3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords FAB light chain
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
1JVMA 3SPCA 2H8PC 4JTCB 3FB6C 4P9OA 1M57C 5CBGA 1AQTA 2Q69A 2WLNA 4GX0A 1V54C 1G4YB 4MTGA 4MVQA 2K1EA 2KB1A 1XL6A 1ZWIC 4OXSA 3ABLC 3SPJA 1XL4A 1OCOC 2A0LA 2ITCC 4MW3A 2WLLB 3OR7C 2W6JH 1R3LC 4DXWA 2WLMA 3X2QC 4BW5A 2HJFC 3BEHA 4RUFA 1R3KC 3HPLC 3LNMB 4LP8A 3K04A 1LNQA 3T4ZA 4EKWA 4PDLA 4ZBMA 4R6ZA 2WLJA 4PA6A 4MS2A 4CBCA 3OGCC 1KKDA 2QE7H 4WFHA 3E8HA 4MVOA 4G28B 4I9WA 2NLJC 4P30A 3UM7A 2ZXWC 2DWDC 2W0FC 4LCUC 2HG5C 4MVMA 2WLIB 2Q67A 1V55C 4PA9A 4YXWH 1BSHA 4TLFA 4HZ3A 4J9ZB 2Q6AA 3F7VC 5J9PC 3E83A 3F5WC 2V7QH 2EINC 4JTDB 1ORQC 2ITDC 3AG1C 3SPGA 1IFPA 2E5TA 2WLHA 4WVZA 4MVRA 4XDJA 5KUKA 2EIMC 2WLLA 5B3SC 3JYCA 1OCZC 4QNHB 3OR6C 2P7TC 2AHZA 3SPHA 3AG3C 5B1BC 4PDVA 3ZRSA 3ASOC 4MVSA 2AHYA 4MVUA 4RAIA 2X6BA 2HFEC 2ATKC 3K08A 2BOCC 4GX1A 2IH3C 4RUEA 3K0DA 4KFMA 4LBEC 5EK0A 2Y69C 3STLC 4MTFA 3T1CA 2ZD9A 2EIKC 4J9YB 1S5HC 5IY5C 3STZC 1E79H 2WLIA 2CK3H 4R50A 3R65A 3E8FA 4GX2A 1QLEC 5EBWC 2JDIH 2WLKA 2DYSC 3E89A 1JEKA 1R3JC 3SYPA 3ABMC 2A9HA 4P2ZA 2EILC 5B1AC 3SYCA 2BOBC 2R9RB 3T4DA 4PA3A 4WFFA 4HYOA 2QKSA 4WFGA 2X6AA 3FB8C 5EBMC 3T2MA 2DYRC 3K0GA 3LDEA 1FS0E 2HVKC 2WSSH 3RVZA 3OUFA 5EBLC 3AG2C 3E86A 1J95A 3EFFK 2EIJC 3RW0A 1R3IC 4XDLA 3ABKC 4MTOA 5KUMA 4PA7A 5EC1C 2E5YA 3PJSK 2X6CA 5CBFA 4GX5A 1BSNA 4MW8A 1BL8A 4QMAA 3SJQC 2DWEC 4PDMA 4MVZA 4QE9A 4JTAB 2XNDH 3TETA 3GB7C 3LUTB 3SYQA 5CBHA 3WG7C 3LDCA 4R7CA 3USSA 5BZBA 3TCUA 1K4DC 2A79B 4PA4A 2QTOA 4P9PA 4DJGA 3ZJZA 1OCRC 2Q68A 2HVJC 3IGAC 4R8CA 4XDKA 3SPIA 4X88A 3SYAA 3FB7C 1P7BA 3K06A 4MSWC 3UKMA 2OCCC 3F7YC 4UUJC 3AG4C 3RVYA 3KG2A 3RBZA 1M56C 4TWKA 3ASNC 5EC2C 3K03A 4WFEA 3SYOA 3VOUA 3LDDA 3IFXA 4X89A 2JK5C 2YEVA 3E8GA 4G27B 4F4LA 1K4CC 5E1AC 4X8AA 2IH1C 4QE7A 4RO2A 1OCCC 3OUSA 3E8BA 3FB5C 4H37A 4PDRA 4H33A
chains in the Genus database with same CATH superfamily
1ZLZA 4RESB 1SFCD 3B5NB 1JY2N 3EQ2A 3AE1C 4YJ3A 2LXBA 5CB4B 1V54C 1G4YB 1N36O 2M3EA 1ZWIC 2WPVB 1XTGB 4ABMA 1I94B 3PN1A 5CB4A 1ZMEC 5KLVD 1U7JA 1U96A 1Q86Q 4BIUA 4LP8A 1MUUA 1ZRTE 1RP3B 3JD0A 2KQXA 3H1JH 4ASUG 1EZVI 1RE3A 1XOUA 4A5UB 1PZQA 1EDKA 1KD1W 1BGYJ 4O9BA 2VQFB 1IBLO 4UCRA 2WLIB 2ZKOA 2QWNB 3VMYA 1YHQV 5CCHC 2WT7A 2NRGA 4H44C 4JASA 2GDSA 4GCZA 1AJQA 4GKKB 1NU1D 2ZXWB 5KKZC 3QVNA 4IL6X 3D3IA 3P8CD 2OYIB 3AEIA 2AHZA 3SPHA 4OGQC 3BCCH 1XMOO 3I56V 2PUSA 5KJ7A 1HP8A 1NTME 1GM7A 5CHXA 5CA1B 1YIJP 2IJIA 2XU6A 2R44A 4RAIA 1FKAO 1XILA 3N7NA 3L74E 1K5SA 2Y69C 4OX9B 3CMEP 2EIKC 4B7EA 1YIJV 2F43G 5BU5A 4X20A 4AILC 1NTMD 4WY4A 5LMUO 5B1OA 3ABMB 3SGIA 1ZV8A 5B1AC 2R9RB 2DE0X 1URQD 1Y4MA 3GWOA 4NR1A 1G1XB 4N3YB 3AG2B 3AG2C 5LXTA 1ZR2A 1S4XA 3CC2P 2Y4TA 2IBZD 4XBFA 5E79H 1BGYH 1IFNA 3L35A 4ZHQA 1SF9A 5L8RJ 1OJHA 4C46A 1T2KC 3CC4P 4R7CA 4YIOA 1TVKB 5AG2A 1FJGO 2A79B 3RL0C 1SFCC 1NR1A 2E76D 2L5GB 1VQLP 3FB7C 3UKMA 5GW7A 4KT0J 3AG4C 3TGUJ 1K05A 2N1TC 4TWKA 1Y6XA 4WFEA 1VARA 3E1IA 2BASA 1VQMP 4OGQB 3E8GA 4DR4O 4YY3O 3RYHB 3RYCB 1YTFB 1BZKA 3H1IH 5AW2B 5C8YB 4I7ZC 4PDRA 5KAFH 1IZNB 3ZMTA 3EWKA 1Y74B 3H1LG 5BR8O 3NTNA 1XI1A 3OR7C 3TGUE 2L6LA 5B1AB 2B1IA 2OQQA 5KKZB 4WY4C 5K1XA 1R3KC 3HPLC 3K04A 3MDSA 3GMAA 1NJIQ 2QJYB 1JY3O 3FAVB 4DZOA 3KZIH 3K5NA 3CEIA 1R5LA 3IN6A 3E8HA 3S9OA 3DXRB 3HKEB 2ZCEA 4LCUC 3C1LA 4PA9A 3A0HH 1VQ4V 2E42A 4B3RO 1SQGA 3I5CA 2FFDA 5IY5B 3JD3A 1K8AQ 3ZHVA 1SZTA 4FZ0A 1P84D 3G6EV 3FWLA 4JPZB 2HLOA 3EFGA 1X8YA 5L3FA 4W7YA 1K97A 1Y8AA 1QR9A 2KG7A 3JCUZ 3K9SA 5LBQA 1VQ6P 2P22C 4DR2B 1BT8A 3G80A 1ZL8B 2FXMA 4L75A 1AI5A 2OTJP 1NAFA 4I5SA 2E76B 1NTZG 1NU1J 2D2CC 4RWUA 3ZMVA 3JSNA 2QGNA 1JTHB 4J9YB 3AG1B 3SWYA 1GL2D 2ETNA 1PL4A 1VF7A 1IFDA 3JASA 2V7QG 2P5OA 4WY4B 5KLVH 2JS5A 5KLVK 2GM4A 3DC6A 1K73Q 4H44D 1BGYD 1AFOA 1EXJA 4CS4A 5KX5B 1BCCD 1AR1B 3AECC 3H1JD 1B06A 3OUFA 4I4TB 1R3IC 2O3JA 4R4LA 5EC1C 5CCGA 2Q3EA 1X22A 1QGKB 3QWOC 1T3JA 5FNVB 3HD7A 2LW7A 2P6JA 1S76D 4JZ2A 1LTJA 2Y0CA 1ZAUA 3QO7A 3L37A 3T1YO 3HD7B 3ABUA 1MZEA 3H1JJ 4LFAO 2JP3A 3H1IE 1F23A 3L70D 4UV9A 4D6TH 2B9ZA 3VP9A 1D7MA 1KYOF 1LP1B 1VQOV 1T6AA 2K3RA 5LOVB 3CCQP 1EXIA 1T5EA 4DW0A 2YICA 4TV9B 3G6EP 3CD6P 1FZEA 1JQ0A 1W5CE 3FXDA 1G2CB 2K9JB 4ASVA 4X1KA 1KP2A 4JI4O 3BCCD 1YITV 4B3SO 4JI2B 3E1RA 1NWQA 3SFDC 3ZHTA 2P2UA 1WRGA 4DR6O 3CSXA 1G1IA 3SPCA 2ZXEB 1GW3A 2A45H 5CBGA 2FB5A 4X20B 1X79B 4WCEV 4XE5B 4MTGA 4I6MC 2P4KA 2KB1A 3D8CA 1QL1A 2WLLB 3E7KA 4W80A 1FAVA 3CWBG 5BVZA 1HR0B 2F95B 1YEWA 3X2QC 1Z5VA 4A7PA 2XTAA 4FPPA 2YXHA 2H7HA 2HJFC 2VQFO 3A0RA 4BWAA 3LIDA 1L4AD 1NU1G 1PGOA 3FAVA 1GO3F 4MS2A 3FKSG 2PZSA 2WTYA 1L4AC 1KC8W 2NLJC 2OYOA 2M6YA 4FFKA 4R4MA 4J42A 3UM7A 1KILC 5APYA 3WMM0 2GV9A 1FD9A 2IFNA 2OYHC 1H2GA 2GUSA 1QU7A 2KYVA 5B66H 2QWOB 1XHZA 2ZYDA 3P7KA 3AG1C 1HNWO 2WLHA 3QF7A 4JYYA 5AW8B 1VQPV 5AVSB 4OX9O 3D36C 3M9BA 2DQ0A 1UPGA 5CMZA 3BY6A 5L3EA 1NHLA 4TQDA 3AE6C 5D5PA 4U3JA 2V4HA 4DK0A 5EK0A 4KFMA 4AQYO 4NTWA 5LGTA 4D6TG 2C0XA 3STZC 2R5BA 5KLIB 2ZXXA 1SQQH 4R50A 3R65A 1RFYA 1SQQK 1XBLA 3JASB 3E89A 1JEKA 5LMNO 2KNCA 3WG7B 1RSOB 4DV4B 5APVA 2E43A 3H1LJ 5DJTB 2GUVA 3DXRA 2MKVA 1XNQO 4IYIA 5DM6V 2N1TA 1US6A 2XNXA 4JI1B 4UB8H 1Z56A 1ZRTD 2PI4A 1OVVA 1IXMA 1F4MA 4K8XA 5DEDA 1LTJB 1UIXA 4O4IB 3AE4C 1KBHA 2P10A 4IIJB 4E4EA 3CCLV 1WPXA 2QWQB 1EDIA 1OW6A 5IYCO 2ZE5A 4KHPB 2K9PA 2JWDA 1YI2P 1G8MA 4AHCA 4IIJA 2PAJA 1NH2D 4LWSB 1RF1B 2Q7HA 3W7XA 2EULA 2PYJA 3K06A 1P7BA 5LOVA 2OCCC 5LP6A 4HNAA 1OHHG 2EZPA 2QKCA 4PI2A 5EYPA 1WJZA 1NGMB 1JR9A 1LUWA 5LP6B 4UVBA 3M06A 2J58A 3R4YA 2IJKA 2QWRB 5JCOC 3E8BA 3WU2E 4LGDE 1IK9A 3BRTB 1LWUA 3CMAP 1SQPG 3L71D 1SQPD 1KQFB 1N33O 1O9GA 2OIEA 1HTLC 1GZLA 1LR1A 3ABLC 4UCUA 4GKGA 1XMOB 1AI6A 4LF4B 3DGEA 5KX5A 1SQQD 5IJ9B 2G3AA 2I1JA 2VRSA 3WUVA 2VQEB 2Y0DA 2IX7C 2Y0PA 4GT1A 1YJ9V 3TDKA 1FZAA 1JMMA 3WB2A 1Q43A 5LMUB 1FJKA 4PV1D 3H32A 2W0FC 1JFFB 1V55C 2QJ1A 4I55A 4JV5O 4TLFA 3P8CE 5J9PC 3E83A 2A45G 3CD6V 4LFBO 1I08A 4LC1A 3PHLA 4TV9A 3CP1A 4DR2O 4MTXA 5LA6A 1YJNV 2Q0OC 2JS3A 1LTGC 1Q82Q 4JZGA 1GMGA 2XAHA 2ZT9B 2A06H 1VQNV 4C7NA 1ZR4A 1SQPJ 1NS1A 3LSQA 1I94O 1Q86W 2QJKC 1M57D 4B3MO 3ZHQA 3OGIB 4U3JB 2ADQB 2GTSA 1AA0A 2P7JA 3H1HJ 4DRXB 2NPSA 2SPZA 1IBKO 3RK3D 1OV9A 3D70A 2YIAA 1Y74A 3B2EE 1N2DC 4X62B 1AILA 2UXBO 1KQGB 1BDCA 2ZYAA 1RF1C 1H2KA 2BOBC 4FFBA 1HNZO 3B8EB 4IFDK 4D7SA 3K0GA 4DV0O 4X66O 1ZSPA 4QIWF 3L75G 1R1BA 1SQQG 3OMNB 1CSBA 2H94A 1VQKV 4O4HA 5L3CA 2YXQB 1J1DB 1YF2A 3ZX6A 3TETA 1SQBE 1S0VA 5BZBA 2FFDB 3LIEA 1Y66A 4UXNA 3H1LD 3H1JG 3RN4A 3SPIA 2AEMA 1H8HG 4Z2WA 2ZT9C 1K7DA 5A9GA 1MG1A 1L0LG 1N36B 3BFRA 2JEXA 3AE8C 2YEVA 1PP9J 4QJFB 1OCCC 3BA8A 3ZMZA 4H37A 1FJPA 1JVMA 3FXEA 2H8PC 3S3WA 2HP8A 1HBWA 1PP9H 1PM9A 1SQXD 3SPJA 3CCUV 2YKQA 4QGPA 4UVCA 4O4LA 1KILE 3TNUA 1VQ7P 2GUZB 4LF9B 3BCCG 3M0DA 3CE2A 3EVKA 3OAAG 5KHHA 2E5LB 3I55V 4X64O 1K33A 2AXCA 4OPHA 1NTZE 2AEJA 4YXWG 5CJ4A 1FXHA 1Q81Q 4I4TA 3OGCC 4GKKO 4O2BB 4O4IA 2FYZA 1S3JA 3GG2A 5IJ0A 4WFBV 3TYYA 4WBNA 3H32B 1PGQA 1K9MW 3D3QA 2NPSD 4ASWA 1YQ4C 2W90A 1JCCA 1ROPA 1FZFA 1BMFG 4CH4A 1GKFA 4HNAB 2HEPA 2D2CD 4IFMA 4WVZA 2F66C 5LHHA 4DK1A 1LP1A 3R66A 4LNUB 3APQA 1E1QG 2XASA 2HPCB 1EM1A 4PHZA 3SWFA 1BGYG 3B40A 3OFNG 3AG3C 4CH5A 2HPCA 4BRYB 3ASOC 2F23A 1QNMA 3RYIA 2AHYA 1A02F 3L74J 1SETA 2X0LA 3K08A 5KA5A 1VQ6V 2IH3C 4JI3O 3NFQA 5FL7G 2BTOA 3BCCJ 4KHXA 1SQXH 1SQXK 2WAMA 1KD1Q 1SRYA 1IZ3A 1M7LA 1URQC 2ZVNB 3K3WA 3CCJV 1ZW0A 3GWKC 5ITZB 3IAYA 1GM8A 3ZHRA 1VQ7V 4UVAA 1RF0C 3CLQA 2X6AA 3L70J 2IFMA 5H5NA 2MW2B 2PF4E 2W6JH 3RYFB 3KXDA 4H13D 4XFJA 3VYIA 4DR3O 1TAEA 3PJSK 5D5QA 5KLIC 2P90A 4EEQA 2VWKA 2A3QA 1GL2B 1PP9G 4E2LA 1SZXA 1OVRA 1YJNP 1AJYA 2NN4A 4LF8O 1ZN5A 4DW1A 1MFZA 2FYUG 4YY3B 4AQRD 3EHBB 1P49A 1JB0J 2IBZI 2UXDO 1M56D 4XDKA 4KUMA 1LUVA 1VQNP 1WAZA 4IL6E 2O01N 1Y67A 3FYEB 4UUJC 5EZYA 4DV6B 2QIWA 3OMIB 1PP9E 3A0HE 2HG5D 3G4SV 2YUAA 5EZYB 3HD7D 3HTKA 1YXBA 2P1JA 1KILB 4H33A 3H1KD 2QR4A 1JY3N 2XUMA 4OH8B 3G4SP 4O2AB 1YTFD 2UU9O 3RL0g 3QNEA 4J7JA 2KUBA 2OCCB 4TQFA 4LF6B 3G6BA 3KCXA 4JYBA 1DD4A 1VQ8P 3QH9A 2XKMA 1RF0A 1R73A 2ODMA 1HJBA 4JI0O 1QL2A 1H0TB 1X4TA 1NR7A 2GUZA 2Y48A 4I7ZB 1KQLA 1VP7A 2WSCJ 2CTWA 3G67A 2GHYA 3L74G 3JCZA 1IVSA 4B3RB 1W0KG 4X9QA 1EBOA 2QM4A 3G71P 3TXQA 3CWBH 1NTMG 4WFHA 1NKNA 1KB9E 3CXCU 2IYOA 2Q8VA 4TUYA 2Q9IA 