3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
b'SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB light chain
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
2Q6AA 1IFPA 3R65A 2EIJC 3ABLC 2IH1C 2ATKC 5EC1C 4PA9A 3SYOA 4PDLA 2WLLB 4LCUC 3BEHA 1E79H 3LDDA 4MTFA 5IY5C 3PJSK 4R7CA 3JYCA 4MSWC 4R6ZA 1OCRC 3F7VC 3SPJA 4MVMA 3SYQA 3ZJZA 4CBCA 1XL4A 4GX5A 2E5TA 4MS2A 5EBWC 3ASNC 3OGCC 4GX1A 2JDIH 4H33A 4EKWA 4MVQA 3AG1C 2R9RB 1KKDA 1JEKA 3E8FA 4P2ZA 4R8CA 3E83A 3RVZA 1R3KC 4PA4A 4YXWH 3SJQC 3LDCA 5CBFA 1P7BA 4TWKA 3ABKC 3ZRSA 4F4LA 2JK5C 4G27B 2IH3C 4MVOA 2X6CA 4PDRA 4PA7A 3RW0A 1OCZC 2K1EA 3T4DA 3F5WC 2ZXWC 4HZ3A 3K08A 1ZWIC 3K0GA 4X89A 2A9HA 4P9OA 3FB7C 2A0LA 3LDEA 4QE9A 3ABMC 2HG5C 5BZBA 2DWDC 1BSHA 1R3LC 2ITCC 3OUFA 4DXWA 4PA3A 3FB6C 4QE7A 1V54C 5KUKA 4OXSA 2DYRC 4LBEC 2H8PC 4X88A 3WG7C 5CBGA 2WLMA 2E5YA 5EBMC 2YEVA 1S5HC 2DWEC 2WLNA 3X2QC 3K06A 2WLJA 4RUEA 4MVRA 4RUFA 3SYCA 4UUJC 3T4ZA 1JVMA 3STZC 1XL6A 4HYOA 3F7YC 3SPHA 2CK3H 3OR6C 3E8GA 1FS0E 4PDVA 1G4YB 1M57C 4MW8A 2KB1A 3FB8C 4MVSA 4WFGA 3LUTB 2EIKC 1QLEC 2X6AA 1LNQA 2Q67A 1ORQC 2QKSA 3K03A 1K4DC 4JTAB 1V55C 3RBZA 2P7TC 4J9YB 4LP8A 3OR7C 4WFFA 3AG4C 3UKMA 2V7QH 2WLLA 2XNDH 2X6BA 5EBLC 2Q68A 4G28B 3SPIA 4KFMA 4MTOA 3FB5C 4X8AA 3SPGA 3AG2C 4PA6A 2AHYA 1R3JC 3EFFK 3ASOC 3E89A 5EK0A 3STLC 2WLKA 3TCUA 3UM7A 3IFXA 4PDMA 2ITDC 5B1AC 5J9PC 4XDJA 2QE7H 2W0FC 4MW3A 1OCOC 2Y69C 4RAIA 2HFEC 2EINC 5EC2C 3SYAA 2WSSH 4GX0A 3IGAC 1AQTA 2Q69A 4QMAA 4WVZA 4I9WA 3E8HA 4DJGA 2WLIB 3OUSA 3SYPA 3T2MA 1BL8A 4P30A 2HVJC 3USSA 2DYSC 4WFEA 2HVKC 3KG2A 1R3IC 4WFHA 1BSNA 2EILC 3SPCA 4BW5A 4MVUA 4MVZA 3E8BA 4P9PA 5CBHA 5E1AC 4JTDB 4GX2A 4XDLA 4ZBMA 3RVYA 4TLFA 2ZD9A 2OCCC 2WLHA 5KUMA 2AHZA 3K0DA 2BOBC 5B1BC 4H37A 4MTGA 3AG3C 2A79B 2NLJC 2QTOA 3TETA 4RO2A 4XDKA 2BOCC 2HJFC 4QNHB 3HPLC 1OCCC 4R50A 1J95A 5B3SC 4J9ZB 2WLIA 4JTCB 3K04A 3E86A 2EIMC 1K4CC 3VOUA 3T1CA 2W6JH 3GB7C 1M56C 3LNMB
chains in the Genus database with same CATH superfamily
5CB4A 2YO2A 4DV5B 4PDLA 4LF7O 4DOJA 3W7SA 3UCSC 2POHA 1AROP 1TA8A 2B9ZA 4E2LA 1HNWO 3CCQV 2M5AB 2IPPA 3MGNA 4L8JA 2UUBB 2OTKE 1OVRA 2N1TA 4UB8Z 2Q7CA 1KILA 4Y99B 1NTZJ 4R8CA 3RVZA 1ZX3A 1R6TA 3M99B 3SJQC 4TUYA 1H0TA 2AXTZ 3L71H 1H38A 5APTA 2KUBA 4FPPA 2ZT9B 4FIPC 2W6AA 4LGDE 1KFNA 3VMZA 2EIKB 2ZR3A 3A5TA 2ZNJA 2WSCJ 1WA8A 1ZWIC 1K73W 3VTPC 1N8RQ 5APQA 1JTHA 2A0LA 4GCZA 3ABMC 3JSNA 4PV1B 1JY3N 1JB0J 3FXDA 4PA3A 1RHZB 3WU2Z 4M3LA 4LBEC 1SA0A 2WLMA 1M1JA 1E1QG 3H1LG 3C90A 3RYCB 4F6RB 4DUYB 5L8RJ 1XL6A 1K34A 3W7UA 1Y9BA 1FS0E 4PDVA 1WT6A 1J1EB 4U3FE 3BAAA 4MW8A 2KB1A 1S5LE 1KQLA 2E74B 1XNQO 3SFEC 2LGQA 5CN0A 5KHJA 5KJ7D 1HNWB 4NYKA 3L4FA 5GTIE 4Z2WA 2ZM6O 3NTNA 1D5NA 1SQBH 2E75B 4X8AA 2NPSC 5AVZB 1QVGO 3HD7C 3ASOC 1XQ8A 4EFEA 1KZUB 2ZAEB 1OZ0A 1GL2B 4YXWG 3RYIB 1QLNA 4RAIA 3W7WA 4TT3G 1MOFA 4DR3O 4H44D 1CI6A 1MUUA 5KJ7C 3AE3C 3TK1A 2DMXA 1K8AW 5FNVB 2ZYAA 1LTAC 2QM4A 2UWJE 3PRJA 4EYYQ 4MVZA 4IL6X 1NU1K 2ZD9A 5LP6C 5JH7A 2OARA 5J2UA 3CCEP 3G6EP 1I08A 4O2BA 4H0LB 3AG3C 2A79B 2NLJC 3CL3D 5IDJA 2RH0A 3CCLP 2ZE8A 3IF4A 3ZMZA 5B3SC 3BATA 3H1JJ 1IO4A 5DEDA 5LOVA 2XKMA 2QSAA 1YQ4C 2BTQA 3T1CA 1N33O 2ZM6B 1MFZA 5TJHA 2IW5A 2KYVA 4PD4F 2IH1C 2QJKB 1LWUC 3SYOA 4KHXA 3K57A 4JI7O 3L70G 3AE9C 5KX5B 3V5BA 4N3YB 3SPJA 2YI8A 3E35A 2E5TA 2Z5HA 5CBNA 3QO5A 2JIZG 5EBWC 1Y8AA 2PAJA 4I6MC 3KPEA 2F1MA 4ZI7A 4H33A 1FXHA 4DR3B 3HTKB 3K9AA 5CA3A 1QBZA 4MVQA 4I4TB 4IFMA 1K73Q 3R66A 2P67A 4I0XA 3UQ8A 2LGWA 1H8EG 3ZX6A 3K3WA 4Z1VA 3AEAC 1O9GA 2RN0A 3C9IA 4EI2A 2OIGA 4NTYA 3BHPA 1R6KA 3FYEB 3G4SV 5KLVJ 3L74E 1QLEB 1NWQA 4O4LB 2QVAA 2YC0A 4NXNB 4X89A 1BQ0A 1EXJA 3TGUH 5BZBA 2ITCC 1LP1B 4WFAV 4UFZA 1V54C 1E5WA 5IWAB 3S9OA 4IT5A 3FGAD 1PIXA 3CHXA 1FDIA 5CJ0A 3CXHD 4WWIA 1YIJP 3KCXA 4FLVA 1IFMA 1NU1D 5M1BA 1VQMV 2WQYC 5IYZA 4N23A 1PP9E 5AW5B 2M3EA 3TF5A 1YXBA 2LW1A 3BPZA 2DN9A 4TT3H 1Y74B 3V2NA 5LHIA 3ZRWB 2OYHB 3ML0A 4DRXA 2Q8VA 1L0LG 4DYLA 1JMBA 3H1HE 1AI6A 2F95B 2W0XA 2KG7A 1DGSA 2K1AA 3FAVA 2B5UA 1SQFA 1IFDA 4IL6H 1IFJA 1K8AQ 1IZ3A 5D5PA 1MV8A 3CCQP 3LIEA 3Q3DA 3ZMSA 1R8EA 5JQGA 3OUSA 1HWTC 3SYPA 3I56P 2JVDA 4P30A 1Q7YW 2BCCJ 4WFEA 