2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
b'LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
molecule tags Hydrolase
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
2WT7B 4JYCA 3T97A 1GD2E 3LIDA 1T2KC 3TNUA 3VTPC 3VN0A 3HTKA 1CZQA 2ZFCA 1SLQA 1FAVA 5AVRB 2WWWA 4RESB 3M91A 1HJBA 2R32A 5AW5B 3P8MC 5AVSB 3HE5A 2R5DA 1CSBA 2E42A 3A2AA 2R5BA 4GKGA 5AW6B 3A7OA 3M9HA 4JYBA 3TNUB 3HE5B 3NFQA 1T2KD 2W6AA 3VMYA 5APYA 3TK1A 2YNYA 2P7JA 3M9BA 1FOSE 1KQLA 1S9KD 2R3CA 2WPSA 2KP8A 4GT1A 5APQA 1JNMA 3NMDA 2P67A 3A5TA 5CMZA 1HUCA 3SWFA 5AW4B 1GU5A 2XU6A 3P32A 3V4QA 4AQRD 2E43A 2ZXEB 3MGNA 5APSA 3P7KA 1J2JB 1MV8A 3VMXA 4C7NB 1NWQA 2WPRA 3UIAA 5AW8B 3IR9A 1A02J 2YO3A 2H7HA 1G2CB 2QM7A 3LIEA 4EOTA 3TYYA 5AW7B 1H8AA 4M3LA 5APXA 5AVUB 5AW1B 4AUWA 1SP4A 1IO4A 2P2UA 3OAKA 2Q3IA 2XV5A 3M06A 4I6MC 1MUUA 4B86A 4AYCA 1HWTC 5AVZB 4C7NA 1MFZA 2QM8A 3HE4B 1DH3A 5APTA 1GZLA 5AVVB 2Q7CA 2IPPA 2WTYA 5AW0B 2N9BA 2WPQA 3HE4A 4C46A 2VRSA 4I2LC 4LC1A 3I5CA 3KDPB 5AVYB 1GK6A 2C9NY 3MD0A 3A3YB 3VYIA 3B8EB 2JJLA 2Z5HA 1GTWA 3V4WA 5AVQB 2XZRA 5AW9B 3NXSA 5AVXB 1GK4A 5AW3B 1CI6A 1H89A 5APWA 3VMZA 1GU4A 1H88A 1A02F 3V5BA 3NTNA 3L36A 2YO2A 3O8ZA 5APVA 1FOSF 2WT7A 1S9KE 3KQGA 1X8YA 1JUNA 1YYCA 5AVTB 3L37A 2Z5IA 3M0AA 4HYTB 4DZOA 1HBWA 5AVWB 4KHXA 1NAFA 1OXZA 4XE5B 5APUA 2C9LY 1CI6B 3M0DA 2BASA 5AW2B 1OWAA 3L35A 2W27A 2Q5UA
chains in the Genus database with same CATH superfamily
3QWOC 4KT0J 1KYOI 4WB4A 1FZGA 1KQGB 2N1TB 2JWAA 2QVAA 3E7KA 1AFOA 1URQD 4U3FG 1QLED 1G1IA 1BSNA 3TNUA 2GUSA 3VTPC 1NTKD 2K9JB 1YJWP 3VN0A 3L70D 1EDLA 1M1KQ 1CZQA 1OVUA 2W6BA 1JB0J 3H32A 3CCRP 1NTME 2OYIB 1KV4A 2LR2A 3AE1C 3L75J 3H1HJ 4WBAA 4GIFA 1FZCA 1VQ4P 2YXRB 4JBZA 3M0DC 3M91A 1KTMA 3C9IA 4EYYQ 5CBNA 1EZVG 4HH2A 5KAFE 3H1LG 4PD4D 2XDJA 3M9QA 1EDKA 2R5BA 3IF4A 2KSEA 3M9HA 4RKUJ 1SQPG 1SQXJ 1L4AD 3GLMA 4N6JA 3H1HD 1NTZE 1VQ7P 1VQLP 3NFQA 1SFCC 1ZN5A 2W6AA 5GTHH 1ZLLA 1VQPP 3FX0A 2FFDC 1IFNA 1UIIA 1FJPA 1EZVD 3L75E 3L74J 2YNYA 3H1LD 2KZIA 4U7JA 2FYZA 2I1KA 1IJDB 1RF0C 4GOEA 4IFMA 5CCHD 3I55P 1QVGO 4H0LB 3BVHA 2WPSA 3L75G 3PJSK 3L73D 4HKZH 1KILB 1AQ5A 1SQXE 2XU6A 4AQRD 1HF9A 4U3FD 4TT3H 2MKVA 3P7KA 1L4AC 1BE3J 4GODA 2QE7H 5AW0B 3CCVP 1L0LE 1MKMA 2YKOA 4C7NB 3V2PA 1OFCX 5AW8B 1IZNB 1LWUB 2H89C 2YO3A 3IR9A 4TLFA 2H7HA 2E75B 5KAFH 3ITKA 3CWBJ 1KN7A 1RE4C 2O1KA 4AUWA 4L75A 1RE3C 3USSA 2OGUA 1RH5B 1U7JA 3L71J 1JMMA 3OAKA 1Q82Q 3B5NC 1BE3G 2XV5A 1SQPD 5L8RJ 2W8ZA 1S4XA 3BCCE 1IFJA 3L71D 3M06A 4I6MC 4K3AA 4N3YB 5C39A 1L4AA 4B86A 1URQB 3RK3E 1L4AB 2BCCE 1WMKA 2N1TD 2Y0CA 2V7QH 4UB6H 3LW5H 1L0LJ 2B88A 2FBWC 4H44D 2W6JH 3A0HH 2QIWA 3HE4B 1DH3A 5APTA 1PIXA 1FZFA 3H1IG 3AEDC 1FDOA 5AVVB 2Q7CA 3CX5E 5KKZC 3CCLP 3CXHH 4EIJA 1OZHA 1LTSC 1VF5C 2FYUG 3H1ID 3S4RA 1NTZG 3BRVB 4C46A 1BSHA 1PV3A 1SFCD 3P8CD 1VPCA 3I5CA 4I2LC 1S72P 1GK6A 2E75D 2K9JA 3AECC 4LLHA 3RL0D 5BU8B 3S1KA 2V7QJ 1JCDA 2WSCH 2BCCJ 2OQQA 4XA4A 2Z5HA 1QEXA 4PV1B 3WUVA 1RQUA 2I1JA 3V4WA 3N7NA 3ABVC 5AVQB 1GTWA 2RN0A 2XZRA 2OYHB 1PGOA 3L72E 1ZR4A 5GTIH 5AW3B 1AJYA 1H89A 2KOGA 5B66H 1GU4A 1SQPK 1YQ3C 2A06G 3TGUG 3TF5A 1GL2C 2HPCB 1SQQK 2AEJA 2AXCA 3PLNA 2JDIH 4H13C 4EDFA 2HPCA 1GW3A 2KIKA 1VF5D 2WSFJ 1Z56A 2JR8A 2KS1A 3O8ZA 3W67A 3JCUE 4DOJA 2WT7A 1S9KE 1KILD 4UB6E 5KAIH 5KLIC 4NPFX 1OX3A 2Z5IA 2HODA 1NU1E 3AEEC 5KLVJ 4DZOA 1S2EA 3CXHI 5DJUB 4L76A 1SQBK 3CX5H 1OXZA 2OARA 3L72J 4OVNF 3CCQP 3CXHE 4I7ZB 1QVFO 1OIPA 1KB9I 1LNQA 2KXPB 1ZV8A 1L0NG 1GL2A 1EXIA 1KD1Q 2BASA 2WSFH 5AW2B 1L0LG 1OWAA 1TU3F 2WITA 1K05A 1NTZD 2XNXA 3CMEP 1ZMEC 2Q5UA 2B87B 5TISH 4IL6E 1FZCB 4I1LA 3H1KE 4PD4H 1NTMK 3Q5RA 2O01N 5M1BA 3LIDA 3RK2C 3T97A 1EXJA 1MZ9A 1OVVA 1LT9A 3AE9C 4HJGH 3CL3D 2KYVA 3H1JD 1Q86Q 1IK7A 1NU1D 2H43A 2KZJA 3HUSC 2FFDA 2D2CD 1X0TA 2WQYC 2K9YA 3H1JE 5H2FE 4YPCA 1SLQA 1FC2C 2LXCB 2XNDH 4BWNA 1ZR2A 4W80A 2L91A 3AE4C 1KYOD 2BEZF 2FXPA 1NYHA 1LTIC 3JCUH 3V6IA 2MJZA 2R5DA 1H0TA 2A45I 1NGMB 1UIXA 2KNCB 2ZYAA 2RH0A 3H1HE 3H1KJ 4GKGA 1URQA 3A7OA 2O1JA 2YKQA 3B71A 1IC2A 2K3RA 3V2NA 1LT9C 3O6QB 4RJTA 1T8ZA 4WWIA 5BVZA 2ZJSE 3JSVC 1S5LE 2P58A 2QJPC 3VMYA 1NKZB 2A06E 