2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
3VMZA 1FOSE 1H88A 3TK1A 1G2CB 2Z5HA 3A3YB 1S9KD 1CI6A 3M0AA 3HTKA 4C46A 4DZOA 3NTNA 4KHXA 4I6MC 2Q7CA 2WTYA 2WPSA 2KP8A 2XZRA 2Q5UA 3NXSA 1CSBA 5AVYB 1MV8A 2Q3IA 4GKGA 3L37A 2QM8A 1T2KD 5AVXB 2WPQA 2WWWA 4B86A 2E42A 1T2KC 1MFZA 3VMXA 2IPPA 3HE5B 2Z5IA 4I2LC 1JUNA 3NFQA 1GU5A 3IR9A 5APQA 3V4WA 1HWTC 4JYBA 1S9KE 5APTA 2JJLA 1MUUA 2BASA 3HE5A 5AW8B 5AW5B 4C7NB 5AVSB 3OAKA 5AVRB 5CMZA 2R5DA 3KDPB 4GT1A 2P2UA 4AUWA 2P7JA 3TYYA 3A7OA 2WPRA 3M9BA 3M0DA 5APXA 2N9BA 5AW9B 5APSA 3L35A 5AVWB 1JNMA 5AVTB 5AW6B 3TNUB 1HJBA 2C9NY 2YNYA 3VMYA 5APVA 1CZQA 1SLQA 5AVZB 1GK6A 1GZLA 5AVUB 3A2AA 3MD0A 5APWA 1DH3A 1OWAA 3O8ZA 2WT7B 3TNUA 1GK4A 3B8EB 5AVVB 3UIAA 1H89A 2C9LY 1J2JB 1NAFA 1FAVA 3P8MC 3A5TA 2R3CA 4AQRD 3MGNA 5AW2B 1A02F 5AVQB 3V5BA 4C7NA 2XU6A 3T97A 3VYIA 2W27A 4M3LA 3V4QA 4EOTA 5AW1B 5AW7B 3I5CA 1A02J 2ZFCA 3NMDA 1CI6B 5APYA 4LC1A 2XV5A 2ZXEB 1GU4A 3M06A 5AW4B 3SWFA 1IO4A 2H7HA 1YYCA 1X8YA 4XE5B 2P67A 4HYTB 4JYCA 3P32A 5APUA 4AYCA 1NWQA 2VRSA 1KQLA 2R32A 3L36A 1FOSF 3HE4B 1GTWA 5AW0B 5AW3B 2WT7A 2YO3A 3KQGA 3M91A 1HUCA 1GD2E 2W6AA 3VN0A 3HE4A 3P7KA 1H8AA 2YO2A 2QM7A 3VTPC 3LIDA 3M9HA 4RESB 1SP4A 2E43A 1OXZA 3LIEA 2R5BA 1HBWA
chains in the Genus database with same CATH superfamily
2D2CC 2FYUK 1KFNA 1JCDA 1BSHA 2YXRB 2WSEH 5KLIC 2WPSA 1FZFA 1UIXA 2CPSA 1KYOI 1ZLLA 1USEA 1JO5A 3VMXA 2PRRA 1EC5A 3L70J 3H32A 3OAKA 3BCCE 2UWJE 1NTZK 4EIJA 1OFCX 3USSA 1LTJA 1Y9BA 3R2PA 1SFCB 2C0XA 2PAJA 3AE2C 1FZEA 5KAFH 2QJKC 5APVA 1GZLA 1IZNB 3H1KD 4Z1MH 3O8ZA 2KIKA 5K5GB 1JM0A 2ZT9B 1IFNA 1IFIA 3HD7B 2WSCJ 1SQVK 3PLNA 2BEQD 3H1KG 3WU2E 1KD1Q 2QEXP 3CXHH 5L8RJ 2KXPB 1OMIA 2M5AB 1SQPE 3H1JD 1NJIQ 1X8YA 5E79H 4HYTB 3P32A 4XA4A 3WUVA 1W2BO 1M1JC 2L91A 3H1JG 1HGZA 5AW0B 5AW3B 3FGAD 1FU1A 3CMAP 1XTCC 2W6AA 1X9VA 3P7KA 3CCEP 3SWKA 3LIEA 2E5TA 1XTGB 3CX5I 1S9KD 1PGQA 4H0LC 3JCUE 1N73A 2KLVA 2WTYA 2KOGA 1JY2O 4BXLA 3L70E 1ZMEC 2I8DA 3ZDMA 1KB9D 2E76C 1IJDB 2WPQA 2WWWA 1MFZA 1VQ8P 3AE9C 2IPPA 2QJKB 1PP9D 1GDTA 2NPSD 2ZAEB 1VQ5P 3ITKA 1PP9G 3AEEC 3KDPB 3G6EP 1LT1A 2P2UA 1LTGC 5GTIH 1YJWP 1HH0A 4L76A 3A0HE 1VF5D 5AVVB 1YJ9P 4JPZB 2C9LY 2MJZA 5GTHE 2FKWB 1A02F 3CI9A 1NTKD 1YITP 1QX8A 1YTZT 1RF1C 3VYIA 3B5NC 4LC1A 3E1IA 1GU4A 3SWFA 1EDKA 1JY3N 2FY8A 3FWLA 2KB7P 4H0LB 1IFPA 1KZUB 3HUSA 1FZGA 1KILA 1HUCA 4OWFA 2QE7H 3HD7A 4PD4E 1S4XA 2E76B 1LTTC 4UB8H 5CBOA 5C39A 2Q1KA 2JO1A 1DX7A 2W83C 3S4RA 3KZIH 2M5AA 3HTKA 1JB0J 2WITA 3FX0A 3BCCD 1KYOE 2KZIA 2E74B 1JY2P 4WY4D 1EZVE 2HODB 2QM8A 3AEFC 4B86A 2V7QJ 1JMBA 5TISE 2KNCB 1EQ7A 3B71A 1SQXJ 2B87B 3AE6C 3B5NB 1QL2A 3PP5A 1KN7A 2H88C 1SQPD 4U3FJ 3MD0A 1N86A 1ZW0A 2M8RA 1DH3A 3Q5SA 1SQPG 4BRYB 2FYZA 1EDJA 2XU6A 2C0WA 3V4QA 1K9MQ 1KB9I 5APYA 3H1LJ 2XV5A 2N1TC 3RL0D 2WQYC 4YXWH 1YYCA 3M9QA 3A0BH 2XNDH 5H2FH 1KB9H 2Y9ZA 1Q82Q 3C8VA 3HE4A 3SFEC 1M1JA 1VQLP 1ZOYC 4OGQD 3CX5E 3L70G 4Y28J 1ZR2A 1IK9A 1BDCA 1SFCD 4NPDA 4IFDK 1SQXE 3R4YA 1L4AD 3V2NA 4Y99C 1JUNA 4ZKUA 2BASA 5KTBA 3CC2P 4U3FE 1FJKA 1PFIA 3CPWO 4GT1A 3H1HE 1NTKK 3N4XA 5APSA 3MUDC 2B88A 1URQD 1SLQA 2N1TB 2FYUD 2HODA 3H1LE 1NAFA 1KORA 4ASVA 3A5TA 1Q2NA 2JDIH 2E75C 2OTJP 2KNCA 3L73J 5KJ7D 2KLUA 4PD4D 2OYIB 1RF1A 2B87A 2POHA 3IN6A 4JF7A 4UB8E 3B5NA 4AYCA 3OA7A 4WVZA 1J1EB 4HH2A 1KYOD 3KHUA 1L2PA 2J59M 2YO2A 1EZVD 4BRYA 2M3EA 4PJ0H 4GIFA 1RE3C 1T8ZA 2Z5HA 1EZVG 2AEMA 1HJ0A 2I1KA 4TT3H 3I56P 4C46A 3WU2H 2J58A 3K5BA 4W80A 5M1BA 2FXOA 3CWBJ 1PPJE 1NU1J 1GL2C 2Q3IA 4L75A 1T2KD 4K3AA 4WY4C 4KT0J 2MKVA 3W68A 1SQPK 2FYNC 1LTJB 4H13D 1SQBJ 2E75B 3V2QA 4IOIH 5AW6B 3PRJA 2AXCA 2Y0CA 1GK6A 1Q7YQ 2DW3A 3JCUH 3TNUA 1LTBC 1OVVA 3FWNA 1ZV8A 1M90Q 1DEEG 3V5BA 2IBZI 4M3LA 1YQ4C 1BDDA 3D6YA 2M3BA 1VQOP 3CX5D 1Q86Q 3EFFK 3RL0C 3U1CA 4XE5B 1X0TA 3E7KA 1KQLA 3MTUE 1EXJA 2N1TA 5CJ0A 2E74D 2WSCH 3A0HH 1SQXD 2QM7A 2WPVB 3CWBE 4C7RA 1NU1E 1SP4A 3KYQA 1AVYA 2K9YA 1QL1A 4OGQC 1SQXG 5GTHH 1N7SC 1AFOA 1BE3J 4U3FD 2ZVNB 3FXDA 3L71J 1NH4A 5CCHA 4GDOA 3H1HD 1SQBE 2PFXA 4RO0A 4U3FG 2OQQA 3CCRP 2JKVA 4PD4I 2GUSA 1NVOA 3V4WA 1MUUA 3GF3A 4ZMDA 1SVFA 1S5LE 4H44B 4PD4H 