1M7LA 1ZR4A 2JEUA 4GKJO 2KK7A 1LJ2A 1THZA 3JAMN 1WPXA 1MA1A 1KKCA 1XREA 3BVHA 3G9RA 2ITAA 1T2KC 1FZCB 3CC7V 2GUZA 4DV7O 3SGIA 5BVZA 1AJYA 1BE3H 1PNMA 1NTZG 4MTGA 2PYLA 3M0AA 2YNYA 1CW5A 2SPZA 2O1JA 4X1IA 3FFQA 1S1CX 5B1NA 4W4LA 1ZLLA 1S9KD 2EJRA 2Z0AA 1S4XA 3UT5A 1K4CC 5KMGA 1EDLA 4UB8E 3HE4B 1K3EA 4JI4O 5CJ4A 1PPJE 4BAYA 1LT9A 4PA9A 1VF5B 2UXBO 1QL1A 3AE1C 3T97B 1I94O 4U3JA 3VN0A 3RYFB 2CH7A 1YJ9V 2HP8A 2G8YA 3B2EE 1HR0O 1GTWA 5H6RA 1KECA 3A0BE 1MSWD 4YHHB 1SFCB 5C8YA 3M06A 2YXRB 3IC9A 3OMNB 2KLVA 2N9YB 4GKJB 1TUEB 1KB9E 5AVWB 4YJ2A 2X7RB 3K5OA 2H3OA 1HNXB 3CWBJ 1GAXA 1GK9A 4PV1D 2DWDC 5KA6A 1URQA 3PP5A 4EIJA 5CCGA 4UCTA 4J7ZA 2R3CA 4OXSA 2PY5A 4X88A 4KHPO 1SQGA 1NHLA 2DWEC 3K06A 5EIBD 2YKQA 5L3DA 2MK3A 1M8OB 4LWSB 3FKSG 1G4YB 2ZT9C 4FK5C 1I94B 3BCCJ 2EIKC 1E79G 2UUAO 2Q67A 1OW6A 2ODMA 1HR0B 1GN6A 5H9CA 4U7NA 3CCMV 1LTJB 1TVKA 2OYOA 4FFKA 1SP4A 2E75D 1GTOA 1S3JA 3H25A 2HODB 3Q5PA 3AEBC 3STLC 1Q7YQ 2P90A 3IFXA 2UXCB 1OWAA 1U7JA 1W0JG 5KAIE 3AG2B 1QVGU 1L1FA 1G2CA 2NRGA 3T1YB 2AGAA 2EINC 3M9HA 3EVKA 1J1EC 3D6ZA 2UXXA 5LMNO 2WPQA 2E74C 1VIBA 1NR7A 2QJYB 1A32A 2K3RA 2FYUE 3W7XA 2R9AA 1RE3C 1QHTA 4B3TB 1AA0A 1SQPE 2E3CA 3G71V 2FYZA 3M9QA 2CE4A 1JA8A 2WSCH 3ZHRA 3DC6A 1EZVE 2EIJB 4KHPB 3N2KA 3CJHA 2FFDA 4U3FD 3ZDMA 3HKCA 3G4SP 1GL2C 1FJKA 4H37A 4QIWF 4H0LD 3VP9A 1FFTB 3CMAV 1XUQA 4DV3B 4D6TG 4JI3O 3TETA 2ZE6A 4QNHB 1QEXA 2UUAB 3JCUH 1Y76A 4DW1A 1NTKE 1NVPB 1Q90D 1EFRG 2P2UA 4W4KA 2WWWA 1DEEG 3A3YB 2I1KA 3A0HH 3E1IA 1FDMA 1VQMP 3S1KA 3CYOA 3L73D 3LDDA 1A02F 4NB5A 2YMYA 3GHGA 1L4AA 4XFJA 3JYCA 4H0LC 3QO7A 3H6PA 1QR9A 3ETQA 1DK1A 1KTMA 3AEDC 5KKZB 3ZHVA 4I9QA 3ETDA 5LMNB 3B5NC 1YBKA 5LA6A 2KOGA 5AVRB 1JO5A 5LL6Y 3SWKA 4IGGA 1IBMO 4FVMA 5CBFA 2FYNB 1HWYA 4JASA 5IYDO 5J2TB 2KB7P 3L72E 1BT8A 4O4HB 4ASWA 1P49A 4DO2A 3U10A 3HKBB 1SQXE 2A7WA 2L5GB 3L75E 4I5SA 4JI1O 2R9IA 5KUKA 3DSQA 3H1KG 5EZYA 2H8PC 5GONA 4AQYO 1DX7A 3B40A 5EBMC 1WLEA 3VQXA 2UU9O 4RUFA 3OEEG 3SYCA 3CC7P 5BXZA 3QO8A 4Z1MG 3H1JH 2CAZC 2CK3H 1OCOB 2QJPB 5APUA 1GN3A 2WPVB 1KN7A 1VQ7V 5AVQB 2O3JA 3K58A 1QLEC 1FE6A 1NH2B 3U1CA 1JY2N 3F5HA 1Q8IA 1SZXA 2W90A 2Q68A 3EHBB 2RCVA 3CCUV 3VYIA 1I0HA 4LF6O 1IBMB 3LSSA 1HGVA 3O9OA 1FXVA 1UFIA 4JGSA 5BR8B 3L74D 1ZL8A 2NPSB 4X1YB 3HKEA 4MW3A 3ASOB 3HD7B 1G1JA 2HFEC 4I7ZB 1CPYA 1SQQH 4MN4C 3LSQA 2WLIB 1N73C 1AJQA 2RQ6A 4WFBV 2OYHC 4X1KA 3HUSA 4B3MB 5KLVH 4JI1B 1IX9A 4P9PA 4WB4A 3V6IA 4IIJA 1VQPV 1PP9D 1NZ6A 4GKKB 5AG2A 2PI5A 5H2FH 2A06H 3OAAG 4JQ0D 1YVWA 5LP6B 3HE5A 3TSIA 2YKPA 2HPCA 1L0NH 4I55A 4ASVA 3H1HD 2AZ0A 1PNLA 1VQOV 2M3BA 1AV1A 1N7SA 3AG3B 3FD9A 5LHHA 1BQZA 4R50A 2DQ0A 3N7NA 4JTCB 2PI4A 3K04A 2OYQA 2XAHA 2DW4A 4GOFA 5B3SB 2CGNA 1WJZA 1GK6A 2ATKC 1OXZA 3H1IJ 4LF6B 4B3RO 1VF5D 4QPJA 3G3ZA 2GUVA 3WFVA 2VQFO 5LYJB 1P84E 2R3SA 3I55V 1T5EA 3TGUJ 2QE7G 1USDA 1SQBE 4CBCA 1XL4A 1RF0C 5A2QN 3D8CA 4FLZA 4GX1A 3CCMP 2I1JA 3JSLA 3DTUB 1SFCD 1T3UA 3WG7B 2EULA 5BMVB 2GV9A 4KL1A 1EDIA 2B1IA 1AVOA 2KI7B 3WB1A 2RMKB 2BCCH 5KLIC 4G27B 2IH3C 1JR9A 4NR1A 2ZFCA 3SDLA 3CX5I 1MZEA 1OCZC 1VF5C 2MJZA 3VQVA 1BS3A 1AB3A 5E79H 1WP8A 1JPXA 3OUFA 4DXWA 1SC5B 2D2CB 2WSEJ 3G71P 4TSFG 1QVFO 1GW3A 4X64B 1PPJD 4TV9A 1NTMK 4LFAO 2WLJA 1TAEA 2JP3A 1X79B 2UXDB 3IFMA 4LH6A 3CCVP 3CMAP 1SQPK 2IU0A 2YICA 1ZP0C 1VARA 4JTAB 1K4DC 4J9YB 2YIUB 4WFFA 4XA4A 1QU7A 5EBLC 1FXKC 2KNCB 3SPGA 3UO3A 4BIZA 1P4RA 1EDKA 1R5SA 5IYCO 2AW9A 1RQVA 3I5DA 3GWOA 3JCUZ 3A2FA 1PV3A 2N1TB 5EYPA 1KILB 3L71G 3MD0A 4J80A 3JD4A 2C0XA 4TUYB 4DCKA 3B71A 3A0HZ 2HVJC 5DJUB 1ZRTE 3H1LE 4PD4I 3K9SA 1F7YA 1WA8B 1CEZA 1IFNA 3BRTB 3CX5H 2QDOA 3CWBH 3SJCC 1JTHB 3Q1MA 3GLMA 3G6BA 5LXTA 3H1KD 1K05A 1KU9A 4DR6O 1A02J 1XNRO 1NAYA 1KV4A 4DV5O 2CPBA 1SA0B 2CTPA 2WITA 2KZJA 1RF1C 3KDPB 2BOCC 1S2EA 3GG2A 1AJPA 4OX9B 4LNUB 1EN4A 3AG1B 1NVPD 3CC2V 4I50A 1OW8A 3SWFA 1DTOA 3BCCH 1Q2NA 1M56C 2EIJC 5EC1C 2YKOA 3S4RA 1GZLA 4EB6A 1NTMD 4UVBA 3BASA 3J7AU 1AQ5A 1K33A 2FYUD 2XAGA 5KHHA 1WPBA 5JVDA 2JGUA 1HGZA 2NR5A 1SQPD 1BCCJ 1IBKO 1KB9F 5KAFE 5B1OA 1EZVD 4RJTA 1GK4A 3CCUP 4GT1A 4WBNA 4UXNA 1U96A 1RY3A 1CI6B 4UB6E 2GA1A 4JZ2A 3M7MX 3NXSA 4DUYO 2ZJSE 1XNRB 4PD4H 1VQ9V 2LJ2A 3EFGA 