4IOIH

Meditope-enabled trastuzumab in complex with cqfdlstrrlkc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
53
structure length
53
Chain Sequence
SYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Trastuzumab light chain
total genus 23
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2013-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4ioiH00
1U7JA 5CBNA 2M5AB 1LP1B 1OVUA 4EYYQ 5CBOA 2Q1KA 4IOIH 2SPZA 5C39A 1ZXGA 1BDCA 3MZWB 2K3RA 1NVOA 4JBZA 4MN4C 3MHVA 2B89A 4GOFA 2KZIA 3ZDMA 1MFTA 4NPDA 4ZNCA 2KZJA 2KIKA 2LXBA 2B87B 1EC5A 4HKZH 5EFWB 1ZW0A 2M0BA 2OTKE 4CPGA 2LXCB 4K35A 4ASWA 1EDKA 1U7MA 1LT1A 1X0TA 1EDIA 1LP1A 1H0TB 1JM0A 4KJMA 1EDLA 4ASVA 4ZMDA 5DJTB 2P58A 3FXDA 1H0TA 2KS1B 1EDJA 2HR3A 4NPEA 1S3JA 3RGUA 2B88A 2WMMA 1SS1A 4GODA 5K5GB 1JMBA 2JWDA 4HB1A 3PH0A 1DEEG 4GOEA 5DJUB 2KI7B 2B87A 4WWIA 4K3AA 2RKLA 2QRXA 2LR2A 2KUBA 1OVVA 2QVAA 1BDDA 1Y47A 1Q2NA 2R44A 1OVRA 2ZAEB 4BXLA 3QWOC 4HJGH 2M5AA 3FXEA 3S1KA 2I8DA 2UWJE 1FC2C 4NPFX
chains in the Genus database with same CATH superfamily
1W2BO 1U7JA 1SQQD 2OYIA 1LP1B 2R32A 2W83C 3EFGA 1VQNP 3A5TA 1CW5A 1JMMA 1QGKB 2W90A 1Z56A 1JOCA 1ZXGA 1VF5C 1NH4A 2N1TC 3GG2A 3H1HD 3M0AA 1MZ9A 1RQUA 4U3FG 3L35A 1SQVG 1SQVJ 3Q3DA 1BSNA 3R4YA 4MN4C 2Q3EA 2IFMA 3B8EB 1ZRTE 3PJSK 5KLVG 1GU4A 1M1KQ 2NZ2A 3GF3A 1DIPA 1LTJA 2WWWA 1L4AA 4PV1B 4W7YA 5KAIH 1FJKA 1LNQA 3BRVB 3CWBG 2A45H 2KZIA 2QJYB 2H43A 3OW2O 2E74D 3A3YB 3H1HE 1M7LA 4KT0J 1KYOD 1T8ZA 4AUWA 1L0LJ 1MFTA 4AYCA 1YJ9P 1H88A 1IK7A 2L91A 1N2DC 2AEMA 5CMZA 1M57D 1AQTA 4JPZB 4U3FD 2W27A 2LXBA 3M9HA 3RL0B 1NAFA 3JC22 2R3SA 2O1JA 1QX8A 3L75J 2HODA 3L72D 4RESB 2FYUK 1N7SC 3B5NA 1VQ8P 3TGUE 2OTKE 1OIPA 1YTZT 3CX5I 3OA7A 1SLQA 3AE6C 2AXTE 3UIAA 2LXCB 4EOTA 2E74C 1N73B 3CX5H 3RL0D 2H7HA 4K35A 3T97B 1BSHA 1FZCC 4Y99B 2P10A 3H1JD 3MD0A 3A0BH 1OZHA 2OQQA 5APYA 3KZIH 1EDKA 2KXPB 3L72E 2V7QH 1U7MA 1Q82Q 2YO2A 4GIFA 5E79E 3LW5H 1EQ7A 3A0HE 5TJHA 2JR8A 2BCCG 1BGYJ 2QIWA 4ZKPA 1VF5D 1PZQA 2ZYGA 1FE6A 3P8CD 3CX5E 2GUSA 1YIJP 2QJPC 1NTZK 3A2AA 2FXMA 3HD7A 3HUSB 4KJMA 3GHGB 3A0BE 2XNDH 1EDLA 1VQ6P 1HGZA 4ASVA 4ZMDA 5DJTB 1SQVD 3RK3B 1VF5B 3H1KJ 2K1AA 5M1BA 4HH2A 3USSA 3Q1MA 2OYHA 5H2FH 2OTJP 1FJPA 3CWBE 1YHQP 4L74A 1HJ0A 2NPSA 1ZLLA 3CX5D 3KZIE 1KQGB 2KS1B 4HYTB 2KK7A 2Y0CA 5AVUB 1EDJA 2C0WA 1VQ7P 3TSIA 1HGVA 2Q3IA 4NPEA 1SQVE 1S3JA 2O01J 2R3CA 2E76D 3S4RA 3D70A 2WMMA 1GK6A 1SS1A 5APXA 5K5GB 2H8PD 3BCCG 3ITKA 2KLUA 3CCSP 3CCUP 3L71D 1NTMK 4HB1A 5CJ0A 1URQB 2IFNA 1NTZD 3E1RA 1KB9H 2HPCB 1DEEG 1OWAA 4GOEA 3MIWA 5L8RJ 2YKPA 2IZ0A 4WWIA 3AE8C 2OTLP 2KSJA 2NRGA 5CJ4A 3AE3C 3FWLA 2YIUC 1LT9B 3V2PA 2FYZA 1QVGO 1IJDB 4R4LA 1AVYA 4C7NA 3AEFC 3L37A 5GTIH 2QEXP 1HBWA 2IBZI 2FFDB 3PRJA 1SQPD 1RE4A 4Y28J 1NJIQ 1M8OB 1BGYD 1LTIC 4OWFA 1BE3J 2WSCJ 1G2CA 1VQ9P 1JCCA 3AEEC 2E43A 1RY3A 3H1LG 3WU2H 1Y47A 1Q81Q 2R5BA 2ZVOB 3H1IJ 3V2QA 1JY2P 1OVRA 3G3ZA 1LTGC 5AVWB 5KLVE 2WITA 3O6QB 5GTIE 1PP9G 2G8YA 1RH5B 4UB8H 4BXLA 1HJBA 1UIIA 2GA1A 3CXHD 3L36A 4BWNA 5KLVJ 2ZT9C 1NU1G 3PLNA 1YQ3C 3RK3E 3CPWO 3L73E 