2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
molecule keywords Cathepsin B
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
1X8YA 1HJBA 3VTPC 1CI6B 1MFZA 1CSBA 3NFQA 3HE5A 4GKGA 2R3CA 3M9HA 5APQA 2P67A 3L36A 5AVWB 3V4QA 4AYCA 1A02J 4AUWA 3NXSA 3A7OA 3A5TA 1GK4A 1H88A 2H7HA 5AW7B 2KP8A 1DH3A 4XE5B 4EOTA 3M0AA 5AW0B 1MUUA 5APYA 3M9BA 2XV5A 1OXZA 5APUA 5AVSB 3TK1A 2R5DA 3P8MC 3P7KA 1GD2E 1GZLA 4JYCA 4DZOA 5AVZB 2JJLA 1S9KE 1OWAA 2QM8A 2R5BA 5AW5B 3M0DA 5AVQB 2WPRA 5APSA 3M91A 4GT1A 3MD0A 2P7JA 3V5BA 2YO3A 4C7NB 2QM7A 3VMZA 4JYBA 1J2JB 2E43A 5AVXB 5AVTB 5AW3B 3TNUB 2W6AA 3VMXA 5AW1B 3NMDA 5APVA 1H8AA 3A2AA 5AVVB 5AVRB 1CZQA 2Q3IA 2YNYA 1FAVA 4LC1A 1H89A 2Q7CA 4RESB 1HWTC 3VYIA 3O8ZA 2C9LY 2IPPA 2WT7A 3HE4B 1FOSE 3HTKA 3UIAA 3VMYA 4I2LC 5AW8B 4I6MC 1T2KD 5CMZA 2C9NY 4C7NA 2VRSA 3SWFA 5AW6B 2E42A 2WWWA 2P2UA 5APTA 1JUNA 1S9KD 1A02F 3HE5B 3M06A 1JNMA 3P32A 3TNUA 5APWA 1FOSF 1HBWA 2BASA 3HE4A 2ZXEB 3KDPB 3KQGA 4C46A 3TYYA 2YO2A 1SLQA 3IR9A 1G2CB 5AW4B 1GU5A 1GTWA 1NAFA 3OAKA 5AVUB 2XU6A 4AQRD 1MV8A 3VN0A 2Z5IA 5AW9B 2Q5UA 5APXA 1CI6A 4B86A 3L35A 3LIEA 1IO4A 2W27A 4KHXA 1T2KC 3LIDA 2WT7B 2XZRA 1GU4A 1NWQA 1YYCA 2N9BA 4M3LA 2Z5HA 1GK6A 2WTYA 2ZFCA 3MGNA 3T97A 3I5CA 1HUCA 5AW2B 1SP4A 2WPSA 5AVYB 3NTNA 3B8EB 3V4WA 2WPQA 3A3YB 1KQLA 4HYTB 2R32A 3L37A
chains in the Genus database with same CATH superfamily
2L5GB 1X8YA 2HR3A 3A0BH 1CI6B 1SQBD 1CSBA 2O1JA 3E7KA 2NPSB 1SFCC 2O01N 2W6JH 2V4HA 3FWLA 3L73G 4GKGA 5APQA 4ASVA 1G1IA 3I56P 1YJNP 3OW2O 2FXMA 3KPEA 1A02J 3KHUA 4HB1A 3IF4A 5E79E 2XKMA 3VP8A 4IL6H 4EDFA 2H7HA 1IFIA 4I7ZB 2YKQA 1QGKB 4AUWA 2KP8A 1DH3A 3B71A 1PGOA 3V6IA 2YKOA 1N86A 3PJSK 4WBAA 2Q3EA 5BU8B 5APUA 3GF7A 3TGUE 3TK1A 4PV1D 3C1LA 1OIPA 2R5DA 4OH8B 1K8AQ 5TJHA 1FBMA 2WSSH 1NKNA 2JO1A 2WZ7A 3CWBE 5AVZB 1VDFA 4K3AA 4WY4A 1FU1A 1T6AA 2IBZG 2IFMA 2RH0A 2RN0A 2WSEJ 1OWAA 3W67A 1S9KE 3CC7P 3CD6P 4Z1MH 1MZ9A 1N73B 4GOEA 1SQVJ 3N4XA 3RK2B 2P7JA 3PH0A 1H0TB 1M1KQ 4L76A 5GTHE 3AE7C 1LTTC 2QM7A 2V7QH 2PGDA 1FS0E 4H13C 4D6TG 5KJ7A 3H1JD 2ZAEB 2UWJE 3CWBD 4H0LD 1VPCA 1KYOD 3TGUJ 4N6JA 1KMIZ 3HD7C 2Y0DA 5CBOA 3MTUE 2H43A 1IK7A 1RY3A 1GL2B 1YTZT 2W6BA 4L74A 1YJWP 3KZIE 1HF9A 4H44C 2Q3IA 1ZV8A 3HRNA 4PV1C 1LTAC 4N78E 3L74E 2CPBA 2BCCG 3O6QB 2A45I 2AEMA 1BE3G 1HVVA 4U3FG 5CCGC 2AEJA 3EFGA 1AVOA 2IBZD 1MFTA 1J1EC 2OYIB 1FOSE 3UIAA 2E76C 2HLOA 2K9YA 3VMYA 5KLVG 1LP1B 1RF0A 1T2KD 3KZIH 3CCRP 1BSNA 2GUVA 3L70J 5GTIH 2CK3H 2MKVA 4LGDE 1M1JB 1PGJA 5AW6B 5APTA 3H32A 1VL2A 1BCCJ 1FDIA 1IC2A 3CXHD 1GMJA 1JNMA 3FXEA 3TNUA 5KLIB 1SQVD 3H1HE 2XDJA 3H1IJ 3CC2P 3D6YA 1M8OB 1USDA 5CHXA 1U7JA 2BASA 2GUSA 1IK9A 2POHA 3L71J 3L74G 4OVNF 2O01J 4W7YA 2JP3A 5KJ7D 1N7SD 2KYVA 4C46A 3PLNA 4U3FE 3SFEC 1G2CB 3V2QA 3B5NA 3L73D 1ZLLA 2E76B 2YIUB 1USEA 4K35A 1NTZJ 3RL0D 1L0NK 2C0XA 2N9YB 2WITA 1LTJB 2KI7B 1HJ0A 2BCCD 1EZVD 3EQ2A 3F89A 1HGZA 1OZHA 2AEFA 2ZJSE 1R8EA 1RF1B 3H1KD 3H1IE 3PRJA 1CI6A 1OMIA 1W2EA 1ZW0A 1NH4A 1LTJC 1EC5A 1ZOYC 3IN6A 3ITKA 4RKUJ 4WY4C 5KLVD 2NRGA 2FFDB 1NGMB 1TU3F 1D7MA 1PP9G 1RE4C 2YMKA 3H1LE 4IOIH 2E75D 2QE7H 3GMAA 3V2PA 2OYHA 4HKZH 1IFMA 5L8RJ 1L0LJ 2HODB 2BCCE 2RMZA 3RK3B 4PD4E 1JCDA 2Y9ZA 2Z5HA 2WTYA 1SQQE 2YIUC 1HUCA 2FYUD 2E74C 3CCJP 1LWUC 2WPSA 1Q2NA 5AVYB 1M1JA 3A3YB 2E75C 1KYOE 3L74J 2QIWA 4HYTB 2AXCA 3L70D 4U7JA 4XE5B 1M56D 2WSEH 3L75D 1BDCA 4H44B 1HJBA 1NOHA 3VTPC 3LW5H 5CCHD 5KAIE 3NFQA 1N73A 3HE5A 1G1JA 2R3CA 1XTGB 1KQGB 3Q5PA 3CX5H 4AYCA 3FWNA 3AE3C 1DIPA 1KQSO 2WSFH 3A5TA 4IFMA 1FZCB 3TF5A 3AECC 1KC8Q 1QL1A 1KB9I 3RL0B 2QEXP 5DJTB 1NTMJ 1NTZD 3GF3A 4ZNCA 1E79H 1MUUA 3GHGA 3HD7D 4WY4D 3L73E 5APYA 3AEBC 2AXTE 3CMEP 3M9BA 2QJKB 1LT9A 3BCCG 1NTZG 5KAIH 1IJDB 3VMAA 1NKZB 2BCCJ 1L0LE 1NTMK 1NTKK 3P8MC 1W5CE 2LKMA 4ZKUA 1LWUA 1N7LA 2KSEA 3H1KE 3RK2D 4EIJA 1QLED 1N7SA 3WUUA 4DZOA 1GW4A 1R5LA 3CWBJ 2Y0CA 4YXWH 2QM8A 1L0LK 1NTME 3AE2C 1WT6A 3EFFK 3WU2E 3RGUA 5KKZC 1M90Q 3FX0A 2WPRA 5APSA 5TISE 3W68A 4A7PA 4ZKPA 4GT1A 3GHGB 1QX8A 3BCCE 2FYZA 3V5BA 1LJ2A 1U7MA 1SQQD 2FXPA 1ZN5A 3VMZA 4I1LA 5KLVE 2PP6A 1YITP 4GODA 4NPFX 5AVTB 1URQD 2FXOA 3TNUB 1PFIA 