4MVMA 4YXWH 4N78D 1S2EA 2XNDG 3ICXA 4NTYA 3F7VC 2QJYC 2OARA 2N04A 4ICGA 4NXNO 4ZIBA 2IBZG 2C9NY 1Q2NA 2VRZA 3B8MA 4B3MB 4LWSA 1HNXO 1RF1A 4JI7O 1KV4A 2EIMC 4Z1VA 1R6NA 2YXRB 3EXAA 1L4AA 1D2DA 3B5NC 1OCZC 1SQVJ 4IFFA 5LXTB 2RN9A 5CCHA 5E79E 4HBNA 2FYNC 4IHJA 2UXBB 1KYOI 1HR0O 3ZHUA 4JI5O 4W7ZA 5M1BA 4MVUA 3I56P 1NQTA 3E22B 1W2BU 4GX1A 2D3OW 4O4LB 3T1CA 3ZBHA 2ZD9A 5A2QN 1L0ND 2IJJA 5BMVB 1XDCA 1S5HC 3MIWA 1AR4A 2O57A 3HUSB 4RQEA 3CMEV 3T1HB 3L72D 2LJ2A 3N2KB 2ZR2A 4X1YA 3T4DA 1H2SB 3HUSA 5JCOA 1JO5A 4TT3H 1N7SC 2K88A 1N7LA 1CXZB 4TV8B 3Q4HA 4W4LA 1RY3A 2WSFH 1NTMH 1NTMK 1CW5A 3AE9C 2LP7A 5GTIE 4PDMA 1L0LE 4JAUA 1ZX3A 4LLHA 3BATA 3MP7B 1F7YA 5CJ0A 3USSA 3TCUA 2YSUB 2Z4EA 1OCCB 3ZJZA 1GTWA 2LQTA 2IJHA 4LH7A 1P84H 4ZOLA 3WFVA 3OTOB 1DD3A 4UB6H 1YTZT 4AQYB 4BRYA 3ASNC 2UUAB 3JARA 4IL6Z 3GF7A 1AP5A 3IFXA 3P3NA 3NXSA 4G27B 5LL6Y 2DW3A 3J80N 1N32O 3JALA 4JYCA 5TISZ 2RJZA 2B1GA 1B3QA 3CC4V 3IFMA 3N2GB 3FB6C 3JALB 4F6RA 1L0NH 1L0NK 1SQVG 3CXHE 5FPOA 1EZVE 2A0LA 4BW9A 2N05A 1HH0A 4DUZO 4L76A 4F6RB 1MNGA 1QR8A 1JY3P 3LNNA 2DW4A 2LFSA 1XEQA 2QE7G 2XAGA 3L72H 3RT3C 1L2PA 3CCRP 1DF4A 4JI6O 4B3TO 2N9BA 5JQGA 1IFJA 4FLVA 1S5LZ 4K0KB 2WLJA 1FZCB 3L9DA 1WP7A 2KP8A 3SSUA 1FZBA 5KHJA 4DT0A 2VS0A 4G28B 1MFTA 4UB8E 1ZL8A 5IDJA 1TGOA 4TUYB 2BEQD 2HG5C 2JDIG 5LHGA 4IL6H 4HAMA 3BA9A 4HZ3A 1JTHA 5AW7B 2JWAA 4H44B 1KFNA 2Q6QA 5JVDA 3C8VA 2DQ3A 4JTDB 1DEEG 2IBZE 3N27A 4J10A 4HJGH 1NTKD 3CPWO 4RJTA 4FIPC 1GRJA 2EJRA 2B87B 1L8DA 4U7NA 3SDLA 1SS1A 4GOFA 1M93A 3ZRSA 5AVRB 3W7SA 4PI0A 2ZM6B 2KLUA 4K8ZA 2YO3A 5AW1B 5LMNB 1JCDA 4OGQD 2IZ1A 3S3XA 2HFEC 4DV4O 1LTBC 2BOCC 2M7WA 2QM8A 2R72A 5APXA 4EB6A 1NAYA 2WT7B 2HYNA 3D6ZA 2QA4P 5BMVA 4DR3B 1IDSA 4OWFA 3CRQA 1LTJC 1K92A 2WLKA 3CS5A 3ABMC 3B71A 1VQ8V 2BTQA 3Q3DA 4D7TA 1VF5B 1VQ9V 1PD3A 5JJEB 3U59A 2K9JA 1MKMA 1MZ9A 1SQBD 1HW7A 2OCHA 2FKXA 2H3OA 1SKVA 2ZDIA 4DV7O 1NTZD 5FPRA 4MVZA 3UT5A 3RL0D 2XAFA 4L8JA 2O01H 2IYPA 3L75J 3AK3A 4IGGA 1K4DC 4DV3B 2R9AA 3J7AU 3H9VA 2QEXP 2HVJC 1L4AB 4R8CA 4I2LC 2XV5A 3SWKA 3L72E 1S5LH 5APSA 2DYSB 2FYUE 4G2KA 1H38A 3A3YB 2OYIC 2JVDA 1XREA 4JF3A 3Q5PA 1L0NE 3LDDA 3JARB 4X89A 3VQXA 3L73D 1QCEA 2KOGA 5LGNA 4LF4O 3ABTA 4DV1O 3AEBC 1WPBA 2YIUB 2R3CA 1NOHA 1CZQA 3PP5A 2J59M 2KKWA 3H1IJ 1WA8A 1YTZI 2V7QJ 2BCCE 5GTHE 4EFBA 4MW3A 1H2NA 1Z2GA 1WA8B 3C3TA 2KZJA 3M99B 5ITZA 1J1EB 4D6TE 3HKDB 4JGSA 1BCCH 5L3BA 2WA4A 5KJ7C 4ZBMA 1SC5B 3RYHA 3RYCA 2H8PD 5CA0B 2PI5A 3HE5B 1FDOA 1NVOA 2KLVA 4WY4D 1KKDA 2QE7H 4J41A 3CCVP 5APUA 1WP8A 1BGYE 4WWIA 4LR3A 4FLTA 1VQ5P 1CEZA 2ZR3A 2CGOA 5K1PA 4NKGB 5IYZB 4FLXA 2KXPB 2Y9YA 3CI9A 1GD2E 4FM2A 3ETGA 1KQSU 1XNQB 1VF5D 5BU8B 2QTSA 3HKBB 1KYOE 2ITDC 2YDEA 1PGJA 1OW8A 4FMTA 1QX8A 4Q6GA 1FBMA 4LFCO 5AW0B 1HF9A 2WMMA 3FD9A 2M3BA 3V4QA 1Q6IA 4BR6A 4WF9V 1KZUB 2AW9A 4JQ0D 4DR7O 4LFBB 4DR5B 2YIUC 4CS3A 3MHVA 2UXDB 3T1HO 4GIFA 1NZ6A 1ZUQA 1NU1E 4X64B 3DTUB 3V4WA 1PPJG 4GKJO 1VIBA 2YXYA 5KHIA 4ZKPA 1HGZA 1OZ0A 3B09A 1E79H 2WLIA 3FGAD 1YQ3C 1VQPP 1BHAA 3IJ4A 2O01J 4U7JA 2JGUA 2YMYA 2BEZF 3T2MA 3FB8C 3AG4B 5EBMC 2DYRC 3M9HA 5EYPB 2H43A 5EBLC 1FS0E 2G38A 3EFFK 3A2AA 3C9IA 1JX9A 2HHHO 1XUQA 4JI0B 1HNWB 4H0LD 2AXTZ 4U3FJ 3A8TA 2Q0AA 1KUQA 3UT5B 4X1IB 3SYQA 4DUYB 5AVTB 2LO1A 3ZN1A 4X66B 1YBKA 1OX3A 4DJGA 4UCVA 2UXXA 1N32B 4X1IA 1OCRC 2YNYA 3A0BH 5APTA 1NVPB 4CC6A 3H1IG 3CYOA 4BIZA 1S9KD 1SQBG 2YIBA 1FU1A 2FYUH 2FYUK 4PV1B 3BRVB 1K34A 4JYAB 2R9IA 4HH2A 3CXHI 3BPZA 4B08A 3H1HG 4NYKA 1IXBA 1PGPA 4EB6B 1W0JG 3T97B 1I7FA 1HGVA 2Z5IA 1MOFA 1J2JB 1V9PA 1QVFO 1Y76B 4MVQA 1XL6A 2YIDA 1XL4A 4ZHQB 1HVVA 2DMXA 4JI2O 4I0XB 2WLMA 2BCCH 4BW5A 5GTHH 1MZFA 3BEHA 3N2KA 3CCEV 1NTZJ 3KYQA 3P32A 4K3AA 3T4ZA 1PPJE 3CCJP 2C9LY 2FKWB 4JAVA 1USEA 5LHIA 3H6PA 5J2TB 3W7WA 2ZQMA 2W83C 1HNZB 3H01A 2Q67A 5J2TA 4NB5A 2OYHB 1RQVA 3OJAB 3K5LA 1TUBB 5C39A 2WPSA 1YJWP 2CDYA 4MVRA 4UCSA 1MSDA 3JYCA 3L4FA 1TUBA 3LW5H 4JI3B 2QEXV 1SP4A 2VWJA 1FXKA 2JGDB 3V5BA 2B88A 1L1FA 3W7UA 1YJWV 4B86A 2FFDC 1Q3EA 3KPEA 1MABG 2Q7CA 2JJLA 2X7RB 4ZI7B 5IYDO 2P4VA 2JGDA 1M1KQ 2LR2A 3OTOO 1YHQP 3M0DC 4PJ0Z 1NTKJ 1L0LD 3CC2V 2WWWA 5EIBD 4L87A 1LTTC 4GYCB 3W67A 1AR5A 2Q5ZA 3B8NA 2M5AA 2OTKE 3ASOB 3HKCA 1R5SA 2JDIH 4DV7B 1KB9D 2BCCG 2KSDA 3SYCA 3P8MC 3AK2A 1I5YA 3M9QA 3ZRWB 1YITP 4NPEA 3AEAC 2QKSA 3SJAC 4JV5B 3QG5A 1SQPE 2YEVB 4LF8B 3THOA 1N34O 1NI8A 4ZKUA 2KG7B 3I5DA 2O1KA 1HDJA 4D6TD 5AVZB 4MW8A 4U3FE 5J2UB 2DWEC 4QE9A 5H2FE 3ZN0A 4GOEA 3JSVC 4UB6Z 1GK9A 4DV6O 2OWOA 4B3TB 1QBZA 2WA3A 3LUTB 1URQA 2GA1A 3HKBA 1RE3C 1FE6A 3BRCA 3CWBJ 2UUBO 2WPRA 3K58A 4AI8A 1FAFA 3IGAC 2NPSC 1E79G 5DECA 3RK2B 1BE3J 3GHGA 2E75D 3KG2A 3RBZA 4B7KA 3CX5E 1HUCA 1ENVA 4F4LA 1JY2P 1HJ0A 1FXKC 1R8EA 4X8AA 2IH1C 5KLVE 5E79Z 1LT9C 3RK3C 5IJ0B 1RM1B 2ITAA 3H1KG 1EN5A 2QVAA 2Q69A 1KYOH 2R3SA 1DIPA 1K04A 2FYUJ 1XMQB 5B5EZ 1JMKC 3UO3A 2A06G 2OYIA 1BE3H 2HODB 5AVQB 3GVMA 4FK5C 1RE4C 3TF5A 3WUUA 2F4VB 2JO1A 1NTKG 3M0AA 4D6TJ 4H0LC 4PDLA 2Q4PA 1OVUA 1GH6A 1VQOP 3HB3B 4PD4E 4MN4C 3OW2U 3L70G 2WSCH 3ETEA 1RH5B 4JI7B 1KU9A 3A5TA 1MA1A 2BCCJ 4UB6E 1BSHA 2BSKB 5H2FZ 5TISH 3IR9A 2FYNB 2WPDG 5AVYB 1AV1A 2ZJSE 2OYHA 3ZRXA 1VQ5V 2BSKA 2W27A 3MD0A 2L91A 4XDJA 5KUKA 2WLLA 5KMGB 1S5JA 1L0LH 4GKJB 1L0LK 2ZYGA 3PRJA 1GMJA 1FXKB 2P7TC 2XZRA 5B1NA 1SQVD 1NU1H 1NU1K 2KIKA 1PFIA 2JIZG 3A0BZ 3A0HZ 1OIPA 1VMGA 3V2QA 1HWTC 2RH0A 1M56B 4LF7B 1S5LE 1TUEB 3BVHA 1PNKA 1HWYA 4I50B 2FTKA 1OW7A 1KYOD 1DK1A 1ZLLA 3RK2D 1H8AA 4AUWA 3TJTA 2C0WA 2WSEJ 4I50A 5EBWC 4GX2A 3CWBE 3AG7A 2UUCO 5HFMA 1IO4A 4WFFA 2UU9B 2Z5UA 1K73W 3CX5H 3CRAA 3QO5A 5KAFZ 2EX3A 2HKOA 1QLEB 3U10A 2H88C 3ABKC 5KUMA 3LSSA 4CZZA 2DJVA 2X6CA 1IX9A 5CBFA 1BL8A 1KILA 1JCHA 2P06A 1GK6A 3O8ZA 2CTQA 2RMKB 4NXMB 2W6BA 2ZE7A 3JCUH 4YJ3B 3A2FA 2ZFCA 4BIOA 2HJDA 4ZNCA 1KECA 1E5WA 3GW6A 2POHA 3ZMUA 2ZNJA 3H1KJ 4FFBB 1M57B 1N73C 3SFEC 3SYOA 4X65B 1FFXB 1W59A 2OT5A 4IYHA 5GTIZ 4PD4H 1VQ4P 4DV2O 2NR5A 1N0JA 4F6EA 5KTBA 1HNXB 2IU3A 3FWNA 3KHUA 2B5UA 4P9OA 2M5AB 2UUAO 1FDMA 1PPJH 1KN7A 1NT2B 4K0KO 1MSWD 3C90A 2ITCC 4DR7B 2ZNIA 1GAXA 2RKLA 2EZOA 3ZRWA 4AYCA 3H1KH 2HODA 4LF5B 3ZS8C 3H25A 4WB4A 2AGAA 5TJHA 1H89A 4U3FD 1LNQA 1EC5A 1IBMB 1VF6C 3ZRVA 1JPXA 3CMAV 1EDLA 2CPSA 1SQXE 1GDTA 4I9WA 1P84I 1BCCG 4JI8B 4NPFX 1KORA 2YI8A 4K35A 5IYBO 4BAYA 1AQ5A 1EDJA 1FC2C 4KL1A 3NR7A 2JEEA 2V7QH 2PGGA 2E75C 4JF7A 1GU4A 3JAKB 2HHHB 2ILMA 3D6YA 3CJHB 5LYJB 2W6JG 3V6IA 3L74D 3SJCC 1BQZA 1IURA 5IWAB 3CJHA 5LYJA 2O1JA 5IJ9A 3P3PA 1OMIA 1IFIA 1BDDA 2CUGA 3QTCA 3ZEDA 2HFED 3PLNA 1JFFA 4I55B 2Q7GA 3OE7G 2RDCA 4WBNB 3N4XA 4PD4F 1OCZB 2CTRA 2ZE8A 3O9OA 2PRRA 2AZ0A 3HRNA 1Y76A 1TVKA 4WBAA 2Z3YA 3L75H 3OTFA 4HYTB 2ZM6O 4ZOLB 2YC0A 1XNRO 1BE3D 2QG4A 3TSIA 2LFRA 3ETQA 3BAAA 1GN3A 2EJ7A 5KAIZ 5GTIH 4UV8A 3Q1MA 2N74A 4FJCC 1UIIA 4WFGA 4DYLA 2Q1KA 4J11A 3CWBD 1FJGB 2JEUA 5IE9A 1Q8IA 5B66Z 1OZHA 1PV3A 4DRXA 2NPSB 1VDFA 4LFCB 4U7OA 1H2LA 1Q7YW 1F51A 1FYJA 2WSEH 3APOA 2XNDH 2EIJB 3CX5F 1QVGO 5LGUA 1OWAA 3VQWA 5KMGA 2Q68A 1B6QA 4DV1B 2RNBA 3SJBC 2N1TD 1PKXA 1VPCA 1RE4A 4O4JB 3P30A 2K9YA 2B9BA 1CI6A 3RVYA 3F7YC 4EFEA 4DV5B 2Y4UA 1I5XA 1FFXA 1M1JB 1FDIA 4YXDC 1NH2B 1EQ7A 3D36A 3L73J 2JJ1G 1QEXA 4J80A 1Y47A 3LW5J 3HUSC 1DTOA 3K9AA 5GTHZ 4IT5A 4FLWA 3FFQA 4Q20A 2F1MA 3AK1A 5BY1A 1KP3A 3CX5I 1N7SA 5JVDB 1PL0A 1P84F 3U11A 1OCOC 3MUDC 5AW5B 1N7SB 1GM9A 1WN7A 2YIBD 3CL3D 1LGHB 2KB7P 4LF6O 1EFRG 2R5DA 2NZ2A 1WNSA 2H89C 2KSEA 3F5HA 2OGUA 5J2UA 2ZXWC 2MK3A 1KKCA 4JBZA 2KZIA 4DOJA 3F5WC 4PD4I 3X2QB 1NKZB 3S1KA 1PV0A 2E5TA 4EIJA 3B5ND 2AXTH 3JD4A 4KJMA 1SQFA 1KILD 4KP4A 3RGBA 3RL0B 5B1BC 2GBOA 4PDVA 3JSLA 1SQXG 5DJUB 1S5LX 3OEEG 2NNUA 1NTKH 4MVSA 1NTKK 5B5EH 5FNVA 3BVOA 5IT9N 1FFTB 2N1TB 3CPWU 4H13C 1GL2C 1PPJD 5AVWB 1W2BO 4DR4B 3BCCE 1FZCC 2CK3H 1G6UA 5KHKA 1M5IA 4JI5B 1LT1A 3ZMSA 3JAWB 2P67A 1T3UA 4N6JA 1K9MQ 1BSMA 3L71G 5CA3A 3D71A 5K5GB 4PA3A 4U3FH 4HYOA 4NXMO 5CCGC 3T1YB 1TU3F 1G2CA 1M1JC 1GK4A 1KC8Q 4YHHB 1OFCX 4GX5A 1CPYA 2PFXA 1KB9H 4QMAA 1AVOA 3B77A 1D5NA 1M8OB 1SQQJ 3JAKA 1JNMA 1LTSC 1SA0A 4N78E 3ABLB 5AVVB 4P9PA 1UFIA 1LWUB 2ARHA 3CCEP 3H1JE 2Z5HA 1NTZH 1NTZK 2Q73A 4O4JA 3IF4A 2CE4A 1SFCA 2QKAA 3VQYA 5EC2C 4QPJA 3HE4B 1Q7YQ 4EDFA 1M1JA 1S1CX 1KTMA 5CA0A 3VBBA 3HE5A 1SFCB 3U1CA 2WSSG 3L73E 3CCMP 3AE3C 1SQQE 4J9ZB 1LJ2A 5CN0A 4GUNA 3L75E 5KAFE 4EYYQ 4LF5O 1WB7A 