5E79E

Macromolecular diffractive imaging using imperfect crystals
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5e79E00
1S5LE 5E79E 5KAFE 4UB8E 4IL6E 3WU2E 5TISE 5B5EE 4UB6E 5B66E 3KZIE 4PJ0E 5KAIE 3JCUE 5H2FE 5GTIE 5GTHE 2AXTE 3A0HE 1W5CE 3A0BE
chains in the Genus database with same CATH superfamily
1NTZG 1SFCB 1WRGA 2WQYC 3H1IE 4D6TD 4WY4B 3M06A 5AW5B 1UIIA 5CCGD 5APQA 1JTHB 2IFMA 1L0LJ 1OVVA 4W7YA 3BASA 5KLVK 4C7NA 2PP6A 5AVXB 1URQC 2NPSA 1RQUA 1R8EA 2E74D 3H1HE 1HGZA 1VQ5P 2PFXA 1DIPA 2QIWA 5B5EE 5GTHH 3HUSC 2Y0CA 2N1TD 3B5NC 3GHGA 3HD7C 1URQB 3PHLA 3V5BA 2JWAA 2CK3H 2XNXA 1BCCJ 1XTGB 2JDIH 3HUSB 2OYIC 3H1IG 3GF7A 1RHZB 2Q6QA 2ZYDA 1LP1B 3CCVP 5AVVB 1RE4C 1X0TA 2AXCA 2P2UA 1FZBA 1WT6A 3RL0C 3II6A 4RESB 1DD3A 3OJAB 2WSSH 2FXPA 5BVZA 1SP4A 2B89A 5M1BA 3H1HG 2KYVA 2POHA 2YMYA 2BCCD 4OGQC 2W6BA 4I2LC 1HBWA 3M0AA 2QVAA 3I5CA 1HGVA 3LW5H 5CCGC 2ZFCA 3G4SP 4OGQB 1CI6A 2R44A 4H44D 2FY8A 3IAOA 2H43A 5GTHE 3T97B 3O6QA 2K9JA 5BU5A 1EDKA 1KD1Q 1PGQA 4UB6H 2O01N 2R3SA 4WWIA 2YIUB 1JB0J 1PGOA 2E74B 4OVNF 2KUBA 3VP9A 1VQPP 2N1TB 3TNUA 2FFDB 4BRYB 2RN0A 3CWBD 1P84I 1NTZK 3AE8C 4RKUJ 2YMKA 1EXJA 2KS1A 2R3CA 2UWJE 1KORA 1MFTA 3CC2P 3U59A 4HB1A 2W8ZA 1GZLA 2B87B 5AW7B 3L74D 4N6JA 3W68A 1BSNA 3GMAA 3M0DA 3FXEA 1IFIA 2AEFA 1GW3A 1NOHA 2Q9IA 2O3JA 2IBZD 5APUA 3BCCE 1KILA 4UB6E 4IL6X 2QG4A 4HH2A 3H1JJ 4K35A 4C7NB 3D6ZA 1ZMEC 4H44B 2P7JA 2NPSB 2JP3A 3IR9A 4GODA 4L76A 1EZVD 2QJPC 3VP8A 1RH5B 4HKZH 1SQQE 3SWFA 1YIJP 4IFMA 2QRXA 1RF1C 1YHQP 4EYYQ 1NO4A 2D2CD 2O1KA 5DJUB 2KI7B 4XA4A 5E79H 1K9MQ 1M7LA 1NTKE 2XDJA 1AA0A 4U3FD 4ASWA 1R5LA 3H32A 3RK3D 3AE9C 2HLOA 3ZDMA 3BCCG 4DT0A 3CX5I 3V2RA 1E79H 3A3YB 1ZLLA 3L74E 2FYZA 1VQ6P 1OZHA 3N4XA 3AE2C 3CXHD 1BGYD 2OYHA 1SQQG 4EDFA 1QL1A 2XZRA 1SQXE 3V4QA 1BE3J 3CWBG 1NTKG 1KILD 1CI6B 5L8RJ 2HPCA 4QMAA 4RO0A 1GTWA 1SQBE 5K5GB 3O6QB 2K9JB 1N73A 3L74G 1S9KD 1JOCA 1FZEA 1LT9A 2ITAA 2E76D 1YQ4C 2I8DA 5E79E 2FYUD 3KHUA 3A2AA 2D2CC 3FGAD 4LC1A 1YBKA 1CSBA 1Z56A 1PP9J 1PPJE 3IF4A 3TNUB 3M91A 1N8RQ 3TGUE 3RK3C 1BDDA 1SQXG 2D2CB 1CZQA 3GW6A 5B66H 1NJIQ 3H1LJ 5KLVJ 3CC4P 4JF7A 4OH8B 3RK3B 1PV3A 1SQBG 1ZR4A 1KTMA 3RK2D 1S5LH 2KS1B 1FZFA 1X22A 5CCHC 2IPPA 2K1AA 3L72D 4CPGA 3M0DC 4RJTA 2KOGA 3V2NA 2IYPA 3PJSK 4JYCA 3WUVA 3B5NA 1PPJG 3MP7B 3HD7A 1JCCA 1HF9A 3TGUG 1N7SD 3TYYA 1ZRTE 2OYIA 4GOFA 1NAYA 1LTTC 1FJPA 1QLED 1KILB 1NU1J 1RE4A 3CI9A 5APVA 1SQVE 2R5BA 4DOJA 3L70E 1DH3A 4H13C 4HJGH 4A7PA 2Y9ZA 1ZW0A 4PD4I 1VQLP 3U1CA 1HTLC 2E76B 3CMEP 5B66E 2FKWB 1KYOI 3F89A 3H1ID 1SQQK 5CCGA 1KC8Q 2YKQA 1VQNP 3H32B 1S5LE 3PRJA 5CJ4A 2J58A 4O9BA 1KN7A 4N78E 3VTPC 1LTBC 3L71J 1X79B 1S2EA 1SQVG 1KMIZ 1LTAC 2AXTH 3H1KE 3L70G 3L72E 3BRTB 1VQ8P 3CCLP 1OXZA 