2YXRB 1BGYG 4DOJA 1SQQJ 1JMBA 5APVA 1H8AA 3AE8C 2RKLA 1BGYD 4EI2A 1CZQA 4CPGA 1FAVA 3AEAC 5K5GB 4OGQB 2K9JA 1JEKA 3AE9C 1RE4A 2D2CD 2Q7CA 3CL3D 3MIWA 3U1CA 1T8ZA 3GHGC 1HWTC 1VQ9P 3H1LJ 1JY2N 4MN4C 1IFPA 2M3EA 1SQXE 3HE4B 3L72E 1YI2P 2KS1A 3PP5A 1VQPP 1UIIA 3BRVB 3L71D 4I2LC 4W7ZA 1ZR4A 3H6PA 5CMZA 1PP9D 2VRSA 3JSVC 2M8RA 1M1JC 1S5LE 2MJZA 1N7SB 1PP9E 3CX5I 2N1TD 3H1LG 4QMAA 1NAYA 3SWYA 1OW7A 3AEEC 1FOSF 1S9KD 3M06A 2E76D 4YTPC 1OW8A 4JF7A 5APWA 1X9VA 5B66E 4GDOA 1SFCB 2IBZE 1X0TA 1FJPA 3HUSA 1URQC 4Y99C 1S72P 2OYOA 1ZP0C 2R44A 2ZXEB 3BASA 3KDPB 5KLVJ 2IX7C 2YO2A 1JTHA 1SLQA 2FY8A 3BRTB 3VOPA 4ZMDA 1OW6A 1Y8AA 4O9BA 2W83C 4I7ZC 1GTWA 1NAFA 2H8PD 3OAKA 2LXCB 2XU6A 2OTJP 4IFFA 3F5HA 2W90A 2ZYGA 3CXHE 2NPSA 1L0LD 3L75E 5B66H 3U59A 1RF1C 1SQBK 1DEBA 2Z5IA 1EQ7A 2ZYDA 5AW9B 1AA0A 1EZVG 1DD3A 1SQVE 1T3UA 2Q5UA 3H1HD 5KKZB 1SVFA 4JBZA 1JY2O 3RK3D 2D2CB 2W27A 3L71G 4BRYB 1EDKA 4NPDA 1NTKD 1VQMP 3H1IG 2YKPA 1QVGO 4R4LA 2B87A 3L73J 3WUVA 3A0BE 1S4XA 2H88C 1NU1K 1ZRTD 2I8DA 3M0DC 3Q3DA 2L91A 1KILD 2OYHB 2IDBA 2ZXXA 3L70G 1FE6A 2LR2A 4M3LA 2ZFCA 3T97A 1PGPA 1AV1A 3BCCJ 5AW2B 4YPCA 2B88A 1L0LG 2CPSA 1DX7A 1PGQA 1JY3N 1R5SA 2QJYB 2A45G 2R32A 3H1HG 5AVXB 2AXTH 1MFZA 1K9MQ 4BWNA 2WVRA 3C8VA 1ZMEC 3M9HA 2B87B 2P67A 5AVWB 3RK3E 3H32B 1P84H 3A0HH 3P8CE 4C7RA 1X79B 2DW3A 3AEFC 1GK4A 1OVVA 1NVOA 2B9BA 1FZBA 2OTKE 3R4YA 3SSUA 4EYYQ 1AJYA 1S5LX 5AW7B 3CCUP 1FZEA 3BATA 1EXJA 3M0AA 4RJTA 3E1RA 5CCHC 5H2FH 2BEQD 3IAOA 1JCCA 5AW0B 3MZWB 3I55P 3L75J 3WU2H 2QJKC 4KJMA 2XV5A 4BRYA 2FYUG 1NU1E 1LP1A 2JKVA 4JQ0D 1KFNA 5AVSB 4OWFA 1VQ5P 3M9QA 1S3JA 3L75G 2IFNA 1IFJA 1LTJA 1T3JA 2HYNA 2QJYC 3MHVA 5E79H 3B4SA 5GTHH 3AEDC 3Q5SA 4PJ0H 3H1JE 1BGYE 2JWDA 2JJLA 3RBXA 1P84I 1KV4A 1LNQA 1OX3A 3USSA 1NTZE 2R5BA 4H13D 5AW5B 3M0DA 1BCCG 3QWOC 1KB9D 3ZDMA 5B5EH 1L0ND 4H0LC 3CCMP 1ZRTE 4W80A 3Q2YA 3TGUD 2HPCA 1NU1D 1VQ4P 1LT9B 1SFCD 2ITAA 3L71E 5M1BA 3TDKA 1S1CX 2E5YA 1BE3J 2R3SA 1J2JB 2Y9YA 3II6A 4H44D 4XA4A 5CBNA 2HPCB 1LT9C 1SQVK 1Q90D 2NPSC 1BCCE 4XFJA 3SFDC 3HD7A 5AW3B 5B5EE 1NU1J 1RF1A 2PFXA 1ZXGA 3VMXA 2PAJA 1E5WA 3H1JG 3NMDA 2O01H 1JY3O 2K3RA 1BE3D 2QRXA 3A2AA 1NTZK 3C9IA 4IL6X 4KT0J 4RO0A 1BE3E 2YNYA 1YIJP 2OGUA 4WY4B 2FKWB 4RESB 1L4AC 4ASWA 2K37A 1Q7YQ 2M3BA 3TGUG 1W2BO 1URQB 1JTHB 2G3AA 2I1JA 1UIXA 4UB8H 4Y99B 4D6TJ 2IPPA 5CCHA 2WT7A 2M0BA 2KSJA 2KZJA 3RK3C 3HTKA 1KB9H 1S2EA 2FYUJ 3CXHI 2WSCJ 1KQFB 2IYPA 3MP7B 1LT1A 2ZVNB 3H1ID 3G6EP 4C7NA 1L4AD 2FYNB 1PIXA 1SQVG 2FBWC 2KIKA 4GOFA 1SQPJ 3V2RA 2WWWA 2P2UA 4H13B 4PD4I 1NTKE 2E42A 1NO4A 3L74D 2JEEA 1SQXG 2J5UA 2KUBA 3H1LD 3L72G 1N73C 1A02F 3IFMA 1YJ9P 4L75A 3LW5J 1RH5B 3ABVC 1SQXD 1URQA 3FGAD 2NPSD 1JM0A 3HUSC 3KXDA 3L72D 1KILE 1L0NE 3HE4A 3KQGA 2V7QJ 3TYYA 1AQ5A 1LTBC 4N78D 3H1KJ 3BVHA 4TT3H 1LTIC 1VF5D 3IR9A 1QEXA 2ZT9D 5AW4B 1L4AA 3JCUE 5BU5A 3S4RA 1YBKA 3HUSB 5AVUB 5DJUB 4UB6H 3N7NA 1VQKP 1MV8A 3RBZA 1YQ4C 3HD7B 2OYIA 3CPWO 3K5BA 3B5ND 1EDLA 1N2DC 1JMMA 1NTKG 2GM4A 2IYOA 4B86A 2Y0EA 3Q1MA 2J59M 2WSFJ 3CCEP 1VF5C 3LIEA 2ZT9C 4GIFA 1LTGC 4PV1B 1FZCC 3R2PA 1IO4A 1FZCA 1FZFA 2JDIH 2A45H 3KYQA 1PL5A 2K88A 4KHXA 2G8YA 2GA1A 3JCUH 5CJ0A 1T2KC 1Q81Q 2HG5D 1FJKA 1Y47A 1IFDA 2P10A 1SQBJ 4WVZA 1BSHA 3OJAB 3CXHH 5KLIC 1RE3C 1EZVE 1NWQA 1YYCA 2N9BA 3HTKB 4L73A 1Q86Q 2A06E 1GK6A 1M57D 4DJGA 5CJ4A 3MGNA 1VQ7P 2N1TB 3S1KA 1SQPD 1OVRA 1LGHB 2WPQA 1BCCD 1KQLA 2O3JA 2QJPC 3L37A 1BDDA 2I1KA 1KFMA 4NPEA 1WRGA 1NTMD 3QH9A 1K05A 1SQXJ 3L72J 3CI9A 1YQ3C 1SFCA 3L36A 2W8ZA 3RL0g 3V4QA 5KTBA 5KLVK 1EXIA 3NXSA 3CC4P 3U1AA 3A7OA 5BVZA 1NYHA 2Q1KA 3D71A 1H88A 2K9JB 2FFDA 1CW5A 3GG2A 1JB0J 3BCCD 2WQYC 1KYOH 4EOTA 2OYIC 4OGQD 1YHQP 1SQXK 1N8RQ 1JOCA 1JY3P 1OXZA 3CCQP 2J58A 2QA4P 1KORA 2B89A 4HH2A 1PPJE 2KXPB 1Q82Q 1EDJA 3P7KA 2KB7P 1GZLA 3AE4C 4LLHA 4U3FJ 1GD2E 1VQLP 1NTMG 4JYCA 1LWUB 1PP9J 2O1KA 4OGQC 4AQRD 2WMMA 2FFDC 4IFDK 3H1JJ 3PHLA 1SS1A 3CCVP 1JO5A 5H2FE 1SQQK 1KZUB 1HTLC 1LTSC 2IZ1A 3AE6C 1H0TA 3AEGC 3WUTA 5AVQB 1SQQG 4H0LB 3D6ZA 1NJIQ 3M91A 4YXDC 4WB4A 3MD0A 1KYOI 3CCLP 1J1DC 3O6QA 1DD4A 2E74B 2YO3A 4DT0A 4C7NB 3PTZA 1KD1Q 1FDOA 2IBZI 4PJ0E 1AFOA 