3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords FAB light chain
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
4YXWH 3E8FA 4PDRA 4XDJA 3RVZA 4MVMA 1OCRC 3LDEA 1BSHA 4R7CA 4G28B 3RBZA 1JVMA 3TCUA 5BZBA 2QTOA 4TWKA 2AHZA 2XNDH 3IFXA 4GX0A 2P7TC 2EILC 2YEVA 3OUSA 3ABMC 3X2QC 3ASNC 3PJSK 2ZD9A 3VOUA 2Y69C 3F7YC 3OR6C 3FB7C 2ITCC 5IY5C 2A0LA 4I9WA 2WSSH 4GX5A 4RO2A 2QKSA 3K0GA 4PA9A 4LCUC 2HG5C 3STZC 4JTCB 4QE9A 4OXSA 1XL6A 2X6AA 4P2ZA 5EC2C 3E8GA 3FB6C 2KB1A 4PA7A 2R9RB 3BEHA 3T1CA 4PDLA 3LDDA 4MS2A 4XDKA 5EBMC 4MVQA 4PDMA 2Q67A 3SYOA 2EINC 5CBHA 5EBWC 1K4DC 2WLIB 2CK3H 5EC1C 3AG2C 3UM7A 4PDVA 1KKDA 1R3JC 2HVJC 3OR7C 4P9PA 2E5TA 1QLEC 1ORQC 2DYRC 5B1BC 3IGAC 5CBFA 4TLFA 4PA6A 3SPJA 2OCCC 2JK5C 2WLIA 3OGCC 4MVUA 2DYSC 4MVOA 2X6BA 4HZ3A 3ABKC 2ZXWC 1V54C 3SYPA 2Q69A 5B3SC 2IH1C 2NLJC 3KG2A 1JEKA 4DJGA 3E8HA 4R6ZA 2V7QH 3AG4C 3EFFK 4EKWA 5EBLC 2WLMA 3OUFA 2ITDC 3SPHA 4JTDB 4LP8A 3SYCA 2EIMC 2BOBC 2X6CA 4QE7A 1K4CC 3T4ZA 2IH3C 3SPGA 2EIJC 3ABLC 4X88A 4H33A 1FS0E 4UUJC 1OCCC 4RUEA 2Q68A 2BOCC 5E1AC 5EK0A 5B1AC 3SPCA 1BSNA 4QMAA 4MVSA 1BL8A 4RUFA 4WFHA 2JDIH 4GX2A 3TETA 3STLC 1M56C 4H37A 4PA3A 2AHYA 4MVRA 4J9ZB 3JYCA 1IFPA 2K1EA 4MW8A 3F7VC 1R3LC 1J95A 1P7BA 4WFEA 4WFFA 3LNMB 2WLKA 4P9OA 4X89A 2A79B 2ATKC 3AG3C 4PA4A 4DXWA 5CBGA 5J9PC 2E5YA 4MW3A 2WLJA 4XDLA 2QE7H 1S5HC 3T2MA 3RVYA 3GB7C 4CBCA 4GX1A 4P30A 2WLHA 3E86A 1ZWIC 2EIKC 4JTAB 1G4YB 3F5WC 4KFMA 3K03A 1V55C 4MTFA 4ZBMA 1LNQA 4WFGA 3K04A 1AQTA 4BW5A 4R8CA 3K08A 3SJQC 2HJFC 4MTGA 2HFEC 2Q6AA 5KUKA 4MSWC 3K0DA 5KUMA 3E89A 3ZJZA 4G27B 2DWDC 3LUTB 1E79H 3E83A 2HVKC 2DWEC 3FB8C 4QNHB 3LDCA 4WVZA 3E8BA 3SYAA 3K06A 1OCOC 4F4LA 1XL4A 2WLLB 4MTOA 3SPIA 3SYQA 1R3KC 3USSA 3R65A 4MVZA 2A9HA 4RAIA 3FB5C 4LBEC 3UKMA 4J9YB 2W0FC 3T4DA 4X8AA 2WLNA 3ASOC 3ZRSA 2W6JH 4R50A 1R3IC 3WG7C 4HYOA 2H8PC 3AG1C 2WLLA 1OCZC 3HPLC 3RW0A 1M57C
chains in the Genus database with same CATH superfamily
4AUWA 1KTMA 3CEIA 4JV5O 3M8AA 4W80A 3CYOA 1Y6XA 2PYLA 3TGUE 2YKPA 3BA9A 4ICGA 1NTKG 3RYFA 3JD2A 1M1KW 4UV8A 2DMXA 2EZPA 5LP6A 3BRTB 3I55V 2PGDA 3L73G 5GTHH 4DW0A 3H25A 2RMZA 1H89A 1JUNA 2R9RB 2N05A 3BEHA 3ZMZA 1VQ7V 1VF6C 3RFRA 4DV3B 1PL0A 4OH8B 3BPZA 1OCOB 3APQA 1SQPE 3I5DA 3CC4V 4CS4A 1U97A 2VRZA 3R4YA 4WWIA 1V9PA 5IYZA 4PA6A 2QJPC 4MVUA 3OGCC 2D2CC 1SETA 3JCZA 3SYPA 4WY4C 1M57B 5CCGD 4YJ3A 1O9HA 4DV7O 4B7KA 1H0TB 1SQFA 3FYEB 5AW7B 2UUCB 4O4LA 4J80A 2V7QJ 2IFNA 5CCHD 1IFMA 2LXCB 2ZM6B 3RK2C 3D6YA 2BOBC 2ARHA 3L72J 5BR8B 3SPGA 1K5QA 4DR3B 4DR7O 2Y69B 1FFXB 1VF7A 3UO3A 1OVRA 4IFMA 1SQBJ 5L8RJ 5C39A 4OPAA 1OCCC 5CB4B 2KSEA 3BABA 1K92A 4UCSA 5B1AC 3SPCA 2KZIA 2WZ7A 2YI8A 2LGQA 2PI4A 3QWOC 5B5EH 5C93A 4O4HA 3VQVA 2K9PA 3VMAA 5LHHA 1J5EO 1CI6B 1BE3J 5A2QN 1SS1A 1R6NA 3A8TA 3FXDA 1LUWA 2QVAA 4UB6Z 4LFAB 2M7WA 2A45H 3MIWA 1PPJH 2YIBA 1HVVA 1SQQK 1WRGA 1Q86Q 2WLKA 2MK3A 4LFBO 5CBGA 3AG3C 2BASA 5KHHA 4XDLA 3GF3A 1F4NA 1S5JA 1Y4MA 3MHHC 2OWOA 3AG3B 4UCRA 5KJ7A 1VP7A 3D70A 4X62O 5AW4B 2HPCA 1EFRG 3K59A 4H0LB 4QPJA 5LGNA 4LH7A 4ZKIA 1GU4A 1XQ8A 1UJWB 5IWAB 2ZNJA 1HDJA 3B8NA 2NPSA 1N7SB 5KAIH 2HODB 2JDIG 2NR5A 3HUSA 4UCVA 2PP6A 1WT6A 3B2EE 4DR4O 3C9IA 3OMIB 1KILC 3PLNA 4F4LA 1SQVD 2G38A 2OIGA 1JJ2U 1VQ8P 3WUTA 2LFSA 1SRYA 1IFJA 1WAZA 1CZQA 3PP5A 1KILB 2H88C 5BMVB 1LTJB 2BEZF 1I5XA 3RW0A 3E7KA 3G9RA 1FXKC 1XILA 1U7JA 4GODA 1Q3EA 3QO5A 2YIBD 4I50A 3PJSK 1H88A 1K7DA 4JI5B 2IFMA 3SWFA 5GONA 4ZKPA 1GL2B 3STZC 4LF8B 1W2EA 4DV3O 3CWBE 4TUYB 3E8GA 1SFCA 3ZRXA 1QU7A 1BHAA 3FD9A 4MS2A 5KJ7D 1S76D 2B89A 2L91A 1XHXA 1VQMV 1I0HA 2M8RA 1GH6A 1BGYD 1K9MW 1SQXE 4B86A 2Y9YA 1FJPA 5L3GA 4CS2A 4DT0A 1BGYH 3RK3D 4EB6B 1Q5OA 3UM7A 3KYQA 2HVJC 1FAVA 3K9AA 4P9PA 3LSSA 3NR7A 2NPSD 2WITA 3H1HD 1WNSA 3M9BA 2ZXXA 2DYRC 3ICXA 3H1HH 3TXQA 2YKOA 3H1IJ 2UUCO 2Q69A 4RQEA 1NKZB 1PGOA 2ZM6O 1WN7A 1FJKA 2XNDG 2ZIOA 5BR8O 2ZE8A 4JI4O 5IE9A 3JSNA 3NFQA 2EIMC 5B5EZ 1BHBA 4CZZA 2EIJC 1FS0E 5AW0B 1S9KD 4U3FG 4WBAA 3WUVA 1Z2GA 3IJ4A 1GMJA 3RBXA 2KP8A 2ZT9C 1EZVE 1MV8A 2KXPB 3OTFA 4UCOA 4LFAO 4H37A 1THZA 1FZAA 1P84E 5KLVK 2HEPA 1EZVI 1OVVA 3SJBC 1SFCD 1IO4A 2RQ6A 5H2FZ 4WFFA 3CC7P 5L3FA 3CCVP 4JBZA 2LFRA 1WLEA 1BCCD 4GKJB 1MSWD 2ZR3A 1W2BU 1W5CE 5APXA 1SERA 5KAIZ 5JQGA 3CCQP 3E35A 3E86A 2IM9A 2H89C 3E22B 1U7MA 3ABLB 2N1TC 3FKSG 1PGQA 1FBMA 2QA4P 3J80N 4JI3B 3L73H 5GTHE 1SQVJ 2XU6A 2JVDA 4D6TE 1AI7A 2E76C 3GVMA 2H8PD 2LR2A 2KLUA 3AE5C 1JCHA 3M0AA 3HE5B 3P8CD 1M56B 2YI9A 4I6MC 4MTOA 4O4JA 1Q7YQ 1FXHA 5JCOA 3FB5C 4YIOA 4JAAA 2YXQB 1ZUQA 2KKWA 2YUAA 3K58A 2C0WA 4PV1B 1JNMA 3KDPB 3ZHTA 2R32A 2ZR2A 1BSHA 4NTXA 5BZBA 4OGQD 2QTOA 1RHZB 2F1MA 3S3XA 1KV4A 3A0HZ 4UB8H 3TNUA 2WTYA 3ABMC 2M3EA 1KYOF 1Q8IA 1JY2P 3OM3B 1KBHA 2W83C 3RL0B 1JB0J 3HR0A 3T1HB 4XBFA 3FAVA 4CPGA 1W0KG 1N33B 2VQFO 2IJJA 2IZ1A 3SYOA 3H1HJ 4BW9A 3OMNB 1VQ8V 1PP9G 2XDJA 2W6JG 2JKVA 3L4FA 2UXBO 1VDFA 1L0NE 1PPJE 5LXTA 2WPVB 2P4VA 3BA8A 1XREA 4MVOA 2QM4A 2X6BA 1L0LK 1YCIA 2ZXWC 3ABKC 5CBNA 1JEKA 3JD4A 3RGBA 2A45I 5H6RA 1Y66A 1GK9A 4HNAB 3ABKB 2I8DA 2F4VO 3ZRVA 5A9GA 3IC9A 1TUBA 1FZEA 2R5DA 2E43A 3N2GA 2JIZG 5E1AC 2K37A 1K8AW 4QMAA 1KB9E 1AVMA 2M5AB 2JDIH 3PRJA 3K5OA 2YXHA 3Q5PA 1XMQB 2G8YA 1KB9I 3O65A 1BCCJ 1SQXK 5AVZB 3F7VC 4CC5A 4GKJO 3BASA 3WB0A 1NR7A 2B1IA 1NTZD 2IJIA 4IHJB 1K73W 1N73C 5B3SB 5F2VO 2Q4PA 2FYNC 1PL4A 4PD4D 3AG4B 2E75C 3F5TA 5AVQB 1FDIA 1JO5A 2RJZA 2Z5HA 3K9SA 1Q6IA 1X0TA 4AILC 4X9QA 4GOEA 4Q20A 1YBKA 3H1LE 4C7NB 3K0DA 3HE4B 4B3RO 5KAFZ 2R70A 2LJ2A 1GAXA 3JCUE 4I4TB 3N2KA 3DC6A 1T2KD 5CA1A 4JI2B 4XFJA 1US6A 4WVZA 2QDOA 1YI2P 3AE4C 2WLLB 1NH2D 1IFNA 3USSA 3CC7V 3H1JJ 3CCVV 1RSOB 3ZRSA 1J1DB 3WG7C 4UB8Z 5LA6A 2XUMA 2FXMA 3CHXA 5TISE 4DW1A 2ZQMA 1JTHB 1YZBA 1AJYA 5BU5A 4DRXB 3CCQV 3HD7A 3THOA 2XNDH 2V7QG 1NAYA 2R3CA 2JWAA 1H8EG 2MW2B 3FB7C 1BT8A 2QA4V 3T1HO 4I9WA 1M7LA 1NOHA 1VF5D 2KS1B 4U3FD 3FGAD 2FFDA 3CD6P 1SQBG 1N33O 1X8YA 1HW7A 4U3FH 2VWJA 1XL6A 2O1JA 5EYPB 4I9QA 5LYJA 3LDDA 2WA4A 1Q43A 3QO8A 2K9JB 1K05A 1BE3G 2BSKB 2AZ0A 1MZ9A 2QJKB 3VTPC 3P32A 1I08A 4U7OA 1VQPV 1JFFB 2E5TA 3JAWB 1ZOYC 1MZEA 1RM1B 1NVPB 1H2MA 4TQDA 1YIJV 4OWFA 5L3EA 1V54C 2M6YA 4FM0A 1HJBA 1NTMJ 2NLJC 3W7UA 5APQA 2WLMA 2E5LB 4JI7B 3ZRWB 5LOVA 4YPCA 5J2UA 2EILB 1W0JG 2X6CA 2YS8A 5EZYA 3X2QB 2IH3C 5JH7B 1IC2A 1LT9B 3II6A 3TSIA 1J1EC 3AEEC 1EN4A 2BE3A 4JZ2A 1L8DA 4H13C 4WFAV 5BU8B 1NTKE 3HD7D 1DLBA 3RYIB 4J7KA 5IJ0B 1XMQO 1CPYA 5CMZA 1R5LA 1OXZA 4RWUA 5M1BA 2Z5UA 1KECA 1QVGO 2XZRA 4PA3A 5LBQA 1L4AC 1NTZJ 4DV2B 4MVRA 1YITP 4J9ZB 3B71A 3VMYA 4WFBV 1ZRTE 4B3SB 1ZR2A 4DXWA 2WLJA 1L0NK 3L71D 4I2LC 1HWYA 1SZXA 4X1IB 3A0BH 1KILE 1HBWA 2QEXP 4K8XA 1GMGA 5B1OA 4QJFB 2JP3A 4B3TB 1WP8A 4W4LA 1LWUB 3J7AU 1ZAUA 2L35A 4Z2WA 1Y76A 1KYOD 2OYIB 3EHBB 3KCXA 1KYOH 5FNVB 2XAGA 3P3PA 3JARB 1TVKA 2QJ1A 4UCTA 4UVBA 3K5MA 1MG1A 1LJ2A 1PP9D 2XHBA 2GUSA 2OQQA 2XKMA 1PP9H 1O9GA 2W0FC 3W7TA 4X8AA 3ASOC 2W6JH 5BY1A 4IL6H 1XEQA 2YEVB 4OX9O 2O3JA 3EXAA 2KG7A 3H1IG 2QKCA 4K3AA 2Z0AA 2GUZB 3ZX6A 4N6JA 3RGUA 3TCUA 3D8CA 3BCCD 2P22C 4TWKA 1T3UA 3E1RA 4LC1A 1KQFB 3RYHB 2CTPA 1Y67A 2WSSH 1X79B 4N21A 1G2CB 2QKSA 4PA9A 3CCEP 1FU1A 2X6AA 2ZYAA 1SA0A 2YIAA 2E42A 3B8MA 3LIDA 5DECA 1YI2V 4MVQA 4ZI7B 1AFOA 1T3JA 1NJIW 5EBWC 1A02J 1U57A 1MSDA 1WP7A 4ASUG 3R2PA 1H38A 5H9CA 1LTSC 1AA0A 3BFRA 4BAYA 4X66B 1FC2C 1VIBA 2WLIA 1I7FA 2E5LO 4JI7O 1JOCA 1QNMA 1KC8W 3E8HA 1QVFU 3DXRB 3W7SA 1RF0A 4BRYB 2E74B 1QCEA 2IBZE 1NQTA 4F6RA 3IAOA 3CD6V 2QR4A 2Y0DA 3CX5E 3CE2A 1Q81W 4DO2A 2IBZI 2EZOA 2EJRA 4NKGB 1SQVG 5BVZA 1EC5A 5CCHC 1GN6A 3BATA 1MZFA 5KA5A 3B4SA 1YQ3C 4HYTB 4LLHA 1M9NA 3HKCA 1AI5A 1EZJA 5CMUA 3VMXA 1FOSE 2YKQA 3M0DA 1FZCB 1KP3A 1R3LC 2FXPA 2Y0IA 1DH3A 2EJ7A 2M0BA 3QO7A 2JS3A 3L71J 3A0BZ 4BWAA 3BY6A 2ZDIA 2R9IA 3G6BA 2PGGA 1PL5A 2CTWA 5LP6C 4DV0B 4B3TO 1ZL8A 2CAZC 1IK7A 2OYQA 3JALA 2R3SA 2V7QH 3WFVA 2MKVA 3IC7A 3CXHF 5KUKA 2Q6AA 1SQBH 4Z1VA 1M1JB 2YO3A 4JI8B 2KB7P 1RF1A 5EIBD 4FLXA 1PP9J 3L75D 3H1HG 3L75H 4IL6Z 1JY2N 3C8VA 3VYIA 4H44B 1YITV 4TV9A 1H2KA 1BE3H 3RYCB 3SYQA 2ZIMA 3CWBD 3GHGB 5KKZC 4WBNB 3UKMA 1YSCA 1RQUA 1AVYA 1LTBC 2XT9A 3BCCJ 1QEXA 4LH6A 3SWYA 4FFBA 5KKZB 1GW4A 1YJ9P 3JATB 2HG5D 1OCRC 5AVXB 1S5LH 1M93A 1VQKP 5APWA 1VQNP 2QEXV 2P7TC 1R6KA 2Y4TA 3R66A 3S4RA 4ZOLA 4RO2A 3D36A 5EC2C 1E79G 1P49A 5CCGA 3TDKA 4O4HB 4DK0A 3ZHQA 