3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB light chain
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
5CBHA 3FB6C 2A79B 1BSHA 2HJFC 4J9ZB 2HG5C 3SPCA 4HYOA 4MS2A 1K4CC 3JYCA 2ZXWC 4MVRA 2WSSH 5EBWC 2X6CA 2JDIH 3RVYA 2Q68A 2DYRC 4GX0A 4JTCB 1KKDA 3ABKC 3RVZA 3K0GA 3LUTB 4I9WA 4MSWC 1R3LC 2DWEC 2QKSA 3E8HA 2Q6AA 2EIKC 4QE7A 2ZD9A 5EC2C 3K0DA 3T1CA 3LDCA 4QNHB 1LNQA 4GX1A 4TLFA 4P9PA 3SPJA 3SPHA 3F7YC 4WFEA 3BEHA 5KUMA 2A9HA 3OUSA 4G27B 3E86A 4ZBMA 3K06A 1ZWIC 4TWKA 2BOBC 2H8PC 3RW0A 4EKWA 1FS0E 3FB8C 4XDJA 2BOCC 4P30A 5EK0A 2WLLA 4YXWH 3IGAC 2IH3C 3ZRSA 2OCCC 4RO2A 4H37A 4H33A 2E5YA 2ITCC 3SYPA 2DYSC 3OUFA 4J9YB 4MVOA 4UUJC 1G4YB 3K08A 3SYOA 4X8AA 1OCCC 2A0LA 4PDRA 3E83A 4R50A 1R3KC 3LDDA 5E1AC 3TCUA 2X6BA 2EIMC 2WLJA 4PA7A 1V54C 2JK5C 3RBZA 4PDVA 4R6ZA 1AQTA 4LCUC 1M56C 4MVSA 4MVUA 4P2ZA 3E8BA 1JEKA 2HFEC 2R9RB 2WLMA 2IH1C 3SYCA 5EC1C 3HPLC 2WLIB 2X6AA 3T4DA 2DWDC 3UM7A 2Q67A 2ITDC 2V7QH 5J9PC 3T4ZA 2CK3H 2EILC 3ABLC 4QE9A 2EIJC 4RUEA 3VOUA 4WVZA 3LNMB 5KUKA 2HVKC 3AG1C 1J95A 1R3JC 4R7CA 1QLEC 1R3IC 1OCOC 3STLC 5IY5C 3UKMA 2WLHA 3GB7C 3SYAA 2W6JH 1JVMA 4DXWA 3AG2C 4X88A 4HZ3A 4PA3A 1BSNA 1ORQC 3SJQC 3SPIA 3OGCC 1XL4A 4RAIA 1E79H 1IFPA 2XNDH 4DJGA 3PJSK 3AG3C 3ASNC 3ASOC 3KG2A 4JTAB 3LDEA 3SYQA 3X2QC 3OR7C 1P7BA 2Q69A 4GX5A 3TETA 3FB7C 3K03A 2HVJC 2WLNA 4PDMA 4X89A 5B1BC 5B1AC 4MTOA 2NLJC 3STZC 3EFFK 3F7VC 4RUFA 4XDKA 3E8FA 4MVQA 4GX2A 4WFHA 2YEVA 5EBMC 4CBCA 2AHZA 2WLIA 4LBEC 3FB5C 3F5WC 4OXSA 4P9OA 2Y69C 3OR6C 3WG7C 4MTFA 4LP8A 3T2MA 5BZBA 3K04A 1M57C 1V55C 4JTDB 1K4DC 4MW8A 5B3SC 2EINC 2QE7H 2KB1A 3E8GA 3E89A 2ATKC 3AG4C 4PA4A 4PA6A 2QTOA 4PDLA 5CBFA 5CBGA 4QMAA 4PA9A 3USSA 3IFXA 2K1EA 3SPGA 4WFFA 2AHYA 4XDLA 4MTGA 4MVZA 1OCRC 2E5TA 3R65A 2WLLB 1BL8A 2WLKA 3ZJZA 4BW5A 4F4LA 2P7TC 4MW3A 2W0FC 1XL6A 4G28B 3ABMC 4KFMA 1S5HC 4WFGA 5EBLC 1OCZC 4R8CA 4MVMA
chains in the Genus database with same CATH superfamily
3IC9A 4RQEA 4O2BB 4I7ZB 2VQEO 2QA4V 3E1RA 4MS2A 2V4HA 1MG1A 4MVRA 3ZDMA 3G67A 1JCDA 5FPRA 1KYOD 2OYHB 4WY4D 2P4KA 5C93A 3BCCJ 5KLVE 1G6UA 4LF5B 3BVHA 3AEGC 4CZZA 5EC2C 1U96A 4GOFA 4FLVA 1ZAUA 5TISZ 1KQLA 1SESA 1J1EC 1JY2N 1VQ7P 3E1IA 3A5TA 2P7JA 2PI5A 4H37A 2GA1A 2ITCC 2K37A 1WA8B 1ZRTD 3NTNA 2Q6QA 1HGZA 5AVVB 4O2BA 1KTMA 4WB4A 2ZNIA 1HNXB 1WJZA 1AI5A 3A0RA 4KL1A 4PDVA 4EFEA 1U57A 2OYHA 1ZV8A 5CBOA 3D71A 1VQ5P 3EVKA 2E42A 5CMUA 1KILE 5L3FA 2OQQA 3SYCA 1I94B 3B5ND 2C0XA 4PJ0H 1URQB 3RK2D 1VQ7V 4ICGA 2CK3H 1P49A 3AG2B 1L4AC 1LTJB 1ZXGA 2EIMB 3RBXA 3M9HA 4AILC 4AQRD 4Z1MH 3PLNA 4X88A 1WA8A 4HZ3A 1SQVH 1YI2P 4H13C 3OGCC 1XL4A 1WAZA 4JI3B 1N7SC 4N21A 4HJGH 3KKYA 3BPZA 3HTKA 4GX5A 3ABLB 3JD4A 4O4JB 4GKKB 4FLUA 4PDMA 4FLZA 4OGQB 2P1JA 3A7OA 2Y0CA 2KLUA 1AJNA 3OJAB 4I6MC 2E75D 1MABG 4FK5C 4NPFX 1PP9J 1L0LD 3VOPA 2A06H 4GX2A 1URQA 2H7HA 4X1YA 3MHSC 4C7RA 3BRVB 3S9OA 1KU9A 1LTJA 1CXZB 4TV9B 3L73H 1UIXA 1SQBD 4LFBO 3L71H 2WA4A 4X9QA 4DR4B 2KOGA 2FTKA 3QVNA 2GM4A 3IF4A 1H8HG 3VBBA 5CCHA 2GHYA 5AW5B 5M1BA 3T1YB 1XDCA 5JJNB 3Q2YA 3ZHQA 3MTUE 4O4JA 2A79B 2HJFC 3E22B 2WZ7A 1XMQO 5KA6A 1N33B 5AW6B 3L75G 1FFTB 2BTOA 1T8ZA 4GX0A 1KKDA 1PGPA 3RVZA 1H2GA 2B9BA 2RMKB 4W80A 1FDIA 1K05A 2RNBA 2I1KA 3LIDA 2LXBA 4X62B 1JB0J 3OA7A 4TV9A 4I4TB 2ILMA 3VQWA 1WT6A 1BGYH 3BEHA 1NI8A 3GHGB 4YHHB 3H1JD 2BOBC 1MKMA 1FS0E 2KZIA 2WSEH 2BOCC 4X64O 2WPDG 2PFXA 1WN7A 4N78E 4FLYA 1TA8A 5JVDB 4KHPB 1P84H 3OE7G 3E22A 3CL3D 3CWBE 1EZJA 1G2CB 1S0VA 1PPJH 3PN1A 2HR3A 2X6BA 3ZHVA 4PD4I 3TYYA 2F23A 3H25A 1TAEA 1OVRA 2FFDB 1XNRB 3CLQA 2GV9A 1IK9A 2H8PD 2EIJB 4IYHA 1SQQE 3L74E 4I4TA 3S3WA 1SQVK 3D36C 1Q6HA 1BDDA 1NTME 4QE9A 1SQPG 2OARA 2HVKC 3TJTA 4F6RB 3JCUH 1XMOB 3VMAA 3AG3B 2L6LA 3X2QB 2JEEA 3ZIAG 3HR0A 3RN4A 5CA0B 5JVDA 1ZTEA 2JEXA 4JF7A 3IR9A 5AW2B 4A7PA 3KG2A 2FXMA 1G2CA 2XU6A 4H44C 1Q2NA 2IU3A 1FFXB 1Q6IA 1GMGA 5KAFE 2WLNA 4X89A 2UXNA 5BR8O 2IJJA 2Z0AA 1K34A 5APVA 3G6EP 4CH6A 2YSUB 3LW5J 1L0LJ 2AHZA 5E79H 3V2QA 2G8YA 1XOUA 4TOIA 2J5UA 4J10A 4D6TE 1THZA 2ETNA 3WB2A 4I7ZC 4F6RA 2OTLP 5GTHZ 1NWQA 2SPZA 2ATKC 4QMAA 3JSLA 3QF7A 2KI7B 5H5NA 1VDFA 2BCCH 2FYUD 2OYHC 3THOA 4PD4E 4DOJA 4MTGA 4XA4A 3CCJP 2QJPB 4DR7B 2OTJP 4GT1A 5CA0A 2WLLB 1VF5D 3H1KD 1JPXA 3I5CA 4H0LD 2W0FC 1XL6A 4C7NB 3LSSA 3WU2H 1IDSA 5EFWB 4NXNO 3L35A 4HBNA 3ABKB 3G6EV 1FFXA 1AI7A 5LGTA 1VQ9P 3L75J 3H1LD 1R6NA 4JBZA 1DLBA 1BCCH 1FXHA 2HG5C 5BY1A 4AYCA 2WSCH 4BWNA 3K3WA 4BIUA 2JKVA 3RVYA 1OW6A 1VEWA 3TGUE 1WB8A 1FXKB 4DV4O 2O01J 1NTKE 3HUSC 2UXBB 1X59A 1Z5VA 1R6KA 2Q6AA 1M93A 1GZLA 1MSDA 3CX5I 3CCJV 3KPEA 3AE6C 4P9PA 4U7JA 2H94A 1FZFA 4PV1C 4IHJB 1EQ7A 3H1IE 1HW7A 2HODB 2W8ZA 5TISH 2CGOA 3HKBB 2OCHA 1VQ9V 2WLLA 4YXWH 1J2JB 5H2FE 4UB8H 2C9NY 3ZMZA 5BXZA 2N9BA 1JX9A 2YXHA 4J41A 2CPSA 3A0HH 3LDDA 2NPSC 1LTJC 2RKLA 1B06A 1NAFA 3VQYA 4TT3H 2EIMC 2HPCB 3OFNG 1OVVA 2Z5HA 1ZR2A 3DTUB 1TU3F 1FXKA 3CE2A 1IURA 1M56C 1NKNA 3L4FA 1BE3D 5LL6Y 2DJVA 3L72D 2Y9ZA 4K0KO 4LF9O 2X6AA 3T4DA 1N7LA 1RQUA 1SQPJ 4KHXA 5AVWB 3QTCA 1XILA 5F2VO 3ZCCA 1H8EG 3ABLC 3A2FA 1MUUA 1PKXA 3WMM0 4IHJA 1XI1A 4WVZA 1GW4A 1A02J 2IDBA 2VQFB 2O01N 4IIJB 2HODA 4IFFA 5IY5C 3HKBA 2ZE5A 3BCCE 1P84F 1JJOA 5DM6V 4JI5O 4DXWA 3M7MX 3OEHG 2ZAEB 2XKMA 1SA0A 1GKFA 4JI6B 1PGQA 1SETA 3HRNA 1OMIA 1BZKA 3WUTA 3HKCB 2AZ0A 2G38A 1SERA 2HPCA 1J1DB 1GK9A 1IBMB 5H9CA 5B1BC 3CX5E 3I5DA 1Q86Q 1L4AD 1IXMA 3CCLV 3BABA 4WFBV 5J2TB 1OXZA 1OCOB 4DT0A 5KHIA 4U3FH 3CCMP 3S3XA 1PL0A 4FPPA 5IE9A 4DW1A 3ZHSA 1DEBA 4BXLA 4H13D 2UXDO 1XREA 1N7SD 3CCQV 3JALB 4ZOLB 3HE5B 1KD1W 1HUCA 1HTLC 2QE7H 1ZMEC 5K1XA 5J2UB 5AW3B 1FBMA 4HB1A 2CAZC 3GMAA 1HBWA 1SZXA 1ZUQA 2M7WA 1OWAA 4YY3B 2AXTE 1BL8A 3APOA 2LR2A 4DR5O 3P8MC 3HKCA 2W6IG 1D2DA 4JYAB 4B3SO 1BSHA 1QR8A 3CYOA 1FOSF 1H2MA 5J2TA 5B5EE 3FGAD 3T1HB 4DV6B 2KZJA 4D7TA 2JDIH 3A3YB 1B6QA 1WB7A 3BAAA 4JTCB 4K8XA 2Z5IA 3A0BH 3D6ZA 3I56P 2IX7C 1SQXG 2VS0A 2CH7B 4GKGA 3T1CA 2YXLA 3FFQA 3JALA 3VQVA 2P6JA 2KYVA 3CMEP 3F7YC 4ASWA 5J2UA 3FXDA 1ZWIC 2XTAA 4X66O 3K9AA 5KKZB 3H6PA 4NKGB 3ETDA 1SQQG 4JZ2A 3L74G 3TK1A 2XDJA 4GZRB 2E5YA 3JD2A 4UCTA 2N1TC 1MZFA 3I56V 1RE4A 2HJDA 2CK3G 3Q5SA 2J59M 2IPPA 1KBHA 2CTRA 1LT1A 3D6YA 1K92A 1SQVD 1KUQA 5LXTA 3CMEV 2WSFH 4N6JA 5B66H 3BA9A 1FC2C 3C90A 1LJ2A 2UXXA 5HFLA 1CZQA 2IBZD 3QH9A 5J9PC 1UFIA 2MK3A 2RDCA 1NYHA 4GKJB 1FDMA 2V1DA 3Q5PA 1AROP 2YDEA 3TNUB 1HF9A 2A06D 3MD0A 4KXRA 5AW0B 3AEDC 2IZ0A 1FZGA 2JP3A 4DV2B 1ZP0C 1IFPA 1KILB 3L73D 5BU5A 2F66C 1GU5A 4JI0B 2QJYB 3L71D 4JTAB 4WBNA 2KS1B 3FB7C 2R9AA 2X7RB 1BSMA 2P2UA 1E5WA 1AJYA 1Z5WA 4KUMA 5CJ0A 4JI7O 2XNDG 1E79G 4G2KA 5APXA 4MVQA 5B3SB 2EINB 3AE2C 1I0HA 4B3RB 2XAHA 3UCSC 3Q4HA 1KYOF 4AHCA 3ABTA 4LP8A 1RFYA 1YJNP 4MW8A 4E4EA 1WMKA 2I1JA 4IYIA 3AEBC 4H44D 3TNUA 1AVMA 4IT5A 1SC5B 3TGUG 3AK2A 2ZIOA 2QIWA 3CD6V 1FXKC 4E2LA 5GTHH 1NTKG 3NMDA 1VQNP 5AVYB 4C46A 1KILA 1BGYD 3II6A 1LTGC 4MVMA 1HWTC 1KZUB 2KS1A 3KCYA 3E35A 1IBLB 2KSJA 3PH0A 2OYIB 3CJHB 4CC5A 3CI9A 2JGUA 5LMUB 4X1IA 1SFCB 1NKDA 2XAJA 1SQXJ 5KAFZ 1N32O 3RL0B 3LUTB 1FJGB 1JOYA 1FE6A 1P84D 5AVUB 1KP3A 2ZM6B 3ABUA 3K0DA 1PPJD 3CCSP 1HNWO 4DR3O 1HR0O 1VQNV 3H1HG 4AUWA 1SQBK 4LFCB 1M8OB 2Q0OC 2W0XA 1SQQJ 4HAMA 2HG5D 4DV7B 2A45G 2Q1KA 1L0LE 4RO2A 4AQYO 1DX7A 1SRYA 4H33A 1IXBA 5EIBC 5DN6G 1YQ3C 1H38A 2QSIA 1KMIZ 1L2PA 1I5YA 1RM1C 2OYIA 2PGGA 3CJHA 3UT5A 1N2DC 4B3TB 5CB4B 2FYUH 2JK5C 3RBZA 2AGAA 4LF6O 1GN2A 4JASA 5LGNA 4PV1D 3CCSV 4UB6H 1S2EA 3FXEA 2RMZA 1PL5A 3PHLA 1KV4A 1L0NH 1QLNA 2DW3A 4LF4O 1EFRG 3IFMA 2F93B 1J1DC 3CC2P 4M3LA 3PRJA 4EIJA 2NPSD 4DUYB 4R7CA 1OCOC 3BHPA 3OAKA 3ZHUA 3CRAA 2LXCB 1M56D 3K79A 2E76C 3RK3C 1I7FA 2YIDA 3SPIA 4DJGA 1H2NA 3PJSK 5H2FZ 4DK1A 1OJHA 1QL1A 1P7BA 1EZVH 2LFRA 2HVJC 4K8ZA 1KKCA 2F1MA 2QWRB 1IBKB 3CC2V 2BCCG 2DE0X 1NS1A 5EBMC 3C1LA 1NKZB 5APTA 2HEPA 1O9GA 5EYPB 3HD7A 4MTFA 1S76D 3AEFC 1EM1A 3TGUJ 2RN0A 1W2EA 1NU1G 2FBWC 2RN9A 1TUBB 1BCCG 4LWSA 1RE3A 1BE3H 3USSA 4ZIBA 4WFFA 1NTZD 1ZW0A 4NPEA 1VF7A 4RKUJ 3FX7A 3ZJZA 2GTAA 5B1NA 2KXPB 4BW5A 4F4LA 1SQPE 2YKPA 4Y28J 2UUAB 5LHGA 5LYJB 2Q7CA 1YTFB 1BGYJ 1ENVA 4DV3B 3R2PA 4ZHQB 2QA4P 4CS2A 1OV9A 2E5LO 5KKZC 3LSUA 5AVRB 4DR1B 1IC2A 1GM9A 3SJBC 3SFDC 4YXWG 5EYPA 3J81N 2XV5A 3H1HJ 1MZ9A 2Z3YA 3B8NA 3PP5A 4TLFA 4N23A 1SVFA 2R5DA 4CC6A 1R5LA 1RPOA 4JI1O 1TUBA 2E3CA 1J5EB 2P10A 1S3JA 3CCEV 2FYUK 3VP9A 