1IZNB 4JYBA 1VF5B 2Q6QA 2SPZA 2ZT9B 2E43A 4UB8E 1J1DB 3T97B 2Z4EA 2P1JA 2IZ0A 1KILA 5TISH 4BXLA 2W6AA 4N3YB 1IFNA 2OTLP 1KB9E 1L0NJ 1GDTA 2WPVB 5AW1B 3FXDA 1VQNP 2KOGA 3CWBG 2OARA 1RHZB 5AVVB 1WMKA 5AVRB 1OFCX 3RL0C 5GTIE 4LC1A 4HJGH 1L0NG 1PZQA 4WWIA 4Y28J 2M5AB 1FZAA 1L4AB 1NTKJ 1SQBE 3RK2C 3TSIA 3V2NA 3O8ZA 1SQPE 3VYIA 1AVYA 1NU1G 3WMM0 2N1TC 2QG4A 2XNXA 3G4SP 1K73Q 3CCSP 2KLUA 1OVUA 2C9LY 1J1EB 2A06D 3Q5RA 3GLMA 1NHLA 4PD4D 3OA7A 4DCKA 3CMAP 1HH0A 5AW8B 1FZGA 4I6MC 2BEZF 1KILB 2LXBA 4U3FD 3H1KG 2C9NY 2YXQB 2OQQA 2D2CC 1GW3A 1RQVA 2FYNC 1XTCC 5EFWB 3SWFA 2KK7A 3G71P 1JUNA 1QL2A 2QSIA 3VP9A 1L2PA 2FYUK 1KTMA 1KILC 3HE5B 1RQUA 1GL2A 4D6TD 1VQ8P 3P32A 1EDIA 5CCGA 1X22A 1Z56A 1HBWA 1U57A 1PV3A 4JPZB 2OYHC 2E74D 2ZYAA 3B5NB 5KAFH 1EZVI 2M5AA 2WSCH 1SQPK 3AE5C 3JC22 1FC2C 1G2CA 3EWKA 2KLVA 3MUDA 3L4FA 2A06G 4R4MA 1S5LH 2Q9IA 2YMYA 1GU5A 1DEEG 2N1TA 3SWKA 2P58A 3D70A 1JY2P 3CX5D 5C39A 3E1IA 1PPJD 2E5TA 1GL2D 3VN0A 1QVFO 1RF0C 5CCGD 5KAFE 1HGVA 2JR8A 4PD4H 5APXA 2KZIA 2FYUE 2KNCA 2NZ2A 2QJPB 3L35A 3P8CD 1FDMA 3G9RA 2K1AA 1VQOP 2H89C 3LIDA 4D6TE 1BGYJ 4UB6E 1H89A 3B5NC 2XNDH 1GL2C 2HFED 2QVAA 1M7LA 1RE3A 4TLFA 2XZRA 1AQTA 2HODA 3G3ZA 2C0WA 1SQPG 3H1HJ 2WT7B 3CLQA 1GU4A 1VQ6P 1KN7A 3CX5E 1P84E 1K04A 1YTZI 2KS1B 1MKMA 3A0HE 3AE1C 3S9OA 1ZR2A 1P84D 3I5CA 3MUDC 4IL6E 2ZVOB 3GW6A 2JWAA 1SP4A 1Y9BA 1PPJG 3B8EB 3L70E 3NTNA 2PRRA 1SQBG 2E75B 2KNCB 3V4WA 1N7SC 5KJ7C 3H25A
chains in the Genus database with same CATH topology
2L5GB 1X8YA 1CI6B 2O1JA 1CSBA 2NPSB 1SFCC 4GKGA 5APQA 1G1IA 2FXMA 3KPEA 1A02J 2XKMA 3VP8A 2H7HA 1IFIA 2YKQA 2KP8A 1DH3A 2YKOA 1N86A 4WBAA 5BU8B 5APUA 3TK1A 2R5DA 4OH8B 1FBMA 1NKNA 2WZ7A 5AVZB 1VDFA 4WY4A 1FU1A 2IFMA 1S9KE 1OWAA 1MZ9A 1N73B 3N4XA 3RK2B 2P7JA 1LTTC 2QM7A 5KJ7A 1VPCA 4N6JA 3HD7C 3MTUE 2H43A 1YTZT 1RY3A 1GL2B 2W6BA 2Q3IA 1ZV8A 3HRNA 1LTAC 4N78E 2CPBA 2A45I 1HVVA 5CCGC 3EFGA 1J1EC 2OYIB 1FOSE 3UIAA 2HLOA 3VMYA 1RF0A 1T2KD 2GUVA 4LGDE 1M1JB 5AW6B 5APTA 3H32A 1IC2A 1JNMA 3TNUA 2XDJA 5CHXA 2BASA 2GUSA 1IK9A 2POHA 4W7YA 5KJ7D 4C46A 1N7SD 2KYVA 1G2CB 3V2QA 3B5NA 1ZLLA 4AQRD 3RL0D 1L0NK 2C0XA 2WITA 1LTJB 3EQ2A 1HGZA 1RF1B 1CI6A 1W2EA 1NH4A 1LTJC 2FFDB 4WY4C 1RE4C 3V2PA 2OYHA 1IFMA 2HODB 3RK3B 1JCDA 2Z5HA 2WTYA 1HUCA 1LWUC 2WPSA 5AVYB 1M1JA 3A3YB 4HYTB 4XE5B 2WSEH 1HJBA 1NOHA 3VTPC 3LW5H 5CCHD 3NFQA 1N73A 3HE5A 1G1JA 2R3CA 1XTGB 4AYCA 2WSFH 3A5TA 4IFMA 1FZCB 1QL1A 3RL0B 1MUUA 3GHGA 3HD7D 4WY4D 5APYA 3M9BA 1LT9A 1IJDB 1NKZB 1NTMK 1NTKK 3P8MC 2LKMA 4ZKUA 1LWUA 1N7LA 3RK2D 4EIJA 1N7SA 4DZOA 1GW4A 2QM8A 1L0LK 1WT6A 2WPRA 5APSA 4ZKPA 4GT1A 3GHGB 2FYZA 3V5BA 1ZN5A 3VMZA 4I1LA 2PP6A 5AVTB 1URQD 3TNUB 1PFIA 4DOJA 5APVA 1H8AA 1CZQA 1FAVA 1JO5A 1H89A 2Q7CA 3U1CA 1RE4A 1HWTC 3MIWA 3CL3D 1T8ZA 3GHGC 1JY2N 3HE4B 3PP5A 3BRVB 4W7ZA 4I2LC 1ZR4A 3H6PA 5CMZA 2VRSA 2M8RA 1M1JC 2MJZA 1N7SB 3SWYA 2N1TD 1S9KD 3M06A 4JF7A 5APWA 1X9VA 1SFCB 1FJPA 3HUSA 1URQC 4Y99C 2ZXEB 3BASA 3KDPB 2IX7C 2YO2A 1JTHA 1SLQA 3BRTB 3VOPA 4O9BA 1GTWA 1NAFA 2H8PD 3OAKA 2XU6A 4IFFA 2NPSA 1RF1C 3U59A 1SQBK 1DEBA 2Z5IA 1EQ7A 5AW9B 2Q5UA 1T3UA 1SVFA 3RK3D 1JY2O 2W27A 2YKPA 1NU1K 3M0DC 1KILD 2OYHB 4M3LA 2ZFCA 3T97A 5AW2B 2CPSA 1DX7A 1JY3N 2R32A 5AVXB 2A45G 1MFZA 3M9HA 2P67A 5AVWB 4C7RA 3H32B 3P8CE 1X79B 1GK4A 1FZBA 5AW7B 1FZEA 3BATA 3M0AA 5CCHC 5AW0B 1JCCA 2XV5A 1KFNA 5AVSB 3M9QA 2IFNA 1IFJA 1LTJA 1T3JA 2HYNA 2JJLA 2R5BA 5AW5B 3M0DA 4W80A 2HPCA 1LT9B 1SFCD 3II6A 1J2JB 4XA4A 2HPCB 1LT9C 1SQVK 2NPSC 1RF1A 3HD7A 5AW3B 3VMXA 2PAJA 1E5WA 3NMDA 2O01H 1JY3O 3A2AA 1NTZK 3C9IA 2YNYA 4WY4B 2FKWB 4RESB 1L4AC 2M3BA 1URQB 1JTHB 2I1JA 4Y99B 5CCHA 2IPPA 2WT7A 2KSJA 3RK3C 3HTKA 4C7NA 1L4AD 3V2RA 2E42A 2WWWA 2P2UA 1NO4A 2JEEA 1A02F 1N73C 3IFMA 1FOSF 1URQA 2NPSD 3HUSC 3HE4A 3KQGA 3TYYA 1AQ5A 1LTBC 4N78D 3BVHA 1LTIC 3IR9A 5AW4B 1L4AA 5BU5A 3HUSB 5AVUB 3N7NA 1MV8A 3HD7B 2OYIA 3B5ND 1N2DC 1JMMA 2GM4A 4B86A 2J59M 3LIEA 4GIFA 1LTGC 1IO4A 1FZCC 3R2PA 1FZCA 1FZFA 2A45H 3KYQA 4KHXA 1T2KC 5CJ0A 2HG5D 1FJKA 1IFDA 3OJAB 1RE3C 1NWQA 1YYCA 2N9BA 3HTKB 1GK6A 5CJ4A 3MGNA 2N1TB 1LGHB 2WPQA 1KQLA 3L37A 2I1KA 1KFMA 