1V55B 2LGWA 2WLNA 3FYIB 1Q82W 2K1EA 2FL4A 4ZKIA 4JYAO 2IW5A 4DR5O 1DF5A 1JJ2U 5KAIH 1R6TA 2CK3G 3KQGA 1N0NA 3F5TA 3IC9A 1NJIW 2HR3A 3L71H 2W8ZA 1NO4A 5LA6B 1Q81W 3A0BE 4PA6A 4DV3O 5AVXB 1V54B 4DR1B 2QA4V 5AW4B 4P30A 4N21A 2UUCB 5C8YA 2Q7EA 5B66E 1T2KD 4JI6B 3OEHG 2ZE6A 1PNMA 2N9YB 4CPGA 1AP6A 3HTKB 5IWAO 3CCVV 1FXVA 2FMLA 4UCTA 2Q6AA 3IAOA 2EINC 1CI6B 3G71V 1P84E 3CB2A 2JKVA 5B3SC 2FXPA 3AEDC 2XAJA 1H0TA 1VQKP 3L73H 1FZCA 1J5EB 4I1LA 3U1AA 3H1ID 2IM9A 4FM1A 3QO8A 3L70E 2OYQA 1Y9BA 3OM3B 2W6AA 1GTOA 2A45I 1YJ9P 3HKEA 1J1DC 1Q5OA 2ATKC 3BHPA 2QRXA 2WVRA 1X0TA 1NTKE 3VTPC 3AEGC 1S9KE 1PL5A 2UXCO 2A06E 2DYRB 4EOTA 3K5OA 2WZ7A 3E8FA 4Z1MH 3S4RA 2A9HA 1Q90D 2HLDG 4OVNF 1VF5C 1AROP 3H1KE 1GW4A 2WSSH 1O9HA 1RPRA 3M8AA 4BWNA 4KHPO 2CGNA 3E22A 1Q6UA 1KB9F 5KLVG 2QSAA 1IFMA 1VQMV 2Q3IA 4KXRA 2YS8A 1JJOA 4IHJB 1H88A 1AJPA 1YYCA 5CBNA 2JJ2G 3LDCA 4J7KA 2K1AA 1SA0B 4PA4A 5JH7A 1M1KW 2ZVOB 1EZVD 4X1YB 2V4DA 3ZDMA 2RN0A 2R70A 4YTPC 3H1HH 3GHGC 1LTIC 1DX7A 1U57A 4HKZH 2BTQB 1IBLB 1AB3A 3VOUA 2E76C 2QSIA 3OMAB 1N33B 3HE4A 3PH0A 2UUBB 4U3FG 3KDPB 1K4CC 1QHTA 4YPCA 3RFRA 1CP9A 4PELA 3GLMA 3JCUE 5CBOA 4O2BA 2YKPA 3Q4HB 1JM0A 4GLXA 2M0BA 2VQEO 1DH3A 2OTLP 5GONA 1M4UA 1U7MA 1M90W 3V2PA 1GU5A 3B4SA 4UB8Z 2P58A 3GF3A 2DN9A 2EINB 1BS3A 2QJPC 4Z1MG 4RUFA 1J1EC 2FBWC 4RO0A 1ZXGA 1NH4A 4CH6A 2PYLA 3AEFC 4EKWA 4PJ0E 3UIAA 4R6ZA 1U97A 4I9QA 2IPPA 1XMQO 2BE3A 3N2GA 2BCCD 4MVOA 5KJ7D 1OCOB 1BCCJ 3VMZA 5H6QA 3ZCCA 1YZBA 1TA8A 2F4VO 2OIGA 1N34B 4UFZA 4TSFG 3M7MX 4NTXA 4DV2B 3VQVA 2CH7A 1RQUA 1ORQC 2WQYC 5JQGB 1K8AW 3RK3E 3HKDA 4DR6B 2CH7B 1M9NA 2QWPB 3JD1A 2FYUD 2E3CA 2LKMA 1FOSF 3OR6C 3L36A 3VOPA 5AW3B 3CHXA 3W7TA 3MAQA 1KFMA 1N86A 2Y9ZA 2Z0AA 1GL2A 2IDBA 4L74A 3TGUH 5KHGA 2QJKB 2XOKG 2EILB 5CMUA 5H6RA 3OW2O 3BABA 3CRMA 4O4HB 1P4RA 3RK2C 1PNLA 2KI7B 4LBEC 3STLC 1FOSE 5IYZA 3CCMV 2E74D 1SQPH 3ABKB 1SQPK 2FXOA 1N8RW 1SQBH 1SQBK 2RMZA 4EI2A 1MV8A 1AI7A 1COWG 1YCIA 3GHGB 4P2ZA 4JI8O 4CC5A 5BXZA 3AE2C 1NBMG 3HR0A 2HVKC 3RVZA 1IFPA 3OT7A 4XDLA 1QVGU 1AVYA 5EFWB 3E35A 3L73G 4O2AA 3H1HE 1MMMA 3Q5SA 2R32A 1BSNA 3WUTA 3SJQC 4Y28J 2K37A 1YI2V 3UQ8A 3O65A 1FPOA 1Z5WA 2CAZC 3K59A 5F2VO 4MT8A 4NVPA 3WB0A 5DN6G 4XA4A 5LP6C 5B5EE 1R6KA 5EIBC 2QJPB 3M91A 2DOSA 3K5MA 1XHXA 2KNCB 3L72J 1RSOA 4Y99C 1KMIZ 4DUYO 3PTZA 1A32A 4FM0A 1L0NJ 1S72P 1RPOA 2IU0A 4QE7A 3CRRA 2LXCB 1L0LJ 4M3LA 3VMAA 3TGUD 1XNRB 1LWUC 4LF9O 3G9RA 1FS0G 4NPDA 2UWJE 3CXHF 2E5LO 1S72V 1GN4A 2ZDIC 4JTCB 1AQTA 1M57C 1USDA 3ITKA 1A02J 1BHBA 1N73B 4GX0A 5L3DA 1IBMO 3L71E 1H2MA 1JOYA 5APQA 3KKYA 2GSMB 1R3LC 3UCSC 2V1DA 1N73A 4DXWA 1GN6A 2IZ0A 4JI1O 3JAWA 3JC22 4FLUA 4LNUA 4CS2A 2A7WA 4YIPA 1IBKB 3BASA 3F89A 1KQSO 2MJZA 3CX5D 4UCOA 5APWA 2Q9LA 4CBCA 1XQ8A 2E74B 2W6IG 2E74C 3ABVC 2KS1A 1N4CA 3ML0A 3SR2C 3WB1A 3T97A 3V2RA 4ZMDA 1SLQA 3RYIB 3G3ZA 1DGSA 1N7SD 1NTMJ 4H13B 1YSCA 3CRCA 4DV5O 4DV0B 2WITA 2A06D 1EZVH 4JAAA 2WPQA 4YHHO 4FZ1A 4LH6A 3JATA 3AEEC 1NKDA 4TT3G 3MTUE 3NMDA 4N23A 2XHBA 3CXHD 5H2FH 4TV8A 4BXLA 3MHSC 4QNHB 4HB1A 3CCSV 2YKOA 2PTMA 3RGUA 3AG3B 1VF6A 4LFAB 2OTJV 3RYFA 2ZINA 3AE7C 2PP6A 3II6A 2JR8A 4PD4D 2E75B 2LW1A 5CCGD 2XDJA 2PGDA 2X6BA 2ZIOA 4RUEA 3K0DA 5B3SB 2KK7A 4FLZA 4FLYA 1G1JA 4OPAA 5IY5C 2M8RA 4JI4B 3TGUG 4B3SB 1SQVH 1SQVK 1T8ZA 3B5NA 3O6QA 1UJWB 1QLEC 1OCRB 1VEWA 2EIMB 4YJ2A 2CPBA 3CCLP 2ZIMA 2YXLA 2L35A 3C3SA 2G8YA 3H1LE 3KZIZ 1GN2A 3LSUA 3O6QB 3RWRD 3ASNB 5L3GA 4Y99B 3MUDA 3DC5A 3E86A 3RW0A 2EIKB 4PV1C 1AI4A 4C7NB 3L70H 4MTOA 1OXZA 1W2EA 3K5BA 3H1LH 4RKUJ 4W4KA 4QPKA 5KLVJ 1P7GA 3AE5C 4L73A 1S77D 1L0NG 2D2CB 3GB7C 4JPRA 3WG7C 3W68A 2C2AA 3E2EA 1VQLV 3ZIAG 1PIXA 3L72G 2QTOA 3K57A 1QQCA 4GZRB 5KA6A 4DR1O 3L71J 2RQ6A 5CCHD 1E1RG 2Q5UA 4X88A 3R2PA 3SYAA 1Q6HA 2Y0IA 4MSWC 4GODA 1JOCA 1M56C 3CXHH 4GDOA 5JWPA 4TOIA 1VL2A 1H8EG 3MHHC 5H9CA 2JK5C 3K79A 3CCRV 5E1AC 1SVFA 2YO2A 1JY2O 2LGQA 1X59A 1LT9B 3CCSP 3FB5C 1RM1C 1EN4A 3ETDA 1F4NA 1LT9A 2JRIA 5CA1A 4OXSA 3WU2Z 3TK1A 1IC2A 3VMXA 1AJNA 3UO2A 1X9VA 1ZP0C 2B87A 3I55P 2OTLV 1EN6A 2ZAEB 3LNMB 1EZJA 2F93B 4DCKA 3DSQA 4DO2A 3IC7A 5BR8B 4WFAV 3OAKA 1WT6A 3V2NA 1K5QA 4NXNB 2AXTE 1YVWA 5C93A 2KS1B 5JJNB 3MZWB 2DWDC 2YMKA 2KSJA 1QLED 2GTAA 4I0XA 2WSFJ 4X65O 5B1BB 1THZA 5JH7B 1IJDB 2ZT9D 2Y0EA 5HFLA 3CC7P 3SPGA 1JMBA 3TNUB 5AW6B 1NYHA 4C7UA 2FY8A 1WLEA 1DEBA 1N8RQ 1JA8A 3J81N 2QDOA 4X1KB 5JJJB 3FX7A 1BCCE 1SQXJ 4RQFA 3RK3B 3KCYA 5AW9B 4IOIH 3L74H 1ZOYC 3OD4A 1XTCC 3MGNA 1SERA 1LTAC 3Q5RA 3VP8A 4MTFA 1ZTEA 2YI9A 3ZHSA 2AEFA 1PP9D 5GONB 1URFA 1I0HA 3WU2H 3Q2YA 1WB8A 1EZVG 4YJ2B 2DYSC 1R3JC 3SYPA 1SQVE 5AVUB 4C7RA 3HD7C 2EILC 2J5UA 4H0LB 2QM7A 4LF7O 4ZI7A 2W0XA 3LDEA 2PY5A 2ADPA 5TISE 3A7OA 1J95A 2EIJC 4X62O 3U0ZA 2CTPA 4J7ZA 3L75D 4PA7A 2E5YA 1RHZB 1BQ0A 1KB9I 3VN0A 4FVMA 2XT9A 1K3EA 1B04A 2Y69B 1AVMA 4JTAB 2I1KA 3JD2A 2AZ2A 1FZGA 3KZIE 5CBHA 1YDXA 3JATB 1SQBJ 5FLXN 2RCVA 1J5EO 4PJ0H 1BE3G 3CCQV 3TXSA 1QVFU 2IBZH 2XAQA 1SS3A 2EBOA 1BE3E 1DLBA 2UXNA 3CCUP 3CC7V 3HKCB 3K03A 1IK7A 1D5AA 1M90Q 1NVPD 5KAIE 1WMKA 3FX0A 2UXCB 1VQ9P 4RO2A 4DUZB 1QLNA 2B89A 2I8DA 1SESA 1JUNA 1URQB 3H1HD 3OUSA 3OA7A 3RBXA 4CH3A 3JAMN
chains in the Genus database with same CATH topology
1JVMA 2H8PC 1MOFA 1V55B 2WLNA 3FYIB 1V54C 1G4YB 1Q82W 4MVQA 2K1EA 1XL6A 1ZWIC 4ZKIA 2IW5A 3SPJA 1XL4A 3CCUV 1JJ2U 1DF5A 4UVCA 2WLMA 2CK3G 4BW5A 3BEHA 3OAAG 4BIUA 3I55V 3CCEV 1NJIW 4LP8A 1K33A 2HR3A 3P32A 3T4ZA 4YXWG 3JD0A 1Q81W 4ASUG 4JAVA 1FXHA 4PA6A 1V54B 3OGCC 5LHIA 2QA4V 1S3JA 1KD1W 4P30A 4N21A 4WFBV 3W7WA 2ZQMA 3OEHG 1PNMA 2WLIB 2Q67A 3H01A 3CCVV 1K9MW 1FXVA 1YHQV 2Q6AA 4JASA 4GCZA 1ROPA 1BMFG 1AJQA 2EINC 1GKFA 3G71V 2ZXWB 4WVZA 5LHHA 4MVRA 3D3IA 5B3SC 3JYCA 1E1QG 2XASA 2XAJA 2QEXV 1FXKA 3AEIA 1L1FA 3W7UA 2AHZA 3OFNG 3AG3C 3SPHA 1YJWV 1MABG 3I56V 3QO8A 3ASOC 2X7RB 5IYDO 3OM3B 1GM7A 1GTOA 2AHYA 2IJIA 4RAIA 1SETA 2X0LA 2ATKC 3K08A 5KA5A 2IH3C 3CC2V 1VQ6V 1K5SA 2WWWA 2Y69C 5FL7G 4L87A 2EIKC 1YIJV 2F43G 2WAMA 2DYRB 3B8NA 1SRYA 3K3WA 3ASOB 3E8FA 3CCJV 2JDIH 5B1OA 1GM8A 3ABMB 2A9HA 3SYCA 5B1AC 2HLDG 1I5YA 2R9RB 3ZRWB 2QKSA 4UVAA 1AROP 1VQ7V 2X6AA 1Y4MA 2WSSH 3GWOA 2YEVB 1RPRA 3AG2B 3AG2C 2W6JH 3PJSK 4MW8A 2P90A 4XBFA 1VQMV 2DWEC 4QE9A 3ZN0A 1GK9A 1AJPA 1QBZA 3LUTB 4E2LA 2JJ2G 3LDCA 4R7CA 2A79B 4PA4A 1M1KW 3EHBB 3IGAC 4XDKA 1NR1A 4KUMA 1E79G 3FB7C 3UKMA 5GW7A 3FYEB 3AG4C 4UUJC 3KG2A 3RBZA 3OMIB 4TWKA 3VOUA 4WFEA 3OMAB 1ENVA 3E8GA 4F4LA 3G4SV 1YTFB 1FXKC 1K4CC 4X8AA 2IH1C 1CP9A 4PELA 4PDRA 1RM1B 4H33A 3ZMTA 1YTFD 2Q69A 3QNEA 2OCCB 4JYBA 1M90W 3OR7C 1R73A 2EINB 1NR7A 2B1IA 2Y48A 5B1AB 4Z1MG 4FK5C 4RUFA 1R3KC 3HPLC 2GHYA 3K04A 3JCZA 4EKWA 4PDLA 1W0KG 1EBOA 4R6ZA 3HB3B 4WFHA 3E8HA 4MVOA 3OW2U 1OCOB 3ETEA 5H6QA 3CXCU 3ZCCA 4LCUC 4MVMA 4PA9A 4YXWH 1BSHA 1VQ4V 2XNDG 4J9ZB 2WPDG 3F7VC 5IY5B 3JD3A 4TSFG 3ZRXA 1VQ5V 1SZTA 3G6EV 1ORQC 3B8MA 1K8AW 3MD0A 4XDJA 5KUKA 5L3FA 2EIMC 2WLLA 1R6NA 1K97A 1M9NA 1QR9A 3JD1A 1OCZC 3OR6C 1FXKB 5LBQA 2P7TC 3W7TA 5B1NA 2XOKG 2EILB 5CMUA 2JIZG 5H6RA 1P4RA 1PNLA 4MVUA 1NQTA 1AI5A 1W2BU 1M56B 4GX1A 4I5SA 4LBEC 1TUEB 3STLC 2D3OW 3T1CA 3ZMVA 1PNKA 3CCMV 1HWYA 2ZD9A 2FTKA 3ABKB 2IJJA 4J9YB 1S5HC 1N8RW 3AG1B 1AI7A 4RQEA 5EBWC 3CMEV 4GX2A 2V7QG 1COWG 4P2ZA 2ZR2A 5HFMA 3T4DA 4WFFA 1NBMG 2Z5UA 1K73W 1AR1B 3QO5A 2HVKC 3RVZA 3OUFA 1IFPA 2HKOA 1QLEB 1R3IC 4XDLA 3ABKC 1QVGU 5KUMA 5EC1C 3E35A 3LSSA 4CZZA 2X6CA 5CBFA 1BSNA 1BL8A 1JCHA 2LP7A 3SJQC 2P6JA 4PDMA 1S76D 4JAUA 1YI2V 3QO7A 3ABUA 3USSA 3TCUA 2YSUB 1F23A 1OCCB 3ZJZA 4MT8A 4UV9A 1KECA 5DN6G 2IJHA 1R6KA 3WFVA 3ZMUA 1VQOV 1M57B 3ASNC 3SYOA 1JQ0A 3IFXA 2OT5A 3NXSA 4G27B 1KP2A 1RPOA 2IU0A 1YITV 4QE7A 4JYCA 2B1GA 1FS0G 3CC4V 2IU3A 3SPCA 1S72V 4JTCB 2ZDIC 3FB6C 2B5UA 1M57C 4P9OA 5CBGA 1AQTA 4WCEV 1BHBA 4GX0A 4MTGA 5L3DA 1JOYA 2KB1A 1MSWD 2ITCC 2A0LA 2WLLB 2GSMB 1R3LC 2V1DA 2EZOA 3ZRWA 3X2QC 1QR8A 4DXWA 2XAGA 2DW4A 2LFSA 2QE7G 4FPPA 1DF4A 2HJFC 3A0RA 1LNQA 2WLJA 3ZRVA 1JPXA 3CMAV 1GO3F 4MS2A 4CBCA 3FKSG 2W6IG 4G28B 4I9WA 3ML0A 2NLJC 1KC8W 5IDJA 3UM7A 2HG5C 5IYBO 2JDIG 4BAYA 1YSCA 5LHGA 4HAMA 4HZ3A 1H2GA 2V7QH 2DQ3A 4JTDB 3AG1C 2W6JG 2WLHA 1NKDA 4TT3G 4N23A 4FIPC 2EJRA 1VQPV 4U7NA 3MHSC 4QNHB 3CCSV 3AG3B 2DQ0A 2OTJV 3ZRSA 3BY6A 5L3EA 3W7SA 3OE7G 1OCZB 2X6BA 2HFEC 4RUEA 2BOCC 5EK0A 2M7WA 2QM8A 3K0DA 4KFMA 5LGTA 5B3SB 5IY5C 3STZC 2Z3YA 