4IOIH

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
53
structure length
53
Chain Sequence
SYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4ioiH00
1U7MA 2Q1KA 1SS1A 5C39A 2B88A 4EYYQ 2B87B 1Y47A 1DEEG 4IOIH 1OVVA 3S1KA 4WWIA 3ZDMA 1ZW0A 3FXDA 4GOFA 2WMMA 1JM0A 2M5AA 2R44A 4K3AA 2LR2A 1LT1A 2B87A 4ZMDA 2M5AB 4NPEA 2B89A 4ZNCA 4ASWA 1U7JA 4K35A 4NPDA 2ZAEB 2M0BA 1OVUA 2LXBA 1EDKA 4HKZH 2KI7B 1H0TB 2OTKE 4CPGA 4NPFX 4JBZA 1BDDA 5CBOA 1NVOA 1BDCA 1Q2NA 2SPZA 4HJGH 4MN4C 4HB1A 1EDJA 2UWJE 1H0TA 4BXLA 2KIKA 2LXCB 5DJUB 2KUBA 2RKLA 2P58A 3MHVA 2HR3A 4ASVA 3QWOC 2KZJA 2I8DA 2KS1B 1JMBA 2QVAA 1OVRA 3FXEA 4KJMA 5K5GB 1X0TA 5CBNA 2QRXA 1EDLA 1EC5A 1S3JA 3PH0A 4GOEA 1ZXGA 2K3RA 1FC2C 5EFWB 1LP1A 1MFTA 1EDIA 2KZIA 3RGUA 3MZWB 4GODA 5DJTB 2JWDA 1LP1B
chains in the Genus database with same CATH superfamily
3UIAA 1NAYA 3CWBD 3S1KA 3CPWO 2FFDB 1J1EB 1JTHB 1L0NK 1LWUC 1PPJD 1YIJP 3CCQP 3CI9A 4HYTB 1SQQD 1JY2N 1JTHA 4H0LB 1IFPA 1N7SC 4IL6H 3L71D 1SQXG 3H1IE 3RK3D 3L70E 2IYOA 4PV1B 1QL2A 1SQXD 3AE1C 2XKMA 2UWJE 5AW8B 2HPCA 2A45I 1FS0E 1BCCE 3TF5A 3IFMA 3AE7C 1P84H 5AVYB 1X0TA 5CBNA 1FOSF 1EDLA 3SWKA 1S3JA 3TGUE 2E76C 1P84I 2BCCJ 1LT9C 3VMYA 3GLMA 1MFTA 4GT1A 5AVSB 5TISH 3H1KE 4YXWH 3L72E 3OW2O 3C8VA 4H0LD 3ITKA 3Q2YA 3T97B 2OYHB 2E74B 3M0AA 3AEBC 4PV1D 1RF1B 5CJ0A 1RF0C 2R32A 1FDOA 1NO4A 4JYCA 1YJNP 1FZCC 1VF5C 1S1CX 1VQKP 3T97A 4BWNA 3WUTA 2H43A 2OYHA 4H13B 2QIWA 3L36A 1RF1A 1MZ9A 3CMAP 4NPEA 2WT7B 3H1JG 3RL0B 1Q81Q 2E5YA 3M9HA 5CCHC 4NPDA 2D2CB 1Q7YQ 1NTZK 2W6AA 3H1JD 2GUSA 2YKQA 5CMZA 2QM8A 1PL5A 5AW1B 3RBZA 3CCUP 2OYIC 2C0WA 2Q3IA 1HBWA 2WT7A 1Q2NA 2WPSA 2SPZA 4HJGH 1ZR2A 5L8RJ 3L74D 2NPSB 1EDJA 2N1TC 1SQBG 2E74D 4I7ZC 2LXCB 1AV1A 1BGYE 1RHZB 3A7OA 3CC4P 4W7ZA 3HUSA 1SQBD 2M8RA 2QVAA 2NPSA 5K5GB 3L37A 3D6ZA 1PP9J 3U1AA 3AE6C 1DD4A 4H13D 2IBZI 1GD2E 2Q9IA 4JYBA 1FC2C 2YO2A 3TDKA 2RMZA 1LJ2A 3CCSP 3PRJA 2D2CD 4AQRD 5APUA 3W68A 2IYPA 1RQUA 1U7MA 4IL6E 2HYNA 3WUUA 5KJ7A 5KLVE 1J2JB 3H1LG 1HJ0A 5BU5A 1TU3F 5CHXA 3CL3D 3H1LD 1M1JB 3L35A 3JSVC 1GW4A 3FX0A 1P84E 1SFCD 2MJZA 2Y0CA 5APSA 2YIUC 1L0NG 3B5NA 3G6EP 1L0LK 2G3AA 1MKMA 1M56D 5TISE 2W27A 1IFDA 2WPVB 3PJSK 1AFOA 1VQ6P 2WWWA 3CX5D 3CXHH 1X22A 4HB1A 3A2AA 5AVWB 3CXHI 1LWUB 2HR3A 1JB0J 1A02J 2QJPB 3EQ2A 2HFED 1JY3N 3Q5RA 1VQ7P 2P7JA 1W2BO 2JDIH 1KORA 2P2UA 3KHUA 2Q6QA 1NU1J 2KZIA 3BASA 1SQVJ 2C9LY 4JF7A 4W7YA 5DJTB 2IX7C 3LW5H 3AEFC 2GA1A 1GU5A 3BVHA 3TNUB 3AEDC 2FFDC 2O1JA 3I55P 1J1EC 1YTZT 1OVVA 1N2DC 3ZDMA 1W5CE 1ZV8A 4XA4A 3Q5SA 3BCCG 2QM7A 4TT3H 4OGQC 3KZIH 2IBZE 2M5AB 4H0LC 1BE3E 2K9JB 2L5GB 3WUVA 3BCCD 2JEEA 2OYOA 4XE5B 1N7SD 4L73A 4PV1C 2M0BA 1MUUA 2JWAA 1DIPA 2E43A 4OWFA 1H0TB 4OVNF 1EQ7A 2BCCE 5CBOA 4XFJA 3BRVB 3K5BA 1VF5B 1NTZD 1H0TA 1HF9A 1L2PA 2KSJA 2O1KA 1LTAC 1HVVA 2I8DA 1JMBA 5E79H 3H1HJ 2OTLP 1FAVA 4DCKA 2E76D 2FXMA 1FJPA 1IFMA 1PZQA 5AW9B 2IFNA 1QEXA 2J58A 1PGJA 3D71A 1EDIA 3RGUA 2OYHC 2E74C 1GW3A 1RF1C 2C9NY 3OAKA 1S5LH 1SS1A 2FYUE 3F5HA 2WZ7A 3VMXA 5H2FH 2KB7P 1EZVI 2QSIA 2FKWB 