  3MD0 A;  2NPS A;  3WUV A;  1VDF A;  2Q6Q A;  1NKZ B;  1QX8 A;  2QJP B;  3M0D C;  4XFJ A;  3VOP A;  5AW5 B;  2E76 D;  2JDI H;  1EZV I;  2D2C D;  3RBX A;  1P84 E;  2NPS D;  3NXS A;  2W6J H;  3TSI A;  2POH A;  1T2K D;  3Q1M A;  1FOS F;  3CC4 P;  4UB6 E;  1SQQ K;  3GLM A;  2NZ2 A;  3WUT A;  1GMJ A;  1ZW0 A;  3CWB E;  4LC1 A;  2RN0 A;  1WMK A;  3A0H E;  1QVG O;  1GD2 E;  1NTK J;  2W8Z A;  3B5N B;  5AW7 B;  3L74 G;  4YPC A;  5CCG D;  1H0T A;  1LTA C;  1M57 D;  4HH2 A;  4DCK A;  1M56 D;  1TU3 F;  5B66 H;  4H44 D;  1LTJ B;  2B89 A;  5AW2 B;  1NOH A;  3AEB C;  2XND H;  4IL6 E;  1YQ4 C;  1FZE A;  2A45 H;  2A06 G;  3PLN A;  3A0B E;  1FS0 E;  2QA4 P;  2QM7 A;  1N7S A;  3CWB J;  1BDD A;  1VL2 A;  2JJL A;  1CSB A;  2IZ1 A;  3BRV B;  1NTM D;  3EQ2 A;  1N2D C;  3L72 E;  2FYU J;  3P7K A;  1N7S D;  1NTK K;  3S9O A;  1K8A Q;  3E7K A;  1S5L E;  3KXD A;  3BAT A;  1DEB A;  2P2U A;  1BGY E;  1LT9 A;  2Q3E A;  5KTB A;  3WMM 0;  3MUD C;  3RK3 E;  2KSE A;  3H25 A;  1FZB A;  1T3J A;  1SQV E;  1R8E A;  1IFP A;  3TGU E;  3H1L D;  2K37 A;  1A02 J;  2KS1 A;  1KIL A;  4KJM A;  4YXD C;  2R32 A;  1BSN A;  4AUW A;  4Y28 J;  3GHG B;  4C7R A;  3RK3 C;  3R2P A;  4U3F E;  2N9B A;  3AEG C;  3CD6 P;  2K9J A;  1RHZ B;  1RF1 B;  1M8O B;  1Z56 A;  1KIL D;  1ZME C;  3C8V A;  1SFC C;  4RJT A;  1BGY J;  2FYU K;  2JR8 A;  1OXZ A;  4PD4 H;  2E5T A;  3FGA D;  5KJ7 C;  1SQV J;  5AVY B;  1L0N E;  3TGU J;  2ZYD A;  4DOJ A;  1SQB D;  3BCC D;  3L72 G;  1LJ2 A;  2L5G B;  2KK7 A;  3EFF K;  3VP9 A;  2OTJ P;  4GOE A;  2A45 I;  3VTP C;  1BDC A;  3O8Z A;  1KMI Z;  1YJ9 P;  4N6J A;  1BGY G;  2GUS A;  2I1J A;  2FBW C;  1KV4 A;  1DH3 A;  4D6T E;  2IFM A;  2FKW B;  3PH0 A;  3G71 P;  1GK4 A;  3L36 A;  4OGQ C;  1JCC A;  4H13 B;  4JYC A;  3TGU G;  3P8M C;  2FYZ A;  1M1J C;  3H1H E;  3RK3 B;  4Z1M H;  2LR2 A;  3BCC G;  4LGD E;  2J59 M;  1PGJ A;  4LLH A;  3L70 D;  3KHU A;  3A3Y B;  1L0N J;  4U3F G;  2Y0C A;  4ZKP A;  2M5A A;  3CCM P;  1PZQ A;  3K5B A;  4TT3 H;  1SFC B;  3CLQ A;  1N73 A;  1RH5 B;  1SQV K;  1OVV A;  3GF3 A;  1ZR4 A;  1IFM A;  2E75 C;  3MP7 B;  3IFM A;  4D6T J;  4WY4 