5E79E

Macromolecular diffractive imaging using imperfect crystals
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 19
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5e79E00
3WU2E 3A0HE 5E79E 5KAIE 5GTHE 2AXTE 5B66E 5GTIE 3KZIE 1W5CE 3A0BE 5KAFE 4UB6E 5B5EE 4UB8E 4IL6E 4PJ0E 5H2FE 5TISE 3JCUE 1S5LE
chains in the Genus database with same CATH superfamily
3MZWB 3L75J 2W83C 2JJLA 1OVVA 3HE4B 1LWUA 3ZDMA 1LTAC 2L5GB 2YIUB 1IK9A 1KFNA 4N78D 3AEGC 1PGQA 1XTGB 2KLUA 2AEMA 2E75C 3P8CE 1KYOE 1NYHA 2KNCB 1JMMA 2Y0DA 4BRYA 1LWUC 5E79H 1LT9B 4YTPC 3TNUB 3BCCD 5AVZB 4C7NB 3AE2C 2E74C 2C9NY 1PPJE 1G1IA 1JY2P 2WT7B 1L4AB 3Q3DA 3IF4A 3L72D 1ZR4A 2NPSA 1BGYG 3MTUE 1RF0A 5GTHH 4IOIH 2ZT9D 4YXDC 2YO2A 3WMM0 3L75E 1H0TA 2J5UA 2NRGA 2A06G 5B66E 2NPSC 4H0LB 1BCCJ 4AYCA 1RF0C 1Y47A 2FKWB 2KXPB 5CBNA 1YTZT 4ASWA 3PH0A 4DJGA 1S3JA 3PHLA 3CCEP 2OYOA 2R5BA 5DJUB 1S5LE 3GF3A 1NTMD 2KS1A 3A0HE 4K3AA 2D2CB 1NTZG 3L4FA 3JSVC 3PLNA 1OW8A 1EDIA 3VMXA 5CMZA 5AW4B 2ZJSE 3FWLA 2J58A 3HD7B 1GU5A 1IFIA 1KYOI 2N1TB 2M3BA 1FZCC 1VQ4P 1KILB 3L74G 2WZ7A 4WY4D 5KLVK 1L0NK 4JPZB 4EYYQ 3L70J 2FFDB 3TF5A 1IO4A 2H7HA 3SFDC 5CHXA 4GOEA 1YITP 2HG5D 1BCCE 4H44B 2WSEH 1ZMEC 2YXQB 2Q5UA 2M5AB 3CWBJ 2OYHB 5H2FE 1K05A 1FDMA 4U3FJ 5AW2B 4EOTA 5KJ7A 2W6JH 3C1LA 1SP4A 1NTMK 2FYUJ 3CCJP 3CCRP 4NPEA 2IFMA 4AUWA 1CI6A 3OAKA 4H13C 3FGAD 1G2CA 1T8ZA 3H25A 1W2BO 3V5BA 1OVUA 2V7QH 1SQPG 3CX5D 4Y99B 1YBKA 1VF5D 3M0AA 5CCHA 3L70E 1X8YA 1WT6A 2OGUA 1N7SD 1JTHA 3OW2O 1FZEA 3KXDA 5EFWB 1M57D 1N7LA 2I1JA 1KB9I 3L73J 2XU6A 2QSIA 2W8ZA 1U7MA 4R4LA 1GL2D 2O01N 2AXTE 2QJYB 2YKQA 1JY3N 1NTKD 3CWBE 4UB6E 5CCHC 3G6EP 4U3FE 1Y9BA 1NU1J 1VDFA 1R5SA 5AVVB 3KPEA 1USEA 2JWDA 3AEAC 2FYUE 1YJNP 1RF1A 1P84H 3MD0A 2IYOA 4XFJA 2Q1KA 3S9OA 1S9KD 2JO1A 5TJHA 2E43A 2XNXA 1A02F 3IAOA 1S5LX 3A2AA 1GK6A 3Q5SA 1HVVA 1LNQA 3P8MC 4DT0A 1L4AA 3H1IG 5AW9B 1RF1C 2KSEA 2R3CA 3V2NA 2KZIA 2ZXEB 3HE4A 1GW4A 3F5HA 4JBZA 2LKMA 2CK3H 5APWA 3EWKA 3L73E 3T97B 2N9YB 1SQQJ 2M8RA 2B9BA 1HJ0A 5B5EH 2FXMA 1SQBG 3SFEC 3CXHD 3LIEA 3WUTA 3Q2YA 1L4AC 3SWFA 2KB7P 5L8RJ 4W7YA 2W90A 4DZOA 5AW5B 2GM4A 5AW0B 1LT9A 1QL1A 1NU1E 3KZIH 3R2PA 1NTZK 2YIUC 4IL6E 2JDIH 2LXCB 3TNUA 4NPDA 4C7NA 5C39A 3IN6A 1NH4A 1BE3J 2BCCJ 1JUNA 5GTIE 1XTCC 2XZRA 1HF9A 1D7MA 2O1JA 2K88A 1KD1Q 1AA0A 1URQB 4BXLA 1LT9C 1U7JA 4RESB 1GU4A 2HODA 2QEXP 5AVWB 4I7ZB 1SQXG 2AEJA 2Z4EA 2W6AA 3CC2P 1NAYA 3HE5A 1JCCA 2XDJA 3L71G 3KHUA 2WMMA 3H1HJ 1SFCA 4IFDK 3H6PA 2PRRA 2N9BA 3B5NB 1SQQE 1FZBA 4D6TJ 3KQGA 4WVZA 3TGUG 2Y9YA 3TYYA 5KKZB 1LJ2A 4H0LC 1SFCC 3WUUA 2WPRA 2JEEA 1WMKA 4PD4E 3AE7C 1RE3A 1CSBA 1S1CX 3P7KA 3CPWO 1SQPK 1BE3E 2BCCE 3N4XA 2P67A 2N1TA 3P8CD 1KYOD 1KILA 2D2CC 1LTTC 3I56P 2VRSA 3CX5H 