2IPPA

Crystal structure of the tetragonal form of human liver cathepsin b
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
LPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the tetragonal form of human liver cathepsin B
rcsb
molecule tags Hydrolase
molecule keywords Cathepsin B
total genus 10
structure length 47
sequence length 47
ec nomenclature ec 3.4.22.1: Cathepsin B.
pdb deposition date 2006-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ippA01
2XU6A 3B8EB 5APXA 3L35A 3A2AA 3O8ZA 5CMZA 5AVZB 1MUUA 2W6AA 4KHXA 5AVXB 2E43A 2R5DA 2YO3A 1GZLA 5APWA 1HJBA 2ZXEB 2H7HA 5AW1B 4JYBA 4XE5B 3UIAA 5AW0B 3I5CA 3M0AA 4AUWA 1HWTC 3T97A 3MGNA 3OAKA 4I2LC 2QM7A 3IR9A 4GKGA 1IO4A 2Z5IA 3LIDA 2YO2A 1GTWA 3HE5B 4JYCA 4M3LA 3L36A 1OXZA 2R3CA 4RESB 1CI6A 1FOSE 2QM8A 2JJLA 5APYA 2Q3IA 1JNMA 3L37A 2WT7A 3P8MC 1SP4A 5AW8B 1A02J 3HTKA 2WTYA 4AYCA 3M0DA 5AVSB 1GK4A 1FAVA 5AVUB 3M9BA 2WPQA 3LIEA 5AVTB 2C9LY 2WPSA 2W27A 3NXSA 1YYCA 2Z5HA 4GT1A 3HE4B 3VMYA 2WPRA 3A3YB 3HE4A 1A02F 1S9KD 5AVQB 5AVYB 5AVVB 2IPPA 1KQLA 5AW7B 1GU4A 5APUA 2C9NY 2P7JA 2R5BA 3MD0A 2BASA 3TYYA 3KQGA 5AW5B 5AVWB 3A5TA 5APTA 3M06A 2Q7CA 1SLQA 3KDPB 5AW4B 1CZQA 5AW6B 2P2UA 5AW3B 1NAFA 1GU5A 4HYTB 3P32A 2YNYA 3VYIA 3VMXA 3VTPC 3VN0A 4DZOA 1MFZA 3V4QA 2E42A 3NMDA 2KP8A 1OWAA 1G2CB 3M91A 4B86A 4C7NB 5APSA 5AVRB 2Q5UA 2P67A 4C46A 3SWFA 1T2KD 5APVA 1NWQA 3V4WA 3VMZA 4C7NA 1J2JB 3TNUA 1CSBA 1H88A 1S9KE 4I6MC 1JUNA 3HE5A 3TNUB 2XV5A 1X8YA 3NFQA 3P7KA 1HBWA 5AW9B 1DH3A 1GK6A 2R32A 1GD2E 1H89A 1HUCA 2N9BA 4AQRD 1T2KC 2XZRA 3NTNA 4LC1A 2WT7B 2WWWA 1CI6B 1MV8A 2ZFCA 3M9HA 1H8AA 4EOTA 3A7OA 3V5BA 5APQA 3TK1A 2VRSA 5AW2B 1FOSF
chains in the Genus database with same CATH superfamily
2XU6A 1DEBA 5APXA 3KYQA 3AE9C 1NTKG 4WY4C 1NYHA 4IL6H 1LP1A 1PL5A 2E74B 2W6AA 4KHXA 2FYUJ 1SQBE 5AVZB 5AVXB 3ZDMA 1A02F 1SQBJ 5CCGA 2YO3A 1GZLA 4L74A 3FXDA 1NKNA 3MP7B 1IFIA 2ZXEB 4PJ0H 5E79E 5APWA 1AJYA 1JM0A 3T97B 4XE5B 3D70A 1FZCA 2FXPA 5KLIC 1T2KD 4UB8H 3TGUG 5M1BA 1SQXD 3Q5SA 1HVVA 1SQVJ 2KLUA 1J1EB 1E5WA 1VQ9P 1U7MA 4GDOA 3JCUE 4GOFA 4I2LC 1K8AQ 5CHXA 1IO4A 1FDOA 2Y9YA 4U3FD 1N7LA 1OMIA 1M1KQ 2IYPA 1KILD 3LIDA 3CCMP 3HE5B 5KLVJ 1PPJD 3L72J 1OFCX 3R2PA 5KJ7C 3RK3E 3RL0g 3II6A 3Q2YA 1J1DC 1KB9I 1P84E 2M3EA 1CI6A 2M5AA 2R3CA 3S1KA 1NOHA 2OYOA 1Y47A 2JJLA 2QM8A 5APYA 1ZMEC 3CMEP 1PGOA 4EIJA 2Q9IA 1NU1D 2G3AA 2K9JA 2O1JA 1W2BO 1URQA 1WT6A 1L0ND 1SQXG 2E5YA 3GW6A 3HD7B 2Z4EA 3A0HE 3ABVC 4W7ZA 1A02J 4HH2A 4H0LB 3CX5E 4WY4A 1YIJP 1GK4A 1LTSC 3RK3D 4U3FG 1VQ4P 1R5SA 1LTIC 2KNCB 3M9BA 1SQPJ 5KJ7D 1VQLP 1JY3P 2HFED 1DD3A 5BVZA 1LTJC 3H32B 3NXSA 3TGUD 2KOGA 4D6TD 1LTGC 3L4FA 3OW2O 1KFNA 3AE6C 4HB1A 2YXQB 2FBWC 1BGYJ 1JTHB 3QWOC 5AVYB 2IPPA 1FZAA 3GHGA 1S9KD 2HODB 1T8ZA 2IX7C 5H2FH 1LT9B 1PP9D 1LTBC 2J59M 1EC5A 3AE7C 3N4XA 3L73G 1D7MA 2UWJE 3PJSK 4N6JA 1KYOE 3EFFK 3M0DC 1KN7A 1NU1K 1SQVK 1N8RQ 2WSSH 3L75J 1L0NK 3F89A 1KB9D 4ASVA 2BCCG 2SPZA 3N7NA 1KQFB 1YJWP 1VPCA 3CPWO 1HGVA 3C9IA 5CBOA 1YTZT 1OIPA 2L5GB 2QJPC 1NU1G 4KJMA 3GG2A 4H0LC 2FYNB 5TISH 1L0LE 5AW6B 5AW3B 3G4SP 5B66E 1BCCJ 1KORA 1SQVG 4HYTB 3VYIA 1BCCE 2IZ1A 3PH0A 3VMXA 1NTZE 1SVFA 5TISE 3VN0A 1M1JB 3CCJP 1NTZJ 3C8VA 1KFMA 1GL2B 1OWAA 4YXDC 3W68A 1N73C 3I56P 3KZIE 4C7NB 1KYOD 2M3BA 4PV1C 4R4LA 1RF0C 1LWUC 2YKPA 4YTPC 1BE3J 4WY4B 1BE3D 4DCKA 4Z1MH 2K88A 1NWQA 3MTUE 2V7QH 1H0TB 3H1HE 3L74E 1NH4A 3HUSC 4WY4D 3H1KG 3TNUB 4YPCA 1NTZD 3AEAC 1EZVE 1HBWA 2LR2A 3V2NA 3MHVA 3H1LD 4DJGA 2WT7B 3SWKA 2POHA 1GL2D 1URQB 2PRRA 3H1HJ 1LTJB 3L74J 1HUCA 3IF4A 5KTBA 3U59A 4AQRD 2WMMA 4OGQC 1T2KC 1M1JA 2XZRA 2WSEJ 3NTNA 1R8EA 2O01H 2A06E 2FFDC 1L4AB 2WSFH 3AEBC 3P8CD 4H13B 1QVGO 2QJKB 2FY8A 1N73A 1DIPA 1SQPE 1KILA 2HG5D 3KXDA 4U7JA 2OTJP 3L75D 3USSA 2I1JA 2OYIB 4EYYQ 3L71D 1JMMA 1R5LA 1RE3A 2D2CB 2I8DA 2I1KA 1GL2C 1JCCA 1XTCC 2QRXA 3PLNA 1L0LJ 1KILE 2FKWB 1QVFO 3M9QA 1FOSF 1PPJE 3RBZA 1LTAC 2PP6A 1PP9G 4LGDE 1MUUA 1ZRTE 1RQUA 3B5ND 1LNQA 4DOJA 3MIWA 3CCSP 3AEGC 3HUSB 1N7SC 3CCVP 1HJBA 3LW5H 2JP3A 5AW1B 3UIAA 2LXCB 2KK7A 3V2PA 3I5CA 2GM4A 3H1KJ 3M0AA 4D6TG 2IFNA 1DD4A 3CWBG 3RGUA 4K35A 1AVYA 3H1IJ 3CX5D 2KZIA 3GF7A 3OAKA 