4IOIH

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
53
structure length
53
Chain Sequence
SYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Trastuzumab light chain
total genus 23
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4ioiH00
4EYYQ 1NVOA 2M5AB 3MZWB 1ZW0A 3FXEA 4K35A 2LXBA 2LR2A 2SPZA 2M0BA 4GOFA 4MN4C 1MFTA 4BXLA 1LP1B 1JMBA 4HJGH 1EDKA 1Y47A 2KS1B 1BDCA 4NPDA 3MHVA 1EDIA 5DJTB 2QVAA 1LP1A 5EFWB 1Q2NA 2Q1KA 2ZAEB 4HKZH 3RGUA 4CPGA 1S3JA 2B89A 2KIKA 1DEEG 5CBOA 4JBZA 5K5GB 3PH0A 3ZDMA 1OVRA 2KZIA 1OVVA 1JM0A 2M5AA 5CBNA 3FXDA 2KI7B 2HR3A 4ASWA 3S1KA 2JWDA 1ZXGA 1SS1A 4ASVA 1FC2C 1X0TA 5DJUB 4K3AA 2B88A 2QRXA 2UWJE 1EDLA 4WWIA 4GODA 1EDJA 4KJMA 2WMMA 4HB1A 2KUBA 1H0TB 2R44A 1BDDA 2OTKE 2B87A 1EC5A 4NPFX 2K3RA 1LT1A 4IOIH 2RKLA 1H0TA 2KZJA 4ZNCA 5C39A 4GOEA 1U7JA 1U7MA 3QWOC 2I8DA 4NPEA 2LXCB 4ZMDA 2B87B 2P58A 1OVUA
chains in the Genus database with same CATH superfamily
1N73A 3L37A 1XTCC 2Z5IA 3NMDA 1T3JA 4QMAA 2KXPB 1RF0C 3L71J 2DW3A 1W2BO 2HPCB 1RF1C 2MKVA 3L71E 3V2RA 1KILB 3HTKB 2WWWA 2SPZA 3H1ID 3TDKA 2I1JA 2O01H 2M0BA 1CW5A 1KV4A 3USSA 4YTPC 1JMMA 1KB9D 2KS1A 3VOPA 2Y9YA 3KZIE 1SQVK 2PP6A 4BXLA 4DCKA 1M7LA 4HJGH 1OW6A 1S4XA 2E76D 2FXMA 4I6MC 1NTZD 5GTHH 1GL2B 3HUSA 3H1JJ 4RO0A 3V4QA 3D71A 1PP9E 1PP9J 1NAYA 1VDFA 2E76C 1MV8A 3VMAA 4N78E 2E74D 3A7OA 2Q7CA 1KZUB 1NTZE 3MP7B 2IX7C 2W27A 3QH9A 3EWKA 5DJTB 1VQ7P 1VQKP 5BU5A 2VRSA 2ZT9B 1KYOE 4U3FE 2K9JA 2BCCD 2FYUK 1QL2A 2OYIA 3CXHI 1BCCD 1LT9A 2J59M 1SQPG 1ZLLA 3BCCG 3L75D 3RGUA 3VMZA 3L75J 3LW5J 3H1HG 2R32A 3O6QA 1VQOP 1KQGB 1NTZK 2N9BA 3V2QA 5CCHC 1LWUA 1HBWA 2WZ7A 1DIPA 1DEEG 2YIUB 3H1LG 5CCGC 2QSIA 3M06A 1NGMB 1J1DB 1NTMK 3HRNA 1BGYD 2GUVA 2WITA 3PP5A 5AW8B 4HH2A 1P84E 3P7KA 4Z1MH 3V2NA 2E75B 2R3SA 1FZEA 1OVVA 5AVXB 5APUA 1VF5C 1IJDB 3KZIH 3HTKA 4N3YB 5AVYB 4IFDK 1JNMA 3TGUE 1S72P 1M1JA 1BE3J 3CX5D 3FWLA 5AW5B 3L36A 5KLVK 2WT7B 2IBZE 4ASWA 3CD6P 1ZXGA 1JB0J 2D2CB 1S2EA 3A0BH 2WPQA 1PZQA 4RESB 4WY4D 1L0NJ 3CCRP 3JCUH 2Q3IA 4PD4I 2LKMA 3B5ND 3ABVC 1NTKG 2Y0EA 4M3LA 4A7PA 3B8EB 5KLVG 3CPWO 1SS1A 5B66E 2YO3A 5CCGD 2Z5HA 4ASVA 4KHXA 1FE6A 1X8YA 2O3JA 3RK3D 1OW7A 2JKVA 1T2KD 1GK6A 1IFPA 2B88A 3VYIA 2D2CD 2QRXA 1K05A 2WPRA 4EI2A 1NJIQ 1JY3P 1NU1K 1CSBA 2E5YA 3GF7A 3M9HA 2MJZA 1SQBK 1S9KD 3L75E 1FDMA 2E74B 2M3EA 1BCCE 2YXRB 1L4AB 5AVZB 1S5LE 4KJMA 1IFMA 4C46A 1SQXG 2QJKB 4OWFA 2WMMA 1JY2O 2WSFH 1WRGA 4U3FJ 2QA4P 3VMXA 3V4WA 1ZRTD 3A0BE 1RF1B 1GL2D 1HJ0A 2QEXP 1YHQP 3RL0g 4N78D 2B87A 1KILE 1WMKA 2IBZG 1KILA 3B5NA 4DT0A 3TGUJ 2IYOA 5APQA 4I2LC 3WU2E 2IFMA 5KAIH 2OTJP 2YKQA 1YTZI 3TGUG 1L4AD 2K9YA 1USDA 2HG5D 2BEZF 2ZVNB 2P10A 3S4RA 1PPJG 3GLMA 3L70J 3P32A 2O01J 2FYUE 1GW4A 3RBZA 3CMAP 3H1IE 2O1JA 1HGZA 3LIEA 3OJAB 4WVZA 1JTHA 1MZ9A 2HLOA 1HH0A 4TLFA 1IFDA 1PGOA 1Q90D 3AEEC 3H1HE 3RBXA 1SFCB 2HODA 1RE3A 2RH0A 4ZMDA 1SQPE 3BCCE 3D70A 1QL1A 1URQB 5TISH 3RK3C 2FYUJ 2W6JH 2FYZA 1BE3D 5GTIH 4AUWA 1J1EB 2WSEJ 2J5UA 1LWUC 2N1TB 3MZWB 2OYOA 3O6QB 1KC8Q 1GD2E 3IF4A 2W83C 3KQGA 4GDOA 2LXBA 4K35A 