3L74G

Cytochrome bc1 complex from chicken with famoxadone bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'GIHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX CORE
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 18
structure length 81
sequence length 81
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l74G00
3L75G 3L70G 3H1KG 3CXHH 4U3FG 1KYOH 1NTMG 1SQXG 3H1HG 1BGYG 2FYUG 1NTKG 1SQQG 3H1IG 3TGUG 1P84H 1KB9H 5KLVG 3L71G 1PPJG 1EZVG 1NTZG 1NU1G 1PP9G 2A06G 3H1LG 1SQPG 1BCCG 3BCCG 1L0LG 3CWBG 3CX5H 1L0NG 3L73G 3L72G 4PD4H 1BE3G 1SQBG 3H1JG 3L74G 4D6TG 1SQVG 2IBZG 2BCCG
chains in the Genus database with same CATH superfamily
3L72D 5CHXA 3GG2A 2P58A 1JUNA 2ZXXA 2KSJA 3BASA 3HTKB 3HE5A 4N6JA 3OAKA 4YTPC 4H0LB 3L72G 1SLQA 1RF1C 3CWBD 3GF7A 1X22A 2R32A 1Q7YQ 1NU1K 2JKVA 2A06E 2ZYGA 2IFMA 1VQ9P 1KILC 1OVVA 1OX3A 5AW9B 3MP7B 1DX7A 1L0NE 1NTZJ 2QJPB 2IBZE 5BVZA 3CWBG 1AA0A 1L0LD 1JY2N 3H1JJ 1X0TA 3L75G 3P8MC 1RQVA 2R44A 2C0WA 3HD7A 3HRNA 1FBMA 1K04A 2BCCE 1L0LG 1FZAA 2KZJA 4GKGA 1HBWA 2WSFH 5AVZB 5CCGC 2FFDC 1KFMA 2YMYA 4N78D 2YXQB 1PPJE 1OW8A 1VPCA 1LTIC 3GMAA 3BATA 2KP8A 4WY4C 1GK4A 1KQFB 1DD4A 4KT0J 1FJKA 2M3BA 4H44D 1SFCB 1FOSF 1Y9BA 5APWA 1OXZA 1KB9I 1VQPP 3AECC 1RF0C 2PFXA 3H32B 1IFMA 1S9KE 4RO0A 2FBWC 2AXTE 5CCGA 3PRJA 1EQ7A 3L71D 1G2CA 2I1KA 2QG4A 5KTBA 2K9YA 1NAYA 1L0NJ 3A0BE 1ZXGA 4IL6X 2O01N 4IOIH 1KORA 1J1EC 2W27A 3L71G 3QWOC 3WU2E 4N3YB 1LWUB 2A45H 3BRVB 1LTJB 2HR3A 4R4LA 2YMKA 1RF0A 4H13C 5B5EE 2YO2A 4DZOA 4K35A 2PGDA 4W80A 1YYCA 3M0DC 3HE4B 5CCHA 1NTKJ 3H1IJ 2IZ0A 4PD4I 1SQQD 3VP8A 1URQB 2GA1A 1H0TA 2Y9YA 1T2KC 2J59M 3AE4C 5B66E 2AEMA 1OW6A 3OA7A 2XNXA 2R3SA 1K8AQ 3V5BA 3GLMA 1KD1Q 1GMJA 1SQQG 3B5NC 1S2EA 5TISE 1SQBE 1K73Q 3M0DA 1YJNP 1QEXA 1LT9C 4MN4C 3TNUA 1E79H 1S72P 3F89A 3BRTB 5L8RJ 2G3AA 1RE3C 1N7SD 2E76C 2ZYDA 5KLVD 1BCCJ 5AVWB 1SP4A 4HJGH 3BCCJ 1L4AD 4BRYA 2KI7B 3AEFC 1G1IA 1MV8A 4OGQD 2N1TB 3HUSA 3B5NA 1JOCA 1Y47A 3P8CD 1VF5C 5KLVG 2ZT9D 2V7QH 1LT9A 1KB9D 2K1AA 2HPCB 4C7RA 2R3CA 2W6AA 1GDTA 2AXTH 3WUTA 4HYTB 4KHXA 2E74D 3CX5E 4H0LC 3L70D 4UB6E 5KAIH 2HODA 2N1TD 3CCSP 3LW5H 1YQ4C 3CC7P 1HJ0A 1Q81Q 2WQYC 4M3LA 4D6TG 3B4SA 1SQBJ 2LXCB 2Z5HA 3E7KA 2QJPC 3L70G 1SQPK 2Y0EA 1WT6A 3Q5SA 1DIPA 3CCVP 3CCMP 1IFDA 3IN6A 1LGHB 5KAFE 2IDBA 2E5TA 1DEEG 5KKZB 3HTKA 1VQ5P 1KYOI 3IR9A 4PD4D 3BVHA 2C0XA 1BSHA 1HUCA 2V4HA 1H89A 3M9HA 1ZV8A 2B87B 4L73A 2BASA 1GL2A 2ZVNB 2RKLA 1EZVE 4JYCA 3M91A 1SFCC 2OARA 4ZKPA 1JO5A 3MHVA 2OTKE 1FZGA 3KQGA 1IFJA 1NTMK 5APXA 2K88A 2RH0A 4GT1A 1IFPA 4PV1D 3H25A 3S4RA 1YHQP 3C9IA 1JY2P 2GUSA 1H8AA 1PP9J 2FYUD 3G6EP 1ZW0A 1KMIZ 2JDIH 4U3FE 3HD7D 3L73J 4WY4B 1SQVG 1JNMA 3Q2YA 1JY2O 4RESB 1EC5A 2W8ZA 1LTJC 3CI9A 3CPWO 4DCKA 3H32A 1DEBA 2OQQA 1DH3A 1VQ7P 1HGZA 2Q3IA 3MUDC 1KQSO 1M1JB 1CI6B 4I6MC 4UB6H 1Q90D 1BE3J 