3H1HD 1R5SA 1MKMA 3RK2B 3Q2YA 1SQPJ 3BVHA 1USEA 2PRRA 2OYHB 1M56D 3B5ND 1IFDA 3HD7D 4W7ZA 3SSUA 3LIEA 1YJ9P 1N7SC 1LWUC 3L75J 3L73J 3WUUA 2PAJA 4U7JA 1NTZJ 2HPCB 1J1DB 2WPRA 2O01J 2KSEA 1LT9C 2Z5HA 3RL0D 1S1CX 2YNYA 2QEXP 1SQXK 3V4WA 1NKNA 3OW2O 3H1KG 3L72G 4HYTB 1ZOYC 1N73B 1LT9B 5CMZA 1HUCA 2YKOA 3VOPA 3QWOC 1HJBA 1FE6A 4ASVA 5KKZC 4AQRD 2E75B 1Y47A 1AVYA 5AVUB 1IFPA 2AXTE 1W2EA 1QX8A 4I1LA 5KKZB 1RY3A 1GD2E 2Y9YA 3MZWB 1AVOA 2OQQA 2WSEH 2OTLP 2HODA 1BDCA 1GL2C 1VQ9P 3A5TA 2WITA 1FOSE 3KQGA 3F5HA 3CPWO 1X8YA 2WSFJ 1TU3F 4GKGA 1BCCE 2A45G 1VF5C 1LTSC 2R5DA 3B5NB 4K3AA 4C7RA 3HD7B 3E1RA 1SS1A 1RF1A 1RE3A 3B71A 2V7QH 2I1JA 1FC2C 4JBZA 2OYIB 4EOTA 1GMJA 1YTZT 3NMDA 3BATA 1EXIA 5AVZB 4GIFA 5KJ7A 3M9QA 3RL0B 1OW8A 5BU8B 1SQVK 2KNCB 2OGUA 1BCCG 2BASA 2FYUK 1AQ5A 1Q81Q 1IO4A 2C9NY 1FU1A 2AEJA 3P7KA 4D6TJ 1LTIC 2B88A 1PZQA 2M5AA 3BCCD 1FDIA 1JCDA 2H89C 3AEDC 1Q90D 1AV1A 1MFZA 4KT0J 2QSIA 1A02F 2H7HA 3V2PA 4Z1MH 1VQMP 1NYHA 2IZ1A 2CPBA 1SQQD 2LXCB 2Q3IA 3U1AA 3H6PA 5AVSB 1XTCC 4IL6E 1H8AA 2M3BA 3OA7A 1NTKD 4BWNA 4R4MA 1OMIA 1VDFA 2WZ7A 1OVRA 2M0BA 4JPZB 5KJ7D 1K05A 2IX7C 1ZN5A 2P67A 1NHLA 4H0LC 1KZUB 1QGKB 5AW2B 1NH4A 2K37A 3AE3C 4L73A 5CCHA 2KIKA 5KAFH 1FBMA 1AQTA 2BCCJ 3QH9A 1LNQA 2E5TA 3MTUE 2KLUA 3TDKA 1T3JA 3VMYA 2W90A 1H88A 1SQXD 1FZAA 1FZGA 3EWKA 1P84E 1A02J 2ZT9D 1NAFA 3GG2A 1RQVA 2WPSA 1SQBD 2HODB 3FWNA 2J5UA 4DZOA 2Q5UA 4LGDE 1RE3C 2W6AA 2SPZA 2Q3EA 1L0ND 5AW3B 2QJPB 4I7ZC 5TISH 2KZIA 1KFMA 2HG5D 1PPJD 1Y9BA 3TGUD 2XU6A 1RF1B 5KJ7C 2IBZI 2ZYGA 3P8MC 4MN4C 1PL5A 4I7ZB 4NPEA 3IN6A 1N2DC 3CWBJ 2A06E 2L5GB 5KAFE 5CCHD 3VMXA 1EZVI 3SWYA 2QJKC 2C9LY 1J2JB 2P1JA 3NTNA 2HYNA 5AVWB 1PGJA 3AEAC 1IFMA 1KV4A 2ZT9C 3L36A 1GU4A 4ZKPA 1N7SA 1LWUA 1IK7A 4N3YB 1ZRTD 3TK1A 3CX5E 2M5AB 1K04A 2KP8A 3D70A 2WPQA 1Q82Q 2ZT9B 1SQVD 2LKMA 2A06G 3L70D 2Q1KA 4H13D 4YPCA 3RBZA 2OARA 1L0NE 3ITKA 5TISE 3CXHI 4ZKUA 3CL3D 3KDPB 1PP9E 3CLQA 3AE4C 2RMZA 3ABVC 5AW6B 3C9IA 2W27A 4EIJA 1KB9D 1KB9H 1MV8A 1N86A 2YO2A 3H1LE 5KLVE 3MGNA 3MD0A 4U3FJ 2ZYAA 4B86A 1LT1A 4N78D 2ZXXA 3KYQA 3H1KD 4NPFX 4W80A 4UB8E 1GL2A 1L0NG 1SLQA 1M1KQ 5APYA 3VMAA 3Q3DA 5C39A 1PP9G 1BGYJ 4JQ0D 4Y99C 3CCEP 1KQGB 2W6JH 3AE1C 4PD4H 2QE7H 3L4FA 4WB4A 2JWDA 1Q86Q 2JEEA 3RBXA 3S9OA 1QL2A 1NU1E 5KLVG 1ZP0C 4BXLA 4PV1C 3L35A 1IJDB 2O01H 1JY2P 3WUTA 1NTMD 1USDA 1VQOP 3PP5A 2QA4P 3V2QA 4EI2A 5DJTB 1HJ0A 3D6YA 2KNCA 1W2BO 4H13B 5GTIH 1G1IA 4YTPC 2KK7A 1KB9E 1YTZI 2FYUJ 2A45H 4KHXA 1SFCD 3HE4A 3AECC 1D7MA 2FYNC 3Q1MA 1IFJA 1L0LD 1YQ3C 1M90Q 4GT1A 1NU1G 1NTKK 3L71E 5AVRB 3VN0A 3KXDA 2PGDA 5TJHA 1AFOA 2Y0DA 1FJKA 1GL2D 3KPEA 1SQPE 3E1IA 4M3LA 2XKMA 2ZVNB 1M1JC 2JJLA 4PD4E 5H2FH 3L72J 1JM0A 1YI2P 1BCCD 1FDMA 1VF5D 3L75E 3A0BH 