4OH8B 1IFNA 5TISE 1G2CB 1L2PA 2KP8A 4MN4C 2BCCJ 4B86A 4EDFA 1L4AC 2FYUD 1SQVD 3CWBG 4W7YA 1MFTA 1SFCA 2E74C 2HODB 2YKPA 1KYOD 2BCCG 3KYQA 1Q7YQ 1YI2P 2O1KA 3PJSK 5B5EE 1VF5B 1NU1E 2O01N 2P7JA 3OA7A 2E75C 3Q5PA 3RK2D 3TSIA 2Y9ZA 1AVOA 4KT0J 2N9YB 2Y0CA 1RE3C 1ZR4A 3V5BA 1EXJA 1M90Q 2QE7H 3IR9A 3MHVA 3BASA 4R4MA 2IPPA 1BCCJ 1EDIA 1K73Q 4YXWH 1VQNP 2WPVB 2C9NY 2ZJSE 4PD4E 1NU1D 3JCUE 1HGVA 4I1LA 2JO1A 4OGQB 1LJ2A 1Q2NA 4WB4A 3MUDC 4JF7A 1KB9E 3CXHH 3TYYA 1IFIA 1RY3A 1N73C 1GU4A 1IFJA 2D2CC 1RHZB 3M0DA 2GA1A 1FZCC 3L73J 3L74J 2BASA 4HKZH 3VP8A 2ZT9C 4O9BA 1G1JA 1M8OB 4DOJA 1JTHB 3WUUA 1S3JA 2B89A 1L0LJ 2PAJA 1LT9C 1TU3F 1EZVG 2KIKA 3H32B 1RF0A 1JCCA 2WSCJ 2V7QH 1YTZT 2H8PD 3SWYA 3WMM0 4ZKUA 5CBOA 1FDOA 1NTME 2XU6A 3PH0A 1R8EA 1NU1G 3H1KE 2WSSH 1FJKA 1R5SA 2AEJA 2OARA 3H1HD 1FAVA 3ITKA 1OVRA 4OGQD 3V6IA 1NKZB 1NU1J 2A06D 4JPZB 2XNXA 3W68A 1VQ8P 1QLED 2YO2A 1SQBD 1YBKA 2Q9IA 4BRYA 3H32A 4GKGA 3C8VA 4UB8H 3H1KG 2IFNA 1N7SA 5KTBA 1LT9B 1L0NG 2H43A 2XDJA 1G1IA 1QEXA 2NRGA 3CXHD 1SVFA 2IBZD 1T6AA 3LIDA 1YYCA 4L76A 3OW2O 3G3ZA 3BVHA 2QM7A 1FZCB 1GZLA 2KSJA 3KHUA 2FFDA 1AFOA 1J2JB 1KD1Q 4H0LD 4EOTA 1IK7A 1VQ5P 3GW6A 4JYCA 4WBAA 1KB9H 1OIPA 2E5TA 2NZ2A 2YKOA 1GU5A 2A06E 3N7NA 3UIAA 5APXA 1N86A 3IN6A 1YITP 3H1KD 1AVYA 1E5WA 5AW4B 3AEFC 1SQPK 3GHGC 3A5TA 1RE4C 5DJUB 1PPJE 5CCGA 1FS0E 1IZNB 3MGNA 4GT1A 1OXZA 1RH5B 5AW9B 3D6YA 1YIJP 1DX7A 3B4SA 1OX3A 4W80A 3AE6C 4WWIA 5AVSB 2WTYA 2RMZA 5APWA 1VQ9P 1AQTA 4GODA 1NKNA 3T97B 4C7NA 1EDJA 2BCCE 1NTKD 1BE3G 2QJPB 2R5BA 5KLVD 3SWKA 3CWBE 1BGYJ 2A45H 1LWUB 2N1TC 2A45G 3L35A 1HJBA 1H0TB 2R44A 4PD4D 2PFXA 3AEDC 1BDDA 2OTKE 3A2AA 3BCCJ 3PTZA 3B5NB 1URQC 4TT3H 1P84I 3RK3B 3L4FA 2W90A 3CCJP 5APTA 3H1LD 4H44D 1SFCC 2K9JB 2JDIH 2I1KA 3HD7A 4AQRD 1X79B 2WVRA 5CHXA 3AE7C 3II6A 4PV1C 4D6TD 2KZJA 2JEEA 4IL6E 4ZNCA 1SQVE 1M1JB 2CPSA 3MD0A 5AVUB 4GOEA 1U7JA 5B66H 5KJ7C 3TGUD 5E79E 4Y99B 3RL0D 1KB9I 4XFJA 1SQBE 2JJLA 3L71D 2Y0DA 3RK2B 2FYUG 3R2PA 1USEA 3AE4C 3G4SP 1SQXJ 4U7JA 1H89A 1OW8A 2KNCB 4W7ZA 5AW6B 1SQPD 1ZN5A 2NPSC 2ZYGA 3BCCD 3H1JG 1T8ZA 2KB7P 4IL6X 1EZVD 1FBMA 1AA0A 1NVOA 2H88C 1UIXA 2M5AB 2W6BA 3L72D 3S9OA 3Q5SA 1L0LK 3FXEA 3HE4A 4C7RA 4DJGA 1KFMA 1SQQG 2QJKC 2QM8A 2XZRA 2WPSA 1KYOH 1SLQA 1NO4A 2ZT9D 1HWTC 1SQXE 2A45I 1JMBA 2PGDA 3EQ2A 3VP9A 3TF5A 2Q3EA 1DD3A 1EDKA 2FKWB 4D6TJ 3CCEP 2KOGA 3L75G 5E79H 2L91A 2KS1B 5AW3B 1H88A 3H1LE 1L0ND 3F89A 3H1LJ 1FZGA 4UB6E 2FXPA 3TK1A 1KILD 4IL6H 3FGAD 3HUSC 3CCLP 1EQ7A 2ZVOB 3AEGC 2OYIB 2L5GB 2W6AA 3L73G 3L74G 3NTNA 1ZRTE 2QVAA 1AJYA 4ZKPA 3CWBD 1OFCX 5KLVE 1NH4A 3FX0A 1NTKE 1A02J 4EIJA 2N1TD 4Y28J 2WT7A 3MUDA 1KQFB 1YJ9P 1S9KE 1KTMA 3VN0A 4WY4A 1M56D 1S5LH 4CPGA 3BRTB 1Q82Q 2NPSD 2QJYC 5AVRB 2FFDB 2OYIC 1BE3E 1JCDA 1NAFA 1PP9G 1GL2A 1PPJD 1ZP0C 2KK7A 1KFNA 2J58A 3CWBJ 4I7ZC 4IFMA 4JBZA 2C9LY 2KNCA 3AEAC 1CZQA 2AEFA 2AXTH 2AEMA 3ZDMA 4DZOA 5KAFH 4JYBA 1K04A 1NOHA 1X22A 1KQLA 2KZIA 4JQ0D 3RL0B 4R4LA 1KORA 1JEKA 1RQVA 2V7QJ 1SQBJ 3CC4P 1JM0A 1GK4A 4OVNF 1NWQA 2ZXXA 1AQ5A 5KAFE 3CI9A 1S5LX 3E1RA 3AE9C 