2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
3M0DA 5AW1B 3TNUB 1YYCA 2N9BA 3OAKA 4M3LA 4I6MC 3M9BA 4C46A 1NAFA 2XU6A 5AVWB 3LIDA 2ZXEB 1GK6A 2R3CA 3M9HA 1X8YA 3M0AA 3P7KA 1GU5A 4JYCA 2BASA 3O8ZA 1GU4A 1CZQA 2YO2A 2KP8A 1HBWA 1KQLA 3VYIA 1OWAA 5AW9B 1CSBA 3P8MC 3TNUA 2WPRA 3A5TA 2QM8A 3HE5B 5AW8B 1HWTC 2E42A 4KHXA 3NMDA 2WT7B 2XV5A 5APWA 1S9KE 3VN0A 1FOSF 4GT1A 2QM7A 3A2AA 2C9LY 2WPSA 4HYTB 4AYCA 2IPPA 2Z5HA 5CMZA 3A7OA 5AVUB 3NFQA 1J2JB 2XZRA 1H89A 2R32A 3TK1A 3HE5A 3MD0A 2WT7A 3L35A 3VTPC 3HE4B 1H88A 1SLQA 3V5BA 2Q5UA 3L37A 5APVA 1SP4A 4AUWA 3L36A 1NWQA 3NXSA 5AVSB 2E43A 2P2UA 4DZOA 2H7HA 1H8AA 5APSA 1DH3A 4GKGA 3P32A 3HE4A 5AVRB 5AVXB 2WWWA 1GK4A 2R5BA 1HUCA 3M91A 1FOSE 2W6AA 1A02F 1JUNA 1G2CB 2Q3IA 5AW5B 4C7NB 1T2KD 3MGNA 5AVYB 3I5CA 5AW2B 4AQRD 1MUUA 4RESB 3A3YB 5APUA 3TYYA 5APXA 1GZLA 3IR9A 2Q7CA 5AW3B 5AW7B 3T97A 2VRSA 1IO4A 4I2LC 3HTKA 3LIEA 1CI6B 1GD2E 5AVQB 4C7NA 1MV8A 2Z5IA 3M06A 3VMYA 4XE5B 1FAVA 2C9NY 4EOTA 4LC1A 3VMZA 2JJLA 1HJBA 2P67A 3V4WA 3KDPB 2YO3A 3SWFA 1A02J 5AW0B 3VMXA 2WTYA 5AVTB 5AVZB 2P7JA 2W27A 2WPQA 4B86A 1CI6A 5APTA 1T2KC 5APYA 5AW4B 3V4QA 1JNMA 3KQGA 2YNYA 5APQA 5AW6B 3UIAA 2ZFCA 1OXZA 3NTNA 1S9KD 1GTWA 3B8EB 1MFZA 5AVVB 4JYBA 2R5DA
chains in the Genus database with same CATH superfamily
1ZN5A 1JCCA 1YYCA 1R5SA 2P58A 2AEJA 3L70G 3PP5A 1S2EA 1L0ND 5KLVG 1JO5A 1MFTA 2QJYB 1BGYD 2HFED 1QVFO 2NPSA 1OW7A 2I8DA 1M57D 5TISH 1EC5A 1NHLA 2E5YA 5KAFH 4YXDC 2OYHB 3H1LD 3L73G 1FZBA 3CC7P 5CJ0A 2JWAA 4GIFA 3SSUA 2O1JA 3AE7C 3U1CA 1J1DB 3L71D 3ABVC 3M91A 2R5BA 1QEXA 3F89A 3GHGC 2QVAA 1YIJP 1YQ4C 3CWBD 2Q1KA 1NGMB 1KB9E 2OGUA 1M90Q 3W67A 1LTJB 1T6AA 1VQPP 4OGQB 2WSFJ 4LC1A 5GTIH 3KDPB 1YJNP 2E75D 2AEFA 2IBZI 1RF0C 3O6QA 2G3AA 1H0TA 2W83C 1OXZA 1S9KD 3KZIE 1PV3A 2FBWC 3M0DA 1NAYA 1KQGB 3PHLA 1MZ9A 2B87B 2ZYAA 4U7JA 1PP9J 3AE9C 2KS1A 1QX8A 3HD7D 3HD7C 1OVVA 3C1LA 5KAIH 1Q7YQ 1LNQA 4IFMA 4WY4D 4WY4C 2XDJA 2Q9IA 1LTBC 1T3UA 2OYHA 1KILD 1PP9E 5BU5A 1KFNA 5DJUB 1G2CB 3G9RA 5AW5B 3Q2YA 3WUTA 2LR2A 2V7QH 1U7MA 2H89C 4W80A 5APUA 3TYYA 5APXA 2J5UA 1NTMK 3LW5J 3WU2E 3IAOA 2FXPA 3VMZA 1UIXA 2C0XA 3FWLA 1LTJA 1NTMJ 1SQVJ 1LTIC 3CCVP 1NTZK 1HJ0A 2QJKC 3M0AA 3AE3C 2BASA 1IZNB 1XTGB 1HVVA 5AW9B 4YTPC 1VQMP 2JKVA 3CL3D 2B87A 1NTZJ 2QM8A 4PD4E 1DIPA 3HE5B 1NTME 2Y0CA 1NKNA 3AEBC 2M3BA 1SQVE 3H1KJ 2BEZF 2A06D 1IK9A 2RH0A 2Y0DA 1SLQA 4XFJA 1FZCC 2D2CD 2D2CC 2FFDC 1NTZG 3FXEA 2M0BA 3CX5H 2HYNA 1QVGO 1BE3J 1NTZE 1GL2D 3Q1MA 5CCHD 1GL2C 3CXHE 5CCHC 2IBZD 2UWJE 3H25A 4ZKUA 1IFJA 4ZNCA 3A3YB 3H1KE 1VF5D 1FC2C 1VF5C 2H43A 1EDIA 1G2CA 3BASA 1GD2E 1ZRTE 3A0HH 1JTHB 3OW2O 1BDDA 5H2FE 1USDA 1AVYA 2NZ2A 2JEEA 4PJ0H 1BE3E 4WB4A 1NOHA 1S4XA 1NKZB 5AVVB 1U7JA 1EZVD 4DCKA 3BCCJ 1ZR4A 2E5TA 2GUSA 1L0LK 5AVWB 3Q5SA 2ZXEB 1URQB 2FYZA 3VMAA 4JYCA 1VL2A 2YO2A 1HBWA 1FZAA 1IC2A 3JCUE 1EXIA 1OFCX 2E42A 1L0LJ 2I1JA 3H1JJ 4GT1A 4O9BA 4U3FG 1OMIA 5AVUB 1NTKJ 3HE5A 3L74J 2ZT9C 2YXQB 3L35A 3BCCE 1NU1J 1FJKA 4OWFA 1W5CE 1ZP0C 3R2PA 4A7PA 4H44B 1L0LE 3ZDMA 1RY3A 3H1JE 2ZVOB 1ZLLA 3I5CA 4GOFA 3RL0B 4D6TD 1NTKE 2OTKE 2WZ7A 3EFFK 5AW3B 3L74E 4WBAA 1RE4A 1SS1A 2Z5IA 2C0WA 3RK3D 1A02J 3CMAP 3RK3C 5CJ4A 3I56P 5AVZB 3AEEC 2A45H 1Q82Q 3KXDA 1VQ4P 1KB9H 1SQBD 3TGUG 1KYOH 1G1IA 1JTHA 1LGHB 2WQYC 1R5LA 2R5DA 1N7SB 1KQFB 1L0NJ 4PV1B 1BGYJ 2K9JB 3CX5I 3L75D 1P84D 3SFDC 1SQQD 1OIPA 2GUVA 1SFCB 1CW5A 2M8RA 1URQA 3KZIH 4IL6H 1QLED 3H1LJ 3VN0A 2QM7A 1YJ9P 2JO1A 4AYCA 1NH4A 3D6YA 3RL0g 1YJWP 3AE4C 1NVOA 2R32A 1L0NE 1U57A 1PGPA 3FGAD 1BGYE 5CBNA 3L71J 1NJIQ 4AUWA 1OW6A 3NXSA 2P2UA 3EWKA 1LP1B 3CWBJ 1K9MQ 3T97B 3HTKB 1DEBA 3H1LE 2LXBA 2OYOA 2R3SA 2W6JH 1VQ9P 3TF5A 3B71A 2QSIA 4N3YB 5AVQB 1D7MA 1MV8A 3S4RA 3II6A 1NU1D 3MHVA 3B5NB 3L71E 1KFMA 2WPQA 2JR8A 2N1TD 3CWBE 3MUDC 1M1JB 1T2KC 3L4FA 2N1TC 4RJTA 4JQ0D 4HH2A 3TNUB 3WU2H 1RF1B 2IDBA 2AXTE 1PPJD 1BCCG 1N7SA 1JMBA 2PAJA 2K9JA 3MP7B 2O3JA 3U1AA 1S9KE 3CCLP 1VQNP 4ZMDA 3LW5H 2QRXA 1SFCA 4H13D 3PH0A 3HE4B 4H13C 4N78D 2A45I 3G71P 3AEFC 3CMEP 1VQ7P 1KB9I 2HLOA 1LTTC 4PD4H 5E79E 1N86A 1KYOI 2AEMA 1SQPJ 5KJ7A 5CCGD 3CCJP 3GG2A 2E76B 