1NTKD 4X65O 5IE9A 5JH7B 5J2UB 3RK2C 5KKZC 4O2BB 2K9PA 4C7NA 1XILA 1OIPA 3PTZA 2LXCB 4DZOA 4IHJA 4N21A 1G1IA 3Q4HB 1AR1B 1JFFB 1VF6C 3L70E 2H7HA 2PP6A 2FYNC 2YS8A 2JWAA 3SPHA 1R6NA 2Y69B 5LOVB 2BTQB 2VWJA 1GDTA 3JAKA 2BTOA 4WFGA 3BVOA 1EN5A 1M4UA 1NH2D 1V55C 2DYSB 2UUCB 5H2FZ 2GM4A 1X8YA 4DR4B 3D36A 1KYOD 1IBKB 1Q86W 2ZQMA 4KFMA 2MW2B 4ABMA 1W2BU 2E42A 3L72D 2HLDG 3TCUA 1N0JA 4ZI7B 2LKMA 2NPSD 3EQ2A 2B9BA 2W0FC 5GTHZ 1DD4A 2QJPC 3HD7D 1OCOC 1D5AA 3JCZA 1ENVA 4I0XB 1VQNV 1BDDA 1SQXD 3L75D 1NH4A 3CXHI 1JMKC 4FZ0A 1GU4A 5TISH 2EINB 3J81N 3JC22 1M90W 3CCSP 5B66H 4X65B 2P4KA 3TGUG 1BHBA 1UIIA 3ZEDA 3CX5F 1Q5OA 1F51A 2IJHA 2NNUA 5HFLA 1SQBK 1JX9A 1L0LE 2LFRA 3ZHUA 4I7ZC 3ZMUA 4YY3O 2Q0OC 2HJFC 4XDKA 5CA0A 3HPLC 1ZV8A 4OH8B 3TXQA 1UJWB 3L73E 2FMLA 5L3FA 4KP4A 4PJ0H 4DRXB 1IFPA 3E22A 4O4JB 5AVTB 3QWOC 4JI5O 2KS1A 1MG1A 2GDSA 1EZJA 4I1LA 3K79A 3A0RA 1AR5A 2ZXWB 1JCHA 1OX3A 3FAVB 4R7CA 4E4EA 1VQ5P 3F7VC 1D7MA 5BU8B 2BSKA 1KP3A 3JALB 4CS4A 3LW5H 4NXNO 4W7ZA 2G38A 1HTLC 3II6A 1WB7A 1FZFA 1PP9J 4OVNF 5IWAO 2FB5A 3B5NB 1NTZE 4WCEV 3UIAA 4LLHA 4ZKUA 3CXHH 2WPSA 5F2VO 1M57B 2PF4E 2OCHA 4JI0B 3H1HJ 5C39A 1BE3G 2XAJA 4OGQB 2GUZB 3ZS8C 2ZE7A 3IAOA 2HG5C 4YY3B 2YIBD 2M5AA 3AEGC 3WG7C 1KORA 4X1IB 2O01N 2QA4P 4WY4A 2QEXV 1QVFU 4RUEA 3T4ZA 4AI8A 1P84D 2GHYA 2R32A 2LO1A 5JJNB 3FYIB 3JD3A 1SQBD 1Q86Q 3UT5B 4JI5B 1SQQJ 3S3WA 3BRVB 3W67A 2F23A 3WUVA 2F43G 1KQSO 4LF5B 1H2GA 1LT9B 1GKFA 3H1IH 3OR7C 2OYIA 4U3JB 2EILB 2D2CC 3SWYA 4N78E 2AZ2A 3DGEA 1IC2A 2AHYA 3MUDC 5CHXA 2OCCB 3UM7A 1M90Q 3D6YA 3CB2A 5K1XA 2ITDC 5IJ9A 5C8YB 2A45I 4X9QA 2EJ7A 2N1TD 4NXMB 1L0NJ 1RPOA 3RYCA 3VP8A 4NVPA 1RH5B 2LQTA 2HKOA 3JD2A 2WT7B 1SETA 4CZZA 4DJGA 4YJ2B 3B8EB 3C3SA 3AK1A 2YIUC 2JRIA 3MHHC 4JYAO 1N73B 3HR0A 1YI2V 2C9NY 2WA4A 3H32B 1NT2B 3SJAC 1BGYJ 3C8VA 4L76A 1BCCG 1FYJA 2WLHA 1URQB 4DV4B 4JAAA 3U11A 5CMZA 2WSEH 4CH4A 3BRCA 3CC2P 2N1TC 1X4TA 1T2KD 1S5LX 3PN1A 1JY3P 1H2KA 2KQXA 1KILC 1PGPA 1VQ9P 1MNGA 1YTFB 2IX7C 3M8AA 4RO2A 2Y0CA 3MHSC 1NR1A 1ZR2A 4PHZA 1H2MA 1J95A 3ABTA 4YHHO 5AW8B 1SQVJ 3V4QA 1PKXA 2FL4A 2W6JH 1BZKA 3AK3A 1Q81W 1P84F 3VBBA 3R65A 3ABLC 4K8XA 3WMM0 3V2PA 2GTSA 4JAUA 5JCOA 3ABVC 1SVFA 4UVAA 3JATA 2N9BA 1M1JC 5CA1B 4NTXA 1ZRTD 3H1LD 1K7DA 5IJ0A 1SS1A 4CS2A 1HNXO 4LF9B 2RDCA 2XAFA 1FZBA 1G2CB 3H01A 1F4MA 3AG1C 3PH0A 2A45H 3E8FA 4JYAB 4HBNA 2Y0PA 4PA4A 1OMIA 5FL7G 4F4LA 2PFXA 1H2SB 4D6TE 3CXHF 3O65A 2ZINA 3CCVV 1AFOA 2Y0IA 2B88A 1WAZA 4IOIH 2FTKA 3CCJV 3T4DA 5JWPA 3F5WC 5KLIB 1JCDA 1ZAUA 1YYCA 4HB1A 3N2KB 3CJHB 1OCZB 1VQ4V 2LP7A 1DF5A 3AEIA 4QE9A 2AXTE 3HKCB 3L35A 1AP6A 3K5LA 5D5QA 3O8ZA 2M8RA 1SS3A 2GUSA 4BRYB 5CBGA 3F5TA 5AW2B 2ZVNB 5TISZ 1UPGA 1HJ0A 1ZXGA 1URFA 4UUJC 1OVUA 4JYYA 2P7JA 5B66Z 2UXCO 1G8MA 3E8GA 2KSDA 3RL0C 2AEFA 3WU2E 3RYHA 2K9JA 2W83C 4MVSA 3O6QB 4KUMA 5AVYB 3T1YO 5GTHE 4UCUA 2X6AA 3PLNA 2HJDA 3K03A 3CLQA 1VQ6V 2ZT9D 4AHCA 3UKMA 3TJTA 3OEHG 3GHGB 1L4AB 3JASA 2XOKG 3OJAB 4G28B 2Y4UA 2ZYGA 1SKVA 2YMKA 4B3TO 1LP1A 1W59A 1L0LK 3CRRA 3EFFK 3G80A 5EK0A 4JI6B 1FXKB 1ZTEA 3JARA 5LA6B 1BCCH 2WMMA 2OGUA 1IFIA 1NTKJ 2Y69C 4H13B 1PGQA 2K9YA 3ZRVA 1FJPA 4PJ0Z 4QMAA 1S5LH 4L87A 4LH7A 1LTBC 4DV3O 3ZBHA 3H1KE 2DYSC 1YITV 2HVKC 1BE3D 1R3IC 5GTIH 4FFBB 2E74D 3ZRWA 3L70D 1FAVA 3OFNG 1EN6A 3E8BA 4JI2O 1JY2O 3CRAA 3RVYA 4K0KB 2Q0AA 4DT0A 2IZ1A 1DLBA 1LTGC 3W68A 5EZYB 4GOEA 3D71A 3M0DA 1Q81Q 2CK3G 3H1JG 1ROPA 2ZR2A 1GL2D 1QL2A 2CPSA 1NTZK 3APQA 2P6JA 2W6IG 2Y48A 4UCVA 4EOTA 1RF1B 1NTME 2J58A 2OT5A 2ZDIA 2WSFH 2ETNA 3VOUA 2LW7A 3NFQA 2DW3A 4L75A 3OAKA 1SQXJ 1M56B 4JF7A 1FZCA 3B4SA 2Q5ZA 3ZCCA 3W7TA 3CRQA 5LGUA 2OTJV 1ZL8B 2Q6QA 1YZBA 3HKEB 1SQQG 4ZOLA 3OTOO 1XBLA 2DYRB 2IBZG 5AW4B 3ITKA 3B5ND 2OQQA 4X1KB 4TWKA 3HUSB 4MT8A 3CC4V 2XDJA 2QWOB 5KLVG 4JI2B 1L0LD 1M57D 3SSUA 4O2AB 3HB3B 4RQEA 2ADPA 2ZXWC 1QX8A 2A06G 1W0KG 2WZ7A 3JD1A 1S5JA 1SRYA 3RYFA 4DV6O 4GDOA 2VQEB 1BSHA 5L3GA 1L0NG 3L9DA 3AE2C 3HE5B 2R70A 2JWDA 4I55B 3RK2B 1AJNA 1SFCA 4DW0A 4XBFA 1YJNV 1PD3A 2H8PD 1KFMA 4ZHQA 2IBZI 4XE5B 2RJZA 3KZIH 2QM7A 1M57C 5BR8O 1KYOE 1RE4A 5KTBA 2C9LY 1BGYG 1ZMEC 2G3AA 3VOPA 1LNQA 3THOA 4OGQC 1DH3A 2JS5A 1QLED 1KQSU 5FLXN 1VL2A 