2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cathepsin B
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
1CI6A 2R5DA 3NTNA 3O8ZA 1GU4A 3KDPB 1NAFA 1MFZA 1SLQA 3HE5A 3T97A 5AVXB 4C7NA 5AVRB 2N9BA 2ZXEB 2R3CA 3NXSA 4HYTB 1HJBA 1JUNA 2YO3A 5APVA 4LC1A 4C7NB 1CSBA 1NWQA 3A3YB 2P2UA 5AVUB 5AW5B 3VTPC 3TNUA 1T2KC 2QM8A 1FOSF 3VMZA 5CMZA 3OAKA 2XZRA 3P32A 4JYCA 5AW9B 2C9LY 3TNUB 3L35A 1HBWA 2W27A 4C46A 5AW1B 3TK1A 1S9KE 3B8EB 4EOTA 4XE5B 2P67A 3LIEA 1S9KD 1GK4A 2JJLA 5AW8B 1CI6B 2Z5HA 2WPRA 4M3LA 5AVSB 2Q3IA 2Z5IA 3HE5B 3M0AA 3HE4A 5AVYB 3A7OA 1GK6A 4AQRD 1H89A 2E42A 1YYCA 2H7HA 4AYCA 1IO4A 4GT1A 3M0DA 3HTKA 5APYA 3UIAA 1A02F 4GKGA 2QM7A 2R5BA 2XU6A 3IR9A 3M06A 5AVTB 2Q5UA 2KP8A 3SWFA 5AVZB 3VN0A 2ZFCA 5AW3B 1GTWA 3KQGA 2R32A 2WPSA 5AVVB 5AW2B 3TYYA 3MD0A 5AVQB 3P8MC 5AW4B 4I6MC 4KHXA 3VMYA 1FAVA 2BASA 2YNYA 3V5BA 3M91A 1GD2E 1DH3A 1KQLA 5APWA 1GZLA 1X8YA 2C9NY 3M9BA 1T2KD 3MGNA 3P7KA 1H88A 3V4QA 1FOSE 1OWAA 3LIDA 3M9HA 3V4WA 3HE4B 5AW6B 3A2AA 1OXZA 3VYIA 1JNMA 1G2CB 1SP4A 1MV8A 5AW7B 4B86A 3NMDA 2WTYA 4AUWA 2Q7CA 1GU5A 2E43A 1CZQA 1HUCA 2P7JA 5APXA 1J2JB 3NFQA 1MUUA 2W6AA 2XV5A 2WT7A 4I2LC 1A02J 3VMXA 2VRSA 5APQA 3L36A 5APSA 1H8AA 3L37A 4DZOA 4RESB 2WPQA 4JYBA 2YO2A 2WT7B 5APUA 1HWTC 2IPPA 3A5TA 5AW0B 2WWWA 5APTA 5AVWB 3I5CA
chains in the Genus database with same CATH superfamily
3BVHA 1NKNA 3T97A 1SFCD 3JSVC 1HGVA 2FYUE 1AA0A 2ZT9C 2CPBA 1RE3C 4WY4C 5C39A 1SQPJ 3SSUA 4PD4E 3VTPC 2W6BA 1EQ7A 2BEZF 3L75E 1SQVJ 1PGJA 3PJSK 2QJKC 3AE6C 3B5ND 1JB0J 3W67A 3JCUH 4ZMDA 1R8EA 3WMM0 2E42A 3HD7C 4U3FD 2R3SA 4GT1A 1QL2A 2K1AA 3N4XA 1IFPA 3GHGC 2XU6A 1NTME 1JY3N 3CXHD 1GTWA 3V2PA 5CBNA 2WZ7A 2QJYC 1W2BO 4I6MC 5KKZC 2JR8A 1AJYA 3M9BA 1Q82Q 2P10A 2A06E 1BCCJ 1Q86Q 4N78D 1VL2A 5AW7B 3L74G 2P7JA 3G4SP 3ITKA 5APSA 1JEKA 2JP3A 4RESB 1NTZK 2E5TA 2YO2A 1GW4A 2R5DA 3KDPB 3L73G 2KNCA 3BATA 5E79E 1LT9A 3C1LA 1SQXD 2OTJP 4R4MA 4W7ZA 4JYCA 4UB8E 1RF1C 2IDBA 2KLUA 1SQBK 3M0AA 3G6EP 2V7QJ 1SQQD 1NJIQ 1R5LA 2ZYGA 3Q5PA 1AVOA 2KZIA 5AVZB 2E75B 3KQGA 1RE4A 5KAIH 4D6TG 1BE3E 1SQXG 4Y99C 2HYNA 5KLVE 1AVYA 4ASWA 3RGUA 1NTKE 1H88A 2KS1A 3L71G 1FOSE 3HUSC 1JY2O 3SWKA 5H2FH 4DJGA 1PGOA 3JC22 1IFDA 2PAJA 2WTYA 1SQQG 4D6TJ 1J2JB 1A02J 1EZVE 2YKPA 2CPSA 4DZOA 2HPCB 2WPQA 3CCSP 4QMAA 1P84H 3S4RA 1OIPA 4KT0J 2OQQA 3MTUE 1L0NJ 3NXSA 1MZ9A 1L4AC 3RK2B 1GL2C 2QJPB 4LC1A 5CJ4A 1WMKA 3H25A 1Y9BA 3C8VA 1G1IA 1PV3A 1Y8AA 2WSSH 3AE9C 1Q81Q 3P32A 1KV4A 3VP8A 5B66E 3O6QB 1VF5C 5KAFH 2SPZA 2ZT9B 4U3FE 2WSCJ 3BCCJ 4WY4B 1YYCA 3E1IA 2KB7P 3HTKA 4U7JA 4GODA 3CXHE 3V6IA 2R5BA 1XTCC 3WU2H 3L72D 3SWYA 2K88A 3CMEP 2QJKB 3TDKA 3V2QA 1KQLA 3C9IA 1X8YA 1NU1D 2KZJA 3P7KA 1X79B 3LIDA 4N78E 2H89C 4RJTA 2HLOA 2GUSA 3GHGB 3AE3C 4H13C 2IYPA 2QJYB 1RF0A 5GTHE 5KKZB 2KIKA 4ZNCA 3RL0B 3A5TA 5AW0B 1T3JA 3I5CA 3A0BE 1URQC 2Y0EA 2J59M 3CLQA 2FYNC 3CX5I 1NU1G 1HVVA 3Q3DA 2J5UA 1RQVA 1HF9A 2JWAA 1PP9E 1NHLA 3M0DC 1HBWA 4C46A 3AEGC 3K5BA 1AV1A 3PHLA 1VQ8P 2NPSA 1FDMA 3HE5B 3H1LD 1UIIA 2N9YB 1M1JA 2H43A 2D2CC 1NTZD 2QM7A 3M06A 4OGQD 3D71A 4L76A 3ABVC 3RL0g 3FWLA 1M57D 3CPWO 4WB4A 1FAVA 1S5LE 1FZGA 1E79H 1OFCX 3CC2P 2Y9YA 1FBMA 2AEMA 1OMIA 2HG5D 1FZCA 3H1LG 2G3AA 3EFFK 2G8YA 2Q7CA 1KQFB 3OW2O 2O01N 1NAYA 2W6AA 1DIPA 1SQBD 2VRSA 1N7SA 4Y99B 2WMMA 3PH0A 4JYBA 2W90A 1SQXK 2IPPA 2Y0CA 3H1ID 1BDCA 1SS1A 4I7ZC 4BXLA 1KQGB 3F89A 3HUSB 4XA4A 2ZXEB 2FBWC 2J58A 1KC8Q 4W80A 2H8PD 1IZNB 4NPFX 3USSA 3GG2A 1NWQA 1SQQK 3CX5D 2YMKA 3EWKA 2FYUJ 5CHXA 1HTLC 2QM8A 1N7SD 2BCCE 5KJ7C 2Q6QA 3FGAD 5GTIH 3CMAP 2JKVA 1CI6B 1L4AB 3L75J 1GL2B 3L70G 3OJAB 2IFNA 2K37A 4DOJA 1H89A 1JMBA 2AXCA 2XNDH 1YJ9P 1FU1A 1SFCC 2FYZA 2JO1A 3L72E 3I56P 1BGYD 2M5AA 3SFEC 2KP8A 3P8CD 5AW2B 1VF5B 3W68A 2B87B 3V5BA 1KMIZ 1N73B 2P1JA 1EXJA 1NTMJ 2IBZD 1L2PA 1QX8A 3V4WA 4EDFA 1PL5A 2WSFJ 3NMDA 2Q1KA 2UWJE 3B5NC 4PJ0H 2N1TA 3EFGA 1JCCA 3AE8C 4H0LD 4IFFA 3PP5A 1BGYG 1JY3O 1BSHA 1GU4A 3O8ZA 1PGQA 4C7NA 2WSEH 1XTGB 2NZ2A 5BU8B 2HODB 4H13B 4TT3H 2IBZG 1K04A 3B71A 1L0LE 1M90Q 4IFDK 3CWBG 3TNUA 2OYIC 4ZKUA 1SQPG 2N1TD 2OYHC 1FC2C 1FOSF 5CMZA 3CI9A 2C9LY 1ZP0C 