1YJNP 3OAKA 4Y28J 3L73E 1KYOE 2P10A 1RF0C 2IZ0A 3VYIA 2K88A 1NTZE 3WU2H 1EDIA 3KZIH 3E7KA 4C46A 1N7SB 1J1EC 1LWUB 1LTGC 1NTME 1L4AA 1OIPA 2J59M 3L71G 3P8CE 1KFNA 1MUUA 3EFFK 5KLIC 5GTIE 1SQBK 1SQPG 2OYOA 3PH0A 3MUDA 4ZNCA 3K5BA 1S5LX 2MKVA 1SFCC 3CCSP 3W67A 4L75A 4WY4C 4JYBA 3L75G 1L0NK 3WMM0 3L73G 1L0LE 2WSCJ 3Q5PA 3AEGC 2RKLA 1IC2A 1L2PA 2NZ2A 2Z4EA 3H1IJ 1KQLA 1VL2A 1NTMG 3AEFC 3A7OA 3GF3A 3Q5RA 4GOEA 2G8YA 3JSVC 5APTA 5H2FE 3FWLA 2Z5IA 2M8RA 3EQ2A 1JY3O 1LTJA 2XNDH 3SFDC 2C0WA 4DJGA 1JY2O 3A0BE 2IYOA 3I56P 1GL2B 5AW1B 5AW9B 3H1HJ 1U57A 4DCKA 3B8EB 3WU2E 3KZIE 4ZMDA 1YJWP 1L0LG 1VF5B 3MHVA 3CCJP 4IL6H 1L4AD 2NRGA 1DEBA 5CJ0A 1VQ4P 3FXDA 1EC5A 1SVFA 2W83C 1OW6A 3GLMA 5APWA 1YITP 1EDLA 3HTKA 5AVYB 3AE7C 3SWKA 4H0LD 2ZXEB 1PIXA 1NU1K 1G1JA 2FXOA 5AVQB 1H89A 1ZV8A 1T2KD 3S4RA 4IFDK 3G71P 1JUNA 3CCRP 2WTYA 2XV5A 3A0HH 1HH0A 1ZXGA 1IK9A 4D6TE 4YXWH 3HE4B 3M9BA 2QM8A 1NVOA 1IFNA 2L91A 1ZR2A 1P84D 1N7LA 3H1JD 1P84H 4TLFA 2YXRB 1DX7A 2KXPB 1PGPA 1DD4A 2YIUC 2WSEJ 2R32A 3H25A 2NPSD 2E74C 3PLNA 3G9RA 3M9HA 3RGUA 1Q7YQ 3CMAP 1K73Q 1FDOA 5KTBA 2N1TC 2FFDC 1FZCA 3JC22 1SQPK 1OX3A 1KQSO 1L4AC 1U7MA 4LLHA 4D6TG 2Q7CA 5AVTB 1S4XA 2V7QJ 1M8OB 3V6IA 3MUDC 1L4AB 2BEQD 2JKVA 1H0TA 1G2CA 2A06D 4R4LA 2WVRA 1T2KC 1NTMK 3S1KA 1HWTC 1GK6A 3A0HE 4OWFA 4H0LB 2BCCE 2IFNA 2WPVB 3LW5J 4AUWA 1BE3D 4L74A 2GA1A 3H1JE 3IFMA 5AW0B 1LTJC 1VQ7P 4H44C 5CBNA 2I1KA 1L0LK 2NPSC 3CX5D 2H88C 4XE5B 2LR2A 3BCCJ 3CX5H 1U7JA 2WT7A 3MIWA 1VPCA 2Y0EA 2YKPA 1LTJB 3GHGC 2OTKE 2BCCG 1PP9D 2E43A 2KSJA 1SQQJ 3AEEC 3GHGB 3BRVB 3H1JG 3CWBE 3H1LD 5KLVD 1NTKJ 1OVUA 1PFIA 3CCMP 3CCUP 3HRNA 2E5YA 3UIAA 1JO5A 3HTKB 2JO1A 2WWWA 2QM7A 2DW3A 3L74J 1FAVA 2LXBA 4UB8H 1W5CE 3G6EP 1M1JA 1BE3E 3RL0g 1NWQA 2QJKB 3CC7P 2YO3A 3CXHH 2YXQB 1OWAA 1S72P 3L37A 5CHXA 3AE5C 3N7NA 2P58A 4TT3H 1JMMA 3CCQP 1RF0A 2IBZE 1X9VA 1T3UA 1SQXJ 1NU1D 4PV1D 2C0XA 3TSIA 1JY3N 2CPSA 1QVFO 2N9YB 1JY2N 1FZCC 1SQBJ 1T6AA 1GW4A 2ZAEB 3SFEC 3R2PA 1IZNB 3HE5A 1EZVE 2G3AA 1OFCX 2GUVA 1FZCB 1WMKA 2KB7P 4NPDA 1BE3G 1BSHA 1L0NJ 1EDJA 1SFCA 4WY4A 4U3FE 2GUSA 3RK3E 3TGUJ 1JTHA 2GM4A 2IBZG 1YYCA 3L71D 1KQFB 1GK4A 1JEKA 5EFWB 1G2CB 1H0TB 1QVGO 1SQPD 2B9BA 2FXMA 2JR8A 3CXHE 1EZVG 1BGYE 1DEEG 1T8ZA 4PD4D 1URQA 3USSA 3G3ZA 1MZ9A 3L75D 1Y8AA 3L73D 5KAIH 3O8ZA 1KYOD 1KB9I 1S3JA 3FX0A 3HUSA 2OTJP 1KYOH 3H1LG 4Y99B 4AYCA 1KILE 1LP1A 1NTZD 1KILC 5APXA 1JY3P 4U3FG 1OW7A 3C1LA 2KLVA 3EFGA 3PTZA 2HFED 3B4SA 4WBAA 1AJYA 2VRSA 2QJYC 1E5WA 3P8CD 1NGMB 2WT7B 2HR3A 1UIXA 4PV1B 4XFJA 5AW8B 1SQVJ 3R4YA 1S9KE 3L70J 3C8VA 2QJYB 2BEZF 2E76C 2FYUE 1BGYG 2IDBA 4WVZA 4WY4D 4IFFA 1JNMA 3NXSA 2N9BA 4PJ0H 4KJMA 2V4HA 1GU5A 2E75D 3JCUH 2K3RA 4I6MC 4YXDC 2WSCH 5CBOA 2WMMA 2RH0A 1Q2NA 