2ZYGA 2FFDA 1IJDB 1LTIC 5BU5A 1RE3C 1T3UA 3HD7C 1URQD 1PPJD 3U1CA 2N1TC 3H1HE 1DEEG 4LC1A 2XNDH 1KILC 3BCCG 4ASVA 4OH8B 4D6TE 2FYZA 3CMEP 2OYHA 2KUBA 2FFDC 3L72G 3WU2E 5KAIE 1G1JA 1NGMB 1NAFA 4L74A 2FXPA 1OX3A 3L75D 3VP9A 4H44C 2E76D 3L70G 3AE5C 3V4QA 1PIXA 2OYHC 4W7ZA 3W68A 1L0LJ 2Y9ZA 1FJKA 3D71A 3LIDA 3OA7A 1FC2C 3A3YB 4IL6X 4DCKA 3Q5RA 1JOCA 2SPZA 3H1KJ 4Y28J 3GMAA 2LXBA 1JB0J 1QLED 2ZT9B 1SQBK 2FXOA 4Y99C 1K9MQ 1KZUB 3EQ2A 4JYBA 5KTBA 1FOSF 2IZ1A 3S4RA 3M9HA 5APTA 3IFMA 3O6QB 3FX0A 3D6YA 5GTHE 5KJ7D 2KZJA 1SQVJ 2AXCA 3CCQP 4NPFX 1LTGC 2QJYC 3RK3D 1ZOYC 2WPVB 1RQVA 1M56D 3B71A 1BCCD 1QVGO 1JY3O 4O9BA 1ZRTE 3CXHI 2Z5HA 3MHVA 4XA4A 2ZVNB 4M3LA 4GDOA 1NOHA 2CPSA 3AEBC 2WSEJ 1SQXK 2B89A 1FZFA 2B87B 2WITA 1NU1G 3T97A 4UB8H 4WY4B 3OJAB 1NJIQ 3C8VA 2K1AA 3MIWA 3KDPB 4QMAA 3NMDA 3R4YA 2V7QJ 3BASA 1WRGA 3M06A 3SWYA 3L70D 4HB1A 3ABVC 1SVFA 4PJ0H 1HGZA 1N73B 1SQVE 1R5LA 3HTKB 1KTMA 4HH2A 1OXZA 1NO4A 3GHGB 4RO0A 1AJYA 1AQ5A 2QRXA 1FBMA 2HLOA 2QJPB 1VQMP 1LT1A 3CWBD 2H88C 4U3FD 2JR8A 1NTKG 1DH3A 1FZCA 3JCUH 1MKMA 4KHXA 2FYUD 1YTZI 1DIPA 3C9IA 1OZHA 2RMZA 4HKZH 1VF5B 2WPQA 3B5NA 3VMZA 4RJTA 1IFNA 5CCGD 1N7SB 2K3RA 4I7ZC 2BEZF 3AE6C 1EZVD 1GL2B 3L35A 1EXIA 2Q3EA 3PP5A 1FU1A 1LTJB 3I5CA 2OYIB 3CC7P 3B5NC 4L76A 2FY8A 3H32A 5M1BA 3NXSA 5AVYB 5BU8B 4ZMDA 1PP9J 2AEFA 3H1JJ 3L73D 3RK3E 5KLVJ 5KKZC 1L0NJ 3N7NA 1VQKP 5APUA 4GT1A 3L36A 1KFMA 2QA4P 3NFQA 1NU1D 2ZYDA 3NTNA 4YXWH 2IFNA 4TT3H 2L91A 2YKOA 4OGQD 4XE5B 1VQLP 1EDJA 3KYQA 1E79H 1KB9H 1PV3A 4TLFA 1UIXA 4GODA 1P84E 3RK2D 1LTBC 2IDBA 5AW8B 2P58A 1BDCA 1X0TA 2ITAA 4GOFA 2JP3A 1R8EA 1PP9E 3H1JE 3H1LJ 2O1KA 5KLVE 1SQQD 2Q7CA 2HR3A 1H8AA 1X9VA 1HWTC 2QM7A 4PV1D 5B5EE 4ZKPA 3B4SA 1FJPA 3TK1A 4IFMA 2QJKB 1NU1K 2FBWC 5AVRB 2KYVA 4BWNA 2QG4A 4PD4D 1BE3D 3MP7B 2BCCD 3QWOC 2R32A 2IBZE 3CCUP 5KAFH 1KQSO 1LP1A 2Q3IA 1EZVE 4GIFA 3O6QA 1BGYJ 5APXA 1MFTA 2Y0EA 2YMKA 2POHA 2E5YA 2ZT9C 2G3AA 1QGKB 3V6IA 5K5GB 1M90Q 1PGOA 3H1HD 3H1LE 3SWKA 3V2PA 4D6TD 1PPJG 3MUDC 2HPCB 4BRYB 1VPCA 1PZQA 1H88A 2P2UA 3M0DA 1NTKK 2KNCA 1J1EB 1K04A 3GG2A 3A0BH 1VQ9P 1Q82Q 2KI7B 4WY4A 3RL0D 3L75G 2WT7A 1JEKA 1NTZJ 1QVFO 1JMBA 3M0DC 1HJBA 2GUSA 1GZLA 2P7JA 1JY2N 1K8AQ 1VQPP 1DX7A 1BGYE 4WY4C 2E75D 3L74J 1N73A 2QIWA 4JYCA 4Z1MH 1J1DB 2KIKA 1Z56A 3RBXA 2E76B 1VQ8P 2A06E 2MJZA 1IC2A 2E74D 1VQ5P 4MN4C 1EZVI 1KORA 2PGDA 1N73C 2LR2A 2IX7C 1KILE 2KOGA 3Q1MA 3V4WA 3D6ZA 3E1RA 2QJPC 1Q86Q 3HD7A 3V2RA 1N7SA 1ZRTD 1L0LD 2PFXA 1BCCG 3V2QA 1Y8AA 2NPSD 3CI9A 1RQUA 1NKZB 2DW3A 2Q6QA 1SQPJ 1YQ3C 1LTJA 1VF5C 2OYIA 3G4SP 3H1KD 3L74E 2E42A 3E7KA 1T6AA 1QL2A 2I1KA 1N7SC 2WSCH 4L73A 5APSA 5AW3B 3MGNA 1GL2C 1YJ9P 2M5AA 4WB4A 1LTJC 3RK3B 3CLQA 1OFCX 2OYIC 2OTJP 1CI6B 1VQ6P 2J59M 1G2CB 