2E74C 3AE3C 5APYA 5KJ7A 1J1DB 5KTBA 3TGUE 1NTZK 1Q2NA 1OMIA 1KILA 4H13D 4IFFA 3TK1A 2NPSB 3GHGA 1FOSE 1GMJA 4PD4I 1NTMD 3CD6P 1LTJC 4IL6H 1LTAC 1S9KD 1JY3P 3EQ2A 2ZYGA 2KP8A 4UB8H 3FWNA 1N73C 3NMDA 2P67A 2KI7B 3L74E 1BGYD 3RBXA 1RY3A 3A0BE 3B5NA 3GF7A 3AEGC 1ZRTE 3BASA 1VF5B 1BDDA 3VP8A 2M5AB 4IOIH 1MV8A 2SPZA 2LXBA 3L72D 5KJ7C 1VL2A 1ZW0A 3BATA 4PV1D 5KKZB 1RF1B 1AQTA 4YTPC 3SWKA 1M90Q 3UIAA 1JY2N 1JY2O 4XFJA 3H1KG 3PTZA 1G2CB 1BE3E 3TYYA 5AW7B 4M3LA 5APXA 1FZEA 2WSEH 1W5CE 5CCGC 1KC8Q 3SSUA 3WU2H 2CK3H 1NHLA 2Q3EA 2PFXA 2R3SA 3MZWB 1YJ9P 3CWBE 3RL0B 2P10A 3O6QA 2KUBA 4W7ZA 5CJ0A 1KQFB 4EI2A 4H44B 2IYPA 3Q2YA 5AVZB 1SQXK 1N7SC 3K5BA 4WY4B 3L70G 1MFZA 3L73G 2IZ0A 3ZDMA 2E76B 1KORA 5KJ7D 5TJHA 4A7PA 2R44A 2RKLA 1M1JB 2IPPA 2WTYA 4UB8E 1SQPE 3KZIH 3L73E 1P84I 3H32B 2BEQD 4I7ZC 2AXTE 3AE5C 2M3EA 2K37A 1IFPA 1KB9D 1NJIQ 1CW5A 3CC7P 1AV1A 3BRTB 5KLIB 2FXMA 1K73Q 1BE3D 2JP3A 2ZT9C 2E76C 3WUTA 3MIWA 2Z4EA 3V2RA 1FZCC 4H44C 3II6A 1CI6A 2Q9IA 1SQPJ 3HTKB 3L73J 2HFED 1WT6A 1H88A 1A02F 1R8EA 2JEEA 1M8OB 3L72G 3GG2A 3NTNA 3CCMP 1M7LA 1S5LX 3D70A 3OJAB 1JOCA 4D6TD 2CPBA 3G4SP 2OYHC 3CPWO 4PV1C 1QL2A 2QJKC 3B4SA 2OTLP 1JUNA 3HD7B 5AVTB 2FYNC 4GDOA 3L37A 2J58A 3AEBC 1VQKP 1NAFA 2YMKA 2IX7C 1EQ7A 1HGZA 1T3JA 2IYOA 3AEAC 3KZIE 2P1JA 4XE5B 3LW5J 3TSIA 4H13B 1YJNP 1RF0A 2AXTH 1RHZB 1SVFA 1NU1J 2JWDA 1SQBE 1PP9E 1SQVD 2OYOA 1XTGB 3G3ZA 4QMAA 1W2BO 2Q6QA 5B66E 1PP9D 1YITP 2K88A 2BCCG 1DD4A 1N7SD 1BCCD 3AE8C 5DJTB 3U59A 4RO0A 1WRGA 1YIJP 1NO4A 4OGQC 1NVOA 1VQ8P 2NPSC 1R5LA 1ZP0C 3KXDA 1X9VA 4JQ0D 3HTKA 2O01H 5KAIE 4H0LC 1J1DC 1SS1A 2ZFCA 3BCCG 2CPSA 1NTKE 3PHLA 1FAVA 2O3JA 3TDKA 3GHGC 1YHQP 1HJBA 2YXQB 3CCJP 1KFNA 1FDIA 1EZVI 1PP9J 2YIUC 4WVZA 2R32A 5AW5B 5KLVD 1K9MQ 1T6AA 2B9BA 1NTMG 2IBZG 3L4FA 3H1JJ 1CSBA 1PPJG 3P8MC 5AVSB 4WY4A 3Q5PA 1N73A 3A2AA 5AW6B 1SQVE 1SQBD 4HB1A 4NPDA 2FYUE 3TNUB 5TISE 2QJYC 3HE5B 2O01J 1LP1A 3PH0A 3RK2D 1PPJE 2ZVOB 2ZYDA 3FXEA 2E74D 3F89A 1VQOP 3RGUA 1M1JA 3Q5SA 3R4YA 1FS0E 1NH4A 3WUUA 1NTKJ 1DIPA 2OYIA 2ITAA 4H0LD 2JKVA 2D2CC 2P7JA 3SFDC 1KQLA 4ASVA 1KFMA 5E79E 2DW3A 1VQ6P 2LKMA 2R3CA 3TGUJ 4ZMDA 2J5UA 2QRXA 4GT1A 2V4HA 5APQA 3VP9A 1VQ5P 4R4MA 3A5TA 4IFDK 1HUCA 1NU1K 1SQVJ 2QJKB 2IZ1A 1KQSO 2FYUJ 3P32A 1HJ0A 4Y99B 2ZXEB 3H1IJ 1J2JB 1M1JC 1M57D 1G2CA 1L0NE 3SWYA 3VMXA 1L2PA 1PP9G 5KLVK 3HUSA 2WPRA 1NWQA 1YBKA 3PRJA 1S5LH 3RBZA 4OH8B 1JEKA 3LIEA 1L0LK 2N1TA 4DCKA 1KB9E 2XKMA 1JMBA 5AW1B 1L0NK 3AE6C 3FWLA 5CJ4A 1H8AA 2IBZD 2AEMA 2C0XA 2FYUK 5BU5A 5B5EH 1USDA 1N2DC 2ZAEB 1GL2B 1SQBG 2A45G 1LGHB 4OGQB 1NTKG 2PGDA 1SFCB 3H1IE 4PJ0E 1SFCA 3A0BH 4WY4D 3W68A 4C7NA 3MUDA 4DT0A 1HGVA 3RL0g 2Y9YA 4Y99C 2QM8A 3D6ZA 1DEEG 4D6TG 2M5AA 1LTTC 4OGQD 1GZLA 1KILC 1SQQE 2QEXP 2KB7P 3H1HG 1BGYE 2I8DA 2YIUB 2N9BA 2HLOA 2K1AA 3H1JG 1Q81Q 3C8VA 4C7RA 2VRSA 4LC1A 1SQQG 3KDPB 2D2CB 3RL0C 5CBOA 2C9NY 3MD0A 4ZKPA 3CMAP 2E75C 1EDJA 3H6PA 4N78E 2GUVA 1LWUC 1ZOYC 2IBZE 3A3YB 4MN4C 3WU2E 3HD7D 3CCSP 2HODB 1JTHB 1Y8AA 3IN6A 1OW7A 2ZT9D 1KYOH 1VDFA 3RK3B 3D6YA 3EFGA 1KMIZ 4W7YA 3CX5D 3NXSA 5AW9B 5AVXB 1GK4A 1NTKK 2RMZA 5APWA 3VMZA 1FBMA 1SQXG 2N9YB 1PFIA 3OW2O 2WZ7A 3L36A 1N8RQ 2YO2A 3GHGB 1SQXD 2HR3A 2HG5D 2M8RA 2NRGA 3BCCD 3GMAA 4PJ0H 2AEFA 2WSEJ 3T97B 4GOFA 4ZNCA 1X8YA 2YKPA 4Y28J 3L71G 1YYCA 4L73A 2A45H 2FYNB 1YTZT 3M0AA 1NOHA 5KLVG 3U1AA 1HBWA 2FFDB 1HTLC 1PGJA 2A06D 3TGUD 1FE6A 2G3AA 2Y0DA 1PGPA 2Y9ZA 2G8YA 5K5GB 2QJYB 3FXDA 1EC5A 1AVOA 3H1LJ 2C9LY 1LTJA 1NU1G 2C0WA 2WSSH 3AEFC 3H1KD 3L70J 2QJPB 1OVRA 1YTZI 1GW4A 2IDBA 3AE2C 1QX8A 2WT7B 2JO1A 4JYCA 1BCCJ 4WY4C 2KS1B 3SFEC 1GD2E 1J1EC 1KYOE 1NTMJ 1SQBJ 3CXHD 3VMAA 1T2KC 3Q1MA 1HH0A 1GL2D 2B89A 1YQ4C 1N73B 2GM4A 1E79H 1JCCA 1Y9BA 5CHXA 1MFTA 1KILE 3CLQA 3H1LE 2FXOA 1NKNA 5AVRB 1PGQA 2WWWA 3HD7A 3IFMA 3L75D 4RESB 1YI2P 1EDIA 3L70E 3PP5A 2IFNA 1K8AQ 1NTZJ 2PAJA 1ZXGA 5CCGA 3HE5A 1PZQA 2W90A 1N7LA 4NPEA 5CCHA 2E42A 1BCCE 4BRYA 1OW8A 1LT9B 4JYBA 3U1CA 4BXLA 3S9OA 1X22A 3MP7B 3C1LA 1BCCG 1JY2P 2IBZI 2POHA 1T2KD 1S3JA 1SQVK 2IFMA 3CCEP 3I56P 1IFIA 2Q1KA 3B5ND 1E5WA 3G6EP 3HD7C 3G71P 1DEBA 2J59M 3M9BA 2WMMA 1LTJB 1VQ9P 1K04A 