4UV9A 1NTZD 4ZMDA 1V55B 4IL6Z 4B3MO 3SPIA 2QJ1A 3OTOB 2P1JA 3DXRA 4DR7O 2WLKA 4JYBA 3B8NA 4TV8A 4XDJA 4YJ3B 5B1BB 1SQVG 4GKKO 2AEJA 1PP9H 2BCCG 2IFNA 4BW9A 2V1DA 4GX0A 4HH2A 1KMIZ 2LXBA 4I9WA 2HFED 3CD6V 1LT9C 1Q3EA 1BHAA 2IYPA 4WFHA 3H1HH 4DV6B 2EILC 1QGKB 3BFRA 2LR2A 4LFCB 1W2EA 1LTJA 3AE5C 3RBXA 3RN4A 1BDCA 1W2BO 2OCCC 1D2DA 1XHXA 2AHZA 2QWPB 4GIFA 1KB9I 4DR5B 2NN4A 2ILMA 5AVXB 4U7OA 3LW5J 4N78D 1YJ9P 2Z4EA 1GU5A 4FMTA 1QNMA 3N27A 1JOYA 2JKVA 3WUUA 2RN9A 1ZLZA 2IBZH 2WVRA 1B6QA 4CH3A 4TQDA 3ZMVA 3AK2A 3OMAB 5KLVK 3CPWO 4DR7B 3CMEV 3L71E 3E1RA 1KBHA 1URQC 2DJVA 3BEHA 1NU1J 2V7QJ 2L35A 3JAWA 5CCGC 3FX7A 4IYIA 1G1XB 5FPRA 1T6AA 1OV9A 1JEKA 3SYQA 1JUNA 3HKDB 1VQ6P 2Q3IA 1DIPA 5EYPB 3ABUA 2RKLA 1WB8A 4OPHA 1XTCC 3U1AA 1FZEA 3RL0g 1M93A 4UB8H 4X64O 3ZRSA 2WA3A 2V4HA 1PPJH 1Z56A 4PDRA 3CWBG 4IFFA 4PA7A 4MTXA 4J11A 1FU1A 2B87B 1VQ8V 2UXDO 1KUQA 1IK9A 3GWKC 2BEQD 1BGYH 2DE0X 5LXTB 4BXLA 1JNMA 2A9HA 1JCCA 1Q6HA 3VQWA 1FD9A 3LDEA 4DR2O 1W5CE 2HLOA 4G2KA 4O4IB 3A0BH 1AI4A 2AXCA 2GSMB 4D7TA 4LF8O 2QSIA 2ZVOB 2XASA 5LGNA 1WRGA 3C3TA 4CH6A 1QCEA 4NPDA 3D70A 2Y9YA 1H89A 1KB9H 3N2GA 3L37A 4I2LC 5B1AB 3BCCG 5DN6G 3UO2A 1F23A 3JSVC 5GTIZ 4H44B 4I50B 5DJTB 2L91A 1U7MA 1SQVH 1EZVI 3FB8C 1I7FA 1GO3F 1N4CA 5JJEB 1LT1A 4EB6B 2FFDC 1Y66A 4RQFA 1IVSA 4UCSA 3OA7A 3T1HO 2WLLA 1KILE 2XNDH 2JGDB 2XZRA 4D6TD 4CH5A 1J1DB 5HFMA 1M9NA 1TUBB 4GKGA 3OM3B 1PGJA 4NPFX 4WBNB 4Q20A 1XHZA 4WVZA 2OTJP 1I5YA 2YXQB 2X0LA 5KHKA 1ZN5A 4YIPA 1R73A 3ZHQA 4DR2B 3SPCA 5CB4B 4OX9O 3GHGC 1L4AC 2JEXA 4LF8B 5AVVB 4KT0J 4JTDB 4XDLA 2IZ0A 2J59M 5LGTA 5KUMA 2FXMA 5KAIH 1WMKA 1MZ9A 2QRXA 2WSSG 1GM8A 3RK3C 4H13C 1HP8A 1RP3B 1GN4A 2NPSA 3EWKA 4X1YA 2M6YA 3HD7A 4BWNA 2F4VB 1LTSC 2YXLA 3RGBA 3MZWB 2MKVA 2FYUH 2PGGA 2WLIA 3JAKB 1JMMA 4AQRD 1SQPH 2Q7GA 1KC8W 1H0TB 2CTWA 3T1HB 2R5DA 2Y0EA 3G6EV 2Q6AA 1EZVH 3ABKB 3B77A 4R4LA 5KJ7A 4LCUC 1M56D 4KJMA 3A8TA 3CCLV 1IXBA 3ABLB 2PTMA 1JY2P 3MHVA 1K5SA 5ITZA 2P22C 3TGUE 2OTLV 5LP6A 2JDIH 1M1JB 1AVYA 3KZIZ 1NTKH 3MAQA 1KKDA 2IYOA 2W8ZA 3MIWA 3ZHTA 1FDOA 2JK5C 1NKNA 2ARHA 2X6CA 1HVVA 3RW0A 1WNSA 2KZIA 3AE4C 2ZIMA 1KD1W 2XU6A 1XOUA 2OWOA 3IC7A 3F89A 1FAFA 5EFWB 2E5LO 2YXHA 1LWUA 1VQ7P 1MZFA 3AECC 3M9BA 5AVSB 2UUCO 1OW7A 2VRSA 2B89A 5IT9N 2DYRC 1PL5A 2GTAA 3RK2D 4AILC 4DR4O 2YEVA 1S5HC 1M5IA 3B09A 5CA0B 2QG4A 4IL6E 4MVRA 3QH9A 3ZRXA 1JVMA 2IU3A 3HUSC 4L73A 3F7YC 1AR4A 4U3FJ 3OR6C 3L72H 1S0VA 2E76B 4IYHA 3TXSA 2IFMA 4C7UA 3E22B 3A2AA 3RL0B 1K97A 2KS1B 3BA9A 4DK1A 1SQXH 3L75H 1YIJV 2X6BA 2Q4PA 2BSKB 4PA6A 1Q6UA 1S72V 1SF9A 2IJKA 1N7SC 3CMEP 1WN7A 1IXMA 2XTAA 1AP5A 1GN2A 1BE3E 3P8CE 1XTGB 3TDKA 1VQPP 3V4WA 2Y0DA 1SERA 3L73J 2WSSH 3TNUA 3CWBD 4HNAA 1KQFB 3OW2O 3Q5RA 2R44A 3P7KA 2WSFJ 2Q73A 1NU1G 2D3OW 1P84I 4DV1O 2E5LB 3N4XA 5CCHD 3PHLA 1FC2C 1VQOP 1EM1A 5AW3B 4K3AA 1FOSE 4EEQA 3OTFA 1N36B 3IJ4A 4ZBMA 4DV0B 2KNCA 1Q82W 3K0DA 1NKZB 1KC8Q 3OMIB 5B1BC 1VQ8P 1FBMA 3BCCD 3I56V 4JPRA 3CRCA 3WUTA 4WY4B 1BMFG 1LGHB 3ASNB 1YQ3C 4DV2B 1NYHA 3I55P 1X0TA 4O9BA 2O1KA 2WPRA 1FKAO 3H1IG 5CCHC 1K9MW 3A0BZ 2P58A 3MP7B 2OYIB 3FWLA 3ICXA 1MFTA 4HJGH 4DR1O 1NI8A 3CPWU 4MTFA 2YSUB 3P3PA 4JI0O 4FJCC 1R5LA 1X59A 1VQLV 1NAFA 1PGOA 4DUZO 5IJ9B 1EDJA 4YTPC 4X20A 1R1BA 2YI9A 1KD1Q 1BCCE 4DV1B 4PD4D 4FM1A 1RM1B 4NPEA 4LNUA 5L3CA 4YIOA 1EXIA 4K8ZA 5IYZB 4UCOA 1H8AA 4LF7B 1P7BA 2FKWB 1KP2A 2XV5A 1FJGO 3KCYA 4MVOA 4FLUA 2FBWC 3L74J 3OGIB 2W6BA 3GMAA 5E79Z 4F6EA 1P84H 2OIEA 4ZNCA 1HDJA 3K0GA 5GW7A 1HJBA 2KG7B 1RSOA 4LC1A 3U0ZA 1OVVA 1F4NA 4LF5O 1GH6A 1NQTA 2HG5D 1FFXA 3L71D 1E1RG 2ZIOA 1KYOF 1ZUQA 5FPOA 4B7EA 4ASUG 2W6JG 3D3QA 5JQGB 1PNKA 4LR3A 4DR1B 3VMYA 1LTIC 1NJIW 1U57A 4NXMO 3C1LA 1AILA 1ORQC 1CZQA 2Q7HA 4LP8A 5KAIZ 2QTSA 5CMUA 1N32O 2V7QH 1NU1H 3JATB 4DUZB 5H5NA 5IYBO 3K5MA 2PRRA 1LTTC 2Q3EA 2KLUA 3P32A 3FB5C 5IJ0B 4B08A 5L3EA 2D2CD 1VP7A 2A45G 3Q5SA 5B1AC 1IBLO 3Q4HA 4FM0A 1JFFA 4DV4O 1XNQB 1FJGB 4H44C 2CDYA 2KIKA 4X62O 2OTLP 3QG5A 1H8HG 1Q82Q 3JCUE 1USEA 1N34O 2QGNA 2ZCEA 5KMGB 4J42A 5BY1A 4QPKA 3SJBC 2Q1KA 2JS3A 1IURA 5DM6V 3D3IA 1YJWV 2QWNB 1Y47A 3E7KA 2M7WA 3ZIAG 2Z5UA 5K1PA 2M0BA 4GODA 5E1AC 4GX2A 1J1DC 2CH7B 3A0HE 3QTCA 2ZKOA 