2NPSD 1VQPP 2Q1KA 2QM7A 3PHLA 3GHGC 3IR9A 4GKGA 3A0BH 3TGUE 2QE7H 2Z5IA 1T6AA 2NPSB 3FWNA 1LJ2A 4PJ0E 1EDLA 2IZ0A 1KB9H 1L0NG 3JC22 4IFMA 1XTGB 5L8RJ 2FYNC 4RESB 1Z56A 2O3JA 4IL6E 1S72P 2ZVNB 1EZVI 1MZ9A 4N78D 4N3YB 5EFWB 3BRTB 2Q3IA 2E75B 5CCGC 3RL0C 3AEDC 2OYHC 2W8ZA 1KB9E 1P84I 1RE3C 2ZVOB 3RK2B 1SFCA 1AFOA 2FYUK 3D6ZA 2YIUB 3HTKA 4RKUJ 1YBKA 2AXTE 1HJ0A 1KILB 1VF5C 2PGDA 1FAVA 3A0BE 5AVSB 5AVUB 2E75C 3RL0B 3G3ZA 3LW5J 3L70J 2WPQA 4H44C 5C39A 1LTTC 4HKZH 4PD4D 1BSNA 2WPSA 2KXPB 3CWBD 1SQQE 2QG4A 3BCCJ 1GW3A 3HE4B 3AE8C 3B4SA 1SS1A 2WPRA 3V6IA 3VMYA 2OYIC 2C0XA 3H1HG 3L74G 3V2RA 3D6YA 1M8OB 2IBZE 5DJTB 1HGZA 1KQLA 2FXOA 1JY2O 3IN6A 3HUSA 4Y99B 2A45I 3AE2C 4BXLA 1URQD 2P1JA 2KIKA 2WVRA 3TDKA 2RH0A 2NRGA 1VQ5P 3C1LA 4Y28J 1EQ7A 1ZR4A 3CC2P 1CW5A 2M5AB 2QJKC 3HTKB 4ZKPA 5GTIE 3O6QB 4L76A 1JMBA 1FZEA 3HD7C 1NTMG 1NTZK 2O01J 3CI9A 5APUA 2IFMA 5AVWB 2OYHA 5APTA 2YKOA 3BATA 1VQKP 2Q7CA 3W67A 1SLQA 1P84D 2AEJA 2YIUC 1CZQA 1PP9J 1JEKA 3GHGB 3BCCG 1L2PA 1KILC 4WBAA 5TJHA 4W80A 5CCHD 4GIFA 3H1LE 4XFJA 3CD6P 2B88A 2YNYA 3P32A 4RO0A 4QMAA 1OZHA 2M8RA 3VTPC 1L0LG 1MFZA 1P84H 2WPVB 3NMDA 1PFIA 1PPJG 5CBNA 1KTMA 1FZCC 3CLQA 3H32A 3M91A 3TSIA 4BRYB 3B5NB 1VQOP 5APSA 2BEZF 1S5LE 3H25A 2QJYC 1LWUB 1HF9A 2IDBA 1DEEG 3S4RA 3V4WA 5KLIB 1N7SA 1J2JB 5K5GB 1CSBA 5KKZB 2CK3H 1UIXA 3H1JE 1H88A 4IFDK 3KHUA 2KS1B 1LT9A 3E1RA 4D6TE 1FC2C 1SQBK 1S5LH 3CCRP 1NGMB 5H2FE 1L0NJ 3KZIH 2D2CC 5KLVG 1S2EA 1U7JA 1QEXA 3Q5RA 3AEEC 4WB4A 1DX7A 4L75A 4IL6X 5AW9B 1SQBG 2R32A 2YKQA 2N1TC 1YITP 1H89A 1MKMA 2Y0EA 2QJPB 2YMYA 1BDDA 2Y0CA 2OGUA 3CXHE 3MZWB 1Q7YQ 1X22A 3RK3B 3CC4P 2PFXA 2JWDA 3CCEP 2IBZI 1OX3A 3BCCD 1G1JA 1Q90D 3CWBJ 3M9HA 1IFDA 1WMKA 1NJIQ 4EOTA 2XDJA 3A7OA 4U3FJ 2KYVA 1OW8A 1IK7A 3OA7A 3V5BA 1YI2P 1USDA 1NTKD 1LP1B 1X0TA 5APQA 4NPFX 2YMKA 2KZJA 1RHZB 1NTKJ 1ZLLA 1SQXJ 2RKLA 5GTHE 1VQNP 2PAJA 1S5LX 5AW2B 1VL2A 1ZW0A 4ZKUA 2J58A 3G6EP 1OVRA 2CPBA 3L35A 3A2AA 3H1JJ 3CXHI 4C7RA 1SQBD 2FYUD 2R5DA 1YQ3C 1HTLC 1IFMA 1TU3F 1NTZG 1UIIA 2A45G 1NVOA 1NAYA 2BCCJ 1AA0A 1SQXE 4JYBA 3WUUA 1BE3E 1URQC 2WSEH 5BU5A 1EDIA 1LGHB 1FZBA 1GMJA 1E79H 2W6BA 4AUWA 1HWTC 1ZV8A 4U3FE 3GLMA 3MGNA 3T97A 4JQ0D 2FFDB 3CWBE 1FU1A 1T3JA 3H1ID 3CCLP 2AXTH 2B87B 3K5BA 3H6PA 3CX5H 2AXCA 2E76D 3H1KD 1LTJA 2YO2A 4Y99C 1KC8Q 3L36A 1VQ7P 2ZYDA 1MFTA 4MN4C 2E75D 1J1DB 1FOSE 2H8PD 4OH8B 3B5NA 1VF5D 1RF1A 3HD7A 1QLED 1KD1Q 3RK2D 1L0NE 2KB7P 3H1IG 1IFNA 1PGJA 1JNMA 2N9YB 2Y9ZA 1J1EC 3SFDC 2R44A 3QH9A 3S9OA 1KQSO 1L0LD 3V2QA 2HPCB 1RF1C 3M0DA 4BWNA 3AE3C 3CXHD 1U57A 4KT0J 4UB6E 2K9JB 2ZT9C 1K04A 2W90A 5AVTB 1SQXK 2B87A 3I55P 1FDMA 2YXRB 2E74D 1G2CA 1Y8AA 1FJPA 4GT1A 1NHLA 1USEA 2GUSA 1NTMD 1ZRTD 2E74C 5KAFH 1GW4A 1YQ4C 1SQVE 2Q6QA 2ZT9D 1PP9E 3BRVB 2QSIA 3H1HD 3L74D 2FYZA 3PTZA 2O1KA 2AEFA 2M0BA 2A45H 3R4YA 3H1LJ 5KLVK 1GU4A 1LT9C 1GDTA 3L75G 5B66H 1W5CE 4A7PA 3AEFC 4GOEA 2C9NY 1SFCC 2NZ2A 2P7JA 2L91A 3JSVC 4EI2A 2N1TA 2B89A 3MD0A 2BASA 2HYNA 3KQGA 1JB0J 3AE5C 3L70D 1L4AD 4H13D 3RK2C 1L0LK 3EWKA 2K37A 1IK9A 1FBMA 2ZYAA 3L71G 5CJ0A 2RMZA 1EXJA 3A0HH 5GTIH 2E5TA 3KDPB 3VMAA 3Q3DA 5AW4B 2AEMA 4TT3H 3L73J 2P2UA 1NAFA 2H88C 4DZOA 1HH0A 3F5HA 1AVOA 2FFDA 3CC7P 1BCCD 1SQQJ 3BCCE 4WWIA 1NTMK 2ZXXA 3EQ2A 1BGYG 3FGAD 3SSUA 3RBXA 2KP8A 2A06G 1YJNP 4OVNF 1SQQK 5B5EH 1NTKK 4B86A 1N2DC 2H43A 2K9YA 3OJAB 4ZNCA 3BVHA 1M7LA 3L73E 1YTZI 2HR3A 2QJYB 4OGQD 5AVRB 3SWFA 1JCDA 1PIXA 2MKVA 2QIWA 1PGQA 1IFPA 2B9BA 1JO5A 3MUDC 2BEQD 3JCUH 3VMZA 1KQGB 3TNUA 4C7NA 1WRGA 4CPGA 1S9KE 4I6MC 1W2EA 1Q81Q 1JUNA 2QA4P 1FDIA 1PZQA 1X79B 2FYUE 1SQPK 1RQVA 1RF1B 2WSCH 2XV5A 1X8YA 1IJDB 3P7KA 4PD4E 1RE4A 1BSHA 3L72G 5E79H 4I7ZB 1KYOI 1GD2E 1BGYD 1EDKA 2FXMA 4PV1D 1AV1A 1BCCG 2K3RA 2KUBA 2N9BA 2Q3EA 4OGQB 1N73B 2XNDH 4LC1A 3L70G 2KLVA 2WQYC 3AE1C 2WWWA 3VP8A 1LT1A 1CI6B 2WZ7A 2ZFCA 3TGUJ 5CCHA 1H8AA 2JDIH 1ZOYC 1AQ5A 2KI7B 1N86A 3H1IE 5KJ7A 2N1TB 2W83C 3P8CE 3FXEA 1FZCB 2HLOA 4DT0A 3L71J 3WUVA 4HJGH 2N1TD 1JOCA 2O01N 2C0WA 3H1KE 1QL1A 1X9VA 2D2CD 1NKZB 1S1CX 2KSEA 3B8EB 2Y0DA 1PGPA 4O9BA 4RJTA 3O8ZA 5CMZA 4EDFA 1JY3N 3H1LG 2E43A 3VOPA 3G9RA 5CJ4A 1FS0E 1NTMJ 1VDFA 2WSCJ 4JPZB 3U1AA 2H7HA 5AW0B 