4XDKA 4J7JA 1FE6A 1AB3A 3CCMP 4HBNA 2Q9IA 3MDSA 2UWJE 4LWSB 4X65O 2Q73A 4X66O 4PDVA 2RNBA 1BCCG 1EZVD 3U1CA 1NU1G 2UXDB 4X1YA 3MP7B 4ASVA 3LSQA 5KJ7C 4CC6A 1VEWA 2BTOA 1WB7A 1HJ0A 3AG1B 2IJHA 5E79Z 1YTZT 1P84D 4DV5B 3JSVC 4AQYB 3RK3C 4X64O 4K0KO 2NPSC 3OUFA 4ZHQA 3JAMN 2WT7B 3KZIH 4JQ0D 4GT1A 3IR9A 3HUSC 3IN6A 3CCEV 5KLVE 1YTFD 3H1KD 1BQZA 2KNCA 3MHVA 2UXCO 1IFIA 1Y74B 1SQGA 4IIJA 2CUGA 1H2GA 1OW6A 4ZMDA 5JWPA 1T8ZA 1MMMA 1DK1A 5CHXA 3AE3C 3AEGC 4QGPA 1USEA 3H1JG 2WVRA 3P3NA 1NR1A 2Q7GA 2WPDG 3LNMB 4P9OA 2QSIA 5APTA 1MKMA 2IJKA 2QJPB 5AVSB 2OTJP 3H1ID 2QWQB 2D2CB 4O4IB 4DV0O 3H1IH 3B5NA 4WY4B 3SJCC 2PUSA 3GB7C 3HKBA 4TSFG 3Q5SA 1B6QA 4I50B 2XNXA 3K3WA 4HAMA 4LGDE 3RK2B 5DN6G 3L75J 1LTTC 1Q82Q 1AR5A 1GK6A 4X1KB 1KD1W 1URFA 1OCCB 2Q3EA 4DR5B 5B1AB 1XMOB 3CWBJ 1HNWB 3U1AA 1SC5B 2HP8A 2Q1KA 1N7LA 5KMGB 3ZN1A 3JD0A 3B77A 2P58A 1FZBA 1Z56A 3ZN0A 2Z3YA 2GTSA 2DE0X 1JCCA 1S5LZ 2KK7A 4LR3A 2RN9A 2H8PC 5HFMA 5H2FH 1M90W 1J2JB 1HR0O 2K88A 1NTMG 5AVVB 3JASA 2XV5A 1JVMA 1QVFO 1DD4A 2KZJA 3OUSA 4DUZB 3UT5A 3BRVB 3D6ZA 2QSAA 2ITCC 1XNQB 2JRIA 1ROPA 4BIUA 2JEEA 1EDJA 3B5ND 4IFFA 4DR1B 1AV1A 1HF9A 2Q9LA 2UUAO 3ZDMA 1QLED 4OGQC 3T1CA 4EI2A 1JPXA 1NYHA 3K79A 1SQVH 4UVCA 1L0LE 3CC2P 1NT2B 4PD4F 2UXDO 1GU5A 1NTZG 4ZIBA 4J10A 2QTSA 4A5UB 4F6EA 4M3LA 4JI1B 4AQYO 3KZIZ 5AW5B 3OFNG 1YJ9V 1R73A 3M91A 5C8YA 1VQNV 3OE7G 1FXKB 1COWG 2LGWA 3NTNA 4ASWA 3N7NA 1H2LA 4YIPA 4LP8A 3H1KJ 1N86A 1DX7A 3A0HH 2WAMA 2ADQB 4XE5B 3L72E 4I7ZC 1QHTA 1JY2O 2BCCD 3ETGA 2BCCH 4EOTA 4JYCA 1GTOA 5JCOC 3CCMV 2UU9B 1BL8A 2F43G 2HHHB 5AW6B 2OTLP 3CXHD 4NR1A 4D6TJ 1FFXA 1NKDA 1LUVA 2ADPA 4MTXA 2QWPB 5CB4A 3CXHH 2ZKOA 3FFQA 1OWAA 1BE3E 2A06D 1SS3A 3JAKB 2ZNIA 2A06H 5JJNB 4UB6E 2DYRB 1CI6A 1X22A 4DK1A 4DR3O 1PM9A 4D7TA 1GTWA 1EDLA 1LTAC 5CBOA 3CCSP 3GWOA 2P6JA 1YYCA 2QWRB 3A7OA 3LSUA 2WQYC 4KFMA 4TV8B 3A0RA 2EIMB 1XOUA 1RPOA 5IJ9B 5IYDO 2AEMA 4DR5O 3H32B 3CCJP 5FPOA 2EIJB 1XMOO 1HNWO 3K08A 4RQFA 4B08A 1LP1B 1A02F 3KQGA 5K1XA 2OARA 2CTRA 2ZT9B 3N27A 3DC5A 1E79H 1EXJA 3VBBA 2DW3A 1S72P 2EULA 4RESB 3M7MX 1AROP 1FDMA 1M57D 5AVRB 1XL4A 1N7SA 1VMGA 2Y0PA 1NU1D 1BCCH 2OTJV 1NU1H 4PI2A 1NKNA 4KUMA 1T2KC 2I1JA 2GV9A 5IWAO 4JAVA 2KOGA 2J59M 4DUZO 3AE2C 1XNQO 3A5TA 1KILA 4J7ZA 3Q2YA 5BMVA 5LMNB 1LTJA 3ASNC 3CJHB 1TUBB 2ZE6A 1YTZI 1PV3A 5IY5C 3EWKA 2A0LA 3SFDC 2N1TB 1OFCX 3AEFC 1XHZA 3UQ8A 1QVGU 1JX9A 1QL1A 1F51A 4GKGA 3ASNB 5KAFH 3KKYA 3EFGA 5AW9B 2E76B 2QRXA 3V5BA 5CBHA 1RY3A 2P7JA 4X20B 1GL2A 1VF5C 4TUYA 3AG2C 1PNLA 1X59A 4N3YB 1AJNA 3H1JD 1U96A 3H1JH 3L71G 4PJ0H 5B66H 2OCCC 1DF5A 4JI5O 4H0LD 4NB5A 2DYSC 2W6BA 4EB6A 4L8JA 4UXNA 1WA8B 3Q4HB 5JVDB 4LF8O 1DIPA 1N7SD 1PV0A 3DGEA 1FYJA 1RE4A 3SPHA 2BCCJ 3SYCA 1WJZA 3ABMB 1PZQA 2PI5A 4R4MA 1WMKA 2UU9O 2HHHO 5B5EE 3ZCCA 4L74A 3W7XA 4FLVA 3H1LJ 5EK0A 2PAJA 3CRCA 5FPRA 4J42A 5CA1B 5IDJA 3CC2V 1KILD 4K8ZA 3WU2H 2CPBA 1T6AA 2V4DA 1KMIZ 3STLC 3QVNA 2AHYA 2P10A 1IVSA 1EN6A 2O01J 1UFIA 2OYHA 3HD7C 3O9OA 1TA8A 2R44A 1KZUB 3BCCG 2A79B 2ATKC 1GW3A 1FD9A 4LNUB 2C2AA 4MW3A 2ZXWB 1GL2D 1NTMD 1S1CX 3FYIB 2FFDC 2WSSG 1S5HC 4GUNA 1NTMH 3T2MA 2DQ3A 4PHZA 1JR9A 4KT0J 2R5BA 4JTAB 3D71A 5KAIE 3ETQA 1ZP0C 3UIAA 3FWNA 4MSWC 3ZJZA 1MOFA 2OTLV 2QG4A 3O6QB 1GM8A 3E22A 2LO1A 4JI0B 1SKVA 3C3SA 2RH0A 1NU1J 3ABTA 2JJ1G 4W4KA 5GTIZ 3AEIA 1SQBK 1X9VA 2UUBB 3HTKB 1X4TA 1NTZH 1JMBA 2AXTZ 5ITZB 2B9ZA 4DV1B 3HE5A 2BEQD 3CCSV 1CXZB 4PD4H 5KX5B 3HPLC 2YIUC 3L74D 1KKDA 1N73B 5LMNO 4EIJA 4WCEV 1NI8A 3OT7A 4JI3O 1A32A 2FYNB 3I5CA 3L37A 2E75B 3EVKA 4GX0A 4AQRD 3ZMTA 2AW9A 3CCJV 1M8OB 3FX7A 2B5UA 2D3OW 2RMKB 3FB6C 1S72V 3MD0A 1VQOP 1BGYE 4YHHB 3RK3E 3VQXA 4PJ0Z 5B66Z 3CX5D 5EC1C 1CSBA 1IFDA 3H1HE 1PFIA 2GHYA 1SQQD 3M9HA 1IDSA 3IGAC 1M1KQ 1D7MA 2YO2A 2Y9ZA 3WG7B 3ZHVA 4YXWG 1URQC 1YXBA 2B88A 4C46A 3AK3A 3KG2A 4JYYA 4R6ZA 1VQLP 1N2DC 1LR1A 2ITDC 1URQB 1AILA 4EEQA 4JYAB 2DW4A 1K4CC 2ZYDA 1S9KE 3WU2Z 3BVOA 1M56D 5K5GB 2ZJSE 1Q86W 3L75G 1AI4A 2B87B 2F95B 2WSCH 3FX0A 1EBOA 1QX8A 3AK2A 4HNAA 2JGDB 5CA0A 4I55B 2W8ZA 2ZXEB 3S3WA 4FM1A 1Y76B 3G71P 3CCRP 3M99B 1OW8A 3CWBG 3L70D 5JJEB 4PV1D 3SFEC 2Q7CA 5B1NA 4O9BA 3TETA 2FYUD 1TVKB 2IDBA 2FYUH 1JOYA 1IBMB 2VWKA 4YJ2B 1JY3P 1E5WA 4C7UA 2M5AA 3W68A 1H2SB 3VQWA 2CH7B 2KG7B 2ZINA 1BCCE 2K9YA 1IZ3A 2E5YA 1V54B 2PYJA 4NTYA 2W6AA 3RL0D 4I0XB 4ABMA 1KD1Q 1QQCA 2WLHA 1G1IA 2YC0A 3PN1A 4IHJA 1HNZB 3V2PA 4O2AB 1J1EB 2PRRA 1GN4A 1YEWA 4UV9A 3SGIA 3L73E 4JI0O 1FS0G 2XAHA 4H13B 3U0ZA 3T1YB 5KUMA 2N04A 4L76A 3CMEP 1Z5VA 5AW1B 3SSUA 3E83A 1P84F 2DWEC 1EZVG 4QNHB 5KAFE 2K1AA 1HNXB 3SYAA 1SVFA 1YJNP 4C7NA 1EXIA 4HKZH 1TGOA 4CH6A 1L4AB 3T97B 1FZGA 1LGHB 1WPBA 4I4TA 3L74J 1KQSU 1I94B 1LT1A 2NN4A 2RDCA 1RF0C 3HKDB 3DSQA 5EIBC 3K5LA 5J2TB 1YQ4C 1R3IC 3L71H 2QJYC 1K4DC 2WLLA 2W90A 1L2PA 3GWKC 4UB8E 3CS5A 1RSOA 4U3JB 2QJYB 4JI2O 3D3IA 2P2UA 3H1KG 2IU0A 2ZVOB 3TGUD 4IT5A 1JTHA 3TGUH 2J5UA 2Q5UA 3FWLA 4UVAA 3SDLA 3K0GA 2HG5C 5FLXN 2CE4A 2PY5A 3M0DC 5EBMC 1N32B 5CJ0A 4PDMA 1SQQJ 2EINC 2VS0A 2KS1A 3A3YB 4D6TG 3K57A 2ZDIC 3CSXA 2A3QA 1SESA 3JD3A 4L87A 4EFEA 5EYPA 2DN9A 1SQVK 1SQPD 1D5NA 2K9JA 1SQPH 4GLXA 4FLTA 4KXRA 5B1BC 3ASOB 1GN3A 2BSKA 1Q6UA 1AJPA 3L9DA 3MZWB 2AGAA 3BCCH 3HKEB 3PHLA 4JYAO 2E3CA 1Y8AA 1IX9A 1JFFA 3JAWA 4JASA 2WSCJ 4EKWA 3AEDC 3UO2A 4FLYA 2C0XA 1K9MQ 2BTQB 1RF1C 1FJGB 1DF4A 3OA7A 3NXSA 2P5OA 3L70J 3ZIAG 3ZRWA 1VQOV 1QLNA 2FYUJ 5KHJA 2PTMA 2KQXA 5JH7A 1LT9A 1KQGB 3SR2C 1RP3B 2EX3A 4TV9B 1N34B 2GA1A 2NRGA 3MGNA 3RWRD 4LF6B 2QM7A 3RYIA 5IJ0A 1NTZE 4WFEA 3H6PA 4Y28J 2ILMA 4O2BB 1VQLV 1R1BA 3CC4P 5E79H 5EFWB 4KHXA 3MHSC 1HNZO 3D36C 4GX1A 1Q7YW 4TOIA 5CCGC 1ZWIC 2EIKC 3OEHG 2N74A 1V55C 2YIDA 4G2KA 4ZOLB 4PD4I 1D2DA 1KB9F 4DV2O 2HJFC 3G71V 4X1IA 2YXRB 1NVPD 1OX3A 2DWDC 4B3SO 2HVKC 2WSEJ 1PKXA 3AEBC 2N9YB 5DJTB 2QWOB 1LWUA 1NHLA 1BDCA 4MVZA 1JMKC 4X1YB 3ZHRA 3KPEA 2OYIA 1HH0A 2DQ0A 1L0LD 4HH2A 4N78E 5FNVA 1MABG 1OCZC 3JARA 2KUBA 2O01N 2Q7HA 4YXWH 3TGUJ 4XDJA 3RYFB 4D7SA 1NU1K 2YDEA 5LP6B 2QIWA 3AE8C 4NXMB 2BCCG 2YEVA 2Q3IA 2FTKA 3MUDA 4U3FE 4NTWA 2L6LA 1OW7A 3CMEV 1QR9A 4GX5A 1N32O 2O57A 1TAEA 2IYOA 1HTLC 4B3MB 3LIEA 3G80A 4OXSA 2IW5A 3H1LG 5KA6A 1IK9A 1DEBA 3VP9A 3ZBHA 5KLVJ 2YMKA 3RYHA 3ZMUA 1GD2E 4BIZA 2A06G 1YJNV 1ZSPA 1ZX3A 1JM0A 3CWBH 2CTQA 2Q67A 3D3QA 1SQPJ 1K34A 5IYZB 5H6QA 1FDOA 2HYNA 3IF4A 3JC22 3U59A 1Q90D 1SQXD 3CI9A 2JJ2G 1M5IA 3B5NC 3OR7C 4YJ3B 5LHGA 1CP9A 1QLEC 5CBFA 1EM1A 4O4LB 1M4UA 4OPHA 2JK5C 3NMDA 1FXVA 4Q6GA 4GZRB 4N23A 4B7EA 1OZ0A 1FJGO 1OCRB 1F23A 2WPSA 1E1RG 3ZEDA 3G67A 5GW7A 3OGIB 4LFCB 1N0JA 2YXLA 4DV4B 3S1KA 2WPQA 3DXRA 4BRYA 1BS3A 3O8ZA 1N4CA 3A2FA 5AW2B 4JGSA 5KLIC 4IFDK 4MVSA 1FPOA 1MUUA 2JJLA 1Z5WA 4L73A 3M9QA 1JA8A 1EZVH 2JGUA 5KHKA 4Y99C 5KLIB 2LW7A 1H2NA 2GBOA 1MFZA 5AW3B 2X7RB 3WUUA 1P84H 1KQSO 4Y99B 1VPCA 2HPCB 4CH5A 1HP8A 1CEZA 1FZFA 2HFED 2YSUB 3WB1A 3A0BE 3RK3B 1K8AQ 1FZCA 4PI0A 4BR6A 2F66C 2NPSB 4JPRA 5L3BA 3G4SP 3F5WC 2P06A 1LNQA 4JF3A 3H1KH 3HUSB 1AQTA 2GTAA 1NTMK 4R8CA 2FBWC 4TT3H 4FZ1A 3LW5J 1KYOE 4IGGA 1VQ6P 1K73Q 1D5AA 2KLVA 2KSDA 4DR2B 1UIXA 2ODMA 3ML0A 3BAAA 4NPEA 4D6TD 3PH0A 1OCOC 1PP9E 1L0LJ 4D6TH 4A7PA 1KYOI 1M1JA 2VRSA 2E74D 4IL6E 2KIKA 1R6TA 1Y9BA 4MN4C 2MJZA 1XDCA 3B09A 2CPSA 4OVNF 4IL6X 3RYCA 5C8YB 1NTZK 1SFCC 4NXMO 1M57C 3GHGA 4WBNA 4MVMA 3LDEA 3J81N 3BCCE 5GONB 4JI8O 2OT5A 1TUEB 4FK5C 1N8RW 1SFCB 1VQ5P 4FVMA 2H43A 3GW6A 4B3MO 1VQ9P 2Y69C 3F7YC 1B04A 3JATA 4RO0A 1E1QG 1KQLA 2V1DA 1IBLB 1MNGA 4LCUC 4UFZA 3JD1A 4P2ZA 1EDIA 1SQXJ 4JI4B 2RKLA 3QH9A 5CN0A 2AEJA 2Z4EA 3OAKA 5CA3A 2HLDG 2WWWA 4Z1MG 1TU3F 2K3RA 4FMTA 1R3JC 1OV9A 1ZW0A 2G3AA 5IT9N 4LWSA 1L0ND 1WPXA 1PPJD 4GCZA 3CB2A 1K97A 2FKXA 1JY3N 3AE7C 4BWNA 1L0NH 4DCKA 2LKMA 1YF2A 1HWTC 4LFCO 1ZN5A 5EBLC 5E79E 3L35A 3GLMA 5TJHA 4DV4O 3P8MC 4I1LA 4JTDB 2IPPA 4GDOA 4DYLA 5D5PA 3Q5RA 1RE3A 4H44D 4H0LC 3ZMVA 2WMMA 3MTUE 3GMAA 3APOA 5AVYB 1KFMA 3W67A 3RL0g 1N7SC 2Q68A 1K33A 2BOCC 2WT7A 4JYBA 4FIPC 4OGQB 2P4KA 2Y0CA 1KB9D 5APUA 3ITKA 2LW1A 5IYBO 4DV5O 1OIPA 1KB9H 3AK1A 3L74G 2M3BA 1Y74A 1KUQA 3IFMA 1P7BA 1VF6A 1VQKV 4X89A 5JQGB 1NWQA 4PA4A 2FYUK 1LTJC 4BXLA 1CW5A 3E1IA 1H0TA 3WB2A 4YTPC 2V4HA 1PNMA 3CX5F 4O4IA 4BIOA 3K03A 4WFGA 5LGTA 2IBZG 4DV6B 4WY4A 1SQBE 1S4XA 3SJQC 5GTHZ 1GL2C 4I7ZB 4DR2O 2ITAA 1G1XB 3E89A 1PIXA 4O4JB 3H1LD 3L75E 4U7JA 3LUTB 