2FYNB 1VQKP 1LGHB 3I55P 3P32A 3T97A 1CW5A 3RK2C 3D71A 2OYHC 3H1KJ 2E42A 2H8PD 4IOIH 1URQD 1K8AQ 3Q5SA 2WSFH 5KAIE 2FYUG 2ZJSE 2A45I 1M1JB 2FBWC 1FS0E 1JMBA 1HVVA 2N1TA 5B5EH 1M57D 2FFDA 1EQ7A 4BRYA 1J1DC 1FOSF 3AEBC 3TF5A 2M3EA 3AE6C 5AW4B 2K9YA 1N73C 1J1EB 2AEMA 3VMZA 1GDTA 1NTMJ 2ZVOB 1NKZB 3CD6P 5KLIB 2B87A 3HE5B 1LJ2A 4PJ0E 2KZJA 3NFQA 3JCUE 1QEXA 2MJZA 2O1JA 2E75C 5APSA 3LIDA 4OGQD 4GDOA
chains in the Genus database with same CATH topology
1S5LE 5E79E 5KAFE 4UB8E 4IL6E 3WU2E 5TISE 5B5EE 4UB6E 5B66E 3KZIE 4PJ0E 5KAIE 3JCUE 5H2FE 5GTIE 5GTHE 2AXTE 3A0HE 1W5CE 3A0BE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L E;  5E79 E;  5KAF E;  4UB8 E;  4IL6 E;  3WU2 E;  5TIS E;  5B5E E;  4UB6 E;  5B66 E;  3KZI E;  4PJ0 E;  5KAI E;  3JCU E;  5H2F E;  5GTI E;  5GTH E;  2AXT E;  3A0H E;  1W5C E;  3A0B E; 
#chains in the Genus database with same CATH topology
 1NTZ G;  1SFC B;  1WRG A;  2WQY C;  3H1I E;  4D6T D;  4WY4 B;  3M06 A;  5AW5 B;  1UII A;  5CCG D;  5APQ A;  1JTH B;  2IFM A;  1L0L J;  1OVV A;  4W7Y A;  3BAS A;  5KLV K;  4C7N A;  2PP6 A;  5AVX B;  1URQ C;  2NPS A;  1RQU A;  1R8E A;  2E74 D;  3H1H E;  1HGZ A;  1VQ5 P;  2PFX A;  1DIP A;  2QIW A;  5B5E E;  5GTH H;  3HUS C;  2Y0C A;  2N1T D;  3B5N C;  3GHG A;  3HD7 C;  1URQ B;  3PHL A;  3V5B A;  2JWA A;  2CK3 H;  2XNX A;  1BCC J;  1XTG B;  2JDI H;  3HUS B;  2OYI C;  3H1I G;  3GF7 A;  1RHZ B;  2Q6Q A;  2ZYD A;  1LP1 B;  3CCV P;  5AVV B;  1RE4 C;  1X0T A;  2AXC A;  2P2U A;  1FZB A;  1WT6 A;  3RL0 C;  3II6 A;  4RES B;  1DD3 A;  3OJA B;  2WSS H;  2FXP A;  5BVZ A;  1SP4 A;  2B89 A;  5M1B A;  3H1H G;  2KYV A;  2POH A;  2YMY A;  2BCC D;  4OGQ C;  2W6B A;  4I2L C;  1HBW A;  3M0A A;  2QVA A;  3I5C A;  1HGV A;  3LW5 H;  5CCG C;  2ZFC A;  3G4S P;  4OGQ B;  1CI6 A;  2R44 A;  4H44 D;  2FY8 A;  3IAO A;  2H43 A;  5GTH E;  3T97 B;  3O6Q A;  2K9J A;  5BU5 A;  1EDK A;  1KD1 Q;  1PGQ A;  4UB6 H;  2O01 N;  2R3S A;  4WWI A;  2YIU B;  1JB0 J;  1PGO A;  2E74 B;  4OVN F;  2KUB A;  3VP9 A;  1VQP P;  2N1T B;  3TNU A;  2FFD B;  4BRY B;  2RN0 A;  3CWB D;  1P84 I;  1NTZ K;  3AE8 C;  4RKU J;  2YMK A;  1EXJ A;  2KS1 A;  2R3C A;  2UWJ E;  1KOR A;  1MFT A;  3CC2 P;  3U59 A;  4HB1 A;  2W8Z A;  1GZL A;  2B87 B;  5AW7 B;  3L74 D;  4N6J A;  3W68 A;  1BSN A;  3GMA A;  3M0D A;  3FXE A;  1IFI A;  2AEF A;  1GW3 A;  1NOH A;  2Q9I A;  2O3J A;  2IBZ D;  5APU A;  3BCC E;  1KIL A;  4UB6 E;  4IL6 X;  2QG4 A;  4HH2 A;  3H1J J;  4K35 A;  4C7N B;  3D6Z A;  1ZME C;  4H44 B;  2P7J A;  2NPS B;  2JP3 A;  3IR9 A;  4GOD A;  4L76 A;  1EZV D;  2QJP C;  3VP8 A;  1RH5 B;  4HKZ H;  1SQQ E;  3SWF A;  1YIJ P;  4IFM A;  2QRX A;  1RF1 C;  1YHQ P;  4EYY Q;  1NO4 A;  