4R50A 3R65A 1UJWB 1QLEC 1OCRB 2EIMB 1K92A 2WLKA 2LFRA 3E89A 1JEKA 3ABMC 3WG7B 1VQ8V 4UV8A 4FJCC 1PD3A 1VQ9V 3ASNB 4WFGA 5L3GA 3E86A 2JEUA 2EIKB 3RW0A 1AI4A 4MTOA 5DM6V 2ZDIA 4U7OA 2PI4A 4QPKA 4MVZA 1IXMA 1F4MA 2XAFA 1F51A 1Q7YW 1S77D 2XNDH 3GB7C 2EIJB 4JPRA 3WG7C 3CCLV 1WPXA 2C2AA 5IYCO 3E2EA 1VQLV 3ZIAG 1K4DC 5LGUA 2QTOA 1G8MA 5KA6A 2Q68A 2HVJC 1B6QA 4R8CA 1PKXA 1NH2D 1E1RG 4X88A 2DYSB 3SYAA 3P30A 3W7XA 3K06A 1P7BA 4G2KA 4MSWC 1H38A 2OCCC 3F7YC 3RVYA 4JF3A 1M56C 1OHHG 2EZPA 1I5XA 1H8EG 3LDDA 3MHHC 4X89A 2JK5C 3K79A 1QCEA 5H9CA 1NH2B 3D36A 5LGNA 3CCRV 2JJ1G 4UVBA 5E1AC 2IJKA 3ABTA 1DTOA 3E8BA 3K9AA 3FB5C 1RM1C 3ETDA 4Q20A 1F4NA 1KP3A 4OXSA 1PL0A 3TK1A 3ABLC 1OCOC 4MW3A 1AJNA 1AI6A 3DGEA 2OTLV 1GM9A 3M99B 4JGSA 3LNMB 1EZJA 5L3BA 4ZBMA 4DO2A 3IC7A 4GT1A 4WFAV 1EFRG 2PI5A 1YJ9V 1K5QA 1KKDA 2QE7H 5C93A 2ZXWC 2DWDC 2W0FC 2MK3A 1V55C 1CEZA 2ZR3A 4TLFA 5B1BB 5J9PC 3E83A 3ETGA 1THZA 3F5WC 1KQSU 3CD6V 3X2QB 4LC1A 5HFLA 3CP1A 2ITDC 3SPGA 4MTXA 2E5TA 4FMTA 3JD4A 1YJNV 1GMGA 1WLEA 4WF9V 2XAHA 4KP4A 4RQFA 1VQNV 3LSQA 5B1BC 4PDVA 1Q86W 3OEEG 2NNUA 4MVSA 1FFTB 1SERA 3DTUB 3CPWU 4MTFA 1OZ0A 1E79H 2WLIA 2CK3H 1BHAA 3ZMSA 2DYSC 2P67A 1R3JC 3SYPA 2EILC 5CA3A 2BOBC 2QM7A 4PA3A 4HYOA 3T2MA 3FB8C 3AG4B 5EBMC 2DYRC 3K0GA 3LDEA 5EBLC 4QIWF 1FS0E 1J95A 3EFFK 2EIJC 3OMNB 4PA7A 1JX9A 2E5YA 4GX5A 1CPYA 2H94A 1VQKV 4QMAA 5L3CA 1K3EA 3B77A 2Y69B 4JTAB 3JD2A 3TETA 3SYQA 1S0VA 5CBHA 3ZN1A 5BZBA 3ABLB 4P9PA 3CCQV 4DJGA 2UXXA 1OCRC 1Y66A 4UXNA 1QVFU 1NVPB 2XAQA 2EBOA 3SPIA 3CYOA 4BIZA 1DLBA 1H8HG 2UXNA 3CC7V 1K7DA 5EC2C 3K03A 4QPJA 1MG1A 2JEXA 1K34A 1NVPD 2YEVA 3VBBA 2R9IA 4QJFB 4RO2A 1QLNA 2WSSG 1OCCC 1SESA 3ZMZA 3OUSA 4H37A 1W0JG 5CN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVM A;  3SPC A;  2H8P C;  4JTC B;  3FB6 C;  4P9O A;  1M57 C;  5CBG A;  1AQT A;  2Q69 A;  2WLN A;  4GX0 A;  1V54 C;  1G4Y B;  4MTG A;  4MVQ A;  2K1E A;  2KB1 A;  1XL6 A;  1ZWI C;  4OXS A;  3ABL C;  3SPJ A;  1XL4 A;  1OCO C;  2A0L A;  2ITC C;  4MW3 A;  2WLL B;  3OR7 C;  2W6J H;  1R3L C;  4DXW A;  2WLM A;  3X2Q C;  4BW5 A;  2HJF C;  3BEH A;  4RUF A;  1R3K C;  3HPL C;  3LNM B;  4LP8 A;  3K04 A;  1LNQ A;  3T4Z A;  4EKW A;  4PDL A;  4ZBM A;  4R6Z A;  2WLJ A;  4PA6 A;  4MS2 A;  4CBC A;  3OGC C;  1KKD A;  2QE7 H;  4WFH A;  3E8H A;  4MVO A;  4G28 B;  4I9W A;  2NLJ C;  4P30 A;  3UM7 A;  2ZXW C;  2DWD C;  2W0F C;  4LCU C;  2HG5 C;  4MVM A;  2WLI B;  2Q67 A;  1V55 C;  4PA9 A;  4YXW H;  1BSH A;  4TLF A;  4HZ3 A;  4J9Z B;  2Q6A A;  3F7V C;  5J9P C;  3E83 A;  3F5W C;  2V7Q H;  2EIN C;  4JTD B;  1ORQ C;  2ITD C;  3AG1 C;  3SPG A;  1IFP A;  2E5T A;  2WLH A;  4WVZ A;  4MVR A;  4XDJ A;  5KUK A;  2EIM C;  2WLL A;  5B3S C;  3JYC A;  1OCZ C;  4QNH B;  3OR6 C;  2P7T C;  2AHZ A;  3SPH A;  3AG3 C;  5B1B C;  4PDV A;  3ZRS A;  3ASO C;  4MVS A;  2AHY A;  4MVU A;  4RAI A;  2X6B A;  2HFE C;  2ATK C;  3K08 A;  2BOC C;  4GX1 A;  2IH3 C;  4RUE A;  3K0D A;  4KFM A;  4LBE C;  5EK0 A;  2Y69 C;  3STL C;  4MTF A;  3T1C A;  2ZD9 A;  2EIK C;  4J9Y B;  1S5H C;  5IY5 C;  3STZ C;  1E79 H;  2WLI A;  2CK3 H;  4R50 A;  3R65 A;  3E8F A;  4GX2 A;  1QLE C;  5EBW C;  2JDI H;  2WLK A;  2DYS C;  3E89 A;  1JEK A;  1R3J C;  3SYP A;  3ABM C;  2A9H A;  4P2Z A;  2EIL C;  5B1A C;  3SYC A;  2BOB C;  2R9R B;  3T4D A;  4PA3 A;  4WFF A;  4HYO A;  2QKS A;  4WFG A;  2X6A A;  3FB8 C;  5EBM C;  3T2M A;  2DYR C;  3K0G A;  3LDE A;  1FS0 E;  2HVK C;  2WSS H;  3RVZ A;  3OUF A;  5EBL C;  3AG2 C;  3E86 A;  1J95 A;  3EFF K;  2EIJ C;  3RW0 A;  1R3I C;  4XDL A;  3ABK C;  4MTO A;  5KUM A;  4PA7 A;  5EC1 C;  2E5Y A;  3PJS K;  2X6C A;  5CBF A;  4GX5 A;  1BSN A;  4MW8 A;  1BL8 A;  4QMA A;  3SJQ C;  2DWE C;  4PDM A;  4MVZ A;  4QE9 A;  4JTA B;  2XND H;  3TET A;  3GB7 C;  3LUT B;  3SYQ A;  5CBH A;  3WG7 C;  3LDC A;  4R7C A;  3USS A;  5BZB A;  3TCU A;  1K4D C;  2A79 B;  4PA4 A;  2QTO A;  4P9P A;  4DJG A;  3ZJZ A;  1OCR C;  2Q68 A;  2HVJ C;  3IGA C;  4R8C A;  4XDK A;  3SPI A;  4X88 A;  3SYA A;  3FB7 C;  1P7B A;  3K06 A;  4MSW C;  3UKM A;  2OCC C;  3F7Y C;  4UUJ C;  3AG4 C;  3RVY A;  3KG2 A;  3RBZ A;  1M56 C;  4TWK A;  3ASN C;  5EC2 C;  3K03 A;  4WFE A;  3SYO A;  3VOU A;  3LDD A;  3IFX A;  4X89 A;  2JK5 C;  2YEV A;  3E8G A;  4G27 B;  4F4L A;  1K4C C;  5E1A C;  4X8A A;  2IH1 C;  4QE7 A;  4RO2 A;  1OCC C;  3OUS A;  3E8B A;  3FB5 C;  4H37 A;  4PDR A;  4H33 A; 
#chains in the Genus database with same CATH topology
 1ZLZ A;  4RES B;  1SFC D;  3B5N B;  1JY2 N;  3EQ2 A;  3AE1 C;  4YJ3 A;  2LXB A;  5CB4 B;  1V54 C;  1G4Y B;  1N36 O;  2M3E A;  1ZWI C;  2WPV B;  1XTG B;  4ABM A;  1I94 B;  3PN1 A;  5CB4 A;  1ZME C;  5KLV D;  1U7J A;  1U96 A;  1Q86 Q;  4BIU A;  4LP8 A;  1MUU A;  1ZRT E;  1RP3 B;  3JD0 A;  2KQX A;  3H1J H;  4ASU G;  1EZV I;  1RE3 A;  1XOU A;  4A5U B;  1PZQ A;  1EDK A;  1KD1 W;  1BGY J;  4O9B A;  2VQF B;  1IBL O;  4UCR A;  2WLI B;  2ZKO A;  2QWN B;  3VMY A;  1YHQ V;  5CCH C;  2WT7 A;  2NRG A;  4H44 C;  4JAS A;  2GDS A;  4GCZ A;  1AJQ A;  4GKK B;  1NU1 D;  2ZXW B;  5KKZ C;  3QVN A;  4IL6 X;  3D3I A;  3P8C D;  2OYI B;  3AEI A;  2AHZ A;  3SPH A;  4OGQ C;  3BCC H;  1XMO O;  3I56 V;  2PUS A;  5KJ7 A;  1HP8 A;  1NTM E;  1GM7 A;  5CHX A;  5CA1 B;  1YIJ P;  2IJI A;  2XU6 A;  2R44 A;  4RAI A;  1FKA O;  1XIL A;  3N7N A;  3L74 E;  1K5S A;  2Y69 C;  4OX9 B;  3CME P;  2EIK C;  4B7E A;  1YIJ V;  2F43 G;  5BU5 A;  4X20 A;  4AIL C;  1NTM D;  4WY4 A;  5LMU O;  5B1O A;  3ABM B;  3SGI A;  1ZV8 A;  5B1A C;  2R9R B;  2DE0 X;  1URQ D;  1Y4M A;  3GWO A;  4NR1 A;  1G1X B;  4N3Y B;  3AG2 B;  3AG2 C;  5LXT A;  1ZR2 A;  1S4X A;  3CC2 P;  2Y4T A;  2IBZ D;  4XBF A;  5E79 H;  1BGY H;  1IFN A;  3L35 A;  4ZHQ A;  1SF9 A;  5L8R J;  1OJH A;  4C46 A;  1T2K C;  3CC4 P;  4R7C A;  4YIO A;  1TVK B;  5AG2 A;  1FJG O;  2A79 B;  3RL0 C;  1SFC C;  1NR1 A;  2E76 D;  2L5G B;  1VQL P;  3FB7 C;  3UKM A;  5GW7 A;  4KT0 J;  3AG4 C;  3TGU J;  1K05 A;  2N1T C;  4TWK A;  1Y6X A;  4WFE A;  1VAR A;  3E1I A;  2BAS A;  1VQM P;  4OGQ B;  3E8G A;  4DR4 O;  4YY3 O;  3RYH B;  3RYC B;  1YTF B;  1BZK A;  3H1I H;  5AW2 B;  5C8Y B;  4I7Z C;  4PDR A;  5KAF H;  1IZN B;  3ZMT A;  3EWK A;  1Y74 B;  3H1L G;  5BR8 O;  3NTN A;  1XI1 A;  3OR7 C;  3TGU E;  2L6L A;  5B1A B;  2B1I A;  2OQQ A;  5KKZ B;  4WY4 C;  5K1X A;  1R3K C;  3HPL C;  3K04 A;  3MDS A;  3GMA A;  1NJI Q;  2QJY B;  1JY3 O;  3FAV B;  4DZO A;  3KZI H;  3K5N A;  3CEI A;  1R5L A;  3IN6 A;  3E8H A;  3S9O A;  3DXR B;  3HKE B;  2ZCE A;  4LCU C;  3C1L A;  4PA9 A;  3A0H H;  1VQ4 V;  2E42 A;  4B3R O;  1SQG A;  3I5C A;  2FFD A;  5IY5 B;  3JD3 A;  1K8A Q;  3ZHV A;  1SZT A;  4FZ0 A;  1P84 D;  3G6E V;  3FWL A;  4JPZ B;  2HLO A;  3EFG A;  1X8Y A;  5L3F A;  4W7Y A;  1K97 A;  1Y8A A;  1QR9 A;  2KG7 A;  3JCU Z;  3K9S A;  5LBQ A;  1VQ6 P;  2P22 C;  4DR2 B;  1BT8 A;  3G80 A;  1ZL8 B;  2FXM A;  4L75 A;  1AI5 A;  2OTJ P;  1NAF A;  4I5S A;  2E76 B;  1NTZ G;  1NU1 J;  2D2C C;  4RWU A;  3ZMV A;  3JSN A;  2QGN A;  1JTH B;  4J9Y B;  3AG1 B;  3SWY A;  1GL2 D;  2ETN A;  1PL4 A;  1VF7 A;  1IFD A;  3JAS A;  2V7Q G;  2P5O A;  4WY4 B;  5KLV H;  2JS5 A;  5KLV K;  2GM4 A;  3DC6 A;  1K73 Q;  4H44 D;  1BGY D;  1AFO A;  1EXJ A;  4CS4 A;  5KX5 B;  1BCC D;  1AR1 B;  3AEC C;  3H1J D;  1B06 A;  3OUF A;  4I4T B;  1R3I C;  2O3J A;  4R4L A;  5EC1 C;  5CCG A;  2Q3E A;  1X22 A;  1QGK B;  3QWO C;  1T3J A;  5FNV B;  3HD7 A;  2LW7 A;  2P6J A;  1S76 D;  4JZ2 A;  1LTJ A;  2Y0C A;  1ZAU A;  3QO7 A;  3L37 A;  3T1Y O;  3HD7 B;  3ABU A;  1MZE A;  3H1J J;  4LFA O;  2JP3 A;  3H1I E;  1F23 A;  3L70 D;  4UV9 A;  4D6T H;  2B9Z A;  3VP9 A;  1D7M A;  1KYO F;  1LP1 B;  1VQO V;  1T6A A;  2K3R A;  5LOV B;  3CCQ P;  1EXI A;  1T5E A;  4DW0 A;  2YIC A;  4TV9 B;  3G6E P;  3CD6 P;  1FZE A;  1JQ0 A;  1W5C E;  3FXD A;  1G2C B;  2K9J B;  4ASV A;  4X1K A;  1KP2 A;  4JI4 O;  3BCC D;  1YIT V;  4B3S O;  4JI2 B;  3E1R A;  1NWQ A;  3SFD C;  3ZHT A;  2P2U A;  1WRG A;  4DR6 O;  3CSX A;  1G1I A;  3SPC A;  2ZXE B;  1GW3 A;  2A45 H;  5CBG A;  2FB5 A;  4X20 B;  1X79 B;  4WCE V;  4XE5 B;  4MTG A;  4I6M C;  2P4K A;  2KB1 A;  3D8C A;  1QL1 A;  2WLL B;  3E7K A;  4W80 A;  1FAV A;  3CWB G;  5BVZ A;  1HR0 B;  2F95 B;  1YEW A;  3X2Q C;  