3HKDB 3G80A 1EDKA 2IH3C 2JS3A 3KZIE 4YIPA 5LYJA 2ZR2A 4DV5B 1L0NK 1QX8A 3M0AA 2AXTZ 1W2BO 2YXRB 1NH2D 5GTIE 4X65O 4JZGA 3BVOA 4NXMB 1LTTC 1M90Q 4GIFA 3ICXA 4DV0B 1PGOA 1F51A 4OVNF 1NZ6A 3EQ2A 3KYQA 1X22A 5JQGB 1QR9A 2LP7A 1FZEA 5B5EZ 4WF9V 5AW1B 1N36O 3NFQA 1ZOYC 2GTSA 3P30A 2JS5A 1JCCA 1KILC 4FM1A 3UM7A 2Q67A 2QJYC 2AEFA 4JYBA 3G6BA 2YIBA 2A3QA 3L70H 1G1XB 2ZCEA 2N1TD 3SWKA 4ASVA 3H1LE 4U3FD 1Y66A 3JARB 4BRYB 3HE4B 3HKDA 2BE3A 2P4VA 1XTCC 2WWWA 4KP4A 1AR4A 3L36A 5KX5B 1HNZO 4B3MB 2PI4A 3RT3C 3ZMUA 3SYQA 3RGUA 3P3PA 2WT7B 1H2KA 1JQ0A 1PV0A 1AB3A 3APQA 2QE7G 2BCCJ 2Q0AA 3JSNA 3N7NA 5JQGA 2YO3A 3STZC 1N0NA 4XDKA 1YJ9V 5AVSB 5KAIE 3W7XA 3M99B 4TQDA 5LMNO 1YBKA 3U10A 3WG7C 3B40A 1NU1J 1M90W 2YC0A 2EZPA 1BCCJ 1VF6C 1PGJA 3JARA 3OM3B 1SLQA 4BRYA 3E8GA 5IDJA 3HE4A 1OX3A 3O8ZA 3SWYA 5CBGA 3KDPB 1RP3B 2K1EA 3RL0C 1DIPA 1DD4A 5KX5A 2YS8A 4DUZB 1NTMH 2IBZH 3L72E 3TDKA 1W2BU 4G28B 3ZMTA 1KC8Q 2PUSA 3M06A 1GO3F 2WT7A 4EDFA 1PM9A 2HHHB 4BW9A 5KTBA 1XNQO 1L0LG 5LA6B 2OWOA 1F4NA 4BIZA 1S5LH 1QBZA 3OMIB 3GG2A 1QVFO 4O4IB 2OIGA 1ZLZA 2QKCA 2PF4E 2WPQA 2FY8A 1SQBG 1N34B 2UXCB 1HWYA 3W7WA 4L8JA 5K5GB 3W7UA 5IWAB 1YITV 4LF5O 4JAAA 2FB5A 2PYLA 2XT9A 1XUQA 1ZLLA 2EBOA 2RQ6A 4D7SA 2DYSC 2EIKB 4MN4C 3CC7P 2ARHA 3HD7C 1NHLA 4R50A 4LF7B 4IL6H 3C3SA 3TCUA 1FDOA 5HFMA 1RE3C 1JEKA 2WITA 2HFEC 5GONB 5LA6A 1H0TB 4I55B 1S9KD 4JV5B 3UO3A 4O4IA 1LTAC 4JQ0D 2GBOA 1KC8W 5C39A 5EIBD 1HNXO 1TUEB 2EILC 2MW2B 3AE1C 1X4TA 3CCVP 3H1JG 1V54B 4U3FJ 3KHUA 1OHHG 3CC7V 1SQXE 3RL0g 1I94O 5D5QA 3AE3C 2R5BA 2YKOA 2E74D 4FLTA 1SKVA 1GAXA 2QJKC 2ZYGA 3P3NA 1RF1C 3OTOB 1YJWP 2P58A 2K9PA 1Q82W 2CUGA 3OR7C 3Q5RA 3TETA 1IO4A 4UV8A 1GRJA 2P06A 3JATB 1SQGA 2UUCB 5AW7B 3ML0A 4PJ0E 4JI3O 1H0TA 4I55A 3RYFB 3CMAP 4WFHA 3CCVV 3GHGA 4WY4B 3FB5C 1QVFU 2E76D 4GKKO 3RK3D 4K35A 3T2MA 2ADQB 1OW8A 1W59A 1RSOB 2QWPB 1LTBC 2ZIMA 2QGNA 2Q4PA 2B1IA 2O3JA 1YJWV 4PA9A 4ZKIA 1KQGB 2BEQD 5FL7G 2KIKA 1USDA 1E1RG 4MVZA 2QG4A 1OCRC 2WPRA 2E5TA 1EN6A 4JGSA 3M9BA 1KB9D 3CRCA 4MW3A 3R4YA 2AZ2A 1BDCA 4WFGA 2XOKG 1WRGA 2GSMB 2K1AA 2FFDA 4R8CA 3CMAV 1JFFB 3FB6C 4DR4O 3W7SA 3JATA 1K8AW 4ZNCA 2X6CA 3RWRD 4GOEA 3RYFA 4O9BA 2WPSA 1X0TA 3N2GB 3T1YO 2UU9B 1JOCA 4QE7A 1SQBJ 2A45I 3L73E 1TGOA 1RSOA 3B5NB 3L71E 1VQLP 3RK2B 2WSSG 1N33O 4QPJA 1PZQA 2ZE6A 3SGIA 1NOHA 3MDSA 3C9IA 3K06A 2JJLA 5JCOA 3K58A 4TWKA 1L0ND 2FYUG 3MHHC 3K5MA 4EKWA 2Q3IA 2WSFJ 5JJEB 4LFAB 2Q73A 4X62O 3ZN1A 3H1KG 1JY3P 3FYEB 1NR1A 5AVTB 1JUNA 2QR4A 5KLVD 1JFFA 3JAMN 4YHHO 3H1LG 1JO5A 3ZS8C 3ZN0A 2AXTH 1WPBA 5KHKA 1NTZH 5L3EA 4A5UB 1LUVA 1VQLV 3ETEA 1N86A 3N2GA 3CRRA 1MMMA 2B87B 5BU8B 4KHPO 2QTSA 2E75B 4HKZH 1EZVD 1SS1A 5CMZA 2DWDC 1BGYE 3EXAA 1USEA 1OCCB 3H1JJ 2XUMA 4QGPA 2Y4UA 4RUEA 4W7ZA 2Y0IA 1XNRO 1J95A 2KG7B 1YIJP 4NTXA 1URQC 4C7NA 3JD1A 4J80A 4HYTB 1FJPA 2RCVA 3AG2C 1BQ0A 1OIPA 1XTGB 3D3QA 4DO2A 2IYOA 2L91A 4LNUB 1P84E 3CXHI 3H1HE 1Q8IA 1KD1Q 1KILD 1NGMB 3H32B 2ZR3A 3KZIZ 1XMOO 1PP9H 1K73Q 2W6JG 3B71A 5GTIZ 3AG1B 2YIUB 5CCHC 1NVPB 2IFMA 4OPHA 3CCLP 3O9OA 2B87A 1BE3G 1HGVA 1HVVA 2Q5ZA 4DR6B 1FJKA 3AK1A 1YIJV 3L72G 1GMJA 5IYZB 3BRTB 4OGQC 4OXSA 2JRIA 2W27A 1IZ3A 2NRGA 2FL4A 1R6TA 2KP8A 3JCUE 4OX9B 2KG7A 3CCQP 4QJFB 4QIWF 5L3BA 4PA6A 2Y48A 2QTOA 4L87A 1GL2B 4B7EA 5APQA 3IFXA 2P5OA 1BS3A 1XQ8A 3D3IA 4LNUA 2JJ2G 1LTSC 2HLOA 3G9RA 3OT7A 2Z4EA 4RWUA 3H32A 5LP6B 1RF0A 2YO2A 3RYIB 1GN3A 2R44A 3SPCA 3OD4A 1GM7A 4L73A 2BASA 4DR7O 4MT8A 4NTWA 1ZX3A 4I0XB 5E79E 1NJIW 4I9WA 1PNKA 2DWEC 3CC4P 2LFSA 4Z2WA 5IYZA 3W67A 2EIKC 4IIJA 4EFBA 5KAIZ 5IT9N 2YMYA 1K73W 1YYCA 3CXHE 2FYUJ 2M3EA 3F5TA 1FU1A 2R32A 2A9HA 1F7YA 3E86A 1AVYA 4CS3A 1GL2A 2BCCE 4I1LA 4FLXA 3HKEB 2FKWB 3AEEC 2YKQA 2CE4A 3H1KJ 2UXBO 4YJ3B 2K88A 5LOVB 1NTZK 4J11A 2QRXA 1ZR4A 1PFIA 1FAVA 3IGAC 4J42A 3GHGC 3L70D 1KYOI 3H1LJ 4UUJC 5LP6A 1NU1E 2P22C 3K08A 2ZVNB 3RYIA 1NT2B 3AE8C 1BCCE 1OW7A 3CC4V 2KUBA 1V54C 2L5GB 1AQTA 4HNAB 1AR5A 4I0XA 1JMBA 4IGGA 3WB0A 4ZOLA 3HE5A 4LC1A 2QWQB 2WLMA 2OCCB 4LF8B 4FM0A 1JY3O 1M1JB 3PTZA 2I8DA 4BIOA 2FFDC 2UUBB 4WBAA 2KQXA 1Y6XA 3VOUA 2EIJC 1RHZB 2W6AA 3HD7D 4YPCA 4CPGA 3LNMB 4DK0A 2YXYA 3HKEA 1VQKV 4YJ3A 3STLC 2IW5A 2X0LA 1W0KG 5LOVA 1FZAA 3CWBD 2Y0DA 4UB8E 3U59A 1VP7A 4FMTA 3IN6A 3P7KA 5DJTB 3V2NA 2HFED 1Y76B 1VF5B 3AG3C 4H0LB 3X2QC 2VQFO 3QO7A 1X9VA 3RYHB 4Z1MG 1G1JA 2YI8A 4HNAA 3LW5H 1BE3J 2CH7A 4CH3A 3MGNA 3KCXA 5JCOC 5FNVB 4RUFA 1SQVG 4JI6O 1NTMD 3L72J 4Y99B 1WPXA 2M5AB 1M1JA 1MA1A 1RQVA 4DR3B 1HR0B 3OAAG 3B77A 3ZRXA 5ITZB 5L3CA 1BHBA 1IBMO 1VPCA 2IBZG 3VMYA 5B1OA 3ASOB 4TV8B 4CH4A 1R5SA 1LT9B 2F4VB 4ZI7B 1KYOE 2FXOA 2KB1A 4PDLA 2A06G 4UV9A 2D3OW 3GW6A 4LGDE 1FD9A 3CD6P 1M4UA 3L75H 1Y76A 1K7DA 3JC22 1P7GA 1CI6B 3L73G 1GTWA 1S5HC 3L71G 1B04A 2Y69B 1Q5OA 3RYHA 1M57B 4LH7A 4I5SA 4J9ZB 2QJPC 4JPZB 4U3FE 3JYCA 4D6TD 5FNVA 4YY3O 2WVRA 3WB1A 1JNMA 4DV1B 3FWNA 5H6RA 1ZRTE 4J7KA 1MFTA 3ABKC 3BY6A 2M5AA 4JI2B 5ITZA 4JI8B 3GF3A 1QHTA 2Q7HA 4JYAO 1GW3A 4PJ0Z 1J1EB 4TV8A 4PD4D 1LT9A 3AE4C 1LNQA 3CCRV 4ZI7A 3AEAC 1FZCB 2QDOA 3B09A 4DV6O 3SPHA 3T1HO 4WFEA 1QNMA 3BFRA 2B9ZA 3UO2A 4ZKUA 3RW0A 3FB8C 3V2RA 1PL4A 3FAVB 1K5SA 2DQ0A 1AP6A 2DOSA 5AG2A 1CI6A 1Y8AA 2E75C 3RGBA 1GU4A 3ZBHA 1BGYG 2N9YB 3J80N 1OCCC 4PDRA 2LGQA 1Z56A 4J7ZA 3G3ZA 1H2LA 5E1AC 5BVZA 3P32A 3DXRB 3A0BE 2PAJA 2Q9LA 2RH0A 4IFDK 2PP6A 1SQPH 2YMKA 4JI4B 1OZ0A 1KB9H 1L4AB 1V9PA 2GUVA 1PNLA 3H1ID 2BSKB 2YEVB 1X79B 1PPJG 3JSVC 1FZCA 1BMFG 3E7KA 1KECA 5JH7B 1JR9A 4NVPA 4H13B 1M1KQ 3AG1C 2OYQA 1LP1B 3VMZA 1W0JG 1UJWB 3FAVA 3N2KB 2Q7EA 5K1PA 1NVOA 5L8RJ 2ZFCA 4PA3A 1BSNA 1SQBE 2LQTA 4GKJO 1SFCA 2FMLA 4DR2B 1K9MW 1IJDB 2QEXP 1VQPP 2B89A 3DXRA 1SQVJ 1CPYA 3IAYA 1GL2C 4X1KB 1QLEB 3KZIH 1DTOA 2NLJC 3OEEG 4LLHA 1L4AA 1URQD 4JI0O 2BSKA 2YEVA 1UPGA 1FPOA 3OGIB 1DH3A 5KLVH 1S5LX 1US6A 1DK1A 1T5EA 3F5WC 1YEWA 4F6EA 5H6QA 2XAFA 5JH7A 3SJAC 1MSWD 5LP6C 3ITKA 1VQMP 4WFAV 1N0JA 5JWPA 1W5CE 1LP1A 2JIZG 5CA1B 3E89A 4B3RO 5APYA 2YUAA 2VQEB 1VQPV 2QEXV 3N2KA 5CCHD 1ZN5A 5LHHA 4XDLA 1Y47A 3L73J 2B1GA 4CH5A 3L71J 5CB4A 3G71V 4I50B 3KQGA 2Y9YA 3H1JE 1YVWA 2ZT9B 2Q8VA 4OGQD 4W4KA 1M1KW 1AJQA 2IYPA 2IJKA 4BAYA 1LWUB 2M3BA 4HYOA 2A7WA 1B3QA 1VQMV 3SFEC 1JTHB 3U1CA 3IJ4A 1XEQA 1R3LC 1WP7A 1AQ5A 1RE4C 2R3CA 3WUUA 1IBLO 3LDCA 3MP7B 5LMUO 1QVGO 1L1FA 1R1BA 5CA1A 3M9QA 5KUMA 1AV1A 1KFMA 4DZOA 5KAIH 2D2CB 3NXSA 1FJGO 3JCUZ 2C0WA 3UQ8A 1NTZG 3CCEP 2ZM6O 1DF5A 1NQTA 2OCCC 1SZTA 4I50A 4ABMA 1M1JC 3I55P 4EEQA 3F5HA 2WSEJ 1JA8A 3SYOA 4LFCO 3AE5C 2O1JA 3LNNA 4U3JB 1BHAA 1LWUA 4DV7O 1URFA 2ADPA 1T3JA 1JTHA 3EWKA 3CP1A 3C8VA 4MVSA 1YHQP 4P2ZA 3SR2C 2IU0A 4UCRA 5IYDO 3J7AU 3N27A 2LW7A 5E79Z 2WLIB 4B3TO 4TT3G 1MFZA 1PP9D 1VF5C 2V7QH 2EZOA 3I55V 2WPVB 5CCGA 1EDIA 2K9JB 2WLHA 4H44B 3P8CD 1H88A 2EX3A 4DCKA 2Y4TA 1QGKB 3B8MA 4ZHQA 4GCZA 4RAIA 1HJ0A 1XHXA 1YHQV 3ASOC 3CB2A 5KLVK 4U3JA 1KB9F 3FD9A 4DUYO 2FYUE 1EXJA 4UB6E 3H1KE 1L8DA 4PI2A 3EFFK 4ZKPA 4LFBB 1YJ9P 1RPRA 5KLIB 2WLIA 1FZBA 1Q7YW 2Y69C 2JJ1G 1QVGU 5L3DA 1T3UA 2W90A 2QVAA 1M57C 4JTDB 3FX0A 5B3SC 2EINC 4U3FG 1YTZT 1GN6A 2K9JA 1IBKO 4PA4A 5IYBO 4BWAA 3VTPC 1CW5A 1AI4A 3FKSG 1LUWA 2P67A 1XMQB 5DJUB 1K97A 4UB8Z 1EZVE 2IJIA 3H9VA 1FZCC 1SQXH 3BA8A 3A0HZ 1Q43A 3A2AA 1QL2A 3HUSB 1EC5A 2V4DA 3CWBH 1T6AA 2WMMA 4JYCA 1HP8A 4ZMDA 3UIAA 5L3GA 3HTKB 1TVKB 2UUAO 4MSWC 4PV1B 2WQYC 2OYIC 4RO0A 1ZSPA 2WSCJ 3U1AA 4TQFA 4CS4A 4X64B 2H43A 3GF7A 4DV3O 1SQQH 2ZXEB 3L74H 4QNHB 1SFCC 5LGUA 4GX1A 4RJTA 2KB7P 2JDIG 3VQXA 4DR1O 4G27B 1BE3E 4ZBMA 1NTZJ 2Z5UA 2FYNB 4X1YB 4YIOA 2MKVA 2Q5UA 3MZWB 3G4SP 1H2SB 2DW4A 2DYRB 2NPSB 4P30A 5EK0A 1YITP 2ZVOB 3QWOC 1YCIA 4NYKA 2OTKE 2NN4A 1G4YB 1M56B 1OVUA 1J5EO 3HUSA 1R3KC 1YTZI 3O65A 2FYZA 4R6ZA 3BASA 1VQ5V 5KAFH 3ZHRA 1TVKA 4JAVA 4UXNA 2CTPA 3E8BA 4DV5O 5APUA 3QO8A 4FFBB 2OGUA 1RY3A 1Q82Q 2JR8A 2W6BA 3HPLC 4NXMO 4BR6A 3G4SV 5EZYB 5IY5B 4DV0O 3ZX6A 1IFNA 3SSUA 4D6TH 3OW2O 2CGNA 3CHXA 1F23A 1QLEC 5LBQA 1S72P 4TUYB 1AA0A 3M0DA 2NPSA 4Z1VA 3SYAA 3LSQA 2YNYA 1JVMA 1YI2V 3SWFA 1JY2O 5BR8B 1K5QA 5B1BB 5C8YB 3MHVA 4PD4H 3SJQC 2XNDH 1E79H 2CDYA 4O4LB 1NBMG 4UFZA 5KHHA 1LGHB 4NPDA 1IZNB 1GD2E 1DF4A 5DECA 1OZHA 3K03A 4FJCC 3JASB 2IBZI 1GDTA 1F4MA 4PHZA 3L75D 4GODA 3ETGA 4B3MO 1NVPD 5CBNA 4FFBA 3A0BZ 3NR7A 3V2PA 2FKXA 2VWKA 1K3EA 3OTFA 1PD3A 3TGUH 1KP2A 5EZYA 1JMMA 1S72V 1N4CA 3O6QB 