A;  3IN6 A;  2G8Y A;  4EDF A;  1S4X A;  3JCU E;  2HLO A;  3A7O A;  1JO5 A;  2Y9Z A;  1MFZ A;  4CPG A;  1X0T A;  5M1B A;  2WPR A;  1K04 A;  2OYI C;  2WSC H;  3S4R A;  3V6I A;  4WY4 D;  1HBW A;  3V2P A;  1JY2 N;  3H1K J;  2PGD A;  2H88 C;  4C46 A;  2H43 A;  5AVT B;  1USD A;  1N8R Q;  3D6Z A;  4R4M A;  3B4S A;  1VQL P;  4OGQ B;  5KLI C;  3PJS K;  3ZDM A;  2XV5 A;  4MN4 C;  1M1J B;  2YKQ A;  1L0N K;  4PD4 I;  1AV1 A;  3U1A A;  4ZKU A;  3EFG A;  3USS A;  3S1K A;  2E43 A;  1AJY A;  3H1H G;  2YXR B;  2HOD A;  2QIW A;  3LIE A;  1KYO E;  3AE9 C;  1GL2 D;  5APY A;  5AW9 B;  1GDT A;  2FXO A;  1CI6 B;  5KLV E;  1VPC A;  2ZT9 D;  3N4X A;  4N78 D;  4L75 A;  2ZAE B;  4AQR D;  2W90 A;  2BEQ D;  3L71 D;  2JWA A;  4QMA A;  3CX5 E;  1NHL A;  1L0L D;  2OYI B;  1P84 H;  2QJY C;  1RE3 A;  4GIF A;  2RMZ A;  2HPC A;  1YI2 P;  1VQK P;  1E79 H;  5H2F H;  5KAI E;  4UB6 H;  1U7J A;  3L71 G;  3V4W A;  5KLI B;  5B5E E;  5KLV J;  1PGP A;  4JPZ B;  4H0L B;  3U59 A;  5CBN A;  1PP9 D;  4ASV A;  4Y99 C;  3SFD C;  1JCD A;  3SSU A;  1L0L G;  2R5D A;  1GW3 A;  2Z5H A;  3TNU B;  2XZR A;  1PPJ D;  1L4A C;  1EDK A;  1K9M Q;  1LTB C;  3L37 A;  5KLV G;  1T6A A;  2IBZ I;  4BRY A;  3F89 A;  5CMZ A;  3H6P A;  3PP5 A;  1KOR A;  1W2B O;  2JKV A;  3V5B A;  3L73 E;  1Q7Y Q;  2N1T B;  5AVQ B;  3AEF C;  3MZW B;  2O01 J;  2B87 A;  1UIX A;  2ZJS E;  3AED C;  5AW0 B;  1FZF A;  1SQP K;  5DJU B;  1NTZ E;  5AVU B;  2B9B A;  2QJY B;  2ZFC A;  3HD7 C;  5KLV K;  1LWU C;  3RK2 D;  3CXH D;  2JWD A;  2E74 C;  2FFD C;  1S5L H;  1UII A;  1RE4 A;  2OTL P;  1SQQ D;  4PV1 B;  1FJK A;  2Z4E A;  4GT1 A;  3GF7 A;  1FZC C;  4Y99 B;  2WSF J;  3II6 A;  5APT A;  2QM8 A;  4GOD A;  1USE A;  3B5N A;  3L73 J;  2NRG A;  3M91 A;  4UB8 E;  3E1I A;  4BXL A;  3ITK A;  2BCC E;  1X8Y A;  2C9N Y;  1NTZ J;  1LTJ A;  3SWY A;  3R4Y A;  1SQQ G;  5AVR B;  4DT0 A;  2B87 B;  5GTI H;  5BU8 B;  2E76 C;  3HUS C;  1FDI A;  2D2C C;  1AA0 A;  2O1J A;  3BRT B;  1L2P A;  2NPS C;  2V7Q H;  1NGM B;  1VQM P;  3L74 D;  1OX3 A;  1T2K C;  3M0D A;  1BSH A;  1FZG A;  1Q82 Q;  1GU4 A;  3AEA C;  3VYI A;  1LWU B;  5C39 A;  