1XTCC 2E5TA 2N1TC 3E1RA 5CCHC 1D7MA 2NPSD 2KNCA 2KSJA 1LTGC 2YMYA 3HUSB 2GA1A 3EFFK 3Q3DA 4JPZB 1JNMA 5CMZA 3SWFA 5AW4B 1GU5A 2E43A 2WSCJ 3V4QA 1JY3O 3MGNA 3RK2B 1JY3N 1KZUB 3F5HA 5APSA 4D6TJ 3A0HE 1IK9A 4DJGA 1FDMA 2ZT9B 3RK3D 3H25A 2QA4P 1T3UA 3KPEA 3L71E 1IFMA 4OWFA 1FJKA 2W83C 1A02J 2M3BA 3MTUE 4LGDE 3R2PA 2QM7A 4N78D 3WMM0 4EOTA 3BCCJ 1L0NJ 5AVUB 2PRRA 2WPVB 1SP4A 2M0BA 3G9RA 2B87A 3P8CE 3V2QA 5E79H 4ASWA 2P2UA 5CCGD 3B5NB 2OYHA 1IO4A 4O9BA 2QSIA 2Q3IA 2E74B 1U7MA 2NZ2A 4K35A 1MUUA 1PL5A 1SQQD 2FKWB 1LWUA 1Q90D 1RQVA 3KYQA 4JF7A 4AYCA 4D6TE 1HWTC 2QG4A 2HYNA 5GTIE 1N7SB 3MHVA 1R5SA 3GW6A 1Y47A 1RF1A 1H0TB 1BDCA 2BCCD 4U3FE 3IAOA 1VQNP 2OTJP 1P84E 1RE4A 1G1JA 2H8PD 1N86A 1SQVG 1HVVA 1RE3A 4R4LA 1JTHA 2WPQA 3CX5I 3FGAD 3HE4A 3N4XA 4CPGA 1Q7YQ 2WVRA 1LT1A 1W2EA 1S1CX 1KB9H 2PP6A 2UWJE 5AVYB 3CC4P 1BGYG 1LJ2A 1SQQJ 2KK7A 1JO5A 1BGYJ 4Z1MH 2H88C 1EZVE 1QL1A 2Y0EA 5B5EE 2NPSA 3AE7C 1M56D 1QGKB 3VYIA 3B8EB 1FU1A 1U57A 2JJLA 1L0LD 1OW6A 3HRNA 5EFWB 1J1EB 3CCUP 1RF1C 1PPJD 1L0ND 4U3FJ 2KLVA 2ZXXA 1P84D 2FYUD 1LP1B 3KHUA 4IL6X 2OTKE 1IFDA 4PD4E 4BRYB 3V5BA 3JC22 1ZRTD 1DD3A 1FZBA 5KLVE 1URQC 5APVA 4YXDC 3RK3C 3CWBD 3L74D 1VQMP 1JM0A 3KQGA 1AVYA 1FOSF 3CC2P 2E5YA 4ZKUA 2ZVNB 1GDTA 1LTBC 5H2FH 3L74G 1DX7A 2FY8A 4HYTB 5AVWB 1N7SA 1AA0A 1P84H 3E1IA 1NAYA 3MUDC 3OA7A 4KHXA 1USEA 2OYIC 5APUA 3CI9A 5GTHE 3D71A 4YXWH 4L74A 1X79B 4KJMA 2KLUA 1CI6B 1FZAA 3VOPA 3M0DA 3CWBG 2L5GB 3GF3A 3L35A 2W27A 3QH9A 3EWKA 2E76D
chains in the Genus database with same CATH topology
4WB4A 1FZGA 2N1TB 1AFOA 1URQD 1G1IA 3TNUA 3VTPC 2GUSA 3VN0A 1CZQA 2W6BA 3H32A 2OYIB 4WBAA 1FZCA 4GIFA 3M0DC 3M91A 3C9IA 4HH2A 2XDJA 3M9QA 2R5BA 3M9HA 1L4AD 4N6JA 3NFQA 1SFCC 1ZN5A 2W6AA 2FFDC 1ZLLA 1IFNA 1FJPA 2YNYA 2FYZA 2I1KA 1IJDB 1RF0C 4IFMA 5CCHD 3BVHA 2WPSA 1KILB 1AQ5A 2XU6A 4AQRD 3P7KA 1L4AC 4C7NB 2YKOA 3V2PA 5AW8B 1LWUB 3IR9A 2YO3A 2H7HA 1RE4C 2O1KA 4AUWA 1RE3C 1JMMA 3OAKA 3B5NC 2XV5A 3M06A 4I6MC 1IFJA 4N3YB 4B86A 1L4AA 1URQB 1L4AB 2N1TD 3LW5H 3HE4B 1DH3A 5APTA 1FZFA 5AVVB 2Q7CA 4EIJA 1LTSC 4C46A 3BRVB 1SFCD 3P8CD 1VPCA 3I5CA 4I2LC 1GK6A 3RL0D 4LLHA 5BU8B 1JCDA 2WSCH 4XA4A 2Z5HA 2I1JA 1GTWA 3V4WA 3N7NA 5AVQB 2OYHB 2XZRA 1ZR4A 5AW3B 1H89A 2KOGA 1GU4A 1SQPK 2HPCB 1GL2C 1SQQK 2HPCA 1GW3A 1Z56A 3O8ZA 4DOJA 2WT7A 1S9KE 1KILD 2Z5IA 2HODA 4DZOA 1SQBK 1OXZA 2OARA 1ZV8A 1GL2A 2BASA 2WSFH 5AW2B 1OWAA 2WITA 2XNXA 2Q5UA 1FZCB 4I1LA 1NTMK 3T97A 3LIDA 3RK2C 1MZ9A 1LT9A 3CL3D 2KYVA 3HUSC 2FFDA 1ZR2A 1SLQA 4W80A 1LTIC 2MJZA 2R5DA 2A45I 4GKGA 1URQA 3A7OA 2O1JA 2YKQA 3V2NA 1IC2A 1LT9C 1T8ZA 5BVZA 2H43A 3VMYA 1NKZB 5KTBA 5KJ7A 5APYA 1J1DB 1NTZK 4IFFA 3TK1A 1KILA 2NPSB 3GHGA 1FOSE 1LTJC 1S9KD 1LTAC 1JY3P 3EQ2A 2KP8A 1N73C 3NMDA 2P67A 1RY3A 3B5NA 3BASA 3VP8A 1MV8A 5KJ7C 3BATA 1RF1B 3UIAA 1JY2N 1JY2O 1G2CB 3TYYA 5AW7B 4M3LA 5APXA 1FZEA 2WSEH 5CCGC 1NHLA 3RL0B 4W7ZA 5CJ0A 5AVZB 1SQXK 1N7SC 4WY4B 1MFZA 5KJ7D 1M1JB 2IPPA 2WTYA 3H32B 1CW5A 3BRTB 2FXMA 3MIWA 2Z4EA 3V2RA 1FZCC 3II6A 1CI6A 3HTKB 1H88A 2HFED 1WT6A 1A02F 2JEEA 3NTNA 1M7LA 3OJAB 1JOCA 2CPBA 2OYHC 1QL2A 1JUNA 3HD7B 5AVTB 3L37A 2J58A 1NAFA 2IX7C 1EQ7A 1HGZA 1T3JA 4XE5B 3TSIA 2P1JA 1RF0A 1SVFA 1XTGB 3G3ZA 1N7SD 3U59A 1WRGA 1NO4A 2NPSC 1X9VA 3HTKA 2O01H 1J1DC 2ZFCA 2CPSA 1FAVA 3GHGC 1HJBA 1KFNA 2R32A 5AW5B 3P8MC 5AVSB 3L4FA 1CSBA 4WY4A 1N73A 3A2AA 5AW6B 3TNUB 3HE5B 3RK2D 1M1JA 1NH4A 2OYIA 2P7JA 1KQLA 1KFMA 2LKMA 2R3CA 4GT1A 5APQA 3VP9A 4IFDK 3A5TA 1HUCA 1NU1K 3P32A 4Y99B 2ZXEB 1J2JB 1M1JC 1G2CA 5KLVK 3SWYA 3VMXA 3HUSA 2WPRA 1NWQA 4OH8B 3LIEA 1L0LK 2N1TA 2XKMA 5AW1B 5CJ4A 1L0NK 1H8AA 2C0XA 2FYUK 5BU5A 1N2DC 1GL2B 2A45G 1LGHB 1SFCB 1SFCA 4WY4D 4C7NA 3MUDA 1HGVA 4Y99C 2QM8A 1LTTC 1GZLA 1KILC 2KB7P 2N9BA 2HLOA 4C7RA 2VRSA 4LC1A 3KDPB 3RL0C 2C9NY 3MD0A 4ZKPA 3H6PA 4N78E 2GUVA 1LWUC 3A3YB 3HD7D 2HODB 1JTHB 3RK3B 1VDFA 3EFGA 4W7YA 5AW9B 3NXSA 5AVXB 1GK4A 1NTKK 5APWA 3VMZA 1FBMA 1PFIA 2WZ7A 3L36A 2YO2A 3GHGB 2HG5D 2M8RA 1X8YA 2YKPA 1YYCA 2A45H 1YTZT 3M0AA 1NOHA 3U1AA 1HBWA 2FFDB 1HTLC 2C9LY 1LTJA 2C0WA 1YTZI 1GW4A 2WT7B 4JYCA 4WY4C 1GD2E 1J1EC 1T2KC 1HH0A 1GL2D 1N73B 