4NTYA 3L70E 1NTKH 3ASNB 2VRSA 3K04A 2ZT9C 1K8AQ 5KJ7A 1K4DC 1LWUC 1SQXK 4NXNB 4TUYA 1MOFA 3V4WA 2O1KA 2ZNJA 5LHIA 1GL2D 1ZL8B 3H1IH 5IYCO 5C8YA 3B4SA 1IK7A 3W7TA 2F95B 4O4LA 1G8MA 5H2FH 4DV4B 3E2EA 1EDJA 1WLEA 3K59A 1SQQK 4KJMA 1V55B 1JCHA 5GONA 3JASA 2JGDB 1NH2B 2D2CC 2K9YA 2M8RA 5CCGC 1D7MA 4DUZO 3H1HH 2Q68A 4LH6A 1NTMK 5BMVB 1KFNA 4Q6GA 2LKMA 2H89C 3O6QA 5B66Z 2A45H 3JD3A 4W4LA 4JYYA 2QWOB 2HHHO 3SPJA 3ZMSA 1SQVE 2QSAA 1HJBA 1SQPD 1GK6A 3OW2U 1ROPA 1NAYA 2N1TB 2ZXWB 2POHA 1S77D 1ZL8A 1XHZA 3MAQA 2IBZE 4YTPC 4UCUA 1KQSO 3BCCH 2PRRA 2R70A 3OUFA 4J9YB 1LTIC 1N34O 2UXCO 1HDJA 2A06E 1SS3A 4XBFA 1EXIA 4FFKA 4K0KB 4LF9B 2JGDA 5IWAO 1P84I 4I2LC 4WY4A 5A2QN 3CX5H 3DC6A 5BMVA 1Y74B 5KA5A 5KHGA 1S5LE 2IH1C 4LF7O 4JI5B 2XAGA 2EULA 4XE5B 2NR5A 3T4ZA 1VQ4P 2ZINA 1P4RA 2ZDIA 4X20B 4GLXA 2GDSA 4NR1A 2IZ1A 2N1TA 3RFRA 1L0NG 1VQ8P 3CRQA 2P90A 3GB7C 3M8AA 3UKMA 4JV5O 4IOIH 1MZEA 5KLIC 3D70A 3CXHH 2N05A 4IL6E 2NZ2A 2IJHA 5KLVG 5A9GA 3LDEA 3LIEA 1YZBA 2O57A 1NTKK 1AILA 3ZMVA 2N74A 2OIEA 2QM7A 2UXDB 3U11A 1GH6A 1SP4A 2AW9A 2B88A 1Y74A 1VQ4V 2H88C 1YF2A 1IVSA 3B5NA 5B5EH 1NU1H 3E8FA 3Q3DA 3OTOO 2XAQA 1IX9A 1IFJA 1EZVG 4LBEC 1VQ8V 3FWLA 2VWJA 3OR6C 5BZBA 4X20A 3K5LA 2OTLV 3ABVC 5D5PA 4DR5B 3B2EE 4U7OA 5KHJA 4PD4F 2UUCO 1NJIQ 1S4XA 4B3SB 2UWJE 1Q81Q 4QPKA 1R73A 4XFJA 2KKWA 2OTJV 2ITAA 1PPJE 2F43G 1KQSU 3R65A 1YXBA 2WLKA 1XBLA 3T97B 5APWA 3ZEDA 5CJ4A 1AR1B 2XNXA 3QNEA 4B7KA 1PV3A 1GTOA 3V6IA 1QQCA 1SA0B 4FIPC 1M57D 2FYNC 4N3YB 2PTMA 5EBWC 3MUDA 3DC5A 2DYRC 4GYCB 4UB6Z 3M0DC 1JY3N 1DGSA 3K0GA 1K04A 4X66B 3CS5A 3E8HA 1CSBA 2PYJA 1R8EA 1OCZB 1Q3EA 2HP8A 1BT8A 3MIWA 1I08A 1SQFA 4GUNA 3OUSA 1A32A 4UCSA 3KXDA 2UU9O 1HH0A 2HLDG 1BQZA 1RM1B 1AFOA 3VN0A 1EBOA 1K33A 3ZRSA 3WFVA 3T97A 2G3AA 2YXQB 2Q3EA 1YQ4C 1KYOH 2KLVA 3K5OA 4MVOA 1M7LA 1UIIA 2XASA 2E74B 2YI9A 2CPBA 1NR7A 2LGWA 2ZQMA 3E83A 3ZRVA 2V7QG 4DYLA 4U7NA 1OFCX 1SFCD 5KJ7C 1FOSE 4LFAO 3AEIA 2LO1A 4PA7A 1U7JA 4OH8B 3RL0D 1Q81W 1U7MA 1YDXA 3F89A 2ZKOA 1H8AA 4MVUA 2R9RB 4EI2A 2KK7A 4MTXA 4RQFA 4WWIA 2C9LY 4IFMA 4EYYQ 1L0NJ 1N73B 3JD0A 2E76B 2YICA 3RK3B 5APSA 5KUKA 3IAOA 4JF3A 3WU2E 2W83C 1AP5A 3K57A 5AW4B 3QG5A 5CA3A 1T2KC 2PGDA 1VQKP 4YJ2B 1Y67A 4NB5A 1CEZA 1EDLA 5KLVJ 1NU1K 4JI7B 3L70G 4KT0J 3CX5F 3ASNC 4FLWA 3K5BA 3QO5A 3FYIB 2AEMA 3CPWO 2C2AA 1KQFB 1NTZE 1S1CX 3CCMV 5TJHA 1CP9A 3F7VC 3OMNB 1QEXA 2WTYA 1QLED 2R9IA 4N78D 1FS0G 3K9SA 3GLMA 1SQXD 5TISE 2JWDA 3ETQA 3GWOA 1GN4A 2YIAA 1V55C 5LXTB 4OWFA 1N73A 1I5XA 3SDLA 3CXHF 3VYIA 1DD3A 1JMKC 5B1AB 5CBFA 1YSCA 3A0HE 3CWBG 4YJ2A 4DR6O 4WY4C 3S4RA 2IFNA 2BTQB 1GM8A 5DEDA 1Q86W 1SQQD 4RESB 3L74D 4EOTA 2JWAA 4Q20A 3BATA 2LJ2A 1N32B 4FZ1A 1L0LH 2CTWA 4KFMA 4OX9O 1PP9E 4UVCA 4R4LA 2ZDIC 2ZT9D 3S1KA 2PZSA 4L75A 1VIBA 1K4CC 1HNWB 3AG4B 4I9QA 2ZXWC 3JCZA 3R66A 4LR3A 1IFMA 1NTMG 1SQBH 4B86A 5AW8B 1EN4A 3P8CE 2E43A 1GK4A 1D5NA 4WBNB 3CXCU 2QKSA 1PIXA 1IFIA 5FLXN 3AK3A 2ZD9A 2RJZA 3ABMB 4AQYB 2NNUA 4EB6B 3CCRP 1Z2GA 3Q4HB 4J7JA 2BTQA 3AG7A 2D2CD 2AEJA 1Y9BA 3D8CA 5CCGD 5CHXA 4LF6B 2QM8A 4AI8A 3B5NC 3RK2C 1YTFD 5JJJB 3SYPA 2H3OA 2V7QJ 2O01H 5AVQB 2Q9IA 4X8AA 4LF4B 1MNGA 3CPWU 1Q6UA 2ZYAA 4UVBA 3M91A 2XZRA 1D5AA 2WLJA 1M9NA 4DW0A 4D6TG 2QKAA 4L74A 4LCUC 1N8RQ 2BEZF 3H1JH 3ZRWB 1K9MQ 2ZJSE 2WAMA 5EC1C 4O4HB 2KNCB 2YIBD 4X1IB 3TSIA 4EB6A 3ZHTA 2EJRA 3DSQA 3H01A 1AVOA 4DRXB 1R3IC 3RYCB 3Q1MA 5AW9B 3TGUD 4LF8O 3MUDC 3L70J 5CN0A 1NTKD 2UUBO 4C7UA 2J58A 3CSXA 3CCUP 1IFDA 1WNSA 3GWKC 4W7YA 4MTOA 3WG7B 3VMXA 5AVZB 4WCEV 3ZRWA 1VL2A 2HKOA 3UT5B 3H1IG 4FVMA 4CBCA 1RF0C 2MJZA 2N04A 4O4HA 2KNCA 1SF9A 2YIUC 1KORA 1N7SB 1S5LZ 3DGEA 4P9OA 1YJNV 3BCCD 1L0LK 1AI6A 2KSEA 3W68A 4UVAA 4DRXA 3CWBJ 2JEUA 3H1HD 3RYCA 3AE9C 2B5UA 3JAWB 1N8RW 1QU7A 1AJPA 3SPGA 2AHYA 3CCUV 2GUZB 1FKAO 2K3RA 2E5LB 2OYOA 4UCOA 4B08A 3C3TA 2F4VO 2EJ7A 2M0BA 2Y0EA 3L74J 2VRZA 3G71P 5EBLC 1OCZC 3K5NA 1EN5A 3B8EB 3BRCA 4DV2O 3N4XA 5CBHA 2GUSA 5B66E 4IL6Z 4JAUA 1NTMJ 2FXPA 5GTIH 4JPRA 4PI0A 2WSSH 3IC7A 4JI1B 1VF6A 4PELA 1FXVA 2ODMA 3EFGA 1MV8A 1M5IA 1N7SA 3BCCG 4FM2A 1FAFA 2E74C 1NO4A 3H1KH 3L9DA 1KB9I 3AE7C 4HH2A 4DV1O 1Y4MA 3CX5D 4K3AA 2DYSB 3JAWA 3JAKB 1X8YA 4X65B 2XHBA 4JI2O 1S9KE 2Y0PA 2H8PC 3H1LH 4JI8O 2QJ1A 3HD7B 3L75E 2GUZA 4XDJA 5KMGB 2HYNA 4IL6X 1COWG 2ZE7A 2DN9A 4X1KA 2IM9A 4LWSB 4OPAA 1Q90D 1N36B 2ZYDA 2A0LA 2AXCA 4D6TJ 2Q7GA 1VQOP 2PY5A 1N73C 1PNMA 3SJCC 3U0ZA 4L76A 2JVDA 3CXHD 2CTQA 2ZXXA 2EILB 5IJ0B 2BCCD 2DQ3A 1U97A 1JJ2U 2DMXA 1VARA 1VQ6P 3CRMA 1JM0A 2ITDC 5GTHE 3EHBB 1HNZB 1SQPK 3JAKA 4JI4O 2R72A 2QJKB 3HB3B 4ASUG 1NU1D 1R3JC 5FPOA 5KJ7D 1BCCD 4R4MA 1RF1B 5KMGA 1VQOV 1H89A 2QM4A 2W6JH 3AECC 3RK3E 1S5JA 5IJ9B 2L35A 3L37A 1Q7YQ 5AVXB 2QWNB 3WUVA 1ORQC 1NTKJ 4GDOA 4YXDC 2M6YA 4O2AB 3L72H 2Q69A 5LMNB 1QCEA 1EZVI 1JY2P 5GW7A 3OMAB 1VQ6V 2JO1A 5B1AC 1KB9E 3H1IJ 5IJ0A 1VMGA 4TSFG 1G1IA 4H0LC 1T2KD 4DR2O 1E1QG 3TXQA 3TXSA 2ZE8A 3GVMA 1PP9G 3CEIA 1FYJA 2WA3A 1NH4A 4Y99C 1OCRB 1O9HA 1KN7A 2LW1A 2R3SA 3V5BA 1RF1A 3AG4C 1DEEG 1RH5B 4FZ0A 5IJ9A 2OT5A 3TF5A 3VP8A 3WU2Z 1LT9C 2KSDA 4UCVA 1XNQB 2P7TC 3A8TA 1A02F 3D36A 3ABMC 4O2AA 1WP8A 3V4QA 1LR1A 1L0NE
chains in the Genus database with same CATH topology
1V55B 4RQEA 1JCHA 3E35A 2QA4V 3SPCA 1NH2B 4MS2A 1GM7A 1MG1A 4MVRA 4MT8A 1NKDA 2Q68A 2XAJA 5C93A 3LUTB 1NJIW 4I9WA 1PNKA 2DWEC 1JOYA 2LFSA 1KP3A 2EIKC 5EC2C 3JD3A 3ABUA 3K0DA 4CZZA 1VQNV 1K73W 3SPJA 3ZMSA 3OW2U 2A9HA 1ROPA 3E86A 1SESA 4HAMA 2ZXWB 1S77D 3IGAC 4RO2A 2PI5A 1SRYA 4H37A 4H33A 2ITCC 5DN6G 3OUFA 4J9YB 4UUJC 1H38A 3K08A 1I5YA 4XBFA 1RM1C 3CC4V 1V54C 2JK5C 1AI5A 3A0RA 3RBZA 4PDVA 4JASA 5LGNA 1AQTA 3CCSV 4LC1A 5KA5A 5CMUA 1QLNA 5L3FA 2WLMA 2IH1C 2OCCB 3SYCA 1EFRG 2XAGA 1VQ7V 3T4ZA 2CK3H 1P4RA 2ZDIA 3AG2B 3VOUA 2EIJC 3LNMB 2EIMB 4R7CA 1VQKV 1OCOC 3STLC 2IW5A 2X0LA 1W0KG 2P90A 3GB7C 3UKMA 4FMTA 3K79A 4X88A 4HZ3A 3SPIA 3OGCC 1XL4A 4DJGA 2IJHA 3PJSK 4N21A 3AG3C 3LDEA 3X2QC 1P7BA 3QO7A 4GX5A 2LFRA 3ABLB 4Z1MG 3JD4A 3ZMVA 2HVJC 4PDMA 2QM7A 1AJNA 4RUFA 1VQ4V 1MABG 3E8FA 4FK5C 3CC2V 1WPXA 4GX2A 5EBMC 2XAQA 3OAAG 3B77A 3ZRXA 4LBEC 1VQ8V 3MHSC 5L3CA 1BHBA 3OR6C 4MTFA 5B1OA 5BZBA 3ASOB 2OTLV 1S76D 4U7OA 2KB1A 4PDLA 4UV9A 3USSA 4QPKA 1R73A 2FTKA 2D3OW 2OTJV 4WFFA 2F43G 1H8HG 3VBBA 1KQSU 2GHYA 3R65A 3ZJZA 2WLKA 5B1NA 1K7DA 4BW5A 4F4LA 5LHGA 1S5HC 1AR1B 2Y69B 1YTFB 3QNEA 1M57B 2A79B 4I5SA 1ENVA 1GTOA 2HJFC 4J9ZB 4FIPC 3JYCA 5KA6A 5EBWC 1FFTB 5H6RA 2DYRC 4GX0A 1KKDA 1GM9A 3ABKC 3BY6A 1H2GA 3K0GA 3RVZA 4YXWG 3E8HA 2Z3YA 1OCZB 3B8NA 1LNQA 3CCRV 4TLFA 4N23A 3SPHA 4WFEA 3BEHA 1RPOA 3OUSA 1S3JA 2BOBC 3CCEV 2HLDG 3RW0A 1FS0E 3FB8C 1RM1B 2BOCC 1EBOA 2WPDG 1K33A 3ZRSA 2IH3C 3WFVA 1K5SA 2DQ0A 2ZR2A 4MVOA 2XASA 1NH2D 1NR7A 1OCCC 4PDRA 2ZQMA 3E83A 3ZRVA 3OE7G 2V7QG 1EZJA 4U7NA 5E1AC 1S0VA 3AEIA 1F51A 2HR3A 2X6BA 3P32A 4PA7A 1Q81W 1QR9A 4MVUA 1OZ0A 2EIJB 2LP7A 2R9RB 4WF9V 1PNLA 4MTXA 3P30A 4RQFA 2YEVB 3UM7A 2Q67A 1BMFG 1KECA 4JYBA 4QE9A 3JD0A 1Y66A 2HVKC 3AG1C 4JF3A 5KUKA 3AG3B 5CA3A 3X2QB 1W0JG 1UJWB 1CEZA 3ZIAG 2WWWA 4KP4A 4PA3A 1BSNA 2PI4A 2JEXA 3ZMUA 3ASNC 1K9MW 3KG2A 3QO5A 3FYIB 3SYQA 2C2AA 2IU3A 1JQ0A 1GMGA 1CPYA 2WLNA 4X89A 2QE7G 3CCMV 2UXNA 1QLEB 1DTOA 2NLJC 3STZC 2IJJA 1CP9A 3F7VC 3OEEG 3OMNB 1K34A 4XDKA 1YJ9V 2R9IA 3W7XA 2YSUB 3M99B 2YEVA 1FS0G 2AHZA 3F5WC 5H6QA 2XAFA 1MSWD 3WG7C 1M90W 3GWOA 1THZA 4WFAV 1V55C 2EZPA 1I5XA 3OM3B 2JIZG 3E8GA 5IDJA 3E89A 2ATKC 4QMAA 5B1AB 5CBFA 5CBGA 1YSCA 1VQPV 2QEXV 5LHHA 2K1EA 1GM8A 4XDLA 4MTGA 1Q86W 2B1GA 4GT1A 2WLLB 4Q20A 1JPXA 3G71V 2W0FC 1XL6A 1W2BU 4G28B 3LSSA 4KFMA 3ZMTA 4UVCA 3ABKB 1GO3F 3G6EV 1AI7A 5LGTA 2ZDIC 1AJQA 1R6NA 2IJKA 1DLBA 2HG5C 1FXHA 4BAYA 4HYOA 1M1KW 1K4CC 3AG4B 1VQMV 2ZXWC 3JCZA 3K3WA 4BIUA 3RVYA 1FXKB 1R3LC 3CXCU 2QKSA 1F4NA 2Q6AA 1R6KA 1QBZA 3OMIB 4BIZA 2ZD9A 3ABMB 3LDCA 3CCJV 2NNUA 1L1FA 4P9PA 2H94A 5KUMA 1HWYA 3W7WA 3NXSA 3W7UA 1YITV 1VQ9V 2QM8A 2WLLA 1DF5A 4YXWH 1NQTA 2EBOA 2OCCC 1SZTA 1YTFD 3SYPA 2DYSC 3ZMZA 2EIKB 3SYOA 1JX9A 4X8AA 4R50A 3CPWU 3LDDA 4UVBA 1BHAA 3TCUA 2EIMC 2WLJA 3OFNG 1M9NA 5HFMA 3CP1A 3DTUB 1FXKA 4LCUC 1M56C 4MVSA 4P2ZA 1JEKA 2HFEC 2IU0A 3ZRWB 2WAMA 5IYDO 5EC1C 1KC8W 2WLIB 2X6AA 3T4DA 4TT3G 2V7QH 2EZOA 1TUEB 2EILC 3ZCCA 2EJRA 1H8EG 3ABLC 3H01A 1PKXA 4WVZA 3I55V 1V54B 1R3IC 1OHHG 3CC7V 5IY5C 2WLHA 5DM6V 5CN0A 4DXWA 3OEHG 3B8MA 