2KLVA 3A3YB 1HGVA 1LTTC 1URQC 2JWAA 3EWKA 1L0LK 4JYBA 2FKWB 1HWTC 1LJ2A 2NPSB 3H1HD 4KJMA 3TGUD 4QMAA 1LWUA 3H1KE 4WVZA 2IX7C 3CXHI 2WSEH 3AEEC 1IFNA 1DD3A 5BU5A 3RK2B 4CPGA 1KYOD 1SQXJ 1KB9H 1LNQA 3A0HH 5H2FE 4ZMDA 1OMIA 2ITAA 1NTZD 2KSEA 3TF5A 2FY8A 2YXRB 3RK3B 2GUVA 3CMAP 5AVQB 5AVVB 1VQKP 3H1JD 2ZVOB 2E43A 2H89C 1NTZG 2WPVB 2N1TC 2UWJE 4AQRD 5CCHD 3TSIA 3L36A 3H1JG 1CSBA 4DJGA 2FXMA 1HF9A 1OZHA 3S9OA 2L5GB 1PZQA 5CJ0A 2I8DA 3GW6A 1T3UA 3V4WA 3E1IA 1HJBA 3A7OA 3ABVC 4I1LA 2VRSA 1SQPE 1KTMA 1YTZT 5AW3B 1R5LA 3CCQP 1PGOA 2K3RA 2HPCA 5KJ7D 4LLHA 2CK3H 1SQQK 2JJLA 5AW0B 3L74J 2DW3A 3RL0D 5KKZC 1IO4A 1BGYJ 2QJYB 4GOFA 1M7LA 1NKNA 3K5BA 3H1LJ 2H43A 3SFDC 1L0NG 3RK3E 1N73C 2ZYAA 2WSFJ 2P2UA 1E5WA 2QA4P 2R5BA 3CXHD 3L75D 2AEJA 1NTKD 3H1ID 5APTA 3Q1MA 4JQ0D 5AW2B 2OYIB 5H2FH 1NTME 5KLVK 2QJKB 4Y99B 4H44B 4C46A 1NTKG 3H1IG 3VTPC 1PPJG 1J1DB 1U7JA 3L72E 1RF1A 3U59A 1SQPJ 4RJTA 3I55P 1NYHA 1NAFA 3O6QB 4XA4A 2C9LY 1KILA 3A2AA 3T97A 5AVRB 2PP6A 1QVFO 3CWBE 3D6YA 2E75D 1IK7A 3AE3C 5KLIB 2Q7CA 1BCCD 3BCCD 3AE6C 3JSVC 2E5YA 2Z4EA 3A5TA 2M0BA 1NH4A 1M1JC 1GL2D 1L0LE 1EDLA 1XTCC 1FC2C 4WBAA 2FFDA 1BCCG 3CC4P 3BCCG 3CCLP 4NPEA 3SWFA 1FZFA 3PJSK 3USSA 1WMKA 4WY4A 5KAIE 2NPSC 3MTUE 4DT0A 1T3JA 1NTMJ 1NGMB 3V2RA 1VDFA 2J58A 2E42A 3V2PA 3RK2C 3M06A 4LC1A 1M1JA 4EI2A 1CI6A 5GTIH 5AW5B 1FU1A 2BCCJ 1SQBD 3RK3C 2YKOA 4JF7A 3SFEC 1GU4A 2O1KA 2KZIA 2WT7A 1FE6A 1S4XA 3GHGB 4EOTA 2RN0A 1BSNA 2JR8A 1SQBG 1N7SB 3AE2C 4C7NA 1YJ9P 1AQTA 2P67A 1M56D 1A02F 2QRXA 5AVSB 1L4AB 1X79B 2V7QJ 4OGQB 1YBKA 2O1JA 3MZWB 4L75A 1IC2A 1USDA 4BXLA 2JO1A 2ZT9B 2FYUK 1KQLA 3FX0A 3NMDA 3P32A 1U57A 2OYOA 2ZAEB 3LW5J 1YI2P 2KS1B 2OYHB 2KNCB 2E74B 2WSCH 1LTGC 1LTBC 1SQQE 1N86A 4I7ZB 2XU6A 3H6PA 3CXHH 1S1CX 5EFWB 3C1LA 1NVOA 3KXDA 3TK1A 1PP9D 2GM4A 2XDJA 2QJYC 4PJ0H 1EDJA 3L73D 1RE3A 1JM0A 1J2JB 1NU1E 1PGPA 3II6A 3NTNA 4D6TD 3M0AA 2XNDH 3KZIH 5C39A 1HTLC 1PP9G 3I5CA 3L73G 1RH5B 1A02J 2CPBA 5KLVE 1NTZK 3AEBC 1BE3D 5AW8B 2B88A 2OYIC 2BEQD 3VOPA 2QJKC 1QVGO 3EFFK 3P8CE 4Y99C 1FDOA 4H44C 1ZRTD 1JY3N 2FXPA 1BE3G 1KB9E 3A0HE 1JEKA 1J1DC 1P84I 3MGNA 2LR2A 1RY3A 2Z5IA 4NPFX 1N73B 1ZP0C 2IYOA 2WMMA 1EZVG 1PIXA 1SQXD 2O3JA 3D71A 1GW3A 2W6BA 3L70E 2O01H 4PV1B 2OYIA 2QSIA 4ASVA 1MZ9A 5KLIC 1SQXG 3F5HA 3HD7B 1NU1J 1VQNP 3O6QA 4DOJA 3QH9A 3AEDC 4EYYQ 2LXBA 1SQVD 4PD4E 3AEGC 4OVNF 2R5DA 1VQOP 1S5LE 1SFCA 1NJIQ 2WSEJ 5GTHH 2OTJP 1RHZB 2POHA 1LP1B 3UIAA 1KILD 1Z56A 2XV5A 3CLQA 4YPCA 2IBZI 2QM7A 3JC22 1GTWA 1FDIA 1NTKK 3L74D 3GHGC 3AEAC 5AW4B 1GZLA 1OW7A 3R4YA 5APSA 1Q82Q 1N7SC 1BGYD 3PP5A 3CL3D 1EXJA 1L4AC 3EFGA 3H1LD 2Y9ZA 5M1BA 1LTJA 4WWIA 4OGQC 3L74G 5CCGD 2FYUE 2XKMA 2QIWA 4JPZB 3VMYA 1BGYG 3MUDA 1RQUA 3VMZA 3HE4A 2ZT9C 2ZXEB 2KOGA 1P84D 3H1LG 1G1JA 2KYVA 1X8YA 2KK7A 1URQA 2OTLP 1ZR2A 1N7SA 3FXDA 1SS1A 2PRRA 2OYHC 2E74C 4U3FJ 1L4AA 