2D2C D;  2O1K A;  5DJU B;  2KI7 B;  4XA4 A;  5E79 H;  1K9M Q;  1M7L A;  1NTK E;  2XDJ A;  1AA0 A;  4U3F D;  4ASW A;  1R5L A;  3H32 A;  3RK3 D;  3AE9 C;  2HLO A;  3ZDM A;  3BCC G;  4DT0 A;  3CX5 I;  3V2R A;  1E79 H;  3A3Y B;  1ZLL A;  3L74 E;  2FYZ A;  1VQ6 P;  1OZH A;  3N4X A;  3AE2 C;  3CXH D;  1BGY D;  2OYH A;  1SQQ G;  4EDF A;  1QL1 A;  2XZR A;  1SQX E;  3V4Q A;  1BE3 J;  3CWB G;  1NTK G;  1KIL D;  1CI6 B;  5L8R J;  2HPC A;  4QMA A;  4RO0 A;  1GTW A;  1SQB E;  5K5G B;  3O6Q B;  2K9J B;  1N73 A;  3L74 G;  1S9K D;  1JOC A;  1FZE A;  1LT9 A;  2ITA A;  2E76 D;  1YQ4 C;  2I8D A;  5E79 E;  2FYU D;  3KHU A;  3A2A A;  2D2C C;  3FGA D;  4LC1 A;  1YBK A;  1CSB A;  1Z56 A;  1PP9 J;  1PPJ E;  3IF4 A;  3TNU B;  3M91 A;  1N8R Q;  3TGU E;  3RK3 C;  1BDD A;  1SQX G;  2D2C B;  1CZQ A;  3GW6 A;  5B66 H;  1NJI Q;  3H1L J;  5KLV J;  3CC4 P;  4JF7 A;  4OH8 B;  3RK3 B;  1PV3 A;  1SQB G;  1ZR4 A;  1KTM A;  3RK2 D;  1S5L H;  2KS1 B;  1FZF A;  1X22 A;  5CCH C;  2IPP A;  2K1A A;  3L72 D;  4CPG A;  3M0D C;  4RJT A;  2KOG A;  3V2N A;  2IYP A;  3PJS K;  4JYC A;  3WUV A;  3B5N A;  1PPJ G;  3MP7 B;  3HD7 A;  1JCC A;  1HF9 A;  3TGU G;  1N7S D;  3TYY A;  1ZRT E;  2OYI A;  4GOF A;  1NAY A;  1LTT C;  1FJP A;  1QLE D;  1KIL B;  1NU1 J;  1RE4 A;  3CI9 A;  5APV A;  1SQV E;  2R5B A;  4DOJ A;  3L70 E;  1DH3 A;  4H13 C;  4HJG H;  4A7P A;  2Y9Z A;  1ZW0 A;  4PD4 I;  1VQL P;  3U1C A;  1HTL C;  2E76 B;  3CME P;  5B66 E;  2FKW B;  1KYO I;  3F89 A;  3H1I D;  1SQQ K;  5CCG A;  1KC8 Q;  2YKQ A;  1VQN P;  3H32 B;  1S5L E;  3PRJ A;  5CJ4 A;  2J58 A;  4O9B A;  1KN7 A;  4N78 E;  3VTP C;  1LTB C;  3L71 J;  1X79 B;  1S2E A;  1SQV G;  1KMI Z;  1LTA C;  2AXT H;  3H1K E;  3L70 G;  3L72 E;  3BRT B;  1VQ8 P;  3CCL P;  1OXZ A;  3H1H D;  1R5S A;  1MKM A;  3RK2 B;  3Q2Y A;  1SQP J;  3BVH A;  1USE A;  2PRR A;  2OYH B;  1M56 D;  3B5N D;  1IFD A;  3HD7 D;  4W7Z A;  3SSU A;  3LIE A;  1YJ9 P;  1N7S C;  1LWU C;  3L75 J;  3L73 J;  3WUU A;  2PAJ A;  4U7J A;  1NTZ J;  2HPC B;  1J1D B;  2WPR A;  2O01 J;  2KSE A;  1LT9 C;  2Z5H A;  3RL0 D;  1S1C X;  2YNY A;  2QEX P;  1SQX K;  3V4W A;  1NKN A;  3OW2 O;  3H1K G;  3L72 G;  4HYT B;  1ZOY C;  1N73 B;  1LT9 B;  5CMZ A;  1HUC A;  2YKO A;  3VOP A;  3QWO C;  1HJB A;  1FE6 A;  4ASV A;  5KKZ C;  4AQR D;  2E75 B;  1Y47 A;  1AVY A;  5AVU B;  1IFP A;  2AXT E;  1W2E A;  1QX8 A;  4I1L A;  5KKZ B;  1RY3 A;  1GD2 E;  2Y9Y A;  3MZW B;  1AVO A;  2OQQ A;  2WSE H;  2OTL P;  2HOD A;  1BDC A;  1GL2 C;  1VQ9 P;  3A5T A;  2WIT A;  1FOS E;  3KQG A;  3F5H A;  3CPW O;  1X8Y A;  2WSF J;  1TU3 F;  4GKG A;  1BCC E;  2A45 G;  1VF5 C;  1LTS C;  2R5D A;  3B5N B;  4K3A A;  4C7R A;  3HD7 B;  3E1R A;  1SS1 