1WRGA 3CI9A 1SFCA 3L36A 3V4QA 5KTBA 5KLVK 4AUWA 3NXSA 3U1AA 3A7OA 5BVZA 1H88A 2FFDA 1CW5A 4EOTA 1SQXK 1JOCA 1JY3P 1OXZA 2J58A 4HH2A 3P7KA 2KB7P 1GZLA 4LLHA 1GD2E 4JYCA 1LWUB 2O1KA 2FFDC 4IFDK 1KZUB 1LTSC 1HTLC 1SQQK 5AVQB 3M91A 4WB4A 3MD0A 1J1DC 2YO3A 4C7NB 4JYBA 2E43A 2Z4EA 1J1DB 2P1JA 1KILA 2W6AA 4N3YB 1IFNA 1GDTA 5AW1B 2KOGA 2OARA 5AVVB 5AVRB 3RL0C 4LC1A 1FZAA 1L4AB 3RK2C 3TSIA 3V2NA 3VYIA 3O8ZA 3WMM0 1AFOA 2N1TC 2C9LY 2XNXA 1J1EB 2OYIC 1NHLA 3OA7A 1HH0A 5AW8B 1FZGA 4I6MC 1KILB 2C9NY 1GW3A 1XTCC 3SWFA 1JUNA 1QL2A 3VP9A 2FYUK 1KILC 3HE5B 1GL2A 3P32A 5CCGA 1Z56A 1HBWA 2OYHC 3B5NB 2WSCH 1SQPK 1G2CA 2KLVA 3MUDA 3L4FA 2Q9IA 2YMYA 1GU5A 2N1TA 1JY2P 3E1IA 1GL2D 3VN0A 1RF0C 5CCGD 1HGVA 5APXA 3L35A 3P8CD 1FDMA 3LIDA 3B5NC 1GL2C 2HFED 1M7LA 1RE3A 2WT7B 2XZRA 2HODA 3G3ZA 1GU4A 2C0WA 3CLQA 1YTZI 1ZR2A 3I5CA 1SP4A 3NTNA 3B8EB 3V4WA 5KJ7C 1N7SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Y A;  1HJB A;  3VTP C;  1CI6 B;  1MFZ A;  1CSB A;  3NFQ A;  3HE5 A;  4GKG A;  2R3C A;  3M9H A;  5APQ A;  2P67 A;  3L36 A;  5AVW B;  3V4Q A;  4AYC A;  1A02 J;  4AUW A;  3NXS A;  3A7O A;  3A5T A;  1GK4 A;  1H88 A;  2H7H A;  5AW7 B;  2KP8 A;  1DH3 A;  4XE5 B;  4EOT A;  3M0A A;  5AW0 B;  1MUU A;  5APY A;  3M9B A;  2XV5 A;  1OXZ A;  5APU A;  5AVS B;  3TK1 A;  2R5D A;  3P8M C;  3P7K A;  1GD2 E;  1GZL A;  4JYC A;  4DZO A;  5AVZ B;  2JJL A;  1S9K E;  1OWA A;  2QM8 A;  2R5B A;  5AW5 B;  3M0D A;  5AVQ B;  2WPR A;  5APS A;  3M91 A;  4GT1 A;  3MD0 A;  2P7J A;  3V5B A;  2YO3 A;  4C7N B;  2QM7 A;  3VMZ A;  4JYB A;  1J2J B;  2E43 A;  5AVX B;  5AVT B;  5AW3 B;  3TNU B;  2W6A A;  3VMX A;  5AW1 B;  3NMD A;  5APV A;  1H8A A;  3A2A A;  5AVV B;  5AVR B;  1CZQ A;  2Q3I A;  2YNY A;  1FAV A;  4LC1 A;  1H89 A;  2Q7C A;  4RES B;  1HWT C;  3VYI A;  3O8Z A;  2C9L Y;  2IPP A;  2WT7 A;  3HE4 B;  1FOS E;  3HTK A;  3UIA A;  3VMY A;  4I2L C;  5AW8 B;  4I6M C;  1T2K D;  5CMZ A;  2C9N Y;  4C7N A;  2VRS A;  3SWF A;  5AW6 B;  2E42 A;  2WWW A;  2P2U A;  5APT A;  1JUN A;  1S9K D;  1A02 F;  3HE5 B;  3M06 A;  1JNM A;  3P32 A;  3TNU A;  5APW A;  1FOS F;  1HBW A;  2BAS A;  3HE4 A;  2ZXE B;  3KDP B;  3KQG A;  4C46 A;  3TYY A;  2YO2 A;  1SLQ A;  3IR9 A;  1G2C B;  5AW4 B;  1GU5 A;  1GTW A;  1NAF A;  3OAK A;  5AVU B;  2XU6 A;  4AQR D;  1MV8 A;  3VN0 A;  2Z5I A;  5AW9 B;  2Q5U A;  5APX A;  1CI6 A;  4B86 A;  3L35 A;  3LIE A;  1IO4 A;  2W27 A;  4KHX A;  1T2K C;  3LID A;  2WT7 B;  2XZR A;  1GU4 A;  1NWQ A;  1YYC A;  2N9B A;  4M3L A;  2Z5H A;  1GK6 A;  2WTY A;  2ZFC A;  3MGN A;  3T97 A;  3I5C A;  1HUC A;  5AW2 B;  1SP4 A;  2WPS A;  5AVY B;  3NTN A;  3B8E B;  3V4W A;  2WPQ A;  3A3Y B;  1KQL A;  4HYT B;  2R32 A;  3L37 A; 
#chains in the Genus database with same CATH topology
 2L5G B;  1X8Y A;  2HR3 A;  3A0B H;  1CI6 B;  1SQB D;  1CSB A;  2O1J A;  3E7K A;  2NPS B;  1SFC C;  2O01 N;  2W6J H;  2V4H A;  3FWL A;  3L73 G;  4GKG A;  5APQ A;  4ASV A;  1G1I A;  3I56 P;  1YJN P;  3OW2 O;  2FXM A;  3KPE A;  1A02 J;  3KHU A;  4HB1 A;  3IF4 A;  5E79 E;  2XKM A;  3VP8 A;  4IL6 H;  4EDF A;  2H7H A;  1IFI A;  4I7Z B;  2YKQ A;  1QGK B;  4AUW A;  2KP8 A;  1DH3 A;  3B71 A;  1PGO A;  3V6I A;  2YKO A;  1N86 A;  3PJS K;  4WBA A;  2Q3E A;  5BU8 B;  5APU A;  3GF7 A;  3TGU E;  3TK1 A;  4PV1 D;  3C1L A;  1OIP A;  2R5D A;  4OH8 B;  1K8A Q;  5TJH A;  1FBM A;  2WSS H;  1NKN A;  2JO1 A;  2WZ7 A;  3CWB E;  5AVZ B;  1VDF A;  4K3A A;  4WY4 A;  1FU1 A;  1T6A A;  2IBZ G;  2IFM A;  2RH0 A;  2RN0 A;  2WSE J;  1OWA A;  3W67 A;  1S9K E;  3CC7 P;  3CD6 P;  4Z1M H;  1MZ9 A;  1N73 B;  4GOE A;  1SQV J;  3N4X A;  3RK2 B;  2P7J A;  3PH0 A;  1H0T B;  1M1K Q;  4L76 A;  5GTH E;  3AE7 C;  1LTT C;  2QM7 A;  2V7Q H;  2PGD A;  1FS0 E;  4H13 C;  4D6T G;  5KJ7 A;  3H1J D;  2ZAE B;  2UWJ E;  3CWB D;  4H0L D;  1VPC A;  1KYO D;  3TGU J;  4N6J A;  1KMI Z;  3HD7 C;  2Y0D A;  5CBO A;  3MTU E;  2H43 A;  1IK7 A;  1RY3 A;  1GL2 B;  1YTZ T;  2W6B A;  4L74 A;  1YJW P;  3KZI E;  1HF9 A;  4H44 C;  2Q3I A;  1ZV8 A;  3HRN A;  4PV1 C;  1LTA C;  4N78 E;  3L74 E;  2CPB A;  2BCC G;  