1FZAA 2Y0EA 1FZCA 1JY3O 3CI9A 1NOHA 3H1IG 4U3FJ 1KILE 1ZR2A 3CLQA 1GTWA 1LTJC 3HTKB 1J1DC 2UWJE 2L5GB 2M8RA 1P84H 3NXSA 1N7SA 1FC2C 3B5NC 1GL2A 2A45I 2YXQB 3RK2D 1PP9E 1NTKD 1VQOP 3SSUA 2I1KA 1L0LG 1GMJA 1AJYA 4EYYQ 5CBOA 1YJWP 5AVRB 1NU1J 1TU3F 2FYUD 2YMYA 3VMXA 1NU1D 3TYYA 3CC2P 2K3RA 1JY2N 1VDFA 5AVYB 1SFCD 4EIJA 1KN7A 1AA0A 2O01H 3P8MC 4JBZA 2AXCA 1IFJA 3T97A 2J58A 1DD4A 2W6AA 4WB4A 3NMDA 2GM4A 1YTZI 1LTBC 4WBAA 2IYPA 3H32A 2E5YA 3ZDMA 3FWNA 1NTZJ 2BCCD 1R8EA 2H88C 1PPJE 3H1JE 1W2EA 2A06E 4RKUJ 3VYIA 2QE7H 2N1TA 2W8ZA 4I7ZC 3I56P 4N6JA 3SFDC 5APTA 2FFDC 1EZVI 4I2LC 3NFQA 3WUUA 2OYIC 1EC5A 1MV8A 1GZLA 1NAYA 1ZW0A 2B87B 2GUVA 3H1KD 1G1JA 4EDFA 1VQ4P 2DW3A 4GKGA 4N78D 2FBWC 2ZXXA 4PD4H 1PGOA 4M3LA 1M1JB 3M0DA 4WVZA 3RL0g 4CPGA 2E42A 3GF7A 1K05A 4TT3H 2RH0A 1KTMA 1T3UA 2JO1A 1JTHA 2JDIH 1IZNB 2JWAA 3H1KE 1SP4A 3BCCJ 4IL6E 1BCCE 1FU1A 1LT1A 1CZQA 1MFZA 1X0TA 2IBZD 2OGUA 3ABVC 2V7QJ 1JB0J 3BCCD 3IFMA 3MP7B 4N78E 5E79H 1J1DB 1QLED 2G3AA 1LP1A 5BU8B 1RF0A 4PD4I 3TK1A 3Q5RA 4RJTA 1FDOA 2YKOA 1JM0A 2Y9YA 1HTLC 4D6TE 5AW7B 3HTKA 3AEDC 4U7JA 5AVQB 3L70J 1NKZB 1N73C 2KYVA 1PFIA 1KV4A 3H1KG 3WUVA 4Y99C 1SQBJ 5KTBA 2B9BA 3L70E 2OYHC 1KMIZ 3FXDA 1T6AA 5H2FE 3V2RA 3L75D 3CC7P 2PGDA 3H1LJ 2WTYA 2QJKC 4EI2A 1BE3G 1FZEA 1NO4A 1CI6B 3E7KA 2JKVA 1EXJA 3P7KA 3HD7C 1JY3N 3Q2YA 2Z5HA 2E5TA 2B88A 3LIEA 3RGUA 4GODA 1JTHB 1H0TA 2WQYC 1T2KC 1NTKG 1G2CB 5AVVB 1GL2D 2E74B 1KD1Q 3CWBJ 1S9KE 1SQBK 2ITAA 2WSEH 1KB9E 3IR9A 3SWYA 3L74G 3WUTA 1YJNP 1NGMB 3IAOA 3MUDA 1K8AQ 3II6A 1ZOYC 1QL1A 1Q7YQ 2QM8A 1AVOA 3L74J 4I6MC 4N3YB 1DH3A 4JYCA 2QRXA 2RKLA 5CCHA 5BU5A 2XDJA 3CXHE 2YKQA 1KB9D 4QMAA 1VQ5P 3A0HH 2HPCA 2YXRB 3RK3D 3IN6A 2P67A 3L73D 3H32B 1URQA 1DX7A 4WY4A 3L73J 2KB7P 2QG4A 3AEAC 4U3FE 3BRTB 4O9BA 1BDDA 1EZVG 3TF5A 1H8AA 2WSFH 1IFIA 3U1CA 2FYUG 3JCUE 4IL6H 1ZV8A 2Z4EA 4L75A 1SQBD 2E75B 3GMAA 5GTHH 4H0LC 3EQ2A 1S5LE 3L72J 5KKZB 3CMEP 2MKVA 1SVFA 2ZAEB 2ZYAA 1Q86Q 1AQ5A 1FOSE 4IFDK 1M56D 2ZXEB 4I1LA 1YI2P 2W6JH 1K9MQ 2D2CB 4OGQB 1SFCA 1WMKA 2M5AA 2ZYDA 4H13C 1NU1E 5KAFH 3RBZA 1BE3E 1GL2B 5AW6B 3I5CA 4DJGA 4Z1MH 1BGYG 2FYUJ 3JCUH 5APWA 2Q9IA 2HFED 2I8DA 3MGNA 2K37A 1GW4A 5KJ7D 1EZVD 1FAVA 1USDA 1LTTC 4GDOA 3HD7B 2IBZG 3HUSA 1OXZA 5B66H 3CCVP 1E79H 1NHLA 3P8CE 1N7SD 2CPSA 1SFCB 2M5AB 3F89A 1OVUA 1KFNA 1YQ4C 3GW6A 3M06A 2O3JA 5AVXB 1AFOA 4IOIH 2A06D 2YIUB 1LT9C 1GW3A 2J5UA 2OYOA 3IF4A 4PV1C 1VQPP 1BDCA 2W6BA 3H6PA 3MZWB 5APVA 4C46A 1RF1C 3B5ND 1HUCA 1NU1K 4L76A 3H1ID 3AE4C 3L71J 1HH0A 2B89A 3MHVA 4W7ZA 1FDMA 4GOFA 1L0LE 1FS0E 3RK2B 3VMZA 1RQVA 3EFFK 1YYCA 3RL0C 4WY4D 3B5NB 2ZT9D 2WT7B 4DT0A 1RE3C 1RE3A 2RMZA 2WSEJ 1VPCA 4NPDA 2KZJA 3OAKA 3AE1C 2V4HA 1SQXD 1X8YA 1N8RQ 3GLMA 3BCCE 1L0NE 4IFMA 3CXHH 2ZT9B 3AEGC 4PD4D 1G1IA 4HKZH 3VMYA 5KLVK 2C9LY 2M0BA 3B71A 3V2NA 4AQRD 2WSCH 2ZJSE 2XZRA 4OVNF 3PHLA 4LLHA 2Y9ZA 1NTZE 3CXHI 1PPJG 3E1IA 1RHZB 4WY4C 4D6TG 2E76C 3I55P 1JNMA 2KOGA 2Z5IA 5KJ7A 3CMAP 2IDBA 2WPSA 5B5EH 1Y8AA 2QJPB 3AE2C 4OH8B 1GU5A 1SQXJ 2BEQD 2LKMA 2YMKA 4DCKA 1BCCG 1P84E 1SQQJ 4I7ZB 3TNUB 1D7MA 1WRGA 