3V2QA 3ITKA 4ZKUA 4I7ZC 4HH2A 2W83C 5AVXB 1CW5A 2HFED 2I1JA 2Q3EA 1KFNA 1KQGB 2JP3A 3Q5RA 3JCUH 1GD2E 3H1HE 1TU3F 3TGUE 2XZRA 4ASWA 1YIJP 1L2PA 5BU8B 1S3JA 1SQPG 2N9YB 1QL2A 3AE7C 4BRYB 3RL0B 3W67A 1KC8Q 2BEZF 2KS1A 1FZCB 1KYOE 3I56P 4JBZA 1EXIA 2OYHA 3RGUA 2KNCA 2D2CD 1FAVA 3HUSB 1NKZB 4H13D 4PD4H 4Z1MH 1W2EA 1N2DC 1AVYA 3S1KA 2N1TA 3IFMA 3H1KJ 2WITA 1S5LH 2FYUJ 1N7LA 3U1CA 2A45G 1SQBK 3EQ2A 1FDMA 1NOHA 2B89A 2YIUB 2A06D 1T2KD 2KLUA 1IZNB 1VQ8P 3WMM0 4GOEA 1NHLA 2M5AB 4BWNA 2C9NY 1L0ND 2FYZA 2IBZD 1EDIA 3VYIA 3KHUA 3VMAA 3VN0A 2Y0DA 2A06G 3B5ND 5GTIE 3L4FA 5APQA 4HB1A 1KZUB 5CJ4A 2IBZG 1OFCX 3KDPB 2ZFCA 4GDOA 4W7ZA 4IFFA 1NTMG 1H88A 2BCCD 3H1HJ 3TGUJ 4PV1C 3FGAD 1JMBA 2E76D 1VQ4P 2JWDA 1PPJD 4L76A 1JTHB 1T6AA 2FYNB 3HD7C 4R4MA 2E75B 4EIJA 2BCCG 1ZN5A 5CMZA 3SSUA 4UB8E 4IFDK 1VF5D 3WUVA 1N73A 5AW6B 3CCJP 1WRGA 2B87A 3R2PA 1GL2B 1CZQA 2QVAA 1S9KD 3PTZA 3G4SP 4RKUJ 3SWYA 3RL0g 1JY3P 1BDDA 4H0LD 3CX5I 1YITP 1NO4A 3CXHE 3L75E 2WZ7A 2KUBA 1JY3O 1NTKE 3H1IE 3OW2O 3VMXA 1GW4A 2WTYA 2WWWA 1KYOH 4OWFA 1P84H 3RBZA 5APYA 4PJ0E 3B71A 1S5LX 1PL5A 1K05A 3KZIE 1FOSE 1HVVA 2H8PD 1FS0E 1LP1A 2MJZA 4N78E 5APUA 3FWLA 3FXEA 1FZEA 5CCHC 2YKPA 5CBNA 1W2BO 1SQXK 1T8ZA 3L72J 1VL2A 2AXCA 1BCCE 1SFCD 3BCCE 1EZVI 2AEFA 3V2NA 2QM8A 4YXDC 1VQ6P 3PLNA 3M9QA 3M9BA 2P1JA 1EDKA 2NPSA 2WSCJ 2D2CC 3CWBJ 2ZJSE 4AUWA 2LKMA 2PAJA 4GIFA 2M3EA 3L71E 4Y28J 4LGDE 3RBXA 3L75J 4YXWH 2Q5UA 1GK6A 3AE9C 1M57D 1SQVK 3G3ZA 5APVA 4UB8H 1PFIA 1L0LJ 5KJ7C 1R8EA 1SVFA 2K9JB 2P7JA 4GODA 1JB0J 3RL0C 3CCUP 1FZCC 3HUSC 4B86A 2QE7H 2WVRA 3L35A 1NU1D 2RMZA 5E79E 4TT3H 3CX5D 3W68A 1M90Q 4A7PA 5AVYB 1URQD 2YIUC 3P7KA 5KJ7A 1NU1G 5GTHE 2P10A 1BDCA 2Q9IA 3G71P 1FZCA 2YKQA 1UIIA 2WPSA 3E1RA 3B8EB 3L71J 1N8RQ 1GU5A 2MKVA 3TYYA 4XE5B 2CPSA 2O01J 1AJYA 3PHLA 1JMMA 2M5AA 1PGJA 5TJHA 1MKMA 3A0BH 1ZLLA 2FYNC 1FZBA 2HG5D 2E75C 3HE5B 1LTSC 1EZVD 3Q3DA 1W5CE 1YQ3C 2KXPB 1M8OB 3WU2H 4EDFA 3CC2P 1PP9E 1OVUA 2W90A 5B5EH 1GL2C 1SQQJ 4TLFA 3L73E 5K5GB 2IZ1A 4D6TE 1YTZI 1MFZA 2W6JH 1JTHA 1X9VA 4K3AA 1OIPA 2JEEA 5B66H 1QX8A 2YO3A 1RF1B 4U3FD 2KIKA 3JCUE 2IPPA 1BE3E 2HYNA 1IK9A 4W7YA 3MD0A 1KILB 1LTAC 2N9BA 3T97B 2QEXP 1XTGB 3L37A 3KYQA 2IYPA 5TISH 1MFTA 3G9RA 1ZRTE 4U3FG 3IAOA 5E79H 1YJWP 3NXSA 3Q5PA 2A45I 1ZOYC 5KLVJ 1VQMP 2OGUA 1L0NK 1LT1A 2FXOA 2Y0CA 1OVRA 1SQXE 3N7NA 1KN7A 1MUUA 2Q6QA 5AW7B 4ZNCA 2WPQA 2FFDB 3H1KD 2H88C 1AFOA 2NRGA 2IFNA 1PV3A 1G2CB 1ZR4A 3O8ZA 2WSSH 2HLOA 3OJAB 2B9BA 2YNYA 4D6TJ 1LWUC 1Y8AA 1AVOA 1IJDB 3H1KG 3V4QA 3VP9A 3L70J 1USEA 2FYUG 1PGQA 2K37A 4OH8B 4IL6E 1R5SA 3CD6P 1OWAA 2SPZA 1SQVE 3CX5H 3WUUA 5CBOA 3PH0A 3U1AA 1QL1A 3GF3A 1JCDA 3CMEP 1D7MA 1QLED 2WT7B 1AV1A 4WY4D 2L91A 3CCEP 1H0TB 3AE5C 1KILE 1J1EB 4C7NB 3GHGA 4WB4A 2Q1KA 1U7MA 5KAFH 1Q86Q 1AQ5A 3CCRP 1ZMEC 1IFIA 2D2CB 3H1HG 4H13B 3TGUG 3D70A 3AE8C 4AYCA 