1FOS E;  2E74 B;  2Q7C A;  1MKM A;  2FFD B;  1JMM A;  1S1C X;  2BCC J;  2RH0 A;  3KQG A;  3RBZ A;  2A06 D;  1X9V A;  2CPS A;  4HB1 A;  1KB9 E;  1FZC B;  1NTK D;  5CCG C;  5DJT B;  3V2R A;  2K3R A;  3E1R A;  1FBM A;  2BAS A;  2YKO A;  2FYU E;  3GW6 A;  1NTZ K;  4H44 C;  5CJ0 A;  4C7N A;  1ZRT D;  3EWK A;  4AYC A;  1SQX K;  4ASW A;  3W67 A;  1FU1 A;  4KT0 J;  3LW5 H;  2WSE J;  1RQV A;  1EZV E;  1P84 D;  1AVO A;  5KAF E;  1KTM A;  2O3J A;  3AE4 C;  1NTM E;  1PGQ A;  3M9H A;  1YJW P;  1OWA A;  3GHG A;  2WVR A;  1NTK G;  1OVU A;  1YHQ P;  1DD3 A;  2QSI A;  3CCV P;  3QH9 A;  3KZI E;  3HUS B;  1ZV8 A;  1RF1 A;  3CWB D;  2D2C B;  3V4Q A;  5TJH A;  2KNC B;  1Q86 Q;  1JEK A;  3OA7 A;  5EFW B;  1S2E A;  1YJN P;  2E42 A;  1DX7 A;  1VF5 D;  2BEZ F;  4WVZ A;  2J58 A;  3L35 A;  3N7N A;  2W27 A;  1NJI Q;  3NMD A;  2OYO A;  1VQ6 P;  3B71 A;  1CZQ A;  3MTU E;  3CWB G;  3OW2 O;  1FAV A;  1KFM A;  4C7N B;  1NTM J;  2M8R A;  1PGO A;  1GK6 A;  2N9Y B;  3TK1 A;  2KXP B;  2Q5U A;  3AE1 C;  2SPZ A;  4WB4 A;  2V4H A;  2RKL A;  2FYU G;  5AVZ B;  2Z5I A;  1ZOY C;  5AVS B;  2WPQ A;  1DEE G;  4PJ0 E;  3RL0 D;  1N86 A;  1EZV G;  1OW6 A;  1QL1 A;  3L72 D;  1URQ C;  4XE5 B;  1IZN B;  3H1L J;  3T97 B;  1KN7 A;  1U57 A;  5AVX B;  1BGY D;  4DZO A;  1LNQ A;  2XU6 A;  4H13 D;  5E79 E;  2KZJ A;  3JC2 2;  1SFC A;  3RK3 D;  2WTY A;  3IF4 A;  1SQV D;  2R3C A;  3TGU D;  1KFN A;  3HE4 B;  5KJ7 A;  1NTM K;  2YXQ B;  3CX5 H;  1SFC D;  3CCL P;  3H1I E;  2KB7 P;  5CCH C;  3L4F A;  4U3F D;  5BVZ A;  5CHX A;  5KJ7 D;  3M0A A;  2QEX P;  2AXT H;  3FX0 A;  3KPE A;  1HGV A;  1SQV G;  3AEC C;  3D6Y A;  4W80 A;  2O01 H;  5B5E H;  1HH0 A;  3RGU A;  4BWN A;  2YIU C;  1NWQ A;  1Y47 A;  4I6M C;  1M1J A;  3H1K E;  3SFE C;  1URQ B;  1LTT C;  1L0N D;  1OZH A;  3HTK B;  3CXH H;  1ZP0 C;  4IFF A;  1JM0 A;  4OGQ D;  3WU2 H;  1YQ3 C;  3H1I J;  2LKM A;  2O01 N;  1CI6 A;  4D6T D;  2WSF H;  3FWN A;  1T8Z A;  2HR3 A;  1AVY A;  4JF7 A;  1G1J A;  2QE7 H;  3GG2 A;  1PIX A;  1L0N G;  4B86 A;  3H1H D;  4ZNC A;  2KP8 A;  3M06 A;  5AVV B;  2C0W A;  2K9Y A;  1VQO P;  2Y0D A;  3B8E B;  3L75 