4YXDC 3H1LG 2YMKA 1EZVI 1URQC 5AVUB 5B66E 2O01J 1OWAA 1ZXGA 2H89C 1KYOH 2FXPA 4GOFA 3RK3C 3V2PA 1LJ2A 1KFMA 1YQ3C 1ZRTE 4NPEA 1PV3A 5TISH 1RHZB 3HUSB 2V4HA 4YTPC 1KILB 4PJ0E 3G9RA 1U7MA 2PGDA 1BCCJ 3M91A 3Q2YA 3CD6P 4PV1C 1KQFB 1QLED 1WMKA 1PPJD 3PJSK 1CW5A 2KSJA 3OW2O 3HTKB 1PPJG 3TK1A 1DEBA 2D2CB 5CCGC 4MN4C 2IX7C 1RE3A 5KLIB 2QRXA 1HF9A 2GM4A 1Y47A 1T2KC 3IR9A 1GL2A 2LXCB 2OARA 5APTA 3AE8C 1VQ6P 4WY4A 3L73G 3BASA 5KLVJ 1YBKA 2AEFA 3GHGC 3D6ZA 2CPBA 4H13C 3L72J 1NOHA 3AECC 4CPGA 1K05A 1NHLA 3CX5H 2YNYA 1RY3A 1CZQA 3TGUJ 3SWYA 5APWA 2V7QH 2A06G 3AEBC 1H89A 1X79B 1J2JB 3P8MC 3GG2A 2IYOA 2IBZE 4PV1B 4HKZH 1BCCE 1KILE 1A02J 1SQXK 3CWBD 2BCCJ 1FZCC 1NU1D 3H6PA 1GMJA 4JYCA 3AE1C 3CWBG 1NU1G 3HE4B 2KS1B 5DJUB 1M1JB 3KQGA 3H25A 5CHXA 1X22A 1LTIC 3CCMP 3PH0A 1SQBD 2ZXXA 2KSEA 2L5GB 1IFMA 1OXZA 3Q5RA 1HBWA 3B4SA 3D71A 1SQBG 1USDA 1G2CB 1FS0E 2K1AA 4DZOA 4I6MC 4LGDE 2IZ0A 3RBZA 1RH5B 1FDMA 3NXSA 1EDLA 1FZBA 1N7SA 5KLVE 1AJYA 3L37A 5AVXB 2P10A 3SSUA 4ZKPA 2K3RA 3Q5PA 1VQKP 1NKZB 2FBWC 1KV4A 2AEJA 3TGUE 2Q6QA 2K9JB 2FFDC 1YJNP 4AUWA 3A7OA 2YKPA 2ITAA 1T3UA 3L35A 1NO4A 4LLHA 1SQQJ 3N7NA 1FZCB 1AQ5A 2WT7B 3AE3C 2BCCE 3MHVA 3E1RA 1URQA 3RK2D 1RF1B 2YKQA 1JTHA 1BE3G 1KTMA 3AEAC 1M1KQ 3CLQA 3L71G 3PTZA 3CCLP 2NZ2A 2R32A 2LKMA 4XFJA 1PZQA 3CCJP 4D6TJ 4DCKA 1K73Q 1E5WA 1JOCA 1LP1B 1OW7A 1S1CX 2B89A 1JY3O 1FOSE 1BSNA 4H44D 4W7ZA 1VQNP 1RE4C 5KAIE 2HR3A 2KYVA 2FFDB 3AE5C 5CCGA 3L70D 2KS1A 3WMM0 2I1JA 1DD3A 2HG5D 1SQQE 3II6A 3M0DC 5AW5B 1K04A 3T97B 3GLMA 2OYHC 1G2CA 1UIIA 2ZYDA 2WPRA 3M9BA 2IBZD 4UB6H 1MKMA 2IYPA 1JNMA 4I7ZC 1BCCD 3GHGA 1KILD 4R4LA 3L4FA 4IL6E 3TNUB 2IBZG 1JEKA 2ZT9D 3HD7D 1NU1K 3UIAA 1BCCG 4EYYQ 2Q3EA 2NPSC 2WZ7A 1OW6A 1RQVA 2JWAA 2K9JA 1FE6A 1SQBK 2D2CD 4GODA 2QVAA 1N8RQ 1S5LH 3MP7B 2ZYGA 1VF5C 1FZCA 2WT7A 3P8CE 1OIPA 1QEXA 3L74J 1L0LJ 3QH9A 5B66H 2CK3H 2JWDA 2E42A 5DJTB 5KLVG 1H88A 5CJ4A 3U59A 3L72G 1JY3P 3TGUD 1JCCA 2LR2A 5TJHA 3GF7A 3D70A 5AVYB 3TGUG 2N9YB 4I7ZB 1KQGB 4QMAA 4Y99B 3CCQP 1LP1A 3CCVP 2BCCD 3H1IJ 4RKUJ 1RF0C 1FDIA 3EFGA 3VMAA 2BCCG 3WUTA 2WVRA 2FFDA 1Y8AA 1NTMJ 3B8EB 1GW3A 3HRNA 2R3SA 1VF5B 4ASWA 4TLFA 4AQRD 5AVQB 3T97A 3GMAA 1S3JA 1N73C 3L73E 3L75J 3L74E 4H0LD 1NTKJ 3PHLA 1L0LE 2P67A 2O01H 1N7LA 1RQUA 1AV1A 2RN0A 5EFWB 2E76D 4IFFA 1Z56A 2A06E 1IC2A 1M7LA 5CBNA 3CL3D 2ZYAA 2W90A 1D7MA 1SQQD 4WBAA 1LT9C 4OVNF 2Q7CA 1VDFA 2WSFJ 3H1IE 1SQQG 1RE4A 2QSIA 4GKGA 1U57A 1GL2B 2SPZA 4UB6E 4WY4B 1ZR4A 1AVOA 3BCCJ 1NTME 2FYNB 1LNQA 1BGYJ 4HB1A 1HVVA 2WMMA 1PIXA 4N6JA 1SFCC 2P58A 1T3JA 3B5ND 5AW9B 3M0DA 5APXA 1W5CE 3KXDA 2A45G 2OYHA 1HJBA 1L0NJ 4L74A 1L4AC 3GW6A 1S2EA 3L75E 1LWUC 3H1LD 4D6TG 1FZAA 1VQ9P 3ABVC 1R5SA 1M56D 3P8CD 3TDKA 5KLVK 2NPSA 5AW1B 1YTZI 2JP3A 2HFED 2ZXEB 1FDOA 4HJGH 3I55P 3RL0B 3MUDA 3L36A 1LT9B 2G8YA 1JY2N 1FBMA 3EQ2A 5KJ7C 1FC2C 2R5BA 2W6BA 1QGKB 4OGQB 2JEEA 3V6IA 2JR8A 1M57D 1N7SB 4KHXA 1S5LX 2YIUC 1BGYE 1P84E 1MV8A 1BE3E 2B9BA 3L71E 2YMYA 4W7YA 3CXHI 4I1LA 1GU5A 2QJPC 1L4AB 1JMMA 2NRGA 3IF4A 2HYNA 3HE5A 1L0NE 2AXTE 1Q81Q 2KK7A 1LWUB 2K88A 2OTKE 2R5DA 1YI2P 3TYYA 2QIWA 3G4SP 2N1TD 1RF0A 3VP8A 4N78E 3L73D 2HPCB 1URQB 3L74D 3LW5J 5KAIH 1L0LD 1FAVA 3JSVC 1VQ4P 3O6QB 3L74G 1VQMP 1L0LG 1OVRA 1G1JA 2FYUJ 3S1KA 3RK3B 3CCSP 2A06D 1JTHB 1LGHB 2ZFCA 1CI6B 1PGOA 2RMZA 5CCHD 3M06A 2H7HA 2W6JH 4KJMA 2WSEJ 1SQQK 3AEDC 2O1JA 4ZNCA 2YO3A 2A45I 2YIUB 3H1ID 5B5EE 4IL6H 1AQTA 1H8AA 3LIDA 3M9HA 2E43A 3TSIA 3H1IG 1NTZJ 3VMZA 1KQSO 2A45H 2QJPB 3A3YB 1NTMD 3NTNA 2OTLP 1W2EA 1KC8Q 2E74C 3BRTB 3W67A 1E79H 1CSBA 1NTMG 1VQPP 1LT9A 2IZ1A 4NPFX 1LTAC 1SQVJ 2KZJA 1HWTC 4R4MA 2E75D 3L75D 1QVGO 4DT0A 1N2DC 3GHGB 4A7PA 4H13B 3L75G 4EI2A 1ZN5A 1NTKG 3L72E 2C9NY 2FYUE 1SFCA 2OGUA 1OVUA 3VMYA 1KMIZ 5AVZB 1PL5A 3BVHA 3RK3E 3IAOA 1L4AA 3MZWB 5KKZC 1HTLC 1LWUA 2O1KA 2GA1A 5AW7B 1WRGA 3F89A 2XDJA 1ZRTD 3CCUP 4DJGA 1HGVA 1NKNA 4DOJA 3JC22 2ZVOB 1NTZE 1FOSF 1GTWA 2HPCA 1GL2D 3G71P 2H8PD 3VN0A 1BGYD 3O6QA 1P84D 3BCCG 1BE3D 3VTPC 1MZ9A 1NYHA 3L71D 4RESB 2ZJSE 3AEGC 1GW4A 5KAFE 1BGYG 2R44A 5KJ7A 1CI6A 1SQVE 1SS1A 1EXIA 2QA4P 3V2RA 1L0ND 4WB4A 4RJTA 