3O6Q B;  2A45 I;  2AEM A;  1BE3 G;  1HVV A;  4U3F G;  5CCG C;  2AEJ A;  3EFG A;  1AVO A;  2IBZ D;  1MFT A;  1J1E C;  2OYI B;  1FOS E;  3UIA A;  2E76 C;  2HLO A;  2K9Y A;  3VMY A;  5KLV G;  1LP1 B;  1RF0 A;  1T2K D;  3KZI H;  3CCR P;  1BSN A;  2GUV A;  3L70 J;  5GTI H;  2CK3 H;  2MKV A;  4LGD E;  1M1J B;  1PGJ A;  5AW6 B;  5APT A;  3H32 A;  1VL2 A;  1BCC J;  1FDI A;  1IC2 A;  3CXH D;  1GMJ A;  1JNM A;  3FXE A;  3TNU A;  5KLI B;  1SQV D;  3H1H E;  2XDJ A;  3H1I J;  3CC2 P;  3D6Y A;  1M8O B;  1USD A;  5CHX A;  1U7J A;  2BAS A;  2GUS A;  1IK9 A;  2POH A;  3L71 J;  3L74 G;  4OVN F;  2O01 J;  4W7Y A;  2JP3 A;  5KJ7 D;  1N7S D;  2KYV A;  4C46 A;  3PLN A;  4U3F E;  3SFE C;  1G2C B;  3V2Q A;  3B5N A;  3L73 D;  1ZLL A;  2E76 B;  2YIU B;  1USE A;  4K35 A;  1NTZ J;  3RL0 D;  1L0N K;  2C0X A;  2N9Y B;  2WIT A;  1LTJ B;  2KI7 B;  1HJ0 A;  2BCC D;  1EZV D;  3EQ2 A;  3F89 A;  1HGZ A;  1OZH A;  2AEF A;  2ZJS E;  1R8E A;  1RF1 B;  3H1K D;  3H1I E;  3PRJ A;  1CI6 A;  1OMI A;  1W2E A;  1ZW0 A;  1NH4 A;  1LTJ C;  1EC5 A;  1ZOY C;  3IN6 A;  3ITK A;  4RKU J;  4WY4 C;  5KLV D;  2NRG A;  2FFD B;  1NGM B;  1TU3 F;  1D7M A;  1PP9 G;  1RE4 C;  2YMK A;  3H1L E;  4IOI H;  2E75 D;  2QE7 H;  3GMA A;  3V2P A;  2OYH A;  4HKZ H;  1IFM A;  5L8R J;  1L0L J;  2HOD B;  2BCC E;  2RMZ A;  3RK3 B;  4PD4 E;  1JCD A;  2Y9Z A;  2Z5H A;  2WTY A;  1SQQ E;  2YIU C;  1HUC A;  2FYU D;  2E74 C;  3CCJ P;  1LWU C;  2WPS A;  1Q2N A;  5AVY B;  1M1J A;  3A3Y B;  2E75 C;  1KYO E;  3L74 J;  2QIW A;  4HYT B;  2AXC A;  3L70 D;  4U7J A;  4XE5 B;  1M56 D;  2WSE H;  3L75 D;  1BDC A;  4H44 B;  1HJB A;  1NOH A;  3VTP C;  3LW5 H;  5CCH D;  5KAI E;  3NFQ A;  1N73 A;  3HE5 A;  1G1J A;  2R3C A;  1XTG B;  1KQG B;  3Q5P A;  3CX5 H;  4AYC A;  3FWN A;  3AE3 C;  1DIP A;  1KQS O;  2WSF H;  3A5T A;  4IFM A;  1FZC B;  3TF5 A;  3AEC C;  1KC8 Q;  1QL1 A;  1KB9 I;  3RL0 B;  2QEX P;  5DJT B;  1NTM J;  1NTZ D;  3GF3 A;  4ZNC A;  1E79 H;  1MUU A;  3GHG A;  3HD7 D;  4WY4 D;  3L73 E;  5APY A;  3AEB C;  2AXT E;  3CME P;  3M9B A;  2QJK B;  1LT9 A;  3BCC G;  1NTZ G;  5KAI H;  1IJD B;  3VMA A;  1NKZ B;  2BCC J;  1L0L E;  1NTM K;  1NTK K;  3P8M C;  1W5C E;  2LKM A;  4ZKU A;  1LWU A;  1N7L A;  2KSE A;  3H1K E;  3RK2 D;  4EIJ A;  1QLE D;  1N7S A;  3WUU A;  4DZO A;  1GW4 A;  1R5L A;  3CWB J;  2Y0C A;  4YXW H;  2QM8 A;  1L0L K;  1NTM E;  3AE2 C;  1WT6 A;  3EFF K;  3WU2 E;  3RGU A;  5KKZ C;  1M90 Q;  3FX0 A;  2WPR A;  5APS A;  5TIS E;  3W68 A;  4A7P A;  4ZKP A;  4GT1 A;  3GHG B;  1QX8 A;  3BCC E;  2FYZ A;  3V5B A;  1LJ2 A;  1U7M A;  1SQQ D;  2FXP A;  1ZN5 A;  3VMZ A;  4I1L A;  5KLV E;  2PP6 A;  1YIT P;  4GOD A;  4NPF X;  5AVT B;  1URQ D;  2FXO A;  3TNU B;  1PFI A;  2YXR B;  1BGY G;  4DOJ A;  1SQQ J;  1JMB A;  5APV A;  1H8A A;  3AE8 C;  2RKL A;  1BGY D;  4EI2 A;  1CZQ A;  4CPG A;  1FAV A;  3AEA C;  5K5G B;  4OGQ B;  2K9J A;  1JEK A;  3AE9 C;  1RE4 A;  2D2C D;  2Q7C A;  3CL3 D;  3MIW A;  3U1C A;  1T8Z A;  3GHG C;  1HWT C;  1VQ9 P;  3H1L J;  1JY2 N;  4MN4 C;  1IFP A;  2M3E A;  1SQX E;  3HE4 B;  3L72 E;  1YI2 P;  2KS1 A;  3PP5 A;  1VQP P;  1UII A;  3BRV B;  3L71 D;  4I2L C;  4W7Z A;  1ZR4 A;  3H6P A;  5CMZ A;  1PP9 D;  2VRS A;  3JSV C;  2M8R A;  1M1J C;  1S5L E;  2MJZ A;  1N7S B;  1PP9 E;  3CX5 I;  2N1T D;  3H1L G;  4QMA A;  1NAY A;  3SWY A;  1OW7 A;  3AEE C;  1FOS F;  1S9K D;  3M06 A;  2E76 D;  4YTP C;  1OW8 A;  4JF7 A;  5APW A;  1X9V A;  5B66 E;  4GDO A;  1SFC B;  2IBZ E;  1X0T A;  1FJP A;  3HUS A;  1URQ C;  4Y99 C;  1S72 P;  2OYO A;  1ZP0 C;  2R44 A;  2ZXE B;  3BAS A;  3KDP B;  5KLV J;  2IX7 C;  2YO2 A;  1JTH A;  1SLQ A;  2FY8 A;  3BRT B;  3VOP A;  4ZMD A;  1OW6 A;  1Y8A A;  4O9B A;  2W83 C;  4I7Z C;  1GTW A;  1NAF A;  2H8P D;  3OAK A;  2LXC B;  2XU6 A;  2OTJ P;  4IFF A;  3F5H A;  2W90 A;  2ZYG A;  3CXH E;  2NPS A;  1L0L D;  3L75 E;  5B66 H;  3U59 A;  1RF1 C;  1SQB K;  1DEB A;  2Z5I A;  1EQ7 A;  2ZYD A;  5AW9 B;  1AA0 A;  1EZV G;  1DD3 A;  1SQV E;  1T3U A;  2Q5U A;  3H1H D;  5KKZ B;  1SVF A;  4JBZ A;  1JY2 O;  3RK3 D;  2D2C B;  2W27 