5AW1B 5KAFE 1S4XA 1H0TB 1NTZG 1SQQE 2NPSB 1NYHA 4H0LD 3O8ZA 2WZ7A 2P1JA 1XTGB 1BGYE 2PRRA 3KYQA 3L74D 5B5EE 1FZFA 3HRNA 1JY3P 4H44D 1M1JC 1LTSC 2KNCB 1L0NG 1X22A 1KILC 2P58A 2PFXA 3C8VA 3GHGA 3L72G 5AVZB 3U59A 3N7NA 1L4AD 1S9KD 2YNYA 5CHXA 5AW3B 1PP9J 2WVRA 1IK9A 1KILA 3GHGC 1LTAC 4XA4A 2XU6A 2FYNC 2JEEA 1LGHB 3BATA 3L73G 1L2PA 1URQC 2HR3A 3H1JG 1KYOE 2K88A 1YITP 4RO0A 3L4FA 1FZBA 3TGUD 3H25A 3W68A 1USEA 1S5LX 4JYBA 2P2UA 1JMBA 1KILD 4XFJA 1J1EC 2CPBA 4YPCA 1NTMD 1OFCX 5CCHC 1M1JA 3P32A 3PH0A 1PP9D 4GT1A 1MUUA 1S72P 2N9BA 5DJUB 2KI7B 1GK4A 2B87A 3KPEA 3VTPC 4DOJA 1K73Q 4K3AA 5AW9B 3VOPA 3LIDA 4PJ0H 1NTME 1S1CX 1L0NJ 2N1TB 1HF9A 2E76B 3KHUA 1KYOI 3U1AA 4C7RA 1M90Q 2LR2A 2KUBA 3Q5SA 3L75G 2OARA 1OVVA 2BCCE 3WMM0 1BE3D 1PGJA 2O01N 1K04A 2WPRA 1L4AB 1SQPJ 1SQPK 1ZP0C 2BCCJ 2FKWB 2H89C 5APUA 3JSVC 2QVAA 1VL2A 1WT6A 3D6YA 2MJZA 2QJYC 1EZVE 1IFNA 1Q2NA 2CK3H 1Q90D 3AECC 4PV1D 3SWKA 1A02F 1RF0C 4DZOA 2C9NY 1T2KD 1U57A 2QJKB 2HG5D 2WPVB 3V5BA 1L0NK 2HLOA 1HVVA 2O1KA 3AE7C 3BASA 3L70G 3QWOC 1S5LH 1QVFO 2XNXA 1KILB 2Q7CA 1A02J 2AXTH 1DD3A 2KSEA 3CWBD 3FXEA 3N4XA 5APSA 2R5DA 3AE5C 2PAJA 4L73A 3S9OA 5KJ7C 1N7SB 2IPPA 1R5LA 2KNCA 4UB6H 3CCRP 1HWTC 3G71P 2XV5A 4A7PA 3HE4B 2K9JB 3L71E 2IBZE 1FZCB 1AV1A 1KZUB 1KQFB 4NPFX 2N9YB 5B66E 1IO4A 1CSBA 5CBNA 1KORA 2N1TD 4YTPC 2Q1KA 3FX0A 2SPZA 3M9QA 3NTNA 5C39A 3TNUA 3CCEP 3O6QA 3M9BA 1NKNA 1W5CE 2POHA 2Q5UA 2Y0DA 4UB6E 2D2CC 4OGQC 1OW8A 1L0ND 4D6TD 4H13B 2RN0A 4TLFA 1DEBA 1NVOA 3PTZA 3L70D 3HUSC 3L75E 1OMIA 1NTMJ 1IC2A 4JQ0D 5BVZA 3SFEC 2IYOA 1ZR4A 1ZN5A 2FFDA 1LWUB 4H13D 3V4QA 2A45G 4LGDE 4C7NB 1JUNA 4ZNCA 2VRSA 2E75C 1SFCC 1RF1A 2A06G 1FBMA 3HE5B 1LT9A 2D2CD 2KIKA 3QH9A 4OGQD 1KC8Q 3OJAB 1NTMG 3H1JJ 1SQQK 2KLVA 3HE5A 1P84D 1IFPA 1SQXK 3R2PA 1RF1B 5AVSB 1GD2E 3CL3D 2ZVNB 5EFWB 5AW5B 1ZRTD 3KQGA 1GL2C 2ZFCA 5KLVD 5GTHE 1JEKA 2WT7A 3BVHA 4BRYB 3H1HJ 4B86A 3B4SA 3L74E 3RK3C 1OW6A 2WSFJ 2PP6A 3G9RA 3D6ZA 1VQMP 1QL2A 3MUDC 3V4WA 1H89A 1FDIA 4ASWA 2NPSD 3SWFA 1NTKE 1UIXA 3PP5A 2QSIA 1N86A 2JJLA 2IZ1A 4H44B 1EDIA 2KS1A 5AW4B 5APQA 2QA4P 3MTUE 5CCGC 2OYHB 3TDKA 1GDTA 3RBXA 2C0XA 1OX3A 1SQBE 2FYUE 2I1JA 2K9JA 1RE4C 3RK2C 1Y9BA 5KLIB 1KQSO 4W80A 1T3JA 1IFDA 3HD7D 1NWQA 3KXDA 4XE5B 3AE9C 1PPJD 1OW7A 1PGPA 3CCLP 1SQPG 4YXDC 3W67A 4UB8E 2K9YA 3H1LE 1L0LK 1LWUC 1KYOH 2KP8A 3C1LA 3EWKA 2IX7C 2AEFA 2JP3A 1KFMA 3VP9A 3Q5PA 3F5HA 1SQXG 1PGQA 1MKMA 4YXWH 1JO5A 2YO3A 1PIXA 1N73A 2JWDA 4IL6X 4WY4B 2HYNA 4JF7A 1X79B 3G6EP 3CC4P 4BRYA 5KAIE 1YBKA 2M3BA 3K5BA 5CCGD 1IFMA 5CCHD 3H1LD 5AVTB 2HODB 2J59M 1LJ2A 3M91A 1SQVK 1KQLA 1EXIA 2BEZF 2WPQA 1PV3A 1R5SA 1SQBG 2XKMA 2E75D 3H1IE 1URQD 3VMAA 4PJ0E 5AW2B 5AW0B 1J2JB 3TGUG 2NPSC 5TISE 1JCDA 2AEJA 1VQKP 1ZMEC 1BCCD 1LWUA 1NTKJ 2M3EA 1SQQG 1BCCJ 1L0LD 3FGAD 3VN0A 2P7JA 2FY8A 1LTJB 1S2EA 3C9IA 3M0DC 3WU2E 4H44C 4ZKUA 3CCMP 3G4SP 1FOSF 3V6IA 1P84I 3TGUJ 5AW8B 3CCJP 2R44A 3A7OA 4D6TJ 3LW5J 1X9VA 5TISH 3L71G 1SQXE 3CCQP 1CI6A 1XTCC 2FYNB 2QM7A 1FZGA 1VQLP 1N7LA 3KDPB 4PD4E 1QEXA 4HJGH 4R4MA 3H1HG 5KLIC 4LC1A 2OYIB 4IFFA 3CD6P 1JY2O 3S1KA 5CCGA 1SQPE 3D71A 1J1EB 1KB9I 3AEBC 4KHXA 4H0LB 2FXOA 5KKZC 3VP8A 3HE4A 1PL5A 2WSSH 1L4AC 2BASA 2Q6QA 2FXPA 1NTKK 1E5WA