2W8ZA 1YQ3C 1IFMA 1SQVG 1URQB 3G71P 3VMAA 1S9KD 3FXEA 4M3LA 2FYNB 3CWBJ 1BCCD 1OVVA 1KILD 1NTZE 1NU1K 3FWNA 2Q3EA 4YPCA 4OH8B 1FE6A 3VP9A 4EYYQ 3LW5J 1K73Q 2ZFCA 1K05A 2OTKE 3N7NA 2POHA 3H32B 1M1KQ 3L74D 4IL6H 1DEBA 3KZIH 1YJWP 2D2CB 1QEXA 1LTJC 1T3UA 3S1KA 3HE4B 1OXZA 3MHVA 3R2PA 1BE3J 1BCCG 1IFNA 5TISE 1CW5A 4R4LA 5KLVJ 1SQBE 1QLED 2V7QH 5APXA 2WSEJ 1NTKJ 1S1CX 1EDJA 3L73D 4I2LC 2NRGA 3H1HE 3H1IE 3L36A 5CCHA 3Q5RA 1GW3A 2FKWB 2RMZA 2QVAA 4UB6E 2N9BA 4HH2A 4C7RA 1JY2P 2E76B 3S9OA 4WY4A 3CCVP 3CX5E 4H44D 3VOPA 4BRYB 1EC5A 1MKMA 5EFWB 3MUDC 4YXWH 1J1DC 4I7ZB 1FJKA 1S5LX 3TK1A 4EOTA 3I55P 3LIEA 1J1EC 1LJ2A 1P84I 1ZN5A 1IO4A 1LGHB 4D6TD 1A02F 1NKZB 2KYVA 4U3FJ 3L71D 1FZEA 1NYHA 3U1AA 3CCLP 2OYOA 3BRVB 2ZVNB 3E1RA 1AFOA 3V4QA 4N6JA 1ZOYC 5CCGA 1KB9H 5AW6B 1D7MA 1SFCB 1W5CE 2MJZA 3Q5SA 2IZ1A 2K9YA 1GU5A 3IFMA 5B5EE 2WSCH 3RBXA 1KYOH 1ZR4A 3RL0D 4PV1B 3AE7C 2WT7B 1VQPP 1N2DC 1MFZA 3HE5A 2C0XA 2R3CA 5CCGD 1JUNA 1L0NG 3B5NB 3G3ZA 4W7YA 2KXPB 2K9JB 2IZ0A 1LWUC 2M3EA 1JTHA 2FY8A 1S9KE 2R44A 1FS0E 1OW8A 2LXBA 1GDTA 1RH5B 1EDIA 1KILE 1YITP 5CBOA 1PP9J 2A45H 5DJTB 1P84D 1PZQA 1KFNA 2OYIB 3BCCG 2PP6A 4RO0A 2OYHB 1U7MA 1SQPK 3IR9A 2JWDA 3CC4P 3MD0A 5AVQB 3L74E 1SQVK 2O3JA 3HUSA 1FZFA 1BDDA 3MGNA 2O01J 1USEA 3JCUE 1LP1B 2AXTH 1MV8A 3L73E 1YIJP 4BWNA 1K9MQ 3Q1MA 4EI2A 2ZXXA 4NPEA 3HD7B 2I1JA 2A45G 5AVWB 1LTJB 1CI6A 1L4AA 4OGQC 1ZR2A 1JCDA 2E74D 1CSBA 2ZAEB 1M1JC 3HRNA 1N86A 3RK3D 2B87A 1RQUA 1N73A 4K35A 2ZJSE 2JEEA 4D6TE 2BCCJ 1SQXE 2ZYDA 1S4XA 3A0HH 2KSEA 3UIAA 3L71E 3H1JG 1J1DB 5AW3B 3EQ2A 3H1KG 1SQQE 1FZCC 1J1EB 3TGUG 3QH9A 1PPJG 3L72J 1G2CA 2MKVA 3H1JJ 1N7SC 2HODA 1PFIA 2QIWA 1VPCA 4PD4H 5TJHA 3H1KJ 1T8ZA 3TGUJ 2M3BA 1LTGC 1RF1B 2IBZI 1H8AA 1KZUB 1LTAC 3RBZA 2NPSD 1URQA 4I1LA 2WWWA 3L75D 5KAIE 2PFXA 2QSIA 4HYTB 2KK7A 3ZDMA 2CK3H 5H2FE 5TISH 4WVZA 2L5GB 3L70D 2WSFH 4YXDC 3MZWB 2FYUG 1K8AQ 1H0TB 1YQ4C 3H32A 1L0LJ 3GW6A 5CJ0A 1JY3P 2XDJA 4XE5B 1P84E 4UB6H 3HE4A 4WWIA 1VQ4P 1ZV8A 5M1BA 4H0LC 1L0NK 3L75G 2BEQD 1M56D 4L75A 2ITAA 1Q7YQ 2RH0A 1LWUB 2FFDC 5AVTB 1FZAA 1E5WA 2M0BA 2YXRB 3VN0A 1YHQP 3HTKB 3L4FA 3CCMP 3P8MC 1FZBA 2Y0DA 2Q9IA 1U57A 2C9NY 1T2KD 5KAFE 2N1TC 1QVFO 5E79H 1OWAA 2FXMA 1NTMG 1WRGA 3D6YA 4L73A 4BRYA 1AQTA 1EDLA 4DT0A 3WUTA 1JOCA 2XV5A 1NU1E 4OWFA 1KILC 2W83C 4NPDA 4UB8H 3WU2E 1WT6A 3L37A 1VQLP 2A06G 3GF7A 3LW5H 3CWBD 4DCKA 2FXPA 3NTNA 1IFJA 5AVXB 1Q90D 2E76D 1SQPD 2H88C 5AVRB 3GF3A 3H1HJ 1HJ0A 3H1IJ 1G1JA 1VQ6P 1LTIC 1SQVD 5AVUB 5KJ7A 5KLIC 2XZRA 2KOGA 1FDOA 3L35A 4OGQB 5L8RJ 5KTBA 3PTZA 5BVZA 5AW8B 1VQ7P 2Q3IA 2XKMA 1BE3D 1SFCA 5KLVD 2OTLP 1NTKD 1M1JB 3IAOA 2AEFA 3TF5A 3H1LE 4JPZB 4H44C 5AW4B 1GMJA 4KHXA 4IFMA 3VMYA 4TLFA 1GD2E 1YJNP 1GZLA 2B88A 5CCHC 1X9VA 3B5NA 1OVRA 1KTMA 2E75D 2K9JA 1BE3G 2HPCA 5KLVG 3VMXA 1FZCB 1KQSO 1N7LA 5B66H 1NTKG 4PV1D 1S2EA 1VDFA 1ZRTD 1N7SB 2B9BA 1OZHA 1EDKA 3CXHH 2OYIA 2DW3A 2HR3A 2GM4A 1KB9I 4GDOA 3AEEC 1EZVG 2KSJA 2OYHA 3L70E 1LT9C 1NGMB 2KLVA 4GIFA 3O6QA 1IK9A 3VMZA 2W27A 1M7LA 3Q2YA 1KYOI 3RK2D 1RE3A 3AEAC 5AVSB 2Z5IA 1YI2P 2JDIH 1L0LK 1LP1A 3RL0C 4AQRD 1LTTC 2H7HA 4CPGA 4O9BA 4Z1MH 5GTHH 4GKGA 5CCHD 2Y9ZA 4YTPC 3U1CA 5CCGC 3GLMA 2R32A 2FYUK 4U3FG 2ZT9D 2M5AB 3HD7A 3KHUA 3M91A 1UIXA 3A0BH 1LTJA 1DH3A 5K5GB 1RE4C 4WY4D 1KD1Q 1JMMA 4H0LB 4OVNF 5GTIE 3AE2C 2PGDA 3GHGA 1JM0A 3A2AA 1BGYE 1NH4A 3AE1C 3P8CE 3VYIA 3L74J 3BRTB 2A45I 2FFDB 3AEBC 4AUWA 2L91A 3NFQA 1HH0A 2RN0A 4JF7A 2HFED 2RKLA 5APQA 2IBZE 4JBZA 1L0ND 3CWBE 3HD7D 1HWTC 1NOHA 2N1TB 3L73J 1SQPE 1PP9D 1Q2NA 4HKZH 3SFDC 1SLQA 1ZMEC 1NTMK 3AE5C 2IFMA 1HJBA 1SQVE 3TSIA 4A7PA 5APVA 3MUDA 4C7NB 2LKMA 3A3YB 3CCEP 2O01H 2QRXA 1VQNP 1USDA 1KILB 1KB9D 4XFJA 1X22A 3H6PA 4PJ0E 1S5LH 3TNUB 2PRRA 3BCCD 2WQYC 1Z56A 1KYOD 3T97B 2YKOA 1IK7A 1JO5A 1MFTA 4HJGH 1PP9G 1EXIA 3CCRP 5KLIB 2V4HA 2O1KA 1RF1A 1KORA 2E74C 2W6JH 1YTZI 1SQXJ 1BCCE 2OGUA 2BASA 2YIUC 2IYOA 1TU3F 2GUVA 2IX7C 3L71J 5APWA 3D70A 1FDIA 1VQMP 4JQ0D 3M9HA 4MN4C 2GA1A 3RK3C 1SQQJ 1JNMA 4IOIH 3V2RA 1S72P 4B86A 3U59A 3FXDA 4KJMA 4H44B 1ZXGA 1H0TA 1ZRTE 1OVUA 2P58A 1RF0C 4Y28J 5APUA 1DEEG 2YKQA 2QA4P 1N8RQ 3WUUA 