3CXHE 2QEXP 1BCCG 4H13C 1VF5D 3D70A 3P32A 5AW7B 3RL0C 1BCCD 2R44A 4IL6X 3AE9C 4D6TJ 2D2CC 4C7NB 1RQVA 4DZOA 1MV8A 1R5LA 3TGUG 1SQPE 1KV4A 5CCHD 2ZVNB 1U7JA 3TGUD 3HUSC 2R5BA 3H1KG 1PP9E 2Y0DA 4A7PA 3L72G 4EIJA 1CW5A 2XV5A 4C7NA 2NPSC 1YBKA 1S9KD 2CPSA 3HTKB 4WB4A 2AXTH 2VRSA 3SWYA 2N1TD 1L0LG 3CWBJ 4YXDC 4PD4I 2KIKA 2XNXA 1L0LD 2KUBA 3HTKA 1OXZA 5KJ7C 1KB9D 1HWTC 2HODB 3VN0A 2HLOA 3KZIE 3CMEP 5EFWB 1DX7A 2QG4A 3EFFK 1WMKA 3RK2B 1SP4A 1VDFA 4D6TD 1SQQJ 2HODA 1CSBA 2V7QJ 2Z4EA 2PP6A 3E1IA 3B5NC 4GDOA 4W80A 1FBMA 1SQXJ 3H25A 1JO5A 2J59M 4GOFA 3L75E 2LR2A 2ZT9B 3CCRP 4ZMDA 5E79E 1W2EA 2FYUK 4ZNCA 3R2PA 2ZAEB 4N6JA 4U3FE 1BSNA 2WPQA 4JBZA 1NVOA 1NU1E 1S5LE 1SQVE 3OA7A 3IAOA 1ZRTD 2W6JH 3CCEP 5H2FE 2QJPC 1AQ5A 1SQPK 4OGQB 3P7KA 2R5DA 1K73Q 3GHGB 2HPCB 2FXOA 2K88A 2KS1B 4AUWA 2M3BA 1X8YA 3WMM0 2AEJA 4DOJA 2A45H 3AE3C 2PRRA 2ZT9D 3MD0A 3B8EB 1KQGB 2ZFCA 3GHGA 1NTME 1ZN5A 3EWKA 2KS1A 3SFDC 1KYOD 3B4SA 1OW7A 3H1JJ 1KN7A 1XTCC 1OIPA 5C39A 3CD6P 1PGPA 2AXTE 1Y47A 1DEEG 1T3UA 4EDFA 4PD4E 3VOPA 3L74J 4JQ0D 1VL2A 3V4WA 4O9BA 3FXDA 5APWA 4OGQD 1IK9A 1OX3A 2QJYB 1KFMA 2FYNC 1MFZA 1SQBJ 5APTA 3V6IA 1JCCA 3H1HE 1URQB 1NTKK 2H89C 3TYYA 3MP7B 3AE5C 1CI6B 1GL2B 3FWLA 3SWFA 1OW6A 2O01N 1HH0A 1URQA 2OARA 1S2EA 1YYCA 1CI6A 1GL2A 4ASVA 1RY3A 3FWNA 1BE3G 4KJMA 3FXEA 3HUSB 3H1LJ 3BRTB 3LIDA 1VQ9P 1N7LA 2QE7H 4WY4B 2A06G 1BE3D 5AW2B 3L73G 1M7LA 2YXRB 2KK7A 5APXA 2A06D 3HRNA 1VQ8P 3L73D 2Q5UA 4HH2A 2GM4A 4WY4A 2Y0EA 1VQMP 1L0NJ 1GL2D 1H89A 1JUNA 3CCMP 3CCLP 3M0DA 3P8CD 3RL0D 2KNCB 1T8ZA 4YTPC 3CWBE 1NTMK 2WITA 1AVOA 3Q5PA 1ZP0C 3L4FA 1KQLA 2YNYA 1R8EA 2Y9YA 1FU1A 2KNCA 3G9RA 2NPSD 4WY4D 1EDKA 2KI7B 2FYUG 1UIXA 3CCVP 3AE2C 3B5NB 1JCDA 1PPJE 1LTBC 2FYUD 1JEKA 1VQ4P 1SQQE 4I6MC 4C46A 1N73B 4H44B 3L71E 2FY8A 5KJ7D 3RK3E 4N78D 5AVQB 2RKLA 3U59A 5GTHH 3MIWA 2W8ZA 1L4AB 1L0ND 1USEA 1OVRA 1SQPG 1SQXE 1S5LX 2GUVA 1N73A 3RK2C 3V4QA 5AW4B 1PP9G 2K3RA 2FYZA 3BCCJ 1JY3O 1L4AA 2ZYDA 1DH3A 2O3JA 4Y28J 1HGVA 2NZ2A 2Q1KA 2PFXA 3KQGA 3B5ND 1G1JA 5KAIH 4UB6H 1YQ3C 4BRYB 4JPZB 2P1JA 2ZT9C 1KILE 3M9QA 1NTZJ 4H44D 3CX5H 2Q3EA 2KYVA 1A02F 5CCGA 5B66H 3A0HH 3JCUH 4BRYA 3CX5I 1L4AD 1J1DB 1G2CB 4K35A 2WVRA 3MUDA 5APYA 1K8AQ 3CC2P 5AW0B 1PGQA 2E5TA 5AVRB 3FGAD 1IC2A 2ITAA 3O6QA 3PLNA 1BDDA 5KAFH 2Y9ZA 1G2CA 1AVYA 4L74A 1NTKG 1NHLA 3GHGC 3H1JE 5KLVK 1NWQA 2FYNB 5CCGD 3RBXA 1FOSE 1NTKD 3L75G 3U1CA 2AXCA 1RE3A 3L74E 1T2KC 1Q82Q 1IFIA 1NOHA 1DEBA 1JOCA 1BCCJ 1IK7A 4LGDE 4U3FG 2WSFJ 1LP1A 1SQBE 4L75A 1FDMA 4DT0A 4GKGA 4U3FD 3TGUJ 3NMDA 4EI2A 1NAFA 2OTJP 1QLED 2WPRA 3AEEC 4IOIH 3L72J 2DW3A 4WWIA 4IFMA 2QJYC 4B86A 1ZW0A 2BEZF 3H1IG 2KSEA 3L70G 2G8YA 5BU8B 2WMMA 1KMIZ 1L0LJ 3D6YA 5GTHE 2RN0A 3H1ID 2P67A 1URQC 3L70D 1YITP 4RESB 2E75B 5KKZC 2JR8A 2LKMA 1NTMG 1GK6A 4R4LA 3H1LE 1GL2C 2WSCJ 1G1IA 1K05A 5AVTB 1FZAA 3MGNA 1NKZB 1PGOA 1GTWA 1BDCA 1FZEA 1YJWP 5AW5B 4RJTA 5KAIE 4UB6E 4N3YB 1ZR4A 1YI2P 2V4HA 3A5TA 1VQNP 3MHVA 1VQ5P 1K9MQ 4WY4C 1OZHA 3CX5E 1NYHA 3H1KD 3L72D 3GMAA 2I1KA 5B66E 3A0HE 4PD4H 3HD7B 3JCUE 1FJKA 