chains in the Genus database with same CATH topology
1U7JA 5CBNA 2M5AB 1LP1B 1OVUA 4EYYQ 5CBOA 2Q1KA 4IOIH 2SPZA 5C39A 1ZXGA 1BDCA 3MZWB 2K3RA 1NVOA 4JBZA 4MN4C 3MHVA 2B89A 4GOFA 2KZIA 3ZDMA 1MFTA 4NPDA 4ZNCA 2KZJA 2KIKA 2LXBA 2B87B 1EC5A 4HKZH 5EFWB 1ZW0A 2M0BA 2OTKE 4CPGA 2LXCB 4K35A 4ASWA 1EDKA 1U7MA 1LT1A 1X0TA 1EDIA 1LP1A 1H0TB 1JM0A 4KJMA 1EDLA 4ASVA 4ZMDA 5DJTB 2P58A 3FXDA 1H0TA 2KS1B 1EDJA 2HR3A 4NPEA 1S3JA 3RGUA 2B88A 2WMMA 1SS1A 4GODA 5K5GB 1JMBA 2JWDA 4HB1A 3PH0A 1DEEG 4GOEA 5DJUB 2KI7B 2B87A 4WWIA 4K3AA 2RKLA 2QRXA 2LR2A 2KUBA 1OVVA 2QVAA 1BDDA 1Y47A 1Q2NA 2R44A 1OVRA 2ZAEB 4BXLA 3QWOC 4HJGH 2M5AA 3FXEA 3S1KA 2I8DA 2UWJE 1FC2C 4NPFX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7J A;  5CBN A;  2M5A B;  1LP1 B;  1OVU A;  4EYY Q;  5CBO A;  2Q1K A;  4IOI H;  2SPZ A;  5C39 A;  1ZXG A;  1BDC A;  3MZW B;  2K3R A;  1NVO A;  4JBZ A;  4MN4 C;  3MHV A;  2B89 A;  4GOF A;  2KZI A;  3ZDM A;  1MFT A;  4NPD A;  4ZNC A;  2KZJ A;  2KIK A;  2LXB A;  2B87 B;  1EC5 A;  4HKZ H;  5EFW B;  1ZW0 A;  2M0B A;  2OTK E;  4CPG A;  2LXC B;  4K35 A;  4ASW A;  1EDK A;  1U7M A;  1LT1 A;  1X0T A;  1EDI A;  1LP1 A;  1H0T B;  1JM0 A;  4KJM A;  1EDL A;  4ASV A;  4ZMD A;  5DJT B;  2P58 A;  3FXD A;  1H0T A;  2KS1 B;  1EDJ A;  2HR3 A;  4NPE A;  1S3J A;  3RGU A;  2B88 A;  2WMM A;  1SS1 A;  4GOD A;  5K5G B;  1JMB A;  2JWD A;  4HB1 A;  3PH0 A;  1DEE G;  4GOE A;  5DJU B;  2KI7 B;  2B87 A;  4WWI A;  4K3A A;  2RKL A;  2QRX A;  2LR2 A;  2KUB A;  1OVV A;  2QVA A;  1BDD A;  1Y47 A;  1Q2N A;  2R44 A;  1OVR A;  2ZAE B;  4BXL A;  3QWO C;  4HJG H;  2M5A A;  3FXE A;  3S1K A;  2I8D A;  2UWJ E;  1FC2 C;  4NPF X; 
#chains in the Genus database with same CATH topology
 1W2B O;  1U7J A;  1SQQ D;  2OYI A;  1LP1 B;  2R32 A;  2W83 C;  3EFG A;  1VQN P;  3A5T A;  1CW5 A;  1JMM A;  1QGK B;  2W90 A;  1Z56 A;  1JOC A;  1ZXG A;  1VF5 C;  1NH4 A;  2N1T C;  3GG2 A;  3H1H D;  3M0A A;  1MZ9 A;  1RQU A;  4U3F G;  3L35 A;  1SQV G;  1SQV J;  3Q3D A;  1BSN A;  3R4Y A;  4MN4 C;  2Q3E A;  2IFM A;  3B8E B;  1ZRT E;  3PJS K;  5KLV G;  1GU4 A;  1M1K Q;  2NZ2 A;  3GF3 A;  1DIP A;  1LTJ A;  2WWW A;  1L4A A;  4PV1 B;  4W7Y A;  5KAI H;  1FJK A;  1LNQ A;  3BRV B;  3CWB G;  2A45 H;  2KZI A;  2QJY B;  2H43 A;  3OW2 O;  2E74 D;  3A3Y B;  3H1H E;  1M7L A;  4KT0 J;  1KYO D;  1T8Z A;  4AUW A;  1L0L J;  1MFT A;  4AYC A;  1YJ9 P;  1H88 A;  1IK7 A;  2L91 A;  1N2D C;  2AEM A;  5CMZ A;  1M57 D;  1AQT A;  4JPZ B;  4U3F D;  2W27 A;  2LXB A;  3M9H A;  3RL0 B;  1NAF A;  3JC2 2;  2R3S A;  2O1J A;  1QX8 A;  3L75 J;  2HOD A;  3L72 D;  4RES B;  2FYU K;  1N7S C;  3B5N A;  1VQ8 P;  3TGU E;  2OTK E;  1OIP A;  1YTZ T;  3CX5 I;  3OA7 A;  1SLQ A;  3AE6 C;  2AXT E;  3UIA A;  2LXC B;  4EOT A;  2E74 C;  1N73 B;  3CX5 H;  3RL0 D;  2H7H A;  4K35 A;  3T97 B;  1BSH A;  1FZC C;  4Y99 B;  2P10 A;  3H1J D;  3MD0 A;  3A0B H;  1OZH A;  2OQQ A;  5APY A;  3KZI H;  1EDK A;  2KXP B;  3L72 E;  2V7Q H;  1U7M A;  1Q82 Q;  2YO2 A;  4GIF A;  5E79 E;  3LW5 H;  1EQ7 A;  3A0H E;  5TJH A;  2JR8 A;  2BCC G;  1BGY J;  2QIW A;  4ZKP A;  1VF5 D;  1PZQ A;  2ZYG A;  1FE6 A;  3P8C D;  3CX5 E;  2GUS A;  1YIJ P;  2QJP C;  1NTZ K;  3A2A A;  2FXM A;  3HD7 A;  3HUS B;  4KJM A;  3GHG B;  3A0B E;  2XND H;  1EDL A;  1VQ6 P;  1HGZ A;  4ASV A;  4ZMD A;  5DJT B;  1SQV D;  3RK3 B;  1VF5 B;  3H1K J;  2K1A A;  5M1B A;  4HH2 A;  3USS A;  3Q1M A;  2OYH A;  5H2F H;  2OTJ P;  1FJP A;  3CWB E;  1YHQ P;  4L74 A;  1HJ0 A;  2NPS A;  1ZLL A;  3CX5 D;  3KZI E;  1KQG B;  2KS1 B;  4HYT B;  2KK7 A;  2Y0C A;  5AVU B;  1EDJ A;  2C0W A;  1VQ7 P;  3TSI A;  1HGV A;  2Q3I A;  4NPE A;  1SQV E;  1S3J A;  2O01 J;  2R3C A;  2E76 D;  3S4R A;  3D70 A;  2WMM A;  1GK6 A;  1SS1 A;  5APX A;  5K5G B;  2H8P D;  3BCC G;  3ITK A;  2KLU A;  3CCS P;  3CCU P;  3L71 D;  1NTM K;  4HB1 A;  5CJ0 A;  1URQ B;  2IFN A;  1NTZ D;  3E1R A;  1KB9 H;  2HPC B;  1DEE G;  1OWA A;  4GOE A;  3MIW A;  5L8R J;  2YKP A;  2IZ0 A;  4WWI A;  3AE8 C;  2OTL P;  2KSJ A;  2NRG A;  5CJ4 A;  3AE3 C;  3FWL A;  2YIU C;  1LT9 B;  3V2P A;  2FYZ A;  1QVG O;  1IJD B;  4R4L A;  1AVY A;  4C7N A;  3AEF C;  3L37 A;  5GTI H;  2QEX P;  1HBW A;  2IBZ I;  2FFD B;  3PRJ A;  1SQP D;  1RE4 A;  4Y28 J;  1NJI Q;  1M8O B;  1BGY D;  1LTI C;  4OWF A;  1BE3 J;  2WSC J;  1G2C A;  1VQ9 P;  1JCC A;  3AEE C;  2E43 A;  1RY3 A;  3H1L G;  3WU2 H;  1Y47 A;  1Q81 Q;  2R5B A;  2ZVO B;  3H1I J;  3V2Q A;  1JY2 P;  1OVR A;  3G3Z A;  1LTG C;  5AVW B;  5KLV E;  2WIT A;  3O6Q B;  5GTI E;  1PP9 G;  2G8Y A;  1RH5 B;  4UB8 H;  4BXL A;  1HJB A;  1UII A;  2GA1 A;  3CXH D;  3L36 A;  4BWN A;  5KLV J;  2ZT9 C;  1NU1 G;  3PLN A;  1YQ3 C;  3RK3 E;  3CPW O;  3L73 E;  1FZA A;  2Y0E A;  1FZC A;  1JY3 O;  3CI9 A;  1NOH A;  3H1I G;  4U3F J;  1KIL E;  1ZR2 A;  3CLQ A;  1GTW A;  1LTJ C;  3HTK B;  1J1D C;  2UWJ E;  2L5G B;  2M8R A;  1P84 H;  3NXS A;  1N7S A;  1FC2 C;  3B5N C;  1GL2 A;  2A45 I;  2YXQ B;  3RK2 D;  1PP9 E;  1NTK D;  1VQO P;  3SSU A;  2I1K A;  1L0L G;  1GMJ A;  1AJY A;  4EYY Q;  5CBO A;  1YJW P;  5AVR B;  1NU1 J;  1TU3 F;  2FYU D;  2YMY A;  3VMX A;  1NU1 D;  3TYY A;  3CC2 P;  2K3R A;  1JY2 N;  1VDF A;  5AVY B;  1SFC D;  4EIJ A;  1KN7 A;  1AA0 A;  2O01 H;  3P8M C;  4JBZ A;  2AXC A;  1IFJ A;  3T97 A;  2J58 A;  1DD4 A;  2W6A A;  4WB4 A;  3NMD A;  2GM4 A;  1YTZ I;  1LTB C;  4WBA A;  2IYP A;  3H32 A;  2E5Y A;  3ZDM A;  3FWN A;  1NTZ J;  2BCC D;  1R8E A;  2H88 C;  1PPJ E;  3H1J E;  1W2E A;  2A06 E;  4RKU J;  3VYI A;  2QE7 H;  2N1T A;  2W8Z A;  4I7Z C;  3I56 P;  4N6J A;  3SFD C;  5APT A;  2FFD C;  1EZV I;  4I2L C;  3NFQ A;  3WUU A;  2OYI C;  1EC5 A;  1MV8 A;  1GZL A;  1NAY A;  1ZW0 A;  2B87 B;  2GUV A;  3H1K D;  1G1J A;  4EDF A;  1VQ4 P;  2DW3 A;  4GKG A;  4N78 D;  2FBW C;  2ZXX A;  4PD4 H;  1PGO A;  4M3L A;  1M1J B;  3M0D A;  4WVZ A;  3RL0 g;  4CPG A;  2E42 A;  3GF7 A;  1K05 A;  4TT3 H;  2RH0 A;  1KTM A;  1T3U A;  2JO1 A;  1JTH A;  2JDI H;  1IZN B;  2JWA