A;  1RF1 A;  1RE3 A;  3B71 A;  2V7Q H;  2I1J A;  1FC2 C;  4JBZ A;  2OYI B;  4EOT A;  1GMJ A;  1YTZ T;  3NMD A;  3BAT A;  1EXI A;  5AVZ B;  4GIF A;  5KJ7 A;  3M9Q A;  3RL0 B;  1OW8 A;  5BU8 B;  1SQV K;  2KNC B;  2OGU A;  1BCC G;  2BAS A;  2FYU K;  1AQ5 A;  1Q81 Q;  1IO4 A;  2C9N Y;  1FU1 A;  2AEJ A;  3P7K A;  4D6T J;  1LTI C;  2B88 A;  1PZQ A;  2M5A A;  3BCC D;  1FDI A;  1JCD A;  2H89 C;  3AED C;  1Q90 D;  1AV1 A;  1MFZ A;  4KT0 J;  2QSI A;  1A02 F;  2H7H A;  3V2P A;  4Z1M H;  1VQM P;  1NYH A;  2IZ1 A;  2CPB A;  1SQQ D;  2LXC B;  2Q3I A;  3U1A A;  3H6P A;  5AVS B;  1XTC C;  4IL6 E;  1H8A A;  2M3B A;  3OA7 A;  1NTK D;  4BWN A;  4R4M A;  1OMI A;  1VDF A;  2WZ7 A;  1OVR A;  2M0B A;  4JPZ B;  5KJ7 D;  1K05 A;  2IX7 C;  1ZN5 A;  2P67 A;  1NHL A;  4H0L C;  1KZU B;  1QGK B;  5AW2 B;  1NH4 A;  2K37 A;  3AE3 C;  4L73 A;  5CCH A;  2KIK A;  5KAF H;  1FBM A;  1AQT A;  2BCC J;  3QH9 A;  1LNQ A;  2E5T A;  3MTU E;  2KLU A;  3TDK A;  1T3J A;  3VMY A;  2W90 A;  1H88 A;  1SQX D;  1FZA A;  1FZG A;  3EWK A;  1P84 E;  1A02 J;  2ZT9 D;  1NAF A;  3GG2 A;  1RQV A;  2WPS A;  1SQB D;  2HOD B;  3FWN A;  2J5U A;  4DZO A;  2Q5U A;  4LGD E;  1RE3 C;  2W6A A;  2SPZ A;  2Q3E A;  1L0N D;  5AW3 B;  2QJP B;  4I7Z C;  5TIS H;  2KZI A;  1KFM A;  2HG5 D;  1PPJ D;  1Y9B A;  3TGU D;  2XU6 A;  1RF1 B;  5KJ7 C;  2IBZ I;  2ZYG A;  3P8M C;  4MN4 C;  1PL5 A;  4I7Z B;  4NPE A;  3IN6 A;  1N2D C;  3CWB J;  2A06 E;  2L5G B;  5KAF E;  5CCH D;  3VMX A;  1EZV I;  3SWY A;  2QJK C;  2C9L Y;  1J2J B;  2P1J A;  3NTN A;  2HYN A;  5AVW B;  1PGJ A;  3AEA C;  1IFM A;  1KV4 A;  2ZT9 C;  3L36 A;  1GU4 A;  4ZKP A;  1N7S A;  1LWU A;  1IK7 A;  4N3Y B;  1ZRT D;  3TK1 A;  3CX5 E;  2M5A B;  1K04 A;  2KP8 A;  3D70 A;  2WPQ A;  1Q82 Q;  2ZT9 B;  1SQV D;  2LKM A;  2A06 G;  3L70 D;  2Q1K A;  4H13 D;  4YPC A;  3RBZ A;  2OAR A;  1L0N E;  3ITK A;  5TIS E;  3CXH I;  4ZKU A;  3CL3 D;  3KDP B;  1PP9 E;  3CLQ A;  3AE4 C;  2RMZ A;  3ABV C;  5AW6 B;  3C9I A;  2W27 A;  4EIJ A;  1KB9 D;  1KB9 H;  1MV8 A;  1N86 A;  2YO2 A;  3H1L E;  5KLV E;  3MGN A;  3MD0 A;  4U3F J;  2ZYA A;  4B86 A;  1LT1 A;  4N78 D;  2ZXX A;  3KYQ A;  3H1K D;  4NPF X;  4W80 A;  4UB8 E;  1GL2 A;  1L0N G;  1SLQ A;  1M1K Q;  5APY A;  3VMA A;  3Q3D A;  5C39 A;  1PP9 G;  1BGY J;  4JQ0 D;  4Y99 C;  3CCE P;  1KQG B;  2W6J H;  3AE1 C;  4PD4 H;  2QE7 H;  3L4F A;  4WB4 A;  2JWD A;  1Q86 Q;  2JEE A;  3RBX A;  3S9O A;  1QL2 A;  1NU1 E;  5KLV G;  1ZP0 C;  4BXL A;  4PV1 C;  3L35 A;  1IJD B;  2O01 H;  1JY2 P;  3WUT A;  1NTM D;  1USD A;  1VQO P;  3PP5 A;  2QA4 P;  3V2Q A;  4EI2 A;  5DJT B;  1HJ0 A;  3D6Y A;  2KNC A;  1W2B O;  4H13 B;  5GTI H;  1G1I A;  4YTP C;  2KK7 A;  1KB9 E;  