4LF4B 3H1LH 2R72A 1FOSF 3LNNA 3LDCA 1SQQG 3JCUH 4PELA 3OJAB 2QM8A 4X1KA 1SLQA 3SPIA 4C7RA 2OGUA 2O01H 5KMGA 1RE4C 2B9BA 3I56P 2F23A 1ZR4A 3TNUB 1S5LE 2VQFB 2QE7G 3VOPA 3E8FA 3RVZA 1Y47A 4JZGA 5TISH 3G4SV 2B1GA 2GUVA 5DM6V 1S5LX 1IBLO 3VP8A 2JO1A 2JR8A 4JPZB 3FAVB 1IXBA 2UXBB 2WSFH 3FXEA 3L70G 3RT3C 3SJAC 1VQ6V 4GOFA 2FYUG 1JMMA 2OYHC 1XTGB 2Q7EA 2HODA 3AEAC 1UIIA 5BXZA 2D2CD 1AVOA 3F5HA 2F4VB 1XNRB 4WY4D 5LXTB 5GTIH 5CJ4A 4CH3A 3IAYA 2OYHB 5AW8B 1L0NJ 1S77D 1EDKA 5APVA 3CMAP 1R8EA 3AECC 1ORQC 3B8EB 3RK2D 2AXTH 2CGOA 3QF7A 3AE1C 4DR1O 1DEEG 1SQPK 3KZIE 3M06A 3GF7A 1XUQA 4YY3B 2RN0A 1SZTA 1NH2B 2JWDA 3N2GB 1VQ5V 3HRNA 1VQ9V 1P84I 1NJIQ 1T5EA 2XOKG 3K5BA 3ABLC 4X88A 1AQ5A 5IY5B 1F7YA 3H1KE 1FXKA 2YICA 2QKAA 4JI1O 3H9VA 3AG7A 1NTKD 1NTKH 1KC8Q 2GSMB 3L73D 3TF5A 2AEFA 1M56C 1PD3A 3BRCA 3JSLA 1VF5B 3CL3D 4DOJA 3AG2B 3U11A 3JYCA 1VL2A 4B3RB 2I1KA 1ZMEC 4PV1C 3CCUP 3H1IE 2OCCB 4EDFA 4LF5B 2DYSB 1ZRTD 3C1LA 1Q81Q 3TGUG 3S9OA 2H94A 1SF9A 3JAKA 5IYCO 1VQPP 2ZAEB 4DV6O 4NYKA 4CBCA 1YIJP 5KHIA 2C9LY 3N2KB 4WB4A 1JCDA 3JCUZ 4LF4O 4MTGA 3CXCU 4FM2A 3RL0C 1Q2NA 2C9NY 5KLVG 1HGZA 4TV8A 3BVHA 5IJ9A 1G8MA 3FB8C 3H32A 1SQPG 1BGYJ 4YXDC 1PGPA 1LP1A 2IU3A 5LA6B 2WPRA 1YJWP 3CCLP 3OAAG 3RN4A 2YMYA 1GN2A 1JY3O 5H2FE 3CRAA 2Q0OC 4Z1MH 4EFBA 3Q1MA 3MAQA 2F93B 3HD7B 2WLNA 5TISZ 2QGNA 2ZE7A 3TXSA 4NPFX 2FYZA 2WSFJ 5FL7G 3P30A 2W27A 2FFDB 4J41A 4R7CA 3RBZA 4NXNB 1IURA 1USDA 5LYJB 1IXMA 3V4WA 1GZLA 2ZD9A 3OR6C 4FLUA 2PF4E 5KTBA 5CA0B 4JTCB 4QE9A 4IYIA 1SQVE 2Y48A 3H01A 1XNRO 3C90A 4CH4A 3CJHA 5APSA 2N1TA 1WB8A 4FPPA 5APYA 3DTUB 5AVTB 1OHHG 3I56V 3L74H 4RJTA 4X20A 3SPJA 4YY3O 5LOVB 5J2UB 2IZ0A 2HKOA 5B3SC 5EZYB 2YIUB 1EN5A 2P90A 5LMUB 2KSJA 2CGNA 3A2AA 3AG4C 3EQ2A 2ZT9D 3A0HE 1R5SA 3CPWU 3VN0A 2KYVA 2HJDA 1WA8A 3Q4HA 5JVDA 1DD3A 2IBZD 1KORA 1NTKJ 2BCCE 2IBZH 2XAFA 5JJJB 2OTKE 4I5SA 2FMLA 3L73J 3V6IA 1VARA 3CXHE 4RUFA 4IYHA 3CX5H 5LHIA 1BQ0A 1KKCA 4GX2A 2CK3G 2RCVA 2FKWB 1LTIC 1IJDB 1SQQH 1L0LG 2A06E 2ZE5A 3CMAV 2ZFCA 4LF5O 2K1EA 2ZCEA 1Q82W 3CXHI 3B40A 5LGUA 1J1DC 1ENVA 2X0LA 1GM7A 5J9PC 2N1TD 3QG5A 1NZ6A 3UCSC 2A7WA 4FLWA 2QE7H 2VQEB 2DJVA 2DOSA 1RFYA 3F89A 1GO3F 1K04A 3QTCA 4ZKUA 2AZ2A 2E76D 4N78D 4LNUA 4IOIH 1G4YB 3WMM0 2Q0AA 1Q6HA 1RPRA 3CRMA 1AR1B 4OX9B 3L70H 2FL4A 1YHQP 3L72G 1QBZA 4G27B 4UCUA 1SQXG 4U7NA 3K5NA 2FXOA 2POHA 1IZNB 1XTCC 3OEEG 3ZS8C 3OW2U 3ZMSA 1OZHA 2QJKC 1JJOA 3OD4A 4AYCA 3O6QA 1NU1E 2A9HA 5GTIE 4KHPB 4FFKA 3CCUV 4LBEC 1S0VA 4J9YB 3T4DA 1RM1C 1GDTA 1KU9A 4R50A 2OYOA 2YXYA 4NVPA 1KP2A 2AXTE 4NXNO 1N8RQ 3T4ZA 5H5NA 3HTKA 2ZVNB 4PDRA 1DTOA 5ITZA 2AHZA 1NGMB 2AXCA 3U10A 1HUCA 1SA0B 1YVWA 2EILC 3X2QC 2EBOA 2P67A 5KX5A 3E2EA 1LT9C 1W59A 1PGJA 1N73A 3V2NA 2UUBO 3L36A 1ZLLA 3P8CE 1W2BO 3OTOB 3HE4A 4PA7A 2KB1A 3G6EP 4DV1O 4PDLA 1M90Q 1YJWV 1I5YA 3CCLV 3KHUA 2SPZA 3ZHUA 4NPDA 2WSEH 1SP4A 2WLIB 1UPGA 3BHPA 5AVWB 2Q8VA 3H1JE 1BDDA 4PJ0E 3TJTA 5B66E 1VQ4P 4QPKA 3V2RA 5LMUO 1NO4A 2UXXA 2N9BA 1HGVA 1RH5B 2ETNA 5LL6Y 4HZ3A 3N4XA 4F6RB 2JS5A 3G3ZA 2L5GB 4TT3G 4DRXA 2FY8A 4YHHO 4JI6B 4DR6B 1NAFA 2Z5IA 2CDYA 1B06A 1OJHA 1NVOA 5HFLA 1F4MA 4FLZA 1K5SA 2Y0EA 4UUJC 4MT8A 1EQ7A 1LWUC 3WU2E 3HKCB 3VQYA 1URQA 5KLVD 4FZ0A 4EYYQ 5KLVH 2OYIC 3CRQA 4WFHA 3VMZA 2HR3A 2B87A 2EINB 4R4LA 1QR8A 2Q6QA 1FKAO 2JGDA 4I55A 3W7WA 4HJGH 2E75D 4MW8A 1GKFA 1XBLA 2W6IG 1DGSA 4ZNCA 5B1BB 2VQEO 4DUYB 3CRRA 3ABUA 1ZL8B 3OMAB 1LTGC 1NTME 3JALB 3MUDC 2J58A 2UXNA 4YJ2A 1S2EA 4KL1A 1S3JA 3RVYA 2CH7A 1JQ0A 5L3CA 4P30A 1RF1B 4ZBMA 1N36B 5DEDA 4BW5A 2NZ2A 3V4QA 2LQTA 2W0XA 4U3FJ 4I0XA 1G6UA 2HFEC 1IBMO 1AI6A 3PTZA 3I55P 2LP7A 2H7HA 1AJQA 4O2AA 4W7YA 1QGKB 3E8BA 4KHPO 4DZOA 1K3EA 1NS1A 1VQ7P 1P7GA 1H8HG 4FFBB 2A45G 3R65A 4LF9B 1L0NG 1AP5A 1YTFB 4FJCC 2OIEA 4RAIA 4GKKB 1PPJG 1URQD 4PD4E 1MA1A 4LF7B 3KXDA 4AI8A 1FFTB 3L74E 1IBKB 3C3TA 3V2QA 3TYYA 1L4AA 2ZYGA 3T97A 2XTAA 3T1YO 4X65B 1P4RA 2JEXA 4G28B 3HKDA 2E74C 2WA3A 5KHGA 5J2TA 1YDXA 3IFXA 3CCRV 3ETDA 1HNXO 3CPWO 3OTOO 4AHCA 2EIKB 4JV5B 3VOUA 1V55B 1NH4A 3CLQA 1YHQV 5L3DA 4JAUA 4U3JA 1I94O 1NBMG 4X64B 1RQVA 4K0KB 3LW5H 1PNKA 1QL2A 1AP6A 2QWNB 4TQFA 1KN7A 1H8AA 2CK3H 1B3QA 1SQQE 1BMFG 1L0LH 2LXBA 1FZCC 4TLFA 3CX5I 2UXCB 2PFXA 4ZHQB 1OCZB 4JI6O 1ZTEA 4CS3A 4E4EA 2IH1C 5D5QA 4DR6O 4H13D 4DJGA 3EFFK 1BZKA 2GUZA 1AR4A 2O1KA 2KNCB 4E2LA 4DV7B 4QE7A 4IIJB 5AVUB 3TK1A 4KP4A 3ETEA 3HKEA 5K1PA 4H33A 1L4AD 2NNUA 4KJMA 2GDSA 3G6EV 1G2CA 4RUEA 3L70E 3L72D 2BTQA 4RKUJ 4DR7B 1M1JC 4L75A 1BSNA 5AG2A 3L72H 1SQXH 2PZSA 2FYUE 4QIWF 1BGYG 1SQBD 4ZI7A 1FAFA 4H44C 3Q3DA 4K35A 1VQ4V 2XAJA 4DUYO 3GHGC 4XA4A 3OW2O 4GIFA 1XI1A 4WF9V 1J5EB 1IFPA 3B5NB 1NTKK 1N0NA 1J95A 1BE3D 1ZV8A 3SWKA 1QLEB 2YNYA 3P7KA 3HKBB 1KFNA 3ABVC 2OCHA 3HB3B 3CP1A 4UB6H 2Q5ZA 2IX7C 1BSMA 1N36O 3QNEA 4LFBB 1G1JA 1OVUA 1GK4A 1N34O 2R9AA 4MTFA 4O2BA 3K04A 2KI7B 3AE9C 2FB5A 5DJUB 4LF6O 2H3OA 4GYCB 4X62B 1HR0B 3AE6C 1L1FA 3ZHSA 2Y4UA 4HB1A 1GM9A 4W7ZA 2XASA 4LF9O 2GM4A 4GKKO 4JF7A 4J11A 2IYPA 3K06A 1VQMP 4LF7O 2HLOA 1R3KC 1IBKO 3JASB 3L71E 4DR4B 5CCHA 2JEUA 2UUAB 1ZXGA 4HYOA 1GRJA 1ZLZA 3AG1C 1MFTA 2XAQA 2P1JA 3GG2A 1OMIA 1RE3C 3UT5B 3KCYA
chains in the Genus database with same CATH topology
3E8FA 3RVZA 4WCEV 3CYOA 3TCUA 4TWKA 2B1GA 3G4SV 5DM6V 4GX0A 3ZMTA 3CCJV 4LC1A 3JD2A 1M1KW 2WSSH 4UV8A 4N21A 2QKSA 4PA9A 2B5UA 2EZPA 3I55V 2D3OW 1VQ6V 2X6AA 3FB6C 2R9RB 3BEHA 3MD0A 1S72V 3B8MA 3ZMZA 1VQ7V 4MVQA 1YI2V 1PL0A 5EBWC 1NJIW 4ASUG 1OCOB 5EC1C 1H38A 3CC4V 1S77D 2GHYA 5H9CA 1ORQC 3IGAC 4BAYA 4PA6A 2WLIA 3OGCC 4MVUA 4YXWG 3WG7B 1SETA 3JCZA 3SYPA 1M57B 3KG2A 1KC8W 3E8HA 4R6ZA 1QVFU 3FYEB 1SZTA 3W7SA 1NH2B 1VQ5V 1QCEA 2ITDC 1VQ9V 2BOBC 2XOKG 1NQTA 2DW4A 1K4CC 3SPGA 3CD6V 1K5QA 2Y69B 3ABLC 4X88A 1Q86W 1AI4A 5IY5B 1FXKA 1EBOA 1OCCC 1Q81W 5B1AC 1K92A 3SPCA 2EZOA 4DO2A 2EJRA 2PI4A 3M99B 5C93A 5LHHA 5B1NA 2GSMB 3TETA 5KA5A 1M56C 1R6NA 1PD3A 1M9NA 1AI5A 1EZJA 5CMUA 1JOYA 3AG2B 3JYCA 2M7WA 1KP3A 1R3LC 3QO7A 2WLKA 2MK3A 2OCCB 3BY6A 2ZDIA 3AG3C 5CBGA 2DYSB 2R9IA 2E5YA 4XDLA 1V54B 2H94A 5IYCO 1F4NA 1Y4MA 3MHHC 4CBCA 3AG3B 2WLHA 2V7QH 1EFRG 3WFVA 3IC7A 4QPJA 5LGNA 4ZKIA 4UV9A 5KUKA 4MTGA 2Q6AA 1FS0G 2XAHA 1UJWB 5KUMA 3CXCU 3B8NA 2JDIG 3E83A 1G8MA 3FB8C 2DWEC 4QNHB 3SYAA 2IU3A 3OMIB 1YITV 4F4LA 3OAAG 3SYQA 1JJ2U 3UKMA 1KQSU 2LFSA 1SRYA 1YSCA 2WLNA 1R3IC 2WLLA 1K4DC 1I5XA 3RW0A 5FL7G 3P30A 1OCRC 4R7CA 1FXKC 3RBZA 3D3IA 2P7TC 1R6KA 3QO5A 2QEXV 2IU0A 1IXMA 3PJSK 2ZD9A 1K7DA 3OR6C 4RO2A 4UVAA 3K0GA 3D36A 2HG5C 3STZC 1E79G 4JTCB 4QE9A 5EC2C 2Y48A 3H01A 3E8GA 3ZRXA 1BHAA 5EBMC 4MS2A 4XDKA 1S76D 1VQMV 4PDMA 2EINC 1K9MW 5L3GA 2ZDIC 4FPPA 1SESA 3JD3A 4L87A 3DTUB 3UM7A 4PDVA 1OHHG 2HVJC 3K9AA 4P9PA 3LSSA 3I56V 2DYRC 5B1BC 3ASOB 3LSQA 3SPJA 1AJPA 3AG1B 2HKOA 2IJHA 5B3SC 2P90A 2Q69A 4RQEA 2XNDG 4JASA 3AG4C 4EKWA 3CPWU 3OUFA 2EIMC 4GT1A 1DF4A 1BHBA 3NXSA 4CZZA 3CCEV 2EIJC 1FS0E 2XAFA 3ZIAG 1YTFD 4I5SA 3ZRWA 1VQOV 1QLNA 4RUFA 1H2GA 5LHIA 4GX2A 2CK3G 4H37A 1THZA 3CMAV 2K1EA 2QM7A 1Q82W 5LGUA 4WFFA 4WFEA 1NR1A 2WPDG 3LNMB 1ENVA 4P9OA 2X0LA 5L3FA 2IJKA 1GM7A 5J9PC 2LFRA 1WLEA 1VQLV 1MSWD 2ZR3A 2QE7H 1W2BU 3MHSC 1GO3F 3GB7C 4GX1A 4TSFG 1B6QA 1Q7YW 1SERA 3E35A 3E86A 1ZWIC 2EIKC 3K3WA 3OEHG 1G4YB 4HAMA 1V55C 4G2KA 1RPRA 5DN6G 1AR1B 3ABLB 2HJFC 3G71V 3FKSG 1KD1W 1OCCB 1QBZA 5B1AB 1NVPD 4G27B 2DWDC 4U7NA 1AI7A 2HVKC 1PKXA 1JCHA 3OEEG 3ZN1A 3JD0A 3OW2U 3B77A 3ZMSA 1M56B 4MTOA 3ZN0A 2Z3YA 1FXHA 4MVZA 2A9HA 3FB5C 3CCUV 4LBEC 1S0VA 4J9YB 3T4DA 1RM1C 4R50A 2DQ0A 1KP2A 5HFMA 2H8PC 1MABG 1OCZC 3T4ZA 1M90W 4YXWH 2ZR2A 4PDRA 4XDJA 1BSHA 1DTOA 1JVMA 5BZBA 2QTOA 2AHZA 2YEVA 2EILC 3X2QC 3OUSA 3ABMC 2EBOA 2P67A 2FTKA 3E2EA 2ITCC 3CMEV 1QR9A 1ROPA 4GX5A 4BIUA 3OM3B 4OXSA 2IW5A 5KA6A 4PA7A 2KB1A 3T1CA 4XBFA 4PDLA 3ZMUA 1JPXA 4BIZA 3K79A 1W0KG 1I5YA 3CCLV 1YJNV 2IJJA 2Q67A 4UVCA 3SYOA 1K34A 1YJWV 5H6QA 2WLIB 3OMNB 1VQ8V 2JJ2G 3OR7C 4QPKA 2W6JG 5LHGA 1CP9A 1QLEC 5CBFA 2UXXA 2JK5C 3OFNG 1YJ9V 4MVOA 1FXVA 1R73A 2X6BA 3ABKC 2ZXWC 4HZ3A 1JEKA 4N23A 1OZ0A 3JD4A 1OCRB 4TT3G 1VQNV 3OE7G 1FXKB 1COWG 1F23A 5H6RA 1Y66A 1GK9A 1E1RG 3ABKB 4LP8A 5GW7A 3ZRVA 2WAMA 5HFLA 1F4MA 1K5SA 4UUJC 4MT8A 3ETGA 2JIZG 5E1AC 4JGSA 4JYCA 1GTOA 3CCMV 1K8AW 4QMAA 4MVSA 1BL8A 2F43G 4WFHA 2HR3A 2JDIH 2EINB 1NKDA 1QR8A 4MTXA 3W7WA 2X7RB 4MW8A 1GKFA 2W6IG 3F7VC 2DYRB 