3RL0g 1JMMA 3M0DC 1FZBA 1Y8AA 1K04A 2IZ1A 2ZXEB 3BATA 1E79H 1M90Q 3V2RA 3HD7A 2XNDH 2B88A 5KAFE 3N4XA 2K1AA 3IN6A 2N9BA 3E1RA 2NRGA 2XZRA 3O8ZA 1HUCA 5KLIC 1IJDB 1SLQA 2IFMA 1S4XA 1AQTA 2L91A 2Z5IA 5TJHA 1X9VA 3JC22 4LC1A 5AVXB 4L76A 3WU2H 2R3CA 3G71P 3AECC 1BGYG 1VQOP 1KB9H 3HD7D 1OVUA 1GMJA 1NJIQ 2YKOA 3B71A 4CPGA 1BGYD 1KB9I 2WSCH 1N73C 4Y99B 4H44C 3H6PA 3BCCE 1KD1Q 1ZOYC 1QVFO 1PFIA 1WRGA 3VP9A 2P10A 3RK3B 1L4AC 2CK3H 4WVZA 4Z1MH 2ZXXA 5KLVG 3E7KA 3AE8C 3RK2D 3NFQA 2A45G 2QRXA 1EZVE 1JY2O 3PHLA 1NTZE 5KLVD 1GU4A 1EXIA 3W67A 1PPJG 5CCGC 1XTGB 5KTBA 5M1BA 2C0XA 1SQQG 2FBWC 5AW6B 5APQA 3A0BE 2FFDA 3MUDC 1N8RQ 1P84D 3L71G 4KT0J 1KILB 1Q86Q 4QMAA 1QL1A 4IFDK 1J1DC 1NKNA 1SVFA 1ZLLA 1LTJB 2B89A 5APVA 1KILA 2V7QH 3VTPC 3II6A 1BE3J 2JP3A 1R5SA 1CZQA 1RE3C 4IFFA 3I5CA 1FDIA 1YHQP 2W90A 1LTJA 1YTZI 1E5WA 3L73J 1HTLC 3A3YB 1KYOH 1FZFA 1OWAA 3I56P 4BXLA 1S9KE 5KKZB 3H32B 1T2KD 1KZUB 1KYOI 3QWOC 1H88A 1KILD 1Q90D 3V2QA 3WU2E 3G3ZA 4GOEA 1L0LE 1ZXGA 3SSUA 4M3LA 3H32A 1WT6A 4PJ0H 2RH0A 1KB9E 3V2PA 1YJ9P 1RE4A 1DD3A 1T3JA 2IBZG 2E42A 1KQSO 2B87B 3AE4C 2ZYGA 2IBZD 4RO0A 1KFNA 2K9YA 1OW8A 1NU1K 2FYUJ 4D6TE 1SQVK 3VP8A 3L74G 5AW3B 2E75C 2BCCG 1GK4A 1GDTA 3HE4B 1URQD 1LT1A 2J5UA 2B87A 3N7NA 2BCCD 1OFCX 1KC8Q 2WQYC 1VPCA 3Q3DA 1SQPJ 2LXBA 2WSEJ 3HE4A 4HKZH 2KXPB 1SFCB 3AEGC 1HJBA 3ABVC 1U57A 2R3SA 4KHXA 3KYQA 1VQLP 5B5EH 5KLIB 4MN4C 2QA4P 2M3EA 4I2LC 1T6AA 3LW5J 1SFCA 1S72P 2KLVA 2P58A 3HD7C 2KZJA 2BEQD 2QJKB 1ZRTE 5GTIH 1X79B 1Y9BA 5AVVB 4C7RA 2ZYAA 3CXHD 3MZWB 4ZKUA 2BASA 3KXDA 4U7JA 2HG5D 3GG2A 1FE6A 1SQPD 1M1JA 2POHA 5CJ4A 1KYOE 4DJGA 1QGKB 3EFGA 1IFNA 1NTKJ 1PP9D 3C1LA 1JY2P 2O01J 3PTZA 3GF7A 1LTGC 2ZVOB 3LIEA 3L75J 2WSSH 1IFJA 3AEAC 1LTTC 4Y99C 4UB8H 4WBAA 2YO3A 2MKVA 3USSA 1BSHA 4I1LA 4PJ0E 2WSEH 4U3FJ 3RK3C 1N7SB 3O6QB 2YKPA 3F89A 3GW6A 3V2NA 1LWUA 2I1JA 3NXSA 5DJUB 3KDPB 1N7SA 2WTYA 2YXQB 3H1IJ 3CC7P 3L70J 3VYIA 1LTIC 2N9YB 4RKUJ 2KLUA 3TNUA 4GODA 2E76B 1LP1B 1LT9B 4TLFA 1NTMJ 1LTSC 3G4SP 2W6BA 1QVGO 1KILC 3L75D 3PP5A 1USDA 4YPCA 1YQ4C 2FXPA 3GF3A 3S9OA 4GIFA 2Z5HA 3OJAB 5B5EE 2AEFA 3Q1MA 1Z56A 4OH8B 2XU6A 2A06E 1ZMEC 3M91A 3L73E 1IZNB 1SQQK 1LT9A 3HE5B 1LTJC 2M5AA 3S4RA 3CLQA 1NU1G 2K9JA 2ZJSE 1EZVG 1JNMA 2H8PD 2KP8A 2IPPA 1SQVG 1NTZG 5AVUB 2CPBA 1H8AA 1FZCB 3NTNA 1LNQA 1IO4A 3H1KJ 1NU1D 2O01H 5GTIE 3P8CE 1SQXK 1EZVD 1SQVD 2B9BA 3HE5A 1M8OB 1RF0A 5AVZB 1LGHB 1RH5B 2H7HA 1FZCA 1PIXA 2K37A 2OYIB 1NH4A 3M9BA 1PV3A 1RE4C 5CCHA 4R4MA 1D7MA 1NTMD 2IZ0A 3TSIA 2N1TB 4I7ZB 1KQFB 2JJLA 2OYIA 3A0BH 1OMIA 4N78E 1AJYA 4PD4D 2JKVA 2N1TA 1L0NE 1N86A 4UB8E 3M06A 3IR9A 3SFEC 1BGYJ 4EYYQ 4EOTA 3H1HG 2IDBA 4LLHA 2E75D 1QX8A 3C9IA 3H1HD 1JM0A 2KOGA 2WSFH 4K3AA 3KPEA 2AEMA 4ZKPA 1FZGA 2JO1A 2H88C 3CCJP 1SFCC 1KTMA 4ASWA 1UIIA 2YMKA 5KLVJ 2XDJA 2OGUA 3V5BA 2OTKE 2YIUB 3TK1A 4NPFX 1SQBK 2YMYA 3QH9A 1GZLA 1M57D 4D6TG 1NGMB 1M1KQ 5BVZA 1JY3P 2Q7CA 2QJKC 2W83C 1HGZA 1VQPP 3VMZA 4AYCA 3L71J 1EXJA 1EC5A 3VMAA 1M1JC 3PH0A 1NTKE 2PGDA 3R4YA 1AA0A 3CWBG 3P8MC 3IF4A 2JWDA 3MTUE 2PAJA 2OQQA