3FWNA 5CCGC 3GMAA 2QJPC 1VPCA 2FXMA 1Q90D 3PRJA 3WMM0 1LP1A 2IX7C 2WSCJ 3T97A 1KILE 3HTKA 4NPDA 1L4AD 1CI6B 2BCCD 1KN7A 1L4AC 4EOTA 1DD4A 2A45G 3SWFA 2OARA 2FYUJ 3CXHH 2YIUC 4L75A 2KZIA 4BRYB 2E74D 3V4QA 4Y99C 5DJTB 1N73B 2E74C 1AFOA 4CPGA 3B5NA 1MFZA 3TDKA 3U59A 5K5GB 4K35A 1RE3C 4I6MC 2RN0A 1M1JA 1S1CX 5H2FH 1CZQA 3VYIA 3TNUA 1T3JA 2E75C 1Y47A 3L72D 1VQ5P 1HWTC 1RF1A 3V2PA 3E1IA 2O01J 3RGUA 4HYTB 3GF7A 5CMZA 1HGZA 3CCEP 3F5HA 3OA7A 1FZFA 3JCUH 3L37A 1SP4A 3WUVA 3BVHA 5B5EE 1GW4A 3HE4A 5AVXB 1EQ7A 1GDTA 2KXPB 3HUSB 3D71A 3L70D 1EDJA 1TU3F 2A06E 5KLIC 1FS0E 1URQD 2MKVA 5KLVD 4AQRD 1PP9G 4RESB 4NPFX 1Q2NA 4K3AA 3PTZA 1KILC 2ZVNB 2QA4P 2YMKA 3S1KA 3FXDA 2JJLA 4R4MA 3OJAB 1M56D 1ZMEC 1SQPD 3L73D 2IBZE 1CI6A 1RQVA 1G1JA 5BU8B 4PD4I 1LT9B 1SQVK 3VOPA 4BRYA 4WWIA 1GK6A 1PFIA 1GU5A 1N73A 3H32A 2ZYDA 3AE5C 1KQSO 4H44D 1IK7A 1KYOD 3A5TA 1JB0J 2FYUD 1RQUA 2WT7B 1S5LE 2AXCA 3IN6A 1EZVE 2KLUA 2B9BA 3H1HJ 2WVRA 1NO4A 2OYIC 3CXHI 5M1BA 1NTMG 3L36A 1NWQA 2QJPB 2E43A 4BXLA 1SQVG 3CPWO 1IFNA 3AE2C 1VQKP 1L2PA 4EYYQ 4D6TJ 4PV1D 3AE1C 3V6IA 4ZKPA 2QE7H 1X0TA 1SQBK 1YHQP 3QWOC 1AQTA 1LWUC 4Z1MH 1JY3P 3GHGB 3A0BE 1VQ8P 3HUSA 1SFCD 3CD6P 1FAVA 2B89A 3K5BA 2W6BA 3E7KA 3WUUA 1SQBJ 3RK2D 2NPSD 4W7ZA 2XKMA 3RK2C 3H1KG 2NPSC 2H8PD 2M3EA 5KJ7D 4D6TE 1YBKA 4I7ZC 2GA1A 3L75J 1EXJA 4I2LC 1K73Q 3M9QA 4C46A 1SQQJ 2KSEA 1X8YA 3RK3E 2WSSH 2IFNA 2ZXXA 5B66E 1BE3G 2POHA 2B88A 1JEKA 4H0LD 3P8MC 1LT9A 1K05A 4H0LC 1SQBE 1FOSF 3PLNA 1HF9A 1J1EC 1Y8AA 3HD7B 1X79B 2XZRA 2H88C 2XNXA 3L75E 1X22A 2AXTH 3MD0A 2KUBA 2WT7A 1P84E 1SQQE 1NTKK 4WY4B 2FY8A 2Z4EA 2ITAA 5APSA 4GOEA 1NU1K 2XNDH 3G3ZA 2WWWA 2IFMA 2K1AA 3BCCG 3RBXA 2W6AA 1A02F 1Z56A 2JDIH 1WMKA 3MGNA 3B4SA 3H1HD 5KAIE 3M0DC 1FZEA 5KKZC 3AEGC 3LIEA 1VQ6P 4ASVA 3V2QA 2P1JA 1L0LG 2C9NY 3H1JG 3V4WA 1FBMA 1QGKB 3Q5RA 1KC8Q 5AVTB 2W27A 3I55P 3W68A 3GHGA 1KZUB 1NTKG 5AW4B 3ITKA 3L74G 3UIAA 3C8VA 3P8CD 2QJYC 1NU1G 4JYBA 4OH8B 1NAFA 4NPEA 4YPCA 1S72P 3CXHD 1NU1E 1PGJA 2KK7A 1L0NK 1GU4A 1JCDA 2E76D 2KZJA 3BATA 2WITA 2WPRA 4HKZH 2QJKB 2XV5A 1RF0A 1IJDB 1FDOA 1Q86Q 1KTMA 3VP9A 1PPJG 1FU1A 1N7LA 1J2JB 3N7NA 1J1DC 3JC22 1PPJE 1H88A 1R8EA 4JBZA 3HD7A 2KB7P 2L91A 3H1ID 2H7HA 4L73A 1NYHA 1ZOYC 1VDFA 1LTJC 1L0NG 1FZCB 4OGQD 2Q3IA 1BGYG 5BVZA 2D2CB 4OGQC 4WY4A 3Q5PA 2FFDB 1LTAC 1DD3A 2BCCJ 2WSFH 3JSVC 4TT3H 1GL2B 5B5EH 1SQXJ 3H1LG 2FXOA 2WPVB 1JY2N 4U3FD 5AW0B 2G8YA 3CC2P 2WTYA 1ZXGA 1VF5B 2O01H 2J58A 4N6JA 1JY2P 3GF3A 3CI9A 1PIXA 5APYA 1PGQA 3L71G 2BCCE 2OTJP 2XU6A 3LIDA 1S5LX 4HB1A 3CWBG 3L72J 1AV1A 2KLVA 1CSBA 4LLHA 2I1KA 4BWNA 1LTGC 3CCRP 3AEDC 2Z5HA 4GODA 3D70A 3NFQA 1JY2O 3TK1A 5KLVK 4TLFA 4KJMA 3S9OA 3TSIA 3R4YA 3TGUD 5GTHE 3L70J 2ZT9B 4EDFA 5KLVJ 2QIWA 1JUNA 1SQPK 3AE6C 4I1LA 5AVYB 3FX0A 3GW6A 5EFWB 2K9YA 1FJPA 1IFMA 1FZCA 3L73J 1Q81Q 2FFDA 4L76A 1FE6A 1JM0A 2HPCB 3L70E 1GL2A 5CCHA 2FYUK 5KLVE 1JNMA 1QL2A 2YNYA 5CHXA 1YITP 3RK3B 3A0BH 2Q3EA 3CX5D 2PP6A 4DOJA 3OAKA 4M3LA 4ASWA 1SQPG 1OVUA 3KHUA 1RH5B 1SQXD 1SQPE 3L73E 3H32B 5AW8B 2MJZA 1USEA 3GLMA 2IPPA 2W8ZA 3E1RA 3A7OA 1KV4A 5B66H 2HODB 1M7LA 4R4LA 3KPEA 1IFPA 2FYUG 1XTCC 1KYOE 1PGOA 1RE4C 2FYUE 1GW3A 4HJGH 4C7NB 2Y0EA 3CCQP 1P84H 3Q3DA 1BCCD 1IFIA 2L5GB 1S3JA 1MUUA 1GZLA 4JPZB 4IL6E 3MZWB 4OVNF 2Q7CA 5AW7B 2JP3A 2OQQA 3BRTB 3VMYA 2A06G 2P67A 2YO3A 5TJHA 1KD1Q 4B86A 1URQC 3N4XA 3MIWA 1GTWA 4UB6E 4W7YA 1OZHA 2N9BA 2HPCA 3M9BA 2PFXA 2K88A 1K04A 2IBZG 1EZVI 2N1TB 3M9HA 3G6EP 2BEQD 2Y9ZA 2V4HA 2GM4A 3H6PA 3G4SP 1W2EA 4EI2A 3NMDA 2HG5D 1IFDA 3V2RA 2WSEJ 1QL1A 4UB8E 4DJGA 3BRVB 1KB9D 1AVOA 4KT0J 4H44C 5APVA 1EZVG 1E5WA 2HODA 3RL0D 3RL0C 4H13B 5AVRB 2CK3H 1GK4A 4C7RA 2HR3A 1WRGA 2KIKA 3EQ2A 1N2DC 2PRRA 2DW3A 1IO4A 4C7NA 3M06A 1UIIA 2QEXP 1N7SD 1N7SC 3SWKA 3IF4A 3H1HG 4PV1C 1JY3N 1L4AB 2KSJA 5APQA 5AW6B 3H1HE 4YXWH 2YIUB 5TISE 1DX7A 5KAFE 3HRNA 2LXCB 1SFCC 1EDLA 2R3CA 3CCSP 4Y99B 1GMJA 2E74B 1AA0A 1KQLA 4D6TG 4IFDK 1SQQK 1M1KQ 1P84I 3VP8A 1JOCA 1PP9D 3MUDA 5KJ7C 1SVFA 2FYNC 2N1TA 1BSHA 3CCUP 1KMIZ 3EFGA 3P8CE 2C9LY 1OVRA 1W2BO 2WPSA 2IZ0A 1BDCA 4QMAA 2E75B 2RMZA 1T8ZA 4EIJA 2KNCB 3VTPC 