2E42A 1X9VA 4IFFA 4PV1D 5KJ7A 2QJYB 3H1HJ 1D7MA 2A06G 2KI7B 3AE2C 3FWNA 3CXHE 3I56P 1SFCD 1G2CA 1N7SC 3EFGA 3L70D 4HYTB 1NYHA 3CX5E 1CI6B 2KSEA 1N7SD 1URQD 2ITAA 4GIFA 3E7KA 2G8YA 4PD4H 3BRVB 1NHLA 1K9MQ 3HD7C 3WUVA 3CCSP 2IZ0A 2NPSA 3P8CE 1FZFA 2XKMA 2OGUA 5AW1B 3TNUA 3L72J 1L0LG 3CX5H 2YMKA 4U3FG 1NTZJ 2Q6QA 5APVA 1SQQK 1MKMA 1FOSF 1NTZG 2XV5A 1FC2C 1BGYE 3PRJA 3M9BA 1Z56A 4RJTA 4Y99C 1X0TA 5AVVB 3Q3DA 1EXIA 1BGYG 1MFZA 3PHLA 2XNDH 4WY4B 1EDLA 3C1LA 1RQUA 2POHA 3U1CA 1NTMG 3V2PA 1LTTC 3P8MC 3AE3C 1OZHA 5AW0B 2WSEH 2H7HA 1KILC 5KLVJ 3KXDA 1JY3O 3CL3D 4XA4A 3Q1MA 1J1EC 2BEQD 1KMIZ 1SQQD 3EFFK 3HD7D 3L71G 3W67A 1FZAA 1PGPA 1EC5A 3GMAA 1LGHB 3HE4B 2K3RA 2NPSB 3P8CD 3G71P 1DH3A 4IOIH 4L74A 2ZYAA 2HYNA 2QJPC 3R4YA 2C0XA 3VMYA 5APSA 3WUTA 3K5BA 2YNYA 1PGJA 1YQ4C 2CPBA 1YJNP 3IFMA 3BATA 4H13B 1FDIA 4WY4C 1L4AA 1LTIC 4XE5B 5L8RJ 1DD4A 1JOCA 1WT6A 3D6ZA 1NTKK 1LTGC 3CC2P 5APYA 3H25A 1E79H 3I5CA 1KN7A 5BVZA 3MIWA 3GHGA 3QWOC 3F5HA 4PV1B 1JY2N 1JO5A 1FOSE 3CCQP 1A02F 3WU2H 2QG4A 1LTJB 2P2UA 3NFQA 2P58A 2HFED 3AEBC 3KDPB 3NXSA 3O8ZA 2OYHC 2WQYC 4EYYQ 1M1KQ 4RKUJ 4YPCA 3HE5B 5CCHA 3Q5RA 2OTLP 3L70G 3CLQA 3SSUA 1U57A 1N7LA 1ZW0A 2WSFJ 3AE1C 2WSCH 4H44B 2HPCA 2FYNB 4H0LB 3L74E 3IAOA 3L73E 2P1JA 4UB8E 2LR2A 3M0DC 3RK3E 1FZCA 2IBZI 4GOFA 2CK3H 2E43A 1RE4A 1UIIA 1LTJA 4PJ0H 1VQ4P 2B9BA 1PIXA 1LP1B 1LTBC 2KLUA 4D6TE 1OWAA 1GMJA 2KLVA 1ZOYC 3H1IG 1MUUA 1Y47A 5AVWB 1PV3A 5AW7B 5KLIB 3H1IJ 1BDCA 4NPDA 1Y8AA 1L0NK 1J1DC 2H89C 4L75A 3TNUB 5KKZC 1KYOI 1SQQE 1S1CX 1W5CE 2YIUC 2N1TA 5CMZA 4LLHA 4YXDC 5AVQB 1T3UA 1LTSC 1LP1A 1VPCA 1W2EA 1SQXD 3A0HE 5EFWB 1VQ6P 3HD7B 1VL2A 3N4XA 2PRRA 2Q1KA 3SFDC 1N73B 1DEBA 2ZAEB 1R5LA 5H2FE 3VTPC 1BSHA 1N8RQ 3H1JE 1JUNA 1N7SB 1EZVI 1LNQA 3U59A 2ZYDA 3I55P 3H6PA 3L72E 1SQQJ 1XTGB 1RF1A 3HUSB 3E1IA 2AXCA 5AW2B 2E76B 1SQBG 5K5GB 1SQPJ 1BCCG 2YXQB 1FU1A 2ZFCA 1SQVJ 2IDBA 3AE8C 2KYVA 1PL5A 2GM4A 3CMEP 1QVGO 4D6TG 1YQ3C 2JP3A 1T2KC 2W8ZA 1Q86Q 1SQVG 3A3YB 1HTLC 1BSNA 2FY8A 4PJ0E 3JC22 4UB6H 5KJ7D 3RL0C 4N6JA 1ZR2A 1L0LD 3CCMP 4I7ZB 3SFEC 2FBWC 1AV1A 2M5AA 5CBNA 5GTHE 2FFDC 1JY3N 3FXDA 2ZXEB 3L70E 4H13D 2HR3A 2FYNC 2Q5UA 1OMIA 2JWDA 1HVVA 2R5DA 1HUCA 1M57D 2G3AA 3L72G 4H44C 3S1KA 1GDTA 4BWNA 3MTUE 4LGDE 1QGKB 3GG2A 4OGQC 2OYHA 3CX5I 1QVFO 5AVTB 5H2FH 1VQPP 1URQA 2K37A 5KKZB 1FZBA 2JR8A 3H1KJ 1NTMD 1SQXK 2C0WA 2M3BA 1NTMJ 1VQMP 1Y9BA 2YMYA 1NTKJ 5KLIC 1ZV8A 5M1BA 4K3AA 4BRYB 3M9QA 3T97A 2Z4EA 3CC7P 1GL2C 1N2DC 1QX8A 2K88A 2UWJE 1HF9A 1P84H 2FXOA 3OAKA 3GF3A 2AXTE 4AYCA 4H0LC 3H1JD 5KAIE 5CCHD 3Q2YA 3PLNA 1GTWA 4HB1A 4U3FD 3M91A 2KUBA 3B71A 3HE5A 2M8RA 3B5NC 3M0AA 4LC1A 1K8AQ 4L73A 4C7NB 2P67A 2E75D 3G6EP 1GW3A 1H8AA 1FJPA 5GTIE 3AECC 4NPFX 3U1AA 2OYHB 1PFIA 1L0NE 1PP9D 1LT1A 2V4HA 1LTJC 2RKLA 1YJWP 2RN0A 1H0TA 2K1AA 3JSVC 3CCUP 3LW5H 3A0HH 3RK2C 3C9IA 1IO4A 5CJ4A 1VQLP 3KPEA 5C39A 1PGQA 5TJHA 2JWAA 1VF5D 5B5EH 1JY2P 1M1JC 5BU8B 1U7MA 2QIWA 3L74D 1IK9A 3G9RA 3GHGB 1LTAC 3L73D 2I8DA 1L0LE 2R3CA 4H13C 1IC2A 2IZ1A 2IYPA 3SWFA 4NPEA 1EZVE 2LXCB 2GUSA 1CI6A 2OQQA 1SP4A 1P84D 2B87B 5CJ0A 3CCVP 1KQSO 1OVUA 1Q81Q 1ZMEC 3AE5C
chains in the Genus database with same CATH topology
4EYYQ 1NVOA 2M5AB 3MZWB 1ZW0A 3FXEA 4K35A 2LXBA 2LR2A 2SPZA 2M0BA 4GOFA 4MN4C 1MFTA 4BXLA 1LP1B 1JMBA 4HJGH 1EDKA 1Y47A 2KS1B 1BDCA 4NPDA 3MHVA 1EDIA 5DJTB 2QVAA 1LP1A 5EFWB 1Q2NA 2Q1KA 2ZAEB 4HKZH 3RGUA 4CPGA 1S3JA 2B89A 2KIKA 1DEEG 5CBOA 4JBZA 5K5GB 3PH0A 3ZDMA 1OVRA 2KZIA 1OVVA 1JM0A 2M5AA 5CBNA 3FXDA 2KI7B 2HR3A 4ASWA 3S1KA 2JWDA 1ZXGA 1SS1A 4ASVA 1FC2C 1X0TA 5DJUB 4K3AA 2B88A 2QRXA 2UWJE 1EDLA 4WWIA 4GODA 1EDJA 4KJMA 2WMMA 4HB1A 2KUBA 1H0TB 2R44A 1BDDA 2OTKE 2B87A 1EC5A 4NPFX 2K3RA 1LT1A 4IOIH 2RKLA 1H0TA 2KZJA 4ZNCA 5C39A 4GOEA 1U7JA 1U7MA 3QWOC 2I8DA 4NPEA 2LXCB 4ZMDA 2B87B 2P58A 1OVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EYY Q;  1NVO A;  2M5A B;  3MZW B;  1ZW0 A;  3FXE A;  4K35 A;  2LXB A;  2LR2 A;  2SPZ A;  2M0B A;  4GOF A;  4MN4 C;  1MFT A;  4BXL A;  1LP1 B;  1JMB A;  4HJG H;  1EDK A;  1Y47 A;  2KS1 B;  1BDC A;  4NPD A;  3MHV A;  1EDI A;  5DJT B;  2QVA A;  1LP1 A;  5EFW B;  1Q2N A;  2Q1K A;  2ZAE B;  4HKZ H;  3RGU A;  4CPG A;  1S3J A;  2B89 A;  2KIK A;  1DEE G;  5CBO A;  4JBZ A;  5K5G B;  3PH0 A;  3ZDM A;  1OVR A;  2KZI A;  1OVV A;  1JM0 A;  2M5A A;  5CBN A;  3FXD A;  2KI7 B;  2HR3 A;  4ASW A;  3S1K A;  2JWD A;  1ZXG A;  1SS1 A;  4ASV A;  1FC2 C;  1X0T A;  5DJU B;  4K3A A;  2B88 A;  2QRX A;  2UWJ E;  1EDL A;  4WWI A;  4GOD A;  1EDJ A;  4KJM A;  2WMM A;  4HB1 A;  2KUB A;  1H0T B;  2R44 A;  1BDD A;  2OTK E;  2B87 A;  1EC5 A;  4NPF X;  2K3R A;  1LT1 A;  4IOI H;  2RKL A;  1H0T A;  2KZJ A;  4ZNC A;  5C39 A;  4GOE A;  1U7J A;  1U7M A;  3QWO C;  2I8D A;  4NPE A;  2LXC B;  4ZMD A;  2B87 B;  2P58 A;  1OVU A; 
#chains in the Genus database with same CATH topology
 1N73 A;  3L37 A;  1XTC C;  2Z5I A;  3NMD A;  1T3J A;  4QMA A;  2KXP B;  1RF0 C;  3L71 J;  2DW3 A;  1W2B O;  2HPC B;  1RF1 C;  2MKV A;  3L71 E;  3V2R A;  1KIL B;  3HTK B;  2WWW A;  2SPZ A;  3H1I D;  3TDK A;  2I1J A;  2O01 H;  2M0B A;  1CW5 A;  1KV4 A;  3USS A;  4YTP C;  1JMM A;  1KB9 D;  2KS1 A;  3VOP A;  2Y9Y A;  3KZI E;  1SQV K;  2PP6 A;  4BXL A;  4DCK A;  1M7L A;  4HJG H;  1OW6 A;  1S4X A;  2E76 D;  2FXM A;  4I6M C;  1NTZ D;  5GTH H;  1GL2 B;  3HUS A;  3H1J J;  4RO0 A;  3V4Q A;  3D71 A;  1PP9 E;  1PP9 J;  1NAY A;  1VDF A;  2E76 C;  1MV8 A;  3VMA A;  4N78 E;  2E74 D;  3A7O A;  2Q7C A;  1KZU B;  1NTZ E;  3MP7 B;  2IX7 C;  2W27 A;  3QH9 A;  3EWK A;  5DJT B;  1VQ7 P;  1VQK P;  5BU5 A;  2VRS A;  2ZT9 B;  1KYO E;  4U3F E;  2K9J A;  2BCC D;  2FYU K;  1QL2 A;  2OYI A;  3CXH I;  1BCC D;  1LT9 A;  2J59 M;  1SQP G;  1ZLL A;  3BCC G;  3L75 D;  3RGU A;  3VMZ A;  3L75 J;  3LW5 J;  3H1H G;  2R32 A;  3O6Q A;  1VQO P;  1KQG B;  1NTZ K;  2N9B A;  3V2Q A;  5CCH C;  1LWU A;  1HBW A;  2WZ7 A;  1DIP A;  1DEE G;  2YIU B;  3H1L G;  5CCG C;  2QSI A;  3M06 A;  1NGM B;  1J1D B;  1NTM K;  3HRN A;  1BGY D;  2GUV A;  2WIT A;  3PP5 A;  5AW8 B;  4HH2 A;  1P84 E;  3P7K A;  4Z1M H;  3V2N A;  2E75 B;  