2K37A 2XZRA 1L0NG 3IFMA 3CXHE 2IFNA 2Z5IA 4N78D 3NFQA 2JJLA 3H1HJ 5AW8B 2XKMA 1PGPA 1L0LK 4YPCA 5E79E 2RKLA 5CMZA 1OZHA 2P7JA 5KKZB 5AVWB 5AVTB 1H0TB 1G1IA 2Y0EA 3OJAB 3C1LA 1R8EA 1LTSC 2FXMA 2PP6A 2R3CA 1K8AQ 3MGNA 5AW2B 3SFDC 2WSSH 3CC7P 2GUVA 2W27A 2G3AA 2OYIC 4L73A 1TU3F 1AA0A 1MFTA 5AW4B 1N7SD 3BRVB 5CCHC 1NTMK 1J1EC 2P1JA 1IFJA 3H1KJ 5GTIE 3EWKA 4D6TE 2BEZF 3C9IA 1M8OB 2O01N 1R5LA 2HLOA 3MIWA 3RL0g 3H1JJ 5KLVD 2XNXA 3L72D 4IL6X 5APQA 4JYBA 1LTJC 2H43A 3KPEA 4C7NB 5BU5A 2FYUG 3RK3D 3RGUA 1YHQP 4N3YB 1ZP0C 2WSFH 2OYHB 3F5HA 2N9BA 3U1AA 2LXBA 1U7JA 2KI7B 1OX3A 1P84I 4JQ0D 3FXEA 3A2AA 2KUBA 3VP9A 1GK4A 3KZIE 4PV1D 1NTZD 2NPSB 1P84H 1PP9J 1OW8A 4EOTA 1NTZG 2E5YA 2J5UA 1VQ7P 1NGMB 3H1KE 1QVFO 1J1DC 5CCGD 2AXTH 1H0TA 2O3JA 1NWQA 2M0BA 2QJYC 1SQVD 1VL2A 1L0NK 2IFMA 1GD2E 4U7JA 2YKOA 1SQVG 2Q9IA 3RK2C 3TF5A 1Q90D 3H1JE 3CXHD 3H32B 1YIJP 4GOEA 1VPCA 3M0AA 2QG4A 4EDFA 4BWNA 5BVZA 3RBXA 4WWIA 2KP8A 2Q5UA 3WUUA 3Q1MA 1IFDA 3VOPA 2Y0DA 2Z4EA 3HE5B 4K35A 4I2LC 1S72P 2RH0A 1S9KE 3CC4P 5AVSB 4H44C 5AVRB 3CMEP 3A0BE 4IFMA 5B5EH 5H2FE 1KB9E 1EDIA 1WT6A 4JBZA 1PP9E 3Q3DA 3G3ZA 1J1DB 2OYOA 2QJYB 1PGJA 2Y9YA 3S9OA 4C7NA 1FJPA 3I5CA 3RK2B 3NMDA 3AE7C 2W8ZA 4OH8B 1N73B 3HUSC 4D6TD 4O9BA 1IO4A 3AE4C 1KILC 1T6AA 2OYIA 2ZT9C 5APUA 3LW5H 3HD7C 2VRSA 2IDBA 1DD4A 3QWOC 1NTKE 1SQPJ 2YXQB 1IK7A 3BATA 1NAYA 1DIPA 3H1HG 5BU8B
chains in the Genus database with same CATH topology
4GIFA 1RE3C 1JY3O 2FYUK 3VMZA 1FOSE 1KFNA 1T8ZA 1JCDA 2A45H 2Z5HA 3A3YB 4W7ZA 2I1KA 1RE4C 4C46A 3NTNA 2J58A 2WSEH 2KYVA 1W2EA 2WPSA 4W80A 1FZFA 2FFDB 2CPSA 3BRTB 1CSBA 5CCGA 1GL2C 1ZLLA 2Q3IA 1T2KD 1LT9A 1JO5A 4WY4C 1LTAC 3VMXA 3WMM0 2I1JA 2HG5D 1SQPK 1HWTC 3II6A 3M0DC 5AW5B 1LTJB 3H32A 3OAKA 2OYHC 1NTZK 1G2CA 4EIJA 3V2QA 1N2DC 3GHGB 1LTJA 2WPRA 3M9BA 3R2PA 1SFCB 1JNMA 5AW6B 1ZN5A 2C0XA 2PAJA 3GHGA 1KILD 1FZEA 3L4FA 3TNUB 2C9NY 1SFCA 3VMYA 5APVA 5AVZB 1GK6A 1GZLA 3HD7D 1NU1K 3O8ZA 3TNUA 3UIAA 3BVHA 1LTBC 1IFNA 1IFIA 3HD7B 1SQVK 2NPSC 2WZ7A 1L4AA 1ZV8A 3V5BA 1HTLC 1LWUA 2O1KA 4M3LA 5AW7B 1SQBK 2M3BA 1WRGA 2XDJA 1HGVA 3RL0C 1NKNA 3U1CA 1X8YA 4XE5B 4DOJA 4HYTB 3P32A 4XA4A 1KQLA 3MTUE 2N1TA 5CJ0A 1M1JC 1FZCA 1FOSF 1GTWA 1HGZA 2WSCH 5AW0B 5AW3B 2HPCA 1FU1A 2WT7A 1GL2D 1XTCC 2H8PD 2W6AA 3P8CE 3VN0A 1X9VA 3P7KA 2QM7A 3VTPC 1MZ9A 4C7RA 4RESB 1SP4A 3KYQA 2E42A 3LIEA 1GW4A 1QL1A 1H88A 1XTGB 5KJ7A 1S9KD 5CJ4A 1CI6A 1N7SC 3U59A 1N73A 1JY3P 3V2RA 1JCCA 2KLVA 2WTYA 1AFOA 2KOGA 4WB4A 1JY2O 2XZRA 5CCHA 1NH4A 5AVYB 1IJDB 3IFMA 2WPQA 2WWWA 1MFZA 2IFNA 2IPPA 2Z5IA 4N78D 2GUSA 3NFQA 4Y99B 3V4WA 1GDTA 2NPSD 2JJLA 1MUUA 5AW8B 2XKMA 1L0LK 1SVFA 1RF0C 5CMZA 3EFGA 3KDPB 2P2UA 2P7JA 1LTGC 5AVWB 5AVTB 2FFDA 1HH0A 1G1IA 3OJAB 1URQC 5AVUB 1OWAA 1LTSC 3B8EB 5AVVB 1GW3A 2C9LY 3HRNA 2FXMA 2MJZA 2FKWB 2PP6A 2R3CA 4AQRD 3MGNA 5AW2B 3CI9A 1A02F 1YTZT 5AVQB 3RK3C 1RF1C 3V2PA 3VYIA 3T97A 2GUVA 2W27A 2OYIC 3B5NC 1KFMA 1N73C 4LC1A 3E1IA 1GU4A 5AW4B 3SWFA 1N7SD 3BRVB 5CCHC 3HUSB 1JY3N 1KILB 2P67A 2O01H 2KB7P 1N7LA 1KZUB 1NTMK 3HUSA 1J1EC 1FZGA 1KILA 2P1JA 3M91A 1HUCA 4IFFA 1Z56A 3HD7A 1IFJA 1IC2A 1M7LA 1LTTC 1CW5A 2KSJA 3CL3D 3HTKB 1DX7A 3TK1A 1DEBA 3C9IA 3HTKA 5CCGC 2HLOA 3MIWA 2WITA 4WBAA 1LT9C 2Q7CA 2IX7C 1RE3A 1VDFA 1RE4A 1JY2P 4WY4D 4GKGA 2GM4A 2HODB 2QM8A 1GL2B 4B86A 1T2KC 2XNXA 4WY4B 1ZR4A 3IR9A 5APQA 1GL2A 4JYBA 2OARA 5APTA 1LTJC 4WY4A 2H43A 3KPEA 4C7NB 1EQ7A 3BASA 5BU5A 1HVVA 3RK3D 3GHGC 2CPBA 4N6JA 1SFCC 4N3YB 1NOHA 2WSFH 1T3JA 3B5ND 5AW9B 2OYHB 3M0DA 5APXA 2N9BA 3U1AA 2A45G 1NHLA 3B5NB 1QL2A 2OYHA 1HJBA 3PP5A 2YNYA 1RY3A 1CZQA 3SWYA 3A2AA 3MD0A 1L4AC 1N86A 2M8RA 5APWA 1DH3A 3VP9A 1GK4A 1H89A 1X79B 1J2JB 1LWUC 3P8MC 1FZAA 2NPSB 2FYZA 2XU6A 3P8CD 5KLVK 2C0WA 2NPSA 3V4QA 5AW1B 1SQXK 1YTZI 4EOTA 1A02J 5APYA 2HFED 2XV5A 2N1TC 2ZXEB 3RL0D 1FZCC 1J1DC 3H6PA 5CCGD 1YYCA 3RL0B 4JYCA 1NWQA 3MUDA 3M9QA 3L36A 1L0NK 1LT9B 3HE4B 1JY2N 1M1JB 2IFMA 1FBMA 3KQGA 3EQ2A 5CHXA 1GD2E 2YKOA 1LTIC 3HE4A 2Q9IA 5KJ7C 3RK2C 1M1JA 2L5GB 1IFMA 1OXZA 3H32B 2R5BA 1HBWA 1ZR2A 2W6BA 1G2CB 1VPCA 3M0AA 1IK9A 2JEEA 4DZOA 1N7SB 4KHXA 1SFCD 4I6MC 5BVZA 