3CCQP 3PRJA 1OVVA 1EZVD 1BE3G 1T3UA 2NPSA 1JY2N 4XA4A 1IZNB 4I1LA 1M56D 2HODA 2JKVA 2LXBA 1VQ8P 5CCHC 1NO4A 1QL2A 1GTWA 1NU1E 2A06D 3E7KA 2W6JH 4JYCA 3HRNA 4M3LA 3SWYA 1IC2A 3GF3A 4H44D 4TLFA 1OXZA 3FWLA 5KAIE 3RK3C 1FE6A 4PD4I 2RN0A 4R4MA 3WU2H 3WU2E 3HD7D 1L4AC 2OARA 4H13C 3CX5I 4IFFA 1RY3A 2P58A 3L37A 4GODA 1Q82Q 2WT7A 3GMAA 3WMM0 3SFEC 1SFCD 3P8MC 5BU8B 1SP4A 5AW8B 2QEXP 2JO1A 3RL0D 5CCGD 3MUDA 2WTYA 4AYCA 1BGYE 2E76B 1SFCB 4K3AA 4L73A 2XNXA 1NTKE 1RH5B 3LIEA 5KKZC 1M57D 1ZN5A 1PV3A 1FJKA 2C9LY 1GL2A 2W27A 1YHQP 1EZVG 1YYCA 2Z5HA 2BCCD 4YXWH 3CXHH 1Q86Q 3AECC 2ZYGA 3G71P 1Y9BA 3A3YB 1SQQD 2GA1A 2NPSC 3B71A 2G8YA 3HE4A 2WITA 3O6QA 4I7ZC 3H1JD 5AVQB 5AVVB 1S4XA 2HPCA 4ZMDA 3L73D 2V7QJ 5AW7B 3Q1MA 3ITKA 2JWAA 3BASA 4D6TJ 1AQTA 2QVAA 2OYHB 2R5BA 3L75E 4BRYA 1RF0A 4NPDA 1OW6A 2BCCE 4UB6H 1IFJA 3B5NC 1Q2NA 4JF7A 3TYYA 1SQPD 5AW5B 2IYOA 1L4AA 3A5TA 1KMIZ 2KSJA 4JBZA 4W7YA 3CMAP 3AE4C 3IAOA 1G1IA 2OTKE 3EFGA 2CPSA 2V4HA 2ZAEB 3PP5A 5DJUB 3V4QA 5B5EE 3M06A 1VF5B 3VP9A 5KLVE 3Q5PA 3L71E 1FZGA 2OYIA 1KYOH 1K73Q 2OTLP 1H0TA 1KZUB 2E76C 1GU5A 2J5UA 1NU1J 1YJ9P 2K1AA 1ZR2A 2IBZG 2E42A 2XKMA 4IOIH 2JEEA 1M1JC 2WSFJ 3CCUP 2LKMA 1G2CB 1QX8A 4WVZA 4PD4H 1N7SB 1S3JA 1ZXGA 3L72D 2Q5UA 2P67A 1ZP0C 3FX0A 5KLVD 2P10A 5APVA 4ASWA 4C46A 1VQMP 1JY2P 1N7SD 1VQ6P 1KV4A 4H44B 1K05A 2IBZD 1NTME 3D71A 1SQVD 2DW3A 2GUVA 3HE5A 2OQQA 1FZFA 3NFQA 1JY3O 3E1IA 1LWUA 2FYUG 4N78E 1DH3A 1EDJA 1GK6A 3L72E 2H89C 5KAFE 1M90Q 3CL3D 2KS1A 2ZJSE 3TF5A 1BDCA 4LLHA 1SQPG 1QGKB 5KAIH 3KPEA 4PV1B 4OWFA 1MV8A 1JTHA 1OVUA 5GTHH 3L70E 3U1CA 1OW7A 2JR8A 2R3SA 1K9MQ 2MJZA 2KNCA 2ITAA 3WUTA 3H1JG 4H0LD 3TK1A 2ZT9B 2VRSA 1SQQG 3IFMA 1EXIA 4UB8E 4NPEA 1RE4C
chains in the Genus database with same CATH topology
2XU6A 1DEBA 5APXA 3KYQA 4WY4C 5AVZB 2W6AA 4KHXA 5AVXB 5CCGA 2YO3A 1GZLA 5APWA 1NKNA 1IFIA 2ZXEB 4XE5B 1FZCA 1HVVA 1J1EB 1E5WA 4I2LC 5CHXA 1IO4A 1N7LA 3LIDA 1KILD 3HE5B 3R2PA 5KJ7C 3II6A 1J1DC 2R3CA 1CI6A 1NOHA 2QM8A 2JJLA 5APYA 2Q9IA 4EIJA 2O1JA 1URQA 1WT6A 3HD7B 2Z4EA 4W7ZA 1A02J 4HH2A 4WY4A 1GK4A 1LTSC 3RK3D 1LTIC 3M9BA 5KJ7D 1JY3P 2HFED 5BVZA 1LTJC 3H32B 3NXSA 2KOGA 1LTGC 3L4FA 1KFNA 1JTHB 5AVYB 1S9KD 3GHGA 1FZAA 2IPPA 2HODB 1T8ZA 2IX7C 1LT9B 2J59M 1LTBC 3N4XA 5APUA 4N6JA 3M0DC 1NU1K 1SQVK 1L0NK 3N7NA 1VPCA 1HGVA 3C9IA 1YTZT 2L5GB 5AW6B 5AW3B 4HYTB 3VYIA 3VN0A 3VMXA 1SVFA 1M1JB 1KFMA 1GL2B 1OWAA 1N73C 4C7NB 2M3BA 1RF0C 1LWUC 2YKPA 1NWQA 4WY4B 3MTUE 1NH4A 3HUSC 4WY4D 3TNUB 1HBWA 3V2NA 2POHA 1GL2D 1URQB 1LTJB 1HUCA 5KTBA 3U59A 4AQRD 1T2KC 1M1JA 2XZRA 3NTNA 2O01H 2FFDC 1L4AB 2WSFH 3P8CD 1N73A 1KILA 2HG5D 2OYIB 2I1JA 1JMMA 1RE3A 2I1KA 1GL2C 1JCCA 1XTCC 2FKWB 3M9QA 1FOSF 1LTAC 2PP6A 4LGDE 1MUUA 3B5ND 4DOJA 3MIWA 3HUSB 1N7SC 1HJBA 3LW5H 5AW1B 3UIAA 3V2PA 3I5CA 2GM4A 3M0AA 2IFNA 3OAKA 2NPSD 2QM7A 3GHGC 3IR9A 4GKGA 2Z5IA 2NPSB 4IFMA 1XTGB 4RESB 1Z56A 1MZ9A 4N78D 2OYHC 4N3YB 3BRTB 2Q3IA 5CCGC 3RL0C 1RE3C 3RK2B 1SFCA 1AFOA 2FYUK 3HTKA 5AVSB 1KILB 1FAVA 5AVUB 3RL0B 3G3ZA 2WPQA 1LTTC 2WPSA 3HE4B 3VMYA 1GW3A 2OYIC 2WPRA 2C0XA 3V2RA 1HGZA 1KQLA 1JY2O 4Y99B 3HUSA 2A45I 1URQD 2P1JA 1ZR4A 1EQ7A 1CW5A 4ZKPA 3HTKB 1FZEA 3HD7C 5AVWB 1NTZK 3CI9A 2OYHA 2IFMA 5APTA 2YKOA 3BATA 2Q7CA 1SLQA 1CZQA 3GHGB 4WBAA 1KILC 4W80A 5CCHD 4GIFA 3P32A 2YNYA 3VTPC 2M8RA 1PFIA 1MFZA 3NMDA 1FZCC 3H32A 3CLQA 3M91A 3TSIA 3B5NB 5APSA 1LWUB 3V4WA 1FZGA 1N7SA 1J2JB 1H88A 1CSBA 4IFDK 1LT9A 1SQBK 4WB4A 1DX7A 5AW9B 2YKQA 2R32A 2N1TC 1H89A 2YMYA 3RK3B 3M9HA 1G1JA 1IFDA 4EOTA 2XDJA 3A7OA 2KYVA 3OA7A 3V5BA 5APQA 1ZLLA 2PAJA 5AW2B 4ZKUA 2J58A 2CPBA 3L35A 3A2AA 4C7RA 2R5DA 1HTLC 1IFMA 2A45G 4JYBA 5BU5A 1URQC 2WSEH 1LGHB 1FZBA 2W6BA 4AUWA 1HWTC 1ZV8A 3T97A 3MGNA 2FFDB 1FU1A 1T3JA 3H6PA 4Y99C 1LTJA 2YO2A 3L36A 1J1DB 1FOSE 2H8PD 4OH8B 3B5NA 1RF1A 3HD7A 3RK2D 2KB7P 1IFNA 1JNMA 1J1EC 2HPCB 3V2QA 1RF1C 3M0DA 5AVTB 1SQXK 1FDMA 1G2CA 1FJPA 4GT1A 1NHLA 2GUSA 1GW4A 3BRVB 2FYZA 2O1KA 5KLVK 2A45H 1GDTA 1GU4A 1LT9C 2C9NY 1SFCC 2P7JA 2N1TA 3MD0A 2BASA 2HYNA 3KQGA 1L4AD 3RK2C 1L0LK 1FBMA 1IK9A 5CJ0A 3KDPB 5AW4B 2P2UA 1NAFA 4DZOA 1HH0A 3V4QA 1NTMK 3EQ2A 2KP8A 1SQQK 2H43A 1NTKK 4B86A 1N2DC 3BVHA 