2R3S A;  1FZE A;  1OVV A;  5AVX B;  5APU A;  1VF5 C;  1IJD B;  3KZI H;  3HTK A;  4N3Y B;  5AVY B;  4IFD K;  1JNM A;  3TGU E;  1S72 P;  1M1J A;  1BE3 J;  3CX5 D;  3FWL A;  5AW5 B;  3L36 A;  5KLV K;  2WT7 B;  2IBZ E;  4ASW A;  3CD6 P;  1ZXG A;  1JB0 J;  2D2C B;  1S2E A;  3A0B H;  2WPQ A;  1PZQ A;  4RES B;  4WY4 D;  1L0N J;  3CCR P;  3JCU H;  2Q3I A;  4PD4 I;  2LKM A;  3B5N D;  3ABV C;  1NTK G;  2Y0E A;  4M3L A;  4A7P A;  3B8E B;  5KLV G;  3CPW O;  1SS1 A;  5B66 E;  2YO3 A;  5CCG D;  2Z5H A;  4ASV A;  4KHX A;  1FE6 A;  1X8Y A;  2O3J A;  3RK3 D;  1OW7 A;  2JKV A;  1T2K D;  1GK6 A;  1IFP A;  2B88 A;  3VYI A;  2D2C D;  2QRX A;  1K05 A;  2WPR A;  4EI2 A;  1NJI Q;  1JY3 P;  1NU1 K;  1CSB A;  2E5Y A;  3GF7 A;  3M9H A;  2MJZ A;  1SQB K;  1S9K D;  3L75 E;  1FDM A;  2E74 B;  2M3E A;  1BCC E;  2YXR B;  1L4A B;  5AVZ B;  1S5L E;  4KJM A;  1IFM A;  4C46 A;  1SQX G;  2QJK B;  4OWF A;  2WMM A;  1JY2 O;  2WSF H;  1WRG A;  4U3F J;  2QA4 P;  3VMX A;  3V4W A;  1ZRT D;  3A0B E;  1RF1 B;  1GL2 D;  1HJ0 A;  2QEX P;  1YHQ P;  3RL0 g;  4N78 D;  2B87 A;  1KIL E;  1WMK A;  2IBZ G;  1KIL A;  3B5N A;  4DT0 A;  3TGU J;  2IYO A;  5APQ A;  4I2L C;  3WU2 E;  2IFM A;  5KAI H;  2OTJ P;  2YKQ A;  1YTZ I;  3TGU G;  1L4A D;  2K9Y A;  1USD A;  2HG5 D;  2BEZ F;  2ZVN B;  2P10 A;  3S4R A;  1PPJ G;  3GLM A;  3L70 J;  3P32 A;  2O01 J;  2FYU E;  1GW4 A;  3RBZ A;  3CMA P;  3H1I E;  2O1J A;  1HGZ A;  3LIE A;  3OJA B;  4WVZ A;  1JTH A;  1MZ9 A;  2HLO A;  1HH0 A;  4TLF A;  1IFD A;  1PGO A;  1Q90 D;  3AEE C;  3H1H E;  3RBX A;  1SFC B;  2HOD A;  1RE3 A;  2RH0 A;  4ZMD A;  1SQP E;  3BCC E;  3D70 A;  1QL1 A;  1URQ B;  5TIS H;  3RK3 C;  2FYU J;  2W6J H;  2FYZ A;  1BE3 D;  5GTI H;  4AUW A;  1J1E B;  2WSE J;  2J5U A;  1LWU C;  2N1T B;  3MZW B;  2OYO A;  3O6Q B;  1KC8 Q;  1GD2 E;  3IF4 A;  2W83 C;  3KQG A;  4GDO A;  2LXB A;  4K35 A;  4OH8 B;  1IFN A;  5TIS E;  1G2C B;  1L2P A;  2KP8 A;  4MN4 C;  2BCC J;  4B86 A;  4EDF A;  1L4A C;  2FYU D;  1SQV D;  3CWB G;  4W7Y A;  1MFT A;  1SFC A;  2E74 C;  2HOD B;  2YKP A;  1KYO D;  2BCC G;  3KYQ A;  1Q7Y Q;  1YI2 P;  2O1K A;  3PJS K;  5B5E E;  1VF5 B;  1NU1 E;  2O01 N;  2P7J A;  3OA7 A;  2E75 C;  3Q5P A;  3RK2 D;  3TSI A;  2Y9Z A;  1AVO A;  4KT0 J;  2N9Y B;  2Y0C A;  1RE3 C;  1ZR4 A;  3V5B A;  1EXJ A;  1M90 Q;  2QE7 H;  3IR9 A;  3MHV A;  3BAS A;  4R4M A;  2IPP A;  1BCC J;  1EDI A;  1K73 Q;  4YXW H;  1VQN P;  2WPV B;  2C9N Y;  2ZJS E;  4PD4 E;  1NU1 D;  3JCU E;  1HGV A;  4I1L A;  2JO1 A;  4OGQ B;  1LJ2 A;  1Q2N A;  4WB4 A;  3MUD C;  4JF7 A;  1KB9 E;  3CXH H;  3TYY A;  1IFI A;  1RY3 A;  1N73 C;  1GU4 A;  1IFJ A;  2D2C C;  1RHZ B;  3M0D A;  2GA1 A;  1FZC C;  3L73 J;  3L74 J;  2BAS A;  4HKZ H;  3VP8 A;  2ZT9 C;  4O9B A;  1G1J A;  1M8O B;  4DOJ A;  1JTH B;  3WUU A;  1S3J A;  2B89 A;  1L0L J;  2PAJ A;  1LT9 C;  1TU3 F;  1EZV G;  2KIK A;  3H32 B;  1RF0 A;  1JCC A;  2WSC J;  2V7Q H;  1YTZ T;  2H8P D;  3SWY A;  3WMM 0;  4ZKU A;  5CBO A;  1FDO A;  1NTM E;  2XU6 A;  3PH0 A;  1R8E A;  