2KXPB 4AYCA 4UV8A 4GZRB 5IY5B 4U7JA 1K9MQ 1KILD 2RNBA 4F6RA 2JR8A 4D6TJ 3H1LH 4LF9O 2B1GA 3BABA 3RYHB 1N32B 2K9JB 4YPCA 2EIMC 3KZIE 2JEEA 4B86A 2Q9IA 3JASB 4TOIA 1RE3A 1YF2A 1IBLB 3CEIA 2DQ3A 1OCRC 1RFYA 4UVCA 2YO3A 2FY8A 1FS0G 3JARB 4U3FG 3OGCC 1OFCX 3RFRA 2K37A 1JJ2U 4X62B 4CS3A 4IFDK 1N34B 1N33B 1GL2A 3B8MA 3RYIA 2EBOA 4YXWH 1S72P 3DC5A 4PI0A 4B7KA 4JI7B 1COWG 3ABKC 4UCRA 1YEWA 2IM9A 4OPAA 3H1JE 4LFBO 1YTZI 3I5CA 1J5EO 2YUAA 3D36C 4ZKPA 2K1EA 2XNXA 5LHGA 4O4JA 2Q7EA 5FNVA 1TVKB 3KYQA 4P9OA 3FB7C 1YCIA 3AG4B 5AW1B 2Q5UA 2QWRB 4K35A 3L73G 4QE7A 3KQGA 5KAFH 3APOA 5JJJB 3JALA 2EX3A 3LIDA 1NJIQ 1J2JB 1NOHA 4PELA 4UB6H 3TYYA 5B5EH 3H1ID 5APXA 3LNNA 1FZGA 3STZC 2ZXEB 3H1KJ 1L2PA 3B5NA 1LUWA 4JI6O 2N74A 5K5GB 2UXNA 2ADQB 3TGUD 2E76D 2YIDA 3NMDA 1GMGA 1SQQE 2QR4A 2VWKA 2IBZE 3RL0D 3H9VA 2KSEA 2P7TC 1KQGB 1VQNP 1N0NA 2HYNA 3RK3E 5KLVE 1L8DA 2FFDB 4AUWA 4MTOA 5KX5A 3SFDC 2YXYA 2CTRA 3L70H 1LUVA 5APYA 2F66C 1XMOO 4ZOLB 5H2FE 5J9PC 2A06E 4K0KO 1NTMJ 2H89C 1GD2E 3HTKA 2O01H 3CCRV 4FM2A 4LFBB 4X66O 4I4TA 2DOSA 1J5EB 1Y76B 1L0NE 1SLQA 2E76C 1M1KW 1VQLP 1HBWA 2ZYDA 4JF3A 2FYUJ 4QGPA 3OW2U 3MTUE 1SQPJ 1US6A 4KXRA 1LR1A 2EZPA 3KHUA 1JOCA 2PYJA 4EFBA 4O4LA 2CTQA 4TLFA 3L36A 2L6LA 1BGYE 2JJ1G 3K5NA 4C7RA 2GBOA 4FLYA 3GF7A 2QKCA 4WY4D 2BEZF 1DD3A 1VEWA 2H88C 1WP7A 4L74A 3RK3B 4ZHQB 1B3QA 3L74G 4U3FH 4R4MA 2WT7A 1P7GA 5AW7B 4J9ZB 2HR3A 3IN6A 5KHIA 1OJHA 1SQVE 3KXDA 4DV7B 3P8CD 1Y74A 2N05A 1FZAA 2BCCE 3K5BA 1N73A 2OYHA 3H32A 1XMOB 3ETEA 3MDSA 3DXRB 3PJSK 1L0LH 4R6ZA 1SESA 1Z5WA 4WY4C 2K88A 1PP9G 4X66B 5E79E 3ASNC 1PV0A 4TV8B 4Y99C 5GONB 5A9GA 2Z5IA 2JO1A 4EKWA 2VQEO 2R9RB 3L73H 5APWA 3X2QB 4P2ZA 4JI4B 1R3KC 1HUCA 3H1HG 3LDCA 2UXBB 3L72J 3RGUA 2KKWA 2PGDA 2OYIC 2P5OA 2KSJA 3OE7G 2QEXP 4PV1C 4DK0A 1K92A 3LSUA 3L75J 1CP9A 1R3LC 4BWAA 5CA1A 4FLXA 2E43A 1GRJA 2Y9ZA 1VPCA 2QWQB 5EIBC 1HW7A 1K04A 3FXEA 1YJWP 1RM1C 1DF4A 4JBZA 1PM9A 1NTZH 1RF0A 2IDBA 3AE6C 4Y28J 3ZHSA 4BR6A 2HEPA 3CRMA 3M91A 3R2PA 1NS1A 2E75C 1BCCD 1CSBA 3HE4A 3P3NA 1U97A 3CS5A 4YXDC 2WAMA 3JAWB 1JJOA 4IIJB 3T97A 4OGQD 1M1KQ 1O9HA 2Q9LA 3CWBE 3CX5E 3CSXA 1N7LA 4LFCO 3E89A 1X9VA 2XUMA 3K59A 4BRYA 2HPCB 1YI2P 2FXOA 4NTWA 2PUSA 1N7SB 1XEQA 5EC2C 1AQTA 1PPJG 2FXPA 2P4VA 4DR5O 1BSMA 2IJJA 1OCCB 1QR8A 2R72A 3T2MA 1BL8A 3ZN1A 3HRNA 1XDCA 2XT9A 1DEBA 3L71J 3O6QA 1FOSF 3Q2YA 5JCOC 3L74H 3WB2A 2YDEA 4HAMA 4BW5A 2PZSA 3BCCE 1HNZO 1EBOA 1S77D 3J80N 5LMUO 2QIWA 3IAYA 3ZMTA 1FXKA 1MSDA 3EXAA 2QTOA 4GUNA 1NGMB 2YIAA 3N2GB 2HHHO 4HYTB 3QF7A 4JPZB 3QNEA 5L3BA 2JJ2G 4ZIBA 1T3JA 3GF3A 3E86A 4LWSA 1T8ZA 2QJKC 1PZQA 3R4YA 1TU3F 4LF4O 1NO4A 5AW9B 4J41A 2XNDG 4QJFB 4JV5O 4FFBA 3P8MC 3V2QA 2WLLB 4RO0A 5KAFZ 1E79H 4JI3B 4Q6GA 4WF9V 5IY5C 5CBOA 1SQBJ 1GM9A 4PD4E 1RQUA 1YSCA 4MSWC 3ZJZA 1URQD 1N2DC 2Y4TA 2HODA 4GX5A 4UB6Z 4MS2A 5B5EZ 3ABMB 2AEMA 2LFSA 5KA5A 4B3SO 5CCGD 1SZTA 3CCJP 3VMXA 4TV9B 3P30A 3AEFC 1YTFD 1VQ4P 1PL0A 2O57A 1RF1A 1SQQK 1HNZB 1VQKV 3CCRP 5LMUB 2ZXXA 4JZGA 3QVNA 1B06A 3GVMA 1AVMA 1Y67A 2HHHB 1NTMG 1YHQV 2C2AA 2F93B 4JI8O 1IK7A 2P10A 3GW6A 2E5YA 3IR9A 3OD4A 2FYUG 2R5BA 1MABG 5H6QA 1L0NK 1IJDB 1SQPG 4FZ1A 4LF4B 4HYOA 1FPOA 4JV5B 4D6TH 1K5QA 1EZVG 1MMMA 4PI2A 2IJIA 5DECA 3U59A 5TISE 3FWNA 4O2AA 3RBZA 1UIXA 4RKUJ 5B66E 1ZW0A 2AXTH 3AG4C 2H43A 2XHBA 4B3SB 4AQYB 4GLXA 3OT7A 2UU9B 3M0DC 2JDIG 5ITZB 1YITP 3H1JD 1NTKG 1H2NA 1Y4MA 1YDXA 1AI5A 4NKGB 5KHGA 1S5LZ 2ZDIC 1CXZB 3WU2H 2BE3A 2Q69A 4BIUA 4N6JA 5GTHH 3E8HA 2W27A 1VF6A 5AW0B 1SQVK 3H1LJ 2C0WA 1H88A 1X22A 5APVA 3KG2A 2F4VO 5J2TA 1BSNA 1FZCC 3VQYA 3AE7C 4MVUA 1H2LA 4O4HA 4PJ0E 5CBHA 4JI8B 5LBQA 2CUGA 1LWUB 3JD0A 1L4AD 1EC5A 1PL4A 3CE2A 3HKBA 4J7JA 1SQQD 2BOBC 3KKYA 5JVDB 2H94A 2IBZD 5AVUB 1VDFA 3CCSV 2YEVB 1HH0A 4YJ3A 3L72G 3A7OA 1EQ7A 1Q6IA 3S3XA 1Z5VA 3RK3D 2ZE5A 4H13D 5KLVD 3H1KH 2A3QA 1YTZT 2FKXA 4J10A 5BU5A 1V9PA 2QKAA 1SQXG 3CP1A 3L75G 4A7PA 4Z1MH 2A06D 3LNMB 5CCHA 3CXHE 2EIMB 1ZOYC 4RESB 1L0ND 2VS0A 1S76D 1NU1E 3CC4P 4D7SA 1RPRA 4MVMA 1SFCC 4C7NB 2ZNIA 2N04A 2XAQA 4BIOA 4CC5A 1AI7A 1KYOI 3V2RA 4IHJB 1OCRB 1V54B 2Z3YA 1NTMH 3TNUB 3NR7A 3BA8A 4HNAB 1GM7A 1RE4C 1BGYD 3E83A 2FYUK 4GYCB 4B3RB 2BASA 