1GKFA 4GCZA 1SETA 4RAIA 1YHQV 3ASOC 1Q82W 3OR7C 1SERA 3TETA 1GK9A 4UV8A 5H9CA 5B1BC 1IXMA 3CCLV 4WFBV 4MTOA 1OCOB 3WG7B 3EFFK 4WCEV 3ML0A 3ZRWA 2HKOA 1PL0A 4FPPA 1RPRA 4WFHA 4CBCA 3CCVV 2WLIA 3FB5C 1QVFU 1Q7YW 3DGEA 4P9OA 2Y69C 1YJNV 2JJ1G 1QVGU 5L3DA 3T2MA 1M57C 3CCQV 1AI6A 4JTDB 5B3SC 4UVAA 2EINC 1KD1W 2JEUA 2QE7H 2B5UA 2B1IA 4PA4A 5IYBO 1YJWV 4PA9A 1N8RW 4ZKIA 5FL7G 1AJPA 3SPGA 1AI4A 1E1RG 2AHYA 3FKSG 2P67A 4MVZA 3CCUV 1OCRC 2M7WA 2E5TA 4JGSA 1BL8A 1K97A 4MW3A 2IJIA 2XOKG 4WFGA 2W6IG 2GSMB 1OCZC 5EBLC 4R8CA 3CMAV 5CBHA 3FB6C 3W7SA 1BSHA 1QR8A 3CYOA 4JAUA 4JPRA 1K8AW 4JYCA 2WSSH 2X6CA 3IC7A 2JDIH 1B6QA 4JTCB 5L3GA 4PELA 1FXVA 4MSWC 4QE7A 3T1CA 4QNHB 5LGUA 4GX1A 2P6JA 2WSSG 4QPJA 2JDIG 3F7YC 1Y4MA 4G27B 4ZBMA 2Z5UA 2DYSB 1ZWIC 3K06A 4TWKA 3MHHC 2H8PC 4EKWA 3K9AA 2DW4A 2DYRB 4XDJA 4P30A 3ETDA 5EK0A 3ZN1A 1COWG 3TK1A 2E5YA 3FYEB 1NR1A 3JD2A 1G4YB 1M56B 2A0LA 3I56V 1R3KC 2CK3G 1PNMA 3ZN0A 4R6ZA 5L3EA 1VQ5V 1K92A 4JAVA 4UXNA 3ETEA 2EILB 3E8BA 3CMEV 1VQLV 2DQ3A 3QO8A 1JJ2U 3HPLC 3G4SV 5IY5B 2DWDC 2UXXA 2ITDC 5HFLA 5J9PC 3EHBB 1OCCB 4RUEA 2MK3A 2V1DA 3HB3B 4ASUG 1J95A 1R3JC 1AROP 1F23A 1QLEC 5LBQA 3JD1A 1VQOV 3MD0A 3SYAA 2W6JH 3LSQA 1JVMA 1YI2V 3AG2C 1K5QA 5B1BB 1ORQC 3SJQC 4DO2A 2XNDH 1E79H 1IFPA 1NBMG 4JTAB 2ZR3A 1DF4A 2Q69A 1QCEA 2W6JG 3FB7C 3K03A 3OMAB 2X7RB 4FJCC 5GW7A 3AG1B 1VQ6V 5B1AC 1F4MA 1NVPB 4KUMA 3ETGA 2XNDG 1E79G 4G2KA 4TSFG 1NVPD 4MVQA 5B3SB 2EINB 2XAHA 1K3EA 1PD3A 1E1QG 1KP2A 1YIJV 1S72V 4OXSA 3ABTA 4LP8A 3ASNB 3K04A 1OCRB 1K4DC 4MW8A 4QJFB 4QIWF 5L3BA 1MOFA 3AG4C 4PA6A 2Y48A 2QTOA 4L87A 3IFXA 2OT5A 1FXKC 5LHIA 3CD6V 4E2LA 5IYCO 3W7TA 3D3IA 2JJ2G 2P7TC 1G8MA 3D36A 3ABMC 3E2EA 1WLEA 4MVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBH A;  3FB6 C;  2A79 B;  1BSH A;  2HJF C;  4J9Z B;  2HG5 C;  3SPC A;  4HYO A;  4MS2 A;  1K4C C;  3JYC A;  2ZXW C;  4MVR A;  2WSS H;  5EBW C;  2X6C A;  2JDI H;  3RVY A;  2Q68 A;  2DYR C;  4GX0 A;  4JTC B;  1KKD A;  3ABK C;  3RVZ A;  3K0G A;  3LUT B;  4I9W A;  4MSW C;  1R3L C;  2DWE C;  2QKS A;  3E8H A;  2Q6A A;  2EIK C;  4QE7 A;  2ZD9 A;  5EC2 C;  3K0D A;  3T1C A;  3LDC A;  4QNH B;  1LNQ A;  4GX1 A;  4TLF A;  4P9P A;  3SPJ A;  3SPH A;  3F7Y C;  4WFE A;  3BEH A;  5KUM A;  2A9H A;  3OUS A;  4G27 B;  3E86 A;  4ZBM A;  3K06 A;  1ZWI C;  4TWK A;  2BOB C;  2H8P C;  3RW0 A;  4EKW A;  1FS0 E;  3FB8 C;  4XDJ A;  2BOC C;  4P30 A;  5EK0 A;  2WLL A;  4YXW H;  3IGA C;  2IH3 C;  3ZRS A;  2OCC C;  4RO2 A;  4H37 A;  4H33 A;  2E5Y A;  2ITC C;  3SYP A;  2DYS C;  3OUF A;  4J9Y B;  4MVO A;  4UUJ C;  1G4Y B;  3K08 A;  3SYO A;  4X8A A;  1OCC C;  2A0L A;  4PDR A;  3E83 A;  4R50 A;  1R3K C;  3LDD A;  5E1A C;  3TCU A;  2X6B A;  2EIM C;  2WLJ A;  4PA7 A;  1V54 C;  2JK5 C;  3RBZ A;  4PDV A;  4R6Z A;  1AQT A;  4LCU C;  1M56 C;  4MVS A;  4MVU A;  4P2Z A;  3E8B A;  1JEK A;  2HFE C;  2R9R B;  2WLM A;  2IH1 C;  3SYC A;  5EC1 C;  3HPL C;  2WLI B;  2X6A A;  3T4D A;  2DWD C;  3UM7 A;  2Q67 A;  2ITD C;  2V7Q H;  5J9P C;  3T4Z A;  2CK3 H;  2EIL C;  3ABL C;  4QE9 A;  2EIJ C;  4RUE A;  3VOU A;  4WVZ A;  3LNM B;  5KUK A;  2HVK C;  3AG1 C;  1J95 A;  1R3J C;  4R7C A;  1QLE C;  1R3I C;  1OCO C;  3STL C;  5IY5 C;  3UKM A;  2WLH A;  3GB7 C;  3SYA A;  2W6J H;  1JVM A;  4DXW A;  3AG2 C;  4X88 A;  4HZ3 A;  4PA3 A;  1BSN A;  1ORQ C;  3SJQ C;  3SPI A;  3OGC C;  1XL4 A;  4RAI A;  1E79 H;  1IFP A;  2XND H;  4DJG A;  3PJS K;  3AG3 C;  3ASN C;  3ASO C;  3KG2 A;  4JTA B;  3LDE A;  3SYQ A;  3X2Q C;  3OR7 C;  1P7B A;  2Q69 A;  4GX5 A;  3TET A;  3FB7 C;  3K03 A;  2HVJ C;  2WLN A;  4PDM A;  4X89 A;  5B1B C;  5B1A C;  4MTO A;  2NLJ C;  3STZ C;  3EFF K;  3F7V C;  4RUF A;  4XDK A;  3E8F A;  4MVQ A;  4GX2 A;  4WFH A;  2YEV A;  5EBM C;  4CBC A;  2AHZ A;  2WLI A;  4LBE C;  3FB5 C;  3F5W C;  4OXS A;  4P9O A;  2Y69 C;  3OR6 C;  3WG7 C;  4MTF A;  4LP8 A;  3T2M A;  5BZB A;  3K04 A;  1M57 C;  1V55 C;  4JTD B;  1K4D C;  4MW8 A;  5B3S C;  2EIN C;  2QE7 H;  2KB1 A;  3E8G A;  3E89 A;  2ATK C;  3AG4 C;  4PA4 A;  4PA6 A;  2QTO A;  4PDL A;  5CBF A;  5CBG A;  4QMA A;  4PA9 A;  3USS A;  3IFX A;  2K1E A;  3SPG A;  4WFF A;  2AHY A;  4XDL A;  4MTG A;  4MVZ A;  1OCR C;  2E5T A;  3R65 A;  2WLL B;  1BL8 A;  2WLK A;  3ZJZ A;  4BW5 A;  4F4L A;  2P7T C;  4MW3 A;  2W0F C;  1XL6 A;  4G28 B;  3ABM C;  4KFM A;  1S5H C;  4WFG A;  5EBL C;  1OCZ C;  4R8C A;  4MVM A; 
#chains in the Genus database with same CATH topology
 3IC9 A;  4RQE A;  4O2B B;  4I7Z B;  2VQE O;  2QA4 V;  3E1R A;  4MS2 A;  2V4H A;  1MG1 A;  4MVR A;  3ZDM A;  3G67 A;  1JCD A;  5FPR A;  1KYO D;  2OYH B;  4WY4 D;  2P4K A;  5C93 A;  3BCC J;  5KLV E;  1G6U A;  4LF5 B;  3BVH A;  3AEG C;  4CZZ A;  5EC2 C;  1U96 A;  4GOF A;  4FLV A;  1ZAU A;  5TIS Z;  1KQL A;  1SES A;  1J1E C;  1JY2 N;  1VQ7 P;  3E1I A;  3A5T A;  2P7J A;  2PI5 A;  4H37 A;  2GA1 A;  2ITC C;  2K37 A;  1WA8 B;  1ZRT D;  3NTN A;  2Q6Q A;  1HGZ A;  5AVV B;  4O2B A;  1KTM A;  4WB4 A;  2ZNI A;  1HNX B;  1WJZ A;  1AI5 A;  3A0R A;  4KL1 A;  4PDV A;  4EFE A;  1U57 A;  2OYH A;  1ZV8 A;  5CBO A;  3D71 A;  1VQ5 P;  3EVK A;  2E42 A;  5CMU A;  1KIL E;  5L3F A;  2OQQ A;  3SYC A;  1I94 B;  3B5N D;  2C0X A;  4PJ0 H;  1URQ B;  3RK2 D;  1VQ7 V;  4ICG A;  2CK3 H;  1P49 A;  3AG2 B;  1L4A C;  1LTJ B;  1ZXG A;  2EIM B;  3RBX A;  3M9H A;  4AIL C;  4AQR D;  4Z1M H;  3PLN A;  4X88 A;  1WA8 A;  4HZ3 A;  1SQV H;  1YI2 P;  4H13 C;  3OGC C;  1XL4 A;  1WAZ A;  4JI3 B;  1N7S C;  4N21 A;  4HJG H;  3KKY A;  3BPZ A;  3HTK A;  4GX5 A;  3ABL B;  3JD4 A;  4O4J B;  4GKK B;  4FLU A;  4PDM A;  4FLZ A;  4OGQ B;  2P1J A;  3A7O A;  2Y0C A;  2KLU A;  1AJN A;  3OJA B;  4I6M C;  2E75 D;  1MAB G;  4FK5 C;  4NPF X;  1PP9 J;  1L0L D;  3VOP A;  2A06 H;  4GX2 A;  1URQ A;  2H7H A;  4X1Y A;  3MHS C;  4C7R A;  3BRV B;  3S9O A;  1KU9 A;  1LTJ A;  1CXZ B;  4TV9 B;  3L73 H;  1UIX A;  1SQB D;  4LFB O;  3L71 H;  2WA4 A;  4X9Q A;  4DR4 B;  2KOG A;  2FTK A;  3QVN A;  2GM4 A;  3IF4 A;  1H8H G;  3VBB A;  5CCH A;  2GHY A;  5AW5 B;  5M1B A;  3T1Y B;  1XDC A;  5JJN B;  3Q2Y A;  3ZHQ A;  3MTU E;  4O4J A;  2A79 B;  2HJF C;  3E22 B;  2WZ7 A;  1XMQ O;  5KA6 A;  1N33 B;  5AW6 B;  3L75 G;  1FFT B;  2BTO A;  1T8Z A;  4GX0 A;  1KKD A;  1PGP A;  3RVZ A;  1H2G A;  2B9B A;  2RMK B;  4W80 A;  1FDI A;  1K05 A;  2RNB A;  2I1K A;  3LID A;  2LXB A;  4X62 B;  1JB0 J;  3OA7 A;  4TV9 A;  4I4T B;  2ILM A;  3VQW A;  1WT6 A;  1BGY H;  3BEH A;  1NI8 A;  3GHG B;  4YHH B;  3H1J D;  2BOB C;  1MKM A;  1FS0 E;  2KZI A;  2WSE H;  2BOC C;  4X64 O;  2WPD G;  2PFX A;  1WN7 A;  4N78 E;  4FLY A;  1TA8 A;  5JVD B;  4KHP B;  1P84 H;  3OE7 G;  3E22 A;  3CL3 D;  3CWB E;  1EZJ A;  1G2C B;  1S0V A;  1PPJ H;  3PN1 A;  2HR3 A;  2X6B A;  3ZHV A;  4PD4 I;  3TYY A;  2F23 A;  3H25 A;  1TAE A;  1OVR A;  2FFD B;  1XNR B;  3CLQ A;  2GV9 A;  1IK9 A;  2H8P D;  2EIJ B;  4IYH A;  1SQQ E;  3L74 E;  4I4T A;  3S3W A;  1SQV K;  3D36 C;  1Q6H A;  1BDD A;  1NTM E;  4QE9 A;  1SQP G;  2OAR A;  2HVK C;  3TJT A;  4F6R B;  3JCU H;  1XMO B;  3VMA A;  3AG3 B;  2L6L A;  3X2Q B;  2JEE A;  3ZIA G;  3HR0 A;  3RN4 A;  5CA0 B;  5JVD A;  1ZTE A;  2JEX A;  4JF7 A;  3IR9 A;  5AW2 B;  4A7P A;  3KG2 A;  2FXM A;  1G2C A;  2XU6 A;  4H44 C;  1Q2N A;  2IU3 A;  1FFX B;  1Q6I A;  1GMG A;  5KAF E;  2WLN A;  4X89 A;  2UXN A;  5BR8 O;  2IJJ A;  2Z0A A;  1K34 A;  5APV A;  3G6E P;  4CH6 A;  2YSU B;  3LW5 J;  1L0L J;  2AHZ A;  5E79 H;  3V2Q A;  2G8Y A;  1XOU A;  4TOI A;  2J5U A;  4J10 A;  4D6T E;  1THZ A;  2ETN A;  3WB2 A;  4I7Z C;  4F6R A;  2OTL P;  5GTH Z;  1NWQ A;  2SPZ A;  2ATK C;  4QMA A;  3JSL A;  3QF7 A;  2KI7 B;  5H5N A;  1VDF A;  2BCC H;  2FYU D;  2OYH C;  3THO A;  4PD4 E;  4DOJ A;  4MTG A;  4XA4 A;  3CCJ P;  2QJP B;  4DR7 B;  2OTJ P;  4GT1 A;  5CA0 A;  2WLL B;  1VF5 D;  3H1K D;  1JPX A;  3I5C A;  4H0L D;  2W0F C;  1XL6 A;  4C7N B;  3LSS A;  3WU2 H;  1IDS A;  5EFW B;  4NXN O;  3L35 A;  4HBN A;  3ABK B;  3G6E V;  1FFX A;  1AI7 A;  5LGT A;  1VQ9 P;  3L75 J;  3H1L D;  1R6N A;  4JBZ A;  1DLB A;  1BCC H;  1FXH A;  2HG5 C;  5BY1 A;  4AYC A;  2WSC H;  4BWN A;  3K3W A;  4BIU A;  2JKV A;  3RVY A;  1OW6 A;  1VEW A;  3TGU E;  1WB8 A;  1FXK B;  4DV4 O;  2O01 J;  1NTK E;  3HUS C;  