1NR7A 5B1BB 2B1IA 3OMAB 3ABUA 2IJIA 1K73W 5B3SB 1CEZA 2UXNA 2P6JA 2YSUB 3GWOA 1S3JA 3AG4B 3RVYA 1JQ0A 5L3CA 4P30A 4JPRA 5L3BA 3A0RA 2EIMB 3F5WC 1RPOA 4KFMA 4ZBMA 4JF3A 1LNQA 5IYDO 1AQTA 2EIJB 4BW5A 4R8CA 3K08A 4RQFA 4Q20A 2HFEC 1AI6A 3K0DA 1E79H 2LP7A 1AJQA 3VBBA 3ML0A 4WVZA 3E8BA 1AROP 1K3EA 1OCOC 1H8HG 1XL4A 2WLLB 1NH2D 3USSA 3R65A 1YTFB 4FJCC 4RAIA 3CC7V 3CCVV 2OTJV 3ZRSA 1FFTB 3WG7C 4KUMA 1M57C 2ZQMA 4JAVA 1P4RA 3LDEA 4MVMA 2JEXA 3CCQV 4G28B 2OT5A 2XNDH 2V7QG 1TUEB 3IFXA 4FK5C 3ETDA 3CCRV 1N8RW 2EIKB 3ASNC 1H8EG 3VOUA 1V55B 2Y69C 3F7YC 3FB7C 5IY5C 1E1QG 2A0LA 4I9WA 2QA4V 2V1DA 5L3DA 1YHQV 4JAUA 4LCUC 1QVGU 3JD1A 1JX9A 1XL6A 1F51A 1NBMG 4P2ZA 3ASNB 3LDDA 3QO8A 5CN0A 1PNKA 5CBHA 5CA3A 2HLDG 2WWWA 4Z1MG 2CK3H 3AG2C 4FMTA 1BMFG 1PNLA 1R3JC 1AJNA 3P32A 4U7OA 1VQPV 2E5TA 1RM1B 1NVPB 4TLFA 2OCCC 1DF5A 1YIJV 2DYSC 5L3EA 1V54C 1OCZB 1WPXA 4GCZA 1K97A 4UXNA 2IH1C 2NLJC 3W7UA 4DJGA 3EFFK 5EBLC 3DGEA 2WLMA 3ZRWB 3SPHA 4JTDB 3SYCA 2EILB 1W0JG 2X6CA 3ABMB 4QE7A 3X2QB 2IH3C 4E2LA 2PI5A 3TK1A 4KP4A 3ETEA 3ZMVA 4H33A 2NNUA 3ZCCA 4WFAV 3W7XA 3G6EV 4RUEA 2Q68A 1K33A 2BOCC 5EK0A 1BSNA 4JYBA 4FIPC 1DLBA 5IDJA 3CC2V 1CPYA 4QIWF 5IYBO 3STLC 2Z5UA 1KECA 1VQ4V 2XAJA 2AHYA 4PA3A 5LBQA 4MVRA 4J9ZB 1IFPA 4WF9V 1J95A 4WFBV 1QLEB 1P7BA 1VQKV 4X89A 2A79B 2ATKC 4PA4A 4DXWA 3HB3B 2C2AA 4MW3A 3CP1A 2WLJA 2ZXWB 3FYIB 2WSSG 1S5HC 1HWYA 3QNEA 3T2MA 2DQ3A 4JTAB 1PNMA 3K03A 4MTFA 4WFGA 3K04A 5LGTA 1GMGA 5B1OA 4QJFB 3SJQC 4MSWC 1L1FA 3E89A 3ZJZA 1MOFA 2OTLV 1GM9A 2XASA 3LUTB 1GM8A 3LDCA 3EHBB 3ABTA 2JJ1G 4PELA 3AEIA 3K06A 2QM8A 2XAGA 3SPIA 1R3KC 4UVBA 1MG1A 2JEUA 2W0FC 3W7TA 4X8AA 3ASOC 2W6JH 4HYOA 3CCSV 3AG1C 2XAQA 2YEVB 2QE7G 3HPLC 1KKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXW H;  3E8F A;  4PDR A;  4XDJ A;  3RVZ A;  4MVM A;  1OCR C;  3LDE A;  1BSH A;  4R7C A;  4G28 B;  3RBZ A;  1JVM A;  3TCU A;  5BZB A;  2QTO A;  4TWK A;  2AHZ A;  2XND H;  3IFX A;  4GX0 A;  2P7T C;  2EIL C;  2YEV A;  3OUS A;  3ABM C;  3X2Q C;  3ASN C;  3PJS K;  2ZD9 A;  3VOU A;  2Y69 C;  3F7Y C;  3OR6 C;  3FB7 C;  2ITC C;  5IY5 C;  2A0L A;  4I9W A;  2WSS H;  4GX5 A;  4RO2 A;  2QKS A;  3K0G A;  4PA9 A;  4LCU C;  2HG5 C;  3STZ C;  4JTC B;  4QE9 A;  4OXS A;  1XL6 A;  2X6A A;  4P2Z A;  5EC2 C;  3E8G A;  3FB6 C;  2KB1 A;  4PA7 A;  2R9R B;  3BEH A;  3T1C A;  4PDL A;  3LDD A;  4MS2 A;  4XDK A;  5EBM C;  4MVQ A;  4PDM A;  2Q67 A;  3SYO A;  2EIN C;  5CBH A;  5EBW C;  1K4D C;  2WLI B;  2CK3 H;  5EC1 C;  3AG2 C;  3UM7 A;  4PDV A;  1KKD A;  1R3J C;  2HVJ C;  3OR7 C;  4P9P A;  2E5T A;  1QLE C;  1ORQ C;  2DYR C;  5B1B C;  3IGA C;  5CBF A;  4TLF A;  4PA6 A;  3SPJ A;  2OCC C;  2JK5 C;  2WLI A;  3OGC C;  4MVU A;  2DYS C;  4MVO A;  2X6B A;  4HZ3 A;  3ABK C;  2ZXW C;  1V54 C;  3SYP A;  2Q69 A;  5B3S C;  2IH1 C;  2NLJ C;  3KG2 A;  1JEK A;  4DJG A;  3E8H A;  4R6Z A;  2V7Q H;  3AG4 C;  3EFF K;  4EKW A;  5EBL C;  2WLM A;  3OUF A;  2ITD C;  3SPH A;  4JTD B;  4LP8 A;  3SYC A;  2EIM C;  2BOB C;  2X6C A;  4QE7 A;  1K4C C;  3T4Z A;  2IH3 C;  3SPG A;  2EIJ C;  3ABL C;  4X88 A;  4H33 A;  1FS0 E;  4UUJ C;  1OCC C;  4RUE A;  2Q68 A;  2BOC C;  5E1A C;  5EK0 A;  5B1A C;  3SPC A;  1BSN A;  4QMA A;  4MVS A;  1BL8 A;  4RUF A;  4WFH A;  2JDI H;  4GX2 A;  3TET A;  3STL C;  1M56 C;  4H37 A;  4PA3 A;  2AHY A;  4MVR A;  4J9Z B;  3JYC A;  1IFP A;  2K1E A;  4MW8 A;  3F7V C;  1R3L C;  1J95 A;  1P7B A;  4WFE A;  4WFF A;  3LNM B;  2WLK A;  4P9O A;  4X89 A;  2A79 B;  2ATK C;  3AG3 C;  4PA4 A;  4DXW A;  5CBG A;  5J9P C;  2E5Y A;  4MW3 A;  2WLJ A;  4XDL A;  2QE7 H;  1S5H C;  3T2M A;  3RVY A;  3GB7 C;  4CBC A;  4GX1 A;  4P30 A;  2WLH A;  3E86 A;  1ZWI C;  2EIK C;  4JTA B;  1G4Y B;  3F5W C;  4KFM A;  3K03 A;  1V55 C;  4MTF A;  4ZBM A;  1LNQ A;  4WFG A;  3K04 A;  1AQT A;  4BW5 A;  4R8C A;  3K08 A;  3SJQ C;  2HJF C;  4MTG A;  2HFE C;  2Q6A A;  5KUK A;  4MSW C;  3K0D A;  5KUM A;  3E89 A;  3ZJZ A;  4G27 B;  2DWD C;  3LUT B;  1E79 H;  3E83 A;  2HVK C;  2DWE C;  3FB8 C;  4QNH B;  3LDC A;  4WVZ A;  3E8B A;  3SYA A;  3K06 A;  1OCO C;  4F4L A;  1XL4 A;  2WLL B;  4MTO A;  3SPI A;  3SYQ A;  1R3K C;  3USS A;  3R65 A;  4MVZ A;  2A9H A;  4RAI A;  3FB5 C;  4LBE C;  3UKM A;  4J9Y B;  2W0F C;  3T4D A;  4X8A A;  2WLN A;  3ASO C;  3ZRS A;  2W6J H;  4R50 A;  1R3I C;  3WG7 C;  4HYO A;  2H8P C;  3AG1 C;  2WLL A;  1OCZ C;  3HPL C;  3RW0 A;  1M57 C; 
#chains in the Genus database with same CATH topology
 4AUW A;  1KTM A;  3CEI A;  4JV5 O;  3M8A A;  4W80 A;  3CYO A;  1Y6X A;  2PYL A;  3TGU E;  2YKP A;  3BA9 A;  4ICG A;  1NTK G;  3RYF A;  3JD2 A;  1M1K W;  4UV8 A;  2DMX A;  2EZP A;  5LP6 A;  3BRT B;  3I55 V;  2PGD A;  3L73 G;  5GTH H;  4DW0 A;  3H25 A;  2RMZ A;  1H89 A;  1JUN A;  2R9R B;  2N05 A;  3BEH A;  3ZMZ A;  1VQ7 V;  1VF6 C;  3RFR A;  4DV3 B;  1PL0 A;  4OH8 B;  3BPZ A;  1OCO B;  3APQ A;  1SQP E;  3I5D A;  3CC4 V;  4CS4 A;  1U97 A;  2VRZ A;  3R4Y A;  4WWI A;  1V9P A;  5IYZ A;  4PA6 A;  2QJP C;  4MVU A;  3OGC C;  2D2C C;  1SET A;  3JCZ A;  3SYP A;  4WY4 C;  1M57 B;  5CCG D;  4YJ3 A;  1O9H A;  4DV7 O;  4B7K A;  1H0T B;  1SQF A;  3FYE B;  5AW7 B;  2UUC B;  4O4L A;  4J80 A;  2V7Q J;  2IFN A;  5CCH D;  1IFM A;  2LXC B;  2ZM6 B;  3RK2 C;  3D6Y A;  2BOB C;  2ARH A;  3L72 J;  5BR8 B;  3SPG A;  1K5Q A;  4DR3 B;  4DR7 O;  2Y69 B;  1FFX B;  1VF7 A;  3UO3 A;  1OVR A;  4IFM A;  1SQB J;  5L8R J;  5C39 A;  4OPA A;  1OCC C;  5CB4 B;  2KSE A;  3BAB A;  1K92 A;  4UCS A;  5B1A C;  3SPC A;  2KZI A;  2WZ7 A;  2YI8 A;  2LGQ A;  2PI4 A;  3QWO C;  5B5E H;  5C93 A;  4O4H A;  3VQV A;  2K9P A;  3VMA A;  5LHH A;  1J5E O;  1CI6 B;  1BE3 J;  5A2Q N;  1SS1 A;  1R6N A;  3A8T A;  3FXD A;  1LUW A;  2QVA A;  4UB6 Z;  4LFA B;  2M7W A;  2A45 H;  3MIW A;  1PPJ H;  2YIB A;  1HVV A;  1SQQ K;  1WRG A;  1Q86 Q;  2WLK A;  2MK3 A;  4LFB O;  5CBG A;  3AG3 C;  2BAS A;  5KHH A;  4XDL A;  3GF3 A;  1F4N A;  1S5J A;  1Y4M A;  3MHH C;  2OWO A;  3AG3 B;  4UCR A;  5KJ7 A;  1VP7 A;  3D70 A;  4X62 O;  5AW4 B;  2HPC A;  1EFR G;  3K59 A;  4H0L B;  4QPJ A;  5LGN A;  4LH7 A;  4ZKI A;  1GU4 A;  1XQ8 A;  1UJW B;  5IWA B;  2ZNJ A;  1HDJ A;  3B8N A;  2NPS A;  1N7S B;  5KAI H;  2HOD B;  2JDI G;  2NR5 A;  3HUS A;  4UCV A;  2PP6 A;  1WT6 A;  3B2E E;  4DR4 O;  3C9I A;  3OMI B;  1KIL C;  3PLN A;  4F4L A;  1SQV D;  2G38 A;  2OIG A;  1JJ2 U;  1VQ8 P;  3WUT A;  2LFS A;  1SRY A;  1IFJ A;  1WAZ A;  1CZQ A;  3PP5 A;  1KIL B;  2H88 C;  5BMV B;  1LTJ B;  2BEZ F;  1I5X A;  3RW0 A;  3E7K A;  3G9R A;  1FXK C;  1XIL A;  1U7J A;  4GOD A;  1Q3E A;  3QO5 A;  2YIB D;  4I50 A;  3PJS K;  1H88 A;  1K7D A;  4JI5 B;  2IFM A;  3SWF A;  5GON A;  4ZKP A;  1GL2 B;  3STZ C;  4LF8 B;  1W2E A;  4DV3 O;  3CWB E;  4TUY B;  3E8G A;  1SFC A;  3ZRX A;  1QU7 A;  1BHA A;  3FD9 A;  4MS2 A;  5KJ7 D;  1S76 D;  2B89 A;  2L91 A;  1XHX A;  1VQM V;  1I0H A;  2M8R A;  1GH6 A;  1BGY D;  1K9M W;  1SQX E;  4B86 A;  2Y9Y A;  1FJP A;  5L3G A;  4CS2 A;  4DT0 A;  1BGY H;  3RK3 D;  4EB6 B;  1Q5O A;  3UM7 A;  3KYQ A;  2HVJ C;  1FAV A;  3K9A A;  4P9P A;  3LSS A;  3NR7 A;  2NPS D;  2WIT A;  3H1H D;  1WNS A;  3M9B A;  2ZXX A;  2DYR C;  3ICX A;  3H1H H;  3TXQ A;  2YKO A;  3H1I J;  2UUC O;  2Q69 A;  4RQE A;  1NKZ B;  1PGO A;  2ZM6 O;  1WN7 A;  1FJK A;  2XND G;  2ZIO A;  5BR8 O;  2ZE8 A;  4JI4 O;  5IE9 A;  3JSN A;  3NFQ A;  2EIM C;  5B5E Z;  1BHB A;  4CZZ A;  2EIJ C;  1FS0 E;  5AW0 B;  1S9K D;  4U3F G;  4WBA A;  3WUV A;  1Z2G A;  3IJ4 A;  1GMJ A;  3RBX A;  2KP8 A;  2ZT9 C;  1EZV E;  1MV8 A;  2KXP B;  3OTF A;  4UCO A;  4LFA O;  4H37 A;  1THZ A;  1FZA A;  1P84 E;  5KLV K;  2HEP A;  1EZV I;  1OVV A;  3SJB C;  1SFC D;  1IO4 A;  2RQ6 A;  5H2F Z;  4WFF A;  3CC7 P;  5L3F A;  3CCV P;  4JBZ A;  2LFR A;  1WLE A;  1BCC D;  4GKJ B;  1MSW D;  2ZR3 A;  1W2B U;  1W5C E;  5APX A;  1SER A;  5KAI Z;  5JQG A;  3CCQ P;  3E35 A;  3E86 A;  2IM9 A;  2H89 C;  3E22 B;  1U7M A;  3ABL B;  2N1T C;  3FKS G;  1PGQ A;  1FBM A;  2QA4 P;  3J80 N;  4JI3 B;  3L73 H;  5GTH E;  1SQV J;  2XU6 A;  2JVD A;  4D6T E;  1AI7 A;  2E76 C;  3GVM A;  2H8P D;  2LR2 A;  2KLU A;  3AE5 C;  1JCH A;  3M0A A;  3HE5 B;  3P8C D;  1M56 B;  2YI9 A;  4I6M C;  4MTO A;  4O4J A;  1Q7Y Q;  1FXH A;  5JCO A;  3FB5 C;  