chains in the Genus database with same CATH topology
1U7MA 2Q1KA 1SS1A 5C39A 2B88A 4EYYQ 2B87B 1Y47A 1DEEG 4IOIH 1OVVA 3S1KA 4WWIA 3ZDMA 1ZW0A 3FXDA 4GOFA 2WMMA 1JM0A 2M5AA 2R44A 4K3AA 2LR2A 1LT1A 2B87A 4ZMDA 2M5AB 4NPEA 2B89A 4ZNCA 4ASWA 1U7JA 4K35A 4NPDA 2ZAEB 2M0BA 1OVUA 2LXBA 1EDKA 4HKZH 2KI7B 1H0TB 2OTKE 4CPGA 4NPFX 4JBZA 1BDDA 5CBOA 1NVOA 1BDCA 1Q2NA 2SPZA 4HJGH 4MN4C 4HB1A 1EDJA 2UWJE 1H0TA 4BXLA 2KIKA 2LXCB 5DJUB 2KUBA 2RKLA 2P58A 3MHVA 2HR3A 4ASVA 3QWOC 2KZJA 2I8DA 2KS1B 1JMBA 2QVAA 1OVRA 3FXEA 4KJMA 5K5GB 1X0TA 5CBNA 2QRXA 1EDLA 1EC5A 1S3JA 3PH0A 4GOEA 1ZXGA 2K3RA 1FC2C 5EFWB 1LP1A 1MFTA 1EDIA 2KZIA 3RGUA 3MZWB 4GODA 5DJTB 2JWDA 1LP1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7M A;  2Q1K A;  1SS1 A;  5C39 A;  2B88 A;  4EYY Q;  2B87 B;  1Y47 A;  1DEE G;  4IOI H;  1OVV A;  3S1K A;  4WWI A;  3ZDM A;  1ZW0 A;  3FXD A;  4GOF A;  2WMM A;  1JM0 A;  2M5A A;  2R44 A;  4K3A A;  2LR2 A;  1LT1 A;  2B87 A;  4ZMD A;  2M5A B;  4NPE A;  2B89 A;  4ZNC A;  4ASW A;  1U7J A;  4K35 A;  4NPD A;  2ZAE B;  2M0B A;  1OVU A;  2LXB A;  1EDK A;  4HKZ H;  2KI7 B;  1H0T B;  2OTK E;  4CPG A;  4NPF X;  4JBZ A;  1BDD A;  5CBO A;  1NVO A;  1BDC A;  1Q2N A;  2SPZ A;  4HJG H;  4MN4 C;  4HB1 A;  1EDJ A;  2UWJ E;  1H0T A;  4BXL A;  2KIK A;  2LXC B;  5DJU B;  2KUB A;  2RKL A;  2P58 A;  3MHV A;  2HR3 A;  4ASV A;  3QWO C;  2KZJ A;  2I8D A;  2KS1 B;  1JMB A;  2QVA A;  1OVR A;  3FXE A;  4KJM A;  5K5G B;  1X0T A;  5CBN A;  2QRX A;  1EDL A;  1EC5 A;  1S3J A;  3PH0 A;  4GOE A;  1ZXG A;  2K3R A;  1FC2 C;  5EFW B;  1LP1 A;  1MFT A;  1EDI A;  2KZI A;  3RGU A;  3MZW B;  4GOD A;  5DJT B;  2JWD A;  1LP1 B; 
#chains in the Genus database with same CATH topology
 3UIA A;  1NAY A;  3CWB D;  3S1K A;  3CPW O;  2FFD B;  1J1E B;  1JTH B;  1L0N K;  1LWU C;  1PPJ D;  1YIJ P;  3CCQ P;  3CI9 A;  4HYT B;  1SQQ D;  1JY2 N;  1JTH A;  4H0L B;  1IFP A;  1N7S C;  4IL6 H;  3L71 D;  1SQX G;  3H1I E;  3RK3 D;  3L70 E;  2IYO A;  4PV1 B;  1QL2 A;  1SQX D;  3AE1 C;  2XKM A;  2UWJ E;  5AW8 B;  2HPC A;  2A45 I;  1FS0 E;  1BCC E;  3TF5 A;  3IFM A;  3AE7 C;  1P84 H;  5AVY B;  1X0T A;  5CBN A;  1FOS F;  1EDL A;  3SWK A;  1S3J A;  3TGU E;  2E76 C;  1P84 I;  2BCC J;  1LT9 C;  3VMY A;  3GLM A;  1MFT A;  4GT1 A;  5AVS B;  5TIS H;  3H1K E;  4YXW H;  3L72 E;  3OW2 O;  3C8V A;  4H0L D;  3ITK A;  3Q2Y A;  3T97 B;  2OYH B;  2E74 B;  3M0A A;  3AEB C;  4PV1 D;  1RF1 B;  5CJ0 A;  1RF0 C;  2R32 A;  1FDO A;  1NO4 A;  4JYC A;  1YJN P;  1FZC C;  1VF5 C;  1S1C X;  1VQK P;  3T97 A;  4BWN A;  3WUT A;  2H43 A;  2OYH A;  4H13 B;  2QIW A;  3L36 A;  1RF1 A;  1MZ9 A;  3CMA P;  4NPE A;  2WT7 B;  3H1J G;  3RL0 B;  1Q81 Q;  2E5Y A;  3M9H A;  5CCH C;  4NPD A;  2D2C B;  1Q7Y Q;  1NTZ K;  2W6A A;  3H1J D;  2GUS A;  2YKQ A;  5CMZ A;  2QM8 A;  1PL5 A;  5AW1 B;  3RBZ A;  3CCU P;  2OYI C;  2C0W A;  2Q3I A;  1HBW A;  2WT7 A;  1Q2N A;  2WPS A;  2SPZ A;  4HJG H;  1ZR2 A;  5L8R J;  3L74 D;  2NPS B;  1EDJ A;  2N1T C;  1SQB G;  2E74 D;  