1RE4C 3L74E 1HH0A 4O9BA 5AVUB 3NFQA 1NWQA 1SQPD 3TNUB 1BGYE 3LIEA 2K9JA 2NPSD 3TDKA 3D6ZA 2WPRA 3H1LE 1KV4A 2G8YA 3SWKA 4NPDA 1FJPA 5AW1B 2M8RA 3RK2D 4XFJA 1P84E 3B5NB 1SQVJ 3MIWA 1RE4A 1NTZE 4HKZH 3AE1C 5DJUB 1LT9B 3RK3D 3KPEA 3N4XA 1VQLP 3H1JE 2H7HA 1JCCA 1UIXA 4U7JA 2E76B 3ZDMA 5DJTB 1M1KQ 4I2LC 5AVTB 4IFMA 3C8VA 2KB7P 3IF4A 1K9MQ 3LIDA 1Q2NA 2NZ2A 2HODB 1QGKB 3FWNA 1NTMD 1VF5B 4L74A 3V6IA 2J5UA 4IL6H
chains in the Genus database with same CATH topology
3L75G 3L70G 3H1KG 3CXHH 4U3FG 1KYOH 1NTMG 1SQXG 3H1HG 1BGYG 2FYUG 1NTKG 1SQQG 3H1IG 3TGUG 1P84H 1KB9H 5KLVG 3L71G 1PPJG 1EZVG 1NTZG 1NU1G 1PP9G 2A06G 3H1LG 1SQPG 1BCCG 3BCCG 1L0LG 3CWBG 3CX5H 1L0NG 3L73G 3L72G 4PD4H 1BE3G 1SQBG 3H1JG 3L74G 4D6TG 1SQVG 2IBZG 2BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 G;  3L70 G;  3H1K G;  3CXH H;  4U3F G;  1KYO H;  1NTM G;  1SQX G;  3H1H G;  1BGY G;  2FYU G;  1NTK G;  1SQQ G;  3H1I G;  3TGU G;  1P84 H;  1KB9 H;  5KLV G;  3L71 G;  1PPJ G;  1EZV G;  1NTZ G;  1NU1 G;  1PP9 G;  2A06 G;  3H1L G;  1SQP G;  1BCC G;  3BCC G;  1L0L G;  3CWB G;  3CX5 H;  1L0N G;  3L73 G;  3L72 G;  4PD4 H;  1BE3 G;  1SQB G;  3H1J G;  3L74 G;  4D6T G;  1SQV G;  2IBZ G;  2BCC G; 
#chains in the Genus database with same CATH topology
 3L72 D;  5CHX A;  3GG2 A;  2P58 A;  1JUN A;  2ZXX A;  2KSJ A;  3BAS A;  3HTK B;  3HE5 A;  4N6J A;  3OAK A;  4YTP C;  4H0L B;  3L72 G;  1SLQ A;  1RF1 C;  3CWB D;  3GF7 A;  1X22 A;  2R32 A;  1Q7Y Q;  1NU1 K;  2JKV A;  2A06 E;  2ZYG A;  2IFM A;  1VQ9 P;  1KIL C;  1OVV A;  1OX3 A;  5AW9 B;  3MP7 B;  1DX7 A;  1L0N E;  1NTZ J;  2QJP B;  2IBZ E;  5BVZ A;  3CWB G;  1AA0 A;  1L0L D;  1JY2 N;  3H1J J;  1X0T A;  3L75 G;  3P8M C;  1RQV A;  2R44 A;  2C0W A;  3HD7 A;  3HRN A;  1FBM A;  1K04 A;  2BCC E;  1L0L G;  1FZA A;  2KZJ A;  4GKG A;  1HBW A;  2WSF H;  5AVZ B;  5CCG C;  2FFD C;  1KFM A;  2YMY A;  4N78 D;  2YXQ B;  1PPJ E;  1OW8 A;  1VPC A;  1LTI C;  3GMA A;  3BAT A;  2KP8 A;  4WY4 C;  1GK4 A;  1KQF B;  1DD4 A;  4KT0 J;  1FJK A;  2M3B A;  4H44 D;  1SFC B;  1FOS F;  1Y9B A;  5APW A;  1OXZ A;  1KB9 I;  1VQP P;  3AEC C;  1RF0 C;  2PFX A;  3H32 B;  1IFM A;  1S9K E;  4RO0 A;  2FBW C;  2AXT E;  5CCG A;  3PRJ A;  1EQ7 A;  3L71 D;  1G2C A;  2I1K A;  2QG4 A;  5KTB A;  2K9Y A;  1NAY A;  1L0N J;  3A0B E;  1ZXG A;  4IL6 X;  2O01 N;  4IOI H;  1KOR A;  1J1E C;  2W27 A;  3L71 G;  3QWO C;  3WU2 E;  4N3Y B;  1LWU B;  2A45 H;  3BRV B;  1LTJ B;  2HR3 A;  4R4L A;  2YMK A;  1RF0 A;  4H13 C;  5B5E E;  2YO2 A;  4DZO A;  4K35 A;  2PGD A;  4W80 A;  1YYC A;  3M0D C;  3HE4 B;  5CCH A;  1NTK J;  3H1I J;  2IZ0 A;  4PD4 I;  1SQQ D;  3VP8 A;  1URQ B;  2GA1 A;  1H0T A;  2Y9Y A;  1T2K C;  2J59 M;  3AE4 C;  5B66 E;  2AEM A;  1OW6 A;  3OA7 A;  2XNX A;  2R3S A;  1K8A Q;  3V5B A;  3GLM A;  1KD1 Q;  1GMJ A;  