1VQOP 4ZNCA 1UIIA 5AVXB 1SQVD 1M7LA 1OVRA 1GMJA 4N3YB 4RKUJ 1BSHA 2K9YA 3CCSP 4IFFA 1KQLA 1JTHB 2OARA 1PL5A 1KC8Q 4EIJA 3LW5H 1SQPE 1JY3P 3CWBG 1GD2E 5AW7B 4U3FG 1ZP0C 2XV5A 2RKLA 4PD4I 3CCLP 2O01H 5E79E 3IR9A 2FYUG 1IFDA 3EFFK 3H1IJ 3PRJA 1ZN5A 1W5CE 1YJWP 5AVSB 3W67A 2JKVA 2YKPA 1FS0E 4I2LC 4H13D 1SQBJ 3CMAP 3D70A 2R5DA 2E5TA 3CXHH 1Q81Q 1DD4A 1T2KD 2FYNB 1EZVG 3AE3C 1HUCA 2KLVA 4DOJA 1ZLLA 3JC22 2A45I 3GLMA 1GW3A 1YQ4C 4ZKUA 4PJ0E 3B8EB 3VYIA 3L73G 1OWAA 4EI2A 1L0LE 4WBAA 3M91A 5TISH 1SLQA 1IK7A 4R4MA 2IPPA 2QJKC 1OW6A 3Q5PA 1M8OB 4LGDE 2M0BA 3P32A 3BRVB 3I55P 3H1KE 1HH0A 2HFED 5CCHD 2BEQD 1M1KQ 3JCUE 5AW1B 1SQXJ 4EDFA 3H1IE 1J2JB 1MV8A 3M9QA 3AEDC 3HUSB 4GKGA 2HPCA 1EDKA 2R44A 3L71J 1S2EA 1P84D 2Q9IA 1Q2NA 1TU3F 3TGUJ 1SQBE 4AQRD 4A7PA 3AECC 2QM8A 1PP9D 1ZW0A 3H1JD 5KLVD 1L0ND 3VMAA 2HODB 3BRTB 1S72P 1J1EC 3EFGA 1URQA 1SQQG 1A02J 3S1KA 4OGQB 1ZR2A 3HE5B 1S4XA 2RN0A 1JO5A 1KYOH 1SFCB 1RHZB 3TSIA 1CW5A 2KP8A 3RK2B 1L4AD 2CPBA 2GA1A 2HYNA 1URQC 1SQXE 4U7JA 2JWAA 1JY2O 2ZAEB 2IBZD 3A5TA 2YMYA 3L71E 3TDKA 3VN0A 1BE3G 2BCCG 5DJTB 3BCCJ 5BVZA 3VMYA 1KB9E 1YYCA 3TGUE 1NWQA 1EQ7A 2WSFH 1PGJA 3K5BA 1N86A 2K9JB 3L72J 1J1DC 4PV1B 1H89A 2WTYA 1DEBA 2E76C 2XKMA 1OMIA 1EC5A 3H1LD 2A45G 1Q7YQ 5AVTB 1OIPA 3H1HG 5B66H 4D6TG 2MKVA 3II6A 1NKNA 3SSUA 3AE9C 4C46A 1ZXGA 2ZVOB 5KLIB 2Y0CA 2YNYA 4N78E 1T3JA 1S5LH 2C0XA 2FYUK 3A0HH 1IFMA 4OWFA 4C7RA 1HTLC 1NTMJ 4WWIA 4H0LD 3G9RA 1SFCD 1E5WA 2W6BA 3USSA 3BCCE 4CPGA 2UWJE 5KAFE 1BGYD 1IFPA 1JCDA 2G8YA 1GDTA 1M1JB 3L72E 1T2KC 2B88A 2D2CD 1USDA 1VL2A 5KJ7C 5APVA 3U59A 2WWWA 3L37A 1LTSC 3QH9A 3RK3C 1L0NE 1VQNP 1AVYA 3HD7D 2A06D 2O3JA 3FWNA 3RL0B 3PTZA 2N1TD 5AW6B 1KILD 3A7OA 2YO3A 1RH5B 1YHQP 5H2FH 2GUVA 1NHLA 4HYTB 1CZQA 1YIJP 1OW7A 3KZIE 3A0BE 3G3ZA 4I1LA 1FZAA 2KSJA 1NTZD 2E75B 1NTME 2WVRA 3PJSK 4H44D 1MZ9A 4N6JA 1W2EA 3CCVP 1L0LG 3MUDA 3RGUA 1LWUB 2R3SA 5APQA 2C9LY 2W27A 2P10A 3L74D 1FAVA 2E74B 1FDOA 3H1KG 2ZYAA 2K37A 3AEFC 1VQ7P 2ZXXA 3FXEA 1KN7A 4L75A 1SQQK 2P1JA 3AE1C 2WSCJ 2H8PD 3AE4C 2OTKE 1P84I 1DD3A 3CD6P 1YI2P 2V4HA 2FYNC 1JM0A 2AXTH 1KMIZ 3G71P 5CCGA 1RY3A 2NZ2A 1U57A 2B87A 4UB6H 3HRNA 2NPSB 2H89C 1NTKJ 1KV4A 1SQVG 3HUSA 1LGHB 3CCMP 2WPSA 1JNMA 1AV1A 5CJ4A 3VP8A 3GF7A 2IZ0A 5APYA 5CCGC 3E1IA 2PP6A 4KT0J 1H0TB 1EDLA 2M3EA 3F89A 1PGPA 1SQPD 1RE4A 1FE6A 3HTKA 3LW5J 1KQFB 3HUSC 3CX5E 3GW6A 2I8DA 2ZFCA 3GHGA 3CL3D 4I6MC 1IZNB 2IBZI 2O01J 2KS1B 2Z5IA 4HJGH 1FZCB 3UIAA 1IFJA 1RE4C 2QVAA 1L2PA 2BASA 1X22A 1QX8A 5AVUB 3GHGC 3U1AA 4YPCA 3BATA 1NTKE 4IL6H 2H43A 3VOPA 2OQQA 4OGQC 1NTZE 1FOSE 1SS1A 3VTPC 5GTIH 1GL2A 3H32B 2WQYC 3RK2C 1MUUA 2K9JA 1PFIA 5CJ0A 3CC4P 1S9KE 3WUVA 4OVNF 2PAJA 4H13B 3BVHA 1Q90D 3H1ID 4B86A 2YXRB 2WSSH 3AEEC 