2FFDA 3OJAB 1M7LA 1YTZI 5AVRB 1T2KD 3SWFA 1JCDA 1JO5A 3VMZA 4C7NA 3TNUA 1WRGA 1S9KE 4I6MC 1W2EA 1JUNA 1X79B 1RF1B 1SQPK 2WSCH 2XV5A 1X8YA 1IJDB 3P7KA 1RE4A 1GD2E 2FXMA 1N73B 2N9BA 4LC1A 3VP8A 2KLVA 2WT7B 2WWWA 5CCHA 1CI6B 2WZ7A 2ZFCA 1H8AA 1AQ5A 1N86A 5KJ7A 2N1TB 3P8CE 1FZCB 2HLOA 2N1TD 1JOCA 2C0WA 1QL1A 1X9VA 1NKZB 4O9BA 3B8EB 3O8ZA 5CMZA 2E43A 1JY3N 3VOPA 5CJ4A 1VDFA 3U1AA 2H7HA 5AW0B 1T3UA 2NPSA 1JY2N 4XA4A 4I1LA 2HODA 5CCHC 1NO4A 1QL2A 1GTWA 3SWYA 4JYCA 4M3LA 3HRNA 1IC2A 1OXZA 3RK3C 3HD7D 1L4AC 2OARA 4IFFA 1RY3A 3L37A 2WT7A 3WMM0 5BU8B 1SFCD 3P8MC 1SP4A 5AW8B 3RL0D 5CCGD 3MUDA 2WTYA 4AYCA 1SFCB 2XNXA 3LIEA 1ZN5A 2C9LY 1FJKA 1GL2A 2W27A 1YYCA 2Z5HA 3A3YB 2NPSC 3HE4A 2WITA 1A02F 5AVQB 5AVVB 2HPCA 5AW7B 3BASA 2OYHB 2R5BA 1RF0A 1IFJA 3B5NC 4JF7A 3TYYA 5AW5B 3A5TA 1L4AA 2KSJA 4W7YA 3PP5A 1G1IA 3EFGA 2CPSA 3M06A 3VP9A 2OYIA 1KZUB 1GU5A 1ZR2A 2E42A 2XKMA 2JEEA 1M1JC 2LKMA 1G2CB 1N7SB 2Q5UA 2P67A 4C46A 5APVA 1JY2P 1N7SD 2GUVA 3HE5A 1FZFA 3NFQA 1JY3O 3E1IA 1LWUA 4N78E 1DH3A 1GK6A 3CL3D 4LLHA 3KPEA 1MV8A 1JTHA 3U1CA 2MJZA 3TK1A 2VRSA 3IFMA 1RE4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XU6 A;  3B8E B;  5APX A;  3L35 A;  3A2A A;  3O8Z A;  5CMZ A;  5AVZ B;  1MUU A;  2W6A A;  4KHX A;  5AVX B;  2E43 A;  2R5D A;  2YO3 A;  1GZL A;  5APW A;  1HJB A;  2ZXE B;  2H7H A;  5AW1 B;  4JYB A;  4XE5 B;  3UIA A;  5AW0 B;  3I5C A;  3M0A A;  4AUW A;  1HWT C;  3T97 A;  3MGN A;  3OAK A;  4I2L C;  2QM7 A;  3IR9 A;  4GKG A;  1IO4 A;  2Z5I A;  3LID A;  2YO2 A;  1GTW A;  3HE5 B;  4JYC A;  4M3L A;  3L36 A;  1OXZ A;  2R3C A;  4RES B;  1CI6 A;  1FOS E;  2QM8 A;  2JJL A;  5APY A;  2Q3I A;  1JNM A;  3L37 A;  2WT7 A;  3P8M C;  1SP4 A;  5AW8 B;  1A02 J;  3HTK A;  2WTY A;  4AYC A;  3M0D A;  5AVS B;  1GK4 A;  1FAV A;  5AVU B;  3M9B A;  2WPQ A;  3LIE A;  5AVT B;  2C9L Y;  2WPS A;  2W27 A;  3NXS A;  1YYC A;  2Z5H A;  4GT1 A;  3HE4 B;  3VMY A;  2WPR A;  3A3Y B;  3HE4 A;  1A02 F;  1S9K D;  5AVQ B;  5AVY B;  5AVV B;  2IPP A;  1KQL A;  5AW7 B;  1GU4 A;  5APU A;  2C9N Y;  2P7J A;  2R5B A;  3MD0 A;  2BAS A;  3TYY A;  3KQG A;  5AW5 B;  5AVW B;  3A5T A;  5APT A;  3M06 A;  2Q7C A;  1SLQ A;  3KDP B;  5AW4 B;  1CZQ A;  5AW6 B;  2P2U A;  5AW3 B;  1NAF A;  1GU5 A;  4HYT B;  3P32 A;  2YNY A;  3VYI A;  3VMX A;  3VTP C;  3VN0 A;  4DZO A;  1MFZ A;  3V4Q A;  2E42 A;  3NMD A;  2KP8 A;  1OWA A;  1G2C B;  3M91 A;  4B86 A;  4C7N B;  5APS A;  5AVR B;  2Q5U A;  2P67 A;  4C46 A;  3SWF A;  1T2K D;  5APV A;  1NWQ A;  3V4W A;  3VMZ A;  4C7N A;  1J2J B;  3TNU A;  1CSB A;  1H88 A;  1S9K E;  4I6M C;  1JUN A;  3HE5 A;  3TNU B;  2XV5 A;  1X8Y A;  3NFQ A;  3P7K A;  1HBW A;  5AW9 B;  1DH3 A;  1GK6 A;  2R32 A;  1GD2 E;  1H89 A;  1HUC A;  2N9B A;  4AQR D;  1T2K C;  2XZR A;  3NTN A;  4LC1 A;  2WT7 B;  2WWW A;  1CI6 B;  1MV8 A;  2ZFC A;  3M9H A;  1H8A A;  4EOT A;  3A7O A;  3V5B A;  5APQ A;  3TK1 A;  2VRS A;  5AW2 B;  1FOS F; 
#chains in the Genus database with same CATH topology
 2XU6 A;  1DEB A;  5APX A;  3KYQ A;  3AE9 C;  1NTK G;  4WY4 C;  1NYH A;  4IL6 H;  1LP1 A;  1PL5 A;  2E74 B;  2W6A A;  4KHX A;  2FYU J;  1SQB E;  5AVZ B;  5AVX B;  3ZDM A;  1A02 F;  1SQB J;  5CCG A;  2YO3 A;  1GZL A;  4L74 A;  3FXD A;  1NKN A;  3MP7 B;  1IFI A;  2ZXE B;  4PJ0 H;  5E79 E;  5APW A;  1AJY A;  1JM0 A;  3T97 B;  4XE5 B;  3D70 A;  1FZC A;  2FXP A;  5KLI C;  1T2K D;  4UB8 H;  3TGU G;  5M1B A;  1SQX D;  3Q5S A;  1HVV A;  1SQV J;  2KLU A;  1J1E B;  1E5W A;  1VQ9 P;  1U7M A;  4GDO A;  3JCU E;  4GOF A;  4I2L C;  1K8A Q;  5CHX A;  1IO4 A;  1FDO A;  2Y9Y A;  4U3F D;  1N7L A;  1OMI A;  1M1K Q;  2IYP A;  1KIL D;  3LID A;  3CCM P;  3HE5 B;  5KLV J;  1PPJ D;  3L72 J;  1OFC X;  3R2P A;  5KJ7 C;  3RK3 E;  3RL0 g;  3II6 A;  3Q2Y A;  1J1D C;  1KB9 I;  1P84 E;  2M3E A;  1CI6 A;  2M5A A;  2R3C A;  3S1K A;  1NOH A;  2OYO A;  1Y47 A;  2JJL A;  2QM8 A;  5APY A;  1ZME C;  3CME P;  1PGO A;  4EIJ A;  2Q9I A;  1NU1 D;  2G3A A;  2K9J A;  2O1J A;  1W2B O;  1URQ A;  1WT6 A;  1L0N D;  1SQX G;  2E5Y A;  3GW6 A;  3HD7 B;  2Z4E A;  3A0H E;  3ABV C;  4W7Z A;  1A02 J;  4HH2 A;  4H0L B;  3CX5 E;  4WY4 