1YTZ I;  2FYU J;  2A45 H;  4KHX A;  1SFC D;  3HE4 A;  3AEC C;  1D7M A;  2FYN C;  3Q1M A;  1IFJ A;  1L0L D;  1YQ3 C;  1M90 Q;  4GT1 A;  1NU1 G;  1NTK K;  3L71 E;  5AVR B;  3VN0 A;  3KXD A;  2PGD A;  5TJH A;  1AFO A;  2Y0D A;  1FJK A;  1GL2 D;  3KPE A;  1SQP E;  3E1I A;  4M3L A;  2XKM A;  2ZVN B;  1M1J C;  2JJL A;  4PD4 E;  5H2F H;  3L72 J;  1JM0 A;  1YI2 P;  1BCC D;  1FDM A;  1VF5 D;  3L75 E;  3A0B H;  1YJN P;  3OAK A;  4Y28 J;  3L73 E;  1KYO E;  2P10 A;  1RF0 C;  2IZ0 A;  3VYI A;  2K88 A;  1NTZ E;  3WU2 H;  1EDI A;  3KZI H;  3E7K A;  4C46 A;  1N7S B;  1J1E C;  1LWU B;  1LTG C;  1NTM E;  1L4A A;  1OIP A;  2J59 M;  3L71 G;  3P8C E;  1KFN A;  1MUU A;  3EFF K;  5KLI C;  5GTI E;  1SQB K;  1SQP G;  2OYO A;  3PH0 A;  3MUD A;  4ZNC A;  3K5B A;  1S5L X;  2MKV A;  1SFC C;  3CCS P;  3W67 A;  4L75 A;  4WY4 C;  4JYB A;  3L75 G;  1L0N K;  3WMM 0;  3L73 G;  1L0L E;  2WSC J;  3Q5P A;  3AEG C;  2RKL A;  1IC2 A;  1L2P A;  2NZ2 A;  2Z4E A;  3H1I J;  1KQL A;  1VL2 A;  1NTM G;  3AEF C;  3A7O A;  3GF3 A;  3Q5R A;  4GOE A;  2G8Y A;  3JSV C;  5APT A;  5H2F E;  3FWL A;  2Z5I A;  2M8R A;  3EQ2 A;  1JY3 O;  1LTJ A;  2XND H;  3SFD C;  2C0W A;  4DJG A;  1JY2 O;  3A0B E;  2IYO A;  3I56 P;  1GL2 B;  5AW1 B;  5AW9 B;  3H1H J;  1U57 A;  4DCK A;  3B8E B;  3WU2 E;  3KZI E;  4ZMD A;  1YJW P;  1L0L G;  1VF5 B;  3MHV A;  3CCJ P;  4IL6 H;  1L4A D;  2NRG A;  1DEB A;  5CJ0 A;  1VQ4 P;  3FXD A;  1EC5 A;  1SVF A;  2W83 C;  1OW6 A;  3GLM A;  5APW A;  1YIT P;  1EDL A;  3HTK A;  5AVY B;  3AE7 C;  3SWK A;  4H0L D;  2ZXE B;  1PIX A;  1NU1 K;  1G1J A;  2FXO A;  5AVQ B;  1H89 A;  1ZV8 A;  1T2K D;  3S4R A;  4IFD K;  3G71 P;  1JUN A;  3CCR P;  2WTY A;  2XV5 A;  3A0H H;  1HH0 A;  1ZXG A;  1IK9 A;  4D6T E;  4YXW H;  3HE4 B;  3M9B A;  2QM8 A;  1NVO A;  1IFN A;  2L91 A;  1ZR2 A;  1P84 D;  1N7L A;  3H1J D;  1P84 H;  4TLF A;  2YXR B;  1DX7 A;  2KXP B;  1PGP A;  1DD4 A;  2YIU C;  2WSE J;  2R32 A;  3H25 A;  2NPS D;  2E74 C;  3PLN A;  3G9R A;  3M9H A;  3RGU A;  1Q7Y Q;  3CMA P;  1K73 Q;  1FDO A;  5KTB A;  2N1T C;  2FFD C;  1FZC A;  3JC2 2;  1SQP K;  1OX3 A;  1KQS O;  1L4A C;  1U7M A;  4LLH A;  4D6T G;  2Q7C A;  5AVT B;  1S4X A;  2V7Q J;  1M8O B;  3V6I A;  3MUD C;  1L4A B;  2BEQ D;  2JKV A;  1H0T A;  1G2C A;  2A06 D;  4R4L A;  2WVR A;  1T2K C;  1NTM K;  3S1K A;  1HWT C;  1GK6 A;  3A0H E;  4OWF A;  4H0L B;  2BCC E;  2IFN A;  2WPV B;  3LW5 J;  4AUW A;  1BE3 D;  4L74 A;  2GA1 A;  3H1J E;  3IFM A;  5AW0 B;  1LTJ C;  1VQ7 P;  4H44 C;  5CBN A;  2I1K A;  1L0L K;  2NPS C;  3CX5 D;  2H88 C;  4XE5 B;  2LR2 A;  3BCC J;  3CX5 H;  1U7J A;  2WT7 A;  3MIW A;  1VPC A;  2Y0E A;  2YKP A;  1LTJ B;  3GHG C;  2OTK E;  2BCC G;  1PP9 