1NVOA 5CBOA 1SQBD 4PV1C 2IYPA 2KK7A 3ITKA 1QEXA 3CX5I 1BDDA 3O8ZA 3CXHE 1GK4A 5AVQB 1PP9G 3B5ND 4PD4H 3H1JG 5KLVG 1L0NG 4KJMA 1L0LK 5KLIC 4LLHA 4W80A 1N2DC 5TISE 2QE7H 1M1JA 1X79B 1HBWA 4K35A 1ZV8A 1MFZA 3AE8C 1SQXD 2OTLP 2A45H 3M9BA 4JQ0D 1K73Q 1KQGB 3L71D 4JF7A 4UB8E 1FDIA 1AVOA 2RH0A 1BSNA 1NTMG 1N8RQ 2IBZG 1EXJA 1M1JC 2C0WA 1AFOA 1AQTA 1KB9D 1RF1B 3TGUD 3WU2H 1GTWA 5KAIH 1SQVK 3FXDA 2WSFJ 3RL0g 1LP1B 3RL0C 3RBZA 1HGVA 3H1LG 1FZGA
chains in the Genus database with same CATH topology
3WU2E 3A0HE 5E79E 5KAIE 5GTHE 2AXTE 5B66E 5GTIE 3KZIE 1W5CE 3A0BE 5KAFE 4UB6E 5B5EE 4UB8E 4IL6E 4PJ0E 5H2FE 5TISE 3JCUE 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 E;  3A0H E;  5E79 E;  5KAI E;  5GTH E;  2AXT E;  5B66 E;  5GTI E;  3KZI E;  1W5C E;  3A0B E;  5KAF E;  4UB6 E;  5B5E E;  4UB8 E;  4IL6 E;  4PJ0 E;  5H2F E;  5TIS E;  3JCU E;  1S5L E; 
#chains in the Genus database with same CATH topology
 3MZW B;  3L75 J;  2W83 C;  2JJL A;  1OVV A;  3HE4 B;  1LWU A;  3ZDM A;  1LTA C;  2L5G B;  2YIU B;  1IK9 A;  1KFN A;  4N78 D;  3AEG C;  1PGQ A;  1XTG B;  2KLU A;  2AEM A;  2E75 C;  3P8C E;  1KYO E;  1NYH A;  2KNC B;  1JMM A;  2Y0D A;  4BRY A;  1LWU C;  5E79 H;  1LT9 B;  4YTP C;  3TNU B;  3BCC D;  5AVZ B;  4C7N B;  3AE2 C;  2E74 C;  2C9N Y;  1PPJ E;  1G1I A;  1JY2 P;  2WT7 B;  1L4A B;  3Q3D A;  3IF4 A;  3L72 D;  1ZR4 A;  2NPS A;  1BGY G;  3MTU E;  1RF0 A;  5GTH H;  4IOI H;  2ZT9 D;  4YXD C;  2YO2 A;  3WMM 0;  3L75 E;  1H0T A;  2J5U A;  2NRG A;  2A06 G;  5B66 E;  2NPS C;  4H0L B;  1BCC J;  4AYC A;  1RF0 C;  1Y47 A;  2FKW B;  2KXP B;  5CBN A;  1YTZ T;  4ASW A;  3PH0 A;  4DJG A;  1S3J A;  3PHL A;  3CCE P;  2OYO A;  2R5B A;  5DJU B;  1S5L E;  3GF3 A;  1NTM D;  2KS1 A;  3A0H E;  4K3A A;  2D2C B;  1NTZ G;  3L4F A;  3JSV C;  3PLN A;  1OW8 A;  1EDI A;  3VMX A;  5CMZ A;  5AW4 B;  2ZJS E;  3FWL A;  2J58 A;  3HD7 B;  1GU5 A;  1IFI A;  1KYO I;  2N1T B;  2M3B A;  1FZC C;  1VQ4 P;  1KIL B;  3L74 G;  2WZ7 A;  4WY4 D;  5KLV K;  1L0N K;  4JPZ B;  4EYY Q;  3L70 J;  2FFD B;  3TF5 A;  1IO4 A;  2H7H A;  3SFD C;  5CHX A;  4GOE A;  1YIT P;  2HG5 D;  1BCC E;  4H44 B;  2WSE H;  1ZME C;  2YXQ B;  2Q5U A;  2M5A B;  3CWB J;  2OYH B;  5H2F E;  1K05 A;  1FDM A;  4U3F J;  5AW2 B;  4EOT A;  5KJ7 A;  2W6J H;  3C1L A;  1SP4 A;  1NTM K;  2FYU J;  3CCJ P;  3CCR P;  4NPE A;  2IFM A;  4AUW A;  1CI6 A;  3OAK A;  4H13 C;  3FGA D;  1G2C A;  1T8Z A;  3H25 A;  1W2B O;  3V5B A;  1OVU A;  2V7Q H;  1SQP G;  3CX5 D;  4Y99 B;  1YBK A;  1VF5 D;  3M0A A;  5CCH A;  3L70 E;  1X8Y A;  1WT6 A;  2OGU A;  1N7S D;  1JTH A;  3OW2 O;  1FZE A;  3KXD A;  5EFW B;  1M57 D;  1N7L A;  2I1J A;  1KB9 I;  3L73 J;  2XU6 A;  2QSI A;  2W8Z