4I7Z C;  2LXC B;  1AV1 A;  1BGY E;  1RHZ B;  3A7O A;  3CC4 P;  4W7Z A;  3HUS A;  1SQB D;  2M8R A;  2QVA A;  2NPS A;  5K5G B;  3L37 A;  3D6Z A;  1PP9 J;  3U1A A;  3AE6 C;  1DD4 A;  4H13 D;  2IBZ I;  1GD2 E;  2Q9I A;  4JYB A;  1FC2 C;  2YO2 A;  3TDK A;  2RMZ A;  1LJ2 A;  3CCS P;  3PRJ A;  2D2C D;  4AQR D;  5APU A;  3W68 A;  2IYP A;  1RQU A;  1U7M A;  4IL6 E;  2HYN A;  3WUU A;  5KJ7 A;  5KLV E;  1J2J B;  3H1L G;  1HJ0 A;  5BU5 A;  1TU3 F;  5CHX A;  3CL3 D;  3H1L D;  1M1J B;  3L35 A;  3JSV C;  1GW4 A;  3FX0 A;  1P84 E;  1SFC D;  2MJZ A;  2Y0C A;  5APS A;  2YIU C;  1L0N G;  3B5N A;  3G6E P;  1L0L K;  2G3A A;  1MKM A;  1M56 D;  5TIS E;  2W27 A;  1IFD A;  2WPV B;  3PJS K;  1AFO A;  1VQ6 P;  2WWW A;  3CX5 D;  3CXH H;  1X22 A;  4HB1 A;  3A2A A;  5AVW B;  3CXH I;  1LWU B;  2HR3 A;  1JB0 J;  1A02 J;  2QJP B;  3EQ2 A;  2HFE D;  1JY3 N;  3Q5R A;  1VQ7 P;  2P7J A;  1W2B O;  2JDI H;  1KOR A;  2P2U A;  3KHU A;  2Q6Q A;  1NU1 J;  2KZI A;  3BAS A;  1SQV J;  2C9L Y;  4JF7 A;  4W7Y A;  5DJT B;  2IX7 C;  3LW5 H;  3AEF C;  2GA1 A;  1GU5 A;  3BVH A;  3TNU B;  3AED C;  2FFD C;  2O1J A;  3I55 P;  1J1E C;  1YTZ T;  1OVV A;  1N2D C;  3ZDM A;  1W5C E;  1ZV8 A;  4XA4 A;  3Q5S A;  3BCC G;  2QM7 A;  4TT3 H;  4OGQ C;  3KZI H;  2IBZ E;  2M5A B;  4H0L C;  1BE3 E;  2K9J B;  2L5G B;  3WUV A;  3BCC D;  2JEE A;  2OYO A;  4XE5 B;  1N7S D;  4L73 A;  4PV1 C;  2M0B A;  1MUU A;  2JWA A;  1DIP A;  2E43 A;  4OWF A;  1H0T B;  4OVN F;  1EQ7 A;  2BCC E;  5CBO A;  4XFJ A;  3BRV B;  3K5B A;  1VF5 B;  1NTZ D;  1H0T A;  1HF9 A;  1L2P A;  2KSJ A;  2O1K A;  1LTA C;  1HVV A;  2I8D A;  1JMB A;  5E79 H;  3H1H J;  2OTL P;  1FAV A;  4DCK A;  2E76 D;  2FXM A;  1FJP A;  1IFM A;  1PZQ A;  5AW9 B;  2IFN A;  1QEX A;  2J58 A;  1PGJ A;  3D71 A;  1EDI A;  3RGU A;  2OYH C;  2E74 C;  1GW3 A;  1RF1 C;  2C9N Y;  3OAK A;  1S5L H;  1SS1 A;  2FYU E;  3F5H A;  2WZ7 A;  3VMX A;  5H2F H;  2KB7 P;  1EZV I;  2QSI A;  2FKW B;  3CXH E;  2QEX P;  1BCC G;  4H13 C;  1VF5 D;  3D70 A;  3P32 A;  5AW7 B;  3RL0 C;  1BCC D;  2R44 A;  4IL6 X;  3AE9 C;  4D6T J;  2D2C C;  4C7N B;  1RQV A;  4DZO A;  1MV8 A;  1R5L A;  3TGU G;  1SQP E;  1KV4 A;  5CCH D;  2ZVN B;  1U7J A;  3TGU D;  3HUS C;  2R5B A;  3H1K G;  1PP9 E;  2Y0D A;  4A7P A;  3L72 G;  4EIJ A;  1CW5 A;  2XV5 A;  4C7N A;  2NPS C;  1YBK A;  1S9K D;  2CPS A;  3HTK B;  4WB4 A;  2AXT H;  2VRS A;  3SWY A;  2N1T D;  1L0L G;  3CWB J;  4YXD C;  4PD4 I;  2KIK A;  2XNX A;  1L0L D;  2KUB A;  3HTK A;  1OXZ A;  5KJ7 C;  1KB9 D;  1HWT C;  2HOD B;  3VN0 A;  2HLO A;  3KZI E;  3CME P;  5EFW B;  1DX7 A;  2QG4 A;  3EFF K;  1WMK A;  3RK2 B;  1SP4 A;  1VDF A;  4D6T D;  1SQQ J;  2HOD A;  1CSB A;  2V7Q J;  2Z4E A;  2PP6 A;  3E1I A;  3B5N C;  4GDO A;  4W80 A;  1FBM A;  1SQX J;  3H25 A;  1JO5 A;  2J59 M;  4GOF A;  3L75 E;  2LR2 A;  2ZT9 B;  3CCR P;  4ZMD A;  5E79 E;  1W2E A;  2FYU K;  4ZNC A;  3R2P A;  2ZAE B;  4N6J A;  4U3F E;  1BSN A;  2WPQ A;  4JBZ A;  1NVO A;  1NU1 E;  1S5L E;  1SQV E;  3OA7 A;  3IAO A;  