1NU1 G;  3H1K E;  2WSS H;  1FJK A;  1R5S A;  2AEJ A;  2OAR A;  3H1H D;  1FAV A;  3ITK A;  1OVR A;  4OGQ D;  3V6I A;  1NKZ B;  1NU1 J;  2A06 D;  4JPZ B;  2XNX A;  3W68 A;  1VQ8 P;  1QLE D;  2YO2 A;  1SQB D;  1YBK A;  2Q9I A;  4BRY A;  3H32 A;  4GKG A;  3C8V A;  4UB8 H;  3H1K G;  2IFN A;  1N7S A;  5KTB A;  1LT9 B;  1L0N G;  2H43 A;  2XDJ A;  1G1I A;  1QEX A;  2NRG A;  3CXH D;  1SVF A;  2IBZ D;  1T6A A;  3LID A;  1YYC A;  4L76 A;  3OW2 O;  3G3Z A;  3BVH A;  2QM7 A;  1FZC B;  1GZL A;  2KSJ A;  3KHU A;  2FFD A;  1AFO A;  1J2J B;  1KD1 Q;  4H0L D;  4EOT A;  1IK7 A;  1VQ5 P;  3GW6 A;  4JYC A;  4WBA A;  1KB9 H;  1OIP A;  2E5T A;  2NZ2 A;  2YKO A;  1GU5 A;  2A06 E;  3N7N A;  3UIA A;  5APX A;  1N86 A;  3IN6 A;  1YIT P;  3H1K D;  1AVY A;  1E5W A;  5AW4 B;  3AEF C;  1SQP K;  3GHG C;  3A5T A;  1RE4 C;  5DJU B;  1PPJ E;  5CCG A;  1FS0 E;  1IZN B;  3MGN A;  4GT1 A;  1OXZ A;  1RH5 B;  5AW9 B;  3D6Y A;  1YIJ P;  1DX7 A;  3B4S A;  1OX3 A;  4W80 A;  3AE6 C;  4WWI A;  5AVS B;  2WTY A;  2RMZ A;  5APW A;  1VQ9 P;  1AQT A;  4GOD A;  1NKN A;  3T97 B;  4C7N A;  1EDJ A;  2BCC E;  1NTK D;  1BE3 G;  2QJP B;  2R5B A;  5KLV D;  3SWK A;  3CWB E;  1BGY J;  2A45 H;  1LWU B;  2N1T C;  2A45 G;  3L35 A;  1HJB A;  1H0T B;  2R44 A;  4PD4 D;  2PFX A;  3AED C;  1BDD A;  2OTK E;  3A2A A;  3BCC J;  3PTZ A;  3B5N B;  1URQ C;  4TT3 H;  1P84 I;  3RK3 B;  3L4F A;  2W90 A;  3CCJ P;  5APT A;  3H1L D;  4H44 D;  1SFC C;  2K9J B;  2JDI H;  2I1K A;  3HD7 A;  4AQR D;  1X79 B;  2WVR A;  5CHX A;  3AE7 C;  3II6 A;  4PV1 C;  4D6T D;  2KZJ A;  2JEE A;  4IL6 E;  4ZNC A;  1SQV E;  1M1J B;  2CPS A;  3MD0 A;  5AVU B;  4GOE A;  1U7J A;  5B66 H;  5KJ7 C;  3TGU D;  5E79 E;  4Y99 B;  3RL0 D;  1KB9 I;  4XFJ A;  1SQB E;  2JJL A;  3L71 D;  2Y0D A;  3RK2 B;  2FYU G;  3R2P A;  1USE A;  3AE4 C;  3G4S P;  1SQX J;  4U7J A;  1H89 A;  1OW8 A;  2KNC B;  4W7Z A;  5AW6 B;  1SQP D;  1ZN5 A;  2NPS C;  2ZYG A;  3BCC D;  3H1J G;  1T8Z A;  2KB7 P;  4IL6 X;  1EZV D;  1FBM A;  1AA0 A;  1NVO A;  2H88 C;  1UIX A;  2M5A B;  2W6B A;  3L72 D;  3S9O A;  3Q5S A;  1L0L K;  3FXE A;  3HE4 A;  4C7R A;  4DJG A;  1KFM A;  1SQQ G;  2QJK C;  2QM8 A;  2XZR A;  2WPS A;  1KYO H;  1SLQ A;  1NO4 A;  2ZT9 D;  1HWT C;  1SQX E;  2A45 I;  1JMB A;  2PGD A;  3EQ2 A;  3VP9 A;  3TF5 A;  2Q3E A;  1DD3 A;  1EDK A;  2FKW B;  4D6T J;  3CCE P;  2KOG A;  3L75 G;  5E79 H;  2L91 A;  2KS1 B;  5AW3 B;  1H88 A;  3H1L E;  1L0N D;  3F89 A;  3H1L J;  1FZG A;  4UB6 E;  2FXP A;  3TK1 A;  1KIL D;  4IL6 H;  3FGA D;  3HUS C;  3CCL P;  1EQ7 A;  2ZVO B;  3AEG C;  2OYI B;  2L5G B;  2W6A A;  3L73 G;  3L74 G;  3NTN A;  1ZRT E;  2QVA A;  1AJY A;  4ZKP A;  3CWB D;  1OFC X;  5KLV E;  1NH4 A;  3FX0 A;  1NTK E;  1A02 J;  4EIJ A;  2N1T D;  4Y28 J;  2WT7 A;  3MUD A;  1KQF B;  1YJ9 P;  1S9K E;  1KTM A;  3VN0 A;  4WY4 A;  1M56 D;  1S5L H;  4CPG A;  3BRT B;  1Q82 Q;  2NPS D;  2QJY C;  5AVR B;  2FFD B;  2OYI C;  1BE3 E;  1JCD A;  1NAF A;  1PP9 G;  1GL2 A;  1PPJ D;  1ZP0 C;  2KK7 A;  1KFN A;  2J58 A;  3CWB