2E5YA 1QVGO 2QE7H 4IL6E 2BCCD 2KUBA 3KZIE 1NO4A 1SVFA 1N73C 1LWUA 3R4YA 5AW5B 4PD4I 2YMYA 2WVRA 5KLVK 4LLHA 1NTKK 3IF4A 3OAKA 1VQ5P 1JY2N 5AW1B 1GL2A 3AEFC 1LTBC 1W2EA 2QG4A 1GK4A 3H1JD 2Z5HA 2WPRA 1OW7A 2QEXP 2KNCB 2NPSC 3H1KD 1LT9B 4AYCA 3M9QA 3TGUD 1RY3A 2BCCG 4ASVA 1PPJD 2YXQB 3KXDA 2I8DA 2WPSA 3TYYA 1L4AD 1GL2D 2LR2A 3L72G 1U7JA 3B4SA 1BSNA 2I1KA 3FX0A 1VF5D 2E43A 1X0TA 1L0NE 2ZYAA 1L0LD 2WPVB 2ZVOB 1KN7A 1NAFA 3BASA 3CC7P 1AQ5A 1LTSC 1NU1J 2KS1B 1ZW0A 2FYUD 2KI7B 1KB9E 3CCUP 2P2UA 3AEDC 1T2KC 3WUVA 4PD4D 1VQ9P 3BCCE 3AE4C 3F5HA 1KYOE 2P67A 4H13D 1L0LG 1JTHB 5AVYB 1S3JA 3A7OA 4L74A 1PIXA 3MIWA 4WBAA 3M0DA 3PLNA 1QL1A 3CCJP 2E76C 3KYQA 1PGPA 5BU5A 1URQD 3SWFA 1OX3A 5AVVB 1NTMD 3PRJA 1NTZG 3KPEA 2K3RA 3CL3D 3GMAA 1NVOA 3H1HD 3CX5H 1KFMA 1T6AA 1YTZT 3CD6P 1IJDB 1R5SA 3H1LJ 3II6A 2A06D 4GOFA 1SP4A 1CZQA 1HUCA 1NTZJ 2E74B 1MUUA 2YIUB 3D6ZA 2LXCB 1EZVI 4RKUJ 2D2CD 2FXOA 3CCQP 1QGKB 3RK3B 1SQBG 1M8OB 2YO3A 4N3YB 3H1HG 3H1IG 4LGDE 3OA7A 2AXTE 1OW6A 1HGZA 4EIJA 1FJPA 5AW9B 1SQBJ 2E75C 3H1JE 5DJUB 3B8EB 3G9RA 3L70J 2JJLA 3E7KA 2AEJA 2Z4EA 3H1KE 1Y47A 1GK6A 4PV1C 3TGUE 1PPJE 2FFDA 1LNQA 3AECC 3RK3E 5B5EH 5APYA 3CXHI 4GOEA 2Q5UA 4ZKPA 1IFIA 1DX7A 1DD3A 2YNYA 4HB1A 2WITA 2XNXA 3MP7B 1IC2A 4IL6X 2NPSB 1ZLLA 2C0WA 1DD4A 1G2CB 1VQKP 5KJ7D 3QWOC 3V2NA 1VQOP 2B89A 1RHZB 3RK2C 1KILA 2QJPC 2OARA 2O1JA 2WT7A 3A0HE 1LT1A 3IN6A 4K3AA 1BGYJ 1YBKA 2M8RA 1EZVD 5APTA
chains in the Genus database with same CATH topology
1CI6A 3HUSB 1L4AA 1NKNA 3BVHA 3T97A 1ZR2A 1SLQA 1SFCD 4XA4A 1JCDA 1HGVA 2ZXEB 2J58A 1NTMK 4W80A 2IFMA 1HJBA 3TSIA 2H8PD 5APVA 3MUDA 4C7NB 1CSBA 2LKMA 3A3YB 2CPBA 1NWQA 1SQQK 1RE3C 4WY4C 2O01H 1KILB 3VTPC 2W6BA 3H6PA 1EQ7A 5CHXA 1HTLC 2QM8A 1M1JC 1N7SD 1N86A 3HRNA 3RK3D 3TNUB 5KJ7C 1N73A 1Z56A 3B5ND 1CI6B 1L4AB 2YKOA 1GL2B 3OJAB 1JO5A 2JEEA 2IFNA 3WMM0 4DOJA 1H89A 2E42A 3HD7C 4GT1A 1QL2A 3N4XA 3UIAA 2O1KA 1FU1A 3GHGC 1SFCC 2FYZA 1J1DB 2XU6A 1JY3N 1RF1A 2KP8A 3P8CD 5AW3B 1GTWA 3V2PA 2WZ7A 5AW2B 1YTZI 3EQ2A 1FZCC 4I6MC 1J1EB 2BASA 3V5BA 2GUVA 2IX7C 5APWA 1N73B 2P1JA 3M9BA 1G2CA 1N7SC 3V4WA 3M9HA 2HODA 3RK3C 1PFIA 1VPCA 4N78D 1JNMA 3V2RA 5AW7B 4B86A 3NMDA 1T8ZA 2P7JA 3B5NC 3U59A 2M3BA 2N1TA 1LTGC 1RF1B 3EFGA 1JCCA 5APSA 1H8AA 1KZUB 4IFFA 1LTAC 1NTZK 2NPSD 1URQA 3PP5A 1RF0C 1GW4A 2YO2A 4RESB 5APUA 4I1LA 2WWWA 2YKQA 1JY3O 2R5DA 3O8ZA 1GU4A 3KDPB 4C7NA 2WSEH 1XTGB 4HYTB 5BU8B 3BATA 2HODB 1LT9A 1NO4A 1SVFA 1N73C 4IFDK 1LWUA 5AW5B 2YMYA 3TNUA 2OYIC 5KLVK 4ZKUA 2L5GB 4LLHA 2N1TD 2OYHC 2WSFH 1NTKK 1FOSF 4W7ZA 5CMZA 3CI9A 3OAKA 2C9LY 4JYCA 3H32A 1JY2N 5AW1B 1GL2A 1IFMA 1URQB 1LTBC 5CJ0A 1JY3P 1W2EA 2XDJA 4XE5B 1S9KD 1GK4A 1RF1C 2Z5HA 2WPRA 4M3LA 1SQBK 3M0AA 3HE4A 1ZV8A 1KILD 1L0NK 1NU1K 2NPSC 1LT9B 4AYCA 3M9QA 4OH8B 1RY3A 1LWUB 3VP9A 2FFDC 5AVTB 1FZAA 1E5WA 5AVZB 3VN0A 2ZFCA 3HTKB 3L4FA 3KQGA 2WPSA 1RE4A 3N7NA 3TYYA 1L4AD 3P8MC 2POHA 1GL2D 1FZBA 2Q9IA 3H32B 4Y99C 2HYNA 2C9NY 1T2KD 2N1TC 1DEBA 1H88A 1FOSE 1LTJC 1OWAA 1T3UA 3HUSC 3HE4B 2FXMA 1JY2O 1OXZA 1WRGA 3R2PA 1IFDA 2I1KA 2PAJA 1IFNA 2WTYA 1CW5A 2E43A 5APXA 1J2JB 1JOCA 2XV5A 4I2LC 1A02J 1KILC 3L36A 1WT6A 3L37A 2YKPA 4DZOA 2CPSA 5CCHA 2HPCB 2WPQA 1GW3A 2FKWB 3LW5H 3NTNA 1IFJA 1NAFA 3BASA 1AQ5A 1LTSC 5AVXB 3MTUE 5AVRB 2N9BA 4HH2A 3NXSA 4C7RA 1MZ9A 1JY2P 4WY4A 1L4AC 3RK2B 1G1JA 1GL2C 4LC1A 5CJ4A 1LTIC 2P2UA 5AVUB 1G1IA 3VOPA 1T2KC 5KJ7A 1J1DC 2XZRA 3P32A 1FJKA 2KOGA 3L35A 3VP8A 3TK1A 5KTBA 4EOTA 2P67A 3LIEA 1J1EC 5BVZA 5AW8B 1JTHB 2Q3IA 5AVYB 1ZN5A 3A7OA 2XKMA 4WY4B 1YYCA 3E1IA 1IO4A 1SFCA 1LGHB 3MIWA 4WBAA 3M0DA 2KB7P 3HTKA 1A02F 1M1JB 1NKZB 1QL1A 2KYVA 2R5BA 1XTCC 3KYQA 5BU5A 1URQD 3SWFA 1FZEA 5AVVB 3U1AA 3SWYA 5AW4B 4KHXA 4IFMA 3VMYA 3KPEA 3BRVB 1GD2E 3V2QA 1KQLA 1GZLA 3C9IA 1X8YA 1AFOA 3CL3D 3P7KA 1X79B 1KFMA 3V4QA 3LIDA 4N6JA 4N78E 1YTZT 1IJDB 5CCGA 5CCHC 5AW6B 1X9VA 3B5NA 2HLOA 2GUSA 3II6A 1SFCB 3GHGB 1SP4A 2MJZA 1GU5A 1CZQA 1HUCA 2HPCA 1MUUA 3IFMA 2WSCH 1RF0A 3VMXA 1FZCB 1N7LA 1ZR4A 3RL0D 2WT7B 3RL0B 3A5TA 5AW0B 1T3JA 1VDFA 1N2DC 1N7SB 3I5CA 1MFZA 3HE5A 1URQC 3RK3B 2C0XA 2R3CA 5CCGD 2J59M 3CLQA 1JUNA 