1ZRT D;  2W6J H;  3CCE P;  5H2F E;  2QJP C;  1AQ5 A;  1SQP K;  4OGQ B;  3P7K A;  2R5D A;  1K73 Q;  3GHG B;  2HPC B;  2FXO A;  2K88 A;  2KS1 B;  4AUW A;  2M3B A;  1X8Y A;  3WMM 0;  2AEJ A;  4DOJ A;  2A45 H;  3AE3 C;  2PRR A;  2ZT9 D;  3MD0 A;  3B8E B;  1KQG B;  2ZFC A;  3GHG A;  1NTM E;  1ZN5 A;  3EWK A;  2KS1 A;  3SFD C;  1KYO D;  3B4S A;  1OW7 A;  3H1J J;  1KN7 A;  1XTC C;  1OIP A;  5C39 A;  3CD6 P;  1PGP A;  2AXT E;  1Y47 A;  1DEE G;  1T3U A;  4EDF A;  4PD4 E;  3VOP A;  3L74 J;  4JQ0 D;  1VL2 A;  3V4W A;  4O9B A;  3FXD A;  5APW A;  4OGQ D;  1IK9 A;  1OX3 A;  2QJY B;  1KFM A;  2FYN C;  1MFZ A;  1SQB J;  5APT A;  3V6I A;  1JCC A;  3H1H E;  1URQ B;  1NTK K;  2H89 C;  3TYY A;  3MP7 B;  3AE5 C;  1CI6 B;  1GL2 B;  3FWL A;  3SWF A;  1OW6 A;  2O01 N;  1HH0 A;  1URQ A;  2OAR A;  1S2E A;  1YYC A;  1CI6 A;  1GL2 A;  4ASV A;  1RY3 A;  3FWN A;  1BE3 G;  4KJM A;  3FXE A;  3HUS B;  3H1L J;  3BRT B;  3LID A;  1VQ9 P;  1N7L A;  2QE7 H;  4WY4 B;  2A06 G;  1BE3 D;  5AW2 B;  3L73 G;  1M7L A;  2YXR B;  2KK7 A;  5APX A;  2A06 D;  3HRN A;  1VQ8 P;  3L73 D;  2Q5U A;  4HH2 A;  2GM4 A;  4WY4 A;  2Y0E A;  1VQM P;  1L0N J;  1GL2 D;  1H89 A;  1JUN A;  3CCM P;  3CCL P;  3M0D A;  3P8C D;  3RL0 D;  2KNC B;  1T8Z A;  4YTP C;  3CWB E;  1NTM K;  2WIT A;  1AVO A;  3Q5P A;  1ZP0 C;  3L4F A;  1KQL A;  2YNY A;  1R8E A;  2Y9Y A;  1FU1 A;  2KNC A;  3G9R A;  2NPS D;  4WY4 D;  1EDK A;  2KI7 B;  2FYU G;  1UIX A;  3CCV P;  3AE2 C;  3B5N B;  1JCD A;  1PPJ E;  1LTB C;  2FYU D;  1JEK A;  1VQ4 P;  1SQQ E;  4I6M C;  4C46 A;  1N73 B;  4H44 B;  3L71 E;  2FY8 A;  5KJ7 D;  3RK3 E;  4N78 D;  5AVQ B;  2RKL A;  3U59 A;  5GTH H;  3MIW A;  2W8Z A;  1L4A B;  1L0N D;  1USE A;  1OVR A;  1SQP G;  1SQX E;  1S5L X;  2GUV A;  1N73 A;  3RK2 C;  3V4Q A;  5AW4 B;  1PP9 G;  2K3R A;  2FYZ A;  3BCC J;  1JY3 O;  1L4A A;  2ZYD A;  1DH3 A;  2O3J A;  4Y28 J;  1HGV A;  2NZ2 A;  2Q1K A;  2PFX A;  3KQG A;  3B5N D;  1G1J A;  5KAI H;  4UB6 H;  1YQ3 C;  4BRY B;  4JPZ B;  2P1J A;  2ZT9 C;  1KIL E;  3M9Q A;  1NTZ J;  4H44 D;  3CX5 H;  2Q3E A;  2KYV A;  1A02 F;  5CCG A;  5B66 H;  3A0H H;  3JCU H;  4BRY A;  3CX5 I;  1L4A D;  1J1D B;  1G2C B;  4K35 A;  2WVR A;  3MUD A;  5APY A;  1K8A Q;  3CC2 P;  5AW0 B;  1PGQ A;  2E5T A;  5AVR B;  3FGA D;  1IC2 A;  2ITA A;  3O6Q A;  3PLN A;  1BDD A;  5KAF H;  2Y9Z A;  1G2C A;  1AVY A;  4L74 A;  1NTK G;  1NHL A;  3GHG C;  3H1J E;  5KLV K;  1NWQ A;  2FYN B;  5CCG D;  3RBX A;  1FOS E;  1NTK D;  3L75 G;  3U1C A;  2AXC A;  1RE3 A;  3L74 E;  1T2K C;  1Q82 Q;  1IFI A;  1NOH A;  1DEB A;  1JOC A;  1BCC J;  1IK7 A;  4LGD E;  4U3F G;  2WSF J;  1LP1 A;  1SQB E;  4L75 A;  1FDM A;  4DT0 A;  4GKG A;  4U3F D;  3TGU J;  3NMD A;  4EI2 A;  1NAF A;  2OTJ P;  1QLE D;  2WPR A;  3AEE C;  4IOI H;  3L72 J;  2DW3 A;  4WWI A;  4IFM A;  2QJY C;  4B86 A;  1ZW0 A;  2BEZ F;  3H1I G;  2KSE A;  3L70 G;  2G8Y A;  5BU8 B;  2WMM A;  1KMI Z;  1L0L J;  3D6Y A;  5GTH E;  2RN0 A;  3H1I D;  2P67 A;  1URQ C;  3L70 D;  1YIT P;  4RES B;  