A;  3L71 G;  4BRY B;  1EDK A;  4NPD A;  1NTK D;  1VQM P;  3H1I G;  2YKP A;  1QVG O;  4R4L A;  2B87 A;  3L73 J;  3WUV A;  3A0B E;  1S4X A;  2H88 C;  1NU1 K;  1ZRT D;  2I8D A;  3M0D C;  3Q3D A;  2L91 A;  1KIL D;  2OYH B;  2IDB A;  2ZXX A;  3L70 G;  1FE6 A;  2LR2 A;  4M3L A;  2ZFC A;  3T97 A;  1PGP A;  1AV1 A;  3BCC J;  5AW2 B;  4YPC A;  2B88 A;  1L0L G;  2CPS A;  1DX7 A;  1PGQ A;  1JY3 N;  1R5S A;  2QJY B;  2A45 G;  2R32 A;  3H1H G;  5AVX B;  2AXT H;  1MFZ A;  1K9M Q;  4BWN A;  2WVR A;  3C8V A;  1ZME C;  3M9H A;  2B87 B;  2P67 A;  5AVW B;  3RK3 E;  3H32 B;  1P84 H;  3A0H H;  3P8C E;  4C7R A;  1X79 B;  2DW3 A;  3AEF C;  1GK4 A;  1OVV A;  1NVO A;  2B9B A;  1FZB A;  2OTK E;  3R4Y A;  3SSU A;  4EYY Q;  1AJY A;  1S5L X;  5AW7 B;  3CCU P;  1FZE A;  3BAT A;  1EXJ A;  3M0A A;  4RJT A;  3E1R A;  5CCH C;  5H2F H;  2BEQ D;  3IAO A;  1JCC A;  5AW0 B;  3MZW B;  3I55 P;  3L75 J;  3WU2 H;  2QJK C;  4KJM A;  2XV5 A;  4BRY A;  2FYU G;  1NU1 E;  1LP1 A;  2JKV A;  4JQ0 D;  1KFN A;  5AVS B;  4OWF A;  1VQ5 P;  3M9Q A;  1S3J A;  3L75 G;  2IFN A;  1IFJ A;  1LTJ A;  1T3J A;  2HYN A;  2QJY C;  3MHV A;  5E79 H;  3B4S A;  5GTH H;  3AED C;  3Q5S A;  4PJ0 H;  3H1J E;  1BGY E;  2JWD A;  2JJL A;  3RBX A;  1P84 I;  1KV4 A;  1LNQ A;  1OX3 A;  3USS A;  1NTZ E;  2R5B A;  4H13 D;  5AW5 B;  3M0D A;  1BCC G;  3QWO C;  1KB9 D;  3ZDM A;  5B5E H;  1L0N D;  4H0L C;  3CCM P;  1ZRT E;  4W80 A;  3Q2Y A;  3TGU D;  2HPC A;  1NU1 D;  1VQ4 P;  1LT9 B;  1SFC D;  2ITA A;  3L71 E;  5M1B A;  3TDK A;  1S1C X;  2E5Y A;  1BE3 J;  2R3S A;  1J2J B;  2Y9Y A;  3II6 A;  4H44 D;  4XA4 A;  5CBN A;  2HPC B;  1LT9 C;  1SQV K;  1Q90 D;  2NPS C;  1BCC E;  4XFJ A;  3SFD C;  3HD7 A;  5AW3 B;  5B5E E;  1NU1 J;  1RF1 A;  2PFX A;  1ZXG A;  3VMX A;  2PAJ A;  1E5W A;  3H1J G;  3NMD A;  2O01 H;  1JY3 O;  2K3R A;  1BE3 D;  2QRX A;  3A2A A;  1NTZ K;  3C9I A;  4IL6 X;  4KT0 J;  4RO0 A;  1BE3 E;  2YNY A;  1YIJ P;  2OGU A;  4WY4 B;  2FKW B;  4RES B;  1L4A C;  4ASW A;  2K37 A;  1Q7Y Q;  2M3B A;  3TGU G;  1W2B O;  1URQ B;  1JTH B;  2G3A A;  2I1J A;  1UIX A;  4UB8 H;  4Y99 B;  4D6T J;  2IPP A;  5CCH A;  2WT7 A;  2M0B A;  2KSJ A;  2KZJ A;  3RK3 C;  3HTK A;  1KB9 H;  1S2E A;  2FYU J;  3CXH I;  2WSC J;  1KQF B;  2IYP A;  3MP7 B;  1LT1 A;  2ZVN B;  3H1I D;  3G6E P;  4C7N A;  1L4A D;  2FYN B;  1PIX A;  1SQV G;  2FBW C;  2KIK A;  4GOF A;  1SQP J;  3V2R A;  2WWW A;  2P2U A;  4H13 B;  4PD4 I;  1NTK E;  2E42 A;  1NO4 A;  3L74 D;  2JEE A;  1SQX G;  2J5U A;  2KUB A;  3H1L D;  3L72 G;  1N73 C;  1A02 F;  3IFM A;  1YJ9 P;  4L75 A;  3LW5 J;  1RH5 B;  3ABV C;  1SQX D;  1URQ A;  3FGA D;  2NPS D;  1JM0 A;  3HUS C;  3KXD A;  3L72 D;  1KIL E;  1L0N E;  3HE4 A;  3KQG A;  2V7Q J;  3TYY A;  1AQ5 A;  1LTB C;  4N78 D;  3H1K J;  3BVH A;  4TT3 H;  1LTI C;  1VF5 D;  3IR9 A;  1QEX A;  2ZT9 D;  5AW4 B;  1L4A A;  3JCU E;  5BU5 A;  3S4R A;  1YBK A;  3HUS B;  5AVU B;  5DJU B;  4UB6 H;  3N7N A;  1VQK P;  1MV8 A;  3RBZ A;  1YQ4 C;  3HD7 B;  2OYI A;  3CPW O;  3K5B A;  3B5N D;  1EDL A;  1N2D C;  1JMM A;  1NTK G;  2GM4 A;  2IYO A;  4B86 A;  2Y0E A;  3Q1M A;  2J59 M;  2WSF J;  3CCE P;  1VF5 C;  3LIE A;  2ZT9 C;  4GIF A;  1LTG C;  4PV1 B;  1FZC C;  3R2P A;  1IO4 A;  1FZC A;  1FZF A;  2JDI H;  2A45 H;  3KYQ A;  1PL5 A;  2K88 A;  4KHX A;  2G8Y A;  2GA1 A;  3JCU H;  5CJ0 A;  1T2K C;  1Q81 Q;  2HG5 D;  1FJK A;  1Y47 A;  1IFD A;  2P10 A;  1SQB J;  4WVZ A;  1BSH A;  3OJA B;  3CXH H;  5KLI C;  1RE3 C;  1EZV E;  1NWQ A;  1YYC A;  2N9B A;  3HTK B;  4L73 A;  1Q86 Q;  2A06 E;  1GK6 A;  1M57 D;  4DJG A;  5CJ4 A;  3MGN A;  1VQ7 P;  2N1T B;  3S1K A;  1SQP D;  1OVR A;  1LGH B;  2WPQ A;  1BCC D;  1KQL A;  2O3J A;  2QJP C;  3L37 A;  1BDD A;  2I1K A;  1KFM A;  4NPE A;  1WRG A;  1NTM D;  3QH9 A;  1K05 A;  1SQX J;  3L72 J;  3CI9 A;  1YQ3 C;  1SFC A;  3L36 A;  2W8Z A;  3RL0 g;  3V4Q A;  5KTB A;  5KLV K;  1EXI A;  3NXS A;  3CC4 P;  3U1A A;  3A7O A;  5BVZ A;  1NYH A;  2Q1K A;  3D71 A;  1H88 A;  2K9J B;  2FFD A;  1CW5 A;  3GG2 A;  1JB0 J;  3BCC D;  2WQY C;  1KYO H;  4EOT A;  2OYI C;  4OGQ D;  1YHQ P;  1SQX K;  1N8R Q;  1JOC A;  1JY3 P;  1OXZ A;  3CCQ P;  2J58 A;  2QA4 P;  1KOR A;  2B89 A;  4HH2 A;  1PPJ E;  2KXP B;  1Q82 Q;  1EDJ A;  3P7K A;  2KB7 P;  1GZL A;  3AE4 C;  4LLH A;  4U3F J;  1GD2 E;  1VQL P;  1NTM G;  4JYC A;  1LWU B;  1PP9 J;  2O1K A;  4OGQ C;  4AQR D;  2WMM A;  2FFD C;  4IFD K;  3H1J J;  3PHL A;  1SS1 A;  3CCV P;  1JO5 A;  5H2F E;  1SQQ K;  1KZU B;  1HTL C;  1LTS C;  2IZ1 A;  3AE6 C;  1H0T A;  3AEG C;  3WUT A;  5AVQ B;  1SQQ G;  4H0L B;  3D6Z A;  1NJI Q;  3M91 A;  4YXD C;  4WB4 A;  3MD0 A;  1KYO I;  3CCL P;  1J1D C;  3O6Q A;  1DD4 A;  2E74 B;  2YO3 A;  4DT0 A;  4C7N B;  3PTZ A;  1KD1 Q;  1FDO A;  2IBZ I;  4PJ0 E;  1AFO A;  1IZN B;  4JYB A;  1VF5 B;  2Q6Q A;  2SPZ A;  2ZT9 B;  2E43 A;  4UB8 E;  1J1D B;  3T97 B;  2Z4E A;  2P1J A;  2IZ0 A;  1KIL A;  5TIS H;  4BXL A;  2W6A A;  4N3Y B;  1IFN A;  2OTL P;  1KB9 E;  1L0N J;  1GDT A;  2WPV B;  5AW1 B;  3FXD A;  1VQN P;  2KOG A;  3CWB G;  2OAR A;  1RHZ B;  5AVV B;  1WMK A;  5AVR B;  1OFC X;  3RL0 C;  5GTI E;  4LC1 A;  4HJG H;  1L0N G;  1PZQ A;  4WWI A;  4Y28 J;  2M5A B;  1FZA A;  1L4A B;  1NTK J;  1SQB E;  3RK2 C;  3TSI A;  3V2N A;  3O8Z A;  1SQP E;  3VYI A;  1AVY A;  1NU1 G;  3WMM 0;  2N1T C;  2QG4 A;  2XNX A;  3G4S P;  1K73 Q;  3CCS P;  2KLU A;  1OVU A;  2C9L Y;  1J1E B;  2A06 D;  3Q5R A;  3GLM A;  1NHL A;  4PD4 D;  3OA7 A;  4DCK A;  3CMA P;  1HH0 A;  5AW8 B;  1FZG A;  4I6M C;  2BEZ F;  1KIL B;  2LXB A;  4U3F D;  3H1K G;  2C9N Y;  2YXQ B;  2OQQ A;  2D2C C;  1GW3 A;  1RQV A;  2FYN C;  1XTC C;  5EFW B;  3SWF A;  2KK7 A;  3G71 P;  1JUN A;  1QL2 A;  2QSI A;  3VP9 A;  1L2P A;  2FYU K;  1KTM A;  1KIL C;  3HE5 B;  1RQU A;  1GL2 A;  4D6T D;  1VQ8 P;  3P32 A;  1EDI A;  5CCG A;  1X22 A;  1Z56 A;  1HBW A;  1U57 A;  1PV3 A;  4JPZ B;  2OYH C;  2E74 D;  2ZYA A;  3B5N B;  5KAF H;  1EZV I;  2M5A A;  2WSC H;  1SQP K;  3AE5 C;  3JC2 2;  1FC2 C;  1G2C A;  3EWK A;  2KLV A;  3MUD A;  3L4F A;  2A06 G;  4R4M A;  1S5L H;  2Q9I A;  2YMY A;  1GU5 A;  1DEE G;  2N1T A;  3SWK A;  2P58 A;  3D70 A;  1JY2 P;  3CX5 D;  5C39 A;  3E1I A;  1PPJ D;  2E5T A;  1GL2 D;  3VN0 A;  1QVF O;  1RF0 C;  5CCG D;  5KAF E;  1HGV A;  2JR8 A;  4PD4 H;  5APX A;  2KZI A;  2FYU E;  2KNC A;  2NZ2 A;  2QJP B;  3L35 A;  3P8C D;  1FDM A;  3G9R A;  2K1A A;  1VQO P;  2H89 C;  3LID A;  4D6T E;  1BGY J;  4UB6 E;  1H89 A;  3B5N C;  2XND H;  1GL2 C;  2HFE D;  2QVA A;  1M7L A;  1RE3 A;  4TLF A;  2XZR A;  1AQT A;  2HOD A;  3G3Z A;  2C0W A;  1SQP G;  3H1H J;  2WT7 B;  3CLQ A;  1GU4 A;  1VQ6 P;  1KN7 A;  3CX5 E;  1P84 E;  1K04 A;  1YTZ I;  2KS1 B;  1MKM A;  3A0H E;  3AE1 C;  3S9O A;  1ZR2 A;  1P84 D;  3I5C A;  3MUD C;  4IL6 E;  2ZVO B;  3GW6 A;  2JWA A;  1SP4 A;  1Y9B A;  1PPJ G;  3B8E B;  3L70 E;  3NTN A;  2PRR A;  1SQB G;  2E75 B;  2KNC B;  3V4W A;  1N7S C;  5KJ7 C;  3H25 A; 
#chains in the Genus database with same CATH homology
 2L5G B;  1X8Y A;  1CI6 B;  2O1J A;  1CSB A;  2NPS B;  1SFC C;  4GKG A;  5APQ A;  1G1I A;  2FXM A;  3KPE A;  1A02 J;  2XKM A;  3VP8 A;  2H7H A;  1IFI A;  2YKQ A;  2KP8 A;  1DH3 A;  2YKO A;  1N86 A;  4WBA A;  5BU8 B;  5APU A;  3TK1 A;  2R5D A;  4OH8 B;  1FBM A;  1NKN A;  2WZ7 A;  5AVZ B;  1VDF A;  4WY4 A;  1FU1 A;  2IFM A;  1S9K E;  1OWA A;  1MZ9 A;  1N73 B;  3N4X A;  3RK2 B;  2P7J A;  1LTT C;  2QM7 A;  5KJ7 A;  1VPC A;  4N6J A;  3HD7 C;  3MTU E;  2H43 A;  1YTZ T;  1RY3 A;  1GL2 B;  2W6B A;  2Q3I A;  1ZV8 A;  3HRN A;  1LTA C;  4N78 E;  2CPB A;  2A45 I;  1HVV A;  5CCG C;  3EFG A;  1J1E C;  2OYI B;  1FOS E;  3UIA A;  2HLO A;  3VMY A;  1RF0 A;  1T2K D;  2GUV A;  4LGD E;  1M1J B;  5AW6 B;  5APT A;  3H32 A;  1IC2 A;  1JNM A;  3TNU A;  2XDJ A;  5CHX A;  2BAS A;  2GUS A;  1IK9 A;  2POH A;  4W7Y A;  5KJ7 D;  4C46 A;  1N7S D;  2KYV A;  1G2C B;  3V2Q A;  3B5N A;  1ZLL A;  4AQR D;  3RL0 D;  1L0N K;  2C0X A;  2WIT A;  1LTJ B;  3EQ2 A;  1HGZ A;  1RF1 B;  1CI6 A;  1W2E A;  1NH4 A;  1LTJ C;  2FFD B;  4WY4 C;  1RE4 C;  3V2P A;  2OYH A;  1IFM A;  2HOD B;  3RK3 B;  1JCD A;  2Z5H A;  2WTY A;  1HUC A;  1LWU C;  2WPS A;  5AVY B;  