1SQBG 3H1IJ 4MN4C 4IFFA 1JY3O 2KI7B 2FKWB 1H8AA 4Y28J 1DH3A 3L75G 3P32A 5GTIE 2CPBA 2J59M 1SQQG 2M5AB 1KORA 2OTLP 3B5ND 3B5NC 5C39A 2WMMA 3H1IG 3IFMA 2IZ1A 4U3FJ 1OX3A 5GTHH 5KTBA 1M1JC 5KLIB 3H1IE 1X9VA 2YMYA 1AJYA 1YI2P 2NRGA 1LT1A 5CCGA 2RKLA 1KILB 1RF1C 2Q6QA 4PD4D 2KOGA 3NTNA 3B8EB 1NTMD 1VQOP 5E79H 2KYVA 2V7QJ 1HTLC 4JF7A 1SQVD 1L4AA 1LJ2A 2ZT9D 4U3FE 3O8ZA 2KP8A 1OWAA 3D6ZA 3AEAC 2K37A 3USSA 4XA4A 1OW8A 1DEEG 2K3RA 1JMMA 4KHXA 2N9YB 1NTZD 3PJSK 1RE3A 1FDMA 3TGUJ 1BSNA 1YTZI 2E76C 2W90A 2ZJSE 3H1KD 1K8AQ 3MTUE 2OYHC 1HGVA 1PZQA 2IYPA 4DZOA 1ZRTD 2O01N 2OYIB 4GKGA 2KNCA 4IL6X 1RHZB 2YKOA 2Y9YA 1HUCA 1FOSE 4DT0A 1WT6A 2WSCH 2P10A 1E79H 5AW2B 1BE3D 3CC4P 2YKQA 3IR9A 2IYOA 2VRSA 3CCMP 1Y9BA 3TGUE 5CBOA 4XE5B 2M5AA 1N73C 3C9IA 1LWUB 2CPSA 5L8RJ 1SQXK 2YXRB 3QH9A 4RKUJ 4LGDE 3KQGA 4N78E 1VQLP 1AQ5A 5AW1B 4WVZA 1N8RQ 3RK2B 2NPSB 1KILA 1MKMA 3P7KA 1YTZT 2R44A 2FYNB 4I7ZB 3BCCD 2ZYGA 3RBZA 3SWYA 1EDKA 1PL5A 2BCCG 4L74A 4UB6H 5APWA 3A2AA 3CX5E 4IOIH 1L0LD 1SQXG 4H0LB 1H89A 4RO0A 3H1JD 1ZW0A 1FDIA 1SQXE 3CLQA 1J1EB 3V2NA 3V5BA 1ZR2A 2Q5UA 1LTSC 3HUSC 1HH0A 2QG4A 1NTKD 2YKPA 3L74D 5AVSB 1M8OB 3A0HE 1BCCJ 2SPZA 4UB8H 1T2KD 3KYQA 3L72G 4PJ0E 2OYIA 3L72E 1YQ3C 1S5LH 3O6QB 2LKMA 1H0TB 1HJBA 3AECC 2PGDA 2JWDA 3AE8C 3VMXA 1LT9C 1FZGA 2P7JA 5KKZB 2WSEH 1ZV8A 5APTA 1BCCE 2O1KA 3SFEC 2ZFCA 2ZAEB 2KS1B 4GDOA 1LWUA
chains in the Genus database with same CATH topology
1ZN5A 1JCCA 1YYCA 2N9BA 2HPCA 3M9QA 3M9BA 4C46A 2N1TB 3M9HA 1X8YA 2IFNA 3PP5A 1JO5A 2POHA 2HFED 3P8MC 1LT9A 2GUVA 2NPSA 2GM4A 1SFCB 3H6PA 1W2EA 1CW5A 2M8RA 1URQA 3NMDA 2HG5D 1IFDA 3VN0A 3V2RA 1FOSF 2QM7A 1J1EC 1NHLA 4AYCA 1NH4A 1QL1A 2OYHB 3HD7B 1X79B 2XZRA 1FZBA 2XNXA 5CJ0A 2R32A 3BRVB 3MD0A 2WT7A 4GIFA 5APVA 1NTKK 4AUWA 4WY4B 3NXSA 1E5WA 2O1JA 2HODA 2P2UA 3RL0D 1J1DB 3U1CA 2Z4EA 5APSA 3RL0C 1NU1K 5AVRB 3G3ZA 2WWWA 1GK4A 2IFMA 2R5BA 3M91A 4C7RA 2W6AA 3GHGC 3HTKB 1A02F 1DEBA 1Z56A 1WRGA 3MGNA 3EQ2A 3M0DC 1N2DC 1LTJB 1FZEA 1IO4A 3LIEA 4N3YB 3V2QA 2P1JA 5AVQB 4C7NA 1MV8A 3M06A 2C9NY 4LC1A 3II6A 3B5NB 3V4WA 3KDPB 1N7SD 1FBMA 1N7SC 5AVTB 1KFMA 2W27A 2WPQA 3GHGA 1KZUB 2N1TD 1M1JB 1T2KC 1JY3N 3L4FA 1L4AB 5AW4B 2N1TC 1RF0C 2KSJA 5APQA 5AW6B 3UIAA 1OXZA 1S9KD 3P8CD 4JYBA 3M0DA 4HH2A 3TNUB 1DX7A 4OH8B 1MZ9A 3HRNA 1NAFA 1SFCC 1RF1B 2R3CA 4Y99B 1L0NK 1GU4A 1JCDA 1N7SB 1KQLA 3BATA 4IFDK 1SQQK 3HD7D 1N7SA 2WITA 3HD7C 2WPRA 2PAJA 3VP8A 1JOCA 3MUDA 5KJ7C 1SVFA 2N1TA 2XV5A 3U1AA 1S9KE 1RF0A 1IJDB 3EFGA 3P8CE 2C9LY 2WPSA 4IFMA 4WY4D 3VP9A 1FU1A 1N7LA 4WY4C 1J2JB 3N7NA 3LW5H 2XDJA 1SFCA 1J1DC 2Q9IA 1T8ZA 1LTBC 4EIJA 3VTPC 3HE4B 1H88A 4N78D 1T3UA 2A45I 4IFFA 1JY3O 2HLOA 1LTTC 2OYHA 1KILD 3HD7A 1N86A 2KB7P 5BU5A 1KFNA 2H7HA 2FKWB 1H8AA 5KJ7A 1DH3A 5CCGD 3P32A 2CPBA 5CCGC 1VDFA 1LTJC 2J59M 1G2CB 1FZCB 2Q3IA 5AW5B 5BVZA 1VPCA 2FXMA 4WY4A 2FFDB 3B5ND 3WMM0 1LTAC 3B5NC 4W80A 2WSFH 5APUA 3TYYA 5APXA 1NTMK 3IFMA 2IX7C 3T97A 1GL2B 3HTKA 1L4AD 1CI6B 5KTBA 1M1JC 1L4AC 4EOTA 1X9VA 3VMZA 2YMYA 2A45G 1JY2N 3SWFA 2OARA 2C0XA 5AW0B 5CCGA 2WTYA 1LTJA 2O01H 2J58A 4N6JA 1JY2P 1KILB 3CI9A 1RF1C 5APYA 3V4QA 4Y99C 1N73B 2KOGA 1AFOA 1LTIC 3NTNA 3B5NA 3B8EB 1MFZA 3U59A 1RE3C 2KYVA 1NTZK 4I6MC 1HTLC 4JF7A 2XU6A 3LIDA 1M1JA 1L4AA 3M0AA 2BASA 3O8ZA 1CZQA 2KP8A 2KLVA 3VYIA 1XTGB 1HVVA 1OWAA 5AW9B 1CSBA 4XA4A 3TNUA 1T3JA 3CL3D 2QM8A 4LLHA 1JMMA 3HE5B 1RF1A 1HWTC 4KHXA 3V2PA 3E1IA 2I1KA 1LTGC 4HYTB 1NKNA 2M3BA 2Z5HA 1RE3A 5CMZA 3NFQA 1JY2O 1HGZA 1FDMA 1IK9A 3TK1A 5KLVK 3OA7A 1FZFA 1YTZI 1SLQA 3MTUE 2OYHC 3L37A 1SP4A 3TSIA 1FZCC 1HGVA 2FFDC 3BVHA 4DZOA 1GW4A 2OYIB 4GKGA 3HE4A 2HYNA 5AVXB 1EQ7A 2YKOA 1GL2D 1HUCA 5CCHD 1FOSE 1GDTA 3HUSB 1WT6A 1GL2C 1SQPK 1JUNA 5CCHC 2WSCH 1URQD 4I1LA 5AVYB 5AW2B 4AQRD 4ZKUA 1IFJA 4RESB 3A3YB 2YKQA 3IR9A 2H43A 1FJPA 2VRSA 1IFMA 1G2CA 3BASA 1FZCA 1KILC 1GD2E 4XE5B 1N73C 2FFDA 3C9IA 2JJLA 1JTHB 3OJAB 1LWUB 2CPSA 1SQXK 2HPCB 1GL2A 4LGDE 1CI6A 5CCHA 2JEEA 2FYUK 1JNMA 3KQGA 1G1JA 1QL2A 4N78E 2YNYA 5CHXA 4WB4A 1NOHA 3RK3B 5BU8B 1AQ5A 1NKZB 5AVVB 5AW1B 1LT9B 2PP6A 4DOJA 3OAKA 1ZR4A 4M3LA 3RK2B 2NPSB 1SQVK 