A;  1YIJ P;  1GK4 A;  1LTS C;  3RK3 D;  4U3F G;  1VQ4 P;  1R5S A;  1LTI C;  2KNC B;  3M9B A;  1SQP J;  5KJ7 D;  1VQL P;  1JY3 P;  2HFE D;  1DD3 A;  5BVZ A;  1LTJ C;  3H32 B;  3NXS A;  3TGU D;  2KOG A;  4D6T D;  1LTG C;  3L4F A;  3OW2 O;  1KFN A;  3AE6 C;  4HB1 A;  2YXQ B;  2FBW C;  1BGY J;  1JTH B;  3QWO C;  5AVY B;  2IPP A;  1FZA A;  3GHG A;  1S9K D;  2HOD B;  1T8Z A;  2IX7 C;  5H2F H;  1LT9 B;  1PP9 D;  1LTB C;  2J59 M;  1EC5 A;  3AE7 C;  3N4X A;  3L73 G;  1D7M A;  2UWJ E;  3PJS K;  4N6J A;  1KYO E;  3EFF K;  3M0D C;  1KN7 A;  1NU1 K;  1SQV K;  1N8R Q;  2WSS H;  3L75 J;  1L0N K;  3F89 A;  1KB9 D;  4ASV A;  2BCC G;  2SPZ A;  3N7N A;  1KQF B;  1YJW P;  1VPC A;  3CPW O;  1HGV A;  3C9I A;  5CBO A;  1YTZ T;  1OIP A;  2L5G B;  2QJP C;  1NU1 G;  4KJM A;  3GG2 A;  4H0L C;  2FYN B;  5TIS H;  1L0L E;  5AW6 B;  5AW3 B;  3G4S P;  5B66 E;  1BCC J;  1KOR A;  1SQV G;  4HYT B;  3VYI A;  1BCC E;  2IZ1 A;  3PH0 A;  3VMX A;  1NTZ E;  1SVF A;  5TIS E;  3VN0 A;  1M1J B;  3CCJ P;  1NTZ J;  3C8V A;  1KFM A;  1GL2 B;  1OWA A;  4YXD C;  3W68 A;  1N73 C;  3I56 P;  3KZI E;  4C7N B;  1KYO D;  2M3B A;  4PV1 C;  4R4L A;  1RF0 C;  1LWU C;  2YKP A;  4YTP C;  1BE3 J;  4WY4 B;  1BE3 D;  4DCK A;  4Z1M H;  2K88 A;  1NWQ A;  3MTU E;  2V7Q H;  1H0T B;  3H1H E;  3L74 E;  1NH4 A;  3HUS C;  4WY4 D;  3H1K G;  3TNU B;  4YPC A;  1NTZ D;  3AEA C;  1EZV E;  1HBW A;  2LR2 A;  3V2N A;  3MHV A;  3H1L D;  4DJG A;  2WT7 B;  3SWK A;  2POH A;  1GL2 D;  1URQ B;  2PRR A;  3H1H J;  1LTJ B;  3L74 J;  1HUC A;  3IF4 A;  5KTB A;  3U59 A;  4AQR D;  2WMM A;  4OGQ C;  1T2K C;  1M1J A;  2XZR A;  2WSE J;  3NTN A;  1R8E A;  2O01 H;  2A06 E;  2FFD C;  1L4A B;  2WSF H;  3AEB C;  3P8C D;  4H13 B;  1QVG O;  2QJK B;  2FY8 A;  1N73 A;  1DIP A;  1SQP E;  1KIL A;  2HG5 D;  3KXD A;  4U7J A;  2OTJ P;  3L75 D;  3USS A;  2I1J A;  2OYI B;  4EYY Q;  3L71 D;  1JMM A;  1R5L A;  1RE3 A;  2D2C B;  2I8D A;  2I1K A;  1GL2 C;  1JCC A;  1XTC C;  2QRX A;  3PLN A;  1L0L J;  1KIL E;  2FKW B;  1QVF O;  3M9Q A;  1FOS F;  1PPJ E;  3RBZ A;  1LTA C;  2PP6 A;  1PP9 G;  4LGD E;  1MUU A;  1ZRT E;  1RQU A;  3B5N D;  1LNQ A;  4DOJ A;  3MIW A;  3CCS P;  3AEG C;  3HUS B;  1N7S C;  3CCV P;  1HJB A;  3LW5 H;  2JP3 A;  5AW1 B;  3UIA A;  2LXC B;  2KK7 A;  3V2P A;  3I5C A;  2GM4 A;  3H1K J;  3M0A A;  4D6T G;  2IFN A;  1DD4 A;  3CWB G;  3RGU A;  4K35 A;  1AVY A;  3H1I J;  3CX5 D;  2KZI A;  3GF7 A;  3OAK A;  2NPS D;  1VQP P;  2Q1K A;  2QM7 A;  3PHL A;  3GHG C;  3IR9 A;  4GKG A;  3A0B H;  3TGU E;  2QE7 H;  2Z5I A;  1T6A A;  2NPS B;  3FWN A;  1LJ2 A;  4PJ0 E;  1EDL A;  2IZ0 A;  1KB9 H;  1L0N G;  3JC2 2;  4IFM A;  1XTG B;  5L8R J;  2FYN C;  4RES B;  1Z56 A;  2O3J A;  4IL6 E;  1S72 P;  2ZVN B;  1EZV I;  1MZ9 A;  4N78 D;  4N3Y B;  5EFW B;  3BRT B;  2Q3I A;  2E75 B;  5CCG C;  3RL0 C;  3AED C;  2OYH C;  2W8Z A;  1KB9 E;  1P84 I;  1RE3 C;  2ZVO B;  3RK2 B;  1SFC A;  1AFO A;  2FYU K;  3D6Z A;  2YIU B;  3HTK A;  4RKU J;  1YBK A;  2AXT E;  1HJ0 A;  1KIL B;  1VF5 C;  2PGD A;  1FAV A;  3A0B E;  5AVS B;  5AVU B;  2E75 C;  3RL0 B;  3G3Z A;  3LW5 J;  3L70 J;  2WPQ A;  4H44 C;  5C39 A;  1LTT C;  4HKZ H;  4PD4 D;  1BSN A;  2WPS A;  2KXP B;  3CWB D;  1SQQ E;  2QG4 A;  3BCC J;  1GW3 A;  3HE4 B;  3AE8 C;  3B4S A;  1SS1 A;  2WPR A;  3V6I A;  3VMY A;  2OYI C;  2C0X A;  3H1H G;  3L74 G;  3V2R A;  3D6Y A;  1M8O B;  2IBZ E;  5DJT B;  1HGZ A;  1KQL A;  2FXO A;  1JY2 O;  3IN6 A;  3HUS A;  4Y99 B;  2A45 I;  3AE2 C;  4BXL A;  1URQ D;  2P1J A;  2KIK A;  2WVR A;  3TDK A;  2RH0 A;  2NRG A;  1VQ5 P;  3C1L A;  4Y28 J;  1EQ7 A;  1ZR4 A;  3CC2 P;  1CW5 A;  2M5A B;  2QJK C;  3HTK B;  4ZKP A;  5GTI E;  3O6Q B;  4L76 A;  1JMB A;  1FZE A;  3HD7 C;  1NTM G;  1NTZ K;  2O01 J;  3CI9 A;  5APU A;  2IFM A;  5AVW B;  2OYH A;  5APT A;  2YKO A;  3BAT A;  1VQK P;  2Q7C A;  3W67 A;  1SLQ A;  1P84 D;  2AEJ A;  2YIU C;  1CZQ A;  1PP9 J;  1JEK A;  3GHG B;  3BCC G;  1L2P A;  1KIL C;  4WBA A;  5TJH A;  4W80 A;  5CCH D;  4GIF A;  3H1L E;  4XFJ A;  3CD6 P;  2B88 A;  2YNY A;  3P32 A;  4RO0 A;  4QMA A;  1OZH A;  2M8R A;  3VTP C;  1L0L G;  1MFZ A;  