E;  1JY2 P;  2VRS A;  2CK3 H;  3H1I G;  2OYI A;  1LP1 B;  3CCU P;  2OYH C;  1IFI A;  3UIA A;  3VMY A;  2WIT A;  1VQP P;  4A7P A;  4D6T G;  3KYQ A;  3O6Q B;  1ZLL A;  3PTZ A;  1RY3 A;  3IR9 A;  5GTH H;  2WPS A;  1Q2N A;  1BE3 E;  1Y8A A;  2KUB A;  4JQ0 D;  1ZR2 A;  1GL2 C;  2YO3 A;  1LTG C;  3G4S P;  2WQY C;  1FZA A;  2W6B A;  5APU A;  4XA4 A;  1SQP E;  1ZXG A;  3H1K G;  2K1A A;  1IK9 A;  1YIT P;  4YXW H;  1XTG B;  4EIJ A;  1RF0 C;  4H0L D;  1HJB A;  3TNU A;  2E75 B;  3L75 J;  2FXP A;  1BCC E;  1S9K E;  3NTN A;  5K5G B;  3I5C A;  4PD4 E;  2WSS H;  2N1T A;  1BE3 J;  1AQT A;  2KLU A;  2OYH B;  2YKP A;  3L75 G;  1KYO D;  3CXH I;  1YIJ P;  3CCE P;  1SQP J;  2PAJ A;  4OH8 B;  1JMB A;  2GUV A;  2H8P D;  5KLV D;  1IFJ A;  2N1T D;  3OAK A;  4W7Z A;  1R5S A;  3A0H H;  3CI9 A;  1GL2 B;  1BE3 G;  4GKG A;  3SWK A;  1BCC J;  3CX5 D;  1NU1 E;  4U7J A;  1SQP G;  3H1J E;  1LTI C;  2AEM A;  2OGU A;  3Q5S A;  1FC2 C;  2KLV A;  4PV1 D;  2P10 A;  2QG4 A;  4OWF A;  3P8C E;  4IL6 H;  5KAF H;  2AXC A;  3A0B H;  2KOG A;  4N3Y B;  1BCC G;  3KZI H;  3P32 A;  3AE6 C;  2FXM A;  4JBZ A;  3RK2 C;  4L76 A;  1SQX E;  1EDI A;  1JTH B;  4KHX A;  1M1K Q;  1G1I A;  3CCR P;  1HTL C;  5AVW B;  3W68 A;  2P1J A;  2H7H A;  1NU1 J;  1LWU A;  2QJP C;  3AE8 C;  3H1J J;  2FFD A;  4IL6 X;  1J2J B;  2IBZ E;  2ZVN B;  1FZC A;  3G3Z A;  4R4L A;  3L73 D;  2E74 D;  2M3E A;  1KZU B;  3CCS P;  1U7M A;  3Q5R A;  2R5B A;  5BU5 A;  1L4A B;  1NU1 G;  1NTZ D;  4WWI A;  1P84 I;  1JNM A;  3H1J G;  2WWW A;  1J1D C;  3AE7 C;  5APX A;  1SQX J;  2W83 C;  3B5N D;  1IFD A;  1PFI A;  1KC8 Q;  1S5L X;  2R44 A;  2IDB A;  2WSC J;  3LID A;  3L73 G;  2GA1 A;  2L91 A;  3HUS A;  1KQS O;  1NU1 K;  3HE5 B;  3HD7 B;  1J1E C;  1MV8 A;  2KNC A;  2KZI A;  3ABV C;  1NTZ G;  2WT7 B;  3GMA A;  1ZRT E;  3H32 B;  4I2L C;  2DW3 A;  4HJG H;  1SQX G;  1IO4 A;  4O9B A;  2HG5 D;  2BCC D;  3C9I A;  3AE2 C;  3L74 J;  2ITA A;  4EYY Q;  2Q3I A;  3FXE A;  5H2F E;  1QGK B;  5AW8 B;  5AW1 B;  1MUU A;  2IBZ G;  2ZXE B;  5CJ4 A;  5CCG A;  2IYP A;  2HFE D;  1G2C B;  2P58 A;  1GW4 A;  1M90 Q;  2LXB A;  1VQ5 P;  