1M1J A;  3A3Y B;  4HYT B;  4XE5 B;  2WSE H;  1HJB A;  1NOH A;  3VTP C;  3LW5 H;  5CCH D;  3NFQ A;  1N73 A;  3HE5 A;  1G1J A;  2R3C A;  1XTG B;  4AYC A;  2WSF H;  3A5T A;  4IFM A;  1FZC B;  1QL1 A;  3RL0 B;  1MUU A;  3GHG A;  3HD7 D;  4WY4 D;  5APY A;  3M9B A;  1LT9 A;  1IJD B;  1NKZ B;  1NTM K;  1NTK K;  3P8M C;  2LKM A;  4ZKU A;  1LWU A;  1N7L A;  3RK2 D;  4EIJ A;  1N7S A;  4DZO A;  1GW4 A;  2QM8 A;  1L0L K;  1WT6 A;  2WPR A;  5APS A;  4ZKP A;  4GT1 A;  3GHG B;  2FYZ A;  3V5B A;  1ZN5 A;  3VMZ A;  4I1L A;  2PP6 A;  5AVT B;  1URQ D;  3TNU B;  1PFI A;  4DOJ A;  5APV A;  1H8A A;  1CZQ A;  1FAV A;  1JO5 A;  1H89 A;  2Q7C A;  3U1C A;  1RE4 A;  1HWT C;  3MIW A;  3CL3 D;  1T8Z A;  3GHG C;  1JY2 N;  3HE4 B;  3PP5 A;  3BRV B;  4W7Z A;  4I2L C;  1ZR4 A;  3H6P A;  5CMZ A;  2VRS A;  2M8R A;  1M1J C;  2MJZ A;  1N7S B;  3SWY A;  2N1T D;  1S9K D;  3M06 A;  4JF7 A;  5APW A;  1X9V A;  1SFC B;  1FJP A;  3HUS A;  1URQ C;  4Y99 C;  2ZXE B;  3BAS A;  3KDP B;  2IX7 C;  2YO2 A;  1JTH A;  1SLQ A;  3BRT B;  3VOP A;  4O9B A;  1GTW A;  1NAF A;  2H8P D;  3OAK A;  2XU6 A;  4IFF A;  2NPS A;  1RF1 C;  3U59 A;  1SQB K;  1DEB A;  2Z5I A;  1EQ7 A;  5AW9 B;  2Q5U A;  1T3U A;  1SVF A;  3RK3 D;  1JY2 O;  2W27 A;  2YKP A;  1NU1 K;  3M0D C;  1KIL D;  2OYH B;  4M3L A;  2ZFC A;  3T97 A;  5AW2 B;  2CPS A;  1DX7 A;  1JY3 N;  2R32 A;  5AVX B;  2A45 G;  1MFZ A;  3M9H A;  2P67 A;  5AVW B;  4C7R A;  3H32 B;  3P8C E;  1X79 B;  1GK4 A;  1FZB A;  5AW7 B;  1FZE A;  3BAT A;  3M0A A;  5CCH C;  5AW0 B;  1JCC A;  2XV5 A;  1KFN A;  5AVS B;  3M9Q A;  2IFN A;  1IFJ A;  1LTJ A;  1T3J A;  2HYN A;  2JJL A;  2R5B A;  5AW5 B;  3M0D A;  4W80 A;  2HPC A;  1LT9 B;  1SFC D;  3II6 A;  1J2J B;  4XA4 A;  2HPC B;  1LT9 C;  1SQV K;  2NPS C;  1RF1 A;  3HD7 A;  5AW3 B;  3VMX A;  2PAJ A;  1E5W A;  3NMD A;  2O01 H;  1JY3 O;  3A2A A;  1NTZ K;  3C9I A;  2YNY A;  4WY4 B;  2FKW B;  4RES B;  1L4A C;  2M3B A;  1URQ B;  1JTH B;  2I1J A;  4Y99 B;  5CCH A;  2IPP A;  2WT7 A;  2KSJ A;  3RK3 C;  3HTK A;  4C7N A;  1L4A D;  3V2R A;  2E42 A;  2WWW A;  2P2U A;  1NO4 A;  2JEE A;  1A02 F;  1N73 C;  3IFM A;  1FOS F;  1URQ A;  2NPS D;  3HUS C;  3HE4 A;  3KQG A;  3TYY A;  1AQ5 A;  1LTB C;  4N78 D;  3BVH A;  1LTI C;  3IR9 A;  5AW4 B;  1L4A A;  5BU5 A;  3HUS B;  5AVU B;  3N7N A;  1MV8 A;  3HD7 B;  2OYI A;  3B5N D;  1N2D C;  1JMM A;  2GM4 A;  4B86 A;  2J59 M;  3LIE A;  4GIF A;  1LTG C;  1IO4 A;  1FZC C;  3R2P A;  1FZC A;  1FZF A;  2A45 H;  3KYQ A;  4KHX A;  1T2K C;  5CJ0 A;  2HG5 D;  1FJK A;  1IFD A;  3OJA B;  1RE3 C;  1NWQ A;  1YYC A;  2N9B A;  3HTK B;  1GK6 A;  5CJ4 A;  3MGN A;  2N1T B;  1LGH B;  2WPQ A;  1KQL A;  3L37 A;  2I1K A;  1KFM A;  1WRG A;  3CI9 A;  1SFC A;  3L36 A;  3V4Q A;  5KTB A;  5KLV K;  4AUW A;  3NXS A;  3U1A A;  3A7O A;  5BVZ A;  1H88 A;  2FFD A;  1CW5 A;  4EOT A;  1SQX K;  1JOC A;  1JY3 P;  1OXZ A;  2J58 A;  4HH2 A;  3P7K A;  2KB7 P;  1GZL A;  4LLH A;  1GD2 E;  4JYC A;  1LWU B;  2O1K A;  2FFD C;  4IFD K;  1KZU B;  1LTS C;  1HTL C;  1SQQ K;  5AVQ B;  3M91 A;  4WB4 A;  3MD0 A;  1J1D C;  2YO3 A;  4C7N B;  4JYB A;  2E43 A;  2Z4E A;  1J1D B;  2P1J A;  1KIL A;  2W6A A;  4N3Y B;  1IFN A;  1GDT A;  5AW1 B;  2KOG A;  2OAR A;  5AVV B;  5AVR B;  3RL0 C;  4LC1 A;  1FZA A;  1L4A B;  3RK2 C;  3TSI A;  3V2N A;  3VYI A;  3O8Z A;  3WMM 0;  1AFO A;  2N1T C;  2C9L Y;  2XNX A;  1J1E B;  2OYI C;  1NHL A;  3OA7 A;  1HH0 A;  5AW8 B;  1FZG A;  4I6M C;  1KIL B;  2C9N Y;  1GW3 A;  1XTC C;  3SWF A;  1JUN A;  1QL2 A;  3VP9 A;  2FYU K;  1KIL C;  3HE5 B;  1GL2 A;  3P32 A;  5CCG A;  1Z56 A;  1HBW A;  2OYH C;  3B5N B;  2WSC H;  1SQP K;  1G2C A;  2KLV A;  3MUD A;  3L4F A;  2Q9I A;  2YMY A;  1GU5 A;  2N1T A;  1JY2 P;  3E1I A;  1GL2 D;  3VN0 A;  1RF0 C;  5CCG D;  1HGV A;  5APX A;  3L35 A;  3P8C D;  1FDM A;  3LID A;  3B5N C;  1GL2 C;  2HFE D;  1M7L A;  1RE3 A;  2WT7 B;  2XZR A;  2HOD A;  3G3Z A;  1GU4 A;  2C0W A;  3CLQ A;  1YTZ I;  1ZR2 A;  3I5C A;  1SP4 A;  3NTN A;  3B8E B;  3V4W A;  5KJ7 C;  1N7S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...