1P84 H;  2WPV B;  3NMD A;  1PFI A;  1PPJ G;  5CBN A;  1KTM A;  1FZC C;  3CLQ A;  3H32 A;  3M91 A;  3TSI A;  4BRY B;  3B5N B;  1VQO P;  5APS A;  2BEZ F;  1S5L E;  3H25 A;  2QJY C;  1LWU B;  1HF9 A;  2IDB A;  1DEE G;  3S4R A;  3V4W A;  5KLI B;  1N7S A;  1J2J B;  5K5G B;  1CSB A;  5KKZ B;  2CK3 H;  1UIX A;  3H1J E;  1H88 A;  4IFD K;  3KHU A;  2KS1 B;  1LT9 A;  3E1R A;  4D6T E;  1FC2 C;  1SQB K;  1S5L H;  3CCR P;  1NGM B;  5H2F E;  1L0N J;  3KZI H;  2D2C C;  5KLV G;  1S2E A;  1U7J A;  1QEX A;  3Q5R A;  3AEE C;  4WB4 A;  1DX7 A;  4L75 A;  4IL6 X;  5AW9 B;  1SQB G;  2R32 A;  2YKQ A;  2N1T C;  1YIT P;  1H89 A;  1MKM A;  2Y0E A;  2QJP B;  2YMY A;  1BDD A;  2Y0C A;  2OGU A;  3CXH E;  3MZW B;  1Q7Y Q;  1X22 A;  3RK3 B;  3CC4 P;  2PFX A;  2JWD A;  3CCE P;  2IBZ I;  1OX3 A;  3BCC D;  1G1J A;  1Q90 D;  3CWB J;  3M9H A;  1IFD A;  1WMK A;  1NJI Q;  4EOT A;  2XDJ A;  3A7O A;  4U3F J;  2KYV A;  1OW8 A;  1IK7 A;  3OA7 A;  3V5B A;  1YI2 P;  1USD A;  1NTK D;  1LP1 B;  1X0T A;  5APQ A;  4NPF X;  2YMK A;  2KZJ A;  1RHZ B;  1NTK J;  1ZLL A;  1SQX J;  2RKL A;  5GTH E;  1VQN P;  2PAJ A;  1S5L X;  5AW2 B;  1VL2 A;  1ZW0 A;  4ZKU A;  2J58 A;  3G6E P;  1OVR A;  2CPB A;  3L35 A;  3A2A A;  3H1J J;  3CXH I;  4C7R A;  1SQB D;  2FYU D;  2R5D A;  1YQ3 C;  1HTL C;  1IFM A;  1TU3 F;  1NTZ G;  1UII A;  2A45 G;  1NVO A;  1NAY A;  2BCC J;  1AA0 A;  1SQX E;  4JYB A;  3WUU A;  1BE3 E;  1URQ C;  2WSE H;  5BU5 A;  1EDI A;  1LGH B;  1FZB A;  1GMJ A;  1E79 H;  2W6B A;  4AUW A;  1HWT C;  1ZV8 A;  4U3F E;  3GLM A;  3MGN A;  3T97 A;  4JQ0 D;  2FFD B;  3CWB E;  1FU1 A;  1T3J A;  3H1I D;  3CCL P;  2AXT H;  2B87 B;  3K5B A;  3H6P A;  3CX5 H;  2AXC A;  2E76 D;  3H1K D;  1LTJ A;  2YO2 A;  4Y99 C;  1KC8 Q;  3L36 A;  1VQ7 P;  2ZYD A;  1MFT A;  4MN4 C;  2E75 D;  1J1D B;  1FOS E;  2H8P D;  4OH8 B;  3B5N A;  1VF5 D;  1RF1 A;  3HD7 A;  1QLE D;  1KD1 Q;  3RK2 D;  1L0N E;  2KB7 P;  3H1I G;  1IFN A;  1PGJ A;  1JNM A;  2N9Y B;  2Y9Z A;  1J1E C;  3SFD C;  2R44 A;  3QH9 A;  3S9O A;  1KQS O;  1L0L D;  3V2Q A;  2HPC B;  1RF1 C;  3M0D A;  4BWN A;  3AE3 C;  3CXH D;  1U57 A;  4KT0 J;  4UB6 E;  2K9J B;  2ZT9 C;  1K04 A;  2W90 A;  5AVT B;  1SQX K;  2B87 A;  3I55 P;  1FDM A;  2YXR B;  2E74 D;  1G2C A;  1Y8A A;  1FJP A;  4GT1 A;  1NHL A;  1USE A;  2GUS A;  1NTM D;  1ZRT D;  2E74 C;  5KAF H;  1GW4 A;  1YQ4 C;  1SQV E;  2Q6Q A;  2ZT9 D;  1PP9 E;  3BRV B;  2QSI A;  3H1H D;  3L74 D;  2FYZ A;  3PTZ A;  2O1K A;  2AEF A;  2M0B A;  2A45 H;  3R4Y A;  3H1L J;  5KLV K;  1GU4 A;  1LT9 C;  1GDT A;  3L75 G;  5B66 H;  1W5C E;  4A7P A;  3AEF C;  4GOE A;  2C9N Y;  1SFC C;  2NZ2 A;  2P7J A;  2L91 A;  3JSV C;  4EI2 A;  2N1T A;  2B89 A;  3MD0 A;  2BAS A;  2HYN A;  3KQG A;  1JB0 J;  3AE5 C;  3L70 D;  1L4A D;  4H13 D;  3RK2 C;  1L0L K;  3EWK A;  2K37 A;  1IK9 A;  1FBM A;  2ZYA A;  3L71 G;  5CJ0 A;  2RMZ A;  1EXJ A;  3A0H H;  5GTI H;  2E5T A;  3KDP B;  3VMA A;  3Q3D A;  5AW4 B;  2AEM A;  4TT3 H;  3L73 J;  2P2U A;  1NAF A;  2H88 C;  4DZO A;  1HH0 A;  3F5H A;  1AVO A;  2FFD A;  3CC7 P;  1BCC D;  1SQQ J;  3BCC E;  4WWI A;  1NTM K;  2ZXX A;  3EQ2 A;  1BGY G;  3FGA D;  3SSU A;  3RBX A;  2KP8 A;  2A06 G;  1YJN P;  4OVN F;  1SQQ K;  5B5E H;  1NTK K;  4B86 A;  1N2D C;  2H43 A;  2K9Y A;  3OJA B;  4ZNC A;  3BVH A;  1M7L A;  3L73 E;  1YTZ I;  2HR3 A;  2QJY B;  4OGQ D;  5AVR B;  3SWF A;  1JCD A;  1PIX A;  2MKV A;  2QIW A;  1PGQ A;  1IFP A;  2B9B A;  1JO5 A;  3MUD C;  2BEQ D;  3JCU H;  3VMZ A;  1KQG B;  3TNU A;  4C7N A;  1WRG A;  4CPG A;  1S9K E;  4I6M C;  1W2E A;  1Q81 Q;  1JUN A;  2QA4 P;  1FDI A;  1PZQ A;  1X79 B;  2FYU E;  1SQP K;  1RQV A;  1RF1 B;  2WSC H;  2XV5 A;  1X8Y A;  1IJD B;  3P7K A;  4PD4 E;  1RE4 A;  1BSH A;  3L72 G;  5E79 H;  4I7Z B;  1KYO I;  1GD2 E;  1BGY D;  1EDK A;  2FXM A;  4PV1 D;  1AV1 A;  1BCC G;  2K3R A;  2KUB A;  2N9B A;  2Q3E A;  4OGQ B;  1N73 B;  2XND H;  4LC1 A;  3L70 G;  2KLV A;  2WQY C;  3AE1 C;  2WWW A;  3VP8 A;  1LT1 A;  1CI6 B;  2WZ7 A;  2ZFC A;  3TGU J;  5CCH A;  1H8A A;  2JDI H;  1ZOY C;  1AQ5 A;  2KI7 B;  1N86 A;  3H1I E;  5KJ7 A;  2N1T B;  2W83 C;  