J;  4I7Z C;  4IFM A;  4JBZ A;  2C9L Y;  2KNC A;  3AEA C;  1CZQ A;  2AEF A;  2AXT H;  2AEM A;  3ZDM A;  4DZO A;  5KAF H;  4JYB A;  1K04 A;  1NOH A;  1X22 A;  1KQL A;  2KZI A;  4JQ0 D;  3RL0 B;  4R4L A;  1KOR A;  1JEK A;  1RQV A;  2V7Q J;  1SQB J;  3CC4 P;  1JM0 A;  1GK4 A;  4OVN F;  1NWQ A;  2ZXX A;  1AQ5 A;  5KAF E;  3CI9 A;  1S5L X;  3E1R A;  3AE9 C;  2E42 A;  1X9V A;  4IFF A;  4PV1 D;  5KJ7 A;  2QJY B;  3H1H J;  1D7M A;  2A06 G;  2KI7 B;  3AE2 C;  3FWN A;  3CXH E;  3I56 P;  1SFC D;  1G2C A;  1N7S C;  3EFG A;  3L70 D;  4HYT B;  1NYH A;  3CX5 E;  1CI6 B;  2KSE A;  1N7S D;  1URQ D;  2ITA A;  4GIF A;  3E7K A;  2G8Y A;  4PD4 H;  3BRV B;  1NHL A;  1K9M Q;  3HD7 C;  3WUV A;  3CCS P;  2IZ0 A;  2NPS A;  3P8C E;  1FZF A;  2XKM A;  2OGU A;  5AW1 B;  3TNU A;  3L72 J;  1L0L G;  3CX5 H;  2YMK A;  4U3F G;  1NTZ J;  2Q6Q A;  5APV A;  1SQQ K;  1MKM A;  1FOS F;  1NTZ G;  2XV5 A;  1FC2 C;  1BGY E;  3PRJ A;  3M9B A;  1Z56 A;  4RJT A;  4Y99 C;  1X0T A;  5AVV B;  3Q3D A;  1EXI A;  1BGY G;  1MFZ A;  3PHL A;  2XND H;  4WY4 B;  1EDL A;  3C1L A;  1RQU A;  2POH A;  3U1C A;  1NTM G;  3V2P A;  1LTT C;  3P8M C;  3AE3 C;  1OZH A;  5AW0 B;  2WSE H;  2H7H A;  1KIL C;  5KLV J;  3KXD A;  1JY3 O;  3CL3 D;  4XA4 A;  3Q1M A;  1J1E C;  2BEQ D;  1KMI Z;  1SQQ D;  3EFF K;  3HD7 D;  3L71 G;  3W67 A;  1FZA A;  1PGP A;  1EC5 A;  3GMA A;  1LGH B;  3HE4 B;  2K3R A;  2NPS B;  3P8C D;  3G71 P;  1DH3 A;  4IOI H;  4L74 A;  2ZYA A;  2HYN A;  2QJP C;  3R4Y A;  2C0X A;  3VMY A;  5APS A;  3WUT A;  3K5B A;  2YNY A;  1PGJ A;  1YQ4 C;  2CPB A;  1YJN P;  3IFM A;  3BAT A;  4H13 B;  1FDI A;  4WY4 C;  1L4A A;  1LTI C;  4XE5 B;  5L8R J;  1DD4 A;  1JOC A;  1WT6 A;  3D6Z A;  1NTK K;  1LTG C;  3CC2 P;  5APY A;  3H25 A;  1E79 H;  3I5C A;  1KN7 A;  5BVZ A;  3MIW A;  3GHG A;  3QWO C;  3F5H A;  4PV1 B;  1JY2 N;  1JO5 A;  1FOS E;  3CCQ P;  1A02 F;  3WU2 H;  2QG4 A;  1LTJ B;  2P2U A;  3NFQ A;  2P58 A;  2HFE D;  3AEB C;  3KDP B;  3NXS A;  3O8Z A;  2OYH C;  2WQY C;  4EYY Q;  1M1K Q;  4RKU J;  4YPC A;  3HE5 B;  5CCH A;  3Q5R A;  2OTL P;  3L70 G;  3CLQ A;  3SSU A;  1U57 A;  1N7L A;  1ZW0 A;  2WSF J;  3AE1 C;  2WSC H;  4H44 B;  2HPC A;  2FYN B;  4H0L B;  3L74 E;  3IAO A;  3L73 E;  2P1J A;  4UB8 E;  2LR2 A;  3M0D C;  3RK3 E;  1FZC A;  2IBZ I;  4GOF A;  2CK3 H;  2E43 A;  1RE4 A;  1UII A;  1LTJ A;  4PJ0 H;  1VQ4 P;  2B9B A;  1PIX A;  1LP1 B;  1LTB C;  2KLU A;  4D6T E;  1OWA A;  1GMJ A;  2KLV A;  1ZOY C;  3H1I G;  1MUU A;  1Y47 A;  5AVW B;  1PV3 A;  5AW7 B;  5KLI B;  3H1I J;  1BDC A;  4NPD A;  1Y8A A;  1L0N K;  1J1D C;  2H89 C;  4L75 A;  3TNU B;  5KKZ C;  1KYO I;  1SQQ E;  1S1C X;  1W5C E;  2YIU C;  2N1T A;  5CMZ A;  4LLH A;  4YXD C;  5AVQ B;  1T3U A;  1LTS C;  1LP1 A;  1VPC A;  1W2E A;  1SQX D;  3A0H E;  5EFW B;  1VQ6 P;  3HD7 B;  1VL2 A;  3N4X A;  2PRR A;  2Q1K A;  3SFD C;  1N73 B;  1DEB A;  2ZAE B;  1R5L A;  5H2F E;  3VTP C;  1BSH A;  1N8R Q;  3H1J E;  1JUN A;  1N7S B;  1EZV I;  1LNQ A;  3U59 A;  2ZYD A;  3I55 P;  3H6P A;  3L72 