2YO3A 4N3YB 1HVVA 3B5NB 2OYIA 3G3ZA 2GM4A 4W7YA 4LGDE 2KSJA 2OYHA 1LT9C 3OA7A 2KLVA 1HGZA 4GIFA 4EIJA 1FJPA 1LWUC 1IK9A 3VMZA 1NHLA 5AW9B 1JTHA 3M0DC 2W27A 1M7LA 1HBWA 4C46A 1S9KE 3B8EB 3RK2D 1RE3A 2JJLA 1GDTA 2NPSA 5AVSB 3HE5B 2Z5IA 1FDMA 2Z4EA 2A45H 1L0LK 1GK6A 1M1JA 3RL0C 4AQRD 2H7HA 1LTTC 2H43A 2FFDA 1KFNA 2OYIB 2PP6A 5APYA 4O9BA 2OYHB 4GKGA 5CCHD 2QM7A 1SQPK 3IR9A 3M06A 3U1CA 2Q5UA 5CCGC 4ZKPA 1IFIA 1DX7A 2R32A 2FYUK 3MD0A 5AVQB 4WB4A 1SQVK 1FAVA 2YNYA 3HD7A 3M91A 1FZGA 1LTJA 2WITA 2XNXA 3HUSA 1DH3A 1RE4C 4WY4D 1FZFA 1JMMA 1IC2A 3MGNA 3GHGA 2NPSB 1ZLLA 3A2AA 1NH4A 2C0WA 1FBMA 3P8CE 3VYIA 3BRTB 1G2CB 2A45I 5KJ7D 2HG5D 3V2NA 2FFDB 1MV8A 1FZCA 3RK2C 4AUWA 2Q7CA 1KILA 2OARA 3NFQA 2W6AA 2O1JA 1HH0A 2WT7A 4JF7A 2HFED 2VRSA 5APQA 1N7SA 4Y99B 3HD7D 4JYBA 2M8RA 1HWTC 1SQXK 2IPPA 1NOHA 2N1TB 3HD7B 2I1JA 2A45G 5APTA 5AVWB 1LTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI6 A;  2R5D A;  3NTN A;  3O8Z A;  1GU4 A;  3KDP B;  1NAF A;  1MFZ A;  1SLQ A;  3HE5 A;  3T97 A;  5AVX B;  4C7N A;  5AVR B;  2N9B A;  2ZXE B;  2R3C A;  3NXS A;  4HYT B;  1HJB A;  1JUN A;  2YO3 A;  5APV A;  4LC1 A;  4C7N B;  1CSB A;  1NWQ A;  3A3Y B;  2P2U A;  5AVU B;  5AW5 B;  3VTP C;  3TNU A;  1T2K C;  2QM8 A;  1FOS F;  3VMZ A;  5CMZ A;  3OAK A;  2XZR A;  3P32 A;  4JYC A;  5AW9 B;  2C9L Y;  3TNU B;  3L35 A;  1HBW A;  2W27 A;  4C46 A;  5AW1 B;  3TK1 A;  1S9K E;  3B8E B;  4EOT A;  4XE5 B;  2P67 A;  3LIE A;  1S9K D;  1GK4 A;  2JJL A;  5AW8 B;  1CI6 B;  2Z5H A;  2WPR A;  4M3L A;  5AVS B;  2Q3I A;  2Z5I A;  3HE5 B;  3M0A A;  3HE4 A;  5AVY B;  3A7O A;  1GK6 A;  4AQR D;  1H89 A;  2E42 A;  1YYC A;  2H7H A;  4AYC A;  1IO4 A;  4GT1 A;  3M0D A;  3HTK A;  5APY A;  3UIA A;  1A02 F;  4GKG A;  2QM7 A;  2R5B A;  2XU6 A;  3IR9 A;  3M06 A;  5AVT B;  2Q5U A;  2KP8 A;  3SWF A;  5AVZ B;  3VN0 A;  2ZFC A;  5AW3 B;  1GTW A;  3KQG A;  2R32 A;  2WPS A;  5AVV B;  5AW2 B;  3TYY A;  3MD0 A;  5AVQ B;  3P8M C;  5AW4 B;  4I6M C;  4KHX A;  3VMY A;  1FAV A;  2BAS A;  2YNY A;  3V5B A;  3M91 A;  1GD2 E;  1DH3 A;  1KQL A;  5APW A;  1GZL A;  1X8Y A;  2C9N Y;  3M9B A;  1T2K D;  3MGN A;  3P7K A;  1H88 A;  3V4Q A;  1FOS E;  1OWA A;  3LID A;  3M9H A;  3V4W A;  3HE4 B;  5AW6 B;  3A2A A;  1OXZ A;  3VYI A;  1JNM A;  1G2C B;  1SP4 A;  1MV8 A;  5AW7 B;  4B86 A;  3NMD A;  2WTY A;  4AUW A;  2Q7C A;  1GU5 A;  2E43 A;  1CZQ A;  1HUC A;  2P7J A;  5APX A;  1J2J B;  3NFQ A;  1MUU A;  2W6A A;  2XV5 A;  2WT7 A;  4I2L C;  1A02 J;  3VMX A;  2VRS A;  5APQ A;  3L36 A;  5APS A;  1H8A A;  3L37 A;  4DZO A;  4RES B;  2WPQ A;  4JYB A;  2YO2 A;  2WT7 B;  5APU A;  1HWT C;  2IPP A;  3A5T A;  5AW0 B;  2WWW A;  5APT A;  5AVW B;  3I5C A; 
#chains in the Genus database with same CATH topology
 3BVH A;  1NKN A;  3T97 A;  1SFC D;  3JSV C;  1HGV A;  2FYU E;  1AA0 A;  2ZT9 C;  2CPB A;  1RE3 C;  4WY4 C;  5C39 A;  1SQP J;  3SSU A;  4PD4 E;  3VTP C;  2W6B A;  1EQ7 A;  2BEZ F;  3L75 E;  1SQV J;  1PGJ A;  3PJS K;  2QJK C;  3AE6 C;  3B5N D;  1JB0 J;  3W67 A;  3JCU H;  4ZMD A;  1R8E A;  3WMM 0;  2E42 A;  3HD7 C;  4U3F D;  2R3S A;  4GT1 A;  1QL2 A;  2K1A A;  3N4X A;  1IFP A;  3GHG C;  2XU6 A;  1NTM E;  1JY3 N;  3CXH D;  1GTW A;  3V2P A;  5CBN A;  2WZ7 A;  2QJY C;  1W2B O;  4I6M C;  5KKZ C;  2JR8 A;  1AJY A;  3M9B A;  1Q82 Q;  2P10 A;  2A06 E;  1BCC J;  1Q86 Q;  4N78 D;  1VL2 A;  5AW7 B;  3L74 G;  2P7J A;  3G4S P;  3ITK A;  5APS A;  1JEK A;  2JP3 A;  4RES B;  1NTZ K;  2E5T A;  2YO2 A;  1GW4 A;  2R5D A;  3KDP B;  3L73 G;  2KNC A;  3BAT A;  5E79 E;  1LT9 A;  3C1L A;  1SQX D;  2OTJ P;  4R4M A;  4W7Z A;  4JYC A;  4UB8 E;  1RF1 C;  2IDB A;  2KLU A;  1SQB K;  3M0A A;  3G6E P;  2V7Q J;  1SQQ D;  1NJI Q;  1R5L A;  2ZYG A;  3Q5P A;  1AVO A;  2KZI A;  5AVZ B;  2E75 B;  3KQG A;  1RE4 A;  5KAI H;  4D6T G;  1BE3 E;  1SQX G;  4Y99 C;  2HYN A;  5KLV E;  1AVY A;  4ASW A;  3RGU A;  1NTK E;  1H88 A;  2KS1 A;  3L71 G;  1FOS E;  3HUS C;  1JY2 O;  3SWK A;  5H2F H;  4DJG A;  1PGO A;  3JC2 2;  1IFD A;  2PAJ A;  2WTY A;  1SQQ G;  4D6T J;  1J2J B;  1A02 J;  1EZV E;  2YKP A;  