A;  1U7M A;  4R4L A;  1GL2 D;  2O01 N;  2AXT E;  2QJY B;  2YKQ A;  1JY3 N;  1NTK D;  3CWB E;  4UB6 E;  5CCH C;  3G6E P;  4U3F E;  1Y9B A;  1NU1 J;  1VDF A;  1R5S A;  5AVV B;  3KPE A;  1USE A;  2JWD A;  3AEA C;  2FYU E;  1YJN P;  1RF1 A;  1P84 H;  3MD0 A;  2IYO A;  4XFJ A;  2Q1K A;  3S9O A;  1S9K D;  2JO1 A;  5TJH A;  2E43 A;  2XNX A;  1A02 F;  3IAO A;  1S5L X;  3A2A A;  1GK6 A;  3Q5S A;  1HVV A;  1LNQ A;  3P8M C;  4DT0 A;  1L4A A;  3H1I G;  5AW9 B;  1RF1 C;  2KSE A;  2R3C A;  3V2N A;  2KZI A;  2ZXE B;  3HE4 A;  1GW4 A;  3F5H A;  4JBZ A;  2LKM A;  2CK3 H;  5APW A;  3EWK A;  3L73 E;  3T97 B;  2N9Y B;  1SQQ J;  2M8R A;  2B9B A;  1HJ0 A;  5B5E H;  2FXM A;  1SQB G;  3SFE C;  3CXH D;  3LIE A;  3WUT A;  3Q2Y A;  1L4A C;  3SWF A;  2KB7 P;  5L8R J;  4W7Y A;  2W90 A;  4DZO A;  5AW5 B;  2GM4 A;  5AW0 B;  1LT9 A;  1QL1 A;  1NU1 E;  3KZI H;  3R2P A;  1NTZ K;  2YIU C;  4IL6 E;  2JDI H;  2LXC B;  3TNU A;  4NPD A;  4C7N A;  5C39 A;  3IN6 A;  1NH4 A;  1BE3 J;  2BCC J;  1JUN A;  5GTI E;  1XTC C;  2XZR A;  1HF9 A;  1D7M A;  2O1J A;  2K88 A;  1KD1 Q;  1AA0 A;  1URQ B;  4BXL A;  1LT9 C;  1U7J A;  4RES B;  1GU4 A;  2HOD A;  2QEX P;  5AVW B;  4I7Z B;  1SQX G;  2AEJ A;  2Z4E A;  2W6A A;  3CC2 P;  1NAY A;  3HE5 A;  1JCC A;  2XDJ A;  3L71 G;  3KHU A;  2WMM A;  3H1H J;  1SFC A;  4IFD K;  3H6P A;  2PRR A;  2N9B A;  3B5N B;  1SQQ E;  1FZB A;  4D6T J;  3KQG A;  4WVZ A;  3TGU G;  2Y9Y A;  3TYY A;  5KKZ B;  1LJ2 A;  4H0L C;  1SFC C;  3WUU A;  2WPR A;  2JEE A;  1WMK A;  4PD4 E;  3AE7 C;  1RE3 A;  1CSB A;  1S1C X;  3P7K A;  3CPW O;  1SQP K;  1BE3 E;  2BCC E;  3N4X A;  2P67 A;  2N1T A;  3P8C D;  1KYO D;  1KIL A;  2D2C C;  1LTT C;  3I56 P;  2VRS A;  3CX5 H;  2ZYG A;  2FFD A;  1IJD B;  1LTI C;  5BU5 A;  1RE3 C;  1T3U A;  3HD7 C;  1URQ D;  1PPJ D;  3U1C A;  2N1T C;  3H1H E;  1DEE G;  4LC1 A;  2XND H;  1KIL C;  3BCC G;  4ASV A;  4OH8 B;  4D6T E;  2FYZ A;  3CME P;  2OYH A;  2KUB A;  2FFD C;  3L72 G;  3WU2 E;  5KAI E;  1G1J A;  1NGM B;  1NAF A;  4L74 A;  2FXP A;  1OX3 A;  3L75 D;  3VP9 A;  4H44 C;  2E76 D;  3L70 G;  3AE5 C;  3V4Q A;  1PIX A;  2OYH C;  4W7Z A;  3W68 A;  1L0L J;  2Y9Z A;  1FJK A;  3D71 A;  3LID A;  3OA7 A;  1FC2 C;  3A3Y B;  4IL6 X;  4DCK A;  3Q5R A;  1JOC A;  2SPZ A;  3H1K J;  4Y28 J;  3GMA A;  2LXB A;  1JB0 J;  1QLE D;  2ZT9 B;  1SQB K;  2FXO A;  4Y99 C;  1K9M Q;  1KZU B;  3EQ2 A;  4JYB A;  5KTB A;  1FOS F;  2IZ1 A;  3S4R A;  3M9H A;  5APT A;  3IFM A;  3O6Q B;  3FX0 A;  3D6Y A;  5GTH E;  5KJ7 D;  2KZJ A;  1SQV J;  2AXC A;  3CCQ P;  4NPF X;  1LTG C;  2QJY C;  3RK3 D;  1ZOY C;  2WPV B;  1RQV A;  1M56 D;  3B71 A;  1BCC D;  1QVG O;  1JY3 O;  4O9B A;  1ZRT E;  3CXH I;  2Z5H A;  3MHV