1G6UA 2VQFB 1MKMA 1VQ5V 2WTYA 3CCEV 2VRZA 4J7KA 2WPDG 1YJNP 2EZOA 1JM0A 1NVOA 4HZ3A 3K08A 1Z2GA 1KB9D 1NBMG 4W80A 1QQCA 3H1IE 1JY3O 1GW4A 4HKZH 3FB6C 1SQVD 3HKDA 1BE3J 2BCCD 2I8DA 3L70J 2J5UA 4A5UB 3X2QC 2WLNA 1NTKK 3VMAA 1N8RW 2O01J 3AE8C 1XMQO 4CC6A 4JAVA 1LTJC 3LUTB 3E2EA 1OZHA 1VMGA 1Q43A 2JJLA 2QKSA 2B87A 3WB0A 5APSA 1ZSPA 4ICGA 2V4DA 4TQFA 2QA4V 1N86A 3ETGA 3G67A 4LFAB 5LYJA 3CD6P 2NZ2A 4O4IA 1HF9A 2P06A 3AG2C 3AEEC 1R3JC 1S9KE 1IDSA 4X20B 4PDMA 1N36O 2QE7H 4JYCA 1TGOA 5C93A 4C46A 1N7SD 4DV0O 3SYAA 2QJYC 1KYOH 4RWUA 1Y6XA 3IGAC 1PFIA 5BMVA 2UUBO 2KP8A 4FLTA 3USSA 4EDFA 3CI9A 3AG7A 4DV2O 1SQBG 1XI1A 1OHHG 4ZKIA 4FLWA 4W7YA 1SQXK 3RT3C 4OWFA 1RSOB 2CGOA 1VF7A 1B04A 2JGDA 1VQKP 3CXCU 5AW6B 1L0LJ 4WBAA 1FFXB 2YIBA 1TUBA 3RWRD 3BY6A 3ZN0A 1XMQB 1JQ0A 2RMZA 3MUDA 3FX0A 1I5XA 1NKDA 2QM8A 1OCCC 5B5EE 3CX5D 1GMJA 1YHQP 1IZNB 3SR2C 2V7QG 4CPGA 4DR6B 3GB7C
chains in the Genus database with same CATH topology
2ATKC 4PDLA 4QPJA 1M56B 3WFVA 3W7SA 3ZCCA 2DQ3A 3W7TA 3I55V 1AROP 1OCRC 2QE7G 4UVCA 4E2LA 4CBCA 5LGUA 1XL4A 3CCQV 2OTJV 1FS0G 3OGCC 4GX1A 1JJ2U 3DTUB 2DYRB 3WG7B 3B8MA 2EBOA 4R8CA 3RVZA 3M99B 2B1IA 4YXWH 3SJQC 1COWG 4TWKA 3ABKC 4MT8A 3CC4V 4G27B 2IH3C 1H38A 4FPPA 1OCZC 2K1EA 3HB3B 4FIPC 5LHGA 4RQEA 2EIKB 2ZR3A 2ZXWC 1W0KG 1ZWIC 3JD1A 1K73W 4P9OA 3FB7C 1SRYA 2A0LA 1JPXA 4GCZA 3AG4B 3ABMC 1BSHA 5L3GA 3OUFA 4DXWA 4PA3A 4QE7A 4TSFG 4LBEC 2WLMA 1AJNA 1E1QG 2WLJA 4PELA 1PD3A 4XBFA 1YJNV 3STZC 1XL6A 1K34A 3W7UA 2UXNA 1FS0E 4PDVA 2QM7A 1M57C 4MW8A 2KB1A 1GMGA 2IU0A 1LNQA 4JTAB 1K4DC 5CN0A 2P7TC 4J9YB 4WFFA 1KQSU 4UV9A 5EBLC 1V55B 1FXKC 3SPIA 4MTOA 3SPGA 4X8AA 1P4RA 4BIZA 5IYCO 3ASOC 2WLKA 3GWOA 4JYBA 3B8NA 5J9PC 1OZ0A 4XDJA 5B1BB 4YXWG 1QLNA 4RAIA 3W7WA 3CCRV 2V1DA 4GX0A 4TT3G 3MD0A 1MOFA 3JD4A 4I9WA 1M1KW 4JF3A 3CD6V 2HVJC 3OW2U 1BHAA 3TK1A 4WFHA 2EILC 2EZPA 1K8AW 1CEZA 4MVZA 4TLFA 2ZD9A 2OCCC 2JJ1G 2AHZA 3AG3C 2A79B 2NLJC 5IDJA 4U7OA 2BOCC 1AJPA 3AG1B 4FMTA 3ZMZA 5B3SC 1NVPD 4J9ZB 1JOYA 2HR3A 3CC2V 1DTOA 1B6QA 3T1CA 3ZMVA 1M56C 3OMAB 2EIJC 2IW5A 2IH1C 5EC1C 3CMEV 3SYOA 3BEHA 4UVBA 3ETEA 3PJSK 1JEKA 1K33A 4R6ZA 1SESA 3SPJA 3E35A 3SYQA 2XAGA 2E5TA 3QO5A 2JIZG 5EBWC 3ASNC 4H33A 3ABUA 1FXHA 3K9AA 4EKWA 5CA3A 1QBZA 4MVQA 5B1OA 2R9RB 4GT1A 3X2QB 4P2ZA 4UXNA 2P67A 1R3KC 1H8EG 3LDCA 3K3WA 3ZRSA 4PDRA 4PA7A 3OE7G 4MTXA 3NXSA 1R6KA 3FYEB 3G4SV 1VQ8V 1QLEB 1K92A 1VQ9V 4X89A 2A9HA 3LDEA 5BZBA 1CP9A 4G2KA 1AI4A 1R3LC 2ITCC 2GSMB 4WFAV 1V54C 2XASA 5LGNA 4N21A 1QCEA 1RM1C 1DF4A 1AR1B 5B1AB 5DN6G 1VQMV 3SPHA 1F23A 1R6NA 2Y69B 4N23A 3FB8C 4WFGA 1GO3F 5LHIA 3ZRWB 1NH2D 1V55C 2DYSB 3ML0A 1Y66A 4RQFA 2WAMA 1AI6A 2WLLA 3D36A 2XNDH 1Q86W 2ZQMA 4KFMA 1W2BU 2B5UA 5HFMA 3E89A 2HLDG 3TCUA 1M9NA 3OM3B 2W0FC 1OCOC 3JCZA 4Q20A 5EC2C 1AQTA 4WVZA 1ENVA 1VQNV 1I5YA 3ZMSA 3OUSA 2IJJA 1OCCB 1QR8A 2EINB 2X0LA 1BL8A 4P30A 3SYPA 3T2MA 3ZN1A 4WFEA 1Q7YW 1M90W 1R73A 2JEUA 3SPCA 1THZA 1BHBA 4HAMA 1WPXA 4BW5A 2JEXA 4JTDB 4XDLA 1EBOA 1F51A 2IJHA 2NNUA 5HFLA 5KUMA 5LGTA 3CC7V 1S77D 1PNMA 2WSSG 1GM8A 1JX9A 3ZMTA 4MTGA 1FXKA 2LFRA 2QTOA 3ZMUA 4XDKA 2HJFC 3HPLC 3QNEA 5L3BA 2JJ2G 5B1NA 1UJWB 2WLIA 2EJRA 3E86A 5L3FA 1KC8W 1K4CC 4KP4A 3G6EV 2XNDG 2Q6AA 3ABKB 1K3EA 4QJFB 1IFPA 3B77A 4BAYA 4PA9A 1MG1A 1EZJA 2WLLB 3K79A 4LCUC 1E79H 3A0RA 3CCLV 4WF9V 3ABLB 5IY5C 2ZXWB 1JCHA 1YJ9V 1GM9A 1K5SA 4R7CA 1YSCA 4MSWC 3F7VC 3ZJZA 5H6RA 4GX5A 4MS2A 1KECA 3ABMB 2LFSA 5KA5A 1KP3A 1SZTA 2OTLV 1MSWD 2JDIH 3P30A 1YTFD 1KKDA 3OMNB 1PL0A 1TUEB 4WCEV 2JK5C 2X7RB 1VQKV 2X6CA 3RW0A 1M57B 1KD1W 3IC7A 2XAJA 1GK9A 2HG5C 2DWDC 5KA6A 1YHQV 4OXSA 2C2AA 2DYRC 4X88A 3WG7C 2E5YA 1MABG 2YEVA 1S5HC 2DWEC 5H6QA 2QEXV 3K06A 4RUEA 3T4ZA 4MVRA 1QVFU 5L3DA 2GHYA 1JVMA 2IU3A 2MK3A 4HYOA 3ZRXA 3F7YC 1K5QA 3FYIB 3JD3A 3OR6C 3FKSG 1G4YB 1S0VA 4FK5C 2IJIA 2EIKC 2F43G 1E79G 2Q67A 1H2GA 3RBZA 1K97A 1GKFA 5H9CA 3OR7C 4U7NA 3CCMV 3AG4C 2EILB 1YIJV 2X6BA 2JDIG 1GTOA 1S3JA 3DGEA 4PA6A 2AHYA 1Y4MA 2OCCB 1AI5A 3STLC 2IJKA 3UM7A 2P90A 3IFXA 1S72V 2ITDC 1W0JG 1IXMA 3AG2B 2ZDIC 1QVGU 1L1FA 1RPOA 2EINC 1SERA 2WSSH 2Q69A 2HKOA 2UXXA 3JD2A 4BIUA 1SETA 3E8HA 4CZZA 4DJGA 1NR7A 2D3OW 3W7XA 