3P8C E;  3FXE A;  1FZC B;  2HLO A;  4DT0 A;  3L71 J;  3WUV A;  4HJG H;  2N1T D;  1JOC A;  2O01 N;  2C0W A;  3H1K E;  1QL1 A;  1X9V A;  2D2C D;  1NKZ B;  1S1C X;  2KSE A;  3B8E B;  2Y0D A;  1PGP A;  4O9B A;  4RJT A;  3O8Z A;  5CMZ A;  4EDF A;  1JY3 N;  3H1L G;  2E43 A;  3VOP A;  3G9R A;  5CJ4 A;  1FS0 E;  1NTM J;  1VDF A;  2WSC J;  4JPZ B;  3U1A A;  2H7H A;  5AW0 B;  3CCQ P;  3PRJ A;  1OVV A;  1EZV D;  1BE3 G;  1T3U A;  2NPS A;  1JY2 N;  4XA4 A;  1IZN B;  4I1L A;  1M56 D;  2HOD A;  2JKV A;  2LXB A;  1VQ8 P;  5CCH C;  1NO4 A;  1QL2 A;  1GTW A;  1NU1 E;  2A06 D;  3E7K A;  2W6J H;  4JYC A;  3HRN A;  4M3L A;  3SWY A;  1IC2 A;  3GF3 A;  4H44 D;  4TLF A;  1OXZ A;  3FWL A;  5KAI E;  3RK3 C;  1FE6 A;  4PD4 I;  2RN0 A;  4R4M A;  3WU2 H;  3WU2 E;  3HD7 D;  1L4A C;  2OAR A;  4H13 C;  3CX5 I;  4IFF A;  1RY3 A;  2P58 A;  3L37 A;  4GOD A;  1Q82 Q;  2WT7 A;  3GMA A;  3WMM 0;  3SFE C;  1SFC D;  3P8M C;  5BU8 B;  1SP4 A;  5AW8 B;  2QEX P;  2JO1 A;  3RL0 D;  5CCG D;  3MUD A;  2WTY A;  4AYC A;  1BGY E;  2E76 B;  1SFC B;  4K3A A;  4L73 A;  2XNX A;  1NTK E;  1RH5 B;  3LIE A;  5KKZ C;  1M57 D;  1ZN5 A;  1PV3 A;  1FJK A;  2C9L Y;  1GL2 A;  2W27 A;  1YHQ P;  1EZV G;  1YYC A;  2Z5H A;  2BCC D;  4YXW H;  3CXH H;  1Q86 Q;  3AEC C;  2ZYG A;  3G71 P;  1Y9B A;  3A3Y B;  1SQQ D;  2GA1 A;  2NPS C;  3B71 A;  2G8Y A;  3HE4 A;  2WIT A;  3O6Q A;  4I7Z C;  3H1J D;  5AVQ B;  5AVV B;  1S4X A;  2HPC A;  4ZMD A;  3L73 D;  2V7Q J;  5AW7 B;  3Q1M A;  3ITK A;  2JWA A;  3BAS A;  4D6T J;  1AQT A;  2QVA A;  2OYH B;  2R5B A;  3L75 E;  4BRY A;  1RF0 A;  4NPD A;  1OW6 A;  2BCC E;  4UB6 H;  1IFJ A;  3B5N C;  1Q2N A;  4JF7 A;  3TYY A;  1SQP D;  5AW5 B;  2IYO A;  1L4A A;  3A5T A;  1KMI Z;  2KSJ A;  4JBZ A;  4W7Y A;  3CMA P;  3AE4 C;  3IAO A;  1G1I A;  2OTK E;  3EFG A;  2CPS A;  2V4H A;  2ZAE B;  3PP5 A;  5DJU B;  3V4Q A;  5B5E E;  3M06 A;  1VF5 B;  3VP9 A;  5KLV E;  3Q5P A;  3L71 E;  1FZG A;  2OYI A;  1KYO H;  1K73 Q;  2OTL P;  1H0T A;  1KZU B;  2E76 C;  1GU5 A;  2J5U A;  1NU1 J;  1YJ9 P;  2K1A A;  1ZR2 A;  2IBZ G;  2E42 A;  2XKM A;  4IOI H;  2JEE A;  1M1J C;  2WSF J;  3CCU P;  2LKM A;  1G2C B;  1QX8 A;  4WVZ A;  4PD4 H;  1N7S B;  1S3J A;  1ZXG A;  3L72 D;  2Q5U A;  2P67 A;  1ZP0 C;  3FX0 A;  5KLV D;  2P10 A;  5APV A;  4ASW A;  4C46 A;  1VQM P;  1JY2 P;  1N7S D;  1VQ6 P;  1KV4 A;  4H44 B;  1K05 A;  2IBZ D;  1NTM E;  3D71 A;  1SQV D;  2DW3 A;  2GUV A;  3HE5 A;  2OQQ A;  1FZF A;  3NFQ A;  1JY3 O;  3E1I A;  1LWU A;  2FYU G;  4N78 E;  1DH3 A;  1EDJ A;  1GK6 A;  3L72 E;  2H89 C;  5KAF E;  1M90 Q;  3CL3 D;  2KS1 A;  2ZJS E;  3TF5 A;  1BDC A;  4LLH A;  1SQP G;  1QGK B;  5KAI H;  3KPE A;  4PV1 B;  4OWF A;  1MV8 A;  1JTH A;  1OVU A;  5GTH H;  3L70 E;  3U1C A;  1OW7 A;  2JR8 A;  2R3S A;  1K9M Q;  2MJZ A;  2KNC A;  2ITA A;  3WUT A;  3H1J G;  4H0L D;  3TK1 A;  2ZT9 B;  2VRS A;  1SQQ G;  3IFM A;  1EXI A;  4UB8 E;  4NPE A;  1RE4 C; 
#chains in the Genus database with same CATH homology
 2XU6 A;  1DEB A;  5APX A;  3KYQ A;  4WY4 C;  5AVZ B;  2W6A A;  4KHX A;  5AVX B;  5CCG A;  2YO3 A;  1GZL A;  5APW A;  1NKN A;  1IFI A;  2ZXE B;  4XE5 B;  1FZC A;  1HVV A;  1J1E B;  1E5W A;  4I2L C;  5CHX A;  1IO4 A;  1N7L A;  3LID A;  1KIL D;  3HE5 B;  3R2P A;  5KJ7 C;  3II6 A;  1J1D C;  2R3C A;  1CI6 A;  1NOH A;  2QM8 A;  2JJL A;  5APY A;  2Q9I A;  4EIJ A;  2O1J A;  1URQ A;  1WT6 A;  3HD7 B;  2Z4E A;  4W7Z A;  1A02 J;  4HH2 A;  4WY4 A;  1GK4 A;  1LTS C;  3RK3 D;  1LTI C;  3M9B A;  5KJ7 D;  1JY3 P;  2HFE D;  5BVZ A;  1LTJ C;  3H32 B;  3NXS A;  2KOG A;  1LTG C;  3L4F A;  1KFN A;  1JTH B;  5AVY B;  1S9K D;  3GHG A;  1FZA A;  2IPP A;  2HOD B;  1T8Z A;  2IX7 C;  1LT9 B;  2J59 M;  1LTB C;  3N4X A;  5APU A;  4N6J A;  3M0D C;  1NU1 K;  1SQV K;  1L0N K;  3N7N A;  1VPC A;  1HGV A;  3C9I A;  1YTZ T;  2L5G B;  5AW6 B;  5AW3 B;  4HYT B;  3VYI A;  3VN0 A;  3VMX A;  1SVF A;  1M1J B;  1KFM A;  1GL2 B;  1OWA A;  1N73 C;  4C7N B;  2M3B A;  1RF0 C;  1LWU C;  2YKP A;  1NWQ A;  4WY4 B;  3MTU E;  1NH4 A;  3HUS C;  4WY4 D;  3TNU B;  1HBW A;  3V2N A;  2POH A;  1GL2 D;  1URQ B;  1LTJ B;  1HUC