1SQQ G;  3B5N C;  1S2E A;  5TIS E;  1SQB E;  1K73 Q;  3M0D A;  1YJN P;  1QEX A;  1LT9 C;  4MN4 C;  3TNU A;  1E79 H;  1S72 P;  3F89 A;  3BRT B;  5L8R J;  2G3A A;  1RE3 C;  1N7S D;  2E76 C;  2ZYD A;  5KLV D;  1BCC J;  5AVW B;  1SP4 A;  4HJG H;  3BCC J;  1L4A D;  4BRY A;  2KI7 B;  3AEF C;  1G1I A;  1MV8 A;  4OGQ D;  2N1T B;  3HUS A;  3B5N A;  1JOC A;  1Y47 A;  3P8C D;  1VF5 C;  5KLV G;  2ZT9 D;  2V7Q H;  1LT9 A;  1KB9 D;  2K1A A;  2HPC B;  4C7R A;  2R3C A;  2W6A A;  1GDT A;  2AXT H;  3WUT A;  4HYT B;  4KHX A;  2E74 D;  3CX5 E;  4H0L C;  3L70 D;  4UB6 E;  5KAI H;  2HOD A;  2N1T D;  3CCS P;  3LW5 H;  1YQ4 C;  3CC7 P;  1HJ0 A;  1Q81 Q;  2WQY C;  4M3L A;  4D6T G;  3B4S A;  1SQB J;  2LXC B;  2Z5H A;  3E7K A;  2QJP C;  3L70 G;  1SQP K;  2Y0E A;  1WT6 A;  3Q5S A;  1DIP A;  3CCV P;  3CCM P;  1IFD A;  3IN6 A;  1LGH B;  5KAF E;  2IDB A;  2E5T A;  1DEE G;  5KKZ B;  3HTK A;  1VQ5 P;  1KYO I;  3IR9 A;  4PD4 D;  3BVH A;  2C0X A;  1BSH A;  1HUC A;  2V4H A;  1H89 A;  3M9H A;  1ZV8 A;  2B87 B;  4L73 A;  2BAS A;  1GL2 A;  2ZVN B;  2RKL A;  1EZV E;  4JYC A;  3M91 A;  1SFC C;  2OAR A;  4ZKP A;  1JO5 A;  3MHV A;  2OTK E;  1FZG A;  3KQG A;  1IFJ A;  1NTM K;  5APX A;  2K88 A;  2RH0 A;  4GT1 A;  1IFP A;  4PV1 D;  3H25 A;  3S4R A;  1YHQ P;  3C9I A;  1JY2 P;  2GUS A;  1H8A A;  1PP9 J;  2FYU D;  3G6E P;  1ZW0 A;  1KMI Z;  2JDI H;  4U3F E;  3HD7 D;  3L73 J;  4WY4 B;  1SQV G;  1JNM A;  3Q2Y A;  1JY2 O;  4RES B;  1EC5 A;  2W8Z A;  1LTJ C;  3CI9 A;  3CPW O;  4DCK A;  3H32 A;  1DEB A;  2OQQ A;  1DH3 A;  1VQ7 P;  1HGZ A;  2Q3I A;  3MUD C;  1KQS O;  1M1J B;  1CI6 B;  4I6M C;  4UB6 H;  1Q90 D;  1BE3 J;  2KLV A;  3A3Y B;  1HGV A;  1LTT C;  1URQ C;  2JWA A;  3EWK A;  1L0L K;  4JYB A;  2FKW B;  1HWT C;  1LJ2 A;  2NPS B;  3H1H D;  4KJM A;  3TGU D;  4QMA A;  1LWU A;  3H1K E;  4WVZ A;  2IX7 C;  3CXH I;  2WSE H;  3AEE C;  1IFN A;  1DD3 A;  5BU5 A;  3RK2 B;  4CPG A;  1KYO D;  1SQX J;  1KB9 H;  1LNQ A;  3A0H H;  5H2F E;  4ZMD A;  1OMI A;  2ITA A;  1NTZ D;  2KSE A;  3TF5 A;  2FY8 A;  2YXR B;  3RK3 B;  2GUV A;  3CMA P;  5AVQ B;  5AVV B;  1VQK P;  3H1J D;  2ZVO B;  2E43 A;  2H89 C;  1NTZ G;  2WPV B;  2N1T C;  2UWJ E;  4AQR D;  5CCH D;  3TSI A;  3L36 A;  3H1J G;  1CSB A;  4DJG A;  2FXM A;  1HF9 A;  1OZH A;  3S9O A;  2L5G B;  1PZQ A;  5CJ0 A;  2I8D A;  3GW6 A;  1T3U A;  3V4W A;  3E1I A;  1HJB A;  3A7O A;  3ABV C;  4I1L A;  2VRS A;  1SQP E;  1KTM A;  1YTZ T;  5AW3 B;  1R5L A;  3CCQ P;  1PGO A;  2K3R A;  2HPC A;  5KJ7 D;  4LLH A;  2CK3 H;  1SQQ K;  2JJL A;  5AW0 B;  3L74 J;  2DW3 A;  3RL0 D;  5KKZ C;  1IO4 A;  1BGY J;  2QJY B;  4GOF A;  1M7L A;  1NKN A;  3K5B A;  3H1L J;  2H43 A;  3SFD C;  1L0N G;  3RK3 E;  1N73 C;  2ZYA A;  2WSF J;  2P2U A;  1E5W A;  2QA4 P;  2R5B A;  3CXH D;  3L75 D;  2AEJ A;  1NTK D;  3H1I D;  