2UXB B;  1X59 A;  1Z5V A;  1R6K A;  2Q6A A;  1M93 A;  1GZL A;  1MSD A;  3CX5 I;  3CCJ V;  3KPE A;  3AE6 C;  4P9P A;  4U7J A;  2H94 A;  1FZF A;  4PV1 C;  4IHJ B;  1EQ7 A;  3H1I E;  1HW7 A;  2HOD B;  2W8Z A;  5TIS H;  2CGO A;  3HKB B;  2OCH A;  1VQ9 V;  2WLL A;  4YXW H;  1J2J B;  5H2F E;  4UB8 H;  2C9N Y;  3ZMZ A;  5BXZ A;  2N9B A;  1JX9 A;  2YXH A;  4J41 A;  2CPS A;  3A0H H;  3LDD A;  2NPS C;  1LTJ C;  2RKL A;  1B06 A;  1NAF A;  3VQY A;  4TT3 H;  2EIM C;  2HPC B;  3OFN G;  1OVV A;  2Z5H A;  1ZR2 A;  3DTU B;  1TU3 F;  1FXK A;  3CE2 A;  1IUR A;  1M56 C;  1NKN A;  3L4F A;  1BE3 D;  5LL6 Y;  2DJV A;  3L72 D;  2Y9Z A;  4K0K O;  4LF9 O;  2X6A A;  3T4D A;  1N7L A;  1RQU A;  1SQP J;  4KHX A;  5AVW B;  3QTC A;  1XIL A;  5F2V O;  3ZCC A;  1H8E G;  3ABL C;  3A2F A;  1MUU A;  1PKX A;  3WMM 0;  4IHJ A;  1XI1 A;  4WVZ A;  1GW4 A;  1A02 J;  2IDB A;  2VQF B;  2O01 N;  4IIJ B;  2HOD A;  4IFF A;  5IY5 C;  3HKB A;  2ZE5 A;  3BCC E;  1P84 F;  1JJO A;  5DM6 V;  4JI5 O;  4DXW A;  3M7M X;  3OEH G;  2ZAE B;  2XKM A;  1SA0 A;  1GKF A;  4JI6 B;  1PGQ A;  1SET A;  3HRN A;  1OMI A;  1BZK A;  3WUT A;  3HKC B;  2AZ0 A;  2G38 A;  1SER A;  2HPC A;  1J1D B;  1GK9 A;  1IBM B;  5H9C A;  5B1B C;  3CX5 E;  3I5D A;  1Q86 Q;  1L4A D;  1IXM A;  3CCL V;  3BAB A;  4WFB V;  5J2T B;  1OXZ A;  1OCO B;  4DT0 A;  5KHI A;  4U3F H;  3CCM P;  3S3X A;  1PL0 A;  4FPP A;  5IE9 A;  4DW1 A;  3ZHS A;  1DEB A;  4BXL A;  4H13 D;  2UXD O;  1XRE A;  1N7S D;  3CCQ V;  3JAL B;  4ZOL B;  3HE5 B;  1KD1 W;  1HUC A;  1HTL C;  2QE7 H;  1ZME C;  5K1X A;  5J2U B;  5AW3 B;  1FBM A;  4HB1 A;  2CAZ C;  3GMA A;  1HBW A;  1SZX A;  1ZUQ A;  2M7W A;  1OWA A;  4YY3 B;  2AXT E;  1BL8 A;  3APO A;  2LR2 A;  4DR5 O;  3P8M C;  3HKC A;  2W6I G;  1D2D A;  4JYA B;  4B3S O;  1BSH A;  1QR8 A;  3CYO A;  1FOS F;  1H2M A;  5J2T A;  5B5E E;  3FGA D;  3T1H B;  4DV6 B;  2KZJ A;  4D7T A;  2JDI H;  3A3Y B;  1B6Q A;  1WB7 A;  3BAA A;  4JTC B;  4K8X A;  2Z5I A;  3A0B H;  3D6Z A;  3I56 P;  2IX7 C;  1SQX G;  2VS0 A;  2CH7 B;  4GKG A;  3T1C A;  2YXL A;  3FFQ A;  3JAL A;  3VQV A;  2P6J A;  2KYV A;  3CME P;  3F7Y C;  4ASW A;  5J2U A;  3FXD A;  1ZWI C;  2XTA A;  4X66 O;  3K9A A;  5KKZ B;  3H6P A;  4NKG B;  3ETD A;  1SQQ G;  4JZ2 A;  3L74 G;  3TK1 A;  2XDJ A;  4GZR B;  2E5Y A;  3JD2 A;  4UCT A;  2N1T C;  1MZF A;  3I56 V;  1RE4 A;  2HJD A;  2CK3 G;  3Q5S A;  2J59 M;  2IPP A;  1KBH A;  2CTR A;  1LT1 A;  3D6Y A;  1K92 A;  1SQV D;  1KUQ A;  5LXT A;  3CME V;  2WSF H;  4N6J A;  5B66 H;  3BA9 A;  1FC2 C;  3C90 A;  1LJ2 A;  2UXX A;  5HFL A;  1CZQ A;  2IBZ D;  3QH9 A;  5J9P C;  1UFI A;  2MK3 A;  2RDC A;  1NYH A;  4GKJ B;  1FDM A;  2V1D A;  3Q5P A;  1ARO P;  2YDE A;  3TNU B;  1HF9 A;  2A06 D;  3MD0 A;  4KXR A;  5AW0 B;  3AED C;  2IZ0 A;  1FZG A;  2JP3 A;  4DV2 B;  1ZP0 C;  1IFP A;  1KIL B;  3L73 D;  5BU5 A;  2F66 C;  1GU5 A;  4JI0 B;  2QJY B;  3L71 D;  4JTA B;  4WBN A;  2KS1 B;  3FB7 C;  2R9A A;  2X7R B;  1BSM A;  2P2U A;  1E5W A;  1AJY A;  1Z5W A;  4KUM A;  5CJ0 A;  4JI7 O;  2XND G;  1E79 G;  4G2K A;  5APX A;  4MVQ A;  5B3S B;  2EIN B;  3AE2 C;  1I0H A;  4B3R B;  2XAH A;  3UCS C;  3Q4H A;  1KYO F;  4AHC A;  3ABT A;  4LP8 A;  1RFY A;  1YJN P;  4MW8 A;  4E4E A;  1WMK A;  2I1J A;  4IYI A;  3AEB C;  4H44 D;  3TNU A;  1AVM A;  4IT5 A;  1SC5 B;  3TGU G;  3AK2 A;  2ZIO A;  2QIW A;  3CD6 V;  1FXK C;  4E2L A;  5GTH H;  1NTK G;  3NMD A;  1VQN P;  5AVY B;  4C46 A;  1KIL A;  1BGY D;  3II6 A;  1LTG C;  4MVM A;  1HWT C;  1KZU B;  2KS1 A;  3KCY A;  3E35 A;  1IBL B;  2KSJ A;  3PH0 A;  2OYI B;  3CJH B;  4CC5 A;  3CI9 A;  2JGU A;  5LMU B;  4X1I A;  1SFC B;  1NKD A;  2XAJ A;  1SQX J;  5KAF Z;  1N32 O;  3RL0 B;  3LUT B;  1FJG B;  1JOY A;  1FE6 A;  1P84 D;  5AVU B;  1KP3 A;  2ZM6 B;  3ABU A;  3K0D A;  1PPJ D;  3CCS P;  1HNW O;  4DR3 O;  1HR0 O;  1VQN V;  3H1H G;  4AUW A;  1SQB K;  4LFC B;  1M8O B;  2Q0O C;  2W0X A;  1SQQ J;  4HAM A;  2HG5 D;  4DV7 B;  2A45 G;  2Q1K A;  1L0L E;  4RO2 A;  4AQY O;  1DX7 A;  1SRY A;  4H33 A;  1IXB A;  5EIB C;  5DN6 G;  1YQ3 C;  1H38 A;  2QSI A;  1KMI Z;  1L2P A;  1I5Y A;  1RM1 C;  2OYI A;  2PGG A;  3CJH A;  3UT5 A;  1N2D C;  4B3T B;  5CB4 B;  2FYU H;  2JK5 C;  3RBZ A;  2AGA A;  4LF6 O;  1GN2 A;  4JAS A;  5LGN A;  4PV1 D;  3CCS V;  4UB6 H;  1S2E A;  3FXE A;  2RMZ A;  1PL5 A;  3PHL A;  1KV4 A;  1L0N H;  1QLN A;  2DW3 A;  4LF4 O;  1EFR G;  3IFM A;  2F93 B;  1J1D C;  3CC2 P;  4M3L A;  3PRJ A;  4EIJ A;  2NPS D;  4DUY B;  4R7C A;  1OCO C;  3BHP A;  3OAK A;  3ZHU A;  3CRA A;  2LXC B;  1M56 D;  3K79 A;  2E76 C;  3RK3 C;  1I7F A;  2YID A;  3SPI A;  4DJG A;  1H2N A;  3PJS K;  5H2F Z;  4DK1 A;  1OJH A;  1QL1 A;  1P7B A;  1EZV H;  2LFR A;  2HVJ C;  4K8Z A;  1KKC A;  2F1M A;  2QWR B;  1IBK B;  3CC2 V;  2BCC G;  2DE0 X;  1NS1 A;  5EBM C;  3C1L A;  1NKZ B;  5APT A;  2HEP A;  1O9G A;  5EYP B;  3HD7 A;  4MTF A;  1S76 D;  3AEF C;  1EM1 A;  3TGU J;  2RN0 A;  1W2E A;  1NU1 G;  2FBW C;  2RN9 A;  1TUB B;  1BCC G;  4LWS A;  1RE3 A;  1BE3 H;  3USS A;  4ZIB A;  4WFF A;  1NTZ D;  1ZW0 A;  4NPE A;  1VF7 A;  4RKU J;  3FX7 A;  3ZJZ A;  2GTA A;  5B1N A;  2KXP B;  4BW5 A;  4F4L A;  1SQP E;  2YKP A;  4Y28 J;  2UUA B;  5LHG A;  5LYJ B;  2Q7C A;  1YTF B;  1BGY J;  1ENV A;  4DV3 B;  3R2P A;  4ZHQ B;  2QA4 P;  4CS2 A;  1OV9 A;  2E5L O;  5KKZ C;  3LSU A;  5AVR B;  4DR1 B;  1IC2 A;  1GM9 A;  3SJB C;  3SFD C;  4YXW G;  5EYP A;  3J81 N;  2XV5 A;  3H1H J;  1MZ9 A;  2Z3Y A;  3B8N A;  3PP5 A;  4TLF A;  4N23 A;  1SVF A;  2R5D A;  4CC6 A;  1R5L A;  1RPO A;  4JI1 O;  1TUB A;  2E3C A;  1J5E B;  2P10 A;  1S3J A;  3CCE V;  2FYU K;  3VP9 A;  3HKD B;  3G80 A;  1EDK A;  2IH3 C;  2JS3 A;  3KZI E;  4YIP A;  5LYJ A;  2ZR2 A;  4DV5 B;  1L0N K;  1QX8 A;  3M0A A;  2AXT Z;  1W2B O;  2YXR B;  1NH2 D;  5GTI E;  4X65 O;  4JZG A;  3BVO A;  4NXM B;  1LTT C;  1M90 Q;  4GIF A;  3ICX A;  4DV0 B;  1PGO A;  1F51 A;  4OVN F;  1NZ6 A;  3EQ2 A;  3KYQ A;  1X22 A;  5JQG B;  1QR9 A;  2LP7 A;  1FZE A;  5B5E Z;  4WF9 V;  5AW1 B;  1N36 O;  3NFQ A;  1ZOY C;  2GTS A;  3P30 A;  2JS5 A;  1JCC A;  1KIL C;  4FM1 A;  3UM7 A;  2Q67 A;  2QJY C;  2AEF A;  4JYB A;  3G6B A;  2YIB A;  2A3Q A;  3L70 H;  1G1X B;  2ZCE A;  2N1T D;  3SWK A;  4ASV A;  3H1L E;  4U3F D;  1Y66 A;  3JAR B;  4BRY B;  3HE4 B;  3HKD A;  2BE3 A;  2P4V A;  1XTC C;  2WWW A;  4KP4 A;  1AR4 A;  3L36 A;  5KX5 B;  1HNZ O;  4B3M B;  2PI4 A;  3RT3 C;  3ZMU A;  3SYQ A;  3RGU A;  3P3P A;  2WT7 B;  1H2K A;  1JQ0 A;  1PV0 A;  1AB3 A;  3APQ A;  2QE7 G;  2BCC J;  2Q0A A;  3JSN A;  3N7N A;  5JQG A;  2YO3 A;  3STZ C;  1N0N A;  4XDK A;  1YJ9 V;  5AVS B;  5KAI E;  3W7X A;  3M99 B;  4TQD A;  5LMN O;  1YBK A;  3U10 A;  3WG7 C;  3B40 A;  1NU1 J;  1M90 W;  2YC0 A;  2EZP A;  1BCC J;  1VF6 C;  1PGJ A;  3JAR A;  3OM3 B;  1SLQ A;  4BRY A;  3E8G A;  5IDJ A;  3HE4 A;  1OX3 A;  3O8Z A;  3SWY A;  5CBG A;  3KDP B;  1RP3 B;  2K1E A;  3RL0 C;  1DIP A;  1DD4 A;  5KX5 A;  2YS8 A;  4DUZ B;  1NTM H;  2IBZ H;  3L72 E;  3TDK A;  1W2B U;  4G28 B;  3ZMT A;  1KC8 Q;  2PUS A;  3M06 A;  1GO3 F;  2WT7 A;  4EDF A;  1PM9 A;  2HHH B;  4BW9 A;  5KTB A;  1XNQ O;  1L0L G;  5LA6 B;  2OWO A;  1F4N A;  4BIZ A;  1S5L H;  1QBZ A;  3OMI B;  3GG2 A;  1QVF O;  4O4I B;  2OIG A;  1ZLZ A;  2QKC A;  2PF4 E;  2WPQ A;  2FY8 A;  1SQB G;  1N34 B;  2UXC B;  1HWY A;  3W7W A;  4L8J A;  5K5G B;  3W7U A;  5IWA B;  1YIT V;  4LF5 O;  4JAA A;  2FB5 A;  2PYL A;  2XT9 A;  1XUQ A;  1ZLL A;  2EBO A;  2RQ6 A;  4D7S A;  2DYS C;  2EIK B;  4MN4 C;  3CC7 P;  2ARH A;  3HD7 C;  1NHL A;  4R50 A;  4LF7 B;  4IL6 H;  3C3S A;  3TCU A;  1FDO A;  5HFM A;  1RE3 C;  1JEK A;  2WIT A;  2HFE C;  5GON B;  5LA6 A;  1H0T B;  4I55 B;  1S9K D;  4JV5 B;  3UO3 A;  4O4I A;  1LTA C;  4JQ0 D;  2GBO A;  1KC8 W;  5C39 A;  5EIB D;  1HNX O;  1TUE B;  2EIL C;  2MW2 B;  3AE1 C;  1X4T A;  3CCV P;  3H1J G;  1V54 B;  4U3F J;  3KHU A;  1OHH G;  3CC7 V;  1SQX E;  3RL0 g;  1I94 O;  5D5Q A;  3AE3 C;  2R5B A;  2YKO A;  2E74 D;  4FLT A;  1SKV A;  1GAX A;  2QJK C;  2ZYG A;  3P3N A;  1RF1 C;  3OTO B;  1YJW P;  2P58 A;  2K9P A;  1Q82 W;  2CUG A;  3OR7 C;  3Q5R A;  3TET A;  1IO4 A;  4UV8 A;  1GRJ A;  2P06 A;  3JAT B;  1SQG A;  2UUC B;  5AW7 B;  3ML0 