2CPS A;  4DZO A;  2HPC B;  2WPQ A;  3CCS P;  4QMA A;  1P84 H;  3S4R A;  1OIP A;  4KT0 J;  2OQQ A;  3MTU E;  1L0N J;  3NXS A;  1MZ9 A;  1L4A C;  3RK2 B;  1GL2 C;  2QJP B;  4LC1 A;  5CJ4 A;  1WMK A;  3H25 A;  1Y9B A;  3C8V A;  1G1I A;  1PV3 A;  1Y8A A;  2WSS H;  3AE9 C;  1Q81 Q;  3P32 A;  1KV4 A;  3VP8 A;  5B66 E;  3O6Q B;  1VF5 C;  5KAF H;  2SPZ A;  2ZT9 B;  4U3F E;  2WSC J;  3BCC J;  4WY4 B;  1YYC A;  3E1I A;  2KB7 P;  3HTK A;  4U7J A;  4GOD A;  3CXH E;  3V6I A;  2R5B A;  1XTC C;  3WU2 H;  3L72 D;  3SWY A;  2K88 A;  3CME P;  2QJK B;  3TDK A;  3V2Q A;  1KQL A;  3C9I A;  1X8Y A;  1NU1 D;  2KZJ A;  3P7K A;  1X79 B;  3LID A;  4N78 E;  2H89 C;  4RJT A;  2HLO A;  2GUS A;  3GHG B;  3AE3 C;  4H13 C;  2IYP A;  2QJY B;  1RF0 A;  5GTH E;  5KKZ B;  2KIK A;  4ZNC A;  3RL0 B;  3A5T A;  5AW0 B;  1T3J A;  3I5C A;  3A0B E;  1URQ C;  2Y0E A;  2J59 M;  3CLQ A;  2FYN C;  3CX5 I;  1NU1 G;  1HVV A;  3Q3D A;  2J5U A;  1RQV A;  1HF9 A;  2JWA A;  1PP9 E;  1NHL A;  3M0D C;  1HBW A;  4C46 A;  3AEG C;  3K5B A;  1AV1 A;  3PHL A;  1VQ8 P;  2NPS A;  1FDM A;  3HE5 B;  3H1L D;  1UII A;  2N9Y B;  1M1J A;  2H43 A;  2D2C C;  1NTZ D;  2QM7 A;  3M06 A;  4OGQ D;  3D71 A;  4L76 A;  3ABV C;  3RL0 g;  3FWL A;  1M57 D;  3CPW O;  4WB4 A;  1FAV A;  1S5L E;  1FZG A;  1E79 H;  1OFC X;  3CC2 P;  2Y9Y A;  1FBM A;  2AEM A;  1OMI A;  2HG5 D;  1FZC A;  3H1L G;  2G3A A;  3EFF K;  2G8Y A;  2Q7C A;  1KQF B;  3OW2 O;  2O01 N;  1NAY A;  2W6A A;  1DIP A;  1SQB D;  2VRS A;  1N7S A;  4Y99 B;  2WMM A;  3PH0 A;  4JYB A;  2W90 A;  1SQX K;  2IPP A;  2Y0C A;  3H1I D;  1BDC A;  1SS1 A;  4I7Z C;  4BXL A;  1KQG B;  3F89 A;  3HUS B;  4XA4 A;  2ZXE B;  2FBW C;  2J58 A;  1KC8 Q;  4W80 A;  2H8P D;  1IZN B;  4NPF X;  3USS A;  3GG2 A;  1NWQ A;  1SQQ K;  3CX5 D;  2YMK A;  3EWK A;  2FYU J;  5CHX A;  1HTL C;  2QM8 A;  1N7S D;  2BCC E;  5KJ7 C;  2Q6Q A;  3FGA D;  5GTI H;  3CMA P;  2JKV A;  1CI6 B;  1L4A B;  3L75 J;  1GL2 B;  3L70 G;  3OJA B;  2IFN A;  2K37 A;  4DOJ A;  1H89 A;  1JMB A;  2AXC A;  2XND H;  1YJ9 P;  1FU1 A;  1SFC C;  2FYZ A;  2JO1 A;  3L72 E;  3I56 P;  1BGY D;  2M5A A;  3SFE C;  2KP8 A;  3P8C D;  5AW2 B;  1VF5 B;  3W68 A;  2B87 B;  3V5B A;  1KMI Z;  1N73 B;  2P1J A;  1EXJ A;  1NTM J;  2IBZ D;  1L2P A;  1QX8 A;  3V4W A;  4EDF A;  1PL5 A;  2WSF J;  3NMD A;  2Q1K A;  2UWJ E;  3B5N C;  4PJ0 H;  2N1T A;  3EFG A;  1JCC A;  3AE8 C;  4H0L D;  4IFF A;  3PP5 A;  1BGY G;  1JY3 O;  1BSH A;  1GU4 A;  3O8Z A;  1PGQ A;  4C7N A;  2WSE H;  1XTG B;  2NZ2 A;  5BU8 B;  2HOD B;  4H13 B;  4TT3 H;  2IBZ G;  1K04 A;  3B71 A;  1L0L E;  1M90 Q;  4IFD K;  3CWB G;  3TNU A;  2OYI C;  4ZKU A;  1SQP G;  2N1T D;  2OYH C;  1FC2 C;  1FOS F;  5CMZ A;  3CI9 A;  2C9L Y;  1ZP0 C;  2W8Z A;  1YQ3 C;  1IFM A;  1SQV G;  1URQ B;  3G71 P;  3VMA A;  1S9K D;  3FXE A;  4M3L A;  2FYN B;  3CWB J;  1BCC D;  1OVV A;  1KIL D;  1NTZ E;  1NU1 K;  3FWN A;  2Q3E A;  4YPC A;  4OH8 B;  1FE6 A;  3VP9 A;  4EYY Q;  3LW5 J;  1K73 Q;  2ZFC A;  1K05 A;  2OTK E;  3N7N A;  2POH A;  3H32 B;  1M1K Q;  3L74 D;  4IL6 H;  1DEB A;  3KZI H;  1YJW P;  2D2C B;  1QEX A;  1LTJ C;  1T3U A;  3S1K A;  3HE4 B;  1OXZ A;  3MHV A;  3R2P A;  1BE3 J;  1BCC G;  1IFN A;  5TIS E;  1CW5 A;  4R4L A;  5KLV J;  1SQB E;  1QLE D;  2V7Q H;  5APX A;  2WSE J;  1NTK J;  1S1C X;  1EDJ A;  3L73 D;  4I2L C;  2NRG A;  3H1H E;  3H1I E;  3L36 A;  5CCH A;  3Q5R A;  1GW3 A;  2FKW B;  2RMZ A;  2QVA A;  4UB6 E;  2N9B A;  4HH2 A;  4C7R A;  1JY2 P;  2E76 B;  3S9O A;  4WY4 A;  3CCV P;  3CX5 E;  4H44 D;  3VOP A;  4BRY B;  1EC5 A;  1MKM A;  5EFW B;  3MUD C;  4YXW H;  1J1D C;  4I7Z B;  1FJK A;  1S5L X;  3TK1 A;  4EOT A;  3I55 P;  3LIE A;  1J1E C;  1LJ2 A;  1P84 I;  1ZN5 A;  1IO4 A;  1LGH B;  4D6T D;  1A02 F;  1NKZ B;  2KYV A;  4U3F J;  3L71 D;  1FZE A;  1NYH A;  3U1A A;  3CCL P;  2OYO A;  3BRV B;  2ZVN B;  3E1R A;  1AFO A;  3V4Q A;  4N6J A;  1ZOY C;  5CCG A;  1KB9 H;  5AW6 B;  1D7M A;  1SFC B;  1W5C E;  2MJZ A;  3Q5S A;  2IZ1 A;  2K9Y A;  1GU5 A;  3IFM A;  5B5E E;  2WSC H;  3RBX A;  1KYO H;  1ZR4 A;  3RL0 D;  4PV1 