4LGDE 2KP8A 4IFDK 2Q5UA 1FDMA 3NXSA 1FZBA 1N7SA 1MV8A 1IFDA 3VOPA 3L37A 5AVXB 2YMYA 1L4AD 3V2NA 2Z4EA 4W7YA 4Y99C 4ZKPA 3HE5B 4I2LC 1JUNA 4I1LA 1GU5A 1NKZB 1S9KE 1L4AB 1JMMA 2HYNA 2BASA 4ZKUA 3HE5A 5KTBA 1LWUB 5AVSB 1FJKA 5AVRB 2FFDC 2R5DA 1PFIA 4IFMA 4GT1A 4AUWA 1NTKK 3A7OA 3TYYA 3N4XA 2YKPA 5APSA 3L35A 1T3UA 1NO4A 2N1TD 1WT6A 1RF0A 4LLHA 3VP8A 1URQD 4N78E 1SLQA 2N1TB 3G3ZA 3N7NA 1FZCB 1J1DB 2HODA 1AQ5A 2HPCB 1URQB 2WT7B 1FAVA 1NAFA 3A5TA 1URQA 5KJ7D 3RK2D 4C7NA 1G1JA 1FJPA 3RK3B 1RF1B 1JTHB 3I5CA 3RK2B 1LGHB 2ZFCA 3NMDA 1CI6B 4OH8B 2OYIB 2YKQA 5CCHD 3M06A 1N73B 3HUSC 1RF1A 2POHA 4O9BA 1IO4A 1KILC 1JTHA 4JF7A 2H7HA 2OYIA 3B5NA 5APUA 4AYCA 3LW5H 3CLQA 3HD7C 2VRSA 3OA7A 1SQQK 2R32A 2LKMA 2O1JA 2YO3A 1J1EB 2A45I 4HH2A 1H8AA 2J59M 1E5WA 2YO2A 3BATA 3LIDA 1JOCA 3M9HA 2E43A 3TSIA 5BU8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMZ A;  1FOS E;  1H88 A;  3TK1 A;  1G2C B;  2Z5H A;  3A3Y B;  1S9K D;  1CI6 A;  3M0A A;  3HTK A;  4C46 A;  4DZO A;  3NTN A;  4KHX A;  4I6M C;  2Q7C A;  2WTY A;  2WPS A;  2KP8 A;  2XZR A;  2Q5U A;  3NXS A;  1CSB A;  5AVY B;  1MV8 A;  2Q3I A;  4GKG A;  3L37 A;  2QM8 A;  1T2K D;  5AVX B;  2WPQ A;  2WWW A;  4B86 A;  2E42 A;  1T2K C;  1MFZ A;  3VMX A;  2IPP A;  3HE5 B;  2Z5I A;  4I2L C;  1JUN A;  3NFQ A;  1GU5 A;  3IR9 A;  5APQ A;  3V4W A;  1HWT C;  4JYB A;  1S9K E;  5APT A;  2JJL A;  1MUU A;  2BAS A;  3HE5 A;  5AW8 B;  5AW5 B;  4C7N B;  5AVS B;  3OAK A;  5AVR B;  5CMZ A;  2R5D A;  3KDP B;  4GT1 A;  2P2U A;  4AUW A;  2P7J A;  3TYY A;  3A7O A;  2WPR A;  3M9B A;  3M0D A;  5APX A;  2N9B A;  5AW9 B;  5APS A;  3L35 A;  5AVW B;  1JNM A;  5AVT B;  5AW6 B;  3TNU B;  1HJB A;  2C9N Y;  2YNY A;  3VMY A;  5APV A;  1CZQ A;  1SLQ A;  5AVZ B;  1GK6 A;  1GZL A;  5AVU B;  3A2A A;  3MD0 A;  5APW A;  1DH3 A;  1OWA A;  3O8Z A;  2WT7 B;  3TNU A;  1GK4 A;  3B8E B;  5AVV B;  3UIA A;  1H89 A;  2C9L Y;  1J2J B;  1NAF A;  1FAV A;  3P8M C;  3A5T A;  2R3C A;  4AQR D;  3MGN A;  5AW2 B;  1A02 F;  5AVQ B;  3V5B A;  4C7N A;  2XU6 A;  3T97 A;  3VYI A;  2W27 A;  4M3L A;  3V4Q A;  4EOT A;  5AW1 B;  5AW7 B;  3I5C A;  1A02 J;  2ZFC A;  3NMD A;  1CI6 B;  5APY A;  4LC1 A;  2XV5 A;  2ZXE B;  1GU4 A;  3M06 A;  5AW4 B;  3SWF A;  1IO4 A;  2H7H A;  1YYC A;  1X8Y A;  4XE5 B;  2P67 A;  4HYT B;  4JYC A;  3P32 A;  5APU A;  4AYC A;  1NWQ A;  2VRS A;  1KQL A;  2R32 A;  3L36 A;  1FOS F;  3HE4 B;  1GTW A;  5AW0 B;  5AW3 B;  2WT7 A;  2YO3 A;  3KQG A;  3M91 A;  1HUC A;  1GD2 E;  2W6A A;  3VN0 A;  3HE4 A;  3P7K A;  1H8A A;  2YO2 A;  2QM7 A;  3VTP C;  3LID A;  3M9H A;  4RES B;  1SP4 A;  2E43 A;  1OXZ A;  3LIE A;  2R5B A;  1HBW A; 
#chains in the Genus database with same CATH topology
 2D2C C;  2FYU K;  1KFN A;  1JCD A;  1BSH A;  2YXR B;  2WSE H;  5KLI C;  2WPS A;  1FZF A;  1UIX A;  2CPS A;  1KYO I;  1ZLL A;  1USE A;  1JO5 A;  3VMX A;  2PRR A;  1EC5 A;  3L70 J;  3H32 A;  3OAK A;  3BCC E;  2UWJ E;  1NTZ K;  4EIJ A;  1OFC X;  3USS A;  1LTJ A;  1Y9B A;  3R2P A;  1SFC B;  2C0X A;  2PAJ A;  3AE2 C;  1FZE A;  5KAF H;  2QJK C;  5APV A;  1GZL A;  1IZN B;  3H1K D;  4Z1M H;  3O8Z A;  2KIK A;  5K5G B;  1JM0 A;  2ZT9 B;  1IFN A;  1IFI A;  3HD7 B;  2WSC J;  1SQV K;  3PLN A;  2BEQ D;  3H1K G;  3WU2 E;  1KD1 Q;  2QEX P;  3CXH H;  5L8R J;  2KXP B;  1OMI A;  2M5A B;  1SQP E;  3H1J D;  1NJI Q;  1X8Y A;  5E79 H;  4HYT B;  3P32 A;  4XA4 A;  3WUV A;  1W2B O;  1M1J C;  2L91 A;  3H1J G;  1HGZ A;  5AW0 B;  5AW3 B;  3FGA D;  1FU1 A;  3CMA P;  1XTC C;  2W6A A;  1X9V A;  3P7K A;  3CCE P;  3SWK A;  3LIE A;  2E5T A;  1XTG B;  3CX5 I;  1S9K D;  1PGQ A;  4H0L C;  3JCU E;  1N73 A;  2KLV A;  2WTY A;  2KOG A;  1JY2 O;  4BXL A;  3L70 E;  1ZME C;  2I8D A;  3ZDM A;  1KB9 D;  2E76 C;  1IJD B;  2WPQ A;  2WWW A;  1MFZ A;  1VQ8 P;  3AE9 C;  2IPP A;  2QJK B;  1PP9 D;  1GDT A;  2NPS D;  2ZAE B;  1VQ5 P;  3ITK A;  1PP9 G;  3AEE C;  3KDP B;  3G6E P;  1LT1 A;  2P2U A;  1LTG C;  5GTI H;  1YJW P;  1HH0 A;  4L76 A;  3A0H E;  1VF5 D;  5AVV B;  1YJ9 P;  4JPZ B;  2C9L Y;  2MJZ A;  5GTH E;  2FKW B;  1A02 F;  3CI9 