D;  2E43 A;  2KSJ A;  1SQQ J;  3AEE C;  3GHG B;  3BRV B;  3H1J G;  3CWB E;  3H1L D;  5KLV D;  1NTK J;  1OVU A;  1PFI A;  3CCM P;  3CCU P;  3HRN A;  2E5Y A;  3UIA A;  1JO5 A;  3HTK B;  2JO1 A;  2WWW A;  2QM7 A;  2DW3 A;  3L74 J;  1FAV A;  2LXB A;  4UB8 H;  1W5C E;  3G6E P;  1M1J A;  1BE3 E;  3RL0 g;  1NWQ A;  2QJK B;  3CC7 P;  2YO3 A;  3CXH H;  2YXQ B;  1OWA A;  1S72 P;  3L37 A;  5CHX A;  3AE5 C;  3N7N A;  2P58 A;  4TT3 H;  1JMM A;  3CCQ P;  1RF0 A;  2IBZ E;  1X9V A;  1T3U A;  1SQX J;  1NU1 D;  4PV1 D;  2C0X A;  3TSI A;  1JY3 N;  2CPS A;  1QVF O;  2N9Y B;  1JY2 N;  1FZC C;  1SQB J;  1T6A A;  1GW4 A;  2ZAE B;  3SFE C;  3R2P A;  1IZN B;  3HE5 A;  1EZV E;  2G3A A;  1OFC X;  2GUV A;  1FZC B;  1WMK A;  2KB7 P;  4NPD A;  1BE3 G;  1BSH A;  1L0N J;  1EDJ A;  1SFC A;  4WY4 A;  4U3F E;  2GUS A;  3RK3 E;  3TGU J;  1JTH A;  2GM4 A;  2IBZ G;  1YYC A;  3L71 D;  1KQF B;  1GK4 A;  1JEK A;  5EFW B;  1G2C B;  1H0T B;  1QVG O;  1SQP D;  2B9B A;  2FXM A;  2JR8 A;  3CXH E;  1EZV G;  1BGY E;  1DEE G;  1T8Z A;  4PD4 D;  1URQ A;  3USS A;  3G3Z A;  1MZ9 A;  3L75 D;  1Y8A A;  3L73 D;  5KAI H;  3O8Z A;  1KYO D;  1KB9 I;  1S3J A;  3FX0 A;  3HUS A;  2OTJ P;  1KYO H;  3H1L G;  4Y99 B;  4AYC A;  1KIL E;  1LP1 A;  1NTZ D;  1KIL C;  5APX A;  1JY3 P;  4U3F G;  1OW7 A;  3C1L A;  2KLV A;  3EFG A;  3PTZ A;  2HFE D;  3B4S A;  4WBA A;  1AJY A;  2VRS A;  2QJY C;  1E5W A;  3P8C D;  1NGM B;  2WT7 B;  2HR3 A;  1UIX A;  4PV1 B;  4XFJ A;  5AW8 B;  1SQV J;  3R4Y A;  1S9K E;  3L70 J;  3C8V A;  2QJY B;  2BEZ F;  2E76 C;  2FYU E;  1BGY G;  2IDB A;  4WVZ A;  4WY4 D;  4IFF A;  1JNM A;  3NXS A;  2N9B A;  4PJ0 H;  4KJM A;  2V4H A;  1GU5 A;  2E75 D;  3JCU H;  2K3R A;  4I6M C;  4YXD C;  2WSC H;  5CBO A;  2WMM A;  2RH0 A;  1Q2N A;  2FYN B;  1VQK P;  1LGH B;  3I55 P;  3P32 A;  3T97 A;  1CW5 A;  3RK2 C;  3D71 A;  2OYH C;  3H1K J;  2E42 A;  2H8P D;  4IOI H;  1URQ D;  1K8A Q;  3Q5S A;  2WSF H;  5KAI E;  2FYU G;  2ZJS E;  2A45 I;  1M1J B;  2FBW C;  1FS0 E;  1JMB A;  1HVV A;  2N1T A;  5B5E H;  1M57 D;  2FFD A;  1EQ7 A;  4BRY A;  1J1D C;  1FOS F;  3AEB C;  3TF5 A;  2M3E A;  3AE6 C;  5AW4 B;  2K9Y A;  1N73 C;  1J1E B;  2AEM A;  3VMZ A;  1GDT A;  1NTM J;  2ZVO B;  1NKZ B;  3CD6 P;  5KLI B;  2B87 A;  3HE5 B;  1LJ2 A;  4PJ0 E;  2KZJ A;  3NFQ A;  3JCU E;  1QEX A;  2MJZ A;  2O1J A;  2E75 C;  5APS A;  3LID A;  4OGQ D;  4GDO A; 
#chains in the Genus database with same CATH homology
 1S5L E;  5E79 E;  5KAF E;  4UB8 E;  4IL6 E;  3WU2 E;  5TIS E;  5B5E E;  4UB6 E;  5B66 E;  3KZI E;  4PJ0 E;  5KAI E;  3JCU E;  5H2F E;  5GTI E;  5GTH E;  2AXT E;  3A0H E;  1W5C E;  3A0B E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...