2GM4A 1JCCA 5CHXA 3CLQA 1NKNA 5AVRB 2WWWA 3HD7A 4RESB 3PP5A 2IFNA 2PAJA 5CCGA 5CCHA 3HE5A 1N7LA 2E42A 1LT9B 4JYBA 3U1CA 1JY2P 1T2KD 2POHA 1SQVK 2IFMA 1IFIA 3B5ND 1E5WA 3HD7C 1DEBA 2J59M 3M9BA 1LTJB 1XTCC 2N1TC 5CCHC 2YMYA 2NPSD 3HUSB 2KSJA 1LTGC 1JNMA 5CMZA 3SWFA 5AW4B 1GU5A 2E43A 3V4QA 1JY3O 3MGNA 3RK2B 1JY3N 1KZUB 5APSA 1IK9A 1FDMA 3RK3D 1T3UA 3KPEA 1IFMA 1FJKA 1A02J 2M3BA 3MTUE 4LGDE 3R2PA 2QM7A 4N78D 3WMM0 4EOTA 5AVUB 1SP4A 3P8CE 3V2QA 1IO4A 2OYHA 2P2UA 5CCGD 3B5NB 4O9BA 2Q3IA 1MUUA 2FKWB 3KYQA 4JF7A 1LWUA 4AYCA 1HWTC 2HYNA 1N7SB 1RF1A 1RE4A 1G1JA 2H8PD 1N86A 5AW0B 1HVVA 1RE3A 1JTHA 2WPQA 3HE4A 3N4XA 1W2EA 2PP6A 5AVYB 1JO5A 1QL1A 2NPSA 3VYIA 3B8EB 1FU1A 2JJLA 3HRNA 1RF1C 1J1EB 2KLVA 1IFDA 3V5BA 1FZBA 1URQC 5APVA 3RK3C 1FOSF 3KQGA 4ZKUA 1GDTA 1LTBC 1DX7A 4HYTB 5AVWB 1N7SA 3E1IA 3OA7A 4KHXA 2Q9IA 2OYIC 5APUA 3CI9A 1X79B 3VOPA 1CI6B 1FZAA 3M0DA 2L5GB 3L35A 2W27A 3IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WT7 B;  4JYC A;  3T97 A;  1GD2 E;  3LID A;  1T2K C;  3TNU A;  3VTP C;  3VN0 A;  3HTK A;  1CZQ A;  2ZFC A;  1SLQ A;  1FAV A;  5AVR B;  2WWW A;  4RES B;  3M91 A;  1HJB A;  2R32 A;  5AW5 B;  3P8M C;  5AVS B;  3HE5 A;  2R5D A;  1CSB A;  2E42 A;  3A2A A;  2R5B A;  4GKG A;  5AW6 B;  3A7O A;  3M9H A;  4JYB A;  3TNU B;  3HE5 B;  3NFQ A;  1T2K D;  2W6A A;  3VMY A;  5APY A;  3TK1 A;  2YNY A;  2P7J A;  3M9B A;  1FOS E;  1KQL A;  1S9K D;  2R3C A;  2WPS A;  2KP8 A;  4GT1 A;  5APQ A;  1JNM A;  3NMD A;  2P67 A;  3A5T A;  5CMZ A;  1HUC A;  3SWF A;  5AW4 B;  1GU5 A;  2XU6 A;  3P32 A;  3V4Q A;  4AQR D;  2E43 A;  2ZXE B;  3MGN A;  5APS A;  3P7K A;  1J2J B;  1MV8 A;  3VMX A;  4C7N B;  1NWQ A;  2WPR A;  3UIA A;  5AW8 B;  3IR9 A;  1A02 J;  2YO3 A;  2H7H A;  1G2C B;  2QM7 A;  3LIE A;  4EOT A;  3TYY A;  5AW7 B;  1H8A A;  4M3L A;  5APX A;  5AVU B;  5AW1 B;  4AUW A;  1SP4 A;  1IO4 A;  2P2U A;  3OAK A;  2Q3I A;  2XV5 A;  3M06 A;  4I6M C;  1MUU A;  4B86 A;  4AYC A;  1HWT C;  5AVZ B;  4C7N A;  1MFZ A;  2QM8 A;  3HE4 B;  1DH3 A;  5APT A;  1GZL A;  5AVV B;  2Q7C A;  2IPP A;  2WTY A;  5AW0 B;  2N9B A;  2WPQ A;  3HE4 A;  4C46 A;  2VRS A;  4I2L C;  4LC1 A;  3I5C A;  3KDP B;  5AVY B;  1GK6 A;  2C9N Y;  3MD0 A;  3A3Y B;  3VYI A;  3B8E B;  2JJL A;  2Z5H A;  1GTW A;  3V4W A;  5AVQ B;  2XZR A;  5AW9 B;  3NXS A;  5AVX B;  1GK4 A;  5AW3 B;  1CI6 A;  1H89 A;  5APW A;  3VMZ A;  1GU4 A;  1H88 A;  1A02 F;  3V5B A;  3NTN A;  3L36 A;  2YO2 A;  3O8Z A;  5APV A;  1FOS F;  2WT7 A;  1S9K E;  3KQG A;  1X8Y A;  1JUN A;  1YYC A;  5AVT B;  3L37 A;  2Z5I A;  3M0A A;  4HYT B;  4DZO A;  1HBW A;  5AVW B;  4KHX A;  1NAF A;  1OXZ A;  4XE5 B;  5APU A;  2C9L Y;  1CI6 B;  3M0D A;  2BAS A;  5AW2 B;  1OWA A;  3L35 A;  2W27 A;  2Q5U A; 
#chains in the Genus database with same CATH topology
 3QWO C;  4KT0 J;  1KYO I;  4WB4 A;  1FZG A;  1KQG B;  2N1T B;  2JWA A;  2QVA A;  3E7K A;  1AFO A;  1URQ D;  4U3F G;  1QLE D;  1G1I A;  1BSN A;  3TNU A;  2GUS A;  3VTP C;  1NTK D;  2K9J B;  1YJW P;  3VN0 A;  3L70 D;  1EDL A;  1M1K Q;  1CZQ A;  1OVU A;  2W6B A;  1JB0 J;  3H32 A;  3CCR P;  1NTM E;  2OYI B;  1KV4 A;  2LR2 A;  3AE1 C;  3L75 J;  3H1H J;  4WBA A;  4GIF A;  1FZC A;  1VQ4 P;  2YXR B;  4JBZ A;  3M0D C;  3M91 A;  1KTM A;  3C9I A;  4EYY Q;  5CBN A;  1EZV G;  4HH2 A;  5KAF E;  3H1L G;  4PD4 D;  2XDJ A;  3M9Q A;  1EDK A;  2R5B A;  3IF4 A;  2KSE A;  3M9H A;  4RKU J;  1SQP G;  1SQX J;  1L4A D;  3GLM A;  4N6J A;  3H1H D;  1NTZ E;  1VQ7 P;  1VQL P;  3NFQ A;  1SFC C;  1ZN5 A;  2W6A A;  5GTH H;  1ZLL A;  1VQP P;  3FX0 A;  2FFD C;  1IFN A;  1UII A;  1FJP A;  1EZV D;  3L75 E;  3L74 J;  2YNY A;  3H1L D;  2KZI A;  4U7J A;  2FYZ A;  2I1K A;  1IJD B;  1RF0 C;  4GOE A;  4IFM A;  5CCH D;  3I55 P;  1QVG O;  4H0L B;  3BVH A;  2WPS A;  3L75 G;  3PJS K;  3L73 D;  4HKZ H;  1KIL B;  1AQ5 A;  1SQX E;  2XU6 A;  4AQR D;  1HF9 A;  4U3F D;  4TT3 H;  2MKV A;  3P7K A;  1L4A C;  1BE3 J;  4GOD A;  2QE7 H;  5AW0 B;  3CCV P;  1L0L E;  1MKM A;  2YKO A;  4C7N B;  3V2P A;  1OFC X;  5AW8 B;  1IZN B;  1LWU B;  2H89 C;  2YO3 A;  3IR9 A;  4TLF A;  