A;  4XA4 A;  2ZVN B;  4M3L A;  4GDO A;  1NOH A;  2CPS A;  3AEB C;  2WSE J;  1SQX K;  2B89 A;  1FZF A;  2B87 B;  2WIT A;  1NU1 G;  3T97 A;  4UB8 H;  4WY4 B;  3OJA B;  1NJI Q;  3C8V A;  2K1A A;  3MIW A;  3KDP B;  4QMA A;  3NMD A;  3R4Y A;  2V7Q J;  3BAS A;  1WRG A;  3M06 A;  3SWY A;  3L70 D;  4HB1 A;  3ABV C;  1SVF A;  4PJ0 H;  1HGZ A;  1N73 B;  1SQV E;  1R5L A;  3HTK B;  1KTM A;  4HH2 A;  1OXZ A;  1NO4 A;  3GHG B;  4RO0 A;  1AJY A;  1AQ5 A;  2QRX A;  1FBM A;  2HLO A;  2QJP B;  1VQM P;  1LT1 A;  3CWB D;  2H88 C;  4U3F D;  2JR8 A;  1NTK G;  1DH3 A;  1FZC A;  3JCU H;  1MKM A;  4KHX A;  2FYU D;  1YTZ I;  1DIP A;  3C9I A;  1OZH A;  2RMZ A;  4HKZ H;  1VF5 B;  2WPQ A;  3B5N A;  3VMZ A;  4RJT A;  1IFN A;  5CCG D;  1N7S B;  2K3R A;  4I7Z C;  2BEZ F;  3AE6 C;  1EZV D;  1GL2 B;  3L35 A;  1EXI A;  2Q3E A;  3PP5 A;  1FU1 A;  1LTJ B;  3I5C A;  2OYI B;  3CC7 P;  3B5N C;  4L76 A;  2FY8 A;  3H32 A;  5M1B A;  3NXS A;  5AVY B;  5BU8 B;  4ZMD A;  1PP9 J;  2AEF A;  3H1J J;  3L73 D;  3RK3 E;  5KLV J;  5KKZ C;  1L0N J;  3N7N A;  1VQK P;  5APU A;  4GT1 A;  3L36 A;  1KFM A;  2QA4 P;  3NFQ A;  1NU1 D;  2ZYD A;  3NTN A;  4YXW H;  2IFN A;  4TT3 H;  2L91 A;  2YKO A;  4OGQ D;  4XE5 B;  1VQL P;  1EDJ A;  3KYQ A;  1E79 H;  1KB9 H;  1PV3 A;  4TLF A;  1UIX A;  4GOD A;  1P84 E;  3RK2 D;  1LTB C;  2IDB A;  5AW8 B;  2P58 A;  1BDC A;  1X0T A;  2ITA A;  4GOF A;  2JP3 A;  1R8E A;  1PP9 E;  3H1J E;  3H1L J;  2O1K A;  5KLV E;  1SQQ D;  2Q7C A;  2HR3 A;  1H8A A;  1X9V A;  1HWT C;  2QM7 A;  4PV1 D;  5B5E E;  4ZKP A;  3B4S A;  1FJP A;  3TK1 A;  4IFM A;  2QJK B;  1NU1 K;  2FBW C;  5AVR B;  2KYV A;  4BWN A;  2QG4 A;  4PD4 D;  1BE3 D;  3MP7 B;  2BCC D;  3QWO C;  2R32 A;  2IBZ E;  3CCU P;  5KAF H;  1KQS O;  1LP1 A;  2Q3I A;  1EZV E;  4GIF A;  3O6Q A;  1BGY J;  5APX A;  1MFT A;  2Y0E A;  2YMK A;  2POH A;  2E5Y A;  2ZT9 C;  2G3A A;  1QGK B;  3V6I A;  5K5G B;  1M90 Q;  1PGO A;  3H1H D;  3H1L E;  3SWK A;  3V2P A;  4D6T D;  1PPJ G;  3MUD C;  2HPC B;  4BRY B;  1VPC A;  1PZQ A;  1H88 A;  2P2U A;  3M0D A;  1NTK K;  2KNC A;  1J1E B;  1K04 A;  3GG2 A;  3A0B H;  1VQ9 P;  1Q82 Q;  2KI7 B;  4WY4 A;  3RL0 D;  3L75 G;  2WT7 A;  1JEK A;  1NTZ J;  1QVF O;  1JMB A;  3M0D C;  1HJB A;  2GUS A;  1GZL A;  2P7J A;  1JY2 N;  1K8A Q;  1VQP P;  1DX7 A;  1BGY E;  4WY4 C;  2E75 D;  3L74 J;  1N73 A;  2QIW A;  4JYC A;  4Z1M H;  1J1D B;  2KIK A;  1Z56 A;  3RBX A;  2E76 B;  1VQ8 P;  2A06 E;  2MJZ A;  1IC2 A;  2E74 D;  1VQ5 P;  4MN4 C;  1EZV I;  1KOR A;  2PGD A;  1N73 C;  2LR2 A;  2IX7 C;  1KIL E;  2KOG A;  3Q1M A;  3V4W A;  3D6Z A;  3E1R A;  2QJP C;  1Q86 Q;  3HD7 A;  3V2R A;  1N7S A;  1ZRT D;  1L0L D;  2PFX A;  1BCC G;  3V2Q A;  1Y8A