A;  3H1K E;  1SP4 A;  3BCC J;  4IL6 E;  1BCC E;  1FU1 A;  1LT1 A;  1CZQ A;  1MFZ A;  1X0T A;  2IBZ D;  2OGU A;  3ABV C;  2V7Q J;  1JB0 J;  3BCC D;  3IFM A;  3MP7 B;  4N78 E;  5E79 H;  1J1D B;  1QLE D;  2G3A A;  1LP1 A;  5BU8 B;  1RF0 A;  4PD4 I;  3TK1 A;  3Q5R A;  4RJT A;  1FDO A;  2YKO A;  1JM0 A;  2Y9Y A;  1HTL C;  4D6T E;  5AW7 B;  3HTK A;  3AED C;  4U7J A;  5AVQ B;  3L70 J;  1NKZ B;  1N73 C;  2KYV A;  1PFI A;  1KV4 A;  3H1K G;  3WUV A;  4Y99 C;  1SQB J;  5KTB A;  2B9B A;  3L70 E;  2OYH C;  1KMI Z;  3FXD A;  1T6A A;  5H2F E;  3V2R A;  3L75 D;  3CC7 P;  2PGD A;  3H1L J;  2WTY A;  2QJK C;  4EI2 A;  1BE3 G;  1FZE A;  1NO4 A;  1CI6 B;  3E7K A;  2JKV A;  1EXJ A;  3P7K A;  3HD7 C;  1JY3 N;  3Q2Y A;  2Z5H A;  2E5T A;  2B88 A;  3LIE A;  3RGU A;  4GOD A;  1JTH B;  1H0T A;  2WQY C;  1T2K C;  1NTK G;  1G2C B;  5AVV B;  1GL2 D;  2E74 B;  1KD1 Q;  3CWB J;  1S9K E;  1SQB K;  2ITA A;  2WSE H;  1KB9 E;  3IR9 A;  3SWY A;  3L74 G;  3WUT A;  1YJN P;  1NGM B;  3IAO A;  3MUD A;  1K8A Q;  3II6 A;  1ZOY C;  1QL1 A;  1Q7Y Q;  2QM8 A;  1AVO A;  3L74 J;  4I6M C;  4N3Y B;  1DH3 A;  4JYC A;  2QRX A;  2RKL A;  5CCH A;  5BU5 A;  2XDJ A;  3CXH E;  2YKQ A;  1KB9 D;  4QMA A;  1VQ5 P;  3A0H H;  2HPC A;  2YXR B;  3RK3 D;  3IN6 A;  2P67 A;  3L73 D;  3H32 B;  1URQ A;  1DX7 A;  4WY4 A;  3L73 J;  2KB7 P;  2QG4 A;  3AEA C;  4U3F E;  3BRT B;  4O9B A;  1BDD A;  1EZV G;  3TF5 A;  1H8A A;  2WSF H;  1IFI A;  3U1C A;  2FYU G;  3JCU E;  4IL6 H;  1ZV8 A;  2Z4E A;  4L75 A;  1SQB D;  2E75 B;  3GMA A;  5GTH H;  4H0L C;  3EQ2 A;  1S5L E;  3L72 J;  5KKZ B;  3CME P;  2MKV A;  1SVF A;  2ZAE B;  2ZYA A;  1Q86 Q;  1AQ5 A;  1FOS E;  4IFD K;  1M56 D;  2ZXE B;  4I1L A;  1YI2 P;  2W6J H;  1K9M Q;  2D2C B;  4OGQ B;  1SFC A;  1WMK A;  2M5A A;  2ZYD A;  4H13 C;  1NU1 E;  5KAF H;  3RBZ A;  1BE3 E;  1GL2 B;  5AW6 B;  3I5C A;  4DJG A;  4Z1M H;  1BGY G;  2FYU J;  3JCU H;  5APW A;  2Q9I A;  2HFE D;  2I8D A;  3MGN A;  2K37 A;  1GW4 A;  5KJ7 D;  1EZV D;  1FAV A;  1USD A;  1LTT C;  4GDO A;  3HD7 B;  2IBZ G;  3HUS A;  1OXZ A;  5B66 H;  3CCV P;  1E79 H;  1NHL A;  3P8C E;  1N7S D;  2CPS A;  1SFC B;  2M5A B;  3F89 A;  1OVU A;  1KFN A;  1YQ4 C;  3GW6 A;  3M06 A;  2O3J A;  5AVX B;  1AFO A;  4IOI H;  2A06 D;  2YIU B;  1LT9 C;  1GW3 A;  2J5U A;  2OYO A;  3IF4 A;  4PV1 C;  1VQP P;  1BDC A;  2W6B A;  3H6P A;  3MZW B;  5APV A;  4C46 A;  1RF1 C;  3B5N D;  1HUC A;  1NU1 K;  4L76 A;  3H1I D;  3AE4 C;  3L71 J;  1HH0 A;  2B89 A;  3MHV A;  4W7Z A;  1FDM A;  4GOF A;  1L0L E;  1FS0 E;  3RK2 B;  3VMZ A;  1RQV A;  3EFF K;  1YYC A;  3RL0 C;  4WY4 D;  3B5N B;  2ZT9 D;  2WT7 B;  4DT0 A;  1RE3 C;  1RE3 A;  2RMZ A;  2WSE J;  1VPC A;  4NPD A;  2KZJ A;  3OAK A;  3AE1 C;  2V4H A;  1SQX D;  1X8Y A;  1N8R Q;  3GLM A;  3BCC E;  1L0N E;  4IFM A;  3CXH H;  2ZT9 B;  3AEG C;  4PD4 D;  1G1I A;  4HKZ H;  3VMY A;  5KLV K;  2C9L Y;  2M0B A;  3B71 A;  3V2N A;  4AQR D;  2WSC H;  2ZJS E;  2XZR A;  4OVN F;  3PHL A;  4LLH A;  2Y9Z A;  1NTZ E;  3CXH I;  1PPJ G;  3E1I A;  1RHZ B;  4WY4 