3KG2A 3MHHC 1BSNA 3G71V 1YI2V 4MVUA 5CBHA 2EIJB 5LBQA 4ZBMA 3JD0A 2WLHA 1Q82W 3K0DA 2BOBC 3OMIB 5B1BC 2H94A 4H37A 4QIWF 3I56V 4JPRA 1FFTB 3CMAV 2YEVB 3CCSV 1YTFB 3TETA 1BMFG 3ASNB 4RO2A 4QNHB 3MHSC 1NR1A 1J95A 1NVPB 3ABTA 1EFRG 1PKXA 3CP1A 1K9MW 2W6JH 2WWWA 3LNMB 1Q81W 3VBBA 3R65A 3ABLC 2EIMB 4JAUA 3CYOA 4UVAA 3LDDA 3CPWU 1S76D 4MTFA 2YSUB 3JYCA 1RPRA 4FJCC 3QO7A 4MVMA 1QR9A 1K7DA 1VQLV 2XAQA 3ETDA 1AI7A 2XAFA 1OCRB 1V54B 2Z3YA 3H01A 1F4MA 3AG1C 1GM7A 1RM1B 5L3CA 3E8FA 3E83A 4PA4A 5CBFA 1P7BA 1HWYA 5FL7G 4F4LA 1KP2A 1VQ5V 4JASA 5IYDO 4MVOA 3CCEV 3CCVV 2WPDG 2FTKA 2EZOA 3CCJV 3T4DA 3F5WC 4HZ3A 3K08A 4DO2A 3K0GA 1NBMG 1OCZB 5GW7A 1VQ4V 2LP7A 1DF5A 3AEIA 4LC1A 4QE9A 1F4NA 4I5SA 3FB6C 2R9IA 5KUKA 1NQTA 5CBGA 2H8PC 5EBMC 1E1RG 1WLEA 2WLNA 3X2QC 4RUFA 3OEEG 3SYCA 4UUJC 4ASUG 1N8RW 3QO8A 2W6JG 4Z1MG 2CK3H 1OCOB 1G8MA 3E8GA 1PNKA 1VQ7V 4JAVA 4MVSA 3LUTB 1QLEC 4KUMA 1NJIW 3E2EA 2X6AA 1ORQC 2QKSA 3K03A 1NH2B 1VQ6V 4LP8A 5CMUA 2QA4V 3UKMA 2V7QH 3OEHG 3ETGA 5IYBO 2Q68A 2XOKG 4G28B 3EHBB 3P32A 3CCUV 3FB5C 3AG2C 1R3JC 3EFFK 5L3EA 5EK0A 3LSSA 1FXKB 4PDMA 1FXVA 4JGSA 5B1AC 2QE7H 4JYCA 4MW3A 5C93A 3ASOB 2Y69C 2HFEC 3SYAA 3ZRVA 3IGAC 1CPYA 4QMAA 4L87A 3LSQA 2WLIB 1AJQA 4WFBV 1H8HG 3USSA 2DYSC 1YITV 2HVKC 1R3IC 4QPKA 1OHHG 3ZRWA 5DM6V 4ZKIA 3D3IA 3OFNG 1YJWV 2M7WA 3ZIAG 2Z5UA 3E8BA 4P9PA 5E1AC 4GX2A 1VQPV 3RVYA 2PI5A 1DLBA 3CXCU 4UV8A 5IY5B 3OAAG 3ZN0A 3BY6A 1JQ0A 2CK3G 1ROPA 2ZR2A 1PNLA 1VQOV 1I5XA 1NKDA 3AG3B 2QM8A 1OCCC 2P6JA 2W6IG 2Y48A 4R50A 5LHHA 2DQ0A 2OT5A 2ZDIA 4JTCB 2B1GA 2PI4A 3K04A 2XAHA 2EIMC 2DW4A 2V7QG 3VOUA 3GB7C 5B3SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q6A A;  1IFP A;  3R65 A;  2EIJ C;  3ABL C;  2IH1 C;  2ATK C;  5EC1 C;  4PA9 A;  3SYO A;  4PDL A;  2WLL B;  4LCU C;  3BEH A;  1E79 H;  3LDD A;  4MTF A;  5IY5 C;  3PJS K;  4R7C A;  3JYC A;  4MSW C;  4R6Z A;  1OCR C;  3F7V C;  3SPJ A;  4MVM A;  3SYQ A;  3ZJZ A;  4CBC A;  1XL4 A;  4GX5 A;  2E5T A;  4MS2 A;  5EBW C;  3ASN C;  3OGC C;  4GX1 A;  2JDI H;  4H33 A;  4EKW A;  4MVQ A;  3AG1 C;  2R9R B;  1KKD A;  1JEK A;  3E8F A;  4P2Z A;  4R8C A;  3E83 A;  3RVZ A;  1R3K C;  4PA4 A;  4YXW H;  3SJQ C;  3LDC A;  5CBF A;  1P7B A;  4TWK A;  3ABK C;  3ZRS A;  4F4L A;  2JK5 C;  4G27 B;  2IH3 C;  4MVO A;  2X6C A;  4PDR A;  4PA7 A;  3RW0 A;  1OCZ C;  2K1E A;  3T4D A;  3F5W C;  2ZXW C;  4HZ3 A;  3K08 A;  1ZWI C;  3K0G A;  4X89 A;  2A9H A;  4P9O A;  3FB7 C;  2A0L A;  3LDE A;  4QE9 A;  3ABM C;  2HG5 C;  5BZB A;  2DWD C;  1BSH A;  1R3L C;  2ITC C;  3OUF A;  4DXW A;  4PA3 A;  3FB6 C;  4QE7 A;  1V54 C;  5KUK A;  4OXS A;  2DYR C;  4LBE C;  2H8P C;  4X88 A;  3WG7 C;  5CBG A;  2WLM A;  2E5Y A;  5EBM C;  2YEV A;  1S5H C;  2DWE C;  2WLN A;  3X2Q C;  3K06 A;  2WLJ A;  4RUE A;  4MVR A;  4RUF A;  3SYC A;  4UUJ C;  3T4Z A;  1JVM A;  3STZ C;  1XL6 A;  4HYO A;  3F7Y C;  3SPH A;  2CK3 H;  3OR6 C;  3E8G A;  1FS0 E;  4PDV A;  1G4Y B;  1M57 C;  4MW8 A;  2KB1 A;  3FB8 C;  4MVS A;  4WFG A;  3LUT B;  2EIK C;  1QLE C;  2X6A A;  1LNQ A;  2Q67 A;  1ORQ C;  2QKS A;  3K03 A;  1K4D C;  4JTA B;  1V55 C;  3RBZ A;  2P7T C;  4J9Y B;  4LP8 A;  3OR7 C;  4WFF A;  3AG4 C;  3UKM A;  2V7Q H;  2WLL A;  2XND H;  2X6B A;  5EBL C;  2Q68 A;  4G28 B;  3SPI A;  4KFM A;  4MTO A;  3FB5 C;  4X8A A;  3SPG A;  3AG2 C;  4PA6 A;  2AHY A;  1R3J C;  3EFF K;  3ASO C;  3E89 A;  5EK0 A;  3STL C;  2WLK A;  3TCU A;  3UM7 A;  3IFX A;  4PDM A;  2ITD C;  5B1A C;  5J9P C;  4XDJ A;  2QE7 H;  2W0F C;  4MW3 A;  1OCO C;  2Y69 C;  4RAI A;  2HFE C;  2EIN C;  5EC2 C;  3SYA A;  2WSS H;  4GX0 A;  3IGA C;  1AQT A;  2Q69 A;  4QMA A;  4WVZ A;  4I9W A;  3E8H A;  4DJG A;  2WLI B;  3OUS A;  3SYP A;  3T2M A;  1BL8 A;  4P30 A;  2HVJ C;  3USS A;  2DYS C;  4WFE A;  2HVK C;  3KG2 A;  1R3I C;  4WFH A;  1BSN A;  2EIL C;  3SPC A;  4BW5 A;  4MVU A;  4MVZ A;  3E8B A;  4P9P A;  5CBH A;  5E1A C;  4JTD B;  4GX2 A;  4XDL A;  4ZBM A;  3RVY A;  4TLF A;  2ZD9 A;  2OCC C;  2WLH A;  5KUM A;  2AHZ A;  3K0D A;  2BOB C;  5B1B C;  4H37 A;  4MTG A;  3AG3 C;  2A79 B;  2NLJ C;  2QTO A;  3TET A;  4RO2 A;  4XDK A;  2BOC C;  2HJF C;  4QNH B;  3HPL C;  1OCC C;  4R50 A;  1J95 A;  5B3S C;  4J9Z B;  2WLI A;  4JTC B;  3K04 A;  3E86 A;  2EIM C;  1K4C C;  3VOU A;  3T1C A;  2W6J H;  3GB7 C;  1M56 C;  3LNM B; 