5APT A;  3Q1M A;  4JQ0 D;  5AW2 B;  2OYI B;  5H2F H;  1NTM E;  5KLV K;  2QJK B;  4Y99 B;  4H44 B;  4C46 A;  1NTK G;  3H1I G;  3VTP C;  1PPJ G;  1J1D B;  1U7J A;  3L72 E;  1RF1 A;  3U59 A;  1SQP J;  4RJT A;  3I55 P;  1NYH A;  1NAF A;  3O6Q B;  4XA4 A;  2C9L Y;  1KIL A;  3A2A A;  3T97 A;  5AVR B;  2PP6 A;  1QVF O;  3CWB E;  3D6Y A;  2E75 D;  1IK7 A;  3AE3 C;  5KLI B;  2Q7C A;  1BCC D;  3BCC D;  3AE6 C;  3JSV C;  2E5Y A;  2Z4E A;  3A5T A;  2M0B A;  1NH4 A;  1M1J C;  1GL2 D;  1L0L E;  1EDL A;  1XTC C;  1FC2 C;  4WBA A;  2FFD A;  1BCC G;  3CC4 P;  3BCC G;  3CCL P;  4NPE A;  3SWF A;  1FZF A;  3PJS K;  3USS A;  1WMK A;  4WY4 A;  5KAI E;  2NPS C;  3MTU E;  4DT0 A;  1T3J A;  1NTM J;  1NGM B;  3V2R A;  1VDF A;  2J58 A;  2E42 A;  3V2P A;  3RK2 C;  3M06 A;  4LC1 A;  1M1J A;  4EI2 A;  1CI6 A;  5GTI H;  5AW5 B;  1FU1 A;  2BCC J;  1SQB D;  3RK3 C;  2YKO A;  4JF7 A;  3SFE C;  1GU4 A;  2O1K A;  2KZI A;  2WT7 A;  1FE6 A;  1S4X A;  3GHG B;  4EOT A;  2RN0 A;  1BSN A;  2JR8 A;  1SQB G;  1N7S B;  3AE2 C;  4C7N A;  1YJ9 P;  1AQT A;  2P67 A;  1M56 D;  1A02 F;  2QRX A;  5AVS B;  1L4A B;  1X79 B;  2V7Q J;  4OGQ B;  1YBK A;  2O1J A;  3MZW B;  4L75 A;  1IC2 A;  1USD A;  4BXL A;  2JO1 A;  2ZT9 B;  2FYU K;  1KQL A;  3FX0 A;  3NMD A;  3P32 A;  1U57 A;  2OYO A;  2ZAE B;  3LW5 J;  1YI2 P;  2KS1 B;  2OYH B;  2KNC B;  2E74 B;  2WSC H;  1LTG C;  1LTB C;  1SQQ E;  1N86 A;  4I7Z B;  2XU6 A;  3H6P A;  3CXH H;  1S1C X;  5EFW B;  3C1L A;  1NVO A;  3KXD A;  3TK1 A;  1PP9 D;  2GM4 A;  2XDJ A;  2QJY C;  4PJ0 H;  1EDJ A;  3L73 D;  1RE3 A;  1JM0 A;  1J2J B;  1NU1 E;  1PGP A;  3II6 A;  3NTN A;  4D6T D;  3M0A A;  2XND H;  3KZI H;  5C39 A;  1HTL C;  1PP9 G;  3I5C A;  3L73 G;  1RH5 B;  1A02 J;  2CPB A;  5KLV E;  1NTZ K;  3AEB C;  1BE3 D;  5AW8 B;  2B88 A;  2OYI C;  2BEQ D;  3VOP A;  2QJK C;  1QVG O;  3EFF K;  3P8C E;  4Y99 C;  1FDO A;  4H44 C;  1ZRT D;  1JY3 N;  2FXP A;  1BE3 G;  1KB9 E;  3A0H E;  1JEK A;  1J1D C;  1P84 I;  3MGN A;  2LR2 A;  1RY3 A;  2Z5I A;  4NPF X;  1N73 B;  1ZP0 C;  2IYO A;  2WMM A;  1EZV G;  1PIX A;  1SQX D;  2O3J A;  3D71 A;  1GW3 A;  2W6B A;  3L70 E;  2O01 H;  4PV1 B;  2OYI A;  2QSI A;  4ASV A;  1MZ9 A;  5KLI C;  1SQX G;  3F5H A;  3HD7 B;  1NU1 J;  1VQN P;  3O6Q A;  4DOJ A;  3QH9 A;  3AED C;  4EYY Q;  2LXB A;  1SQV D;  4PD4 E;  3AEG C;  4OVN F;  2R5D A;  1VQO P;  1S5L E;  1SFC A;  1NJI Q;  2WSE J;  5GTH H;  2OTJ P;  1RHZ B;  2POH A;  1LP1 B;  3UIA A;  1KIL D;  1Z56 A;  2XV5 A;  3CLQ A;  4YPC A;  2IBZ I;  2QM7 A;  3JC2 2;  1GTW A;  1FDI A;  1NTK K;  3L74 D;  3GHG C;  3AEA C;  5AW4 B;  1GZL A;  1OW7 A;  3R4Y A;  5APS A;  1Q82 Q;  1N7S C;  1BGY D;  3PP5 A;  3CL3 D;  1EXJ A;  1L4A C;  3EFG A;  3H1L D;  2Y9Z A;  5M1B A;  1LTJ A;  4WWI A;  4OGQ C;  3L74 G;  5CCG D;  2FYU E;  2XKM A;  2QIW A;  