4YIO A;  4JAA A;  2YXQ B;  1ZUQ A;  2KKW A;  2YUA A;  3K58 A;  2C0W A;  4PV1 B;  1JNM A;  3KDP B;  3ZHT A;  2R32 A;  2ZR2 A;  1BSH A;  4NTX A;  5BZB A;  4OGQ D;  2QTO A;  1RHZ B;  2F1M A;  3S3X A;  1KV4 A;  3A0H Z;  4UB8 H;  3TNU A;  2WTY A;  3ABM C;  2M3E A;  1KYO F;  1Q8I A;  1JY2 P;  3OM3 B;  1KBH A;  2W83 C;  3RL0 B;  1JB0 J;  3HR0 A;  3T1H B;  4XBF A;  3FAV A;  4CPG A;  1W0K G;  1N33 B;  2VQF O;  2IJJ A;  2IZ1 A;  3SYO A;  3H1H J;  4BW9 A;  3OMN B;  1VQ8 V;  1PP9 G;  2XDJ A;  2W6J G;  2JKV A;  3L4F A;  2UXB O;  1VDF A;  1L0N E;  1PPJ E;  5LXT A;  2WPV B;  2P4V A;  3BA8 A;  1XRE A;  4MVO A;  2QM4 A;  2X6B A;  1L0L K;  1YCI A;  2ZXW C;  3ABK C;  5CBN A;  1JEK A;  3JD4 A;  3RGB A;  2A45 I;  5H6R A;  1Y66 A;  1GK9 A;  4HNA B;  3ABK B;  2I8D A;  2F4V O;  3ZRV A;  5A9G A;  3IC9 A;  1TUB A;  1FZE A;  2R5D A;  2E43 A;  3N2G A;  2JIZ G;  5E1A C;  2K37 A;  1K8A W;  4QMA A;  1KB9 E;  1AVM A;  2M5A B;  2JDI H;  3PRJ A;  3K5O A;  2YXH A;  3Q5P A;  1XMQ B;  2G8Y A;  1KB9 I;  3O65 A;  1BCC J;  1SQX K;  5AVZ B;  3F7V C;  4CC5 A;  4GKJ O;  3BAS A;  3WB0 A;  1NR7 A;  2B1I A;  1NTZ D;  2IJI A;  4IHJ B;  1K73 W;  1N73 C;  5B3S B;  5F2V O;  2Q4P A;  2FYN C;  1PL4 A;  4PD4 D;  3AG4 B;  2E75 C;  3F5T A;  5AVQ B;  1FDI A;  1JO5 A;  2RJZ A;  2Z5H A;  3K9S A;  1Q6I A;  1X0T A;  4AIL C;  4X9Q A;  4GOE A;  4Q20 A;  1YBK A;  3H1L E;  4C7N B;  3K0D A;  3HE4 B;  4B3R O;  5KAF Z;  2R70 A;  2LJ2 A;  1GAX A;  3JCU E;  4I4T B;  3N2K A;  3DC6 A;  1T2K D;  5CA1 A;  4JI2 B;  4XFJ A;  1US6 A;  4WVZ A;  2QDO A;  1YI2 P;  3AE4 C;  2WLL B;  1NH2 D;  1IFN A;  3USS A;  3CC7 V;  3H1J J;  3CCV V;  1RSO B;  3ZRS A;  1J1D B;  3WG7 C;  4UB8 Z;  5LA6 A;  2XUM A;  2FXM A;  3CHX A;  5TIS E;  4DW1 A;  2ZQM A;  1JTH B;  1YZB A;  1AJY A;  5BU5 A;  4DRX B;  3CCQ V;  3HD7 A;  3THO A;  2XND H;  2V7Q G;  1NAY A;  2R3C A;  2JWA A;  1H8E G;  2MW2 B;  3FB7 C;  1BT8 A;  2QA4 V;  3T1H O;  4I9W A;  1M7L A;  1NOH A;  1VF5 D;  2KS1 B;  4U3F D;  3FGA D;  2FFD A;  3CD6 P;  1SQB G;  1N33 O;  1X8Y A;  1HW7 A;  4U3F H;  2VWJ A;  1XL6 A;  2O1J A;  5EYP B;  4I9Q A;  5LYJ A;  3LDD A;  2WA4 A;  1Q43 A;  3QO8 A;  2K9J B;  1K05 A;  1BE3 G;  2BSK B;  2AZ0 A;  1MZ9 A;  2QJK B;  3VTP C;  3P32 A;  1I08 A;  4U7O A;  1VQP V;  1JFF B;  2E5T A;  3JAW B;  1ZOY C;  1MZE A;  1RM1 B;  1NVP B;  1H2M A;  4TQD A;  1YIJ V;  4OWF A;  5L3E A;  1V54 C;  2M6Y A;  4FM0 A;  1HJB A;  1NTM J;  2NLJ C;  3W7U A;  5APQ A;  2WLM A;  2E5L B;  4JI7 B;  3ZRW B;  5LOV A;  4YPC A;  5J2U A;  2EIL B;  1W0J G;  2X6C A;  2YS8 A;  5EZY A;  3X2Q B;  2IH3 C;  5JH7 B;  1IC2 A;  1LT9 B;  3II6 A;  3TSI A;  1J1E C;  3AEE C;  1EN4 A;  2BE3 A;  4JZ2 A;  1L8D A;  4H13 C;  4WFA V;  5BU8 B;  1NTK E;  3HD7 D;  1DLB A;  3RYI B;  4J7K A;  5IJ0 B;  1XMQ O;  1CPY A;  5CMZ A;  1R5L A;  1OXZ A;  4RWU A;  5M1B A;  2Z5U A;  1KEC A;  1QVG O;  2XZR A;  4PA3 A;  5LBQ A;  1L4A C;  1NTZ J;  4DV2 B;  4MVR A;  1YIT P;  4J9Z B;  3B71 A;  3VMY A;  4WFB V;  1ZRT E;  4B3S B;  1ZR2 A;  4DXW A;  2WLJ A;  1L0N K;  3L71 D;  4I2L C;  1HWY A;  1SZX A;  4X1I B;  3A0B H;  1KIL E;  1HBW A;  2QEX P;  4K8X A;  1GMG A;  5B1O A;  4QJF B;  2JP3 A;  4B3T B;  1WP8 A;  4W4L A;  1LWU B;  3J7A U;  1ZAU A;  2L35 A;  4Z2W A;  1Y76 A;  1KYO D;  2OYI B;  3EHB B;  3KCX A;  1KYO H;  5FNV B;  2XAG A;  3P3P A;  3JAR B;  1TVK A;  2QJ1 A;  4UCT A;  4UVB A;  3K5M A;  1MG1 A;  1LJ2 A;  1PP9 D;  2XHB A;  2GUS A;  2OQQ A;  2XKM A;  1PP9 H;  1O9G A;  2W0F C;  3W7T A;  4X8A A;  3ASO C;  2W6J H;  5BY1 A;  4IL6 H;  1XEQ A;  2YEV B;  4OX9 O;  2O3J A;  3EXA A;  2KG7 A;  3H1I G;  2QKC A;  4K3A A;  2Z0A A;  2GUZ B;  3ZX6 A;  4N6J A;  3RGU A;  3TCU A;  3D8C A;  3BCC D;  2P22 C;  4TWK A;  1T3U A;  3E1R A;  4LC1 A;  1KQF B;  3RYH B;  2CTP A;  1Y67 A;  2WSS H;  1X79 B;  4N21 A;  1G2C B;  2QKS A;  4PA9 A;  3CCE P;  1FU1 A;  2X6A A;  2ZYA A;  1SA0 A;  2YIA A;  2E42 A;  3B8M A;  3LID A;  5DEC A;  1YI2 V;  4MVQ A;  4ZI7 B;  1AFO A;  1T3J A;  1NJI W;  5EBW C;  1A02 J;  1U57 A;  1MSD A;  1WP7 A;  4ASU G;  3R2P A;  1H38 A;  5H9C A;  1LTS C;  1AA0 A;  3BFR A;  4BAY A;  4X66 B;  1FC2 C;  1VIB A;  2WLI A;  1I7F A;  2E5L O;  4JI7 O;  1JOC A;  1QNM A;  1KC8 W;  3E8H A;  1QVF U;  3DXR B;  3W7S A;  1RF0 A;  4BRY B;  2E74 B;  1QCE A;  2IBZ E;  1NQT A;  4F6R A;  3IAO A;  3CD6 V;  2QR4 A;  2Y0D A;  3CX5 E;  3CE2 A;  1Q81 W;  4DO2 A;  2IBZ I;  2EZO A;  2EJR A;  4NKG B;  1SQV G;  5BVZ A;  1EC5 A;  5CCH C;  1GN6 A;  3BAT A;  1MZF A;  5KA5 A;  3B4S A;  1YQ3 C;  4HYT B;  4LLH A;  1M9N A;  3HKC A;  1AI5 A;  1EZJ A;  5CMU A;  3VMX A;  1FOS E;  2YKQ A;  3M0D A;  1FZC B;  1KP3 A;  1R3L C;  2FXP A;  2Y0I A;  1DH3 A;  2EJ7 A;  2M0B A;  3QO7 A;  2JS3 A;  3L71 J;  3A0B Z;  4BWA A;  3BY6 A;  2ZDI A;  2R9I A;  3G6B A;  2PGG A;  1PL5 A;  2CTW A;  5LP6 C;  4DV0 B;  4B3T O;  1ZL8 A;  2CAZ C;  1IK7 A;  2OYQ A;  3JAL A;  2R3S A;  2V7Q H;  3WFV A;  2MKV A;  3IC7 A;  3CXH F;  5KUK A;  2Q6A A;  1SQB H;  4Z1V A;  1M1J B;  2YO3 A;  4JI8 B;  2KB7 P;  1RF1 A;  5EIB D;  4FLX A;  1PP9 J;  3L75 D;  3H1H G;  3L75 H;  4IL6 Z;  1JY2 N;  3C8V A;  3VYI A;  4H44 B;  1YIT V;  4TV9 A;  1H2K A;  1BE3 H;  3RYC B;  3SYQ A;  2ZIM A;  3CWB D;  3GHG B;  5KKZ C;  4WBN B;  3UKM A;  1YSC A;  1RQU A;  1AVY A;  1LTB C;  2XT9 A;  3BCC J;  1QEX A;  4LH6 A;  3SWY A;  4FFB A;  5KKZ B;  1GW4 A;  1YJ9 P;  3JAT B;  2HG5 D;  1OCR C;  5AVX B;  1S5L H;  1M93 A;  1VQK P;  5APW A;  1VQN P;  2QEX V;  2P7T C;  1R6K A;  2Y4T A;  3R66 A;  3S4R A;  4ZOL A;  4RO2 A;  3D36 A;  5EC2 C;  1E79 G;  1P49 A;  5CCG A;  3TDK A;  4O4H B;  4DK0 A;  3ZHQ A;  4XDK A;  4J7J A;  1FE6 A;  1AB3 A;  3CCM P;  4HBN A;  2Q9I A;  3MDS A;  2UWJ E;  4LWS B;  4X65 O;  2Q73 A;  4X66 O;  4PDV A;  2RNB A;  1BCC G;  1EZV D;  3U1C A;  1NU1 G;  2UXD B;  4X1Y A;  3MP7 B;  4ASV A;  3LSQ A;  5KJ7 C;  4CC6 A;  1VEW A;  2BTO A;  1WB7 A;  1HJ0 A;  3AG1 B;  2IJH A;  5E79 Z;  1YTZ T;  1P84 D;  4DV5 B;  3JSV C;  4AQY B;  3RK3 C;  4X64 O;  4K0K O;  2NPS C;  3OUF A;  4ZHQ A;  3JAM N;  2WT7 B;  3KZI H;  4JQ0 D;  4GT1 A;  3IR9 A;  3HUS C;  3IN6 A;  3CCE V;  5KLV E;  1YTF D;  3H1K D;  1BQZ A;  2KNC A;  3MHV A;  2UXC O;  1IFI A;  1Y74 B;  1SQG A;  4IIJ A;  2CUG A;  1H2G A;  1OW6 A;  4ZMD A;  5JWP A;  1T8Z A;  1MMM A;  1DK1 A;  5CHX A;  3AE3 C;  3AEG C;  4QGP A;  1USE A;  3H1J G;  2WVR A;  3P3N A;  1NR1 A;  2Q7G A;  2WPD G;  3LNM B;  4P9O A;  2QSI A;  5APT A;  1MKM A;  2IJK A;  2QJP B;  5AVS B;  2OTJ P;  3H1I D;  2QWQ B;  2D2C B;  4O4I B;  4DV0 O;  3H1I H;  3B5N A;  4WY4 B;  3SJC C;  2PUS A;  3GB7 C;  3HKB A;  4TSF G;  3Q5S A;  1B6Q A;  4I50 B;  2XNX A;  3K3W A;  4HAM A;  4LGD E;  3RK2 B;  5DN6 G;  3L75 J;  1LTT C;  1Q82 Q;  1AR5 A;  1GK6 A;  4X1K B;  1KD1 W;  1URF A;  1OCC B;  2Q3E A;  4DR5 B;  5B1A B;  1XMO B;  3CWB J;  1HNW B;  3U1A A;  1SC5 B;  2HP8 A;  2Q1K A;  1N7L A;  5KMG B;  3ZN1 A;  3JD0 A;  3B77 A;  2P58 A;  1FZB A;  1Z56 A;  3ZN0 A;  2Z3Y A;  2GTS A;  2DE0 X;  1JCC A;  1S5L Z;  2KK7 A;  4LR3 A;  2RN9 A;  2H8P C;  5HFM A;  5H2F H;  1M90 W;  1J2J B;  1HR0 O;  2K88 A;  1NTM G;  5AVV B;  3JAS A;  2XV5 A;  1JVM A;  1QVF O;  1DD4 A;  2KZJ A;  3OUS A;  4DUZ B;  3UT5 A;  3BRV B;  3D6Z A;  2QSA A;  2ITC C;  1XNQ B;  2JRI A;  1ROP A;  4BIU A;  2JEE A;  1EDJ A;  3B5N D;  4IFF A;  4DR1 B;  1AV1 A;  1HF9 A;  2Q9L A;  2UUA O;  3ZDM A;  1QLE D;  4OGQ C;  3T1C A;  4EI2 A;  1JPX A;  1NYH A;  3K79 A;  1SQV H;  4UVC A;  1L0L E;  3CC2 P;  1NT2 B;  4PD4 F;  2UXD O;  1GU5 A;  1NTZ G;  4ZIB A;  4J10 A;  2QTS A;  4A5U B;  4F6E A;  4M3L A;  4JI1 B;  4AQY O;  3KZI Z;  5AW5 B;  3OFN G;  1YJ9 V;  1R73 A;  3M91 A;  5C8Y A;  1VQN V;  3OE7 G;  1FXK B;  1COW G;  2LGW A;  3NTN A;  4ASW A;  3N7N A;  1H2L A;  4YIP A;  4LP8 A;  3H1K J;  1N86 A;  1DX7 A;  3A0H H;  2WAM A;  2ADQ B;  4XE5 B;  3L72 E;  4I7Z C;  1QHT A;  1JY2 O;  2BCC D;  3ETG A;  2BCC H;  4EOT A;  4JYC A;  1GTO A;  5JCO C;  3CCM V;  2UU9 B;  1BL8 A;  2F43 G;  2HHH B;  5AW6 B;  2OTL P;  3CXH D;  4NR1 A;  4D6T J;  1FFX A;  1NKD A;  1LUV A;  2ADP A;  4MTX A;  2QWP B;  5CB4 A;  3CXH H;  2ZKO A;  3FFQ A;  1OWA A;  1BE3 E;  2A06 D;  1SS3 A;  3JAK B;  2ZNI A;  2A06 H;  5JJN B;  4UB6 