B;  3AE7 C;  2WT7 B;  1VQP P;  1N2D C;  1MFZ A;  3HE5 A;  2C0X A;  2R3C A;  5CCG D;  1JUN A;  1L0N G;  3B5N B;  3G3Z A;  4W7Y A;  2KXP B;  2K9J B;  2IZ0 A;  1LWU C;  2M3E A;  1JTH A;  2FY8 A;  1S9K E;  2R44 A;  1FS0 E;  1OW8 A;  2LXB A;  1GDT A;  1RH5 B;  1EDI A;  1KIL E;  1YIT P;  5CBO A;  1PP9 J;  2A45 H;  5DJT B;  1P84 D;  1PZQ A;  1KFN A;  2OYI B;  3BCC G;  2PP6 A;  4RO0 A;  2OYH B;  1U7M A;  1SQP K;  3IR9 A;  2JWD A;  3CC4 P;  3MD0 A;  5AVQ B;  3L74 E;  1SQV K;  2O3J A;  3HUS A;  1FZF A;  1BDD A;  3MGN A;  2O01 J;  1USE A;  3JCU E;  1LP1 B;  2AXT H;  1MV8 A;  3L73 E;  1YIJ P;  4BWN A;  1K9M Q;  3Q1M A;  4EI2 A;  2ZXX A;  4NPE A;  3HD7 B;  2I1J A;  2A45 G;  5AVW B;  1LTJ B;  1CI6 A;  1L4A A;  4OGQ C;  1ZR2 A;  1JCD A;  2E74 D;  1CSB A;  2ZAE B;  1M1J C;  3HRN A;  1N86 A;  3RK3 D;  2B87 A;  1RQU A;  1N73 A;  4K35 A;  2ZJS E;  2JEE A;  4D6T E;  2BCC J;  1SQX E;  2ZYD A;  1S4X A;  3A0H H;  2KSE A;  3UIA A;  3L71 E;  3H1J G;  1J1D B;  5AW3 B;  3EQ2 A;  3H1K G;  1SQQ E;  1FZC C;  1J1E B;  3TGU G;  3QH9 A;  1PPJ G;  3L72 J;  1G2C A;  2MKV A;  3H1J J;  1N7S C;  2HOD A;  1PFI A;  2QIW A;  1VPC A;  4PD4 H;  5TJH A;  3H1K J;  1T8Z A;  3TGU J;  2M3B A;  1LTG C;  1RF1 B;  2IBZ I;  1H8A A;  1KZU B;  1LTA C;  3RBZ A;  2NPS D;  1URQ A;  4I1L A;  2WWW A;  3L75 D;  5KAI E;  2PFX A;  2QSI A;  4HYT B;  2KK7 A;  3ZDM A;  2CK3 H;  5H2F E;  5TIS H;  4WVZ A;  2L5G B;  3L70 D;  2WSF H;  4YXD C;  3MZW B;  2FYU G;  1K8A Q;  1H0T B;  1YQ4 C;  3H32 A;  1L0L J;  3GW6 A;  5CJ0 A;  1JY3 P;  2XDJ A;  4XE5 B;  1P84 E;  4UB6 H;  3HE4 A;  4WWI A;  1VQ4 P;  1ZV8 A;  5M1B A;  4H0L C;  1L0N K;  3L75 G;  2BEQ D;  1M56 D;  4L75 A;  2ITA A;  1Q7Y Q;  2RH0 A;  1LWU B;  2FFD C;  5AVT B;  1FZA A;  1E5W A;  2M0B A;  2YXR B;  3VN0 A;  1YHQ P;  3HTK B;  3L4F A;  3CCM P;  3P8M C;  1FZB A;  2Y0D A;  2Q9I A;  1U57 A;  2C9N Y;  1T2K D;  5KAF E;  2N1T C;  1QVF O;  5E79 H;  1OWA A;  2FXM A;  1NTM G;  1WRG A;  3D6Y A;  4L73 A;  4BRY A;  1AQT A;  1EDL A;  4DT0 A;  3WUT A;  1JOC A;  2XV5 A;  1NU1 E;  4OWF A;  1KIL C;  2W83 C;  4NPD A;  4UB8 H;  3WU2 E;  1WT6 A;  3L37 A;  1VQL P;  2A06 G;  3GF7 A;  3LW5 H;  3CWB D;  4DCK A;  2FXP A;  3NTN A;  1IFJ A;  5AVX B;  1Q90 D;  2E76 D;  1SQP D;  2H88 C;  5AVR B;  3GF3 A;  3H1H J;  1HJ0 A;  3H1I J;  1G1J A;  1VQ6 P;  1LTI C;  1SQV D;  5AVU B;  5KJ7 A;  5KLI C;  2XZR A;  2KOG A;  1FDO A;  3L35 A;  4OGQ B;  5L8R J;  5KTB A;  3PTZ A;  5BVZ A;  5AW8 B;  1VQ7 P;  2Q3I A;  2XKM A;  1BE3 D;  1SFC A;  5KLV D;  2OTL P;  1NTK D;  1M1J B;  3IAO A;  2AEF A;  3TF5 A;  3H1L E;  4JPZ B;  4H44 C;  5AW4 B;  1GMJ A;  4KHX A;  4IFM A;  3VMY A;  4TLF A;  1GD2 E;  1YJN P;  1GZL A;  2B88 A;  5CCH C;  1X9V A;  3B5N A;  1OVR A;  1KTM A;  2E75 D;  2K9J A;  1BE3 G;  2HPC A;  5KLV G;  3VMX A;  1FZC B;  1KQS O;  1N7L A;  5B66 H;  1NTK G;  4PV1 D;  1S2E A;  1VDF A;  1ZRT D;  1N7S B;  2B9B A;  1OZH A;  1EDK A;  3CXH H;  2OYI A;  2DW3 A;  2HR3 A;  2GM4 A;  1KB9 I;  4GDO A;  3AEE C;  1EZV G;  2KSJ A;  2OYH A;  3L70 E;  1LT9 C;  1NGM B;  2KLV A;  4GIF A;  3O6Q A;  1IK9 A;  3VMZ A;  2W27 A;  1M7L A;  3Q2Y A;  1KYO I;  3RK2 D;  1RE3 A;  3AEA C;  5AVS B;  2Z5I A;  1YI2 P;  2JDI H;  1L0L K;  1LP1 A;  3RL0 C;  4AQR D;  1LTT C;  2H7H A;  4CPG A;  4O9B A;  4Z1M H;  5GTH H;  4GKG A;  5CCH D;  2Y9Z A;  4YTP C;  3U1C A;  5CCG C;  3GLM A;  2R32 A;  2FYU K;  4U3F G;  2ZT9 D;  2M5A B;  3HD7 A;  3KHU A;  3M91 A;  1UIX A;  3A0B H;  1LTJ A;  1DH3 A;  5K5G B;  1RE4 C;  4WY4 D;  1KD1 Q;  1JMM A;  4H0L B;  4OVN F;  5GTI E;  3AE2 C;  2PGD A;  3GHG A;  1JM0 A;  3A2A A;  1BGY E;  1NH4 A;  3AE1 C;  3P8C E;  3VYI A;  3L74 J;  3BRT B;  2A45 I;  2FFD B;  3AEB C;  4AUW A;  2L91 A;  3NFQ A;  1HH0 A;  2RN0 A;  4JF7 A;  2HFE D;  2RKL A;  5APQ A;  2IBZ E;  4JBZ A;  1L0N D;  3CWB E;  3HD7 D;  1HWT C;  1NOH A;  2N1T B;  3L73 J;  1SQP E;  1PP9 D;  1Q2N A;  4HKZ H;  3SFD C;  1SLQ A;  1ZME C;  1NTM K;  3AE5 C;  2IFM A;  1HJB A;  1SQV E;  3TSI A;  4A7P A;  5APV A;  3MUD A;  4C7N B;  2LKM A;  3A3Y B;  3CCE P;  2O01 H;  