2GUSA 1L0LK 5AVWB 3VOPA 1KILA 1GK6A 1URQB 2ZXEB 1PFIA 2FYZA 3P7KA 1GU5A 4JYCA 1N73A 1YTZT 3H32A 2YO2A 1HBWA 1FZAA 1IC2A 3A5TA 3SWYA 3H32B 5AW8B 2E42A 2WT7B 5APWA 2I1JA 4GT1A 3A2AA 2MJZA 4O9BA 2IPPA 3A7OA 5AVUB 2HODB 1H89A 1NO4A 1M7LA 3HE5A 3KPEA 3L35A 2OYIC 3CLQA 1XTCC 1J1EB 3V2NA 3V5BA 1ZR2A 2Q5UA 1LTSC 1FJKA 3HUSC 1HH0A 1RE4C 3L36A 1NWQA 2YKPA 1GW3A 5AVSB 2E43A 1IFNA 3R2PA 1RY3A 4C7NB 4ZKPA 1ZLLA 1T2KD 3KYQA 3I5CA 1SQBK 1IFIA 2L5GB 1MUUA 3RL0B 1LWUC 2OYIA 1GZLA 2WZ7A 2Q7CA 1JY3P 5AW3B 3GHGB 5AW7B 4I2LC 3HUSA 4WBAA 1RE4A 3BRTB 1SFCD 2Z5IA 3VMYA 1FAVA 2LKMA 2C0WA 3RK3D 1HJBA 2P67A 2W6BA 2YO3A 1A02J 3RK3C 5CJ4A 3VMXA 3RK2D 1LT9C 2NPSD 5AVZB 4W7ZA 1FZGA 2P7JA 2XKMA 2A45H 3RK2C 2NPSC 2WSEH 1ZV8A 4B86A 5APTA 1URQC 2H8PD 5KJ7D 3N4XA 2O1KA 2ZFCA 1G1IA 3MIWA 1JTHA 1GTWA 1LGHB 4W7YA 1LWUA 2R5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0D A;  5AW1 B;  3TNU B;  1YYC A;  2N9B A;  3OAK A;  4M3L A;  4I6M C;  3M9B A;  4C46 A;  1NAF A;  2XU6 A;  5AVW B;  3LID A;  2ZXE B;  1GK6 A;  2R3C A;  3M9H A;  1X8Y A;  3M0A A;  3P7K A;  1GU5 A;  4JYC A;  2BAS A;  3O8Z A;  1GU4 A;  1CZQ A;  2YO2 A;  2KP8 A;  1HBW A;  1KQL A;  3VYI A;  1OWA A;  5AW9 B;  1CSB A;  3P8M C;  3TNU A;  2WPR A;  3A5T A;  2QM8 A;  3HE5 B;  5AW8 B;  1HWT C;  2E42 A;  4KHX A;  3NMD A;  2WT7 B;  2XV5 A;  5APW A;  1S9K E;  3VN0 A;  1FOS F;  4GT1 A;  2QM7 A;  3A2A A;  2C9L Y;  2WPS A;  4HYT B;  4AYC A;  2IPP A;  2Z5H A;  5CMZ A;  3A7O A;  5AVU B;  3NFQ A;  1J2J B;  2XZR A;  1H89 A;  2R32 A;  3TK1 A;  3HE5 A;  3MD0 A;  2WT7 A;  3L35 A;  3VTP C;  3HE4 B;  1H88 A;  1SLQ A;  3V5B A;  2Q5U A;  3L37 A;  5APV A;  1SP4 A;  4AUW A;  3L36 A;  1NWQ A;  3NXS A;  5AVS B;  2E43 A;  2P2U A;  4DZO A;  2H7H A;  1H8A A;  5APS A;  1DH3 A;  4GKG A;  3P32 A;  3HE4 A;  5AVR B;  5AVX B;  2WWW A;  1GK4 A;  2R5B A;  1HUC A;  3M91 A;  1FOS E;  2W6A A;  1A02 F;  1JUN A;  1G2C B;  2Q3I A;  5AW5 B;  4C7N B;  1T2K D;  3MGN A;  5AVY B;  3I5C A;  5AW2 B;  4AQR D;  1MUU A;  4RES B;  3A3Y B;  5APU A;  3TYY A;  5APX A;  1GZL A;  3IR9 A;  2Q7C A;  5AW3 B;  5AW7 B;  3T97 A;  2VRS A;  1IO4 A;  4I2L C;  3HTK A;  3LIE A;  1CI6 B;  1GD2 E;  5AVQ B;  4C7N A;  1MV8 A;  2Z5I A;  3M06 A;  3VMY A;  4XE5 B;  1FAV A;  2C9N Y;  4EOT A;  4LC1 A;  3VMZ A;  2JJL A;  1HJB A;  2P67 A;  3V4W A;  3KDP B;  2YO3 A;  3SWF A;  1A02 J;  5AW0 B;  3VMX A;  2WTY A;  5AVT B;  5AVZ B;  2P7J A;  2W27 A;  2WPQ A;  4B86 A;  1CI6 A;  5APT A;  1T2K C;  5APY A;  5AW4 B;  3V4Q A;  1JNM A;  3KQG A;  2YNY A;  5APQ A;  5AW6 B;  3UIA A;  2ZFC A;  1OXZ A;  3NTN A;  1S9K D;  1GTW A;  3B8E B;  1MFZ A;  5AVV B;  4JYB A;  2R5D A; 
#chains in the Genus database with same CATH topology
 1ZN5 A;  1JCC A;  1YYC A;  1R5S A;  2P58 A;  2AEJ A;  3L70 G;  3PP5 A;  1S2E A;  1L0N D;  5KLV G;  1JO5 A;  1MFT A;  2QJY B;  1BGY D;  2HFE D;  1QVF O;  2NPS A;  1OW7 A;  2I8D A;  1M57 D;  5TIS H;  1EC5 A;  1NHL A;  2E5Y A;  5KAF H;  4YXD C;  2OYH B;  3H1L D;  3L73 G;  1FZB A;  3CC7 P;  5CJ0 A;  2JWA A;  4GIF A;  3SSU A;  2O1J A;  3AE7 C;  3U1C A;  1J1D B;  3L71 D;  3ABV C;  3M91 A;  2R5B A;  1QEX A;  3F89 A;  3GHG C;  2QVA A;  1YIJ P;  1YQ4 C;  3CWB D;  2Q1K A;  1NGM B;  1KB9 E;  2OGU A;  1M90 Q;  3W67 A;  1LTJ B;  1T6A A;  1VQP P;  4OGQ B;  2WSF J;  4LC1 A;  5GTI H;  3KDP B;  1YJN P;  2E75 D;  2AEF A;  2IBZ I;  1RF0 C;  3O6Q A;  2G3A A;  1H0T A;  2W83 C;  1OXZ A;  1S9K D;  3KZI E;  1PV3 A;  2FBW C;  3M0D A;  1NAY A;  1KQG B;  3PHL A;  1MZ9 A;  2B87 B;  2ZYA A;  4U7J A;  1PP9 J;  3AE9 C;  2KS1 A;  1QX8 A;  3HD7 D;  3HD7 C;  1OVV A;  3C1L A;  5KAI H;  1Q7Y Q;  1LNQ A;  4IFM A;  4WY4 D;  4WY4 C;  2XDJ A;  2Q9I A;  1LTB C;  1T3U A;  2OYH A;  1KIL D;  1PP9 E;  5BU5 A;  1KFN A;  5DJU B;  1G2C B;  3G9R A;  5AW5 B;  3Q2Y A;  3WUT A;  2LR2 A;  2V7Q H;  1U7M A;  2H89 C;  4W80 A;  5APU A;  3TYY A;  5APX A;  2J5U A;  1NTM K;  3LW5 J;  3WU2 E;  3IAO A;  2FXP A;  3VMZ A;  1UIX A;  2C0X A;  3FWL A;  1LTJ A;  1NTM J;  1SQV J;  1LTI C;  3CCV P;  1NTZ K;  1HJ0 A;  2QJK C;  3M0A A;  3AE3 C;  2BAS A;  1IZN B;  1XTG B;  1HVV A;  5AW9 B;  4YTP C;  1VQM P;  2JKV A;  3CL3 D;  2B87 A;  1NTZ J;  2QM8 A;  4PD4 E;  1DIP A;  3HE5 B;  1NTM E;  2Y0C A;  1NKN A;  3AEB C;  2M3B A;  1SQV E;  3H1K J;  2BEZ F;  2A06 D;  1IK9 A;  2RH0 A;  2Y0D A;  1SLQ A;  4XFJ A;  1FZC C;  2D2C D;  2D2C C;  2FFD C;  1NTZ G;  3FXE A;  2M0B A;  3CX5 H;  2HYN A;  1QVG O;  1BE3 J;  1NTZ E;  1GL2 D;  3Q1M A;  5CCH D;  1GL2 C;  3CXH E;  5CCH C;  2IBZ D;  2UWJ E;  3H25 A;  4ZKU A;  1IFJ A;  4ZNC A;  3A3Y B;  3H1K E;  1VF5 D;  1FC2 C;  1VF5 C;  2H43 A;  1EDI A;  1G2C A;  3BAS A;  1GD2 E;  1ZRT E;  3A0H H;  1JTH B;  3OW2 O;  1BDD A;  5H2F E;  1USD A;  1AVY A;  2NZ2 A;  2JEE A;  4PJ0 H;  1BE3 E;  4WB4 A;  1NOH A;  1S4X A;  1NKZ B;  5AVV B;  1U7J A;  1EZV D;  4DCK A;  3BCC J;  1ZR4 A;  2E5T A;  2GUS A;  1L0L K;  5AVW B;  3Q5S A;  2ZXE B;  1URQ B;  2FYZ A;  3VMA A;  4JYC A;  1VL2 A;  2YO2 A;  1HBW A;  1FZA A;  1IC2 A;  3JCU E;  1EXI A;  1OFC X;  2E42 A;  1L0L J;  2I1J A;  3H1J J;  4GT1 A;  4O9B A;  4U3F G;  1OMI A;  5AVU B;  1NTK J;  3HE5 A;  3L74 J;  2ZT9 C;  2YXQ B;  3L35 A;  3BCC E;  1NU1 J;  1FJK A;  4OWF A;  1W5C E;  1ZP0 C;  3R2P A;  4A7P A;  4H44 B;  1L0L E;  3ZDM A;  1RY3 A;  3H1J E;  2ZVO B;  1ZLL A;  3I5C A;  4GOF A;  3RL0 B;  4D6T D;  1NTK E;  2OTK E;  2WZ7 A;  3EFF K;  5AW3 B;  3L74 E;  4WBA A;  1RE4 A;  1SS1 A;  2Z5I A;  2C0W A;  3RK3 D;  1A02 J;  3CMA P;  3RK3 C;  5CJ4 A;  3I56 P;  5AVZ B;  3AEE C;  2A45 H;  1Q82 Q;  3KXD A;  1VQ4 P;  1KB9 H;  1SQB D;  3TGU G;  1KYO H;  1G1I A;  1JTH A;  1LGH B;  2WQY C;  1R5L A;  2R5D A;  1N7S B;  1KQF B;  1L0N J;  4PV1 B;  1BGY J;  2K9J B;  3CX5 I;  3L75 D;  1P84 D;  3SFD C;  1SQQ D;  1OIP A;  2GUV A;  1SFC B;  1CW5 A;  2M8R A;  1URQ A;  3KZI H;  4IL6 H;  1QLE D;  3H1L J;  3VN0 A;  2QM7 A;  1YJ9 P;  2JO1 A;  4AYC A;  1NH4 A;  3D6Y A;  3RL0 g;  1YJW P;  3AE4 C;  1NVO A;  2R32 A;  1L0N E;  1U57 A;  1PGP A;  3FGA D;  1BGY E;  5CBN A;  3L71 J;  1NJI Q;  4AUW A;  1OW6 A;  3NXS A;  2P2U A;  3EWK A;  1LP1 B;  3CWB J;  1K9M Q;  3T97 B;  3HTK B;  1DEB A;  3H1L E;  2LXB A;  2OYO A;  2R3S A;  2W6J H;  1VQ9 P;  3TF5 A;  3B71 A;  2QSI A;  4N3Y B;  5AVQ B;  1D7M A;  1MV8 A;  3S4R A;  3II6 A;  1NU1 D;  3MHV A;  3B5N B;  3L71 E;  1KFM A;  2WPQ A;  2JR8 A;  2N1T D;  3CWB E;  3MUD C;  1M1J B;  1T2K C;  3L4F A;  2N1T C;  4RJT A;  4JQ0 D;  4HH2 A;  3TNU B;  3WU2 H;  1RF1 B;  2IDB A;  2AXT E;  1PPJ D;  1BCC G;  1N7S A;  1JMB A;  2PAJ A;  2K9J A;  3MP7 B;  2O3J A;  3U1A A;  1S9K E;  3CCL P;  1VQN P;  4ZMD A;  3LW5 H;  2QRX A;  1SFC A;  4H13 D;  3PH0 A;  3HE4 B;  4H13 C;  4N78 D;  2A45 I;  3G71 P;  3AEF C;  3CME P;  1VQ7 P;  1KB9 I;  2HLO A;  1LTT C;  4PD4 H;  5E79 E;  1N86 A;  1KYO I;  2AEM A;  1SQP J;  5KJ7 A;  5CCG D;  3CCJ P;  3GG2 A;  2E76 B;  3FWN A;  5CCG C;  3GMA A;  2QJP C;  1VPC A;  2FXM A;  1Q90 D;  3PRJ A;  3WMM 0;  1LP1 A;  2IX7 C;  2WSC J;  3T97 A;  1KIL E;  3HTK A;  4NPD A;  1L4A D;  1CI6 B;  2BCC D;  1KN7 A;  1L4A C;  4EOT A;  1DD4 A;  2A45 G;  3SWF A;  2OAR A;  2FYU J;  3CXH H;  2YIU C;  4L75 A;  2KZI A;  4BRY B;  2E74 D;  3V4Q A;  4Y99 C;  5DJT B;  1N73 B;  2E74 C;  1AFO A;  4CPG A;  3B5N A;  1MFZ A;  3TDK A;  3U59 A;  5K5G B;  4K35 A;  1RE3 C;  4I6M C;  2RN0 A;  1M1J A;  1S1C X;  5H2F H;  1CZQ A;  3VYI A;  3TNU A;  1T3J A;  2E75 C;  1Y47 A;  3L72 D;  1VQ5 P;  1HWT C;  1RF1 A;  3V2P A;  3E1I A;  2O01 J;  3RGU A;  4HYT B;  3GF7 A;  5CMZ A;  1HGZ A;  3CCE P;  3F5H A;  3OA7 A;  1FZF A;  3JCU H;  3L37 A;  1SP4 A;  3WUV A;  3BVH A;  5B5E E;  1GW4 A;  3HE4 A;  5AVX B;  1EQ7 A;  1GDT A;  2KXP B;  3HUS B;  3D71 A;  3L70 D;  1EDJ A;  1TU3 F;  2A06 E;  5KLI C;  1FS0 E;  1URQ D;  2MKV A;  5KLV D;  4AQR D;  1PP9 G;  4RES B;  4NPF X;  1Q2N A;  4K3A A;  3PTZ A;  1KIL C;  2ZVN B;  2QA4 P;  2YMK A;  3S1K A;  3FXD A;  2JJL A;  4R4M A;  3OJA B;  1M56 D;  1ZME C;  1SQP D;  3L73 D;  2IBZ E;  1CI6 A;  1RQV A;  1G1J A;  5BU8 B;  4PD4 I;  1LT9 B;  1SQV K;  3VOP A;  4BRY A;  4WWI A;  1GK6 A;  1PFI A;  1GU5 A;  1N73 A;  3H32 A;  2ZYD A;  3AE5 C;  