A;  2NPS D;  3CI9 A;  1RQU A;  1NKZ B;  2DW3 A;  2Q6Q A;  1SQP J;  1YQ3 C;  1LTJ A;  1VF5 C;  2OYI A;  3G4S P;  3H1K D;  3L74 E;  2E42 A;  3E7K A;  1T6A A;  1QL2 A;  2I1K A;  1N7S C;  2WSC H;  4L73 A;  5APS A;  5AW3 B;  3MGN A;  1GL2 C;  1YJ9 P;  2M5A A;  4WB4 A;  1LTJ C;  3RK3 B;  3CLQ A;  1OFC X;  2OYI C;  2OTJ P;  1CI6 B;  1VQ6 P;  2J59 M;  1G2C B;  1VQO P;  4ZNC A;  1UII A;  5AVX B;  1SQV D;  1M7L A;  1OVR A;  1GMJ A;  4N3Y B;  4RKU J;  1BSH A;  2K9Y A;  3CCS P;  4IFF A;  1KQL A;  1JTH B;  2OAR A;  1PL5 A;  1KC8 Q;  4EIJ A;  3LW5 H;  1SQP E;  1JY3 P;  3CWB G;  1GD2 E;  5AW7 B;  4U3F G;  1ZP0 C;  2XV5 A;  2RKL A;  4PD4 I;  3CCL P;  2O01 H;  5E79 E;  3IR9 A;  2FYU G;  1IFD A;  3EFF K;  3H1I J;  3PRJ A;  1ZN5 A;  1W5C E;  1YJW P;  5AVS B;  3W67 A;  2JKV A;  2YKP A;  1FS0 E;  4I2L C;  4H13 D;  1SQB J;  3CMA P;  3D70 A;  2R5D A;  2E5T A;  3CXH H;  1Q81 Q;  1DD4 A;  1T2K D;  2FYN B;  1EZV G;  3AE3 C;  1HUC A;  2KLV A;  4DOJ A;  1ZLL A;  3JC2 2;  2A45 I;  3GLM A;  1GW3 A;  1YQ4 C;  4ZKU A;  4PJ0 E;  3B8E B;  3VYI A;  3L73 G;  1OWA A;  4EI2 A;  1L0L E;  4WBA A;  3M91 A;  5TIS H;  1SLQ A;  1IK7 A;  4R4M A;  2IPP A;  2QJK C;  1OW6 A;  3Q5P A;  1M8O B;  4LGD E;  2M0B A;  3P32 A;  3BRV B;  3I55 P;  3H1K E;  1HH0 A;  2HFE D;  5CCH D;  2BEQ D;  1M1K Q;  3JCU E;  5AW1 B;  1SQX J;  4EDF A;  3H1I E;  1J2J B;  1MV8 A;  3M9Q A;  3AED C;  3HUS B;  4GKG A;  2HPC A;  1EDK A;  2R44 A;  3L71 J;  1S2E A;  1P84 D;  2Q9I A;  1Q2N A;  1TU3 F;  3TGU J;  1SQB E;  4AQR D;  4A7P A;  3AEC C;  2QM8 A;  1PP9 D;  1ZW0 A;  3H1J D;  5KLV D;  1L0N D;  3VMA A;  2HOD B;  3BRT B;  1S72 P;  1J1E C;  3EFG A;  1URQ A;  1SQQ G;  1A02 J;  3S1K A;  4OGQ B;  1ZR2 A;  3HE5 B;  1S4X A;  2RN0 A;  1JO5 A;  1KYO H;  1SFC B;  1RHZ B;  3TSI A;  1CW5 A;  2KP8 A;  3RK2 B;  1L4A D;  2CPB A;  2GA1 A;  2HYN A;  1URQ C;  1SQX E;  4U7J A;  2JWA A;  1JY2 O;  2ZAE B;  2IBZ D;  3A5T A;  2YMY A;  3L71 E;  3TDK A;  3VN0 A;  1BE3 G;  2BCC G;  5DJT B;  3BCC J;  5BVZ A;  3VMY A;  1KB9 E;  1YYC A;  3TGU E;  1NWQ A;  1EQ7 A;  2WSF H;  1PGJ A;  3K5B A;  1N86 A;  2K9J B;  3L72 J;  1J1D C;  4PV1 B;  1H89 A;  2WTY A;  1DEB A;  2E76 C;  2XKM A;  1OMI A;  1EC5 A;  3H1L D;  2A45 G;  1Q7Y Q;  5AVT B;  1OIP A;  3H1H G;  5B66 H;  4D6T G;  2MKV A;  3II6 A;  1NKN A;  3SSU A;  3AE9 C;  4C46 A;  1ZXG A;  2ZVO B;  5KLI B;  2Y0C A;  2YNY A;  4N78 E;  1T3J A;  1S5L H;  2C0X A;  2FYU K;  3A0H H;  1IFM A;  4OWF A;  4C7R A;  1HTL C;  1NTM J;  4WWI A;  4H0L D;  3G9R A;  1SFC D;  1E5W A;  2W6B A;  3USS A;  3BCC E;  4CPG A;  2UWJ E;  5KAF E;  1BGY D;  1IFP A;  1JCD A;  2G8Y A;  1GDT A;  1M1J B;  3L72 E;  1T2K C;  2B88 A;  2D2C D;  1USD A;  1VL2 A;  