A;  4PJ0 E;  4JI3 O;  1H0T A;  4I55 A;  3RYF B;  3CMA P;  4WFH A;  3CCV V;  3GHG A;  4WY4 B;  3FB5 C;  1QVF U;  2E76 D;  4GKK O;  3RK3 D;  4K35 A;  3T2M A;  2ADQ B;  1OW8 A;  1W59 A;  1RSO B;  2QWP B;  1LTB C;  2ZIM A;  2QGN A;  2Q4P A;  2B1I A;  2O3J A;  1YJW V;  4PA9 A;  4ZKI A;  1KQG B;  2BEQ D;  5FL7 G;  2KIK A;  1USD A;  1E1R G;  4MVZ A;  2QG4 A;  1OCR C;  2WPR A;  2E5T A;  1EN6 A;  4JGS A;  3M9B A;  1KB9 D;  3CRC A;  4MW3 A;  3R4Y A;  2AZ2 A;  1BDC A;  4WFG A;  2XOK G;  1WRG A;  2GSM B;  2K1A A;  2FFD A;  4R8C A;  3CMA V;  1JFF B;  3FB6 C;  4DR4 O;  3W7S A;  3JAT A;  1K8A W;  4ZNC A;  2X6C A;  3RWR D;  4GOE A;  3RYF A;  4O9B A;  2WPS A;  1X0T A;  3N2G B;  3T1Y O;  2UU9 B;  1JOC A;  4QE7 A;  1SQB J;  2A45 I;  3L73 E;  1TGO A;  1RSO A;  3B5N B;  3L71 E;  1VQL P;  3RK2 B;  2WSS G;  1N33 O;  4QPJ A;  1PZQ A;  2ZE6 A;  3SGI A;  1NOH A;  3MDS A;  3C9I A;  3K06 A;  2JJL A;  5JCO A;  3K58 A;  4TWK A;  1L0N D;  2FYU G;  3MHH C;  3K5M A;  4EKW A;  2Q3I A;  2WSF J;  5JJE B;  4LFA B;  2Q73 A;  4X62 O;  3ZN1 A;  3H1K G;  1JY3 P;  3FYE B;  1NR1 A;  5AVT B;  1JUN A;  2QR4 A;  5KLV D;  1JFF A;  3JAM N;  4YHH O;  3H1L G;  1JO5 A;  3ZS8 C;  3ZN0 A;  2AXT H;  1WPB A;  5KHK A;  1NTZ H;  5L3E A;  4A5U B;  1LUV A;  1VQL V;  3ETE A;  1N86 A;  3N2G A;  3CRR A;  1MMM A;  2B87 B;  5BU8 B;  4KHP O;  2QTS A;  2E75 B;  4HKZ H;  1EZV D;  1SS1 A;  5CMZ A;  2DWD C;  1BGY E;  3EXA A;  1USE A;  1OCC B;  3H1J J;  2XUM A;  4QGP A;  2Y4U A;  4RUE A;  4W7Z A;  2Y0I A;  1XNR O;  1J95 A;  2KG7 B;  1YIJ P;  4NTX A;  1URQ C;  4C7N A;  3JD1 A;  4J80 A;  4HYT B;  1FJP A;  2RCV A;  3AG2 C;  1BQ0 A;  1OIP A;  1XTG B;  3D3Q A;  4DO2 A;  2IYO A;  2L91 A;  4LNU B;  1P84 E;  3CXH I;  3H1H E;  1Q8I A;  1KD1 Q;  1KIL D;  1NGM B;  3H32 B;  2ZR3 A;  3KZI Z;  1XMO O;  1PP9 H;  1K73 Q;  2W6J G;  3B71 A;  5GTI Z;  3AG1 B;  2YIU B;  5CCH C;  1NVP B;  2IFM A;  4OPH A;  3CCL P;  3O9O A;  2B87 A;  1BE3 G;  1HGV A;  1HVV A;  2Q5Z A;  4DR6 B;  1FJK A;  3AK1 A;  1YIJ V;  3L72 G;  1GMJ A;  5IYZ B;  3BRT B;  4OGQ C;  4OXS A;  2JRI A;  2W27 A;  1IZ3 A;  2NRG A;  2FL4 A;  1R6T A;  2KP8 A;  3JCU E;  4OX9 B;  2KG7 A;  3CCQ P;  4QJF B;  4QIW F;  5L3B A;  4PA6 A;  2Y48 A;  2QTO A;  4L87 A;  1GL2 B;  4B7E A;  5APQ A;  3IFX A;  2P5O A;  1BS3 A;  1XQ8 A;  3D3I A;  4LNU A;  2JJ2 G;  1LTS C;  2HLO A;  3G9R A;  3OT7 A;  2Z4E A;  4RWU A;  3H32 A;  5LP6 B;  1RF0 A;  2YO2 A;  3RYI B;  1GN3 A;  2R44 A;  3SPC A;  3OD4 A;  1GM7 A;  4L73 A;  2BAS A;  4DR7 O;  4MT8 A;  4NTW A;  1ZX3 A;  4I0X B;  5E79 E;  1NJI W;  4I9W A;  1PNK A;  2DWE C;  3CC4 P;  2LFS A;  4Z2W A;  5IYZ A;  3W67 A;  2EIK C;  4IIJ A;  4EFB A;  5KAI Z;  5IT9 N;  2YMY A;  1K73 W;  1YYC A;  3CXH E;  2FYU J;  2M3E A;  3F5T A;  1FU1 A;  2R32 A;  2A9H A;  1F7Y A;  3E86 A;  1AVY A;  4CS3 A;  1GL2 A;  2BCC E;  4I1L A;  4FLX A;  3HKE B;  2FKW B;  3AEE C;  2YKQ A;  2CE4 A;  3H1K J;  2UXB O;  4YJ3 B;  2K88 A;  5LOV B;  1NTZ K;  4J11 A;  2QRX A;  1ZR4 A;  1PFI A;  1FAV A;  3IGA C;  4J42 A;  3GHG C;  3L70 D;  1KYO I;  3H1L J;  4UUJ C;  5LP6 A;  1NU1 E;  2P22 C;  3K08 A;  2ZVN B;  3RYI A;  1NT2 B;  3AE8 C;  1BCC E;  1OW7 A;  3CC4 V;  2KUB A;  1V54 C;  2L5G B;  1AQT A;  4HNA B;  1AR5 A;  4I0X A;  1JMB A;  4IGG A;  3WB0 A;  4ZOL A;  3HE5 A;  4LC1 A;  2QWQ B;  2WLM A;  2OCC B;  4LF8 B;  4FM0 A;  1JY3 O;  1M1J B;  3PTZ A;  2I8D A;  4BIO A;  2FFD C;  2UUB B;  4WBA A;  2KQX A;  1Y6X A;  3VOU A;  2EIJ C;  1RHZ B;  2W6A A;  3HD7 D;  4YPC A;  4CPG A;  3LNM B;  4DK0 A;  2YXY A;  3HKE A;  1VQK V;  4YJ3 A;  3STL C;  2IW5 A;  2X0L A;  1W0K G;  5LOV A;  1FZA A;  3CWB D;  2Y0D A;  4UB8 E;  3U59 A;  1VP7 A;  4FMT A;  3IN6 A;  3P7K A;  5DJT B;  3V2N A;  2HFE D;  1Y76 B;  1VF5 B;  3AG3 C;  4H0L B;  3X2Q C;  2VQF O;  3QO7 A;  1X9V A;  3RYH B;  4Z1M G;  1G1J A;  2YI8 A;  4HNA A;  3LW5 H;  1BE3 J;  2CH7 A;  4CH3 A;  3MGN A;  3KCX A;  5JCO C;  5FNV B;  4RUF A;  1SQV G;  4JI6 O;  1NTM D;  3L72 J;  4Y99 B;  1WPX A;  2M5A B;  1M1J A;  1MA1 A;  1RQV A;  4DR3 B;  1HR0 B;  3OAA G;  3B77 A;  3ZRX A;  5ITZ B;  5L3C A;  1BHB A;  1IBM O;  1VPC A;  2IBZ G;  3VMY A;  5B1O A;  3ASO B;  4TV8 B;  4CH4 A;  1R5S A;  1LT9 B;  2F4V B;  4ZI7 B;  1KYO E;  2FXO A;  2KB1 A;  4PDL A;  2A06 G;  4UV9 A;  2D3O W;  3GW6 A;  4LGD E;  1FD9 A;  3CD6 P;  1M4U A;  3L75 H;  1Y76 A;  1K7D A;  3JC2 2;  1P7G A;  1CI6 B;  3L73 G;  1GTW A;  1S5H C;  3L71 G;  1B04 A;  2Y69 B;  1Q5O A;  3RYH A;  1M57 B;  4LH7 A;  4I5S A;  4J9Z B;  2QJP C;  4JPZ B;  4U3F E;  3JYC A;  4D6T D;  5FNV A;  4YY3 O;  2WVR A;  3WB1 A;  1JNM A;  4DV1 B;  3FWN A;  5H6R A;  1ZRT E;  4J7K A;  1MFT A;  3ABK C;  3BY6 A;  2M5A A;  4JI2 B;  5ITZ A;  4JI8 B;  3GF3 A;  1QHT A;  2Q7H A;  4JYA O;  1GW3 A;  4PJ0 Z;  1J1E B;  4TV8 A;  4PD4 D;  1LT9 A;  3AE4 C;  1LNQ A;  3CCR V;  4ZI7 A;  3AEA C;  1FZC B;  2QDO A;  3B09 A;  4DV6 O;  3SPH A;  3T1H O;  4WFE A;  1QNM A;  3BFR A;  2B9Z A;  3UO2 A;  4ZKU A;  3RW0 A;  3FB8 C;  3V2R A;  1PL4 A;  3FAV B;  1K5S A;  2DQ0 A;  1AP6 A;  2DOS A;  5AG2 A;  1CI6 A;  1Y8A A;  2E75 C;  3RGB A;  1GU4 A;  3ZBH A;  1BGY G;  2N9Y B;  3J80 N;  1OCC C;  4PDR A;  2LGQ A;  1Z56 A;  4J7Z A;  3G3Z A;  1H2L A;  5E1A C;  5BVZ A;  3P32 A;  3DXR B;  3A0B E;  2PAJ A;  2Q9L A;  2RH0 A;  4IFD K;  2PP6 A;  1SQP H;  2YMK A;  4JI4 B;  1OZ0 A;  1KB9 H;  1L4A B;  1V9P A;  2GUV A;  1PNL A;  3H1I D;  2BSK B;  2YEV B;  1X79 B;  1PPJ G;  3JSV C;  1FZC A;  1BMF G;  3E7K A;  1KEC A;  5JH7 B;  1JR9 A;  4NVP A;  4H13 B;  1M1K Q;  3AG1 C;  2OYQ A;  1LP1 B;  3VMZ A;  1W0J G;  1UJW B;  3FAV A;  3N2K B;  2Q7E A;  5K1P A;  1NVO A;  5L8R J;  2ZFC A;  4PA3 A;  1BSN A;  1SQB E;  2LQT A;  4GKJ O;  1SFC A;  2FML A;  4DR2 B;  1K9M W;  1IJD B;  2QEX P;  1VQP P;  2B89 A;  3DXR A;  1SQV J;  1CPY A;  3IAY A;  1GL2 C;  4X1K B;  1QLE B;  3KZI H;  1DTO A;  2NLJ C;  3OEE G;  4LLH A;  1L4A A;  1URQ D;  4JI0 O;  2BSK A;  2YEV A;  1UPG A;  1FPO A;  3OGI B;  1DH3 A;  5KLV H;  1S5L X;  1US6 A;  1DK1 A;  1T5E A;  3F5W C;  1YEW A;  4F6E A;  5H6Q A;  2XAF A;  5JH7 A;  3SJA C;  1MSW D;  5LP6 C;  3ITK A;  1VQM P;  4WFA V;  1N0J A;  5JWP A;  1W5C E;  1LP1 A;  2JIZ G;  5CA1 B;  3E89 A;  4B3R O;  5APY A;  2YUA A;  2VQE B;  1VQP V;  2QEX V;  3N2K A;  5CCH D;  1ZN5 A;  5LHH A;  4XDL A;  1Y47 A;  3L73 J;  2B1G A;  4CH5 A;  3L71 J;  5CB4 A;  3G71 V;  4I50 B;  3KQG A;  2Y9Y A;  3H1J E;  1YVW A;  2ZT9 B;  2Q8V A;  4OGQ D;  4W4K A;  1M1K W;  1AJQ A;  2IYP A;  2IJK A;  4BAY A;  1LWU B;  2M3B A;  4HYO A;  2A7W A;  1B3Q A;  1VQM V;  3SFE C;  1JTH B;  3U1C A;  3IJ4 A;  1XEQ A;  1R3L C;  1WP7 A;  1AQ5 A;  1RE4 C;  2R3C A;  3WUU A;  1IBL O;  3LDC A;  3MP7 B;  5LMU O;  1QVG O;  1L1F A;  1R1B A;  5CA1 A;  3M9Q A;  5KUM A;  1AV1 A;  1KFM A;  4DZO A;  5KAI H;  2D2C B;  3NXS A;  1FJG O;  3JCU Z;  2C0W A;  3UQ8 A;  1NTZ G;  3CCE P;  2ZM6 O;  1DF5 A;  1NQT A;  2OCC C;  1SZT A;  4I50 A;  4ABM A;  1M1J C;  3I55 P;  4EEQ A;  3F5H A;  2WSE J;  1JA8 A;  3SYO A;  4LFC O;  3AE5 C;  2O1J A;  3LNN A;  4U3J B;  1BHA A;  1LWU A;  4DV7 O;  1URF A;  2ADP A;  1T3J A;  1JTH A;  3EWK A;  3CP1 A;  3C8V A;  4MVS A;  1YHQ P;  4P2Z A;  3SR2 C;  2IU0 A;  4UCR A;  5IYD O;  3J7A U;  3N27 A;  2LW7 A;  5E79 Z;  2WLI B;  4B3T O;  4TT3 G;  1MFZ A;  1PP9 D;  1VF5 C;  2V7Q H;  2EZO A;  3I55 V;  2WPV B;  5CCG A;  1EDI A;  2K9J B;  2WLH A;  4H44 B;  3P8C D;  1H88 A;  2EX3 A;  4DCK A;  2Y4T A;  1QGK B;  3B8M A;  4ZHQ A;  4GCZ A;  4RAI A;  1HJ0 A;  1XHX A;  1YHQ V;  3ASO C;  3CB2 A;  5KLV K;  4U3J A;  1KB9 F;  3FD9 A;  4DUY O;  2FYU E;  1EXJ A;  4UB6 E;  3H1K E;  1L8D A;  4PI2 A;  3EFF K;  4ZKP A;  4LFB B;  1YJ9 P;  1RPR A;  5KLI B;  2WLI A;  1FZB A;  1Q7Y W;  2Y69 C;  2JJ1 G;  1QVG U;  5L3D A;  1T3U A;  2W90 A;  2QVA A;  1M57 C;  4JTD B;  3FX0 A;  5B3S C;  2EIN C;  4U3F G;  1YTZ T;  1GN6 A;  2K9J A;  1IBK O;  4PA4 A;  5IYB O;  4BWA A;  3VTP C;  1CW5 A;  1AI4 A;  3FKS G;  1LUW A;  2P67 A;  1XMQ B;  5DJU B;  1K97 A;  4UB8 Z;  1EZV E;  2IJI A;  3H9V A;  1FZC C;  1SQX H;  3BA8 A;  3A0H Z;  1Q43 A;  3A2A A;  1QL2 A;  3HUS B;  1EC5 A;  2V4D A;  3CWB H;  1T6A A;  2WMM A;  4JYC A;  1HP8 A;  4ZMD A;  3UIA A;  5L3G A;  