C;  4D6T G;  2E76 C;  3I55 P;  1JNM A;  2KOG A;  2Z5I A;  5KJ7 A;  3CMA P;  2IDB A;  2WPS A;  5B5E H;  1Y8A A;  2QJP B;  3AE2 C;  4OH8 B;  1GU5 A;  1SQX J;  2BEQ D;  2LKM A;  2YMK A;  4DCK A;  1BCC G;  1P84 E;  1SQQ J;  4I7Z B;  3TNU B;  1D7M A;  1WRG A;  5AW1 B;  5KAF E;  1S4X A;  1H0T B;  1NTZ G;  1SQQ E;  2NPS B;  1NYH A;  4H0L D;  3O8Z A;  2WZ7 A;  2P1J A;  1XTG B;  1BGY E;  2PRR A;  3KYQ A;  3L74 D;  5B5E E;  1FZF A;  3HRN A;  1JY3 P;  4H44 D;  1M1J C;  1LTS C;  2KNC B;  1L0N G;  1X22 A;  1KIL C;  2P58 A;  2PFX A;  3C8V A;  3GHG A;  3L72 G;  5AVZ B;  3U59 A;  3N7N A;  1L4A D;  1S9K D;  2YNY A;  5CHX A;  5AW3 B;  1PP9 J;  2WVR A;  1IK9 A;  1KIL A;  3GHG C;  1LTA C;  4XA4 A;  2XU6 A;  2FYN C;  2JEE A;  1LGH B;  3BAT A;  3L73 G;  1L2P A;  1URQ C;  2HR3 A;  3H1J G;  1KYO E;  2K88 A;  1YIT P;  4RO0 A;  3L4F A;  1FZB A;  3TGU D;  3H25 A;  3W68 A;  1USE A;  1S5L X;  4JYB A;  2P2U A;  1JMB A;  1KIL D;  4XFJ A;  1J1E C;  2CPB A;  4YPC A;  1NTM D;  1OFC X;  5CCH C;  1M1J A;  3P32 A;  3PH0 A;  1PP9 D;  4GT1 A;  1MUU A;  1S72 P;  2N9B A;  5DJU B;  2KI7 B;  1GK4 A;  2B87 A;  3KPE A;  3VTP C;  4DOJ A;  1K73 Q;  4K3A A;  5AW9 B;  3VOP A;  3LID A;  4PJ0 H;  1NTM E;  1S1C X;  1L0N J;  2N1T B;  1HF9 A;  2E76 B;  3KHU A;  1KYO I;  3U1A A;  4C7R A;  1M90 Q;  2LR2 A;  2KUB A;  3Q5S A;  3L75 G;  2OAR A;  1OVV A;  2BCC E;  3WMM 0;  1BE3 D;  1PGJ A;  2O01 N;  1K04 A;  2WPR A;  1L4A B;  1SQP J;  1SQP K;  1ZP0 C;  2BCC J;  2FKW B;  2H89 C;  5APU A;  3JSV C;  2QVA A;  1VL2 A;  1WT6 A;  3D6Y A;  2MJZ A;  2QJY C;  1EZV E;  1IFN A;  1Q2N A;  2CK3 H;  1Q90 D;  3AEC C;  4PV1 D;  3SWK A;  1A02 F;  1RF0 C;  4DZO A;  2C9N Y;  1T2K D;  1U57 A;  2QJK B;  2HG5 D;  2WPV B;  3V5B A;  1L0N K;  2HLO A;  1HVV A;  2O1K A;  3AE7 C;  3BAS A;  3L70 G;  3QWO C;  1S5L H;  1QVF O;  2XNX A;  1KIL B;  2Q7C A;  1A02 J;  2AXT H;  1DD3 A;  2KSE A;  3CWB D;  3FXE A;  3N4X A;  5APS A;  2R5D A;  3AE5 C;  2PAJ A;  4L73 A;  3S9O A;  5KJ7 C;  1N7S B;  2IPP A;  1R5L A;  2KNC A;  4UB6 H;  3CCR P;  1HWT C;  3G71 P;  2XV5 A;  4A7P A;  3HE4 B;  2K9J B;  3L71 E;  2IBZ E;  1FZC B;  1AV1 A;  1KZU B;  1KQF B;  4NPF X;  2N9Y B;  5B66 E;  1IO4 A;  1CSB A;  5CBN A;  1KOR A;  2N1T D;  4YTP C;  2Q1K A;  3FX0 A;  2SPZ A;  3M9Q A;  3NTN A;  5C39 A;  3TNU A;  3CCE P;  3O6Q A;  3M9B A;  1NKN A;  1W5C E;  2POH A;  2Q5U A;  2Y0D A;  4UB6 E;  2D2C C;  4OGQ C;  1OW8 A;  1L0N D;  4D6T D;  4H13 B;  2RN0 A;  4TLF A;  1DEB A;  1NVO A;  3PTZ A;  3L70 D;  3HUS C;  3L75 E;  1OMI A;  1NTM J;  1IC2 A;  4JQ0 D;  5BVZ A;  3SFE C;  2IYO A;  1ZR4 A;  1ZN5 A;  2FFD A;  1LWU B;  4H13 D;  3V4Q A;  2A45 G;  4LGD E;  4C7N B;  1JUN A;  4ZNC A;  2VRS A;  2E75 C;  1SFC C;  1RF1 A;  2A06 G;  1FBM A;  3HE5 B;  1LT9 A;  2D2C D;  2KIK A;  3QH9 A;  4OGQ D;  1KC8 Q;  3OJA B;  1NTM G;  3H1J J;  1SQQ K;  2KLV A;  3HE5 A;  1P84 D;  1IFP A;  1SQX K;  3R2P A;  1RF1 B;  5AVS B;  1GD2 E;  3CL3 D;  2ZVN B;  5EFW B;  5AW5 B;  1ZRT D;  3KQG A;  1GL2 C;  2ZFC A;  5KLV D;  5GTH E;  