5KJ7 C;  5APV A;  3U59 A;  2WWW A;  3L37 A;  1LTS C;  3QH9 A;  3RK3 C;  1L0N E;  1VQN P;  1AVY A;  3HD7 D;  2A06 D;  2O3J A;  3FWN A;  3RL0 B;  3PTZ A;  2N1T D;  5AW6 B;  1KIL D;  3A7O A;  2YO3 A;  1RH5 B;  1YHQ P;  5H2F H;  2GUV A;  1NHL A;  4HYT B;  1CZQ A;  1YIJ P;  1OW7 A;  3KZI E;  3A0B E;  3G3Z A;  4I1L A;  1FZA A;  2KSJ A;  1NTZ D;  2E75 B;  1NTM E;  2WVR A;  3PJS K;  4H44 D;  1MZ9 A;  4N6J A;  1W2E A;  3CCV P;  1L0L G;  3MUD A;  3RGU A;  1LWU B;  2R3S A;  5APQ A;  2C9L Y;  2W27 A;  2P10 A;  3L74 D;  1FAV A;  2E74 B;  1FDO A;  3H1K G;  2ZYA A;  2K37 A;  3AEF C;  1VQ7 P;  2ZXX A;  3FXE A;  1KN7 A;  4L75 A;  1SQQ K;  2P1J A;  3AE1 C;  2WSC J;  2H8P D;  3AE4 C;  2OTK E;  1P84 I;  1DD3 A;  3CD6 P;  1YI2 P;  2V4H A;  2FYN C;  1JM0 A;  2AXT H;  1KMI Z;  3G71 P;  5CCG A;  1RY3 A;  2NZ2 A;  1U57 A;  2B87 A;  4UB6 H;  3HRN A;  2NPS B;  2H89 C;  1NTK J;  1KV4 A;  1SQV G;  3HUS A;  1LGH B;  3CCM P;  2WPS A;  1JNM A;  1AV1 A;  5CJ4 A;  3VP8 A;  3GF7 A;  2IZ0 A;  5APY A;  5CCG C;  3E1I A;  2PP6 A;  4KT0 J;  1H0T B;  1EDL A;  2M3E A;  3F89 A;  1PGP A;  1SQP D;  1RE4 A;  1FE6 A;  3HTK A;  3LW5 J;  1KQF B;  3HUS C;  3CX5 E;  3GW6 A;  2I8D A;  2ZFC A;  3GHG A;  3CL3 D;  4I6M C;  1IZN B;  2IBZ I;  2O01 J;  2KS1 B;  2Z5I A;  4HJG H;  1FZC B;  3UIA A;  1IFJ A;  1RE4 C;  2QVA A;  1L2P A;  2BAS A;  1X22 A;  1QX8 A;  5AVU B;  3GHG C;  3U1A A;  4YPC A;  3BAT A;  1NTK E;  4IL6 H;  2H43 A;  3VOP A;  2OQQ A;  4OGQ C;  1NTZ E;  1FOS E;  1SS1 A;  3VTP C;  5GTI H;  1GL2 A;  3H32 B;  2WQY C;  3RK2 C;  1MUU A;  2K9J A;  1PFI A;  5CJ0 A;  3CC4 P;  1S9K E;  3WUV A;  4OVN F;  2PAJ A;  4H13 B;  3BVH A;  1Q90 D;  3H1I D;  4B86 A;  2YXR B;  2WSS H;  3AEE C;  1NVO A;  5CBO A;  1SQB D;  4PV1 C;  2IYP A;  2KK7 A;  3ITK A;  1QEX A;  3CX5 I;  1BDD A;  3O8Z A;  3CXH E;  1GK4 A;  5AVQ B;  1PP9 G;  3B5N D;  4PD4 H;  3H1J G;  5KLV G;  1L0N G;  4KJM A;  1L0L K;  5KLI C;  4LLH A;  4W80 A;  1N2D C;  5TIS E;  2QE7 H;  1M1J A;  1X79 B;  1HBW A;  4K35 A;  1ZV8 A;  1MFZ A;  3AE8 C;  1SQX D;  2OTL P;  2A45 H;  3M9B A;  4JQ0 D;  1K73 Q;  1KQG B;  3L71 D;  4JF7 A;  4UB8 E;  1FDI A;  1AVO A;  2RH0 A;  1BSN A;  1NTM G;  1N8R Q;  2IBZ G;  1EXJ A;  1M1J C;  2C0W A;  1AFO A;  1AQT A;  1KB9 D;  1RF1 B;  3TGU D;  3WU2 H;  1GTW A;  5KAI H;  1SQV K;  3FXD A;  2WSF J;  3RL0 g;  1LP1 B;  3RL0 C;  3RBZ A;  1HGV A;  3H1L G;  1FZG A; 
#chains in the Genus database with same CATH homology
 3WU2 E;  3A0H E;  5E79 E;  5KAI E;  5GTH E;  2AXT E;  5B66 E;  5GTI E;  3KZI E;  1W5C E;  3A0B E;  5KAF E;  4UB6 E;  5B5E E;  4UB8 E;  4IL6 E;  4PJ0 E;  5H2F E;  5TIS E;  3JCU E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...