2QRX A;  1VQN P;  1USD A;  1KIL B;  1KB9 D;  4XFJ A;  1X22 A;  3H6P A;  4PJ0 E;  1S5L H;  3TNU B;  2PRR A;  3BCC D;  2WQY C;  1Z56 A;  1KYO D;  3T97 B;  2YKO A;  1IK7 A;  1JO5 A;  1MFT A;  4HJG H;  1PP9 G;  1EXI A;  3CCR P;  5KLI B;  2V4H A;  2O1K A;  1RF1 A;  1KOR A;  2E74 C;  2W6J H;  1YTZ I;  1SQX J;  1BCC E;  2OGU A;  2BAS A;  2YIU C;  2IYO A;  1TU3 F;  2GUV A;  2IX7 C;  3L71 J;  5APW A;  3D70 A;  1FDI A;  1VQM P;  4JQ0 D;  3M9H A;  4MN4 C;  2GA1 A;  3RK3 C;  1SQQ J;  1JNM A;  4IOI H;  3V2R A;  1S72 P;  4B86 A;  3U59 A;  3FXD A;  4KJM A;  4H44 B;  1ZXG A;  1H0T A;  1ZRT E;  1OVU A;  2P58 A;  1RF0 C;  4Y28 J;  5APU A;  1DEE G;  2YKQ A;  2QA4 P;  1N8R Q;  3WUU A;  2E5Y A;  1QVG O;  2QE7 H;  4IL6 E;  2BCC D;  2KUB A;  3KZI E;  1NO4 A;  1SVF A;  1N73 C;  1LWU A;  3R4Y A;  5AW5 B;  4PD4 I;  2YMY A;  2WVR A;  5KLV K;  4LLH A;  1NTK K;  3IF4 A;  3OAK A;  1VQ5 P;  1JY2 N;  5AW1 B;  1GL2 A;  3AEF C;  1LTB C;  1W2E A;  2QG4 A;  1GK4 A;  3H1J D;  2Z5H A;  2WPR A;  1OW7 A;  2QEX P;  2KNC B;  2NPS C;  3H1K D;  1LT9 B;  4AYC A;  3M9Q A;  3TGU D;  1RY3 A;  2BCC G;  4ASV A;  1PPJ D;  2YXQ B;  3KXD A;  2I8D A;  2WPS A;  3TYY A;  1L4A D;  1GL2 D;  2LR2 A;  3L72 G;  1U7J A;  3B4S A;  1BSN A;  2I1K A;  3FX0 A;  1VF5 D;  2E43 A;  1X0T A;  1L0N E;  2ZYA A;  1L0L D;  2WPV B;  2ZVO B;  1KN7 A;  1NAF A;  3BAS A;  3CC7 P;  1AQ5 A;  1LTS C;  1NU1 J;  2KS1 B;  1ZW0 A;  2FYU D;  2KI7 B;  1KB9 E;  3CCU P;  2P2U A;  3AED C;  1T2K C;  3WUV A;  4PD4 D;  1VQ9 P;  3BCC E;  3AE4 C;  3F5H A;  1KYO E;  2P67 A;  4H13 D;  1L0L G;  1JTH B;  5AVY B;  1S3J A;  3A7O A;  4L74 A;  1PIX A;  3MIW A;  4WBA A;  3M0D A;  3PLN A;  1QL1 A;  3CCJ P;  2E76 C;  3KYQ A;  1PGP A;  5BU5 A;  1URQ D;  3SWF A;  1OX3 A;  5AVV B;  1NTM D;  3PRJ A;  1NTZ G;  3KPE A;  2K3R A;  3CL3 D;  3GMA A;  1NVO A;  3H1H D;  3CX5 H;  1KFM A;  1T6A A;  1YTZ T;  3CD6 P;  1IJD B;  1R5S A;  3H1L J;  3II6 A;  2A06 D;  4GOF A;  1SP4 A;  1CZQ A;  1HUC A;  1NTZ J;  2E74 B;  1MUU A;  2YIU B;  3D6Z A;  2LXC B;  1EZV I;  4RKU J;  2D2C D;  2FXO A;  3CCQ P;  1QGK B;  3RK3 B;  1SQB G;  1M8O B;  2YO3 A;  4N3Y B;  3H1H G;  3H1I G;  4LGD E;  3OA7 A;  2AXT E;  1OW6 A;  1HGZ A;  4EIJ A;  1FJP A;  5AW9 B;  1SQB J;  2E75 C;  3H1J E;  5DJU B;  3B8E B;  3G9R A;  3L70 J;  2JJL A;  3E7K A;  2AEJ A;  2Z4E A;  3H1K E;  1Y47 A;  1GK6 A;  4PV1 C;  3TGU E;  1PPJ E;  2FFD A;  1LNQ A;  3AEC C;  3RK3 E;  5B5E H;  5APY A;  3CXH I;  4GOE A;  2Q5U A;  4ZKP A;  1IFI A;  1DX7 A;  1DD3 A;  2YNY A;  4HB1 A;  2WIT A;  2XNX A;  3MP7 B;  1IC2 A;  4IL6 X;  2NPS B;  1ZLL A;  2C0W A;  1DD4 A;  1G2C B;  1VQK P;  5KJ7 D;  3QWO C;  3V2N A;  1VQO P;  2B89 A;  1RHZ B;  3RK2 C;  1KIL A;  2QJP C;  2OAR A;  2O1J A;  2WT7 A;  3A0H E;  1LT1 A;  3IN6 A;  4K3A A;  1BGY J;  1YBK A;  2M8R A;  1EZV D;  5APT A; 
#chains in the Genus database with same CATH homology
 1CI6 A;  3HUS B;  1L4A A;  1NKN A;  3BVH A;  3T97 A;  1ZR2 A;  1SLQ A;  1SFC D;  4XA4 A;  1JCD A;  1HGV A;  2ZXE B;  2J58 A;  1NTM K;  4W80 A;  2IFM A;  1HJB A;  3TSI A;  2H8P D;  5APV A;  3MUD A;  4C7N B;  1CSB A;  2LKM A;  3A3Y B;  2CPB A;  1NWQ A;  1SQQ K;  1RE3 C;  4WY4 C;  2O01 H;  1KIL B;  3VTP C;  2W6B A;  3H6P A;  1EQ7 A;  5CHX A;  1HTL C;  2QM8 A;  1M1J C;  1N7S D;  1N86 A;  3HRN A;  3RK3 D;  3TNU B;  5KJ7 C;  1N73 A;  1Z56 A;  3B5N D;  1CI6 B;  1L4A B;  2YKO A;  1GL2 B;  3OJA B;  1JO5 A;  2JEE A;  2IFN A;  3WMM 0;  4DOJ A;  1H89 A;  2E42 A;  3HD7 C;  4GT1 A;  1QL2 A;  3N4X A;  3UIA A;  2O1K A;  1FU1 A;  3GHG C;  1SFC C;  2FYZ A;  1J1D B;  2XU6 A;  1JY3 N;  1RF1 A;  2KP8 A;  3P8C D;  5AW3 B;  1GTW A;  3V2P A;  2WZ7 A;  5AW2 B;  1YTZ I;  3EQ2 A;  1FZC C;  4I6M C;  1J1E B;  2BAS A;  3V5B A;  2GUV A;  2IX7 C;  5APW A;  1N73 B;  2P1J A;  3M9B A;  1G2C A;  1N7S C;  3V4W A;  3M9H A;  2HOD A;  3RK3 C;  1PFI A;  1VPC A;  4N78 D;  1JNM A;  3V2R A;  5AW7 B;  4B86 A;  3NMD A;  1T8Z A;  2P7J A;  3B5N C;  3U59 A;  2M3B A;  2N1T A;  1LTG C;  1RF1 B;  3EFG A;  1JCC A;  5APS A;  1H8A A;  1KZU B;  4IFF A;  1LTA C;  