4JPZ B;  3VMY A;  1BGY G;  3MUD A;  1RQU A;  3VMZ A;  3HE4 A;  2ZT9 C;  2ZXE B;  2KOG A;  1P84 D;  3H1L G;  1G1J A;  2KYV A;  1X8Y A;  2KK7 A;  1URQ A;  2OTL P;  1ZR2 A;  1N7S A;  3FXD A;  1SS1 A;  2PRR A;  2OYH C;  2E74 C;  4U3F J;  1L4A A;  3V2Q A;  3ITK A;  4ZKU A;  4I7Z C;  4HH2 A;  2W83 C;  5AVX B;  1CW5 A;  2HFE D;  2I1J A;  2Q3E A;  1KFN A;  1KQG B;  2JP3 A;  3Q5R A;  3JCU H;  1GD2 E;  3H1H E;  1TU3 F;  3TGU E;  2XZR A;  4ASW A;  1YIJ P;  1L2P A;  5BU8 B;  1S3J A;  1SQP G;  2N9Y B;  1QL2 A;  3AE7 C;  4BRY B;  3RL0 B;  3W67 A;  1KC8 Q;  2BEZ F;  2KS1 A;  1FZC B;  1KYO E;  3I56 P;  4JBZ A;  1EXI A;  2OYH A;  3RGU A;  2KNC A;  2D2C D;  1FAV A;  3HUS B;  1NKZ B;  4H13 D;  4PD4 H;  4Z1M H;  1W2E A;  1N2D C;  1AVY A;  3S1K A;  2N1T A;  3IFM A;  3H1K J;  2WIT A;  1S5L H;  2FYU J;  1N7L A;  3U1C A;  2A45 G;  1SQB K;  3EQ2 A;  1FDM A;  1NOH A;  2B89 A;  2YIU B;  2A06 D;  1T2K D;  2KLU A;  1IZN B;  1VQ8 P;  3WMM 0;  4GOE A;  1NHL A;  2M5A B;  4BWN A;  2C9N Y;  1L0N D;  2FYZ A;  2IBZ D;  1EDI A;  3VYI A;  3KHU A;  3VMA A;  3VN0 A;  2Y0D A;  2A06 G;  3B5N D;  5GTI E;  3L4F A;  5APQ A;  4HB1 A;  1KZU B;  5CJ4 A;  2IBZ G;  1OFC X;  3KDP B;  2ZFC A;  4GDO A;  4W7Z A;  4IFF A;  1NTM G;  1H88 A;  2BCC D;  3H1H J;  3TGU J;  4PV1 C;  3FGA D;  1JMB A;  2E76 D;  1VQ4 P;  2JWD A;  1PPJ D;  4L76 A;  1JTH B;  1T6A A;  2FYN B;  3HD7 C;  4R4M A;  2E75 B;  4EIJ A;  2BCC G;  1ZN5 A;  5CMZ A;  3SSU A;  4UB8 E;  4IFD K;  1VF5 D;  3WUV A;  1N73 A;  5AW6 B;  3CCJ P;  1WRG A;  2B87 A;  3R2P A;  1GL2 B;  1CZQ A;  2QVA A;  1S9K D;  3PTZ A;  3G4S P;  4RKU J;  3SWY A;  3RL0 g;  1JY3 P;  1BDD A;  4H0L D;  3CX5 I;  1YIT P;  1NO4 A;  3CXH E;  3L75 E;  2WZ7 A;  2KUB A;  1JY3 O;  1NTK E;  3H1I E;  3OW2 O;  3VMX A;  1GW4 A;  2WTY A;  2WWW A;  1KYO H;  4OWF A;  1P84 H;  3RBZ A;  5APY A;  4PJ0 E;  3B71 A;  1S5L X;  1PL5 A;  1K05 A;  3KZI E;  1FOS E;  1HVV A;  2H8P D;  1FS0 E;  1LP1 A;  2MJZ A;  4N78 E;  5APU A;  3FWL A;  3FXE A;  1FZE A;  5CCH C;  2YKP A;  5CBN A;  1W2B O;  1SQX K;  1T8Z A;  3L72 J;  1VL2 A;  2AXC A;  1BCC E;  1SFC D;  3BCC E;  1EZV I;  2AEF A;  3V2N A;  2QM8 A;  4YXD C;  1VQ6 P;  3PLN A;  3M9Q A;  3M9B A;  2P1J A;  1EDK A;  2NPS A;  2WSC J;  2D2C C;  3CWB J;  2ZJS E;  4AUW A;  2LKM A;  2PAJ A;  4GIF A;  2M3E A;  3L71 E;  4Y28 J;  4LGD E;  3RBX A;  3L75 J;  4YXW H;  2Q5U A;  1GK6 A;  3AE9 C;  1M57 D;  1SQV K;  3G3Z A;  5APV A;  4UB8 H;  1PFI A;  1L0L J;  5KJ7 C;  1R8E A;  1SVF A;  2K9J B;  2P7J A;  4GOD A;  1JB0 J;  3RL0 C;  3CCU P;  1FZC C;  3HUS C;  4B86 A;  2QE7 H;  2WVR A;  3L35 A;  1NU1 D;  2RMZ A;  5E79 E;  4TT3 H;  3CX5 D;  3W68 A;  1M90 Q;  4A7P A;  5AVY B;  1URQ D;  2YIU C;  3P7K A;  5KJ7 A;  1NU1 G;  5GTH E;  2P10 A;  1BDC A;  2Q9I A;  3G71 P;  1FZC A;  2YKQ A;  1UII