2E75 B;  5KKZ C;  2JR8 A;  2LKM A;  1NTM G;  1GK6 A;  4R4L A;  3H1L E;  1GL2 C;  2WSC J;  1G1I A;  1K05 A;  5AVT B;  1FZA A;  3MGN A;  1NKZ B;  1PGO A;  1GTW A;  1BDC A;  1FZE A;  1YJW P;  5AW5 B;  4RJT A;  5KAI E;  4UB6 E;  4N3Y B;  1ZR4 A;  1YI2 P;  2V4H A;  3A5T A;  1VQN P;  3MHV A;  1VQ5 P;  1K9M Q;  4WY4 C;  1OZH A;  3CX5 E;  1NYH A;  3H1K D;  3L72 D;  3GMA A;  2I1K A;  5B66 E;  3A0H E;  4PD4 H;  3HD7 B;  3JCU E;  1FJK A;  3RL0 g;  1JMM A;  3M0D C;  1FZB A;  1Y8A A;  1K04 A;  2IZ1 A;  2ZXE B;  3BAT A;  1E79 H;  1M90 Q;  3V2R A;  3HD7 A;  2XND H;  2B88 A;  5KAF E;  3N4X A;  2K1A A;  3IN6 A;  2N9B A;  3E1R A;  2NRG A;  2XZR A;  3O8Z A;  1HUC A;  5KLI C;  1IJD B;  1SLQ A;  2IFM A;  1S4X A;  1AQT A;  2L91 A;  2Z5I A;  5TJH A;  1X9V A;  3JC2 2;  4LC1 A;  5AVX B;  4L76 A;  3WU2 H;  2R3C A;  3G71 P;  3AEC C;  1BGY G;  1VQO P;  1KB9 H;  3HD7 D;  1OVU A;  1GMJ A;  1NJI Q;  2YKO A;  3B71 A;  4CPG A;  1BGY D;  1KB9 I;  2WSC H;  1N73 C;  4Y99 B;  4H44 C;  3H6P A;  3BCC E;  1KD1 Q;  1ZOY C;  1QVF O;  1PFI A;  1WRG A;  3VP9 A;  2P10 A;  3RK3 B;  1L4A C;  2CK3 H;  4WVZ A;  4Z1M H;  2ZXX A;  5KLV G;  3E7K A;  3AE8 C;  3RK2 D;  3NFQ A;  2A45 G;  2QRX A;  1EZV E;  1JY2 O;  3PHL A;  1NTZ E;  5KLV D;  1GU4 A;  1EXI A;  3W67 A;  1PPJ G;  5CCG C;  1XTG B;  5KTB A;  5M1B A;  2C0X A;  1SQQ G;  2FBW C;  5AW6 B;  5APQ A;  3A0B E;  2FFD A;  3MUD C;  1N8R Q;  1P84 D;  3L71 G;  4KT0 J;  1KIL B;  1Q86 Q;  4QMA A;  1QL1 A;  4IFD K;  1J1D C;  1NKN A;  1SVF A;  1ZLL A;  1LTJ B;  2B89 A;  5APV A;  1KIL A;  2V7Q H;  3VTP C;  3II6 A;  1BE3 J;  2JP3 A;  1R5S A;  1CZQ A;  1RE3 C;  4IFF A;  3I5C A;  1FDI A;  1YHQ P;  2W90 A;  1LTJ A;  1YTZ I;  1E5W A;  3L73 J;  1HTL C;  3A3Y B;  1KYO H;  1FZF A;  1OWA A;  3I56 P;  4BXL A;  1S9K E;  5KKZ B;  3H32 B;  1T2K D;  1KZU B;  1KYO I;  3QWO C;  1H88 A;  1KIL D;  1Q90 D;  3V2Q A;  3WU2 E;  3G3Z A;  4GOE A;  1L0L E;  1ZXG A;  3SSU A;  4M3L A;  3H32 A;  1WT6 A;  4PJ0 H;  2RH0 A;  1KB9 E;  3V2P A;  1YJ9 P;  1RE4 A;  1DD3 A;  1T3J A;  2IBZ G;  2E42 A;  1KQS O;  2B87 B;  3AE4 C;  2ZYG A;  2IBZ D;  4RO0 A;  1KFN A;  2K9Y A;  1OW8 A;  1NU1 K;  2FYU J;  4D6T E;  1SQV K;  3VP8 A;  3L74 G;  5AW3 B;  2E75 C;  2BCC G;  1GK4 A;  1GDT A;  3HE4 B;  1URQ D;  1LT1 A;  2J5U A;  2B87 A;  3N7N A;  2BCC D;  1OFC X;  1KC8 Q;  2WQY C;  1VPC A;  3Q3D A;  1SQP J;  2LXB A;  2WSE J;  3HE4 A;  4HKZ H;  2KXP B;  1SFC B;  3AEG C;  1HJB A;  3ABV C;  1U57 A;  2R3S A;  4KHX A;  3KYQ A;  1VQL P;  5B5E H;  5KLI B;  4MN4 C;  2QA4 P;  2M3E A;  4I2L C;  1T6A A;  3LW5 J;  1SFC A;  1S72 P;  2KLV A;  2P58 A;  3HD7 C;  2KZJ A;  2BEQ D;  2QJK B;  1ZRT E;  5GTI H;  1X79 B;  1Y9B A;  5AVV B;  4C7R A;  2ZYA A;  3CXH D;  3MZW B;  4ZKU A;  2BAS A;  3KXD A;  4U7J A;  2HG5 D;  3GG2 A;  1FE6 A;  1SQP D;  1M1J A;  2POH A;  5CJ4 A;  1KYO E;  4DJG A;  1QGK B;  3EFG A;  1IFN A;  1NTK J;  1PP9 D;  3C1L A;  1JY2 P;  2O01 J;  3PTZ A;  3GF7 A;  1LTG C;  2ZVO B;  3LIE A;  3L75 J;  2WSS H;  1IFJ A;  