E;  1SQQ J;  1XTG B;  1RF1 A;  3HUS B;  3E1I A;  2AXC A;  5AW2 B;  2E76 B;  1SQB G;  5K5G B;  1SQP J;  1BCC G;  2YXQ B;  1FU1 A;  2ZFC A;  1SQV J;  2IDB A;  3AE8 C;  2KYV A;  1PL5 A;  2GM4 A;  3CME P;  1QVG O;  4D6T G;  1YQ3 C;  2JP3 A;  1T2K C;  2W8Z A;  1Q86 Q;  1SQV G;  3A3Y B;  1HTL C;  1BSN A;  2FY8 A;  4PJ0 E;  3JC2 2;  4UB6 H;  5KJ7 D;  3RL0 C;  4N6J A;  1ZR2 A;  1L0L D;  3CCM P;  4I7Z B;  3SFE C;  2FBW C;  1AV1 A;  2M5A A;  5CBN A;  5GTH E;  2FFD C;  1JY3 N;  3FXD A;  2ZXE B;  3L70 E;  4H13 D;  2HR3 A;  2FYN C;  2Q5U A;  1OMI A;  2JWD A;  1HVV A;  2R5D A;  1HUC A;  1M57 D;  2G3A A;  3L72 G;  4H44 C;  3S1K A;  1GDT A;  4BWN A;  3MTU E;  4LGD E;  1QGK B;  3GG2 A;  4OGQ C;  2OYH A;  3CX5 I;  1QVF O;  5AVT B;  5H2F H;  1VQP P;  1URQ A;  2K37 A;  5KKZ B;  1FZB A;  2JR8 A;  3H1K J;  1NTM D;  1SQX K;  2C0W A;  2M3B A;  1NTM J;  1VQM P;  1Y9B A;  2YMY A;  1NTK J;  5KLI C;  1ZV8 A;  5M1B A;  4K3A A;  4BRY B;  3M9Q A;  3T97 A;  2Z4E A;  3CC7 P;  1GL2 C;  1N2D C;  1QX8 A;  2K88 A;  2UWJ E;  1HF9 A;  1P84 H;  2FXO A;  3OAK A;  3GF3 A;  2AXT E;  4AYC A;  4H0L C;  3H1J D;  5KAI E;  5CCH D;  3Q2Y A;  3PLN A;  1GTW A;  4HB1 A;  4U3F D;  3M91 A;  2KUB A;  3B71 A;  3HE5 A;  2M8R A;  3B5N C;  3M0A A;  4LC1 A;  1K8A Q;  4L73 A;  4C7N B;  2P67 A;  2E75 D;  3G6E P;  1GW3 A;  1H8A A;  1FJP A;  5GTI E;  3AEC C;  4NPF X;  3U1A A;  2OYH B;  1PFI A;  1L0N E;  1PP9 D;  1LT1 A;  2V4H A;  1LTJ C;  2RKL A;  1YJW P;  2RN0 A;  1H0T A;  2K1A A;  3JSV C;  3CCU P;  3LW5 H;  3A0H H;  3RK2 C;  3C9I A;  1IO4 A;  5CJ4 A;  1VQL P;  3KPE A;  5C39 A;  1PGQ A;  5TJH A;  2JWA A;  1VF5 D;  5B5E H;  1JY2 P;  1M1J C;  5BU8 B;  1U7M A;  2QIW A;  3L74 D;  1IK9 A;  3G9R A;  3GHG B;  1LTA C;  3L73 D;  2I8D A;  1L0L E;  2R3C A;  4H13 C;  1IC2 A;  2IZ1 A;  2IYP A;  3SWF A;  4NPE A;  1EZV E;  2LXC B;  2GUS A;  1CI6 A;  2OQQ A;  1SP4 A;  1P84 D;  2B87 B;  5CJ0 A;  3CCV P;  1KQS O;  1OVU A;  1Q81 Q;  1ZME C;  3AE5 C; 
#chains in the Genus database with same CATH homology
 4EYY Q;  1NVO A;  2M5A B;  3MZW B;  1ZW0 A;  3FXE A;  4K35 A;  2LXB A;  2LR2 A;  2SPZ A;  2M0B A;  4GOF A;  4MN4 C;  1MFT A;  4BXL A;  1LP1 B;  1JMB A;  4HJG H;  1EDK A;  1Y47 A;  2KS1 B;  1BDC A;  4NPD A;  3MHV A;  1EDI A;  5DJT B;  2QVA A;  1LP1 A;  5EFW B;  1Q2N A;  2Q1K A;  2ZAE B;  4HKZ H;  3RGU A;  4CPG A;  1S3J A;  2B89 A;  2KIK A;  1DEE G;  5CBO A;  4JBZ A;  5K5G B;  3PH0 A;  3ZDM A;  1OVR A;  2KZI A;  1OVV A;  1JM0 A;  2M5A A;  5CBN A;  3FXD A;  2KI7 B;  2HR3 A;  4ASW A;  3S1K A;  2JWD A;  1ZXG A;  1SS1 A;  4ASV A;  1FC2 C;  1X0T A;  5DJU B;  4K3A A;  2B88 A;  2QRX A;  2UWJ E;  1EDL A;  4WWI A;  4GOD A;  1EDJ A;  4KJM A;  2WMM A;  4HB1 A;  2KUB A;  1H0T B;  2R44 A;  1BDD A;  2OTK E;  2B87 A;  1EC5 A;  4NPF X;  2K3R A;  1LT1 A;  4IOI H;  2RKL A;  1H0T A;  2KZJ A;  4ZNC A;  5C39 A;  4GOE A;  1U7J A;  1U7M A;  3QWO C;  2I8D A;  4NPE A;  2LXC B;  4ZMD A;  2B87 B;  2P58 A;  1OVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...