E;  2DYR B;  1CI6 A;  1X22 A;  4DK1 A;  4DR3 O;  1PM9 A;  4D7T A;  1GTW A;  1EDL A;  1LTA C;  5CBO A;  3CCS P;  3GWO A;  2P6J A;  1YYC A;  2QWR B;  3A7O A;  3LSU A;  2WQY C;  4KFM A;  4TV8 B;  3A0R A;  2EIM B;  1XOU A;  1RPO A;  5IJ9 B;  5IYD O;  2AEM A;  4DR5 O;  3H32 B;  3CCJ P;  5FPO A;  2EIJ B;  1XMO O;  1HNW O;  3K08 A;  4RQF A;  4B08 A;  1LP1 B;  1A02 F;  3KQG A;  5K1X A;  2OAR A;  2CTR A;  2ZT9 B;  3N27 A;  3DC5 A;  1E79 H;  1EXJ A;  3VBB A;  2DW3 A;  1S72 P;  2EUL A;  4RES B;  3M7M X;  1ARO P;  1FDM A;  1M57 D;  5AVR B;  1XL4 A;  1N7S A;  1VMG A;  2Y0P A;  1NU1 D;  1BCC H;  2OTJ V;  1NU1 H;  4PI2 A;  1NKN A;  4KUM A;  1T2K C;  2I1J A;  2GV9 A;  5IWA O;  4JAV A;  2KOG A;  2J59 M;  4DUZ O;  3AE2 C;  1XNQ O;  3A5T A;  1KIL A;  4J7Z A;  3Q2Y A;  5BMV A;  5LMN B;  1LTJ A;  3ASN C;  3CJH B;  1TUB B;  2ZE6 A;  1YTZ I;  1PV3 A;  5IY5 C;  3EWK A;  2A0L A;  3SFD C;  2N1T B;  1OFC X;  3AEF C;  1XHZ A;  3UQ8 A;  1QVG U;  1JX9 A;  1QL1 A;  1F51 A;  4GKG A;  3ASN B;  5KAF H;  3KKY A;  3EFG A;  5AW9 B;  2E76 B;  2QRX A;  3V5B A;  5CBH A;  1RY3 A;  2P7J A;  4X20 B;  1GL2 A;  1VF5 C;  4TUY A;  3AG2 C;  1PNL A;  1X59 A;  4N3Y B;  1AJN A;  3H1J D;  1U96 A;  3H1J H;  3L71 G;  4PJ0 H;  5B66 H;  2OCC C;  1DF5 A;  4JI5 O;  4H0L D;  4NB5 A;  2DYS C;  2W6B A;  4EB6 A;  4L8J A;  4UXN A;  1WA8 B;  3Q4H B;  5JVD B;  4LF8 O;  1DIP A;  1N7S D;  1PV0 A;  3DGE A;  1FYJ A;  1RE4 A;  3SPH A;  2BCC J;  3SYC A;  1WJZ A;  3ABM B;  1PZQ A;  2PI5 A;  4R4M A;  1WMK A;  2UU9 O;  2HHH O;  5B5E E;  3ZCC A;  4L74 A;  3W7X A;  4FLV A;  3H1L J;  5EK0 A;  2PAJ A;  3CRC A;  5FPR A;  4J42 A;  5CA1 B;  5IDJ A;  3CC2 V;  1KIL D;  4K8Z A;  3WU2 H;  2CPB A;  1T6A A;  2V4D A;  1KMI Z;  3STL C;  3QVN A;  2AHY A;  2P10 A;  1IVS A;  1EN6 A;  2O01 J;  1UFI A;  2OYH A;  3HD7 C;  3O9O A;  1TA8 A;  2R44 A;  1KZU B;  3BCC G;  2A79 B;  2ATK C;  1GW3 A;  1FD9 A;  4LNU B;  2C2A A;  4MW3 A;  2ZXW B;  1GL2 D;  1NTM D;  1S1C X;  3FYI B;  2FFD C;  2WSS G;  1S5H C;  4GUN A;  1NTM H;  3T2M A;  2DQ3 A;  4PHZ A;  1JR9 A;  4KT0 J;  2R5B A;  4JTA B;  3D71 A;  5KAI E;  3ETQ A;  1ZP0 C;  3UIA A;  3FWN A;  4MSW C;  3ZJZ A;  1MOF A;  2OTL V;  2QG4 A;  3O6Q B;  1GM8 A;  3E22 A;  2LO1 A;  4JI0 B;  1SKV A;  3C3S A;  2RH0 A;  1NU1 J;  3ABT A;  2JJ1 G;  4W4K A;  5GTI Z;  3AEI A;  1SQB K;  1X9V A;  2UUB B;  3HTK B;  1X4T A;  1NTZ H;  1JMB A;  2AXT Z;  5ITZ B;  2B9Z A;  4DV1 B;  3HE5 A;  2BEQ D;  3CCS V;  1CXZ B;  4PD4 H;  5KX5 B;  3HPL C;  2YIU C;  3L74 D;  1KKD A;  1N73 B;  5LMN O;  4EIJ A;  4WCE V;  1NI8 A;  3OT7 A;  4JI3 O;  1A32 A;  2FYN B;  3I5C A;  3L37 A;  2E75 B;  3EVK A;  4GX0 A;  4AQR D;  3ZMT A;  2AW9 A;  3CCJ V;  1M8O B;  3FX7 A;  2B5U A;  2D3O W;  2RMK B;  3FB6 C;  1S72 V;  3MD0 A;  1VQO P;  1BGY E;  4YHH B;  3RK3 E;  3VQX A;  4PJ0 Z;  5B66 Z;  3CX5 D;  5EC1 C;  1CSB A;  1IFD A;  3H1H E;  1PFI A;  2GHY A;  1SQQ D;  3M9H A;  1IDS A;  3IGA C;  1M1K Q;  1D7M A;  2YO2 A;  2Y9Z A;  3WG7 B;  3ZHV A;  4YXW G;  1URQ C;  1YXB A;  2B88 A;  4C46 A;  3AK3 A;  3KG2 A;  4JYY A;  4R6Z A;  1VQL P;  1N2D C;  1LR1 A;  2ITD C;  1URQ B;  1AIL A;  4EEQ A;  4JYA B;  2DW4 A;  1K4C C;  2ZYD A;  1S9K E;  3WU2 Z;  3BVO A;  1M56 D;  5K5G B;  2ZJS E;  1Q86 W;  3L75 G;  1AI4 A;  2B87 B;  2F95 B;  2WSC H;  3FX0 A;  1EBO A;  1QX8 A;  3AK2 A;  4HNA A;  2JGD B;  5CA0 A;  4I55 B;  2W8Z A;  2ZXE B;  3S3W A;  4FM1 A;  1Y76 B;  3G71 P;  3CCR P;  3M99 B;  1OW8 A;  3CWB G;  3L70 D;  5JJE B;  4PV1 D;  3SFE C;  2Q7C A;  5B1N A;  4O9B A;  3TET A;  2FYU D;  1TVK B;  2IDB A;  2FYU H;  1JOY A;  1IBM B;  2VWK A;  4YJ2 B;  1JY3 P;  1E5W A;  4C7U A;  2M5A A;  3W68 A;  1H2S B;  3VQW A;  2CH7 B;  2KG7 B;  2ZIN A;  1BCC E;  2K9Y A;  1IZ3 A;  2E5Y A;  1V54 B;  2PYJ A;  4NTY A;  2W6A A;  3RL0 D;  4I0X B;  4ABM A;  1KD1 Q;  1QQC A;  2WLH A;  1G1I A;  2YC0 A;  3PN1 A;  4IHJ A;  1HNZ B;  3V2P A;  4O2A B;  1J1E B;  2PRR A;  1GN4 A;  1YEW A;  4UV9 A;  3SGI A;  3L73 E;  4JI0 O;  1FS0 G;  2XAH A;  4H13 B;  3U0Z A;  3T1Y B;  5KUM A;  2N04 A;  4L76 A;  3CME P;  1Z5V A;  5AW1 B;  3SSU A;  3E83 A;  1P84 F;  2DWE C;  1EZV G;  4QNH B;  5KAF E;  2K1A A;  1HNX B;  3SYA A;  1SVF A;  1YJN P;  4C7N A;  1EXI A;  4HKZ H;  1TGO A;  4CH6 A;  1L4A B;  3T97 B;  1FZG A;  1LGH B;  1WPB A;  4I4T A;  3L74 J;  1KQS U;  1I94 B;  1LT1 A;  2NN4 A;  2RDC A;  1RF0 C;  3HKD B;  3DSQ A;  5EIB C;  3K5L A;  5J2T B;  1YQ4 C;  1R3I C;  3L71 H;  2QJY C;  1K4D C;  2WLL A;  2W90 A;  1L2P A;  3GWK C;  4UB8 E;  3CS5 A;  1RSO A;  4U3J B;  2QJY B;  4JI2 O;  3D3I A;  2P2U A;  3H1K G;  2IU0 A;  2ZVO B;  3TGU D;  4IT5 A;  1JTH A;  3TGU H;  2J5U A;  2Q5U A;  3FWL A;  4UVA A;  3SDL A;  3K0G A;  2HG5 C;  5FLX N;  2CE4 A;  2PY5 A;  3M0D C;  5EBM C;  1N32 B;  5CJ0 A;  4PDM A;  1SQQ J;  2EIN C;  2VS0 A;  2KS1 A;  3A3Y B;  4D6T G;  3K57 A;  2ZDI C;  3CSX A;  2A3Q A;  1SES A;  3JD3 A;  4L87 A;  4EFE A;  5EYP A;  2DN9 A;  1SQV K;  1SQP D;  1D5N A;  2K9J A;  1SQP H;  4GLX A;  4FLT A;  4KXR A;  5B1B C;  3ASO B;  1GN3 A;  2BSK A;  1Q6U A;  1AJP A;  3L9D A;  3MZW B;  2AGA A;  3BCC H;  3HKE B;  3PHL A;  4JYA O;  2E3C A;  1Y8A A;  1IX9 A;  1JFF A;  3JAW A;  4JAS A;  2WSC J;  4EKW A;  3AED C;  3UO2 A;  4FLY A;  2C0X A;  1K9M Q;  2BTQ B;  1RF1 C;  1FJG B;  1DF4 A;  3OA7 A;  3NXS A;  2P5O A;  3L70 J;  3ZIA G;  3ZRW A;  1VQO V;  1QLN A;  2FYU J;  5KHJ A;  2PTM A;  2KQX A;  5JH7 A;  1LT9 A;  1KQG B;  3SR2 C;  1RP3 B;  2EX3 A;  4TV9 B;  1N34 B;  2GA1 A;  2NRG A;  3MGN A;  3RWR D;  4LF6 B;  2QM7 A;  3RYI A;  5IJ0 A;  1NTZ E;  4WFE A;  3H6P A;  4Y28 J;  2ILM A;  4O2B B;  1VQL V;  1R1B A;  3CC4 P;  5E79 H;  5EFW B;  4KHX A;  3MHS C;  1HNZ O;  3D36 C;  4GX1 A;  1Q7Y W;  4TOI A;  5CCG C;  1ZWI C;  2EIK C;  3OEH G;  2N74 A;  1V55 C;  2YID A;  4G2K A;  4ZOL B;  4PD4 I;  1D2D A;  1KB9 F;  4DV2 O;  2HJF C;  3G71 V;  4X1I A;  2YXR B;  1NVP D;  1OX3 A;  2DWD C;  4B3S O;  2HVK C;  2WSE J;  1PKX A;  3AEB C;  2N9Y B;  5DJT B;  2QWO B;  1LWU A;  1NHL A;  1BDC A;  4MVZ A;  1JMK C;  4X1Y B;  3ZHR A;  3KPE A;  2OYI A;  1HH0 A;  2DQ0 A;  1L0L D;  4HH2 A;  4N78 E;  5FNV A;  1MAB G;  1OCZ C;  3JAR A;  2KUB A;  2O01 N;  2Q7H A;  4YXW H;  3TGU J;  4XDJ A;  3RYF B;  4D7S A;  1NU1 K;  2YDE A;  5LP6 B;  2QIW A;  3AE8 C;  4NXM B;  2BCC G;  2YEV A;  2Q3I A;  2FTK A;  3MUD A;  4U3F E;  4NTW A;  2L6L A;  1OW7 A;  3CME V;  1QR9 A;  4GX5 A;  1N32 O;  2O57 A;  1TAE A;  2IYO A;  1HTL C;  4B3M B;  3LIE A;  3G80 A;  4OXS A;  2IW5 A;  3H1L G;  5KA6 A;  1IK9 A;  1DEB A;  3VP9 A;  3ZBH A;  5KLV J;  2YMK A;  3RYH A;  3ZMU A;  1GD2 E;  4BIZ A;  2A06 G;  1YJN V;  1ZSP A;  1ZX3 A;  1JM0 A;  3CWB H;  2CTQ A;  2Q67 A;  3D3Q A;  1SQP J;  1K34 A;  5IYZ B;  5H6Q A;  1FDO A;  2HYN A;  3IF4 A;  3JC2 2;  3U59 A;  1Q90 D;  1SQX D;  3CI9 A;  2JJ2 G;  1M5I A;  3B5N C;  3OR7 C;  4YJ3 B;  5LHG A;  1CP9 A;  1QLE C;  5CBF A;  1EM1 A;  4O4L B;  1M4U A;  4OPH A;  2JK5 C;  3NMD A;  1FXV A;  4Q6G A;  4GZR B;  4N23 A;  4B7E A;  1OZ0 A;  1FJG O;  1OCR B;  1F23 A;  2WPS A;  1E1R G;  3ZED A;  3G67 A;  5GW7 A;  3OGI B;  4LFC B;  1N0J A;  2YXL A;  4DV4 B;  3S1K A;  2WPQ A;  3DXR A;  4BRY A;  1BS3 A;  3O8Z A;  1N4C A;  3A2F A;  5AW2 B;  4JGS A;  5KLI C;  4IFD K;  4MVS A;  1FPO A;  1MUU A;  2JJL A;  1Z5W A;  4L73 A;  3M9Q A;  1JA8 A;  1EZV H;  2JGU A;  5KHK A;  4Y99 C;  5KLI B;  2LW7 A;  1H2N A;  2GBO A;  1MFZ A;  5AW3 B;  2X7R B;  3WUU A;  1P84 H;  1KQS O;  4Y99 B;  1VPC A;  2HPC B;  4CH5 A;  1HP8 A;  1CEZ A;  1FZF A;  2HFE D;  2YSU B;  3WB1 A;  3A0B E;  3RK3 B;  1K8A Q;  1FZC A;  4PI0 A;  4BR6 A;  2F66 C;  2NPS B;  4JPR A;  5L3B A;  3G4S P;  3F5W C;  2P06 A;  1LNQ A;  4JF3 A;  3H1K H;  3HUS B;  1AQT A;  2GTA A;  1NTM K;  4R8C A;  2FBW C;  4TT3 H;  4FZ1 A;  3LW5 J;  1KYO E;  4IGG A;  1VQ6 P;  1K73 Q;  1D5A A;  2KLV A;  2KSD A;  4DR2 B;  1UIX A;  2ODM A;  3ML0 A;  3BAA A;  4NPE A;  4D6T D;  3PH0 A;  1OCO C;  1PP9 E;  1L0L J;  4D6T H;  4A7P A;  1KYO I;  1M1J A;  2VRS A;  2E74 D;  4IL6 E;  2KIK A;  1R6T A;  1Y9B A;  4MN4 C;  2MJZ A;  1XDC A;  3B09 A;  2CPS A;  4OVN F;  4IL6 X;  3RYC A;  5C8Y B;  1NTZ K;  1SFC C;  4NXM O;  1M57 C;  3GHG A;  4WBN A;  4MVM