1NTZ K;  2NPS D;  1URQ A;  3PP5 A;  1RF0 C;  1GW4 A;  2YO2 A;  4RES B;  5APU A;  4I1L A;  2WWW A;  2YKQ A;  1JY3 O;  2R5D A;  3O8Z A;  1GU4 A;  3KDP B;  4C7N A;  2WSE H;  1XTG B;  4HYT B;  5BU8 B;  3BAT A;  2HOD B;  1LT9 A;  1NO4 A;  1SVF A;  1N73 C;  4IFD K;  1LWU A;  5AW5 B;  2YMY A;  3TNU A;  2OYI C;  5KLV K;  4ZKU A;  2L5G B;  4LLH A;  2N1T D;  2OYH C;  2WSF H;  1NTK K;  1FOS F;  4W7Z A;  5CMZ A;  3CI9 A;  3OAK A;  2C9L Y;  4JYC A;  3H32 A;  1JY2 N;  5AW1 B;  1GL2 A;  1IFM A;  1URQ B;  1LTB C;  5CJ0 A;  1JY3 P;  1W2E A;  2XDJ A;  4XE5 B;  1S9K D;  1GK4 A;  1RF1 C;  2Z5H A;  2WPR A;  4M3L A;  1SQB K;  3M0A A;  3HE4 A;  1ZV8 A;  1KIL D;  1L0N K;  1NU1 K;  2NPS C;  1LT9 B;  4AYC A;  3M9Q A;  4OH8 B;  1RY3 A;  1LWU B;  3VP9 A;  2FFD C;  5AVT B;  1FZA A;  1E5W A;  5AVZ B;  3VN0 A;  2ZFC A;  3HTK B;  3L4F A;  3KQG A;  2WPS A;  1RE4 A;  3N7N A;  3TYY A;  1L4A D;  3P8M C;  2POH A;  1GL2 D;  1FZB A;  2Q9I A;  3H32 B;  4Y99 C;  2HYN A;  2C9N Y;  1T2K D;  2N1T C;  1DEB A;  1H88 A;  1FOS E;  1LTJ C;  1OWA A;  1T3U A;  3HUS C;  3HE4 B;  2FXM A;  1JY2 O;  1OXZ A;  1WRG A;  3R2P A;  1IFD A;  2I1K A;  2PAJ A;  1IFN A;  2WTY A;  1CW5 A;  2E43 A;  5APX A;  1J2J B;  1JOC A;  2XV5 A;  4I2L C;  1A02 J;  1KIL C;  3L36 A;  1WT6 A;  3L37 A;  2YKP A;  4DZO A;  2CPS A;  5CCH A;  2HPC B;  2WPQ A;  1GW3 A;  2FKW B;  3LW5 H;  3NTN A;  1IFJ A;  1NAF A;  3BAS A;  1AQ5 A;  1LTS C;  5AVX B;  3MTU E;  5AVR B;  2N9B A;  4HH2 A;  3NXS A;  4C7R A;  1MZ9 A;  1JY2 P;  4WY4 A;  1L4A C;  3RK2 B;  1G1J A;  1GL2 C;  4LC1 A;  5CJ4 A;  1LTI C;  2P2U A;  5AVU B;  1G1I A;  3VOP A;  1T2K C;  5KJ7 A;  1J1D C;  2XZR A;  3P32 A;  1FJK A;  2KOG A;  3L35 A;  3VP8 A;  3TK1 A;  5KTB A;  4EOT A;  2P67 A;  3LIE A;  1J1E C;  5BVZ A;  5AW8 B;  1JTH B;  2Q3I A;  5AVY B;  1ZN5 A;  3A7O A;  2XKM A;  4WY4 B;  1YYC A;  3E1I A;  1IO4 A;  1SFC A;  1LGH B;  3MIW A;  4WBA A;  3M0D A;  2KB7 P;  3HTK A;  1A02 F;  1M1J B;  1NKZ B;  1QL1 A;  2KYV A;  2R5B A;  1XTC C;  3KYQ A;  5BU5 A;  1URQ D;  3SWF A;  1FZE A;  5AVV B;  3U1A A;  3SWY A;  5AW4 B;  4KHX A;  4IFM A;  3VMY A;  3KPE A;  3BRV B;  1GD2 E;  3V2Q A;  1KQL A;  1GZL A;  3C9I A;  1X8Y A;  1AFO A;  3CL3 D;  3P7K A;  1X79 B;  1KFM A;  3V4Q A;  3LID A;  4N6J A;  4N78 E;  1YTZ T;  1IJD B;  5CCG A;  5CCH C;  5AW6 B;  1X9V A;  3B5N A;  2HLO A;  2GUS A;  3II6 A;  1SFC B;  3GHG B;  1SP4 A;  2MJZ A;  1GU5 A;  1CZQ A;  1HUC A;  2HPC A;  1MUU A;  3IFM A;  2WSC H;  1RF0 A;  3VMX A;  1FZC B;  1N7L A;  1ZR4 A;  3RL0 D;  2WT7 B;  3RL0 B;  3A5T A;  5AW0 B;  1T3J A;  1VDF A;  1N2D C;  1N7S B;  3I5C A;  1MFZ A;  3HE5 A;  1URQ C;  3RK3 B;  2C0X A;  2R3C A;  5CCG D;  2J59 M;  3CLQ A;  1JUN A;  2YO3 A;  4N3Y B;  1HVV A;  3B5N B;  2OYI A;  3G3Z A;  2GM4 A;  4W7Y A;  4LGD E;  2KSJ A;  2OYH A;  1LT9 C;  3OA7 A;  2KLV A;  1HGZ A;  4GIF A;  4EIJ A;  1FJP A;  1LWU C;  1IK9 A;  3VMZ A;  1NHL A;  5AW9 B;  1JTH A;  3M0D C;  2W27 A;  1M7L A;  1HBW A;  4C46 A;  1S9K E;  3B8E B;  3RK2 D;  1RE3 A;  2JJL A;  1GDT A;  2NPS A;  5AVS B;  3HE5 B;  2Z5I A;  1FDM A;  2Z4E A;  2A45 H;  1L0L K;  1GK6 A;  1M1J A;  3RL0 C;  4AQR D;  2H7H A;  1LTT C;  2H43 A;  2FFD A;  1KFN A;  2OYI B;  2PP6 A;  5APY A;  4O9B A;  2OYH B;  4GKG A;  5CCH D;  2QM7 A;  1SQP K;  3IR9 A;  3M06 A;  3U1C A;  2Q5U A;  5CCG C;  4ZKP A;  1IFI A;  1DX7 A;  2R32 A;  2FYU K;  3MD0 A;  5AVQ B;  4WB4 A;  1SQV K;  1FAV A;  2YNY A;  3HD7 A;  3M91 A;  1FZG A;  1LTJ A;  2WIT A;  2XNX A;  3HUS A;  1DH3 A;  1RE4 C;  4WY4 D;  1FZF A;  1JMM A;  1IC2 A;  3MGN A;  3GHG A;  2NPS B;  1ZLL A;  3A2A A;  1NH4 A;  2C0W A;  1FBM A;  3P8C E;  3VYI A;  3BRT B;  1G2C B;  2A45 I;  5KJ7 D;  2HG5 D;  3V2N A;  2FFD B;  1MV8 A;  1FZC A;  3RK2 C;  4AUW A;  2Q7C A;  1KIL A;  2OAR A;  3NFQ A;  2W6A A;  2O1J A;  1HH0 A;  2WT7 A;  4JF7 A;  2HFE D;  2VRS A;  5APQ A;  1N7S A;  4Y99 B;  3HD7 D;  4JYB A;  2M8R A;  1HWT C;  1SQX K;  2IPP A;  1NOH A;  2N1T B;  3HD7 B;  2I1J A;  2A45 G;  5APT A;  5AVW B;  1LTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...