2H7H A;  2E75 B;  5KAF H;  3ITK A;  3CWB J;  1KN7 A;  1RE4 C;  2O1K A;  4AUW A;  4L75 A;  1RE3 C;  3USS A;  2OGU A;  1RH5 B;  1U7J A;  3L71 J;  1JMM A;  3OAK A;  1Q82 Q;  3B5N C;  1BE3 G;  2XV5 A;  1SQP D;  5L8R J;  2W8Z A;  1S4X A;  3BCC E;  1IFJ A;  3L71 D;  3M06 A;  4I6M C;  4K3A A;  4N3Y B;  5C39 A;  1L4A A;  4B86 A;  1URQ B;  3RK3 E;  1L4A B;  2BCC E;  1WMK A;  2N1T D;  2Y0C A;  2V7Q H;  4UB6 H;  3LW5 H;  1L0L J;  2B88 A;  2FBW C;  4H44 D;  2W6J H;  3A0H H;  2QIW A;  3HE4 B;  1DH3 A;  5APT A;  1PIX A;  1FZF A;  3H1I G;  3AED C;  1FDO A;  5AVV B;  2Q7C A;  3CX5 E;  5KKZ C;  3CCL P;  3CXH H;  4EIJ A;  1OZH A;  1LTS C;  1VF5 C;  2FYU G;  3H1I D;  3S4R A;  1NTZ G;  3BRV B;  4C46 A;  1BSH A;  1PV3 A;  1SFC D;  3P8C D;  1VPC A;  3I5C A;  4I2L C;  1S72 P;  1GK6 A;  2E75 D;  2K9J A;  3AEC C;  4LLH A;  3RL0 D;  5BU8 B;  3S1K A;  2V7Q J;  1JCD A;  2WSC H;  2BCC J;  2OQQ A;  4XA4 A;  2Z5H A;  1QEX A;  4PV1 B;  3WUV A;  1RQU A;  2I1J A;  3V4W A;  3N7N A;  3ABV C;  5AVQ B;  1GTW A;  2RN0 A;  2XZR A;  2OYH B;  1PGO A;  3L72 E;  1ZR4 A;  5GTI H;  5AW3 B;  1AJY A;  1H89 A;  2KOG A;  5B66 H;  1GU4 A;  1SQP K;  1YQ3 C;  2A06 G;  3TGU G;  3TF5 A;  1GL2 C;  2HPC B;  1SQQ K;  2AEJ A;  2AXC A;  3PLN A;  2JDI H;  4H13 C;  4EDF A;  2HPC A;  1GW3 A;  2KIK A;  1VF5 D;  2WSF J;  1Z56 A;  2JR8 A;  2KS1 A;  3O8Z A;  3W67 A;  3JCU E;  4DOJ A;  2WT7 A;  1S9K E;  1KIL D;  4UB6 E;  5KAI H;  5KLI C;  4NPF X;  1OX3 A;  2Z5I A;  2HOD A;  1NU1 E;  3AEE C;  5KLV J;  4DZO A;  1S2E A;  3CXH I;  5DJU B;  4L76 A;  1SQB K;  3CX5 H;  1OXZ A;  2OAR A;  3L72 J;  4OVN F;  3CCQ P;  3CXH E;  4I7Z B;  1QVF O;  1OIP A;  1KB9 I;  1LNQ A;  2KXP B;  1ZV8 A;  1L0N G;  1GL2 A;  1EXI A;  1KD1 Q;  2BAS A;  2WSF H;  5AW2 B;  1L0L G;  1OWA A;  1TU3 F;  2WIT A;  1K05 A;  1NTZ D;  2XNX A;  3CME P;  1ZME C;  2Q5U A;  2B87 B;  5TIS H;  4IL6 E;  1FZC B;  4I1L A;  3H1K E;  4PD4 H;  1NTM K;  3Q5R A;  2O01 N;  5M1B A;  3LID A;  3RK2 C;  3T97 A;  1EXJ A;  1MZ9 A;  1OVV A;  1LT9 A;  3AE9 C;  4HJG H;  3CL3 D;  2KYV A;  3H1J D;  1Q86 Q;  1IK7 A;  1NU1 D;  2H43 A;  2KZJ A;  3HUS C;  2FFD A;  2D2C D;  1X0T A;  2WQY C;  2K9Y A;  3H1J E;  5H2F E;  4YPC A;  1SLQ A;  1FC2 C;  2LXC B;  2XND H;  4BWN A;  1ZR2 A;  4W80 A;  2L91 A;  3AE4 C;  1KYO D;  2BEZ F;  2FXP A;  1NYH A;  1LTI C;  3JCU H;  3V6I A;  2MJZ A;  2R5D A;  1H0T A;  2A45 I;  1NGM B;  1UIX A;  2KNC B;  2ZYA A;  2RH0 A;  3H1H E;  3H1K J;  4GKG A;  1URQ A;  3A7O A;  2O1J A;  2YKQ A;  3B71 A;  1IC2 A;  2K3R A;  3V2N A;  1LT9 C;  3O6Q B;  4RJT A;  1T8Z A;  4WWI A;  5BVZ A;  2ZJS E;  3JSV C;  1S5L E;  2P58 A;  2QJP C;  3VMY A;  1NKZ B;  2A06 E;  2E74 C;  3AE3 C;  5APY A;  5KJ7 A;  1J1D B;  5KTB A;  3TGU E;  1NTZ K;  1Q2N A;  1OMI A;  1KIL A;  4H13 D;  4IFF A;  3TK1 A;  2NPS B;  3GHG A;  1FOS E;  1GMJ A;  4PD4 I;  1NTM D;  3CD6 P;  1LTJ C;  4IL6 H;  1LTA C;  1S9K D;  1JY3 P;  3EQ2 A;  2ZYG A;  2KP8 A;  4UB8 H;  3FWN A;  1N73 C;  3NMD A;  2P67 A;  2KI7 B;  3L74 E;  1BGY D;  3RBX A;  1RY3 A;  3A0B E;  3B5N A;  3GF7 A;  3AEG C;  1ZRT E;  3BAS A;  1VF5 B;  1BDD A;  3VP8 A;  2M5A B;  4IOI H;  1MV8 A;  2SPZ A;  2LXB A;  3L72 D;  5KJ7 C;  1VL2 A;  1ZW0 A;  3BAT A;  4PV1 D;  5KKZ B;  1RF1 B;  1AQT A;  4YTP C;  3SWK A;  1M90 Q;  3UIA A;  1JY2 N;  1JY2 O;  4XFJ A;  3H1K G;  3PTZ A;  1G2C B;  1BE3 E;  3TYY A;  5AW7 B;  4M3L A;  5APX A;  1FZE A;  2WSE H;  1W5C E;  5CCG C;  1KC8 Q;  3SSU A;  3WU2 H;  2CK3 H;  1NHL A;  2Q3E A;  2PFX A;  2R3S A;  3MZW B;  1YJ9 P;  3CWB E;  3RL0 B;  2P10 A;  3O6Q A;  2KUB A;  4W7Z A;  5CJ0 A;  1KQF B;  4EI2 A;  4H44 B;  2IYP A;  3Q2Y A;  5AVZ B;  1SQX K;  1N7S C;  3K5B A;  4WY4 B;  3L70 G;  1MFZ A;  3L73 G;  2IZ0 A;  3ZDM A;  2E76 B;  1KOR A;  5KJ7 D;  5TJH A;  4A7P A;  2R44 A;  2RKL A;  1M1J B;  2IPP A;  2WTY A;  4UB8 E;  1SQP E;  3KZI H;  3L73 E;  1P84 I;  3H32 B;  2BEQ D;  4I7Z C;  2AXT E;  3AE5 C;  2M3E A;  2K37 A;  1IFP A;  1KB9 D;  1NJI Q;  1CW5 A;  3CC7 P;  1AV1 A;  3BRT B;  5KLI B;  2FXM A;  1K73 Q;  1BE3 D;  2JP3 A;  2ZT9 C;  2E76 C;  3WUT