1Z5V A;  4A7P A;  2XTA A;  4FPP A;  2YXH A;  2H7H A;  2HJF C;  2VQF O;  3A0R A;  4BWA A;  3LID A;  1L4A D;  1NU1 G;  1PGO A;  3FAV A;  1GO3 F;  4MS2 A;  3FKS G;  2PZS A;  2WTY A;  1L4A C;  1KC8 W;  2NLJ C;  2OYO A;  2M6Y A;  4FFK A;  4R4M A;  4J42 A;  3UM7 A;  1KIL C;  5APY A;  3WMM 0;  2GV9 A;  1FD9 A;  2IFN A;  2OYH C;  1H2G A;  2GUS A;  1QU7 A;  2KYV A;  5B66 H;  2QWO B;  1XHZ A;  2ZYD A;  3P7K A;  3AG1 C;  1HNW O;  2WLH A;  3QF7 A;  4JYY A;  5AW8 B;  1VQP V;  5AVS B;  4OX9 O;  3D36 C;  3M9B A;  2DQ0 A;  1UPG A;  5CMZ A;  3BY6 A;  5L3E A;  1NHL A;  4TQD A;  3AE6 C;  5D5P A;  4U3J A;  2V4H A;  4DK0 A;  5EK0 A;  4KFM A;  4AQY O;  4NTW A;  5LGT A;  4D6T G;  2C0X A;  3STZ C;  2R5B A;  5KLI B;  2ZXX A;  1SQQ H;  4R50 A;  3R65 A;  1RFY A;  1SQQ K;  1XBL A;  3JAS B;  3E89 A;  1JEK A;  5LMN O;  2KNC A;  3WG7 B;  1RSO B;  4DV4 B;  5APV A;  2E43 A;  3H1L J;  5DJT B;  2GUV A;  3DXR A;  2MKV A;  1XNQ O;  4IYI A;  5DM6 V;  2N1T A;  1US6 A;  2XNX A;  4JI1 B;  4UB8 H;  1Z56 A;  1ZRT D;  2PI4 A;  1OVV A;  1IXM A;  1F4M A;  4K8X A;  5DED A;  1LTJ B;  1UIX A;  4O4I B;  3AE4 C;  1KBH A;  2P10 A;  4IIJ B;  4E4E A;  3CCL V;  1WPX A;  2QWQ B;  1EDI A;  1OW6 A;  5IYC O;  2ZE5 A;  4KHP B;  2K9P A;  2JWD A;  1YI2 P;  1G8M A;  4AHC A;  4IIJ A;  2PAJ A;  1NH2 D;  4LWS B;  1RF1 B;  2Q7H A;  3W7X A;  2EUL A;  2PYJ A;  3K06 A;  1P7B A;  5LOV A;  2OCC C;  5LP6 A;  4HNA A;  1OHH G;  2EZP A;  2QKC A;  4PI2 A;  5EYP A;  1WJZ A;  1NGM B;  1JR9 A;  1LUW A;  5LP6 B;  4UVB A;  3M06 A;  2J58 A;  3R4Y A;  2IJK A;  2QWR B;  5JCO C;  3E8B A;  3WU2 E;  4LGD E;  1IK9 A;  3BRT B;  1LWU A;  3CMA P;  1SQP G;  3L71 D;  1SQP D;  1KQF B;  1N33 O;  1O9G A;  2OIE A;  1HTL C;  1GZL A;  1LR1 A;  3ABL C;  4UCU A;  4GKG A;  1XMO B;  1AI6 A;  4LF4 B;  3DGE A;  5KX5 A;  1SQQ D;  5IJ9 B;  2G3A A;  2I1J A;  2VRS A;  3WUV A;  2VQE B;  2Y0D A;  2IX7 C;  2Y0P A;  4GT1 A;  1YJ9 V;  3TDK A;  1FZA A;  1JMM A;  3WB2 A;  1Q43 A;  5LMU B;  1FJK A;  4PV1 D;  3H32 A;  2W0F C;  1JFF B;  1V55 C;  2QJ1 A;  4I55 A;  4JV5 O;  4TLF A;  3P8C E;  5J9P C;  3E83 A;  2A45 G;  3CD6 V;  4LFB O;  1I08 A;  4LC1 A;  3PHL A;  4TV9 A;  3CP1 A;  4DR2 O;  4MTX A;  5LA6 A;  1YJN V;  2Q0O C;  2JS3 A;  1LTG C;  1Q82 Q;  4JZG A;  1GMG A;  2XAH A;  2ZT9 B;  2A06 H;  1VQN V;  4C7N A;  1ZR4 A;  1SQP J;  1NS1 A;  3LSQ A;  1I94 O;  1Q86 W;  2QJK C;  1M57 D;  4B3M O;  3ZHQ A;  3OGI B;  4U3J B;  2ADQ B;  2GTS A;  1AA0 A;  2P7J A;  3H1H J;  4DRX B;  2NPS A;  2SPZ A;  1IBK O;  3RK3 D;  1OV9 A;  3D70 A;  2YIA A;  1Y74 A;  3B2E E;  1N2D C;  4X62 B;  1AIL A;  2UXB O;  1KQG B;  1BDC A;  2ZYA A;  1RF1 C;  1H2K A;  2BOB C;  4FFB A;  1HNZ O;  3B8E B;  4IFD K;  4D7S A;  3K0G A;  4DV0 O;  4X66 O;  1ZSP A;  4QIW F;  3L75 G;  1R1B A;  1SQQ G;  3OMN B;  1CSB A;  2H94 A;  1VQK V;  4O4H A;  5L3C A;  2YXQ B;  1J1D B;  1YF2 A;  3ZX6 A;  3TET A;  1SQB E;  1S0V A;  5BZB A;  2FFD B;  3LIE A;  1Y66 A;  4UXN A;  3H1L D;  3H1J G;  3RN4 A;  3SPI A;  2AEM A;  1H8H G;  4Z2W A;  2ZT9 C;  1K7D A;  5A9G A;  1MG1 A;  1L0L G;  1N36 B;  3BFR A;  2JEX A;  3AE8 C;  2YEV A;  1PP9 J;  4QJF B;  1OCC C;  3BA8 A;  3ZMZ A;  4H37 A;  1FJP A;  1JVM A;  3FXE A;  2H8P C;  3S3W A;  2HP8 A;  1HBW A;  1PP9 H;  1PM9 A;  1SQX D;  3SPJ A;  3CCU V;  2YKQ A;  4QGP A;  4UVC A;  4O4L A;  1KIL E;  3TNU A;  1VQ7 P;  2GUZ B;  4LF9 B;  3BCC G;  3M0D A;  3CE2 A;  3EVK A;  3OAA G;  5KHH A;  2E5L B;  3I55 V;  4X64 O;  1K33 A;  2AXC A;  4OPH A;  1NTZ E;  2AEJ A;  4YXW G;  5CJ4 A;  1FXH A;  1Q81 Q;  4I4T A;  3OGC C;  4GKK O;  4O2B B;  4O4I A;  2FYZ A;  1S3J A;  3GG2 A;  5IJ0 A;  4WFB V;  3TYY A;  4WBN A;  3H32 B;  1PGQ A;  1K9M W;  3D3Q A;  2NPS D;  4ASW A;  1YQ4 C;  2W90 A;  1JCC A;  1ROP A;  1FZF A;  1BMF G;  4CH4 A;  1GKF A;  4HNA B;  2HEP A;  2D2C D;  4IFM A;  4WVZ A;  2F66 C;  5LHH A;  4DK1 A;  1LP1 A;  3R66 A;  4LNU B;  3APQ A;  1E1Q G;  2XAS A;  2HPC B;  1EM1 A;  4PHZ A;  3SWF A;  1BGY G;  3B40 A;  3OFN G;  3AG3 C;  4CH5 A;  2HPC A;  4BRY B;  3ASO C;  2F23 A;  1QNM A;  3RYI A;  2AHY A;  1A02 F;  3L74 J;  1SET A;  2X0L A;  3K08 A;  5KA5 A;  1VQ6 V;  2IH3 C;  4JI3 O;  3NFQ A;  5FL7 G;  2BTO A;  3BCC J;  4KHX A;  1SQX H;  1SQX K;  2WAM A;  1KD1 Q;  1SRY A;  1IZ3 A;  1M7L A;  1URQ C;  2ZVN B;  3K3W A;  3CCJ V;  1ZW0 A;  3GWK C;  5ITZ B;  3IAY A;  1GM8 A;  3ZHR A;  1VQ7 V;  4UVA A;  1RF0 C;  3CLQ A;  2X6A A;  3L70 J;  2IFM A;  5H5N A;  2MW2 B;  2PF4 E;  2W6J H;  3RYF B;  3KXD A;  4H13 D;  4XFJ A;  3VYI A;  4DR3 O;  1TAE A;  3PJS K;  5D5Q A;  5KLI C;  2P90 A;  4EEQ A;  2VWK A;  2A3Q A;  1GL2 B;  1PP9 G;  4E2L A;  1SZX A;  1OVR A;  1YJN P;  1AJY A;  2NN4 A;  4LF8 O;  1ZN5 A;  4DW1 A;  1MFZ A;  2FYU G;  4YY3 B;  4AQR D;  3EHB B;  1P49 A;  1JB0 J;  2IBZ I;  2UXD O;  1M56 D;  4XDK A;  4KUM A;  1LUV A;  1VQN P;  1WAZ A;  4IL6 E;  2O01 N;  1Y67 A;  3FYE B;  4UUJ C;  5EZY A;  4DV6 B;  2QIW A;  3OMI B;  1PP9 E;  3A0H E;  2HG5 D;  3G4S V;  2YUA A;  5EZY B;  3HD7 D;  3HTK A;  1YXB A;  2P1J A;  1KIL B;  4H33 A;  3H1K D;  2QR4 A;  1JY3 N;  2XUM A;  4OH8 B;  3G4S P;  4O2A B;  1YTF D;  2UU9 O;  3RL0 g;  3QNE A;  4J7J A;  2KUB A;  2OCC B;  4TQF A;  4LF6 B;  3G6B A;  3KCX A;  4JYB A;  1DD4 A;  1VQ8 P;  3QH9 A;  2XKM A;  1RF0 A;  1R73 A;  2ODM A;  1HJB A;  4JI0 O;  1QL2 A;  1H0T B;  1X4T A;  1NR7 A;  2GUZ A;  2Y48 A;  4I7Z B;  1KQL A;  1VP7 A;  2WSC J;  2CTW A;  3G67 A;  2GHY A;  3L74 G;  3JCZ A;  1IVS A;  4B3R B;  1W0K G;  4X9Q A;  1EBO A;  2QM4 A;  3G71 P;  3TXQ A;  3CWB H;  1NTM G;  4WFH A;  1NKN A;  1KB9 E;  3CXC U;  2IYO A;  2Q8V A;  4TUY A;  2Q9I A;  4MVM A;  4YXW H;  4N78 D;  1S2E A;  2XND G;  3ICX A;  4NTY A;  3F7V C;  2QJY C;  2OAR A;  2N04 A;  4ICG A;  4NXN O;  4ZIB A;  2IBZ G;  2C9N Y;  1Q2N A;  2VRZ A;  3B8M A;  4B3M B;  4LWS A;  1HNX O;  1RF1 A;  4JI7 O;  1KV4 A;  2EIM C;  4Z1V A;  1R6N A;  2YXR B;  3EXA A;  1L4A A;  1D2D A;  3B5N C;  1OCZ C;  1SQV J;  4IFF A;  5LXT B;  2RN9 A;  5CCH A;  5E79 E;  4HBN A;  2FYN C;  4IHJ A;  2UXB B;  1KYO I;  1HR0 O;  3ZHU A;  4JI5 O;  4W7Z A;  5M1B A;  4MVU A;  3I56 P;  1NQT A;  3E22 B;  1W2B U;  4GX1 A;  2D3O W;  4O4L B;  3T1C A;  3ZBH A;  2ZD9 A;  5A2Q N;  1L0N D;  2IJJ A;  5BMV B;  1XDC A;  1S5H C;  3MIW A;  1AR4 A;  2O57 A;  3HUS B;  4RQE A;  3CME V;  3T1H B;  3L72 D;  2LJ2 A;  3N2K B;  2ZR2 A;  4X1Y A;  3T4D A;  1H2S B;  3HUS A;  5JCO A;  1JO5 A;  4TT3 H;  1N7S C;  2K88 A;  1N7L A;  1CXZ B;  4TV8 B;  3Q4H A;  4W4L A;  1RY3 A;  2WSF H;  1NTM H;  1NTM K;  1CW5 A;  3AE9 C;  2LP7 A;  5GTI E;  4PDM A;  1L0L E;  4JAU A;  1ZX3 A;  4LLH A;  3BAT A;  3MP7 B;  1F7Y A;  5CJ0 A;  3USS A;  3TCU A;  2YSU B;  2Z4E A;  1OCC B;  3ZJZ A;  1GTW A;  2LQT A;  2IJH A;  4LH7 A;  1P84 H;  4ZOL A;  3WFV A;  3OTO B;  1DD3 A;  4UB6 H;  1YTZ T;  4AQY B;  4BRY A;  3ASN C;  2UUA B;  3JAR A;  4IL6 Z;  3GF7 A;  1AP5 A;  3IFX A;  3P3N A;  3NXS A;  4G27 B;  5LL6 Y;  2DW3 A;  3J80 N;  1N32 O;  3JAL A;  4JYC A;  5TIS Z;  2RJZ A;  2B1G A;  1B3Q A;  3CC4 V;  3IFM A;  3N2G B;  3FB6 C;  3JAL B;  4F6R A;  1L0N H;  1L0N K;  1SQV G;  3CXH E;  5FPO A;  1EZV E;  2A0L A;  4BW9 A;  2N05 A;  1HH0 A;  4DUZ O;  4L76 A;  4F6R B;  1MNG A;  1QR8 A;  1JY3 P;  3LNN A;  2DW4 A;  2LFS A;  1XEQ A;  2QE7 G;  2XAG A;  3L72 H;  3RT3 C;  1L2P A;  3CCR P;  1DF4 A;  4JI6 O;  4B3T O;  2N9B A;  5JQG A;  1IFJ A;  4FLV A;  1S5L Z;  4K0K B;  2WLJ A;  1FZC B;  3L9D A;  1WP7 A;  2KP8 A;  3SSU A;  1FZB A;  5KHJ A;  4DT0 A;  2VS0 A;  4G28 B;  1MFT A;  4UB8 E;  1ZL8 A;  5IDJ A;  1TGO A;  4TUY B;  2BEQ D;  2HG5 C;  2JDI G;  5LHG A;  4IL6 H;  4HAM A;  3BA9 A;  4HZ3 A;  1JTH A;  5AW7 B;  2JWA A;  4H44 B;  1KFN A;  2Q6Q A;  5JVD A;  3C8V A;  2DQ3 A;  4JTD B;  1DEE G;  2IBZ E;  3N27 A;  4J10 A;  4HJG H;  1NTK D;  3CPW O;  4RJT A;  4FIP C;  1GRJ A;  2EJR A;  2B87 B;  1L8D A;  4U7N A;  3SDL A;  1SS1 A;  4GOF A;  1M93 A;  3ZRS A;  5AVR B;  3W7S A;  4PI0 A;  2ZM6 B;  2KLU A;  4K8Z A;  2YO3 A;  5AW1 B;  5LMN B;  1JCD A;  4OGQ D;  2IZ1 A;  3S3X A;  2HFE C;  4DV4 O;  1LTB C;  2BOC C;  2M7W A;  2QM8 A;  2R72 A;  5APX A;  4EB6 A;  1NAY A;  2WT7 B;  2HYN A;  3D6Z A;  2QA4 P;  5BMV A;  4DR3 B;  1IDS A;  4OWF A;  3CRQ A;  1LTJ C;  1K92 A;  2WLK A;  3CS5 A;  3ABM C;  3B71 A;  1VQ8 V;  2BTQ A;  3Q3D A;  4D7T A;  1VF5 B;  1VQ9 V;  1PD3 A;  5JJE B;  3U59 A;  2K9J A;  1MKM A;  1MZ9 A;  1SQB D;  1HW7 A;  2OCH A;  2FKX A;  2H3O A;  1SKV A;  2ZDI A;  4DV7 O;  1NTZ D;  5FPR A;  4MVZ A;  3UT5 A;  3RL0 D;  2XAF A;  4L8J A;  2O01 H;  2IYP A;  3L75 J;  3AK3 A;  4IGG A;  1K4D C;  4DV3 B;  2R9A A;  3J7A U;  3H9V A;  2QEX P;  2HVJ C;  1L4A B;  4R8C A;  4I2L C;  2XV5 A;  3SWK A;  3L72 E;  1S5L H;  5APS A;  2DYS B;  2FYU E;  4G2K A;  1H38 A;  3A3Y B;  2OYI C;  2JVD A;  1XRE A;  4JF3 A;  3Q5P A;  1L0N E;  3LDD A;  3JAR B;  4X89 A;  3VQX A;  3L73 D;  1QCE A;  2KOG A;  5LGN A;  4LF4 O;  3ABT A;  4DV1 O;  3AEB C;  1WPB A;  2YIU B;  2R3C A;  1NOH A;  1CZQ A;  3PP5 A;  2J59 M;  2KKW A;  3H1I J;  1WA8 A;  1YTZ I;  2V7Q J;  2BCC E;  5GTH E;  4EFB A;  4MW3 A;  1H2N A;  1Z2G A;  1WA8 B;  3C3T A;  2KZJ A;  3M99 B;  5ITZ A;  1J1E B;  4D6T E;  3HKD B;  4JGS A;  1BCC H;  5L3B A;  2WA4 A;  5KJ7 C;  4ZBM A;  1SC5 B;  3RYH A;  3RYC A;  2H8P D;  5CA0 B;  2PI5 A;  3HE5 B;  1FDO A;  1NVO A;  2KLV A;  4WY4 D;  1KKD A;  2QE7 H;  4J41 A;  3CCV P;  5APU A;  1WP8 A;  1BGY E;  4WWI A;  4LR3 A;  4FLT A;  1VQ5 P;  1CEZ A;  2ZR3 A;  2CGO A;  5K1P A;  4NKG B;  5IYZ B;  4FLX A;  2KXP B;  2Y9Y A;  3CI9 A;  1GD2 E;  4FM2 A;  3ETG A;  1KQS U;  1XNQ B;  1VF5 D;  5BU8 B;  2QTS A;  3HKB B;  1KYO E;  2ITD C;  2YDE A;  1PGJ A;  1OW8 A;  4FMT A;  1QX8 A;  4Q6G A;  1FBM A;  4LFC O;  5AW0 B;  1HF9 A;  2WMM A;  3FD9 A;  2M3B A;  3V4Q A;  1Q6I A;  4BR6 A;  4WF9 V;  1KZU B;  2AW9 A;  4JQ0 D;  4DR7 O;  4LFB B;  4DR5 B;  2YIU C;  4CS3 A;  3MHV A;  2UXD B;  3T1H O;  4GIF A;  1NZ6 A;  1ZUQ A;  1NU1 E;  4X64 B;  3DTU B;  3V4W A;  1PPJ G;  4GKJ O;  1VIB A;  2YXY A;  5KHI A;  4ZKP A;  1HGZ A;  1OZ0 A;  3B09 A;  1E79 H;  2WLI A;  3FGA D;  1YQ3 C;  1VQP P;  1BHA A;  3IJ4 A;  2O01 J;  4U7J A;  2JGU A;  2YMY A;  2BEZ F;  3T2M A;  3FB8 C;  3AG4 B;  5EBM C;  2DYR C;  3M9H A;  5EYP B;  2H43 A;  5EBL C;  1FS0 E;  2G38 A;  3EFF K;  3A2A A;  3C9I A;  1JX9 A;  2HHH O;  1XUQ A;  4JI0 B;  1HNW B;  4H0L D;  2AXT Z;  4U3F J;  3A8T A;  2Q0A A;  1KUQ A;  3UT5 B;  4X1I B;  3SYQ A;  4DUY B;  5AVT B;  2LO1 A;  3ZN1 A;  4X66 B;  1YBK A;  1OX3 A;  4DJG A;  4UCV A;  2UXX A;  1N32 B;  4X1I A;  1OCR C;  2YNY A;  3A0B H;  5APT A;  1NVP B;  4CC6 A;  3H1I G;  3CYO A;  4BIZ A;  1S9K D;  1SQB G;  2YIB A;  1FU1 A;  2FYU H;  2FYU K;  4PV1 B;  3BRV B;  1K34 A;  4JYA B;  2R9I A;  4HH2 A;  3CXH I;  3BPZ A;  4B08 A;  3H1H G;  4NYK A;  1IXB A;  1PGP A;  4EB6 B;  1W0J G;  3T97 B;  1I7F A;  1HGV A;  2Z5I A;  1MOF A;  1J2J B;  1V9P A;  1QVF O;  1Y76 B;  4MVQ A;  1XL6 A;  2YID A;  1XL4 A;  4ZHQ B;  1HVV A;  2DMX A;  4JI2 O;  4I0X B;  2WLM A;  2BCC H;  4BW5 A;  5GTH H;  1MZF A;  3BEH A;  3N2K A;  3CCE V;  1NTZ J;  3KYQ A;  3P32 A;  4K3A A;  3T4Z A;  1PPJ E;  3CCJ P;  2C9L Y;  2FKW B;  4JAV A;  1USE A;  5LHI A;  3H6P A;  5J2T B;  3W7W A;  2ZQM A;  2W83 C;  1HNZ B;  3H01 A;  2Q67 A;  5J2T A;  4NB5 A;  2OYH B;  1RQV A;  3OJA B;  3K5L A;  1TUB B;  5C39 A;  2WPS A;  1YJW P;  2CDY A;  4MVR A;  4UCS A;  1MSD A;  3JYC A;  3L4F A;  1TUB A;  3LW5 H;  4JI3 B;  2QEX V;  1SP4 A;  2VWJ A;  1FXK A;  2JGD B;  3V5B A;  2B88 A;  1L1F A;  3W7U A;  1YJW V;  4B86 A;  2FFD C;  1Q3E A;  3KPE A;  1MAB G;  2Q7C A;  2JJL A;  2X7R B;  4ZI7 B;  5IYD O;  2P4V A;  2JGD A;  1M1K Q;  2LR2 A;  3OTO O;  1YHQ P;  3M0D C;  4PJ0 Z;  1NTK J;  1L0L D;  3CC2 V;  2WWW A;  5EIB D;  4L87 A;  1LTT C;  4GYC B;  3W67 A;  1AR5 A;  2Q5Z A;  3B8N A;  2M5A A;  2OTK E;  3ASO B;  3HKC A;  1R5S A;  2JDI H;  4DV7 B;  1KB9 D;  2BCC G;  2KSD A;  3SYC A;  3P8M C;  3AK2 A;  1I5Y A;  3M9Q A;  3ZRW B;  1YIT P;  4NPE A;  3AEA C;  2QKS A;  3SJA C;  4JV5 B;  3QG5 A;  1SQP E;  2YEV B;  4LF8 B;  3THO A;  1N34 O;  1NI8 A;  4ZKU A;  2KG7 B;  3I5D A;  2O1K A;  1HDJ A;  4D6T D;  5AVZ B;  4MW8 A;  4U3F E;  5J2U B;  2DWE C;  4QE9 A;  5H2F E;  3ZN0 A;  4GOE A;  3JSV C;  4UB6 Z;  1GK9 A;  4DV6 O;  2OWO A;  4B3T B;  1QBZ A;  2WA3 A;  3LUT B;  1URQ A;  2GA1 A;  3HKB A;  1RE3 C;  1FE6 A;  3BRC A;  3CWB J;  2UUB O;  2WPR A;  3K58 A;  4AI8 A;  1FAF A;  3IGA C;  2NPS C;  1E79 G;  5DEC A;  3RK2 B;  1BE3 J;  3GHG A;  2E75 D;  3KG2 A;  3RBZ A;  4B7K A;  3CX5 E;  1HUC A;  1ENV A;  4F4L A;  1JY2 P;  1HJ0 A;  1FXK C;  1R8E A;  4X8A A;  2IH1 C;  5KLV E;  5E79 Z;  1LT9 C;  3RK3 C;  5IJ0 B;  1RM1 B;  2ITA A;  3H1K G;  1EN5 A;  2QVA A;  2Q69 A;  1KYO H;  2R3S A;  1DIP A;  1K04 A;  2FYU J;  1XMQ B;  5B5E Z;  1JMK C;  3UO3 A;  2A06 G;  2OYI A;  1BE3 H;  2HOD B;  5AVQ B;  3GVM A;  4FK5 C;  1RE4 C;  3TF5 A;  3WUU A;  2F4V B;  2JO1 A;  1NTK G;  3M0A A;  4D6T J;  4H0L C;  4PDL A;  2Q4P A;  1OVU A;  1GH6 A;  1VQO P;  3HB3 B;  4PD4 E;  4MN4 C;  3OW2 U;  3L70 G;  2WSC H;  3ETE A;  1RH5 B;  4JI7 B;  1KU9 A;  3A5T A;  1MA1 A;  2BCC J;  4UB6 E;  1BSH A;  2BSK B;  5H2F Z;  5TIS H;  3IR9 A;  2FYN B;  2WPD G;  5AVY B;  1AV1 A;  2ZJS E;  2OYH A;  3ZRX A;  1VQ5 V;  2BSK A;  2W27 A;  3MD0 A;  2L91 A;  4XDJ A;  5KUK A;  2WLL A;  5KMG B;  1S5J A;  1L0L H;  4GKJ B;  1L0L K;  2ZYG A;  3PRJ A;  1GMJ A;  1FXK B;  2P7T C;  2XZR A;  5B1N A;  1SQV D;  1NU1 H;  1NU1 K;  2KIK A;  1PFI A;  2JIZ G;  3A0B Z;  3A0H Z;  1OIP A;  1VMG A;  3V2Q A;  1HWT C;  2RH0 A;  1M56 B;  4LF7 B;  1S5L E;  1TUE B;  3BVH A;  1PNK A;  1HWY A;  4I50 B;  2FTK A;  1OW7 A;  1KYO D;  1DK1 A;  1ZLL A;  3RK2 D;  1H8A A;  4AUW A;  3TJT A;  2C0W A;  2WSE J;  4I50 A;  5EBW C;  4GX2 A;  3CWB E;  3AG7 A;  2UUC O;  5HFM A;  1IO4 A;  4WFF A;  2UU9 B;  2Z5U A;  1K73 W;  3CX5 H;  3CRA A;  3QO5 A;  5KAF Z;  2EX3 A;  2HKO A;  1QLE B;  3U10 A;  2H88 C;  3ABK C;  5KUM A;  3LSS A;  4CZZ A;  2DJV A;  2X6C A;  1IX9 A;  5CBF A;  1BL8 A;  1KIL A;  1JCH A;  2P06 A;  1GK6 A;  3O8Z A;  2CTQ A;  2RMK B;  4NXM B;  2W6B A;  2ZE7 A;  3JCU H;  4YJ3 B;  3A2F A;  2ZFC A;  4BIO A;  2HJD A;  4ZNC A;  1KEC A;  1E5W A;  3GW6 A;  2POH A;  3ZMU A;  2ZNJ A;  3H1K J;  4FFB B;  1M57 B;  1N73 C;  3SFE C;  3SYO A;  4X65 B;  1FFX B;  1W59 A;  2OT5 A;  4IYH A;  5GTI Z;  4PD4 H;  1VQ4 P;  4DV2 O;  2NR5 A;  1N0J A;  4F6E A;  5KTB A;  1HNX B;  2IU3 A;  3FWN A;  3KHU A;  2B5U A;  4P9O A;  2M5A B;  2UUA O;  1FDM A;  1PPJ H;  1KN7 A;  1NT2 B;  4K0K O;  1MSW D;  3C90 A;  2ITC C;  4DR7 B;  2ZNI A;  1GAX A;  2RKL A;  2EZO A;  3ZRW A;  4AYC A;  3H1K H;  2HOD A;  4LF5 B;  3ZS8 C;  3H25 A;  4WB4 A;  2AGA A;  5TJH A;  1H89 A;  4U3F D;  1LNQ A;  1EC5 A;  1IBM B;  1VF6 C;  3ZRV A;  1JPX A;  3CMA V;  1EDL A;  2CPS A;  1SQX E;  1GDT A;  4I9W A;  1P84 I;  1BCC G;  4JI8 B;  4NPF X;  1KOR A;  2YI8 A;  4K35 A;  5IYB O;  4BAY A;  1AQ5 A;  1EDJ A;  1FC2 C;  4KL1 A;  3NR7 A;  2JEE A;  2V7Q H;  2PGG A;  2E75 C;  4JF7 A;  1GU4 A;  3JAK B;  2HHH B;  2ILM A;  3D6Y A;  3CJH B;  5LYJ B;  2W6J G;  3V6I A;  3L74 D;  3SJC C;  1BQZ A;  1IUR A;  5IWA B;  3CJH A;  5LYJ A;  2O1J A;  5IJ9 A;  3P3P A;  1OMI A;  1IFI A;  1BDD A;  2CUG A;  3QTC A;  3ZED A;  2HFE D;  3PLN A;  1JFF A;  4I55 B;  2Q7G A;  3OE7 G;  2RDC A;  4WBN B;  3N4X A;  4PD4 F;  1OCZ B;  2CTR A;  2ZE8 A;  3O9O A;  2PRR A;  2AZ0 A;  3HRN A;  1Y76 A;  1TVK A;  4WBA A;  2Z3Y A;  3L75 H;  3OTF A;  4HYT B;  2ZM6 O;  4ZOL B;  2YC0 A;  1XNR O;  1BE3 D;  2QG4 A;  3TSI A;  2LFR A;  3ETQ A;  3BAA A;  1GN3 A;  2EJ7 A;  5KAI Z;  5GTI H;  4UV8 A;  3Q1M A;  2N74 A;  4FJC C;  1UII A;  4WFG A;  4DYL A;  2Q1K A;  4J11 A;  3CWB D;  1FJG B;  2JEU A;  5IE9 A;  1Q8I A;  5B66 Z;  1OZH A;  1PV3 A;  4DRX A;  2NPS B;  1VDF A;  4LFC B;  4U7O A;  1H2L A;  1Q7Y W;  1F51 A;  1FYJ A;  2WSE H;  3APO A;  2XND H;  2EIJ B;  3CX5 F;  1QVG O;  5LGU A;  1OWA A;  3VQW A;  5KMG A;  2Q68 A;  1B6Q A;  4DV1 B;  2RNB A;  3SJB C;  2N1T D;  1PKX A;  1VPC A;  1RE4 A;  4O4J B;  3P30 A;  2K9Y A;  2B9B A;  1CI6 A;  3RVY A;  3F7Y C;  4EFE A;  4DV5 B;  2Y4U A;  1I5X A;  1FFX A;  1M1J B;  1FDI A;  4YXD C;  1NH2 B;  1EQ7 A;  3D36 A;  3L73 J;  2JJ1 G;  1QEX A;  4J80 A;  1Y47 A;  3LW5 J;  3HUS C;  1DTO A;  3K9A A;  5GTH Z;  4IT5 A;  4FLW A;  3FFQ A;  4Q20 A;  2F1M A;  3AK1 A;  5BY1 A;  1KP3 A;  3CX5 I;  1N7S A;  5JVD B;  1PL0 A;  1P84 