A;  2WPS A;  3E1R A;  3B8E B;  3L71 J;  1N8R Q;  1GU5 A;  2MKV A;  3TYY A;  4XE5 B;  2CPS A;  2O01 J;  1AJY A;  3PHL A;  1JMM A;  2M5A A;  1PGJ A;  5TJH A;  1MKM A;  3A0B H;  1ZLL A;  2FYN C;  1FZB A;  2HG5 D;  2E75 C;  3HE5 B;  1LTS C;  1EZV D;  3Q3D A;  1W5C E;  1YQ3 C;  2KXP B;  1M8O B;  3WU2 H;  4EDF A;  3CC2 P;  1PP9 E;  1OVU A;  2W90 A;  5B5E H;  1GL2 C;  1SQQ J;  4TLF A;  3L73 E;  5K5G B;  2IZ1 A;  4D6T E;  1YTZ I;  1MFZ A;  2W6J H;  1JTH A;  1X9V A;  4K3A A;  1OIP A;  2JEE A;  5B66 H;  1QX8 A;  2YO3 A;  1RF1 B;  4U3F D;  2KIK A;  3JCU E;  2IPP A;  1BE3 E;  2HYN A;  1IK9 A;  4W7Y A;  3MD0 A;  1KIL B;  1LTA C;  2N9B A;  3T97 B;  2QEX P;  1XTG B;  3L37 A;  3KYQ A;  2IYP A;  5TIS H;  1MFT A;  3G9R A;  1ZRT E;  4U3F G;  3IAO A;  5E79 H;  1YJW P;  3NXS A;  3Q5P A;  2A45 I;  1ZOY C;  5KLV J;  1VQM P;  2OGU A;  1L0N K;  1LT1 A;  2FXO A;  2Y0C A;  1OVR A;  1SQX E;  3N7N A;  1KN7 A;  1MUU A;  2Q6Q A;  5AW7 B;  4ZNC A;  2WPQ A;  2FFD B;  3H1K D;  2H88 C;  1AFO A;  2NRG A;  2IFN A;  1PV3 A;  1G2C B;  1ZR4 A;  3O8Z A;  2WSS H;  2HLO A;  3OJA B;  2B9B A;  2YNY A;  4D6T J;  1LWU C;  1Y8A A;  1AVO A;  1IJD B;  3H1K G;  3V4Q A;  3VP9 A;  3L70 J;  1USE A;  2FYU G;  1PGQ A;  2K37 A;  4OH8 B;  4IL6 E;  1R5S A;  3CD6 P;  1OWA A;  2SPZ A;  1SQV E;  3CX5 H;  3WUU A;  5CBO A;  3PH0 A;  3U1A A;  1QL1 A;  3GF3 A;  1JCD A;  3CME P;  1D7M A;  1QLE D;  2WT7 B;  1AV1 A;  4WY4 D;  2L91 A;  3CCE P;  1H0T B;  3AE5 C;  1KIL E;  1J1E B;  4C7N B;  3GHG A;  4WB4 A;  2Q1K A;  1U7M A;  5KAF H;  1Q86 Q;  1AQ5 A;  3CCR P;  1ZME C;  1IFI A;  2D2C B;  3H1H G;  4H13 B;  3TGU G;  3D70 A;  3AE8 C;  4AYC A;  1RE4 C;  3L74 E;  1HH0 A;  4O9B A;  5AVU B;  3NFQ A;  1NWQ A;  1SQP D;  3TNU B;  1BGY E;  3LIE A;  2K9J A;  2NPS D;  3TDK A;  3D6Z A;  2WPR A;  3H1L E;  1KV4 A;  2G8Y A;  3SWK A;  4NPD A;  1FJP A;  5AW1 B;  2M8R A;  3RK2 D;  4XFJ A;  1P84 E;  3B5N B;  1SQV J;  3MIW A;  1RE4 A;  1NTZ E;  4HKZ H;  3AE1 C;  5DJU B;  1LT9 B;  3RK3 D;  3KPE A;  3N4X A;  1VQL P;  3H1J E;  2H7H A;  1JCC A;  1UIX A;  4U7J A;  2E76 B;  3ZDM A;  5DJT B;  1M1K Q;  4I2L C;  5AVT B;  4IFM A;  3C8V A;  2KB7 P;  3IF4 A;  1K9M Q;  3LID A;  1Q2N A;  2NZ2 A;  2HOD B;  1QGK B;  3FWN A;  1NTM D;  1VF5 B;  4L74 A;  3V6I A;  2J5U A;  4IL6 H; 
#chains in the Genus database with same CATH homology
 3L75 G;  3L70 G;  3H1K G;  3CXH H;  4U3F G;  1KYO H;  1NTM G;  1SQX G;  3H1H G;  1BGY G;  2FYU G;  1NTK G;  1SQQ G;  3H1I G;  3TGU G;  1P84 H;  1KB9 H;  5KLV G;  3L71 G;  1PPJ G;  1EZV G;  1NTZ G;  1NU1 G;  1PP9 G;  2A06 G;  3H1L G;  1SQP G;  1BCC G;  3BCC G;  1L0L G;  3CWB G;  3CX5 H;  1L0N G;  3L73 G;  3L72 G;  4PD4 H;  1BE3 G;  1SQB G;  3H1J G;  3L74 G;  4D6T G;  1SQV G;  2IBZ G;  2BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...