1JEK A;  2WT7 A;  3BVH A;  4BRY B;  3H1H J;  4B86 A;  3B4S A;  3L74 E;  3RK3 C;  1OW6 A;  2WSF J;  2PP6 A;  3G9R A;  3D6Z A;  1VQM P;  1QL2 A;  3MUD C;  3V4W A;  1H89 A;  1FDI A;  4ASW A;  2NPS D;  3SWF A;  1NTK E;  1UIX A;  3PP5 A;  2QSI A;  1N86 A;  2JJL A;  2IZ1 A;  4H44 B;  1EDI A;  2KS1 A;  5AW4 B;  5APQ A;  2QA4 P;  3MTU E;  5CCG C;  2OYH B;  3TDK A;  1GDT A;  3RBX A;  2C0X A;  1OX3 A;  1SQB E;  2FYU E;  2I1J A;  2K9J A;  1RE4 C;  3RK2 C;  1Y9B A;  5KLI B;  1KQS O;  4W80 A;  1T3J A;  1IFD A;  3HD7 D;  1NWQ A;  3KXD A;  4XE5 B;  3AE9 C;  1PPJ D;  1OW7 A;  1PGP A;  3CCL P;  1SQP G;  4YXD C;  3W67 A;  4UB8 E;  2K9Y A;  3H1L E;  1L0L K;  1LWU C;  1KYO H;  2KP8 A;  3C1L A;  3EWK A;  2IX7 C;  2AEF A;  2JP3 A;  1KFM A;  3VP9 A;  3Q5P A;  3F5H A;  1SQX G;  1PGQ A;  1MKM A;  4YXW H;  1JO5 A;  2YO3 A;  1PIX A;  1N73 A;  2JWD A;  4IL6 X;  4WY4 B;  2HYN A;  4JF7 A;  1X79 B;  3G6E P;  3CC4 P;  4BRY A;  5KAI E;  1YBK A;  2M3B A;  3K5B A;  5CCG D;  1IFM A;  5CCH D;  3H1L D;  5AVT B;  2HOD B;  2J59 M;  1LJ2 A;  3M91 A;  1SQV K;  1KQL A;  1EXI A;  2BEZ F;  2WPQ A;  1PV3 A;  1R5S A;  1SQB G;  2XKM A;  2E75 D;  3H1I E;  1URQ D;  3VMA A;  4PJ0 E;  5AW2 B;  5AW0 B;  1J2J B;  3TGU G;  2NPS C;  5TIS E;  1JCD A;  2AEJ A;  1VQK P;  1ZME C;  1BCC D;  1LWU A;  1NTK J;  2M3E A;  1SQQ G;  1BCC J;  1L0L D;  3FGA D;  3VN0 A;  2P7J A;  2FY8 A;  1LTJ B;  1S2E A;  3C9I A;  3M0D C;  3WU2 E;  4H44 C;  4ZKU A;  3CCM P;  3G4S P;  1FOS F;  3V6I A;  1P84 I;  3TGU J;  5AW8 B;  3CCJ P;  2R44 A;  3A7O A;  4D6T J;  3LW5 J;  1X9V A;  5TIS H;  3L71 G;  1SQX E;  3CCQ P;  1CI6 A;  1XTC C;  2FYN B;  2QM7 A;  1FZG A;  1VQL P;  1N7L A;  3KDP B;  4PD4 E;  1QEX A;  4HJG H;  4R4M A;  3H1H G;  5KLI C;  4LC1 A;  2OYI B;  4IFF A;  3CD6 P;  1JY2 O;  3S1K A;  5CCG A;  1SQP E;  3D71 A;  1J1E B;  1KB9 I;  3AEB C;  4KHX A;  4H0L B;  2FXO A;  5KKZ C;  3VP8 A;  3HE4 A;  1PL5 A;  2WSS H;  1L4A C;  2BAS A;  2Q6Q A;  2FXP A;  1NTK K;  1E5W A; 
#chains in the Genus database with same CATH homology
 1U7J A;  5CBN A;  2M5A B;  1LP1 B;  1OVU A;  4EYY Q;  5CBO A;  2Q1K A;  4IOI H;  2SPZ A;  5C39 A;  1ZXG A;  1BDC A;  3MZW B;  2K3R A;  1NVO A;  4JBZ A;  4MN4 C;  3MHV A;  2B89 A;  4GOF A;  2KZI A;  3ZDM A;  1MFT A;  4NPD A;  4ZNC A;  2KZJ A;  2KIK A;  2LXB A;  2B87 B;  1EC5 A;  4HKZ H;  5EFW B;  1ZW0 A;  2M0B A;  2OTK E;  4CPG A;  2LXC B;  4K35 A;  4ASW A;  1EDK A;  1U7M A;  1LT1 A;  1X0T A;  1EDI A;  1LP1 A;  1H0T B;  1JM0 A;  4KJM A;  1EDL A;  4ASV A;  4ZMD A;  5DJT B;  2P58 A;  3FXD A;  1H0T A;  2KS1 B;  1EDJ A;  2HR3 A;  4NPE A;  1S3J A;  3RGU A;  2B88 A;  2WMM A;  1SS1 A;  4GOD A;  5K5G B;  1JMB A;  2JWD A;  4HB1 A;  3PH0 A;  1DEE G;  4GOE A;  5DJU B;  2KI7 B;  2B87 A;  4WWI A;  4K3A A;  2RKL A;  2QRX A;  2LR2 A;  2KUB A;  1OVV A;  2QVA A;  1BDD A;  1Y47 A;  1Q2N A;  2R44 A;  1OVR A;  2ZAE B;  4BXL A;  3QWO C;  4HJG H;  2M5A A;  3FXE A;  3S1K A;  2I8D A;  2UWJ E;  1FC2 C;  4NPF X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...