A;  3LDE A;  3J81 N;  3BCC E;  5GON B;  4JI8 O;  2OT5 A;  1TUE B;  4FK5 C;  1N8R W;  1SFC B;  1VQ5 P;  4FVM A;  2H43 A;  3GW6 A;  4B3M O;  1VQ9 P;  2Y69 C;  3F7Y C;  1B04 A;  3JAT A;  4RO0 A;  1E1Q G;  1KQL A;  2V1D A;  1IBL B;  1MNG A;  4LCU C;  4UFZ A;  3JD1 A;  4P2Z A;  1EDI A;  1SQX J;  4JI4 B;  2RKL A;  3QH9 A;  5CN0 A;  2AEJ A;  2Z4E A;  3OAK A;  5CA3 A;  2HLD G;  2WWW A;  4Z1M G;  1TU3 F;  2K3R A;  4FMT A;  1R3J C;  1OV9 A;  1ZW0 A;  2G3A A;  5IT9 N;  4LWS A;  1L0N D;  1WPX A;  1PPJ D;  4GCZ A;  3CB2 A;  1K97 A;  2FKX A;  1JY3 N;  3AE7 C;  4BWN A;  1L0N H;  4DCK A;  2LKM A;  1YF2 A;  1HWT C;  4LFC O;  1ZN5 A;  5EBL C;  5E79 E;  3L35 A;  3GLM A;  5TJH A;  4DV4 O;  3P8M C;  4I1L A;  4JTD B;  2IPP A;  4GDO A;  4DYL A;  5D5P A;  3Q5R A;  1RE3 A;  4H44 D;  4H0L C;  3ZMV A;  2WMM A;  3MTU E;  3GMA A;  3APO A;  5AVY B;  1KFM A;  3W67 A;  3RL0 g;  1N7S C;  2Q68 A;  1K33 A;  2BOC C;  2WT7 A;  4JYB A;  4FIP C;  4OGQ B;  2P4K A;  2Y0C A;  1KB9 D;  5APU A;  3ITK A;  2LW1 A;  5IYB O;  4DV5 O;  1OIP A;  1KB9 H;  3AK1 A;  3L74 G;  2M3B A;  1Y74 A;  1KUQ A;  3IFM A;  1P7B A;  1VF6 A;  1VQK V;  4X89 A;  5JQG B;  1NWQ A;  4PA4 A;  2FYU K;  1LTJ C;  4BXL A;  1CW5 A;  3E1I A;  1H0T A;  3WB2 A;  4YTP C;  2V4H A;  1PNM A;  3CX5 F;  4O4I A;  4BIO A;  3K03 A;  4WFG A;  5LGT A;  2IBZ G;  4DV6 B;  4WY4 A;  1SQB E;  1S4X A;  3SJQ C;  5GTH Z;  1GL2 C;  4I7Z B;  4DR2 O;  2ITA A;  1G1X B;  3E89 A;  1PIX A;  4O4J B;  3H1L D;  3L75 E;  4U7J A;  3LUT B;  4LF4 B;  3H1L H;  2R72 A;  1FOS F;  3LNN A;  3LDC A;  1SQQ G;  3JCU H;  4PEL A;  3OJA B;  2QM8 A;  4X1K A;  1SLQ A;  3SPI A;  4C7R A;  2OGU A;  2O01 H;  5KMG A;  1RE4 C;  2B9B A;  3I56 P;  2F23 A;  1ZR4 A;  3TNU B;  1S5L E;  2VQF B;  2QE7 G;  3VOP A;  3E8F A;  3RVZ A;  1Y47 A;  4JZG A;  5TIS H;  3G4S V;  2B1G A;  2GUV A;  5DM6 V;  1S5L X;  1IBL O;  3VP8 A;  2JO1 A;  2JR8 A;  4JPZ B;  3FAV B;  1IXB A;  2UXB B;  2WSF H;  3FXE A;  3L70 G;  3RT3 C;  3SJA C;  1VQ6 V;  4GOF A;  2FYU G;  1JMM A;  2OYH C;  1XTG B;  2Q7E A;  2HOD A;  3AEA C;  1UII A;  5BXZ A;  2D2C D;  1AVO A;  3F5H A;  2F4V B;  1XNR B;  4WY4 D;  5LXT B;  5GTI H;  5CJ4 A;  4CH3 A;  3IAY A;  2OYH B;  5AW8 B;  1L0N J;  1S77 D;  1EDK A;  5APV A;  3CMA P;  1R8E A;  3AEC C;  1ORQ C;  3B8E B;  3RK2 D;  2AXT H;  2CGO A;  3QF7 A;  3AE1 C;  4DR1 O;  1DEE G;  1SQP K;  3KZI E;  3M06 A;  3GF7 A;  1XUQ A;  4YY3 B;  2RN0 A;  1SZT A;  1NH2 B;  2JWD A;  3N2G B;  1VQ5 V;  3HRN A;  1VQ9 V;  1P84 I;  1NJI Q;  1T5E A;  2XOK G;  3K5B A;  3ABL C;  4X88 A;  1AQ5 A;  5IY5 B;  1F7Y A;  3H1K E;  1FXK A;  2YIC A;  2QKA A;  4JI1 O;  3H9V A;  3AG7 A;  1NTK D;  1NTK H;  1KC8 Q;  2GSM B;  3L73 D;  3TF5 A;  2AEF A;  1M56 C;  1PD3 A;  3BRC A;  3JSL A;  1VF5 B;  3CL3 D;  4DOJ A;  3AG2 B;  3U11 A;  3JYC A;  1VL2 A;  4B3R B;  2I1K A;  1ZME C;  4PV1 C;  3CCU P;  3H1I E;  2OCC B;  4EDF A;  4LF5 B;  2DYS B;  1ZRT D;  3C1L A;  1Q81 Q;  3TGU G;  3S9O A;  2H94 A;  1SF9 A;  3JAK A;  5IYC O;  1VQP P;  2ZAE B;  4DV6 O;  4NYK A;  4CBC A;  1YIJ P;  5KHI A;  2C9L Y;  3N2K B;  4WB4 A;  1JCD A;  3JCU Z;  4LF4 O;  4MTG A;  3CXC U;  4FM2 A;  3RL0 C;  1Q2N A;  2C9N Y;  5KLV G;  1HGZ A;  4TV8 A;  3BVH A;  5IJ9 A;  1G8M A;  3FB8 C;  3H32 A;  1SQP G;  1BGY J;  4YXD C;  1PGP A;  1LP1 A;  2IU3 A;  5LA6 B;  2WPR A;  1YJW P;  3CCL P;  3OAA G;  3RN4 A;  2YMY A;  1GN2 A;  1JY3 O;  5H2F E;  3CRA A;  2Q0O C;  4Z1M H;  4EFB A;  3Q1M A;  3MAQ A;  2F93 B;  3HD7 B;  2WLN A;  5TIS Z;  2QGN A;  2ZE7 A;  3TXS A;  4NPF X;  2FYZ A;  2WSF J;  5FL7 G;  3P30 A;  2W27 A;  2FFD B;  4J41 A;  4R7C A;  3RBZ A;  4NXN B;  1IUR A;  1USD A;  5LYJ B;  1IXM A;  3V4W A;  1GZL A;  2ZD9 A;  3OR6 C;  4FLU A;  2PF4 E;  5KTB A;  5CA0 B;  4JTC B;  4QE9 A;  4IYI A;  1SQV E;  2Y48 A;  3H01 A;  1XNR O;  3C90 A;  4CH4 A;  3CJH A;  5APS A;  2N1T A;  1WB8 A;  4FPP A;  5APY A;  3DTU B;  5AVT B;  1OHH G;  3I56 V;  3L74 H;  4RJT A;  4X20 A;  3SPJ A;  4YY3 O;  5LOV B;  5J2U B;  2IZ0 A;  2HKO A;  5B3S C;  5EZY B;  2YIU B;  1EN5 A;  2P90 A;  5LMU B;  2KSJ A;  2CGN A;  3A2A A;  3AG4 C;  3EQ2 A;  2ZT9 D;  3A0H E;  1R5S A;  3CPW U;  3VN0 A;  2KYV A;  2HJD A;  1WA8 A;  3Q4H A;  5JVD A;  1DD3 A;  2IBZ D;  1KOR A;  1NTK J;  2BCC E;  2IBZ H;  2XAF A;  5JJJ B;  2OTK E;  4I5S A;  2FML A;  3L73 J;  3V6I A;  1VAR A;  3CXH E;  4RUF A;  4IYH A;  3CX5 H;  5LHI A;  1BQ0 A;  1KKC A;  4GX2 A;  2CK3 G;  2RCV A;  2FKW B;  1LTI C;  1IJD B;  1SQQ H;  1L0L G;  2A06 E;  2ZE5 A;  3CMA V;  2ZFC A;  4LF5 O;  2K1E A;  2ZCE A;  1Q82 W;  3CXH I;  3B40 A;  5LGU A;  1J1D C;  1ENV A;  2X0L A;  1GM7 A;  5J9P C;  2N1T D;  3QG5 A;  1NZ6 A;  3UCS C;  2A7W A;  4FLW A;  2QE7 H;  2VQE B;  2DJV A;  2DOS A;  1RFY A;  3F89 A;  1GO3 F;  1K04 A;  3QTC A;  4ZKU A;  2AZ2 A;  2E76 D;  4N78 D;  4LNU A;  4IOI H;  1G4Y B;  3WMM 0;  2Q0A A;  1Q6H A;  1RPR A;  3CRM A;  1AR1 B;  4OX9 B;  3L70 H;  2FL4 A;  1YHQ P;  3L72 G;  1QBZ A;  4G27 B;  4UCU A;  1SQX G;  4U7N A;  3K5N A;  2FXO A;  2POH A;  1IZN B;  1XTC C;  3OEE G;  3ZS8 C;  3OW2 U;  3ZMS A;  1OZH A;  2QJK C;  1JJO A;  3OD4 A;  4AYC A;  3O6Q A;  1NU1 E;  2A9H A;  5GTI E;  4KHP B;  4FFK A;  3CCU V;  4LBE C;  1S0V A;  4J9Y B;  3T4D A;  1RM1 C;  1GDT A;  1KU9 A;  4R50 A;  2OYO A;  2YXY A;  4NVP A;  1KP2 A;  2AXT E;  4NXN O;  1N8R Q;  3T4Z A;  5H5N A;  3HTK A;  2ZVN B;  4PDR A;  1DTO A;  5ITZ A;  2AHZ A;  1NGM B;  2AXC A;  3U10 A;  1HUC A;  1SA0 B;  1YVW A;  2EIL C;  3X2Q C;  2EBO A;  2P67 A;  5KX5 A;  3E2E A;  1LT9 C;  1W59 A;  1PGJ A;  1N73 A;  3V2N A;  2UUB O;  3L36 A;  1ZLL A;  3P8C E;  1W2B O;  3OTO B;  3HE4 A;  4PA7 A;  2KB1 A;  3G6E P;  4DV1 O;  4PDL A;  1M90 Q;  1YJW V;  1I5Y A;  3CCL V;  3KHU A;  2SPZ A;  3ZHU A;  4NPD A;  2WSE H;  1SP4 A;  2WLI B;  1UPG A;  3BHP A;  5AVW B;  2Q8V A;  3H1J E;  1BDD A;  4PJ0 E;  3TJT A;  5B66 E;  1VQ4 P;  4QPK A;  3V2R A;  5LMU O;  1NO4 A;  2UXX A;  2N9B A;  1HGV A;  1RH5 B;  2ETN A;  5LL6 Y;  4HZ3 A;  3N4X A;  4F6R B;  2JS5 A;  3G3Z A;  2L5G B;  4TT3 G;  4DRX A;  2FY8 A;  4YHH O;  4JI6 B;  4DR6 B;  1NAF A;  2Z5I A;  2CDY A;  1B06 A;  1OJH A;  1NVO A;  5HFL A;  1F4M A;  4FLZ A;  1K5S A;  2Y0E A;  4UUJ C;  4MT8 A;  1EQ7 A;  1LWU C;  3WU2 E;  3HKC B;  3VQY A;  1URQ A;  5KLV D;  4FZ0 A;  4EYY Q;  5KLV H;  2OYI C;  3CRQ A;  4WFH A;  3VMZ A;  2HR3 A;  2B87 A;  2EIN B;  4R4L A;  1QR8 A;  2Q6Q A;  1FKA O;  2JGD A;  4I55 A;  3W7W A;  4HJG H;  2E75 D;  4MW8 A;  1GKF A;  1XBL A;  2W6I G;  1DGS A;  4ZNC A;  5B1B B;  2VQE O;  4DUY B;  3CRR A;  3ABU A;  1ZL8 B;  3OMA B;  1LTG C;  1NTM E;  3JAL B;  3MUD C;  2J58 A;  2UXN A;  4YJ2 A;  1S2E A;  4KL1 A;  1S3J A;  3RVY A;  2CH7 A;  1JQ0 A;  5L3C A;  4P30 A;  1RF1 B;  4ZBM A;  1N36 B;  5DED A;  4BW5 A;  2NZ2 A;  3V4Q A;  2LQT A;  2W0X A;  4U3F J;  4I0X A;  1G6U A;  2HFE C;  1IBM O;  1AI6 A;  3PTZ A;  3I55 P;  2LP7 A;  2H7H A;  1AJQ A;  4O2A A;  4W7Y A;  1QGK B;  3E8B A;  4KHP O;  4DZO A;  1K3E A;  1NS1 A;  1VQ7 P;  1P7G A;  1H8H G;  4FFB B;  2A45 G;  3R65 A;  4LF9 B;  1L0N G;  1AP5 A;  1YTF B;  4FJC C;  2OIE A;  4RAI A;  4GKK B;  1PPJ G;  1URQ D;  4PD4 E;  1MA1 A;  4LF7 B;  3KXD A;  4AI8 A;  1FFT B;  3L74 E;  1IBK B;  3C3T A;  3V2Q A;  3TYY A;  1L4A A;  2ZYG A;  3T97 A;  2XTA A;  3T1Y O;  4X65 B;  1P4R A;  2JEX A;  4G28 B;  3HKD A;  2E74 C;  2WA3 A;  5KHG A;  5J2T A;  1YDX A;  3IFX A;  3CCR V;  3ETD A;  1HNX O;  3CPW O;  3OTO O;  4AHC A;  2EIK B;  4JV5 B;  3VOU A;  1V55 B;  1NH4 A;  3CLQ A;  1YHQ V;  5L3D A;  4JAU A;  4U3J A;  1I94 O;  1NBM G;  4X64 B;  1RQV A;  4K0K B;  3LW5 H;  1PNK A;  1QL2 A;  1AP6 A;  2QWN B;  4TQF A;  1KN7 A;  1H8A A;  2CK3 H;  1B3Q A;  1SQQ E;  1BMF G;  1L0L H;  2LXB A;  1FZC C;  4TLF A;  3CX5 I;  2UXC B;  2PFX A;  4ZHQ B;  1OCZ B;  4JI6 O;  1ZTE A;  4CS3 A;  4E4E A;  2IH1 C;  5D5Q A;  4DR6 O;  4H13 D;  4DJG A;  3EFF K;  1BZK A;  2GUZ A;  1AR4 A;  2O1K A;  2KNC B;  4E2L A;  4DV7 B;  4QE7 A;  4IIJ B;  5AVU B;  3TK1 A;  4KP4 A;  3ETE A;  3HKE A;  5K1P A;  4H33 A;  1L4A D;  2NNU A;  4KJM A;  2GDS A;  3G6E V;  1G2C A;  4RUE A;  3L70 E;  3L72 D;  2BTQ A;  4RKU J;  4DR7 B;  1M1J C;  4L75 A;  1BSN A;  5AG2 A;  3L72 H;  1SQX H;  2PZS A;  2FYU E;  4QIW F;  1BGY G;  1SQB D;  4ZI7 A;  1FAF A;  4H44 C;  3Q3D A;  4K35 A;  1VQ4 V;  2XAJ A;  4DUY O;  3GHG C;  4XA4 A;  3OW2 O;  4GIF A;  1XI1 A;  4WF9 V;  1J5E B;  1IFP A;  3B5N B;  1NTK K;  1N0N A;  1J95 A;  1BE3 D;  1ZV8 A;  3SWK A;  1QLE B;  2YNY A;  3P7K A;  3HKB B;  1KFN A;  3ABV C;  2OCH A;  3HB3 B;  3CP1 A;  4UB6 H;  2Q5Z A;  2IX7 C;  1BSM A;  1N36 O;  3QNE A;  4LFB B;  1G1J A;  1OVU A;  1GK4 A;  1N34 O;  2R9A A;  4MTF A;  4O2B A;  3K04 A;  2KI7 B;  3AE9 C;  2FB5 A;  5DJU B;  4LF6 O;  2H3O A;  4GYC B;  4X62 B;  1HR0 B;  3AE6 C;  1L1F A;  3ZHS A;  2Y4U A;  4HB1 A;  1GM9 A;  4W7Z A;  2XAS A;  4LF9 O;  2GM4 A;  4GKK O;  4JF7 A;  4J11 A;  2IYP A;  3K06 A;  1VQM P;  4LF7 O;  2HLO A;  1R3K C;  1IBK O;  3JAS B;  3L71 E;  4DR4 B;  5CCH A;  2JEU A;  2UUA B;  1ZXG A;  4HYO A;  1GRJ A;  1ZLZ A;  3AG1 C;  1MFT A;  2XAQ A;  2P1J A;  3GG2 A;  1OMI A;  1RE3 C;  3UT5 B;  3KCY A; 