1KQS O;  4H44 D;  1IK7 A;  1KYO D;  3A5T A;  1JB0 J;  2FYU D;  1RQU A;  2WT7 B;  1S5L E;  2AXC A;  3IN6 A;  1EZV E;  2KLU A;  2B9B A;  3H1H J;  2WVR A;  1NO4 A;  2OYI C;  3CXH I;  5M1B A;  1NTM G;  3L36 A;  1NWQ A;  2QJP B;  2E43 A;  4BXL A;  1SQV G;  3CPW O;  1IFN A;  3AE2 C;  1VQK P;  1L2P A;  4EYY Q;  4D6T J;  4PV1 D;  3AE1 C;  3V6I A;  4ZKP A;  2QE7 H;  1X0T A;  1SQB K;  1YHQ P;  3QWO C;  1AQT A;  1LWU C;  4Z1M H;  1JY3 P;  3GHG B;  3A0B E;  1VQ8 P;  3HUS A;  1SFC D;  3CD6 P;  1FAV A;  2B89 A;  3K5B A;  2W6B A;  3E7K A;  3WUU A;  1SQB J;  3RK2 D;  2NPS D;  4W7Z A;  2XKM A;  3RK2 C;  3H1K G;  2NPS C;  2H8P D;  2M3E A;  5KJ7 D;  4D6T E;  1YBK A;  4I7Z C;  2GA1 A;  3L75 J;  1EXJ A;  4I2L C;  1K73 Q;  3M9Q A;  4C46 A;  1SQQ J;  2KSE A;  1X8Y A;  3RK3 E;  2WSS H;  2IFN A;  2ZXX A;  5B66 E;  1BE3 G;  2POH A;  2B88 A;  1JEK A;  4H0L D;  3P8M C;  1LT9 A;  1K05 A;  4H0L C;  1SQB E;  1FOS F;  3PLN A;  1HF9 A;  1J1E C;  1Y8A A;  3HD7 B;  1X79 B;  2XZR A;  2H88 C;  2XNX A;  3L75 E;  1X22 A;  2AXT H;  3MD0 A;  2KUB A;  2WT7 A;  1P84 E;  1SQQ E;  1NTK K;  4WY4 B;  2FY8 A;  2Z4E A;  2ITA A;  5APS A;  4GOE A;  1NU1 K;  2XND H;  3G3Z A;  2WWW A;  2IFM A;  2K1A A;  3BCC G;  3RBX A;  2W6A A;  1A02 F;  1Z56 A;  2JDI H;  1WMK A;  3MGN A;  3B4S A;  3H1H D;  5KAI E;  3M0D C;  1FZE A;  5KKZ C;  3AEG C;  3LIE A;  1VQ6 P;  4ASV A;  3V2Q A;  2P1J A;  1L0L G;  2C9N Y;  3H1J G;  3V4W A;  1FBM A;  1QGK B;  3Q5R A;  1KC8 Q;  5AVT B;  2W27 A;  3I55 P;  3W68 A;  3GHG A;  1KZU B;  1NTK G;  5AW4 B;  3ITK A;  3L74 G;  3UIA A;  3C8V A;  3P8C D;  2QJY C;  1NU1 G;  4JYB A;  4OH8 B;  1NAF A;  4NPE A;  4YPC A;  1S72 P;  3CXH D;  1NU1 E;  1PGJ A;  2KK7 A;  1L0N K;  1GU4 A;  1JCD A;  2E76 D;  2KZJ A;  3BAT A;  2WIT A;  2WPR A;  4HKZ H;  2QJK B;  2XV5 A;  1RF0 A;  1IJD B;  1FDO A;  1Q86 Q;  1KTM A;  3VP9 A;  1PPJ G;  1FU1 A;  1N7L A;  1J2J B;  3N7N A;  1J1D C;  3JC2 2;  1PPJ E;  1H88 A;  1R8E A;  4JBZ A;  3HD7 A;  2KB7 P;  2L91 A;  3H1I D;  2H7H A;  4L73 A;  1NYH A;  1ZOY C;  1VDF A;  1LTJ C;  1L0N G;  1FZC B;  4OGQ D;  2Q3I A;  1BGY G;  5BVZ A;  2D2C B;  4OGQ C;  4WY4 A;  3Q5P A;  2FFD B;  1LTA C;  1DD3 A;  2BCC J;  2WSF H;  3JSV C;  4TT3 H;  1GL2 B;  5B5E H;  1SQX J;  3H1L G;  2FXO A;  2WPV B;  1JY2 N;  4U3F D;  5AW0 B;  2G8Y A;  3CC2 P;  2WTY A;  1ZXG A;  1VF5 B;  2O01 H;  2J58 A;  4N6J A;  1JY2 P;  3GF3 A;  3CI9 A;  1PIX A;  5APY A;  1PGQ A;  3L71 G;  2BCC E;  2OTJ P;  2XU6 A;  3LID A;  1S5L X;  4HB1 A;  3CWB G;  3L72 J;  1AV1 A;  2KLV A;  1CSB A;  4LLH A;  2I1K A;  4BWN A;  1LTG C;  3CCR P;  3AED C;  2Z5H A;  4GOD A;  3D70 A;  3NFQ A;  1JY2 O;  3TK1 A;  5KLV K;  4TLF A;  4KJM A;  3S9O A;  3TSI A;  3R4Y A;  3TGU D;  5GTH E;  3L70 J;  2ZT9 B;  4EDF A;  5KLV J;  2QIW A;  1JUN A;  1SQP K;  3AE6 C;  4I1L A;  5AVY B;  3FX0 A;  3GW6 A;  5EFW B;  2K9Y A;  1FJP A;  1IFM A;  1FZC A;  3L73 J;  1Q81 Q;  2FFD A;  4L76 A;  1FE6 A;  1JM0 A;  2HPC B;  3L70 E;  1GL2 A;  5CCH A;  2FYU K;  5KLV E;  1JNM A;  1QL2 A;  2YNY A;  5CHX A;  1YIT P;  3RK3 B;  3A0B H;  2Q3E A;  3CX5 D;  2PP6 A;  4DOJ A;  3OAK A;  4M3L A;  4ASW A;  1SQP G;  1OVU A;  3KHU A;  1RH5 B;  1SQX D;  1SQP E;  3L73 E;  3H32 B;  5AW8 B;  2MJZ A;  1USE A;  3GLM A;  2IPP A;  2W8Z A;  3E1R A;  3A7O A;  1KV4 A;  5B66 H;  2HOD B;  1M7L A;  4R4L A;  3KPE A;  1IFP A;  2FYU G;  1XTC C;  1KYO E;  1PGO A;  1RE4 C;  2FYU E;  1GW3 A;  4HJG H;  4C7N B;  2Y0E A;  3CCQ P;  1P84 H;  3Q3D A;  1BCC D;  1IFI A;  2L5G B;  1S3J A;  1MUU A;  1GZL A;  4JPZ B;  4IL6 E;  3MZW B;  4OVN F;  2Q7C A;  5AW7 B;  2JP3 A;  2OQQ A;  3BRT B;  3VMY A;  2A06 G;  2P67 A;  2YO3 A;  5TJH A;  1KD1 Q;  4B86 A;  1URQ C;  3N4X A;  3MIW A;  1GTW A;  4UB6 E;  4W7Y A;  1OZH A;  2N9B A;  2HPC A;  3M9B A;  2PFX A;  2K88 A;  1K04 A;  2IBZ G;  1EZV I;  2N1T B;  3M9H A;  3G6E P;  2BEQ D;  2Y9Z A;  2V4H A;  2GM4 A;  3H6P A;  3G4S P;  1W2E A;  4EI2 A;  3NMD A;  2HG5 D;  1IFD A;  3V2R A;  2WSE J;  1QL1 A;  4UB8 E;  4DJG A;  3BRV B;  1KB9 D;  1AVO A;  4KT0 J;  4H44 C;  5APV