A;  1NTK D;  1YIT P;  1QX8 A;  1YTZ T;  1RF1 C;  3VYI A;  3B5N C;  4LC1 A;  3E1I A;  1GU4 A;  3SWF A;  1EDK A;  1JY3 N;  2FY8 A;  3FWL A;  2KB7 P;  4H0L B;  1IFP A;  1KZU B;  3HUS A;  1FZG A;  1KIL A;  1HUC A;  4OWF A;  2QE7 H;  3HD7 A;  4PD4 E;  1S4X A;  2E76 B;  1LTT C;  4UB8 H;  5CBO A;  5C39 A;  2Q1K A;  2JO1 A;  1DX7 A;  2W83 C;  3S4R A;  3KZI H;  2M5A A;  3HTK A;  1JB0 J;  2WIT A;  3FX0 A;  3BCC D;  1KYO E;  2KZI A;  2E74 B;  1JY2 P;  4WY4 D;  1EZV E;  2HOD B;  2QM8 A;  3AEF C;  4B86 A;  2V7Q J;  1JMB A;  5TIS E;  2KNC B;  1EQ7 A;  3B71 A;  1SQX J;  2B87 B;  3AE6 C;  3B5N B;  1QL2 A;  3PP5 A;  1KN7 A;  2H88 C;  1SQP D;  4U3F J;  3MD0 A;  1N86 A;  1ZW0 A;  2M8R A;  1DH3 A;  3Q5S A;  1SQP G;  4BRY B;  2FYZ A;  1EDJ A;  2XU6 A;  2C0W A;  3V4Q A;  1K9M Q;  1KB9 I;  5APY A;  3H1L J;  2XV5 A;  2N1T C;  3RL0 D;  2WQY C;  4YXW H;  1YYC A;  3M9Q A;  3A0B H;  2XND H;  5H2F H;  1KB9 H;  2Y9Z A;  1Q82 Q;  3C8V A;  3HE4 A;  3SFE C;  1M1J A;  1VQL P;  1ZOY C;  4OGQ D;  3CX5 E;  3L70 G;  4Y28 J;  1ZR2 A;  1IK9 A;  1BDC A;  1SFC D;  4NPD A;  4IFD K;  1SQX E;  3R4Y A;  1L4A D;  3V2N A;  4Y99 C;  1JUN A;  4ZKU A;  2BAS A;  5KTB A;  3CC2 P;  4U3F E;  1FJK A;  1PFI A;  3CPW O;  4GT1 A;  3H1H E;  1NTK K;  3N4X A;  5APS A;  3MUD C;  2B88 A;  1URQ D;  1SLQ A;  2N1T B;  2FYU D;  2HOD A;  3H1L E;  1NAF A;  1KOR A;  4ASV A;  3A5T A;  1Q2N A;  2JDI H;  2E75 C;  2OTJ P;  2KNC A;  3L73 J;  5KJ7 D;  2KLU A;  4PD4 D;  2OYI B;  1RF1 A;  2B87 A;  2POH A;  3IN6 A;  4JF7 A;  4UB8 E;  3B5N A;  4AYC A;  3OA7 A;  4WVZ A;  1J1E B;  4HH2 A;  1KYO D;  3KHU A;  1L2P A;  2J59 M;  2YO2 A;  1EZV D;  4BRY A;  2M3E A;  4PJ0 H;  4GIF A;  1RE3 C;  1T8Z A;  2Z5H A;  1EZV G;  2AEM A;  1HJ0 A;  2I1K A;  4TT3 H;  3I56 P;  4C46 A;  3WU2 H;  2J58 A;  3K5B A;  4W80 A;  5M1B A;  2FXO A;  3CWB J;  1PPJ E;  1NU1 J;  1GL2 C;  2Q3I A;  4L75 A;  1T2K D;  4K3A A;  4WY4 C;  4KT0 J;  2MKV A;  3W68 A;  1SQP K;  2FYN C;  1LTJ B;  4H13 D;  1SQB J;  2E75 B;  3V2Q A;  4IOI H;  5AW6 B;  3PRJ A;  2AXC A;  2Y0C A;  1GK6 A;  1Q7Y Q;  2DW3 A;  3JCU H;  3TNU A;  1LTB C;  1OVV A;  3FWN A;  1ZV8 A;  1M90 Q;  1DEE G;  3V5B A;  2IBZ I;  4M3L A;  1YQ4 C;  1BDD A;  3D6Y A;  2M3B A;  1VQO P;  3CX5 D;  1Q86 Q;  3EFF K;  3RL0 C;  3U1C A;  4XE5 B;  1X0T A;  3E7K A;  1KQL A;  3MTU E;  1EXJ A;  2N1T A;  5CJ0 A;  2E74 D;  2WSC H;  3A0H H;  1SQX D;  2QM7 A;  2WPV B;  3CWB E;  4C7R A;  1NU1 E;  1SP4 A;  3KYQ A;  1AVY A;  2K9Y A;  1QL1 A;  4OGQ C;  1SQX G;  5GTH H;  1N7S C;  1AFO A;  1BE3 J;  4U3F D;  2ZVN B;  3FXD A;  3L71 J;  1NH4 A;  5CCH A;  4GDO A;  3H1H D;  1SQB E;  2PFX A;  4RO0 A;  4U3F G;  2OQQ A;  3CCR P;  2JKV A;  4PD4 I;  2GUS A;  1NVO A;  3V4W A;  1MUU A;  3GF3 A;  4ZMD A;  1SVF A;  1S5L E;  4H44 B;  4PD4 H;  4YXD C;  3H1L G;  2YMK A;  1EZV I;  1URQ C;  5AVU B;  5B66 E;  2O01 J;  1OWA A;  1ZXG A;  2H89 C;  1KYO H;  2FXP A;  4GOF A;  3RK3 C;  3V2P A;  1LJ2 A;  1KFM A;  1YQ3 C;  1ZRT E;  4NPE A;  1PV3 A;  5TIS H;  1RHZ B;  3HUS B;  2V4H A;  4YTP C;  1KIL B;  4PJ0 E;  3G9R A;  1U7M A;  2PGD A;  1BCC J;  3M91 A;  3Q2Y A;  3CD6 P;  4PV1 C;  1KQF B;  1QLE D;  1WMK A;  1PPJ D;  3PJS K;  1CW5 A;  2KSJ A;  3OW2 O;  3HTK B;  1PPJ G;  3TK1 A;  1DEB A;  2D2C B;  5CCG C;  4MN4 C;  2IX7 C;  1RE3 A;  5KLI B;  2QRX A;  1HF9 A;  2GM4 A;  1Y47 A;  1T2K C;  3IR9 A;  1GL2 A;  2LXC B;  2OAR A;  5APT A;  3AE8 C;  1VQ6 P;  4WY4 A;  3L73 G;  3BAS A;  5KLV J;  1YBK A;  2AEF A;  3GHG C;  3D6Z A;  2CPB A;  4H13 C;  3L72 J;  1NOH A;  3AEC C;  4CPG A;  1K05 A;  1NHL A;  3CX5 H;  2YNY A;  1RY3 A;  1CZQ A;  3TGU J;  3SWY A;  5APW A;  2V7Q H;  2A06 G;  3AEB C;  1H89 A;  1X79 B;  1J2J B;  3P8M C;  3GG2 A;  2IYO A;  2IBZ E;  4PV1 B;  4HKZ H;  1BCC E;  1KIL E;  1A02 J;  1SQX K;  3CWB D;  2BCC J;  1FZC C;  1NU1 D;  3H6P A;  1GMJ A;  4JYC A;  3AE1 C;  3CWB G;  1NU1 G;  3HE4 B;  2KS1 B;  5DJU B;  1M1J B;  3KQG A;  3H25 A;  5CHX A;  1X22 A;  1LTI C;  3CCM P;  3PH0 A;  1SQB D;  2ZXX A;  2KSE A;  2L5G B;  1IFM A;  1OXZ A;  3Q5R A;  1HBW A;  