A;  3MIW A;  2Z4E A;  3V2R A;  1FZC C;  4H44 C;  3II6 A;  1CI6 A;  2Q9I A;  1SQP J;  3HTK B;  3L73 J;  2HFE D;  1WT6 A;  1H88 A;  1A02 F;  1R8E A;  2JEE A;  1M8O B;  3L72 G;  3GG2 A;  3NTN A;  3CCM P;  1M7L A;  1S5L X;  3D70 A;  3OJA B;  1JOC A;  4D6T D;  2CPB A;  3G4S P;  2OYH C;  3CPW O;  4PV1 C;  1QL2 A;  2QJK C;  3B4S A;  2OTL P;  1JUN A;  3HD7 B;  5AVT B;  2FYN C;  4GDO A;  3L37 A;  2J58 A;  3AEB C;  1VQK P;  1NAF A;  2YMK A;  2IX7 C;  1EQ7 A;  1HGZ A;  1T3J A;  2IYO A;  3AEA C;  3KZI E;  2P1J A;  4XE5 B;  3LW5 J;  3TSI A;  4H13 B;  1YJN P;  1RF0 A;  2AXT H;  1RHZ B;  1SVF A;  1NU1 J;  2JWD A;  1SQB E;  1PP9 E;  1SQV D;  2OYO A;  1XTG B;  3G3Z A;  4QMA A;  1W2B O;  2Q6Q A;  5B66 E;  1PP9 D;  1YIT P;  2K88 A;  2BCC G;  1DD4 A;  1N7S D;  1BCC D;  3AE8 C;  5DJT B;  3U59 A;  4RO0 A;  1WRG A;  1YIJ P;  1NO4 A;  4OGQ C;  1NVO A;  1VQ8 P;  2NPS C;  1R5L A;  1ZP0 C;  3KXD A;  1X9V A;  4JQ0 D;  3HTK A;  2O01 H;  5KAI E;  4H0L C;  1J1D C;  1SS1 A;  2ZFC A;  3BCC G;  2CPS A;  1NTK E;  3PHL A;  1FAV A;  2O3J A;  3TDK A;  3GHG C;  1YHQ P;  1HJB A;  2YXQ B;  3CCJ P;  1KFN A;  1FDI A;  1EZV I;  1PP9 J;  2YIU C;  4WVZ A;  2R32 A;  5AW5 B;  5KLV D;  1K9M Q;  1T6A A;  2B9B A;  1NTM G;  2IBZ G;  3L4F A;  3H1J J;  1CSB A;  1PPJ G;  3P8M C;  5AVS B;  4WY4 A;  3Q5P A;  1N73 A;  3A2A A;  5AW6 B;  1SQV E;  1SQB D;  4HB1 A;  4NPD A;  2FYU E;  3TNU B;  5TIS E;  2QJY C;  3HE5 B;  2O01 J;  1LP1 A;  3PH0 A;  3RK2 D;  1PPJ E;  2ZVO B;  2ZYD A;  3FXE A;  2E74 D;  3F89 A;  1VQO P;  3RGU A;  1M1J A;  3Q5S A;  3R4Y A;  1FS0 E;  1NH4 A;  3WUU A;  1NTK J;  1DIP A;  2OYI A;  2ITA A;  4H0L D;  2JKV A;  2D2C C;  2P7J A;  3SFD C;  1KQL A;  4ASV A;  1KFM A;  5E79 E;  2DW3 A;  1VQ6 P;  2LKM A;  2R3C A;  3TGU J;  4ZMD A;  2J5U A;  2QRX A;  4GT1 A;  2V4H A;  5APQ A;  3VP9 A;  1VQ5 P;  4R4M A;  3A5T A;  4IFD K;  1HUC A;  1NU1 K;  1SQV J;  2QJK B;  2IZ1 A;  1KQS O;  2FYU J;  3P32 A;  1HJ0 A;  4Y99 B;  2ZXE B;  3H1I J;  1J2J B;  1M1J C;  1M57 D;  1G2C A;  1L0N E;  3SWY A;  3VMX A;  1L2P A;  1PP9 G;  5KLV K;  3HUS A;  2WPR A;  1NWQ A;  1YBK A;  3PRJ A;  1S5L H;  3RBZ A;  4OH8 B;  1JEK A;  3LIE A;  1L0L K;  2N1T A;  4DCK A;  1KB9 E;  2XKM A;  1JMB A;  5AW1 B;  1L0N K;  3AE6 C;  3FWL A;  5CJ4 A;  1H8A A;  2IBZ D;  2AEM A;  2C0X A;  2FYU K;  5BU5 A;  5B5E H;  1USD A;  1N2D C;  2ZAE B;  1GL2 B;  1SQB G;  2A45 G;  1LGH B;  4OGQ B;  1NTK G;  2PGD A;  1SFC B;  3H1I E;  4PJ0 E;  1SFC A;  3A0B H;  4WY4 D;  3W68 A;  4C7N A;  3MUD A;  4DT0 A;  1HGV A;  3RL0 g;  2Y9Y A;  4Y99 C;  2QM8 A;  3D6Z A;  1DEE G;  4D6T G;  2M5A A;  1LTT C;  4OGQ D;  1GZL A;  1KIL C;  1SQQ E;  2QEX P;  2KB7 P;  3H1H G;  1BGY E;  2I8D A;  2YIU B;  2N9B A;  2HLO A;  2K1A A;  3H1J G;  1Q81 Q;  3C8V A;  4C7R A;  2VRS A;  4LC1 A;  1SQQ G;  3KDP B;  2D2C B;  3RL0 C;  5CBO A;  2C9N Y;  3MD0 A;  4ZKP A;  3CMA P;  2E75 C;  1EDJ A;  3H6P A;  4N78 E;  2GUV A;  1LWU C;  1ZOY C;  2IBZ E;  3A3Y B;  4MN4 C;  3WU2 E;  3HD7 D;  3CCS P;  2HOD B;  1JTH B;  1Y8A A;  3IN6 A;  1OW7 A;  2ZT9 D;  1KYO H;  1VDF A;  3RK3 B;  3D6Y A;  3EFG A;  1KMI Z;  4W7Y A;  3CX5 D;  3NXS A;  5AW9 B;  5AVX B;  1GK4 A;  1NTK K;  2RMZ A;  5APW A;  3VMZ A;  1FBM A;  1SQX G;  2N9Y B;  1PFI A;  3OW2 O;  2WZ7 A;  3L36 A;  1N8R Q;  2YO2 A;  3GHG B;  1SQX D;  2HR3 A;  2HG5 D;  2M8R A;  2NRG A;  3BCC D;  3GMA A;  4PJ0 H;  2AEF A;  2WSE J;  3T97 B;  4GOF A;  4ZNC A;  1X8Y A;  2YKP A;  4Y28 J;  3L71 G;  1YYC A;  4L73 A;  2A45 H;  2FYN B;  1YTZ T;  3M0A A;  1NOH A;  5KLV G;  3U1A A;  1HBW A;  2FFD B;  1HTL C;  1PGJ A;  2A06 D;  3TGU D;  1FE6 A;  2G3A A;  2Y0D A;  1PGP A;  2Y9Z A;  2G8Y A;  5K5G B;  2QJY B;  3FXD A;  1EC5 A;  1AVO A;  3H1L J;  2C9L Y;  1LTJ A;  1NU1 G;  2C0W A;  2WSS H;  3AEF C;  3H1K D;  3L70 J;  2QJP B;  1OVR A;  1YTZ I;  1GW4 A;  2IDB A;  3AE2 C;  1QX8 A;  2WT7 B;  2JO1 A;  4JYC A;  1BCC J;  4WY4 C;  2KS1 B;  3SFE C;  1GD2 E;  1J1E C;  1KYO E;  1NTM J;  1SQB J;  3CXH D;  3VMA A;  1T2K C;  3Q1M A;  1HH0 A;  1GL2 D;  2B89 A;  1YQ4 C;  1N73 B;  2GM4 A;  1E79 H;  