A;  1EZV G;  1E5W A;  2HOD A;  3RL0 D;  3RL0 C;  4H13 B;  5AVR B;  2CK3 H;  1GK4 A;  4C7R A;  2HR3 A;  1WRG A;  2KIK A;  3EQ2 A;  1N2D C;  2PRR A;  2DW3 A;  1IO4 A;  4C7N A;  3M06 A;  1UII A;  2QEX P;  1N7S D;  1N7S C;  3SWK A;  3IF4 A;  3H1H G;  4PV1 C;  1JY3 N;  1L4A B;  2KSJ A;  5APQ A;  5AW6 B;  3H1H E;  4YXW H;  2YIU B;  5TIS E;  1DX7 A;  5KAF E;  3HRN A;  2LXC B;  1SFC C;  1EDL A;  2R3C A;  3CCS P;  4Y99 B;  1GMJ A;  2E74 B;  1AA0 A;  1KQL A;  4D6T G;  4IFD K;  1SQQ K;  1M1K Q;  1P84 I;  3VP8 A;  1JOC A;  1PP9 D;  3MUD A;  5KJ7 C;  1SVF A;  2FYN C;  2N1T A;  1BSH A;  3CCU P;  1KMI Z;  3EFG A;  3P8C E;  2C9L Y;  1OVR A;  1W2B O;  2WPS A;  2IZ0 A;  1BDC A;  4QMA A;  2E75 B;  2RMZ A;  1T8Z A;  4EIJ A;  2KNC B;  3VTP C;  1SQB G;  3H1I J;  4MN4 C;  4IFF A;  1JY3 O;  2KI7 B;  2FKW B;  1H8A A;  4Y28 J;  1DH3 A;  3L75 G;  3P32 A;  5GTI E;  2CPB A;  2J59 M;  1SQQ G;  2M5A B;  1KOR A;  2OTL P;  3B5N D;  3B5N C;  5C39 A;  2WMM A;  3H1I G;  3IFM A;  2IZ1 A;  4U3F J;  1OX3 A;  5GTH H;  5KTB A;  1M1J C;  5KLI B;  3H1I E;  1X9V A;  2YMY A;  1AJY A;  1YI2 P;  2NRG A;  1LT1 A;  5CCG A;  2RKL A;  1KIL B;  1RF1 C;  2Q6Q A;  4PD4 D;  2KOG A;  3NTN A;  3B8E B;  1NTM D;  1VQO P;  5E79 H;  2KYV A;  2V7Q J;  1HTL C;  4JF7 A;  1SQV D;  1L4A A;  1LJ2 A;  2ZT9 D;  4U3F E;  3O8Z A;  2KP8 A;  1OWA A;  3D6Z A;  3AEA C;  2K37 A;  3USS A;  4XA4 A;  1OW8 A;  1DEE G;  2K3R A;  1JMM A;  4KHX A;  2N9Y B;  1NTZ D;  3PJS K;  1RE3 A;  1FDM A;  3TGU J;  1BSN A;  1YTZ I;  2E76 C;  2W90 A;  2ZJS E;  3H1K D;  1K8A Q;  3MTU E;  2OYH C;  1HGV A;  1PZQ A;  2IYP A;  4DZO A;  1ZRT D;  2O01 N;  2OYI B;  4GKG A;  2KNC A;  4IL6 X;  1RHZ B;  2YKO A;  2Y9Y A;  1HUC A;  1FOS E;  4DT0 A;  1WT6 A;  2WSC H;  2P10 A;  1E79 H;  5AW2 B;  1BE3 D;  3CC4 P;  2YKQ A;  3IR9 A;  2IYO A;  2VRS A;  3CCM P;  1Y9B A;  3TGU E;  5CBO A;  4XE5 B;  2M5A A;  1N73 C;  3C9I A;  1LWU B;  2CPS A;  5L8R J;  1SQX K;  2YXR B;  3QH9 A;  4RKU J;  4LGD E;  3KQG A;  4N78 E;  1VQL P;  1AQ5 A;  5AW1 B;  4WVZ A;  1N8R Q;  3RK2 B;  2NPS B;  1KIL A;  1MKM A;  3P7K A;  1YTZ T;  2R44 A;  2FYN B;  4I7Z B;  3BCC D;  2ZYG A;  3RBZ A;  3SWY A;  1EDK A;  1PL5 A;  2BCC G;  4L74 A;  4UB6 H;  5APW A;  3A2A A;  3CX5 E;  4IOI H;  1L0L D;  1SQX G;  4H0L B;  1H89 A;  4RO0 A;  3H1J D;  1ZW0 A;  1FDI A;  1SQX E;  3CLQ A;  1J1E B;  3V2N A;  3V5B A;  1ZR2 A;  2Q5U A;  1LTS C;  3HUS C;  1HH0 A;  2QG4 A;  1NTK D;  2YKP A;  3L74 D;  5AVS B;  1M8O B;  3A0H E;  1BCC J;  2SPZ A;  4UB8 H;  1T2K D;  3KYQ A;  3L72 G;  4PJ0 E;  2OYI A;  3L72 E;  1YQ3 C;  1S5L H;  3O6Q B;  2LKM A;  1H0T B;  1HJB A;  3AEC C;  2PGD A;  2JWD A;  3AE8 C;  3VMX A;  1LT9 C;  1FZG A;  2P7J A;  5KKZ B;  2WSE H;  1ZV8 A;  5APT A;  1BCC E;  2O1K A;  3SFE C;  2ZFC A;  2ZAE B;  2KS1 B;  4GDO A;  1LWU A; 
#chains in the Genus database with same CATH homology
 1ZN5 A;  1JCC A;  1YYC A;  2N9B A;  2HPC A;  3M9Q A;  3M9B A;  4C46 A;  2N1T B;  3M9H A;  1X8Y A;  2IFN A;  3PP5 A;  1JO5 A;  2POH A;  2HFE D;  3P8M C;  1LT9 A;  2GUV A;  2NPS A;  2GM4 A;  1SFC B;  3H6P A;  1W2E A;  1CW5 A;  2M8R A;  1URQ A;  3NMD A;  2HG5 D;  1IFD A;  3VN0 A;  3V2R A;  1FOS F;  2QM7 A;  1J1E C;  1NHL A;  4AYC A;  1NH4 A;  1QL1 A;  2OYH B;  3HD7 B;  1X79 B;  2XZR A;  1FZB A;  2XNX A;  5CJ0 A;  2R32 A;  3BRV B;  3MD0 A;  2WT7 A;  4GIF A;  5APV A;  1NTK K;  4AUW A;  4WY4 B;  3NXS A;  1E5W A;  2O1J A;  2HOD A;  2P2U A;  3RL0 D;  1J1D B;  3U1C A;  2Z4E A;  5APS A;  3RL0 C;  1NU1 K;  5AVR B;  3G3Z A;  2WWW A;  1GK4 A;  2IFM A;  2R5B A;  3M91 A;  4C7R A;  2W6A A;  3GHG C;  3HTK B;  1A02 F;  1DEB A;  1Z56 A;  1WRG A;  3MGN A;  3EQ2 A;  3M0D C;  1N2D C;  1LTJ B;  1FZE A;  1IO4 A;  3LIE A;  4N3Y B;  3V2Q A;  2P1J A;  5AVQ B;  4C7N A;  1MV8 A;  3M06 A;  2C9N Y;  4LC1 A;  3II6 A;  3B5N B;  3V4W A;  3KDP B;  1N7S D;  1FBM A;  1N7S C;  5AVT B;  1KFM A;  2W27 A;  2WPQ A;  3GHG A;  1KZU B;  2N1T D;  1M1J B;  1T2K C;  1JY3 N;  3L4F A;  1L4A B;  5AW4 B;  2N1T C;  1RF0 C;  2KSJ A;  5APQ A;  5AW6 B;  3UIA A;  1OXZ A;  