3B4S A;  3D71 A;  1SQB G;  1USD A;  1G2C B;  1FS0 E;  2K1A A;  4DZO A;  4I6M C;  4LGD E;  2IZ0 A;  3RBZ A;  1RH5 B;  1FDM A;  3NXS A;  1EDL A;  1FZB A;  1N7S A;  5KLV E;  1AJY A;  3L37 A;  5AVX B;  2P10 A;  3SSU A;  4ZKP A;  2K3R A;  3Q5P A;  1VQK P;  1NKZ B;  2FBW C;  1KV4 A;  2AEJ A;  3TGU E;  2Q6Q A;  2K9J B;  2FFD C;  1YJN P;  4AUW A;  3A7O A;  2YKP A;  2ITA A;  1T3U A;  3L35 A;  1NO4 A;  4LLH A;  1SQQ J;  3N7N A;  1FZC B;  1AQ5 A;  2WT7 B;  3AE3 C;  2BCC E;  3MHV A;  3E1R A;  1URQ A;  3RK2 D;  1RF1 B;  2YKQ A;  1JTH A;  1BE3 G;  1KTM A;  3AEA C;  1M1K Q;  3CLQ A;  3L71 G;  3PTZ A;  3CCL P;  2NZ2 A;  2R32 A;  2LKM A;  4XFJ A;  1PZQ A;  3CCJ P;  4D6T J;  4DCK A;  1K73 Q;  1E5W A;  1JOC A;  1LP1 B;  1OW7 A;  1S1C X;  2B89 A;  1JY3 O;  1FOS E;  1BSN A;  4H44 D;  4W7Z A;  1VQN P;  1RE4 C;  5KAI E;  2HR3 A;  2KYV A;  2FFD B;  3AE5 C;  5CCG A;  3L70 D;  2KS1 A;  3WMM 0;  2I1J A;  1DD3 A;  2HG5 D;  1SQQ E;  3II6 A;  3M0D C;  5AW5 B;  1K04 A;  3T97 B;  3GLM A;  2OYH C;  1G2C A;  1UII A;  2ZYD A;  2WPR A;  3M9B A;  2IBZ D;  4UB6 H;  1MKM A;  2IYP A;  1JNM A;  4I7Z C;  1BCC D;  3GHG A;  1KIL D;  4R4L A;  3L4F A;  4IL6 E;  3TNU B;  2IBZ G;  1JEK A;  2ZT9 D;  3HD7 D;  1NU1 K;  3UIA A;  1BCC G;  4EYY Q;  2Q3E A;  2NPS C;  2WZ7 A;  1OW6 A;  1RQV A;  2JWA A;  2K9J A;  1FE6 A;  1SQB K;  2D2C D;  4GOD A;  2QVA A;  1N8R Q;  1S5L H;  3MP7 B;  2ZYG A;  1VF5 C;  1FZC A;  2WT7 A;  3P8C E;  1OIP A;  1QEX A;  3L74 J;  1L0L J;  3QH9 A;  5B66 H;  2CK3 H;  2JWD A;  2E42 A;  5DJT B;  5KLV G;  1H88 A;  5CJ4 A;  3U59 A;  3L72 G;  1JY3 P;  3TGU D;  1JCC A;  2LR2 A;  5TJH A;  3GF7 A;  3D70 A;  5AVY B;  3TGU G;  2N9Y B;  4I7Z B;  1KQG B;  4QMA A;  4Y99 B;  3CCQ P;  1LP1 A;  3CCV P;  2BCC D;  3H1I J;  4RKU J;  1RF0 C;  1FDI A;  3EFG A;  3VMA A;  2BCC G;  3WUT A;  2WVR A;  2FFD A;  1Y8A A;  1NTM J;  3B8E B;  1GW3 A;  3HRN A;  2R3S A;  1VF5 B;  4ASW A;  4TLF A;  4AQR D;  5AVQ B;  3T97 A;  3GMA A;  1S3J A;  1N73 C;  3L73 E;  3L75 J;  3L74 E;  4H0L D;  1NTK J;  3PHL A;  1L0L E;  2P67 A;  2O01 H;  1N7L A;  1RQU A;  1AV1 A;  2RN0 A;  5EFW B;  2E76 D;  4IFF A;  1Z56 A;  2A06 E;  1IC2 A;  1M7L A;  5CBN A;  3CL3 D;  2ZYA A;  2W90 A;  1D7M A;  1SQQ D;  4WBA A;  1LT9 C;  4OVN F;  2Q7C A;  1VDF A;  2WSF J;  3H1I E;  1SQQ G;  1RE4 A;  2QSI A;  4GKG A;  1U57 A;  1GL2 B;  2SPZ A;  4UB6 E;  4WY4 B;  1ZR4 A;  1AVO A;  3BCC J;  1NTM E;  2FYN B;  1LNQ A;  1BGY J;  4HB1 A;  1HVV A;  2WMM A;  1PIX A;  4N6J A;  1SFC C;  2P58 A;  1T3J A;  3B5N D;  5AW9 B;  3M0D A;  5APX A;  1W5C E;  3KXD A;  2A45 G;  2OYH A;  1HJB A;  1L0N J;  4L74 A;  1L4A C;  3GW6 A;  1S2E A;  3L75 E;  1LWU C;  3H1L D;  4D6T G;  1FZA A;  1VQ9 P;  3ABV C;  1R5S A;  1M56 D;  3P8C D;  3TDK A;  5KLV K;  2NPS A;  5AW1 B;  1YTZ I;  2JP3 A;  2HFE D;  2ZXE B;  1FDO A;  4HJG H;  3I55 P;  3RL0 B;  3MUD A;  3L36 A;  1LT9 B;  2G8Y A;  1JY2 N;  1FBM A;  3EQ2 A;  5KJ7 C;  1FC2 C;  2R5B A;  2W6B A;  1QGK B;  4OGQ B;  2JEE A;  3V6I A;  2JR8 A;  1M57 D;  1N7S B;  4KHX A;  1S5L X;  2YIU C;  1BGY E;  1P84 E;  1MV8 A;  1BE3 E;  2B9B A;  3L71 E;  2YMY A;  4W7Y A;  3CXH I;  4I1L A;  1GU5 A;  2QJP C;  1L4A B;  1JMM A;  2NRG A;  3IF4 A;  2HYN A;  3HE5 A;  1L0N E;  2AXT E;  1Q81 Q;  2KK7 A;  1LWU B;  2K88 A;  2OTK E;  2R5D A;  1YI2 P;  3TYY A;  2QIW A;  3G4S P;  2N1T D;  1RF0 A;  3VP8 A;  4N78 E;  3L73 D;  2HPC B;  1URQ B;  3L74 D;  3LW5 J;  5KAI H;  1L0L D;  1FAV A;  3JSV C;  1VQ4 P;  3O6Q B;  3L74 G;  1VQM P;  1L0L G;  1OVR A;  1G1J A;  2FYU J;  3S1K A;  3RK3 B;  3CCS P;  2A06 D;  1JTH B;  1LGH B;  2ZFC A;  1CI6 B;  1PGO A;  2RMZ A;  5CCH D;  3M06 A;  2H7H A;  2W6J H;  4KJM A;  2WSE J;  1SQQ K;  3AED C;  2O1J A;  4ZNC A;  2YO3 A;  2A45 I;  2YIU B;  3H1I D;  5B5E E;  4IL6 H;  1AQT A;  1H8A A;  3LID A;  3M9H A;  2E43 A;  3TSI A;  3H1I G;  1NTZ J;  3VMZ A;  1KQS O;  2A45 H;  2QJP B;  3A3Y B;  1NTM D;  3NTN A;  2OTL P;  1W2E A;  1KC8 Q;  2E74 C;  3BRT B;  3W67 A;  1E79 H;  1CSB A;  1NTM G;  1VQP P;  1LT9 A;  2IZ1 A;  4NPF X;  1LTA C;  1SQV