1JCC A;  1Y9B A;  5CHX A;  1MFT A;  1KIL E;  3CLQ A;  3H1L E;  2FXO A;  1NKN A;  5AVR B;  1PGQ A;  2WWW A;  3HD7 A;  3IFM A;  3L75 D;  4RES B;  1YI2 P;  1EDI A;  3L70 E;  3PP5 A;  2IFN A;  1K8A Q;  1NTZ J;  2PAJ A;  1ZXG A;  5CCG A;  3HE5 A;  1PZQ A;  2W90 A;  1N7L A;  4NPE A;  5CCH A;  2E42 A;  1BCC E;  4BRY A;  1OW8 A;  1LT9 B;  4JYB A;  3U1C A;  4BXL A;  3S9O A;  1X22 A;  3MP7 B;  3C1L A;  1BCC G;  1JY2 P;  2IBZ I;  2POH A;  1T2K D;  1S3J A;  1SQV K;  2IFM A;  3CCE P;  3I56 P;  1IFI A;  2Q1K A;  3B5N D;  1E5W A;  3G6E P;  3HD7 C;  3G71 P;  1DEB A;  2J59 M;  3M9B A;  2WMM A;  1LTJ B;  1VQ9 P;  1K04 A;  1XTC C;  2E5T A;  2N1T C;  3E1R A;  5CCH C;  1D7M A;  2NPS D;  2KNC A;  2KSJ A;  1LTG C;  2YMY A;  3HUS B;  2GA1 A;  3EFF K;  3Q3D A;  4JPZ B;  1JNM A;  5CMZ A;  3SWF A;  5AW4 B;  1GU5 A;  2E43 A;  2WSC J;  3V4Q A;  1JY3 O;  3MGN A;  3RK2 B;  1JY3 N;  1KZU B;  3F5H A;  5APS A;  4D6T J;  3A0H E;  1IK9 A;  4DJG A;  1FDM A;  2ZT9 B;  3RK3 D;  3H25 A;  2QA4 P;  1T3U A;  3KPE A;  3L71 E;  1IFM A;  4OWF A;  1FJK A;  2W83 C;  1A02 J;  2M3B A;  3MTU E;  4LGD E;  3R2P A;  2QM7 A;  4N78 D;  3WMM 0;  4EOT A;  3BCC J;  1L0N J;  5AVU B;  2PRR A;  2WPV B;  1SP4 A;  2M0B A;  3G9R A;  2B87 A;  3P8C E;  3V2Q A;  5E79 H;  4ASW A;  2P2U A;  5CCG D;  3B5N B;  2OYH A;  1IO4 A;  4O9B A;  2QSI A;  2Q3I A;  2E74 B;  1U7M A;  2NZ2 A;  4K35 A;  1MUU A;  1PL5 A;  1SQQ D;  2FKW B;  1LWU A;  1Q90 D;  1RQV A;  3KYQ A;  4JF7 A;  4AYC A;  4D6T E;  1HWT C;  2QG4 A;  2HYN A;  5GTI E;  1N7S B;  3MHV A;  1R5S A;  3GW6 A;  1Y47 A;  1RF1 A;  1H0T B;  1BDC A;  2BCC D;  4U3F E;  3IAO A;  1VQN P;  2OTJ P;  1P84 E;  1RE4 A;  1G1J A;  2H8P D;  1N86 A;  1SQV G;  1HVV A;  1RE3 A;  4R4L A;  1JTH A;  2WPQ A;  3CX5 I;  3FGA D;  3HE4 A;  3N4X A;  4CPG A;  1Q7Y Q;  2WVR A;  1LT1 A;  1W2E A;  1S1C X;  1KB9 H;  2PP6 A;  2UWJ E;  5AVY B;  3CC4 P;  1BGY G;  1LJ2 A;  1SQQ J;  2KK7 A;  1JO5 A;  1BGY J;  4Z1M H;  2H88 C;  1EZV E;  1QL1 A;  2Y0E A;  5B5E E;  2NPS A;  3AE7 C;  1M56 D;  1QGK B;  3VYI A;  3B8E B;  1FU1 A;  1U57 A;  2JJL A;  1L0L D;  1OW6 A;  3HRN A;  5EFW B;  1J1E B;  3CCU P;  1RF1 C;  1PPJ D;  1L0N D;  4U3F J;  2KLV A;  2ZXX A;  1P84 D;  2FYU D;  1LP1 B;  3KHU A;  4IL6 X;  2OTK E;  1IFD A;  4PD4 E;  4BRY B;  3V5B A;  3JC2 2;  1ZRT D;  1DD3 A;  1FZB A;  5KLV E;  1URQ C;  5APV A;  4YXD C;  3RK3 C;  3CWB D;  3L74 D;  1VQM P;  1JM0 A;  3KQG A;  1AVY A;  1FOS F;  3CC2 P;  2E5Y A;  4ZKU A;  2ZVN B;  1GDT A;  1LTB C;  5H2F H;  3L74 G;  1DX7 A;  2FY8 A;  4HYT B;  5AVW B;  1N7S A;  1AA0 A;  1P84 H;  3E1I A;  1NAY A;  3MUD C;  3OA7 A;  4KHX A;  1USE A;  2OYI C;  5APU A;  3CI9 A;  5GTH E;  3D71 A;  4YXW H;  4L74 A;  1X79 B;  4KJM A;  2KLU A;  1CI6 B;  1FZA A;  3VOP A;  3M0D A;  3CWB G;  2L5G B;  3GF3 A;  3L35 A;  2W27 A;  3QH9 A;  3EWK A;  2E76 D; 
#chains in the Genus database with same CATH homology
 4WB4 A;  1FZG A;  2N1T B;  1AFO A;  1URQ D;  1G1I A;  3TNU A;  3VTP C;  2GUS A;  3VN0 A;  1CZQ A;  2W6B A;  3H32 A;  2OYI B;  4WBA A;  1FZC A;  4GIF A;  3M0D C;  3M91 A;  3C9I A;  4HH2 A;  2XDJ A;  3M9Q A;  2R5B A;  3M9H A;  1L4A D;  4N6J A;  3NFQ A;  1SFC C;  1ZN5 A;  2W6A A;  2FFD C;  1ZLL A;  1IFN A;  1FJP A;  2YNY A;  2FYZ A;  2I1K A;  1IJD B;  1RF0 C;  4IFM A;  5CCH D;  3BVH A;  2WPS A;  1KIL B;  1AQ5 A;  2XU6 A;  4AQR D;  3P7K A;  1L4A C;  4C7N B;  2YKO A;  3V2P A;  5AW8 B;  1LWU B;  3IR9 A;  2YO3 A;  2H7H A;  1RE4 C;  2O1K A;  4AUW A;  1RE3 C;  1JMM A;  3OAK A;  3B5N C;  2XV5 A;  3M06 A;  4I6M C;  1IFJ A;  4N3Y B;  4B86 A;  1L4A A;  1URQ B;  1L4A B;  2N1T D;  3LW5 H;  3HE4 B;  1DH3 A;  5APT A;  1FZF A;  5AVV B;  2Q7C A;  4EIJ A;  1LTS C;  4C46 A;  3BRV B;  1SFC D;  3P8C D;  1VPC A;  3I5C A;  4I2L C;  1GK6 A;  3RL0 D;  4LLH A;  5BU8 B;  1JCD A;  2WSC H;  4XA4 A;  2Z5H A;  2I1J A;  1GTW A;  3V4W A;  3N7N A;  5AVQ B;  2OYH B;  2XZR A;  1ZR4 A;  5AW3 B;  1H89 A;  2KOG A;  1GU4 A;  1SQP K;  2HPC B;  1GL2 C;  1SQQ K;  2HPC A;  1GW3 A;  1Z56 A;  3O8Z A;  4DOJ A;  2WT7 A;  1S9K E;  1KIL D;  2Z5I A;  