A;  5KTB A;  3U59 A;  4AQR D;  1T2K C;  1M1J A;  2XZR A;  3NTN A;  2O01 H;  2FFD C;  1L4A B;  2WSF H;  3P8C D;  1N73 A;  1KIL A;  2HG5 D;  2OYI B;  2I1J A;  1JMM A;  1RE3 A;  2I1K A;  1GL2 C;  1JCC A;  1XTC C;  2FKW B;  3M9Q A;  1FOS F;  1LTA C;  2PP6 A;  4LGD E;  1MUU A;  3B5N D;  4DOJ A;  3MIW A;  3HUS B;  1N7S C;  1HJB A;  3LW5 H;  5AW1 B;  3UIA A;  3V2P A;  3I5C A;  2GM4 A;  3M0A A;  2IFN A;  3OAK A;  2NPS D;  2QM7 A;  3GHG C;  3IR9 A;  4GKG A;  2Z5I A;  2NPS B;  4IFM A;  1XTG B;  4RES B;  1Z56 A;  1MZ9 A;  4N78 D;  2OYH C;  4N3Y B;  3BRT B;  2Q3I A;  5CCG C;  3RL0 C;  1RE3 C;  3RK2 B;  1SFC A;  1AFO A;  2FYU K;  3HTK A;  5AVS B;  1KIL B;  1FAV A;  5AVU B;  3RL0 B;  3G3Z A;  2WPQ A;  1LTT C;  2WPS A;  3HE4 B;  3VMY A;  1GW3 A;  2OYI C;  2WPR A;  2C0X A;  3V2R A;  1HGZ A;  1KQL A;  1JY2 O;  4Y99 B;  3HUS A;  2A45 I;  1URQ D;  2P1J A;  1ZR4 A;  1EQ7 A;  1CW5 A;  4ZKP A;  3HTK B;  1FZE A;  3HD7 C;  5AVW B;  1NTZ K;  3CI9 A;  2OYH A;  2IFM A;  5APT A;  2YKO A;  3BAT A;  2Q7C A;  1SLQ A;  1CZQ A;  3GHG B;  4WBA A;  1KIL C;  4W80 A;  5CCH D;  4GIF A;  3P32 A;  2YNY A;  3VTP C;  2M8R A;  1PFI A;  1MFZ A;  3NMD A;  1FZC C;  3H32 A;  3CLQ A;  3M91 A;  3TSI A;  3B5N B;  5APS A;  1LWU B;  3V4W A;  1FZG A;  1N7S A;  1J2J B;  1H88 A;  1CSB A;  4IFD K;  1LT9 A;  1SQB K;  4WB4 A;  1DX7 A;  5AW9 B;  2YKQ A;  2R32 A;  2N1T C;  1H89 A;  2YMY A;  3RK3 B;  3M9H A;  1G1J A;  1IFD A;  4EOT A;  2XDJ A;  3A7O A;  2KYV A;  3OA7 A;  3V5B A;  5APQ A;  1ZLL A;  2PAJ A;  5AW2 B;  4ZKU A;  2J58 A;  2CPB A;  3L35 A;  3A2A A;  4C7R A;  2R5D A;  1HTL C;  1IFM A;  2A45 G;  4JYB A;  5BU5 A;  1URQ C;  2WSE H;  1LGH B;  1FZB A;  2W6B A;  4AUW A;  1HWT C;  1ZV8 A;  3T97 A;  3MGN A;  2FFD B;  1FU1 A;  1T3J A;  3H6P A;  4Y99 C;  1LTJ A;  2YO2 A;  3L36 A;  1J1D B;  1FOS E;  2H8P D;  4OH8 B;  3B5N A;  1RF1 A;  3HD7 A;  3RK2 D;  2KB7 P;  1IFN A;  1JNM A;  1J1E C;  2HPC B;  3V2Q A;  1RF1 C;  3M0D A;  5AVT B;  1SQX K;  1FDM A;  1G2C A;  1FJP A;  4GT1 A;  1NHL A;  2GUS A;  1GW4 A;  3BRV B;  2FYZ A;  2O1K A;  5KLV K;  2A45 H;  1GDT A;  1GU4 A;  1LT9 C;  2C9N Y;  1SFC C;  2P7J A;  2N1T A;  3MD0 A;  2BAS A;  2HYN A;  3KQG A;  1L4A D;  3RK2 C;  1L0L K;  1FBM A;  1IK9 A;  5CJ0 A;  3KDP B;  5AW4 B;  2P2U A;  1NAF A;  4DZO A;  1HH0 A;  3V4Q A;  1NTM K;  3EQ2 A;  2KP8 A;  1SQQ K;  2H43 A;  1NTK K;  4B86 A;  1N2D C;  3BVH A;  2FFD A;  3OJA B;  1M7L A;  1YTZ I;  5AVR B;  1T2K D;  3SWF A;  1JCD A;  1JO5 A;  3VMZ A;  4C7N A;  3TNU A;  1WRG A;  1S9K E;  4I6M C;  1W2E A;  1JUN A;  1X79 B;  1RF1 B;  1SQP K;  2WSC H;  2XV5 A;  1X8Y A;  1IJD B;  3P7K A;  1RE4 A;  1GD2 E;  2FXM A;  1N73 B;  2N9B A;  4LC1 A;  3VP8 A;  2KLV A;  2WT7 B;  2WWW A;  5CCH A;  1CI6 B;  2WZ7 A;  2ZFC A;  1H8A A;  1AQ5 A;  1N86 A;  5KJ7 A;  2N1T B;  3P8C E;  1FZC B;  2HLO A;  2N1T D;  1JOC A;  2C0W A;  1QL1 A;  1X9V A;  1NKZ B;  4O9B A;  3B8E B;  3O8Z A;  5CMZ A;  2E43 A;  1JY3 N;  3VOP A;  5CJ4 A;  1VDF A;  3U1A A;  2H7H A;  5AW0 B;  1T3U A;  2NPS A;  1JY2 N;  4XA4 A;  4I1L A;  2HOD A;  5CCH C;  1NO4 A;  1QL2 A;  1GTW A;  3SWY A;  4JYC A;  4M3L A;  3HRN A;  1IC2 A;  1OXZ A;  3RK3 C;  3HD7 D;  1L4A C;  2OAR A;  4IFF A;  1RY3 A;  3L37 A;  2WT7 A;  3WMM 0;  5BU8 B;  1SFC D;  3P8M C;  1SP4 A;  5AW8 B;  3RL0 D;  5CCG D;  3MUD A;  2WTY A;  4AYC A;  1SFC B;  2XNX A;  3LIE A;  1ZN5 A;  2C9L Y;  1FJK A;  1GL2 A;  2W27 A;  1YYC A;  2Z5H A;  3A3Y B;  2NPS C;  3HE4 A;  2WIT A;  1A02 F;  5AVQ B;  5AVV B;  2HPC A;  5AW7 B;  3BAS A;  2OYH B;  2R5B A;  1RF0 A;  1IFJ A;  3B5N C;  4JF7 A;  3TYY A;  5AW5 B;  3A5T A;  1L4A A;  2KSJ A;  4W7Y A;  3PP5 A;  1G1I A;  3EFG A;  2CPS A;  3M06 A;  3VP9 A;  2OYI A;  1KZU B;  1GU5 A;  1ZR2 A;  2E42 A;  2XKM A;  2JEE A;  1M1J C;  2LKM A;  1G2C B;  1N7S B;  2Q5U A;  2P67 A;  4C46 A;  5APV A;  1JY2 P;  1N7S D;  2GUV A;  3HE5 A;  1FZF A;  3NFQ A;  1JY3 O;  3E1I A;  1LWU A;  4N78 E;  1DH3 A;  1GK6 A;  3CL3 D;  4LLH A;  3KPE A;  1MV8 A;  1JTH A;  3U1C A;  2MJZ A;  3TK1 A;  2VRS A;  3IFM A;  1RE4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...