J;  2KZJ A;  1HWT C;  4R4M A;  2E75 D;  3L75 D;  1QVG O;  4DT0 A;  1N2D C;  3GHG B;  4A7P A;  4H13 B;  3L75 G;  4EI2 A;  1ZN5 A;  1NTK G;  3L72 E;  2C9N Y;  2FYU E;  1SFC A;  2OGU A;  1OVU A;  3VMY A;  1KMI Z;  5AVZ B;  1PL5 A;  3BVH A;  3RK3 E;  3IAO A;  1L4A A;  3MZW B;  5KKZ C;  1HTL C;  1LWU A;  2O1K A;  2GA1 A;  5AW7 B;  1WRG A;  3F89 A;  2XDJ A;  1ZRT D;  3CCU P;  4DJG A;  1HGV A;  1NKN A;  4DOJ A;  3JC2 2;  2ZVO B;  1NTZ E;  1FOS F;  1GTW A;  2HPC A;  1GL2 D;  3G71 P;  2H8P D;  3VN0 A;  1BGY D;  3O6Q A;  1P84 D;  3BCC G;  1BE3 D;  3VTP C;  1MZ9 A;  1NYH A;  3L71 D;  4RES B;  2ZJS E;  3AEG C;  1GW4 A;  5KAF E;  1BGY G;  2R44 A;  5KJ7 A;  1CI6 A;  1SQV E;  1SS1 A;  1EXI A;  2QA4 P;  3V2R A;  1L0N D;  4WB4 A;  4RJT A;  2K37 A;  2XZR A;  1L0N G;  3IFM A;  3CXH E;  2IFN A;  2Z5I A;  4N78 D;  3NFQ A;  2JJL A;  3H1H J;  5AW8 B;  2XKM A;  1PGP A;  1L0L K;  4YPC A;  5E79 E;  2RKL A;  5CMZ A;  1OZH A;  2P7J A;  5KKZ B;  5AVW B;  5AVT B;  1H0T B;  1G1I A;  2Y0E A;  3OJA B;  3C1L A;  1R8E A;  1LTS C;  2FXM A;  2PP6 A;  2R3C A;  1K8A Q;  3MGN A;  5AW2 B;  3SFD C;  2WSS H;  3CC7 P;  2GUV A;  2W27 A;  2G3A A;  2OYI C;  4L73 A;  1TU3 F;  1AA0 A;  1MFT A;  5AW4 B;  1N7S D;  3BRV B;  5CCH C;  1NTM K;  1J1E C;  2P1J A;  1IFJ A;  3H1K J;  5GTI E;  3EWK A;  4D6T E;  2BEZ F;  3C9I A;  1M8O B;  2O01 N;  1R5L A;  2HLO A;  3MIW A;  3RL0 g;  3H1J J;  5KLV D;  2XNX A;  3L72 D;  4IL6 X;  5APQ A;  4JYB A;  1LTJ C;  2H43 A;  3KPE A;  4C7N B;  5BU5 A;  2FYU G;  3RK3 D;  3RGU A;  1YHQ P;  4N3Y B;  1ZP0 C;  2WSF H;  2OYH B;  3F5H A;  2N9B A;  3U1A A;  2LXB A;  1U7J A;  2KI7 B;  1OX3 A;  1P84 I;  4JQ0 D;  3FXE A;  3A2A A;  2KUB A;  3VP9 A;  1GK4 A;  3KZI E;  4PV1 D;  1NTZ D;  2NPS B;  1P84 H;  1PP9 J;  1OW8 A;  4EOT A;  1NTZ G;  2E5Y A;  2J5U A;  1VQ7 P;  1NGM B;  3H1K E;  1QVF O;  1J1D C;  5CCG D;  2AXT H;  1H0T A;  2O3J A;  1NWQ A;  2M0B A;  2QJY C;  1SQV D;  1VL2 A;  1L0N K;  2IFM A;  1GD2 E;  4U7J A;  2YKO A;  1SQV G;  2Q9I A;  3RK2 C;  3TF5 A;  1Q90 D;  3H1J E;  3CXH D;  3H32 B;  1YIJ P;  4GOE A;  1VPC A;  3M0A A;  2QG4 A;  4EDF A;  4BWN A;  5BVZ A;  3RBX A;  4WWI A;  2KP8 A;  2Q5U A;  3WUU A;  3Q1M A;  1IFD A;  3VOP A;  2Y0D A;  2Z4E A;  3HE5 B;  4K35 A;  4I2L C;  1S72 P;  2RH0 A;  1S9K E;  3CC4 P;  5AVS B;  4H44 C;  5AVR B;  3CME P;  3A0B E;  4IFM A;  5B5E H;  5H2F E;  1KB9 E;  1EDI A;  1WT6 A;  4JBZ A;  1PP9 E;  3Q3D A;  3G3Z A;  1J1D B;  2OYO A;  2QJY B;  1PGJ A;  2Y9Y A;  3S9O A;  4C7N A;  1FJP A;  3I5C A;  3RK2 B;  3NMD A;  3AE7 C;  2W8Z A;  4OH8 B;  1N73 B;  3HUS C;  4D6T D;  4O9B A;  1IO4 A;  3AE4 C;  1KIL C;  1T6A A;  2OYI A;  2ZT9 C;  5APU A;  3LW5 H;  3HD7 C;  2VRS A;  2IDB A;  1DD4 A;  3QWO C;  1NTK E;  1SQP J;  2YXQ B;  1IK7 A;  3BAT A;  1NAY A;  1DIP A;  3H1H G;  5BU8 B; 
#chains in the Genus database with same CATH homology
 4GIF A;  1RE3 C;  1JY3 O;  2FYU K;  3VMZ A;  1FOS E;  1KFN A;  1T8Z A;  1JCD A;  2A45 H;  2Z5H A;  3A3Y B;  4W7Z A;  2I1K A;  1RE4 C;  4C46 A;  3NTN A;  2J58 A;  2WSE H;  2KYV A;  1W2E A;  2WPS A;  4W80 A;  1FZF A;  2FFD B;  2CPS A;  3BRT B;  1CSB A;  5CCG A;  1GL2 C;  1ZLL A;  2Q3I A;  1T2K D;  1LT9 A;  1JO5 A;  4WY4 C;  1LTA C;  3VMX A;  3WMM 0;  2I1J A;  2HG5 D;  1SQP K;  1HWT C;  3II6 A;  3M0D C;  5AW5 B;  1LTJ B;  3H32 A;  3OAK A;  2OYH C;  1NTZ K;  1G2C A;  4EIJ A;  3V2Q A;  1N2D C;  3GHG B;  1LTJ A;  2WPR A;  3M9B A;  3R2P A;  1SFC B;  1JNM A;  5AW6 B;  1ZN5 A;  2C0X A;  2PAJ A;  3GHG A;  1KIL D;  1FZE A;  3L4F A;  3TNU B;  2C9N Y;  1SFC A;  3VMY A;  5APV A;  5AVZ B;  1GK6 A;  1GZL A;  3HD7 D;  1NU1 K;  3O8Z A;  3TNU A;  3UIA A;  3BVH A;  1LTB C;  1IFN A;  1IFI A;  3HD7 B;  1SQV K;  2NPS C;  2WZ7 A;  1L4A A;  1ZV8 A;  3V5B A;  1HTL C;  1LWU A;  2O1K A;  4M3L A;  5AW7 B;  1SQB K;  2M3B A;  1WRG A;  2XDJ A;  1HGV A;  3RL0 C;  1NKN A;  3U1C A;  1X8Y A;  4XE5 B;  4DOJ A;  4HYT B;  3P32 A;  4XA4 A;  1KQL A;  3MTU E;  2N1T A;  5CJ0 A;  1M1J C;  1FZC A;  1FOS F;  1GTW A;  1HGZ A;  2WSC H;  5AW0 B;  5AW3 B;  2HPC A;  