F;  3U11 A;  1OCO C;  3MUD C;  5AW5 B;  1N7S B;  1GM9 A;  1WN7 A;  2YIB D;  3CL3 D;  1LGH B;  2KB7 P;  4LF6 O;  1EFR G;  2R5D A;  2NZ2 A;  1WNS A;  2H89 C;  2KSE A;  3F5H A;  2OGU A;  5J2U A;  2ZXW C;  2MK3 A;  1KKC A;  4JBZ A;  2KZI A;  4DOJ A;  3F5W C;  4PD4 I;  3X2Q B;  1NKZ B;  3S1K A;  1PV0 A;  2E5T A;  4EIJ A;  3B5N D;  2AXT H;  3JD4 A;  4KJM A;  1SQF A;  1KIL D;  4KP4 A;  3RGB A;  3RL0 B;  5B1B C;  2GBO A;  4PDV A;  3JSL A;  1SQX G;  5DJU B;  1S5L X;  3OEE G;  2NNU A;  1NTK H;  4MVS A;  1NTK K;  5B5E H;  5FNV A;  3BVO A;  5IT9 N;  1FFT B;  2N1T B;  3CPW U;  4H13 C;  1GL2 C;  1PPJ D;  5AVW B;  1W2B O;  4DR4 B;  3BCC E;  1FZC C;  2CK3 H;  1G6U A;  5KHK A;  1M5I A;  4JI5 B;  1LT1 A;  3ZMS A;  3JAW B;  2P67 A;  1T3U A;  4N6J A;  1K9M Q;  1BSM A;  3L71 G;  5CA3 A;  3D71 A;  5K5G B;  4PA3 A;  4U3F H;  4HYO A;  4NXM O;  5CCG C;  3T1Y B;  1TU3 F;  1G2C A;  1M1J C;  1GK4 A;  1KC8 Q;  4YHH B;  1OFC X;  4GX5 A;  1CPY A;  2PFX A;  1KB9 H;  4QMA A;  1AVO A;  3B77 A;  1D5N A;  1M8O B;  1SQQ J;  3JAK A;  1JNM A;  1LTS C;  1SA0 A;  4N78 E;  3ABL B;  5AVV B;  4P9P A;  1UFI A;  1LWU B;  2ARH A;  3CCE P;  3H1J E;  2Z5H A;  1NTZ H;  1NTZ K;  2Q73 A;  4O4J A;  3IF4 A;  2CE4 A;  1SFC A;  2QKA A;  3VQY A;  5EC2 C;  4QPJ A;  3HE4 B;  1Q7Y Q;  4EDF A;  1M1J A;  1S1C X;  1KTM A;  5CA0 A;  3VBB A;  3HE5 A;  1SFC B;  3U1C A;  2WSS G;  3L73 E;  3CCM P;  3AE3 C;  1SQQ E;  4J9Z B;  1LJ2 A;  5CN0 A;  4GUN A;  3L75 E;  5KAF E;  4EYY Q;  4LF5 O;  1WB7 A;  1V55 B;  2LGW A;  2WLN A;  3FYI B;  1Q82 W;  2K1E A;  2FL4 A;  4ZKI A;  4JYA O;  2IW5 A;  4DR5 O;  1DF5 A;  1JJ2 U;  5KAI H;  1R6T A;  2CK3 G;  3KQG A;  1N0N A;  3F5T A;  3IC9 A;  1NJI W;  2HR3 A;  3L71 H;  2W8Z A;  1NO4 A;  5LA6 B;  1Q81 W;  3A0B E;  4PA6 A;  4DV3 O;  5AVX B;  1V54 B;  4DR1 B;  2QA4 V;  5AW4 B;  4P30 A;  4N21 A;  2UUC B;  5C8Y A;  2Q7E A;  5B66 E;  1T2K D;  4JI6 B;  3OEH G;  2ZE6 A;  1PNM A;  2N9Y B;  4CPG A;  1AP6 A;  3HTK B;  5IWA O;  3CCV V;  1FXV A;  2FML A;  4UCT A;  2Q6A A;  3IAO A;  2EIN C;  1CI6 B;  3G71 V;  1P84 E;  3CB2 A;  2JKV A;  5B3S C;  2FXP A;  3AED C;  2XAJ A;  1H0T A;  1VQK P;  3L73 H;  1FZC A;  1J5E B;  4I1L A;  3U1A A;  3H1I D;  2IM9 A;  4FM1 A;  3QO8 A;  3L70 E;  2OYQ A;  1Y9B A;  3OM3 B;  2W6A A;  1GTO A;  2A45 I;  1YJ9 P;  3HKE A;  1J1D C;  1Q5O A;  2ATK C;  3BHP A;  2QRX A;  2WVR A;  1X0T A;  1NTK E;  3VTP C;  3AEG C;  1S9K E;  1PL5 A;  2UXC O;  2A06 E;  2DYR B;  4EOT A;  3K5O A;  2WZ7 A;  3E8F A;  4Z1M H;  3S4R A;  2A9H A;  1Q90 D;  2HLD G;  4OVN F;  1VF5 C;  1ARO P;  3H1K E;  1GW4 A;  2WSS H;  1O9H A;  1RPR A;  3M8A A;  4BWN A;  4KHP O;  2CGN A;  3E22 A;  1Q6U A;  1KB9 F;  5KLV G;  2QSA A;  1IFM A;  1VQM V;  2Q3I A;  4KXR A;  2YS8 A;  1JJO A;  4IHJ B;  1H88 A;  1AJP A;  1YYC A;  5CBN A;  2JJ2 G;  3LDC A;  4J7K A;  2K1A A;  1SA0 B;  4PA4 A;  5JH7 A;  1M1K W;  2ZVO B;  1EZV D;  4X1Y B;  2V4D A;  3ZDM A;  2RN0 A;  2R70 A;  4YTP C;  3H1H H;  3GHG C;  1LTI C;  1DX7 A;  1U57 A;  4HKZ H;  2BTQ B;  1IBL B;  1AB3 A;  3VOU A;  2E76 C;  2QSI A;  3OMA B;  1N33 B;  3HE4 A;  3PH0 A;  2UUB B;  4U3F G;  3KDP B;  1K4C C;  1QHT A;  4YPC A;  3RFR A;  1CP9 A;  4PEL A;  3GLM A;  3JCU E;  5CBO A;  4O2B A;  2YKP A;  3Q4H B;  1JM0 A;  4GLX A;  2M0B A;  2VQE O;  1DH3 A;  2OTL P;  5GON A;  1M4U A;  1U7M A;  1M90 W;  3V2P A;  1GU5 A;  3B4S A;  4UB8 Z;  2P58 A;  3GF3 A;  2DN9 A;  2EIN B;  1BS3 A;  2QJP C;  4Z1M G;  4RUF A;  1J1E C;  2FBW C;  4RO0 A;  1ZXG A;  1NH4 A;  4CH6 A;  2PYL A;  3AEF C;  4EKW A;  4PJ0 E;  3UIA A;  4R6Z A;  1U97 A;  4I9Q A;  2IPP A;  1XMQ O;  2BE3 A;  3N2G A;  2BCC D;  4MVO A;  5KJ7 D;  1OCO B;  1BCC J;  3VMZ A;  5H6Q A;  3ZCC A;  1YZB A;  1TA8 A;  2F4V O;  2OIG A;  1N34 B;  4UFZ A;  4TSF G;  3M7M X;  4NTX A;  4DV2 B;  3VQV A;  2CH7 A;  1RQU A;  1ORQ C;  2WQY C;  5JQG B;  1K8A W;  3RK3 E;  3HKD A;  4DR6 B;  2CH7 B;  1M9N A;  2QWP B;  3JD1 A;  2FYU D;  2E3C A;  2LKM A;  1FOS F;  3OR6 C;  3L36 A;  3VOP A;  5AW3 B;  3CHX A;  3W7T A;  3MAQ A;  1KFM A;  1N86 A;  2Y9Z A;  2Z0A A;  1GL2 A;  2IDB A;  4L74 A;  3TGU H;  5KHG A;  2QJK B;  2XOK G;  2EIL B;  5CMU A;  5H6R A;  3OW2 O;  3BAB A;  3CRM A;  4O4H B;  1P4R A;  3RK2 C;  1PNL A;  2KI7 B;  4LBE C;  3STL C;  1FOS E;  5IYZ A;  3CCM V;  2E74 D;  1SQP H;  3ABK B;  1SQP K;  2FXO A;  1N8R W;  1SQB H;  1SQB K;  2RMZ A;  4EI2 A;  1MV8 A;  1AI7 A;  1COW G;  1YCI A;  3GHG B;  4P2Z A;  4JI8 O;  4CC5 A;  5BXZ A;  3AE2 C;  1NBM G;  3HR0 A;  2HVK C;  3RVZ A;  1IFP A;  3OT7 A;  4XDL A;  1QVG U;  1AVY A;  5EFW B;  3E35 A;  3L73 G;  4O2A A;  3H1H E;  1MMM A;  3Q5S A;  2R32 A;  1BSN A;  3WUT A;  3SJQ C;  4Y28 J;  2K37 A;  1YI2 V;  3UQ8 A;  3O65 A;  1FPO A;  1Z5W A;  2CAZ C;  3K59 A;  5F2V O;  4MT8 A;  4NVP A;  3WB0 A;  5DN6 G;  4XA4 A;  5LP6 C;  5B5E E;  1R6K A;  5EIB C;  2QJP B;  3M91 A;  2DOS A;  3K5M A;  1XHX A;  2KNC B;  3L72 J;  1RSO A;  4Y99 C;  1KMI Z;  4DUY O;  3PTZ A;  1A32 A;  4FM0 A;  1L0N J;  1S72 P;  1RPO A;  2IU0 A;  4QE7 A;  3CRR A;  2LXC B;  1L0L J;  4M3L A;  3VMA A;  3TGU D;  1XNR B;  1LWU C;  4LF9 O;  3G9R A;  1FS0 G;  4NPD A;  2UWJ E;  3CXH F;  2E5L O;  1S72 V;  1GN4 A;  2ZDI C;  4JTC B;  1AQT A;  1M57 C;  1USD A;  3ITK A;  1A02 J;  1BHB A;  1N73 B;  4GX0 A;  5L3D A;  1IBM O;  3L71 E;  1H2M A;  1JOY A;  5APQ A;  3KKY A;  2GSM B;  1R3L C;  3UCS C;  2V1D A;  1N73 A;  4DXW A;  1GN6 A;  2IZ0 A;  4JI1 O;  3JAW A;  3JC2 2;  4FLU A;  4LNU A;  4CS2 A;  2A7W A;  4YIP A;  1IBK B;  3BAS A;  3F89 A;  1KQS O;  2MJZ A;  3CX5 D;  4UCO A;  5APW A;  2Q9L A;  4CBC A;  1XQ8 A;  2E74 B;  2W6I G;  2E74 C;  3ABV C;  2KS1 A;  1N4C A;  3ML0 A;  3SR2 C;  3WB1 A;  3T97 A;  3V2R A;  4ZMD A;  1SLQ A;  3RYI B;  3G3Z A;  1DGS A;  1N7S D;  1NTM J;  4H13 B;  1YSC A;  3CRC A;  4DV5 O;  4DV0 B;  2WIT A;  2A06 D;  1EZV H;  4JAA A;  2WPQ A;  4YHH O;  4FZ1 A;  4LH6 A;  3JAT A;  3AEE C;  1NKD A;  4TT3 G;  3MTU E;  3NMD A;  4N23 A;  2XHB A;  3CXH D;  5H2F H;  4TV8 A;  4BXL A;  3MHS C;  4QNH B;  4HB1 A;  3CCS V;  2YKO A;  2PTM A;  3RGU A;  3AG3 B;  1VF6 A;  4LFA B;  2OTJ V;  3RYF A;  2ZIN A;  3AE7 C;  2PP6 A;  3II6 A;  2JR8 A;  4PD4 D;  2E75 B;  2LW1 A;  5CCG D;  2XDJ A;  2PGD A;  2X6B A;  2ZIO A;  4RUE A;  3K0D A;  5B3S B;  2KK7 A;  4FLZ A;  4FLY A;  1G1J A;  4OPA A;  5IY5 C;  2M8R A;  4JI4 B;  3TGU G;  4B3S B;  1SQV H;  1SQV K;  1T8Z A;  3B5N A;  3O6Q A;  1UJW B;  1QLE C;  1OCR B;  1VEW A;  2EIM B;  4YJ2 A;  2CPB A;  3CCL P;  2ZIM A;  2YXL A;  2L35 A;  3C3S A;  2G8Y A;  3H1L E;  3KZI Z;  1GN2 A;  3LSU A;  3O6Q B;  3RWR D;  3ASN B;  5L3G A;  4Y99 B;  3MUD A;  3DC5 A;  3E86 A;  3RW0 A;  2EIK B;  4PV1 C;  1AI4 A;  4C7N B;  3L70 H;  4MTO A;  1OXZ A;  1W2E A;  3K5B A;  3H1L H;  4RKU J;  4W4K A;  4QPK A;  5KLV J;  1P7G A;  3AE5 C;  4L73 A;  1S77 D;  1L0N G;  2D2C B;  3GB7 C;  4JPR A;  3WG7 C;  3W68 A;  2C2A A;  3E2E A;  1VQL V;  3ZIA G;  1PIX A;  3L72 G;  2QTO A;  3K57 A;  1QQC A;  4GZR B;  5KA6 A;  4DR1 O;  3L71 J;  2RQ6 A;  5CCH D;  1E1R G;  2Q5U A;  4X88 A;  3R2P A;  3SYA A;  1Q6H A;  2Y0I A;  4MSW C;  4GOD A;  1JOC A;  1M56 C;  3CXH H;  4GDO A;  5JWP A;  4TOI A;  1VL2 A;  1H8E G;  3MHH C;  5H9C A;  2JK5 C;  3K79 A;  3CCR V;  5E1A C;  1SVF A;  2YO2 A;  1JY2 O;  2LGQ A;  1X59 A;  1LT9 B;  3CCS P;  3FB5 C;  1RM1 C;  1EN4 A;  3ETD A;  1F4N A;  1LT9 A;  2JRI A;  5CA1 A;  4OXS A;  3WU2 Z;  3TK1 A;  1IC2 A;  3VMX A;  1AJN A;  3UO2 A;  1X9V A;  1ZP0 C;  2B87 A;  3I55 P;  2OTL V;  1EN6 A;  2ZAE B;  3LNM B;  1EZJ A;  2F93 B;  4DCK A;  3DSQ A;  4DO2 A;  3IC7 A;  5BR8 B;  4WFA V;  3OAK A;  1WT6 A;  3V2N A;  1K5Q A;  4NXN B;  2AXT E;  1YVW A;  5C93 A;  2KS1 B;  5JJN B;  3MZW B;  2DWD C;  2YMK A;  2KSJ A;  1QLE D;  2GTA A;  4I0X A;  2WSF J;  4X65 O;  5B1B B;  1THZ A;  5JH7 B;  1IJD B;  2ZT9 D;  2Y0E A;  5HFL A;  3CC7 P;  3SPG A;  1JMB A;  3TNU B;  5AW6 B;  1NYH A;  4C7U A;  2FY8 A;  1WLE A;  1DEB A;  1N8R Q;  1JA8 A;  3J81 N;  2QDO A;  4X1K B;  5JJJ B;  3FX7 A;  1BCC E;  1SQX J;  4RQF A;  3RK3 B;  3KCY A;  5AW9 B;  4IOI H;  3L74 H;  1ZOY C;  3OD4 A;  1XTC C;  3MGN A;  1SER A;  1LTA C;  3Q5R A;  3VP8 A;  4MTF A;  1ZTE A;  2YI9 A;  3ZHS A;  2AEF A;  1PP9 D;  5GON B;  1URF A;  1I0H A;  3WU2 H;  3Q2Y A;  1WB8 A;  1EZV G;  4YJ2 B;  2DYS C;  1R3J C;  3SYP A;  1SQV E;  5AVU B;  4C7R A;  3HD7 C;  2EIL C;  2J5U A;  4H0L B;  2QM7 A;  4LF7 O;  4ZI7 A;  2W0X A;  3LDE A;  2PY5 A;  2ADP A;  5TIS E;  3A7O A;  1J95 A;  2EIJ C;  4X62 O;  3U0Z A;  2CTP A;  4J7Z A;  3L75 D;  4PA7 A;  2E5Y A;  1RHZ B;  1BQ0 A;  1KB9 I;  3VN0 A;  4FVM A;  2XT9 A;  1K3E A;  1B04 A;  2Y69 B;  1AVM A;  4JTA B;  2I1K A;  3JD2 A;  2AZ2 A;  1FZG A;  3KZI E;  5CBH A;  1YDX A;  3JAT B;  1SQB J;  5FLX N;  2RCV A;  1J5E O;  4PJ0 H;  1BE3 G;  3CCQ V;  3TXS A;  1QVF U;  2IBZ H;  2XAQ A;  1SS3 A;  2EBO A;  1BE3 E;  1DLB A;  2UXN A;  3CCU P;  3CC7 V;  3HKC B;  3K03 A;  1IK7 A;  1D5A A;  1M90 Q;  1NVP D;  5KAI E;  1WMK A;  3FX0 A;  2UXC B;  1VQ9 P;  4RO2 A;  4DUZ B;  1QLN A;  2B89 A;  2I8D A;  1SES A;  1JUN A;  1URQ B;  3H1H D;  3OUS A;  3OA7 A;  3RBX A;  4CH3 A;  3JAM N; 