#chains in the Genus database with same CATH homology
 3E8F A;  3RVZ A;  4WCE V;  3CYO A;  3TCU A;  4TWK A;  2B1G A;  3G4S V;  5DM6 V;  4GX0 A;  3ZMT A;  3CCJ V;  4LC1 A;  3JD2 A;  1M1K W;  2WSS H;  4UV8 A;  4N21 A;  2QKS A;  4PA9 A;  2B5U A;  2EZP A;  3I55 V;  2D3O W;  1VQ6 V;  2X6A A;  3FB6 C;  2R9R B;  3BEH A;  3MD0 A;  1S72 V;  3B8M A;  3ZMZ A;  1VQ7 V;  4MVQ A;  1YI2 V;  1PL0 A;  5EBW C;  1NJI W;  4ASU G;  1OCO B;  5EC1 C;  1H38 A;  3CC4 V;  1S77 D;  2GHY A;  5H9C A;  1ORQ C;  3IGA C;  4BAY A;  4PA6 A;  2WLI A;  3OGC C;  4MVU A;  4YXW G;  3WG7 B;  1SET A;  3JCZ A;  3SYP A;  1M57 B;  3KG2 A;  1KC8 W;  3E8H A;  4R6Z A;  1QVF U;  3FYE B;  1SZT A;  3W7S A;  1NH2 B;  1VQ5 V;  1QCE A;  2ITD C;  1VQ9 V;  2BOB C;  2XOK G;  1NQT A;  2DW4 A;  1K4C C;  3SPG A;  3CD6 V;  1K5Q A;  2Y69 B;  3ABL C;  4X88 A;  1Q86 W;  1AI4 A;  5IY5 B;  1FXK A;  1EBO A;  1OCC C;  1Q81 W;  5B1A C;  1K92 A;  3SPC A;  2EZO A;  4DO2 A;  2EJR A;  2PI4 A;  3M99 B;  5C93 A;  5LHH A;  5B1N A;  2GSM B;  3TET A;  5KA5 A;  1M56 C;  1R6N A;  1PD3 A;  1M9N A;  1AI5 A;  1EZJ A;  5CMU A;  1JOY A;  3AG2 B;  3JYC A;  2M7W A;  1KP3 A;  1R3L C;  3QO7 A;  2WLK A;  2MK3 A;  2OCC B;  3BY6 A;  2ZDI A;  3AG3 C;  5CBG A;  2DYS B;  2R9I A;  2E5Y A;  4XDL A;  1V54 B;  2H94 A;  5IYC O;  1F4N A;  1Y4M A;  3MHH C;  4CBC A;  3AG3 B;  2WLH A;  2V7Q H;  1EFR G;  3WFV A;  3IC7 A;  4QPJ A;  5LGN A;  4ZKI A;  4UV9 A;  5KUK A;  4MTG A;  2Q6A A;  1FS0 G;  2XAH A;  1UJW B;  5KUM A;  3CXC U;  3B8N A;  2JDI G;  3E83 A;  1G8M A;  3FB8 C;  2DWE C;  4QNH B;  3SYA A;  2IU3 A;  3OMI B;  1YIT V;  4F4L A;  3OAA G;  3SYQ A;  1JJ2 U;  3UKM A;  1KQS U;  2LFS A;  1SRY A;  1YSC A;  2WLN A;  1R3I C;  2WLL A;  1K4D C;  1I5X A;  3RW0 A;  5FL7 G;  3P30 A;  1OCR C;  4R7C A;  1FXK C;  3RBZ A;  3D3I A;  2P7T C;  1R6K A;  3QO5 A;  2QEX V;  2IU0 A;  1IXM A;  3PJS K;  2ZD9 A;  1K7D A;  3OR6 C;  4RO2 A;  4UVA A;  3K0G A;  3D36 A;  2HG5 C;  3STZ C;  1E79 G;  4JTC B;  4QE9 A;  5EC2 C;  2Y48 A;  3H01 A;  3E8G A;  3ZRX A;  1BHA A;  5EBM C;  4MS2 A;  4XDK A;  1S76 D;  1VQM V;  4PDM A;  2EIN C;  1K9M W;  5L3G A;  2ZDI C;  4FPP A;  1SES A;  3JD3 A;  4L87 A;  3DTU B;  3UM7 A;  4PDV A;  1OHH G;  2HVJ C;  3K9A A;  4P9P A;  3LSS A;  3I56 V;  2DYR C;  5B1B C;  3ASO B;  3LSQ A;  3SPJ A;  1AJP A;  3AG1 B;  2HKO A;  2IJH A;  5B3S C;  2P90 A;  2Q69 A;  4RQE A;  2XND G;  4JAS A;  3AG4 C;  4EKW A;  3CPW U;  3OUF A;  2EIM C;  4GT1 A;  1DF4 A;  1BHB A;  3NXS A;  4CZZ A;  3CCE V;  2EIJ C;  1FS0 E;  2XAF A;  3ZIA G;  1YTF D;  4I5S A;  3ZRW A;  1VQO V;  1QLN A;  4RUF A;  1H2G A;  5LHI A;  4GX2 A;  2CK3 G;  4H37 A;  1THZ A;  3CMA V;  2K1E A;  2QM7 A;  1Q82 W;  5LGU A;  4WFF A;  4WFE A;  1NR1 A;  2WPD G;  3LNM B;  1ENV A;  4P9O A;  2X0L A;  5L3F A;  2IJK A;  1GM7 A;  5J9P C;  2LFR A;  1WLE A;  1VQL V;  1MSW D;  2ZR3 A;  2QE7 H;  1W2B U;  3MHS C;  1GO3 F;  3GB7 C;  4GX1 A;  4TSF G;  1B6Q A;  1Q7Y W;  1SER A;  3E35 A;  3E86 A;  1ZWI C;  2EIK C;  3K3W A;  3OEH G;  1G4Y B;  4HAM A;  1V55 C;  4G2K A;  1RPR A;  5DN6 G;  1AR1 B;  3ABL B;  2HJF C;  3G71 V;  3FKS G;  1KD1 W;  1OCC B;  1QBZ A;  5B1A B;  1NVP D;  4G27 B;  2DWD C;  4U7N A;  1AI7 A;  2HVK C;  1PKX A;  1JCH A;  3OEE G;  3ZN1 A;  3JD0 A;  3OW2 U;  3B77 A;  3ZMS A;  1M56 B;  4MTO A;  3ZN0 A;  2Z3Y A;  1FXH A;  4MVZ A;  2A9H A;  3FB5 C;  3CCU V;  4LBE C;  1S0V A;  4J9Y B;  3T4D A;  1RM1 C;  4R50 A;  2DQ0 A;  1KP2 A;  5HFM A;  2H8P C;  1MAB G;  1OCZ C;  3T4Z A;  1M90 W;  4YXW H;  2ZR2 A;  4PDR A;  4XDJ A;  1BSH A;  1DTO A;  1JVM A;  5BZB A;  2QTO A;  2AHZ A;  2YEV A;  2EIL C;  3X2Q C;  3OUS A;  3ABM C;  2EBO A;  2P67 A;  2FTK A;  3E2E A;  2ITC C;  3CME V;  1QR9 A;  1ROP A;  4GX5 A;  4BIU A;  3OM3 B;  4OXS A;  2IW5 A;  5KA6 A;  4PA7 A;  2KB1 A;  3T1C A;  4XBF A;  4PDL A;  3ZMU A;  1JPX A;  4BIZ A;  3K79 A;  1W0K G;  1I5Y A;  3CCL V;  1YJN V;  2IJJ A;  2Q67 A;  4UVC A;  3SYO A;  1K34 A;  1YJW V;  5H6Q A;  2WLI B;  3OMN B;  1VQ8 V;  2JJ2 G;  3OR7 C;  4QPK A;  2W6J G;  5LHG A;  1CP9 A;  1QLE C;  5CBF A;  2UXX A;  2JK5 C;  3OFN G;  1YJ9 V;  4MVO A;  1FXV A;  1R73 A;  2X6B A;  3ABK C;  2ZXW C;  4HZ3 A;  1JEK A;  4N23 A;  1OZ0 A;  3JD4 A;  1OCR B;  4TT3 G;  1VQN V;  3OE7 G;  1FXK B;  1COW G;  1F23 A;  5H6R A;  1Y66 A;  1GK9 A;  1E1R G;  3ABK B;  4LP8 A;  5GW7 A;  3ZRV A;  2WAM A;  5HFL A;  1F4M A;  1K5S A;  4UUJ C;  4MT8 A;  3ETG A;  2JIZ G;  5E1A C;  4JGS A;  4JYC A;  1GTO A;  3CCM V;  1K8A W;  4QMA A;  4MVS A;  1BL8 A;  2F43 G;  4WFH A;  2HR3 A;  2JDI H;  2EIN B;  1NKD A;  1QR8 A;  4MTX A;  3W7W A;  2X7R B;  4MW8 A;  1GKF A;  2W6I G;  3F7V C;  2DYR B;  1NR7 A;  5B1B B;  2B1I A;  3OMA B;  3ABU A;  2IJI A;  1K73 W;  5B3S B;  1CEZ A;  2UXN A;  2P6J A;  2YSU B;  3GWO A;  1S3J A;  3AG4 B;  3RVY A;  1JQ0 A;  5L3C A;  4P30 A;  4JPR A;  5L3B A;  3A0R A;  2EIM B;  3F5W C;  1RPO A;  4KFM A;  4ZBM A;  4JF3 A;  1LNQ A;  5IYD O;  1AQT A;  2EIJ B;  4BW5 A;  4R8C A;  3K08 A;  4RQF A;  4Q20 A;  2HFE C;  1AI6 A;  3K0D A;  1E79 H;  2LP7 A;  1AJQ A;  3VBB A;  3ML0 A;  4WVZ A;  3E8B A;  1ARO P;  1K3E A;  1OCO C;  1H8H G;  1XL4 A;  2WLL B;  1NH2 D;  3USS A;  3R65 A;  1YTF B;  4FJC C;  4RAI A;  3CC7 V;  3CCV V;  2OTJ V;  3ZRS A;  1FFT B;  3WG7 C;  4KUM A;  1M57 C;  2ZQM A;  4JAV A;  1P4R A;  3LDE A;  4MVM A;  2JEX A;  3CCQ V;  4G28 B;  2OT5 A;  2XND H;  2V7Q G;  1TUE B;  3IFX A;  4FK5 C;  3ETD A;  3CCR V;  1N8R W;  2EIK B;  3ASN C;  1H8E G;  3VOU A;  1V55 B;  2Y69 C;  3F7Y C;  3FB7 C;  5IY5 C;  1E1Q G;  2A0L A;  4I9W A;  2QA4 V;  2V1D A;  5L3D A;  1YHQ V;  4JAU A;  4LCU C;  1QVG U;  3JD1 A;  1JX9 A;  1XL6 A;  1F51 A;  1NBM G;  4P2Z A;  3ASN B;  3LDD A;  3QO8 A;  5CN0 A;  1PNK A;  5CBH A;  5CA3 A;  2HLD G;  2WWW A;  4Z1M G;  2CK3 H;  3AG2 C;  4FMT A;  1BMF G;  1PNL A;  1R3J C;  1AJN A;  3P32 A;  4U7O A;  1VQP V;  2E5T A;  1RM1 B;  1NVP B;  4TLF A;  2OCC C;  1DF5 A;  1YIJ V;  2DYS C;  5L3E A;  1V54 C;  1OCZ B;  1WPX A;  4GCZ A;  1K97 A;  4UXN A;  2IH1 C;  2NLJ C;  3W7U A;  4DJG A;  3EFF K;  5EBL C;  3DGE A;  2WLM A;  3ZRW B;  3SPH A;  4JTD B;  3SYC A;  2EIL B;  1W0J G;  2X6C A;  3ABM B;  4QE7 A;  3X2Q B;  2IH3 C;  4E2L A;  2PI5 A;  3TK1 A;  4KP4 A;  3ETE A;  3ZMV A;  4H33 A;  2NNU A;  3ZCC A;  4WFA V;  3W7X A;  3G6E V;  4RUE A;  2Q68 A;  1K33 A;  2BOC C;  5EK0 A;  1BSN A;  4JYB A;  4FIP C;  1DLB A;  5IDJ A;  3CC2 V;  1CPY A;  4QIW F;  5IYB O;  3STL C;  2Z5U A;  1KEC A;  1VQ4 V;  2XAJ A;  2AHY A;  4PA3 A;  5LBQ A;  4MVR A;  4J9Z B;  1IFP A;  4WF9 V;  1J95 A;  4WFB V;  1QLE B;  1P7B A;  1VQK V;  4X89 A;  2A79 B;  2ATK C;  4PA4 A;  4DXW A;  3HB3 B;  2C2A A;  4MW3 A;  3CP1 A;  2WLJ A;  2ZXW B;  3FYI B;  2WSS G;  1S5H C;  1HWY A;  3QNE A;  3T2M A;  2DQ3 A;  4JTA B;  1PNM A;  3K03 A;  4MTF A;  4WFG A;  3K04 A;  5LGT A;  1GMG A;  5B1O A;  4QJF B;  3SJQ C;  4MSW C;  1L1F A;  3E89 A;  3ZJZ A;  1MOF A;  2OTL V;  1GM9 A;  2XAS A;  3LUT B;  1GM8 A;  3LDC A;  3EHB B;  3ABT A;  2JJ1 G;  4PEL A;  3AEI A;  3K06 A;  2QM8 A;  2XAG A;  3SPI A;  1R3K C;  4UVB A;  1MG1 A;  2JEU A;  2W0F C;  3W7T A;  4X8A A;  3ASO C;  2W6J H;  4HYO A;  3CCS V;  3AG1 C;  2XAQ A;  2YEV B;  2QE7 G;  3HPL C;  1KKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...