1FU1 A;  2WT7 A;  1GL2 D;  1XTC C;  2H8P D;  2W6A A;  3P8C E;  3VN0 A;  1X9V A;  3P7K A;  2QM7 A;  3VTP C;  1MZ9 A;  4C7R A;  4RES B;  1SP4 A;  3KYQ A;  2E42 A;  3LIE A;  1GW4 A;  1QL1 A;  1H88 A;  1XTG B;  5KJ7 A;  1S9K D;  5CJ4 A;  1CI6 A;  1N7S C;  3U59 A;  1N73 A;  1JY3 P;  3V2R A;  1JCC A;  2KLV A;  2WTY A;  1AFO A;  2KOG A;  4WB4 A;  1JY2 O;  2XZR A;  5CCH A;  1NH4 A;  5AVY B;  1IJD B;  3IFM A;  2WPQ A;  2WWW A;  1MFZ A;  2IFN A;  2IPP A;  2Z5I A;  4N78 D;  2GUS A;  3NFQ A;  4Y99 B;  3V4W A;  1GDT A;  2NPS D;  2JJL A;  1MUU A;  5AW8 B;  2XKM A;  1L0L K;  1SVF A;  1RF0 C;  5CMZ A;  3EFG A;  3KDP B;  2P2U A;  2P7J A;  1LTG C;  5AVW B;  5AVT B;  2FFD A;  1HH0 A;  1G1I A;  3OJA B;  1URQ C;  5AVU B;  1OWA A;  1LTS C;  3B8E B;  5AVV B;  1GW3 A;  2C9L Y;  3HRN A;  2FXM A;  2MJZ A;  2FKW B;  2PP6 A;  2R3C A;  4AQR D;  3MGN A;  5AW2 B;  3CI9 A;  1A02 F;  1YTZ T;  5AVQ B;  3RK3 C;  1RF1 C;  3V2P A;  3VYI A;  3T97 A;  2GUV A;  2W27 A;  2OYI C;  3B5N C;  1KFM A;  1N73 C;  4LC1 A;  3E1I A;  1GU4 A;  5AW4 B;  3SWF A;  1N7S D;  3BRV B;  5CCH C;  3HUS B;  1JY3 N;  1KIL B;  2P67 A;  2O01 H;  2KB7 P;  1N7L A;  1KZU B;  1NTM K;  3HUS A;  1J1E C;  1FZG A;  1KIL A;  2P1J A;  3M91 A;  1HUC A;  4IFF A;  1Z56 A;  3HD7 A;  1IFJ A;  1IC2 A;  1M7L A;  1LTT C;  1CW5 A;  2KSJ A;  3CL3 D;  3HTK B;  1DX7 A;  3TK1 A;  1DEB A;  3C9I A;  3HTK A;  5CCG C;  2HLO A;  3MIW A;  2WIT A;  4WBA A;  1LT9 C;  2Q7C A;  2IX7 C;  1RE3 A;  1VDF A;  1RE4 A;  1JY2 P;  4WY4 D;  4GKG A;  2GM4 A;  2HOD B;  2QM8 A;  1GL2 B;  4B86 A;  1T2K C;  2XNX A;  4WY4 B;  1ZR4 A;  3IR9 A;  5APQ A;  1GL2 A;  4JYB A;  2OAR A;  5APT A;  1LTJ C;  4WY4 A;  2H43 A;  3KPE A;  4C7N B;  1EQ7 A;  3BAS A;  5BU5 A;  1HVV A;  3RK3 D;  3GHG C;  2CPB A;  4N6J A;  1SFC C;  4N3Y B;  1NOH A;  2WSF H;  1T3J A;  3B5N D;  5AW9 B;  2OYH B;  3M0D A;  5APX A;  2N9B A;  3U1A A;  2A45 G;  1NHL A;  3B5N B;  1QL2 A;  2OYH A;  1HJB A;  3PP5 A;  2YNY A;  1RY3 A;  1CZQ A;  3SWY A;  3A2A A;  3MD0 A;  1L4A C;  1N86 A;  2M8R A;  5APW A;  1DH3 A;  3VP9 A;  1GK4 A;  1H89 A;  1X79 B;  1J2J B;  1LWU C;  3P8M C;  1FZA A;  2NPS B;  2FYZ A;  2XU6 A;  3P8C D;  5KLV K;  2C0W A;  2NPS A;  3V4Q A;  5AW1 B;  1SQX K;  1YTZ I;  4EOT A;  1A02 J;  5APY A;  2HFE D;  2XV5 A;  2N1T C;  2ZXE B;  3RL0 D;  1FZC C;  1J1D C;  3H6P A;  5CCG D;  1YYC A;  3RL0 B;  4JYC A;  1NWQ A;  3MUD A;  3M9Q A;  3L36 A;  1L0N K;  1LT9 B;  3HE4 B;  1JY2 N;  1M1J B;  2IFM A;  1FBM A;  3KQG A;  3EQ2 A;  5CHX A;  1GD2 E;  2YKO A;  1LTI C;  3HE4 A;  2Q9I A;  5KJ7 C;  3RK2 C;  1M1J A;  2L5G B;  1IFM A;  1OXZ A;  3H32 B;  2R5B A;  1HBW A;  1ZR2 A;  2W6B A;  1G2C B;  1VPC A;  3M0A A;  1IK9 A;  2JEE A;  4DZO A;  1N7S B;  4KHX A;  1SFC D;  4I6M C;  5BVZ A;  4LGD E;  2KP8 A;  4IFD K;  2Q5U A;  1FDM A;  3NXS A;  1FZB A;  1N7S A;  1MV8 A;  1IFD A;  3VOP A;  3L37 A;  5AVX B;  2YMY A;  1L4A D;  3V2N A;  2Z4E A;  4W7Y A;  4Y99 C;  4ZKP A;  3HE5 B;  4I2L C;  1JUN A;  4I1L A;  1GU5 A;  1NKZ B;  1S9K E;  1L4A B;  1JMM A;  2HYN A;  2BAS A;  4ZKU A;  3HE5 A;  5KTB A;  1LWU B;  5AVS B;  1FJK A;  5AVR B;  2FFD C;  2R5D A;  1PFI A;  4IFM A;  4GT1 A;  4AUW A;  1NTK K;  3A7O A;  3TYY A;  3N4X A;  2YKP A;  5APS A;  3L35 A;  1T3U A;  1NO4 A;  2N1T D;  1WT6 A;  1RF0 A;  4LLH A;  3VP8 A;  1URQ D;  4N78 E;  1SLQ A;  2N1T B;  3G3Z A;  3N7N A;  1FZC B;  1J1D B;  2HOD A;  1AQ5 A;  2HPC B;  1URQ B;  2WT7 B;  1FAV A;  1NAF A;  3A5T A;  1URQ A;  5KJ7 D;  3RK2 D;  4C7N A;  1G1J A;  1FJP A;  3RK3 B;  1RF1 B;  1JTH B;  3I5C A;  3RK2 B;  1LGH B;  2ZFC A;  3NMD A;  1CI6 B;  4OH8 B;  2OYI B;  2YKQ A;  5CCH D;  3M06 A;  1N73 B;  3HUS C;  1RF1 A;  2POH A;  4O9B A;  1IO4 A;  1KIL C;  1JTH A;  4JF7 A;  2H7H A;  2OYI A;  3B5N A;  5APU A;  4AYC A;  3LW5 H;  3CLQ A;  3HD7 C;  2VRS A;  3OA7 A;  1SQQ K;  2R32 A;  2LKM A;  2O1J A;  2YO3 A;  1J1E B;  2A45 I;  4HH2 A;  1H8A A;  2J59 M;  1E5W A;  2YO2 A;  3BAT A;  3LID A;  1JOC A;  3M9H A;  2E43 A;  3TSI A;  5BU8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...