1S9K D;  3P8C D;  4JYB A;  3M0D A;  4HH2 A;  3TNU B;  1DX7 A;  4OH8 B;  1MZ9 A;  3HRN A;  1NAF A;  1SFC C;  1RF1 B;  2R3C A;  4Y99 B;  1L0N K;  1GU4 A;  1JCD A;  1N7S B;  1KQL A;  3BAT A;  4IFD K;  1SQQ K;  3HD7 D;  1N7S A;  2WIT A;  3HD7 C;  2WPR A;  2PAJ A;  3VP8 A;  1JOC A;  3MUD A;  5KJ7 C;  1SVF A;  2N1T A;  2XV5 A;  3U1A A;  1S9K E;  1RF0 A;  1IJD B;  3EFG A;  3P8C E;  2C9L Y;  2WPS A;  4IFM A;  4WY4 D;  3VP9 A;  1FU1 A;  1N7L A;  4WY4 C;  1J2J B;  3N7N A;  3LW5 H;  2XDJ A;  1SFC A;  1J1D C;  2Q9I A;  1T8Z A;  1LTB C;  4EIJ A;  3VTP C;  3HE4 B;  1H88 A;  4N78 D;  1T3U A;  2A45 I;  4IFF A;  1JY3 O;  2HLO A;  1LTT C;  2OYH A;  1KIL D;  3HD7 A;  1N86 A;  2KB7 P;  5BU5 A;  1KFN A;  2H7H A;  2FKW B;  1H8A A;  5KJ7 A;  1DH3 A;  5CCG D;  3P32 A;  2CPB A;  5CCG C;  1VDF A;  1LTJ C;  2J59 M;  1G2C B;  1FZC B;  2Q3I A;  5AW5 B;  5BVZ A;  1VPC A;  2FXM A;  4WY4 A;  2FFD B;  3B5N D;  3WMM 0;  1LTA C;  3B5N C;  4W80 A;  2WSF H;  5APU A;  3TYY A;  5APX A;  1NTM K;  3IFM A;  2IX7 C;  3T97 A;  1GL2 B;  3HTK A;  1L4A D;  1CI6 B;  5KTB A;  1M1J C;  1L4A C;  4EOT A;  1X9V A;  3VMZ A;  2YMY A;  2A45 G;  1JY2 N;  3SWF A;  2OAR A;  2C0X A;  5AW0 B;  5CCG A;  2WTY A;  1LTJ A;  2O01 H;  2J58 A;  4N6J A;  1JY2 P;  1KIL B;  3CI9 A;  1RF1 C;  5APY A;  3V4Q A;  4Y99 C;  1N73 B;  2KOG A;  1AFO A;  1LTI C;  3NTN A;  3B5N A;  3B8E B;  1MFZ A;  3U59 A;  1RE3 C;  2KYV A;  1NTZ K;  4I6M C;  1HTL C;  4JF7 A;  2XU6 A;  3LID A;  1M1J A;  1L4A A;  3M0A A;  2BAS A;  3O8Z A;  1CZQ A;  2KP8 A;  2KLV A;  3VYI A;  1XTG B;  1HVV A;  1OWA A;  5AW9 B;  1CSB A;  4XA4 A;  3TNU A;  1T3J A;  3CL3 D;  2QM8 A;  4LLH A;  1JMM A;  3HE5 B;  1RF1 A;  1HWT C;  4KHX A;  3V2P A;  3E1I A;  2I1K A;  1LTG C;  4HYT B;  1NKN A;  2M3B A;  2Z5H A;  1RE3 A;  5CMZ A;  3NFQ A;  1JY2 O;  1HGZ A;  1FDM A;  1IK9 A;  3TK1 A;  5KLV K;  3OA7 A;  1FZF A;  1YTZ I;  1SLQ A;  3MTU E;  2OYH C;  3L37 A;  1SP4 A;  3TSI A;  1FZC C;  1HGV A;  2FFD C;  3BVH A;  4DZO A;  1GW4 A;  2OYI B;  4GKG A;  3HE4 A;  2HYN A;  5AVX B;  1EQ7 A;  2YKO A;  1GL2 D;  1HUC A;  5CCH D;  1FOS E;  1GDT A;  3HUS B;  1WT6 A;  1GL2 C;  1SQP K;  1JUN A;  5CCH C;  2WSC H;  1URQ D;  4I1L A;  5AVY B;  5AW2 B;  4AQR D;  4ZKU A;  1IFJ A;  4RES B;  3A3Y B;  2YKQ A;  3IR9 A;  2H43 A;  1FJP A;  2VRS A;  1IFM A;  1G2C A;  3BAS A;  1FZC A;  1KIL C;  1GD2 E;  4XE5 B;  1N73 C;  2FFD A;  3C9I A;  2JJL A;  1JTH B;  3OJA B;  1LWU B;  2CPS A;  1SQX K;  2HPC B;  1GL2 A;  4LGD E;  1CI6 A;  5CCH A;  2JEE A;  2FYU K;  1JNM A;  3KQG A;  1G1J A;  1QL2 A;  4N78 E;  2YNY A;  5CHX A;  4WB4 A;  1NOH A;  3RK3 B;  5BU8 B;  1AQ5 A;  1NKZ B;  5AVV B;  5AW1 B;  1LT9 B;  2PP6 A;  4DOJ A;  3OAK A;  1ZR4 A;  4M3L A;  3RK2 B;  2NPS B;  1SQV K;  2GUS A;  1L0L K;  5AVW B;  3VOP A;  1KIL A;  1GK6 A;  1URQ B;  2ZXE B;  1PFI A;  2FYZ A;  3P7K A;  1GU5 A;  4JYC A;  1N73 A;  1YTZ T;  3H32 A;  2YO2 A;  1HBW A;  1FZA A;  1IC2 A;  3A5T A;  3SWY A;  3H32 B;  5AW8 B;  2E42 A;  2WT7 B;  5APW A;  2I1J A;  4GT1 A;  3A2A A;  2MJZ A;  4O9B A;  2IPP A;  3A7O A;  5AVU B;  2HOD B;  1H89 A;  1NO4 A;  1M7L A;  3HE5 A;  3KPE A;  3L35 A;  2OYI C;  3CLQ A;  1XTC C;  1J1E B;  3V2N A;  3V5B A;  1ZR2 A;  2Q5U A;  1LTS C;  1FJK A;  3HUS C;  1HH0 A;  1RE4 C;  3L36 A;  1NWQ A;  2YKP A;  1GW3 A;  5AVS B;  2E43 A;  1IFN A;  3R2P A;  1RY3 A;  4C7N B;  4ZKP A;  1ZLL A;  1T2K D;  3KYQ A;  3I5C A;  1SQB K;  1IFI A;  2L5G B;  1MUU A;  3RL0 B;  1LWU C;  2OYI A;  1GZL A;  2WZ7 A;  2Q7C A;  1JY3 P;  5AW3 B;  3GHG B;  5AW7 B;  4I2L C;  3HUS A;  4WBA A;  1RE4 A;  3BRT B;  1SFC D;  2Z5I A;  3VMY A;  1FAV A;  2LKM A;  2C0W A;  3RK3 D;  1HJB A;  2P67 A;  2W6B A;  2YO3 A;  1A02 J;  3RK3 C;  5CJ4 A;  3VMX A;  3RK2 D;  1LT9 C;  2NPS D;  5AVZ B;  4W7Z A;  1FZG A;  2P7J A;  2XKM A;  2A45 H;  3RK2 C;  2NPS C;  2WSE H;  1ZV8 A;  4B86 A;  5APT A;  1URQ C;  2H8P D;  5KJ7 D;  3N4X A;  2O1K A;  2ZFC A;  1G1I A;  3MIW A;  1JTH A;  1GTW A;  1LGH B;  4W7Y A;  1LWU A;  2R5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...