2QRX A;  2JO1 A;  2QVA A;  1EDJ A;  4EI2 A;  3MIW A;  2OTK E;  4K3A A;  2BCC G;  1OVR A;  4EOT A;  1J1D B;  2Q9I A;  3G9R A;  3CCQ P;  2C9L Y;  2IYO A;  2WMM A;  1YTZ I;  2E76 B;  4NPE A;  2HYN A;  1FJP A;  1EXI A;  4L73 A;  2NPS B;  3GHG C;  1KB9 D;  3T97 A;  3M9Q A;  1J1E B;  1VF5 C;  2M0B A;  1RF1 C;  4GDO A;  2J5U A;  3AEE C;  3C1L A;  1N7S C;  2FYU D;  1HGZ A;  5AW4 B;  4I1L A;  3HRN A;  1JY3 P;  1EDL A;  1OW8 A;  1S3J A;  1JY3 N;  4OVN F;  3H1L E;  3CMA P;  1A02 F;  3TDK A;  3JCU H;  1NAY A;  2IZ0 A;  3Q5P A;  2P67 A;  1EZV D;  3HE4 A;  2W6A A;  3F5H A;  1OMI A;  3CME P;  1LT9 C;  3JSV C;  1KIL E;  4H44 B;  3MUD A;  2Y0E A;  4DJG A;  1FDO A;  3RL0 C;  4IFD K;  2GM4 A;  1H0T B;  1XTC C;  5KKZ C;  1QL2 A;  5TIS E;  3PHL A;  1PL5 A;  2YMY A;  1LTS C;  1KIL C;  3FWL A;  1GZL A;  1HF9 A;  1JY2 O;  3BVH A;  2Q1K A;  1NTM G;  1JOC A;  4JYB A;  1SQB E;  1X22 A;  4H13 C;  3BCC E;  1K05 A;  1D7M A;  1KYO H;  1URQ A;  1OW7 A;  4NPD A;  2XDJ A;  1KQL A;  5CBO A;  5APV A;  3MGN A;  1MFT A;  3HTK A;  1S72 P;  1M7L A;  4GOF A;  1JUN A;  1VF5 B;  5GTI E;  3L72 J;  1N7S B;  2P7J A;  1URQ D;  1LGH B;  3KDP B;  1CW5 A;  1OFC X;  3H1L G;  1ZN5 A;  1VQ4 P;  2YMK A;  2PP6 A;  2C0X A;  2ZYA A;  2I8D A;  3A2A A;  3OJA B;  1EXJ A;  5APW A;  3L70 E;  2KYV A;  1NO4 A;  3U1C A;  1LT9 B;  5CCH A;  1IK7 A;  1Y9B A;  2QJK C;  5L8R J;  2PFX A;  1SQB J;  3QWO C;  3BCC J;  5KAI H;  3RL0 B;  1LP1 A;  3VN0 A;  3VP8 A;  5AW6 B;  5KKZ B;  1YBK A;  1N7L A;  1VQ7 P;  4U3F J;  3O6Q A;  5CCH D;  2KS1 B;  1KIL B;  3D71 A;  4I7Z C;  4TLF A;  1MZ9 A;  5B66 E; 
#chains in the Genus database with same CATH homology
 3H1I G;  1SQP G;  1NTZ G;  3L72 G;  4U3F G;  1BCC G;  3L74 G;  3H1H G;  2IBZ G;  2A06 G;  3CWB G;  1SQV G;  3CX5 H;  1P84 H;  3CXH H;  3H1L G;  3TGU G;  1SQX G;  5KLV G;  1KB9 H;  1NTK G;  3L70 G;  4D6T G;  3H1K G;  1EZV G;  1L0L G;  1PPJ G;  1SQB G;  1NU1 G;  4PD4 H;  1L0N G;  1BGY G;  3L75 G;  3L73 G;  1BE3 G;  3BCC G;  1PP9 G;  3L71 G;  3H1J G;  1NTM G;  1SQQ G;  2FYU G;  1KYO H;  2BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...