3AEA C;  1LTT C;  4Y99 C;  4UB8 H;  4WBA A;  2YO3 A;  2MKV A;  3USS A;  1BSH A;  4I1L A;  4PJ0 E;  2WSE H;  4U3F J;  3RK3 C;  1N7S B;  3O6Q B;  2YKP A;  3F89 A;  3GW6 A;  3V2N A;  1LWU A;  2I1J A;  3NXS A;  5DJU B;  3KDP B;  1N7S A;  2WTY A;  2YXQ B;  3H1I J;  3CC7 P;  3L70 J;  3VYI A;  1LTI C;  2N9Y B;  4RKU J;  2KLU A;  3TNU A;  4GOD A;  2E76 B;  1LP1 B;  1LT9 B;  4TLF A;  1NTM J;  1LTS C;  3G4S P;  2W6B A;  1QVG O;  1KIL C;  3L75 D;  3PP5 A;  1USD A;  4YPC A;  1YQ4 C;  2FXP A;  3GF3 A;  3S9O A;  4GIF A;  2Z5H A;  3OJA B;  5B5E E;  2AEF A;  3Q1M A;  1Z56 A;  4OH8 B;  2XU6 A;  2A06 E;  1ZME C;  3M91 A;  3L73 E;  1IZN B;  1SQQ K;  1LT9 A;  3HE5 B;  1LTJ C;  2M5A A;  3S4R A;  3CLQ A;  1NU1 G;  2K9J A;  2ZJS E;  1EZV G;  1JNM A;  2H8P D;  2KP8 A;  2IPP A;  1SQV G;  1NTZ G;  5AVU B;  2CPB A;  1H8A A;  1FZC B;  3NTN A;  1LNQ A;  1IO4 A;  3H1K J;  1NU1 D;  2O01 H;  5GTI E;  3P8C E;  1SQX K;  1EZV D;  1SQV D;  2B9B A;  3HE5 A;  1M8O B;  1RF0 A;  5AVZ B;  1LGH B;  1RH5 B;  2H7H A;  1FZC A;  1PIX A;  2K37 A;  2OYI B;  1NH4 A;  3M9B A;  1PV3 A;  1RE4 C;  5CCH A;  4R4M A;  1D7M A;  1NTM D;  2IZ0 A;  3TSI A;  2N1T B;  4I7Z B;  1KQF B;  2JJL A;  2OYI A;  3A0B H;  1OMI A;  4N78 E;  1AJY A;  4PD4 D;  2JKV A;  2N1T A;  1L0N E;  1N86 A;  4UB8 E;  3M06 A;  3IR9 A;  3SFE C;  1BGY J;  4EYY Q;  4EOT A;  3H1H G;  2IDB A;  4LLH A;  2E75 D;  1QX8 A;  3C9I A;  3H1H D;  1JM0 A;  2KOG A;  2WSF H;  4K3A A;  3KPE A;  2AEM A;  4ZKP A;  1FZG A;  2JO1 A;  2H88 C;  3CCJ P;  1SFC C;  1KTM A;  4ASW A;  1UII A;  2YMK A;  5KLV J;  2XDJ A;  2OGU A;  3V5B A;  2OTK E;  2YIU B;  3TK1 A;  4NPF X;  1SQB K;  2YMY A;  3QH9 A;  1GZL A;  1M57 D;  4D6T G;  1NGM B;  1M1K Q;  5BVZ A;  1JY3 P;  2Q7C A;  2QJK C;  2W83 C;  1HGZ A;  1VQP P;  3VMZ A;  4AYC A;  3L71 J;  1EXJ A;  1EC5 A;  3VMA A;  1M1J C;  3PH0 A;  1NTK E;  2PGD A;  3R4Y A;  1AA0 A;  3CWB G;  3P8M C;  3IF4 A;  2JWD A;  3MTU E;  2PAJ A;  2OQQ A; 
#chains in the Genus database with same CATH homology
 1U7M A;  2Q1K A;  1SS1 A;  5C39 A;  2B88 A;  4EYY Q;  2B87 B;  1Y47 A;  1DEE G;  4IOI H;  1OVV A;  3S1K A;  4WWI A;  3ZDM A;  1ZW0 A;  3FXD A;  4GOF A;  2WMM A;  1JM0 A;  2M5A A;  2R44 A;  4K3A A;  2LR2 A;  1LT1 A;  2B87 A;  4ZMD A;  2M5A B;  4NPE A;  2B89 A;  4ZNC A;  4ASW A;  1U7J A;  4K35 A;  4NPD A;  2ZAE B;  2M0B A;  1OVU A;  2LXB A;  1EDK A;  4HKZ H;  2KI7 B;  1H0T B;  2OTK E;  4CPG A;  4NPF X;  4JBZ A;  1BDD A;  5CBO A;  1NVO A;  1BDC A;  1Q2N A;  2SPZ A;  4HJG H;  4MN4 C;  4HB1 A;  1EDJ A;  2UWJ E;  1H0T A;  4BXL A;  2KIK A;  2LXC B;  5DJU B;  2KUB A;  2RKL A;  2P58 A;  3MHV A;  2HR3 A;  4ASV A;  3QWO C;  2KZJ A;  2I8D A;  2KS1 B;  1JMB A;  2QVA A;  1OVR A;  3FXE A;  4KJM A;  5K5G B;  1X0T A;  5CBN A;  2QRX A;  1EDL A;  1EC5 A;  1S3J A;  3PH0 A;  4GOE A;  1ZXG A;  2K3R A;  1FC2 C;  5EFW B;  1LP1 A;  1MFT A;  1EDI A;  2KZI A;  3RGU A;  3MZW B;  4GOD A;  5DJT B;  2JWD A;  1LP1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...