3HTK B;  1TVK B;  2UUA O;  4MSW C;  4PV1 B;  2WQY C;  2OYI C;  4RO0 A;  1ZSP A;  2WSC J;  3U1A A;  4TQF A;  4CS4 A;  4X64 B;  2H43 A;  3GF7 A;  4DV3 O;  1SQQ H;  2ZXE B;  3L74 H;  4QNH B;  1SFC C;  5LGU A;  4GX1 A;  4RJT A;  2KB7 P;  2JDI G;  3VQX A;  4DR1 O;  4G27 B;  1BE3 E;  4ZBM A;  1NTZ J;  2Z5U A;  2FYN B;  4X1Y B;  4YIO A;  2MKV A;  2Q5U A;  3MZW B;  3G4S P;  1H2S B;  2DW4 A;  2DYR B;  2NPS B;  4P30 A;  5EK0 A;  1YIT P;  2ZVO B;  3QWO C;  1YCI A;  4NYK A;  2OTK E;  2NN4 A;  1G4Y B;  1M56 B;  1OVU A;  1J5E O;  3HUS A;  1R3K C;  1YTZ I;  3O65 A;  2FYZ A;  4R6Z A;  3BAS A;  1VQ5 V;  5KAF H;  3ZHR A;  1TVK A;  4JAV A;  4UXN A;  2CTP A;  3E8B A;  4DV5 O;  5APU A;  3QO8 A;  4FFB B;  2OGU A;  1RY3 A;  1Q82 Q;  2JR8 A;  2W6B A;  3HPL C;  4NXM O;  4BR6 A;  3G4S V;  5EZY B;  5IY5 B;  4DV0 O;  3ZX6 A;  1IFN A;  3SSU A;  4D6T H;  3OW2 O;  2CGN A;  3CHX A;  1F23 A;  1QLE C;  5LBQ A;  1S72 P;  4TUY B;  1AA0 A;  3M0D A;  2NPS A;  4Z1V A;  3SYA A;  3LSQ A;  2YNY A;  1JVM A;  1YI2 V;  3SWF A;  1JY2 O;  5BR8 B;  1K5Q A;  5B1B B;  5C8Y B;  3MHV A;  4PD4 H;  3SJQ C;  2XND H;  1E79 H;  2CDY A;  4O4L B;  1NBM G;  4UFZ A;  5KHH A;  1LGH B;  4NPD A;  1IZN B;  1GD2 E;  1DF4 A;  5DEC A;  1OZH A;  3K03 A;  4FJC C;  3JAS B;  2IBZ I;  1GDT A;  1F4M A;  4PHZ A;  3L75 D;  4GOD A;  3ETG A;  4B3M O;  1NVP D;  5CBN A;  4FFB A;  3A0B Z;  3NR7 A;  3V2P A;  2FKX A;  2VWK A;  1K3E A;  3OTF A;  1PD3 A;  3TGU H;  1KP2 A;  5EZY A;  1JMM A;  1S72 V;  1N4C A;  3O6Q B;  4NTY A;  3L70 E;  1NTK H;  3ASN B;  2VRS A;  3K04 A;  2ZT9 C;  1K8A Q;  5KJ7 A;  1K4D C;  1LWU C;  1SQX K;  4NXN B;  4TUY A;  1MOF A;  3V4W A;  2O1K A;  2ZNJ A;  5LHI A;  1GL2 D;  1ZL8 B;  3H1I H;  5IYC O;  5C8Y A;  3B4S A;  1IK7 A;  3W7T A;  2F95 B;  4O4L A;  1G8M A;  5H2F H;  4DV4 B;  3E2E A;  1EDJ A;  1WLE A;  3K59 A;  1SQQ K;  4KJM A;  1V55 B;  1JCH A;  5GON A;  3JAS A;  2JGD B;  1NH2 B;  2D2C C;  2K9Y A;  2M8R A;  5CCG C;  1D7M A;  4DUZ O;  3H1H H;  2Q68 A;  4LH6 A;  1NTM K;  5BMV B;  1KFN A;  4Q6G A;  2LKM A;  2H89 C;  3O6Q A;  5B66 Z;  2A45 H;  3JD3 A;  4W4L A;  4JYY A;  2QWO B;  2HHH O;  3SPJ A;  3ZMS A;  1SQV E;  2QSA A;  1HJB A;  1SQP D;  1GK6 A;  3OW2 U;  1ROP A;  1NAY A;  2N1T B;  2ZXW B;  2POH A;  1S77 D;  1ZL8 A;  1XHZ A;  3MAQ A;  2IBZ E;  4YTP C;  4UCU A;  1KQS O;  3BCC H;  2PRR A;  2R70 A;  3OUF A;  4J9Y B;  1LTI C;  1N34 O;  2UXC O;  1HDJ A;  2A06 E;  1SS3 A;  4XBF A;  1EXI A;  4FFK A;  4K0K B;  4LF9 B;  2JGD A;  5IWA O;  1P84 I;  4I2L C;  4WY4 A;  5A2Q N;  3CX5 H;  3DC6 A;  5BMV A;  1Y74 B;  5KA5 A;  5KHG A;  1S5L E;  2IH1 C;  4LF7 O;  4JI5 B;  2XAG A;  2EUL A;  4XE5 B;  2NR5 A;  3T4Z A;  1VQ4 P;  2ZIN A;  1P4R A;  2ZDI A;  4X20 B;  4GLX A;  2GDS A;  4NR1 A;  2IZ1 A;  2N1T A;  3RFR A;  1L0N G;  1VQ8 P;  3CRQ A;  2P90 A;  3GB7 C;  3M8A A;  3UKM A;  4JV5 O;  4IOI H;  1MZE A;  5KLI C;  3D70 A;  3CXH H;  2N05 A;  4IL6 E;  2NZ2 A;  2IJH A;  5KLV G;  5A9G A;  3LDE A;  3LIE A;  1YZB A;  2O57 A;  1NTK K;  1AIL A;  3ZMV A;  2N74 A;  2OIE A;  2QM7 A;  2UXD B;  3U11 A;  1GH6 A;  1SP4 A;  2AW9 A;  2B88 A;  1Y74 A;  1VQ4 V;  2H88 C;  1YF2 A;  1IVS A;  3B5N A;  5B5E H;  1NU1 H;  3E8F A;  3Q3D A;  3OTO O;  2XAQ A;  1IX9 A;  1IFJ A;  1EZV G;  4LBE C;  1VQ8 V;  3FWL A;  2VWJ A;  3OR6 C;  5BZB A;  4X20 A;  3K5L A;  2OTL V;  3ABV C;  5D5P A;  4DR5 B;  3B2E E;  4U7O A;  5KHJ A;  4PD4 F;  2UUC O;  1NJI Q;  1S4X A;  4B3S B;  2UWJ E;  1Q81 Q;  4QPK A;  1R73 A;  4XFJ A;  2KKW A;  2OTJ V;  2ITA A;  1PPJ E;  2F43 G;  1KQS U;  3R65 A;  1YXB A;  2WLK A;  1XBL A;  3T97 B;  5APW A;  3ZED A;  5CJ4 A;  1AR1 B;  2XNX A;  3QNE A;  4B7K A;  1PV3 A;  1GTO A;  3V6I A;  1QQC A;  1SA0 B;  4FIP C;  1M57 D;  2FYN C;  4N3Y B;  2PTM A;  5EBW C;  3MUD A;  3DC5 A;  2DYR C;  4GYC B;  4UB6 Z;  3M0D C;  1JY3 N;  1DGS A;  3K0G A;  1K04 A;  4X66 B;  3CS5 A;  3E8H A;  1CSB A;  2PYJ A;  1R8E A;  1OCZ B;  1Q3E A;  2HP8 A;  1BT8 A;  3MIW A;  1I08 A;  1SQF A;  4GUN A;  3OUS A;  1A32 A;  4UCS A;  3KXD A;  2UU9 O;  1HH0 A;  2HLD G;  1BQZ A;  1RM1 B;  1AFO A;  3VN0 A;  1EBO A;  1K33 A;  3ZRS A;  3WFV A;  3T97 A;  2G3A A;  2YXQ B;  2Q3E A;  1YQ4 C;  1KYO H;  2KLV A;  3K5O A;  4MVO A;  1M7L A;  1UII A;  2XAS A;  2E74 B;  2YI9 A;  2CPB A;  1NR7 A;  2LGW A;  2ZQM A;  3E83 A;  3ZRV A;  2V7Q G;  4DYL A;  4U7N A;  1OFC X;  1SFC D;  5KJ7 C;  1FOS E;  4LFA O;  3AEI A;  2LO1 A;  4PA7 A;  1U7J A;  4OH8 B;  3RL0 D;  1Q81 W;  1U7M A;  1YDX A;  3F89 A;  2ZKO A;  1H8A A;  4MVU A;  2R9R B;  4EI2 A;  2KK7 A;  4MTX A;  4RQF A;  4WWI A;  2C9L Y;  4IFM A;  4EYY Q;  1L0N J;  1N73 B;  3JD0 A;  2E76 B;  2YIC A;  3RK3 B;  5APS A;  5KUK A;  3IAO A;  4JF3 A;  3WU2 E;  2W83 C;  1AP5 A;  3K57 A;  5AW4 B;  3QG5 A;  5CA3 A;  1T2K C;  2PGD A;  1VQK P;  4YJ2 B;  1Y67 A;  4NB5 A;  1CEZ A;  1EDL A;  5KLV J;  1NU1 K;  4JI7 B;  3L70 G;  4KT0 J;  3CX5 F;  3ASN C;  4FLW A;  3K5B A;  3QO5 A;  3FYI B;  2AEM A;  3CPW O;  2C2A A;  1KQF B;  1NTZ E;  1S1C X;  3CCM V;  5TJH A;  1CP9 A;  3F7V C;  3OMN B;  1QEX A;  2WTY A;  1QLE D;  2R9I A;  4N78 D;  1FS0 G;  3K9S A;  3GLM A;  1SQX D;  5TIS E;  2JWD A;  3ETQ A;  3GWO A;  1GN4 A;  2YIA A;  1V55 C;  5LXT B;  4OWF A;  1N73 A;  1I5X A;  3SDL A;  3CXH F;  3VYI A;  1DD3 A;  1JMK C;  5B1A B;  5CBF A;  1YSC A;  3A0H E;  3CWB G;  4YJ2 A;  4DR6 O;  4WY4 C;  3S4R A;  2IFN A;  2BTQ B;  1GM8 A;  5DED A;  1Q86 W;  1SQQ D;  4RES B;  3L74 D;  4EOT A;  2JWA A;  4Q20 A;  3BAT A;  2LJ2 A;  1N32 B;  4FZ1 A;  1L0L H;  2CTW A;  4KFM A;  4OX9 O;  1PP9 E;  4UVC A;  4R4L A;  2ZDI C;  2ZT9 D;  3S1K A;  2PZS A;  4L75 A;  1VIB A;  1K4C C;  1HNW B;  3AG4 B;  4I9Q A;  2ZXW C;  3JCZ A;  3R66 A;  4LR3 A;  1IFM A;  1NTM G;  1SQB H;  4B86 A;  5AW8 B;  1EN4 A;  3P8C E;  2E43 A;  1GK4 A;  1D5N A;  4WBN B;  3CXC U;  2QKS A;  1PIX A;  1IFI A;  5FLX N;  3AK3 A;  2ZD9 A;  2RJZ A;  3ABM B;  4AQY B;  2NNU A;  4EB6 B;  3CCR P;  1Z2G A;  3Q4H B;  4J7J A;  2BTQ A;  3AG7 A;  2D2C D;  2AEJ A;  1Y9B A;  3D8C A;  5CCG D;  5CHX A;  4LF6 B;  2QM8 A;  4AI8 A;  3B5N C;  3RK2 C;  1YTF D;  5JJJ B;  3SYP A;  2H3O A;  2V7Q J;  2O01 H;  5AVQ B;  2Q9I A;  4X8A A;  4LF4 B;  1MNG A;  3CPW U;  1Q6U A;  2ZYA A;  4UVB A;  3M91 A;  2XZR A;  1D5A A;  2WLJ A;  1M9N A;  4DW0 A;  4D6T G;  2QKA A;  4L74 A;  4LCU C;  1N8R Q;  2BEZ F;  3H1J H;  3ZRW B;  1K9M Q;  2ZJS E;  2WAM A;  5EC1 C;  4O4H B;  2KNC B;  2YIB D;  4X1I B;  3TSI A;  4EB6 A;  3ZHT A;  2EJR A;  3DSQ A;  3H01 A;  1AVO A;  4DRX B;  1R3I C;  3RYC B;  3Q1M A;  5AW9 B;  3TGU D;  4LF8 O;  3MUD C;  3L70 J;  5CN0 A;  1NTK D;  2UUB O;  4C7U A;  2J58 A;  3CSX A;  3CCU P;  1IFD A;  1WNS A;  3GWK C;  4W7Y A;  4MTO A;  3WG7 B;  3VMX A;  5AVZ B;  4WCE V;  3ZRW A;  1VL2 A;  2HKO A;  3UT5 B;  3H1I G;  4FVM A;  4CBC A;  1RF0 C;  2MJZ A;  2N04 A;  4O4H A;  2KNC A;  1SF9 A;  2YIU C;  1KOR A;  1N7S B;  1S5L Z;  3DGE A;  4P9O A;  1YJN V;  3BCC D;  1L0L K;  1AI6 A;  2KSE A;  3W68 A;  4UVA A;  4DRX A;  3CWB J;  2JEU A;  3H1H D;  3RYC A;  3AE9 C;  2B5U A;  3JAW B;  1N8R W;  1QU7 A;  1AJP A;  3SPG A;  2AHY A;  3CCU V;  2GUZ B;  1FKA O;  2K3R A;  2E5L B;  2OYO A;  4UCO A;  4B08 A;  3C3T A;  2F4V O;  2EJ7 A;  2M0B A;  2Y0E A;  3L74 J;  2VRZ A;  3G71 P;  5EBL C;  1OCZ C;  3K5N A;  1EN5 A;  3B8E B;  3BRC A;  4DV2 O;  3N4X A;  5CBH A;  2GUS A;  5B66 E;  4IL6 Z;  4JAU A;  1NTM J;  2FXP A;  5GTI H;  4JPR A;  4PI0 A;  2WSS H;  3IC7 A;  4JI1 B;  1VF6 A;  4PEL A;  1FXV A;  2ODM A;  3EFG A;  1MV8 A;  1M5I A;  1N7S A;  3BCC G;  4FM2 A;  1FAF A;  2E74 C;  1NO4 A;  3H1K H;  3L9D A;  1KB9 I;  3AE7 C;  4HH2 A;  4DV1 O;  1Y4M A;  3CX5 D;  4K3A A;  2DYS B;  3JAW A;  3JAK B;  1X8Y A;  4X65 B;  2XHB A;  4JI2 O;  1S9K E;  2Y0P A;  2H8P C;  3H1L H;  4JI8 O;  2QJ1 A;  3HD7 B;  3L75 E;  2GUZ A;  4XDJ A;  5KMG B;  2HYN A;  4IL6 X;  1COW G;  2ZE7 A;  2DN9 A;  4X1K A;  2IM9 A;  4LWS B;  4OPA A;  1Q90 D;  1N36 B;  2ZYD A;  2A0L A;  2AXC A;  4D6T J;  2Q7G A;  1VQO P;  2PY5 A;  1N73 C;  1PNM A;  3SJC C;  3U0Z A;  4L76 A;  2JVD A;  3CXH D;  2CTQ A;  2ZXX A;  2EIL B;  5IJ0 B;  2BCC D;  2DQ3 A;  1U97 A;  1JJ2 U;  2DMX A;  1VAR A;  1VQ6 P;  3CRM A;  1JM0 A;  2ITD C;  5GTH E;  3EHB B;  1HNZ B;  1SQP K;  3JAK A;  4JI4 O;  2R72 A;  2QJK B;  3HB3 B;  4ASU G;  1NU1 D;  1R3J C;  5FPO A;  5KJ7 D;  1BCC D;  4R4M A;  1RF1 B;  5KMG A;  1VQO V;  1H89 A;  2QM4 A;  2W6J H;  3AEC C;  3RK3 E;  1S5J A;  5IJ9 B;  2L35 A;  3L37 A;  1Q7Y Q;  5AVX B;  2QWN B;  3WUV A;  1ORQ C;  1NTK J;  4GDO A;  4YXD C;  2M6Y A;  4O2A B;  3L72 H;  2Q69 A;  5LMN B;  1QCE A;  1EZV I;  1JY2 P;  5GW7 A;  3OMA B;  1VQ6 V;  2JO1 A;  5B1A C;  1KB9 E;  3H1I J;  5IJ0 A;  1VMG A;  4TSF G;  1G1I A;  4H0L C;  1T2K D;  4DR2 O;  1E1Q G;  3TXQ A;  3TXS A;  2ZE8 A;  3GVM A;  1PP9 G;  3CEI A;  1FYJ A;  2WA3 A;  1NH4 A;  4Y99 C;  1OCR B;  1O9H A;  1KN7 A;  2LW1 A;  2R3S A;  3V5B A;  1RF1 A;  3AG4 C;  1DEE G;  1RH5 B;  4FZ0 A;  5IJ9 A;  2OT5 A;  3TF5 A;  3VP8 A;  3WU2 Z;  1LT9 C;  2KSD A;  4UCV A;  1XNQ B;  2P7T C;  3A8T A;  1A02 F;  3D36 A;  3ABM C;  4O2A A;  1WP8 A;  3V4Q A;  1LR1 A;  1L0N E; 