2HOD A;  4DZO A;  1SQB K;  1OXZ A;  2OAR A;  1ZV8 A;  1GL2 A;  2BAS A;  2WSF H;  5AW2 B;  1OWA A;  2WIT A;  2XNX A;  2Q5U A;  1FZC B;  4I1L A;  1NTM K;  3T97 A;  3LID A;  3RK2 C;  1MZ9 A;  1LT9 A;  3CL3 D;  2KYV A;  3HUS C;  2FFD A;  1ZR2 A;  1SLQ A;  4W80 A;  1LTI C;  2MJZ A;  2R5D A;  2A45 I;  4GKG A;  1URQ A;  3A7O A;  2O1J A;  2YKQ A;  3V2N A;  1IC2 A;  1LT9 C;  1T8Z A;  5BVZ A;  2H43 A;  3VMY A;  1NKZ B;  5KTB A;  5KJ7 A;  5APY A;  1J1D B;  1NTZ K;  4IFF A;  3TK1 A;  1KIL A;  2NPS B;  3GHG A;  1FOS E;  1LTJ C;  1S9K D;  1LTA C;  1JY3 P;  3EQ2 A;  2KP8 A;  1N73 C;  3NMD A;  2P67 A;  1RY3 A;  3B5N A;  3BAS A;  3VP8 A;  1MV8 A;  5KJ7 C;  3BAT A;  1RF1 B;  3UIA A;  1JY2 N;  1JY2 O;  1G2C B;  3TYY A;  5AW7 B;  4M3L A;  5APX A;  1FZE A;  2WSE H;  5CCG C;  1NHL A;  3RL0 B;  4W7Z A;  5CJ0 A;  5AVZ B;  1SQX K;  1N7S C;  4WY4 B;  1MFZ A;  5KJ7 D;  1M1J B;  2IPP A;  2WTY A;  3H32 B;  1CW5 A;  3BRT B;  2FXM A;  3MIW A;  2Z4E A;  3V2R A;  1FZC C;  3II6 A;  1CI6 A;  3HTK B;  1H88 A;  2HFE D;  1WT6 A;  1A02 F;  2JEE A;  3NTN A;  1M7L A;  3OJA B;  1JOC A;  2CPB A;  2OYH C;  1QL2 A;  1JUN A;  3HD7 B;  5AVT B;  3L37 A;  2J58 A;  1NAF A;  2IX7 C;  1EQ7 A;  1HGZ A;  1T3J A;  4XE5 B;  3TSI A;  2P1J A;  1RF0 A;  1SVF A;  1XTG B;  3G3Z A;  1N7S D;  3U59 A;  1WRG A;  1NO4 A;  2NPS C;  1X9V A;  3HTK A;  2O01 H;  1J1D C;  2ZFC A;  2CPS A;  1FAV A;  3GHG C;  1HJB A;  1KFN A;  2R32 A;  5AW5 B;  3P8M C;  5AVS B;  3L4F A;  1CSB A;  4WY4 A;  1N73 A;  3A2A A;  5AW6 B;  3TNU B;  3HE5 B;  3RK2 D;  1M1J A;  1NH4 A;  2OYI A;  2P7J A;  1KQL A;  1KFM A;  2LKM A;  2R3C A;  4GT1 A;  5APQ A;  3VP9 A;  4IFD K;  3A5T A;  1HUC A;  1NU1 K;  3P32 A;  4Y99 B;  2ZXE B;  1J2J B;  1M1J C;  1G2C A;  5KLV K;  3SWY A;  3VMX A;  3HUS A;  2WPR A;  1NWQ A;  4OH8 B;  3LIE A;  1L0L K;  2N1T A;  2XKM A;  5AW1 B;  5CJ4 A;  1L0N K;  1H8A A;  2C0X A;  2FYU K;  5BU5 A;  1N2D C;  1GL2 B;  2A45 G;  1LGH B;  1SFC B;  1SFC A;  4WY4 D;  4C7N A;  3MUD A;  1HGV A;  4Y99 C;  2QM8 A;  1LTT C;  1GZL A;  1KIL C;  2KB7 P;  2N9B A;  2HLO A;  4C7R A;  2VRS A;  4LC1 A;  3KDP B;  3RL0 C;  2C9N Y;  3MD0 A;  4ZKP A;  3H6P A;  4N78 E;  2GUV A;  1LWU C;  3A3Y B;  3HD7 D;  2HOD B;  1JTH B;  3RK3 B;  1VDF A;  3EFG A;  4W7Y A;  5AW9 B;  3NXS A;  5AVX B;  1GK4 A;  1NTK K;  5APW A;  3VMZ A;  1FBM A;  1PFI A;  2WZ7 A;  3L36 A;  2YO2 A;  3GHG B;  2HG5 D;  2M8R A;  1X8Y A;  2YKP A;  1YYC A;  2A45 H;  1YTZ T;  3M0A A;  1NOH A;  3U1A A;  1HBW A;  2FFD B;  1HTL C;  2C9L Y;  1LTJ A;  2C0W A;  1YTZ I;  1GW4 A;  2WT7 B;  4JYC A;  4WY4 C;  1GD2 E;  1J1E C;  1T2K C;  1HH0 A;  1GL2 D;  1N73 B;  2GM4 A;  1JCC A;  5CHX A;  3CLQ A;  1NKN A;  5AVR B;  2WWW A;  3HD7 A;  4RES B;  3PP5 A;  2IFN A;  2PAJ A;  5CCG A;  5CCH A;  3HE5 A;  1N7L A;  2E42 A;  1LT9 B;  4JYB A;  3U1C A;  1JY2 P;  1T2K D;  2POH A;  1SQV K;  2IFM A;  1IFI A;  3B5N D;  1E5W A;  3HD7 C;  1DEB A;  2J59 M;  3M9B A;  1LTJ B;  1XTC C;  2N1T C;  5CCH C;  2YMY A;  2NPS D;  3HUS B;  2KSJ A;  1LTG C;  1JNM A;  5CMZ A;  3SWF A;  5AW4 B;  1GU5 A;  2E43 A;  3V4Q A;  1JY3 O;  3MGN A;  3RK2 B;  1JY3 N;  1KZU B;  5APS A;  1IK9 A;  1FDM A;  3RK3 D;  1T3U A;  3KPE A;  1IFM A;  1FJK A;  1A02 J;  2M3B A;  3MTU E;  4LGD E;  3R2P A;  2QM7 A;  4N78 D;  3WMM 0;  4EOT A;  5AVU B;  1SP4 A;  3P8C E;  3V2Q A;  1IO4 A;  2OYH A;  2P2U A;  5CCG D;  3B5N B;  4O9B A;  2Q3I A;  1MUU A;  2FKW B;  3KYQ A;  4JF7 A;  1LWU A;  4AYC A;  1HWT C;  2HYN A;  1N7S B;  1RF1 A;  1RE4 A;  1G1J A;  2H8P D;  1N86 A;  5AW0 B;  1HVV A;  1RE3 A;  1JTH A;  2WPQ A;  3HE4 A;  3N4X A;  1W2E A;  2PP6 A;  5AVY B;  1JO5 A;  1QL1 A;  2NPS A;  3VYI A;  3B8E B;  1FU1 A;  2JJL A;  3HRN A;  1RF1 C;  1J1E B;  2KLV A;  1IFD A;  3V5B A;  1FZB A;  1URQ C;  5APV A;  3RK3 C;  1FOS F;  3KQG A;  4ZKU A;  1GDT A;  1LTB C;  1DX7 A;  4HYT B;  5AVW B;  1N7S A;  3E1I A;  3OA7 A;  4KHX A;  2Q9I A;  2OYI C;  5APU A;  3CI9 A;  1X79 B;  3VOP A;  1CI6 B;  1FZA A;  3M0D A;  2L5G B;  3L35 A;  2W27 A;  3IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...