#chains in the Genus database with same CATH homology
 1JVM A;  2H8P C;  1MOF A;  1V55 B;  2WLN A;  3FYI B;  1V54 C;  1G4Y B;  1Q82 W;  4MVQ A;  2K1E A;  1XL6 A;  1ZWI C;  4ZKI A;  2IW5 A;  3SPJ A;  1XL4 A;  3CCU V;  1JJ2 U;  1DF5 A;  4UVC A;  2WLM A;  2CK3 G;  4BW5 A;  3BEH A;  3OAA G;  4BIU A;  3I55 V;  3CCE V;  1NJI W;  4LP8 A;  1K33 A;  2HR3 A;  3P32 A;  3T4Z A;  4YXW G;  3JD0 A;  1Q81 W;  4ASU G;  4JAV A;  1FXH A;  4PA6 A;  1V54 B;  3OGC C;  5LHI A;  2QA4 V;  1S3J A;  1KD1 W;  4P30 A;  4N21 A;  4WFB V;  3W7W A;  2ZQM A;  3OEH G;  1PNM A;  2WLI B;  2Q67 A;  3H01 A;  3CCV V;  1K9M W;  1FXV A;  1YHQ V;  2Q6A A;  4JAS A;  4GCZ A;  1ROP A;  1BMF G;  1AJQ A;  2EIN C;  1GKF A;  3G71 V;  2ZXW B;  4WVZ A;  5LHH A;  4MVR A;  3D3I A;  5B3S C;  3JYC A;  1E1Q G;  2XAS A;  2XAJ A;  2QEX V;  1FXK A;  3AEI A;  1L1F A;  3W7U A;  2AHZ A;  3OFN G;  3AG3 C;  3SPH A;  1YJW V;  1MAB G;  3I56 V;  3QO8 A;  3ASO C;  2X7R B;  5IYD O;  3OM3 B;  1GM7 A;  1GTO A;  2AHY A;  2IJI A;  4RAI A;  1SET A;  2X0L A;  2ATK C;  3K08 A;  5KA5 A;  2IH3 C;  3CC2 V;  1VQ6 V;  1K5S A;  2WWW A;  2Y69 C;  5FL7 G;  4L87 A;  2EIK C;  1YIJ V;  2F43 G;  2WAM A;  2DYR B;  3B8N A;  1SRY A;  3K3W A;  3ASO B;  3E8F A;  3CCJ V;  2JDI H;  5B1O A;  1GM8 A;  3ABM B;  2A9H A;  3SYC A;  5B1A C;  2HLD G;  1I5Y A;  2R9R B;  3ZRW B;  2QKS A;  4UVA A;  1ARO P;  1VQ7 V;  2X6A A;  1Y4M A;  2WSS H;  3GWO A;  2YEV B;  1RPR A;  3AG2 B;  3AG2 C;  2W6J H;  3PJS K;  4MW8 A;  2P90 A;  4XBF A;  1VQM V;  2DWE C;  4QE9 A;  3ZN0 A;  1GK9 A;  1AJP A;  1QBZ A;  3LUT B;  4E2L A;  2JJ2 G;  3LDC A;  4R7C A;  2A79 B;  4PA4 A;  1M1K W;  3EHB B;  3IGA C;  4XDK A;  1NR1 A;  4KUM A;  1E79 G;  3FB7 C;  3UKM A;  5GW7 A;  3FYE B;  3AG4 C;  4UUJ C;  3KG2 A;  3RBZ A;  3OMI B;  4TWK A;  3VOU A;  4WFE A;  3OMA B;  1ENV A;  3E8G A;  4F4L A;  3G4S V;  1YTF B;  1FXK C;  1K4C C;  4X8A A;  2IH1 C;  1CP9 A;  4PEL A;  4PDR A;  1RM1 B;  4H33 A;  3ZMT A;  1YTF D;  2Q69 A;  3QNE A;  2OCC B;  4JYB A;  1M90 W;  3OR7 C;  1R73 A;  2EIN B;  1NR7 A;  2B1I A;  2Y48 A;  5B1A B;  4Z1M G;  4FK5 C;  4RUF A;  1R3K C;  3HPL C;  2GHY A;  3K04 A;  3JCZ A;  4EKW A;  4PDL A;  1W0K G;  1EBO A;  4R6Z A;  3HB3 B;  4WFH A;  3E8H A;  4MVO A;  3OW2 U;  1OCO B;  3ETE A;  5H6Q A;  3CXC U;  3ZCC A;  4LCU C;  4MVM A;  4PA9 A;  4YXW H;  1BSH A;  1VQ4 V;  2XND G;  4J9Z B;  2WPD G;  3F7V C;  5IY5 B;  3JD3 A;  4TSF G;  3ZRX A;  1VQ5 V;  1SZT A;  3G6E V;  1ORQ C;  3B8M A;  1K8A W;  3MD0 A;  4XDJ A;  5KUK A;  5L3F A;  2EIM C;  2WLL A;  1R6N A;  1K97 A;  1M9N A;  1QR9 A;  3JD1 A;  1OCZ C;  3OR6 C;  1FXK B;  5LBQ A;  2P7T C;  3W7T A;  5B1N A;  2XOK G;  2EIL B;  5CMU A;  2JIZ G;  5H6R A;  1P4R A;  1PNL A;  4MVU A;  1NQT A;  1AI5 A;  1W2B U;  1M56 B;  4GX1 A;  4I5S A;  4LBE C;  1TUE B;  3STL C;  2D3O W;  3T1C A;  3ZMV A;  1PNK A;  3CCM V;  1HWY A;  2ZD9 A;  2FTK A;  3ABK B;  2IJJ A;  4J9Y B;  1S5H C;  1N8R W;  3AG1 B;  1AI7 A;  4RQE A;  5EBW C;  3CME V;  4GX2 A;  2V7Q G;  1COW G;  4P2Z A;  2ZR2 A;  5HFM A;  3T4D A;  4WFF A;  1NBM G;  2Z5U A;  1K73 W;  1AR1 B;  3QO5 A;  2HVK C;  3RVZ A;  3OUF A;  1IFP A;  2HKO A;  1QLE B;  1R3I C;  4XDL A;  3ABK C;  1QVG U;  5KUM A;  5EC1 C;  3E35 A;  3LSS A;  4CZZ A;  2X6C A;  5CBF A;  1BSN A;  1BL8 A;  1JCH A;  2LP7 A;  3SJQ C;  2P6J A;  4PDM A;  1S76 D;  4JAU A;  1YI2 V;  3QO7 A;  3ABU A;  3USS A;  3TCU A;  2YSU B;  1F23 A;  1OCC B;  3ZJZ A;  4MT8 A;  4UV9 A;  1KEC A;  5DN6 G;  2IJH A;  1R6K A;  3WFV A;  3ZMU A;  1VQO V;  1M57 B;  3ASN C;  3SYO A;  1JQ0 A;  3IFX A;  2OT5 A;  3NXS A;  4G27 B;  1KP2 A;  1RPO A;  2IU0 A;  1YIT V;  4QE7 A;  4JYC A;  2B1G A;  1FS0 G;  3CC4 V;  2IU3 A;  3SPC A;  1S72 V;  4JTC B;  2ZDI C;  3FB6 C;  2B5U A;  1M57 C;  4P9O A;  5CBG A;  1AQT A;  4WCE V;  1BHB A;  4GX0 A;  4MTG A;  5L3D A;  1JOY A;  2KB1 A;  1MSW D;  2ITC C;  2A0L A;  2WLL B;  2GSM B;  1R3L C;  2V1D A;  2EZO A;  3ZRW A;  3X2Q C;  1QR8 A;  4DXW A;  2XAG A;  2DW4 A;  2LFS A;  2QE7 G;  4FPP A;  1DF4 A;  2HJF C;  3A0R A;  1LNQ A;  2WLJ A;  3ZRV A;  1JPX A;  3CMA V;  1GO3 F;  4MS2 A;  4CBC A;  3FKS G;  2W6I G;  4G28 B;  4I9W A;  3ML0 A;  2NLJ C;  1KC8 W;  5IDJ A;  3UM7 A;  2HG5 C;  5IYB O;  2JDI G;  4BAY A;  1YSC A;  5LHG A;  4HAM A;  4HZ3 A;  1H2G A;  2V7Q H;  2DQ3 A;  4JTD B;  3AG1 C;  2W6J G;  2WLH A;  1NKD A;  4TT3 G;  4N23 A;  4FIP C;  2EJR A;  1VQP V;  4U7N A;  3MHS C;  4QNH B;  3CCS V;  3AG3 B;  2DQ0 A;  2OTJ V;  3ZRS A;  3BY6 A;  5L3E A;  3W7S A;  3OE7 G;  1OCZ B;  2X6B A;  2HFE C;  4RUE A;  2BOC C;  5EK0 A;  2M7W A;  2QM8 A;  3K0D A;  4KFM A;  5LGT A;  5B3S B;  5IY5 C;  3STZ C;  2Z3Y A;  4R50 A;  3R65 A;  1UJW B;  1QLE C;  1OCR B;  2EIM B;  1K92 A;  2WLK A;  2LFR A;  3E89 A;  1JEK A;  3ABM C;  3WG7 B;  1VQ8 V;  4UV8 A;  4FJC C;  1PD3 A;  1VQ9 V;  3ASN B;  4WFG A;  5L3G A;  3E86 A;  2JEU A;  2EIK B;  3RW0 A;  1AI4 A;  4MTO A;  5DM6 V;  2ZDI A;  4U7O A;  2PI4 A;  4QPK A;  4MVZ A;  1IXM A;  1F4M A;  2XAF A;  1F51 A;  1Q7Y W;  1S77 D;  2XND H;  3GB7 C;  2EIJ B;  4JPR A;  3WG7 C;  3CCL V;  1WPX A;  2C2A A;  5IYC O;  3E2E A;  1VQL V;  3ZIA G;  1K4D C;  5LGU A;  2QTO A;  1G8M A;  5KA6 A;  2Q68 A;  2HVJ C;  1B6Q A;  4R8C A;  1PKX A;  1NH2 D;  1E1R G;  4X88 A;  2DYS B;  3SYA A;  3P30 A;  3W7X A;  3K06 A;  1P7B A;  4G2K A;  4MSW C;  1H38 A;  2OCC C;  3F7Y C;  3RVY A;  4JF3 A;  1M56 C;  1OHH G;  2EZP A;  1I5X A;  1H8E G;  3LDD A;  3MHH C;  4X89 A;  2JK5 C;  3K79 A;  1QCE A;  5H9C A;  1NH2 B;  3D36 A;  5LGN A;  3CCR V;  2JJ1 G;  4UVB A;  5E1A C;  2IJK A;  3ABT A;  1DTO A;  3E8B A;  3K9A A;  3FB5 C;  1RM1 C;  3ETD A;  4Q20 A;  1F4N A;  1KP3 A;  4OXS A;  1PL0 A;  3TK1 A;  3ABL C;  1OCO C;  4MW3 A;  1AJN A;  1AI6 A;  3DGE A;  2OTL V;  1GM9 A;  3M99 B;  4JGS A;  3LNM B;  1EZJ A;  5L3B A;  4ZBM A;  4DO2 A;  3IC7 A;  4GT1 A;  4WFA V;  1EFR G;  2PI5 A;  1YJ9 V;  1K5Q A;  1KKD A;  2QE7 H;  5C93 A;  2ZXW C;  2DWD C;  2W0F C;  2MK3 A;  1V55 C;  1CEZ A;  2ZR3 A;  4TLF A;  5B1B B;  5J9P C;  3E83 A;  3ETG A;  1THZ A;  3F5W C;  1KQS U;  3CD6 V;  3X2Q B;  4LC1 A;  5HFL A;  3CP1 A;  2ITD C;  3SPG A;  4MTX A;  2E5T A;  4FMT A;  3JD4 A;  1YJN V;  1GMG A;  1WLE A;  4WF9 V;  2XAH A;  4KP4 A;  4RQF A;  1VQN V;  3LSQ A;  5B1B C;  4PDV A;  1Q86 W;  3OEE G;  2NNU A;  4MVS A;  1FFT B;  1SER A;  3DTU B;  3CPW U;  4MTF A;  1OZ0 A;  1E79 H;  2WLI A;  2CK3 H;  1BHA A;  3ZMS A;  2DYS C;  2P67 A;  1R3J C;  3SYP A;  2EIL C;  5CA3 A;  2BOB C;  2QM7 A;  4PA3 A;  4HYO A;  3T2M A;  3FB8 C;  3AG4 B;  5EBM C;  2DYR C;  3K0G A;  3LDE A;  5EBL C;  4QIW F;  1FS0 E;  1J95 A;  3EFF K;  2EIJ C;  3OMN B;  4PA7 A;  1JX9 A;  2E5Y A;  4GX5 A;  1CPY A;  2H94 A;  1VQK V;  4QMA A;  5L3C A;  1K3E A;  3B77 A;  2Y69 B;  4JTA B;  3JD2 A;  3TET A;  3SYQ A;  1S0V A;  5CBH A;  3ZN1 A;  5BZB A;  3ABL B;  4P9P A;  3CCQ V;  4DJG A;  2UXX A;  1OCR C;  1Y66 A;  4UXN A;  1QVF U;  1NVP B;  2XAQ A;  2EBO A;  3SPI A;  3CYO A;  4BIZ A;  1DLB A;  1H8H G;  2UXN A;  3CC7 V;  1K7D A;  5EC2 C;  3K03 A;  4QPJ A;  1MG1 A;  2JEX A;  1K34 A;  1NVP D;  2YEV A;  3VBB A;  2R9I A;  4QJF B;  4RO2 A;  1QLN A;  2WSS G;  1OCC C;  1SES A;  3ZMZ A;  3OUS A;  4H37 A;  1W0J G;  5CN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...