#chains in the Genus database with same CATH homology
 1V55 B;  4RQE A;  1JCH A;  3E35 A;  2QA4 V;  3SPC A;  1NH2 B;  4MS2 A;  1GM7 A;  1MG1 A;  4MVR A;  4MT8 A;  1NKD A;  2Q68 A;  2XAJ A;  5C93 A;  3LUT B;  1NJI W;  4I9W A;  1PNK A;  2DWE C;  1JOY A;  2LFS A;  1KP3 A;  2EIK C;  5EC2 C;  3JD3 A;  3ABU A;  3K0D A;  4CZZ A;  1VQN V;  1K73 W;  3SPJ A;  3ZMS A;  3OW2 U;  2A9H A;  1ROP A;  3E86 A;  1SES A;  4HAM A;  2ZXW B;  1S77 D;  3IGA C;  4RO2 A;  2PI5 A;  1SRY A;  4H37 A;  4H33 A;  2ITC C;  5DN6 G;  3OUF A;  4J9Y B;  4UUJ C;  1H38 A;  3K08 A;  1I5Y A;  4XBF A;  1RM1 C;  3CC4 V;  1V54 C;  2JK5 C;  1AI5 A;  3A0R A;  3RBZ A;  4PDV A;  4JAS A;  5LGN A;  1AQT A;  3CCS V;  4LC1 A;  5KA5 A;  5CMU A;  1QLN A;  5L3F A;  2WLM A;  2IH1 C;  2OCC B;  3SYC A;  1EFR G;  2XAG A;  1VQ7 V;  3T4Z A;  2CK3 H;  1P4R A;  2ZDI A;  3AG2 B;  3VOU A;  2EIJ C;  3LNM B;  2EIM B;  4R7C A;  1VQK V;  1OCO C;  3STL C;  2IW5 A;  2X0L A;  1W0K G;  2P90 A;  3GB7 C;  3UKM A;  4FMT A;  3K79 A;  4X88 A;  4HZ3 A;  3SPI A;  3OGC C;  1XL4 A;  4DJG A;  2IJH A;  3PJS K;  4N21 A;  3AG3 C;  3LDE A;  3X2Q C;  1P7B A;  3QO7 A;  4GX5 A;  2LFR A;  3ABL B;  4Z1M G;  3JD4 A;  3ZMV A;  2HVJ C;  4PDM A;  2QM7 A;  1AJN A;  4RUF A;  1VQ4 V;  1MAB G;  3E8F A;  4FK5 C;  3CC2 V;  1WPX A;  4GX2 A;  5EBM C;  2XAQ A;  3OAA G;  3B77 A;  3ZRX A;  4LBE C;  1VQ8 V;  3MHS C;  5L3C A;  1BHB A;  3OR6 C;  4MTF A;  5B1O A;  5BZB A;  3ASO B;  2OTL V;  1S76 D;  4U7O A;  2KB1 A;  4PDL A;  4UV9 A;  3USS A;  4QPK A;  1R73 A;  2FTK A;  2D3O W;  2OTJ V;  4WFF A;  2F43 G;  1H8H G;  3VBB A;  1KQS U;  2GHY A;  3R65 A;  3ZJZ A;  2WLK A;  5B1N A;  1K7D A;  4BW5 A;  4F4L A;  5LHG A;  1S5H C;  1AR1 B;  2Y69 B;  1YTF B;  3QNE A;  1M57 B;  2A79 B;  4I5S A;  1ENV A;  1GTO A;  2HJF C;  4J9Z B;  4FIP C;  3JYC A;  5KA6 A;  5EBW C;  1FFT B;  5H6R A;  2DYR C;  4GX0 A;  1KKD A;  1GM9 A;  3ABK C;  3BY6 A;  1H2G A;  3K0G A;  3RVZ A;  4YXW G;  3E8H A;  2Z3Y A;  1OCZ B;  3B8N A;  1LNQ A;  3CCR V;  4TLF A;  4N23 A;  3SPH A;  4WFE A;  3BEH A;  1RPO A;  3OUS A;  1S3J A;  2BOB C;  3CCE V;  2HLD G;  3RW0 A;  1FS0 E;  3FB8 C;  1RM1 B;  2BOC C;  1EBO A;  2WPD G;  1K33 A;  3ZRS A;  2IH3 C;  3WFV A;  1K5S A;  2DQ0 A;  2ZR2 A;  4MVO A;  2XAS A;  1NH2 D;  1NR7 A;  1OCC C;  4PDR A;  2ZQM A;  3E83 A;  3ZRV A;  3OE7 G;  2V7Q G;  1EZJ A;  4U7N A;  5E1A C;  1S0V A;  3AEI A;  1F51 A;  2HR3 A;  2X6B A;  3P32 A;  4PA7 A;  1Q81 W;  1QR9 A;  4MVU A;  1OZ0 A;  2EIJ B;  2LP7 A;  2R9R B;  4WF9 V;  1PNL A;  4MTX A;  3P30 A;  4RQF A;  2YEV B;  3UM7 A;  2Q67 A;  1BMF G;  1KEC A;  4JYB A;  4QE9 A;  3JD0 A;  1Y66 A;  2HVK C;  3AG1 C;  4JF3 A;  5KUK A;  3AG3 B;  5CA3 A;  3X2Q B;  1W0J G;  1UJW B;  1CEZ A;  3ZIA G;  2WWW A;  4KP4 A;  4PA3 A;  1BSN A;  2PI4 A;  2JEX A;  3ZMU A;  3ASN C;  1K9M W;  3KG2 A;  3QO5 A;  3FYI B;  3SYQ A;  2C2A A;  2IU3 A;  1JQ0 A;  1GMG A;  1CPY A;  2WLN A;  4X89 A;  2QE7 G;  3CCM V;  2UXN A;  1QLE B;  1DTO A;  2NLJ C;  3STZ C;  2IJJ A;  1CP9 A;  3F7V C;  3OEE G;  3OMN B;  1K34 A;  4XDK A;  1YJ9 V;  2R9I A;  3W7X A;  2YSU B;  3M99 B;  2YEV A;  1FS0 G;  2AHZ A;  3F5W C;  5H6Q A;  2XAF A;  1MSW D;  3WG7 C;  1M90 W;  3GWO A;  1THZ A;  4WFA V;  1V55 C;  2EZP A;  1I5X A;  3OM3 B;  2JIZ G;  3E8G A;  5IDJ A;  3E89 A;  2ATK C;  4QMA A;  5B1A B;  5CBF A;  5CBG A;  1YSC A;  1VQP V;  2QEX V;  5LHH A;  2K1E A;  1GM8 A;  4XDL A;  4MTG A;  1Q86 W;  2B1G A;  4GT1 A;  2WLL B;  4Q20 A;  1JPX A;  3G71 V;  2W0F C;  1XL6 A;  1W2B U;  4G28 B;  3LSS A;  4KFM A;  3ZMT A;  4UVC A;  3ABK B;  1GO3 F;  3G6E V;  1AI7 A;  5LGT A;  2ZDI C;  1AJQ A;  1R6N A;  2IJK A;  1DLB A;  2HG5 C;  1FXH A;  4BAY A;  4HYO A;  1M1K W;  1K4C C;  3AG4 B;  1VQM V;  2ZXW C;  3JCZ A;  3K3W A;  4BIU A;  3RVY A;  1FXK B;  1R3L C;  3CXC U;  2QKS A;  1F4N A;  2Q6A A;  1R6K A;  1QBZ A;  3OMI B;  4BIZ A;  2ZD9 A;  3ABM B;  3LDC A;  3CCJ V;  2NNU A;  1L1F A;  4P9P A;  2H94 A;  5KUM A;  1HWY A;  3W7W A;  3NXS A;  3W7U A;  1YIT V;  1VQ9 V;  2QM8 A;  2WLL A;  1DF5 A;  4YXW H;  1NQT A;  2EBO A;  2OCC C;  1SZT A;  1YTF D;  3SYP A;  2DYS C;  3ZMZ A;  2EIK B;  3SYO A;  1JX9 A;  4X8A A;  4R50 A;  3CPW U;  3LDD A;  4UVB A;  1BHA A;  3TCU A;  2EIM C;  2WLJ A;  3OFN G;  1M9N A;  5HFM A;  3CP1 A;  3DTU B;  1FXK A;  4LCU C;  1M56 C;  4MVS A;  4P2Z A;  1JEK A;  2HFE C;  2IU0 A;  3ZRW B;  2WAM A;  5IYD O;  5EC1 C;  1KC8 W;  2WLI B;  2X6A A;  3T4D A;  4TT3 G;  2V7Q H;  2EZO A;  1TUE B;  2EIL C;  3ZCC A;  2EJR A;  1H8E G;  3ABL C;  3H01 A;  1PKX A;  4WVZ A;  3I55 V;  1V54 B;  1R3I C;  1OHH G;  3CC7 V;  5IY5 C;  2WLH A;  5DM6 V;  5CN0 A;  4DXW A;  3OEH G;  3B8M A;  1GKF A;  4GCZ A;  1SET A;  4RAI A;  1YHQ V;  3ASO C;  1Q82 W;  3OR7 C;  1SER A;  3TET A;  1GK9 A;  4UV8 A;  5H9C A;  5B1B C;  1IXM A;  3CCL V;  4WFB V;  4MTO A;  1OCO B;  3WG7 B;  3EFF K;  4WCE V;  3ML0 A;  3ZRW A;  2HKO A;  1PL0 A;  4FPP A;  1RPR A;  4WFH A;  4CBC A;  3CCV V;  2WLI A;  3FB5 C;  1QVF U;  1Q7Y W;  3DGE A;  4P9O A;  2Y69 C;  1YJN V;  2JJ1 G;  1QVG U;  5L3D A;  3T2M A;  1M57 C;  3CCQ V;  1AI6 A;  4JTD B;  5B3S C;  4UVA A;  2EIN C;  1KD1 W;  2JEU A;  2QE7 H;  2B5U A;  2B1I A;  4PA4 A;  5IYB O;  1YJW V;  4PA9 A;  1N8R W;  4ZKI A;  5FL7 G;  1AJP A;  3SPG A;  1AI4 A;  1E1R G;  2AHY A;  3FKS G;  2P67 A;  4MVZ A;  3CCU V;  1OCR C;  2M7W A;  2E5T A;  4JGS A;  1BL8 A;  1K97 A;  4MW3 A;  2IJI A;  2XOK G;  4WFG A;  2W6I G;  2GSM B;  1OCZ C;  5EBL C;  4R8C A;  3CMA V;  5CBH A;  3FB6 C;  3W7S A;  1BSH A;  1QR8 A;  3CYO A;  4JAU A;  4JPR A;  1K8A W;  4JYC A;  2WSS H;  2X6C A;  3IC7 A;  2JDI H;  1B6Q A;  4JTC B;  5L3G A;  4PEL A;  1FXV A;  4MSW C;  4QE7 A;  3T1C A;  4QNH B;  5LGU A;  4GX1 A;  2P6J A;  2WSS G;  4QPJ A;  2JDI G;  3F7Y C;  1Y4M A;  4G27 B;  4ZBM A;  2Z5U A;  2DYS B;  1ZWI C;  3K06 A;  4TWK A;  3MHH C;  2H8P C;  4EKW A;  3K9A A;  2DW4 A;  2DYR B;  4XDJ A;  4P30 A;  3ETD A;  5EK0 A;  3ZN1 A;  1COW G;  3TK1 A;  2E5Y A;  3FYE B;  1NR1 A;  3JD2 A;  1G4Y B;  1M56 B;  2A0L A;  3I56 V;  1R3K C;  2CK3 G;  1PNM A;  3ZN0 A;  4R6Z A;  5L3E A;  1VQ5 V;  1K92 A;  4JAV A;  4UXN A;  3ETE A;  2EIL B;  3E8B A;  3CME V;  1VQL V;  2DQ3 A;  3QO8 A;  1JJ2 U;  3HPL C;  3G4S V;  5IY5 B;  2DWD C;  2UXX A;  2ITD C;  5HFL A;  5J9P C;  3EHB B;  1OCC B;  4RUE A;  2MK3 A;  2V1D A;  3HB3 B;  4ASU G;  1J95 A;  1R3J C;  1ARO P;  1F23 A;  1QLE C;  5LBQ A;  3JD1 A;  1VQO V;  3MD0 A;  3SYA A;  2W6J H;  3LSQ A;  1JVM A;  1YI2 V;  3AG2 C;  1K5Q A;  5B1B B;  1ORQ C;  3SJQ C;  4DO2 A;  2XND H;  1E79 H;  1IFP A;  1NBM G;  4JTA B;  2ZR3 A;  1DF4 A;  2Q69 A;  1QCE A;  2W6J G;  3FB7 C;  3K03 A;  3OMA B;  2X7R B;  4FJC C;  5GW7 A;  3AG1 B;  1VQ6 V;  5B1A C;  1F4M A;  1NVP B;  4KUM A;  3ETG A;  2XND G;  1E79 G;  4G2K A;  4TSF G;  1NVP D;  4MVQ A;  5B3S B;  2EIN B;  2XAH A;  1K3E A;  1PD3 A;  1E1Q G;  1KP2 A;  1YIJ V;  1S72 V;  4OXS A;  3ABT A;  4LP8 A;  3ASN B;  3K04 A;  1OCR B;  1K4D C;  4MW8 A;  4QJF B;  4QIW F;  5L3B A;  1MOF A;  3AG4 C;  4PA6 A;  2Y48 A;  2QTO A;  4L87 A;  3IFX A;  2OT5 A;  1FXK C;  5LHI A;  3CD6 V;  4E2L A;  5IYC O;  3W7T A;  3D3I A;  2JJ2 G;  2P7T C;  1G8M A;  3D36 A;  3ABM C;  3E2E A;  1WLE A;  4MVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...