#chains in the Genus database with same CATH topology
 5CB4 A;  2YO2 A;  4DV5 B;  4PDL A;  4LF7 O;  4DOJ A;  3W7S A;  3UCS C;  2POH A;  1ARO P;  1TA8 A;  2B9Z A;  4E2L A;  1HNW O;  3CCQ V;  2M5A B;  2IPP A;  3MGN A;  4L8J A;  2UUB B;  2OTK E;  1OVR A;  2N1T A;  4UB8 Z;  2Q7C A;  1KIL A;  4Y99 B;  1NTZ J;  4R8C A;  3RVZ A;  1ZX3 A;  1R6T A;  3M99 B;  3SJQ C;  4TUY A;  1H0T A;  2AXT Z;  3L71 H;  1H38 A;  5APT A;  2KUB A;  4FPP A;  2ZT9 B;  4FIP C;  2W6A A;  4LGD E;  1KFN A;  3VMZ A;  2EIK B;  2ZR3 A;  3A5T A;  2ZNJ A;  2WSC J;  1WA8 A;  1ZWI C;  1K73 W;  3VTP C;  1N8R Q;  5APQ A;  1JTH A;  2A0L A;  4GCZ A;  3ABM C;  3JSN A;  4PV1 B;  1JY3 N;  1JB0 J;  3FXD A;  4PA3 A;  1RHZ B;  3WU2 Z;  4M3L A;  4LBE C;  1SA0 A;  2WLM A;  1M1J A;  1E1Q G;  3H1L G;  3C90 A;  3RYC B;  4F6R B;  4DUY B;  5L8R J;  1XL6 A;  1K34 A;  3W7U A;  1Y9B A;  1FS0 E;  4PDV A;  1WT6 A;  1J1E B;  4U3F E;  3BAA A;  4MW8 A;  2KB1 A;  1S5L E;  1KQL A;  2E74 B;  1XNQ O;  3SFE C;  2LGQ A;  5CN0 A;  5KHJ A;  5KJ7 D;  1HNW B;  4NYK A;  3L4F A;  5GTI E;  4Z2W A;  2ZM6 O;  3NTN A;  1D5N A;  1SQB H;  2E75 B;  4X8A A;  2NPS C;  5AVZ B;  1QVG O;  3HD7 C;  3ASO C;  1XQ8 A;  4EFE A;  1KZU B;  2ZAE B;  1OZ0 A;  1GL2 B;  4YXW G;  3RYI B;  1QLN A;  4RAI A;  3W7W A;  4TT3 G;  1MOF A;  4DR3 O;  4H44 D;  1CI6 A;  1MUU A;  5KJ7 C;  3AE3 C;  3TK1 A;  2DMX A;  1K8A W;  5FNV B;  2ZYA A;  1LTA C;  2QM4 A;  2UWJ E;  3PRJ A;  4EYY Q;  4MVZ A;  4IL6 X;  1NU1 K;  2ZD9 A;  5LP6 C;  5JH7 A;  2OAR A;  5J2U A;  3CCE P;  3G6E P;  1I08 A;  4O2B A;  4H0L B;  3AG3 C;  2A79 B;  2NLJ C;  3CL3 D;  5IDJ A;  2RH0 A;  3CCL P;  2ZE8 A;  3IF4 A;  3ZMZ A;  5B3S C;  3BAT A;  3H1J J;  1IO4 A;  5DED A;  5LOV A;  2XKM A;  2QSA A;  1YQ4 C;  2BTQ A;  3T1C A;  1N33 O;  2ZM6 B;  1MFZ A;  5TJH A;  2IW5 A;  2KYV A;  4PD4 F;  2IH1 C;  2QJK B;  1LWU C;  3SYO A;  4KHX A;  3K57 A;  4JI7 O;  3L70 G;  3AE9 C;  5KX5 B;  3V5B A;  4N3Y B;  3SPJ A;  2YI8 A;  3E35 A;  2E5T A;  2Z5H A;  5CBN A;  3QO5 A;  2JIZ G;  5EBW C;  1Y8A A;  2PAJ A;  4I6M C;  3KPE A;  2F1M A;  4ZI7 A;  4H33 A;  1FXH A;  4DR3 B;  3HTK B;  3K9A A;  5CA3 A;  1QBZ A;  4MVQ A;  4I4T B;  4IFM A;  1K73 Q;  3R66 A;  2P67 A;  4I0X A;  3UQ8 A;  2LGW A;  1H8E G;  3ZX6 A;  3K3W A;  4Z1V A;  3AEA C;  1O9G A;  2RN0 A;  3C9I A;  4EI2 A;  2OIG A;  4NTY A;  3BHP A;  1R6K A;  3FYE B;  3G4S V;  5KLV J;  3L74 E;  1QLE B;  1NWQ A;  4O4L B;  2QVA A;  2YC0 A;  4NXN B;  4X89 A;  1BQ0 A;  1EXJ A;  3TGU H;  5BZB A;  2ITC C;  1LP1 B;  4WFA V;  4UFZ A;  1V54 C;  1E5W A;  5IWA B;  3S9O A;  4IT5 A;  3FGA D;  1PIX A;  3CHX A;  1FDI A;  5CJ0 A;  3CXH D;  4WWI A;  1YIJ P;  3KCX A;  4FLV A;  1IFM A;  1NU1 D;  5M1B A;  1VQM V;  2WQY C;  5IYZ A;  4N23 A;  1PP9 E;  5AW5 B;  2M3E A;  3TF5 A;  1YXB A;  2LW1 A;  3BPZ A;  2DN9 A;  4TT3 H;  1Y74 B;  3V2N A;  5LHI A;  3ZRW B;  2OYH B;  3ML0 A;  4DRX A;  2Q8V A;  1L0L G;  4DYL A;  1JMB A;  3H1H E;  1AI6 A;  2F95 B;  2W0X A;  2KG7 A;  1DGS A;  2K1A A;  3FAV A;  2B5U A;  1SQF A;  1IFD A;  4IL6 H;  1IFJ A;  1K8A Q;  1IZ3 A;  5D5P A;  1MV8 A;  3CCQ P;  3LIE A;  3Q3D A;  3ZMS A;  1R8E A;  5JQG A;  3OUS A;  1HWT C;  3SYP A;  3I56 P;  2JVD A;  4P30 A;  1Q7Y W;  2BCC J;  4WFE A;  1M7L A;  1ZR4 A;  2JEU A;  4GKJ O;  2KK7 A;  1LJ2 A;  1THZ A;  3JAM N;  1WPX A;  1MA1 A;  1KKC A;  1XRE A;  3BVH A;  3G9R A;  2ITA A;  1T2K C;  1FZC B;  3CC7 V;  2GUZ A;  4DV7 O;  3SGI A;  5BVZ A;  1AJY A;  1BE3 H;  1PNM A;  1NTZ G;  4MTG A;  2PYL A;  3M0A A;  2YNY A;  1CW5 A;  2SPZ A;  2O1J A;  4X1I A;  3FFQ A;  1S1C X;  5B1N A;  4W4L A;  1ZLL A;  1S9K D;  2EJR A;  2Z0A A;  1S4X A;  3UT5 A;  1K4C C;  5KMG A;  1EDL A;  4UB8 E;  3HE4 B;  1K3E A;  4JI4 O;  5CJ4 A;  1PPJ E;  4BAY A;  1LT9 A;  4PA9 A;  1VF5 B;  2UXB O;  1QL1 A;  3AE1 C;  3T97 B;  1I94 O;  4U3J A;  3VN0 A;  3RYF B;  2CH7 A;  1YJ9 V;  2HP8 A;  2G8Y A;  3B2E E;  1HR0 O;  1GTW A;  5H6R A;  1KEC A;  3A0B E;  1MSW D;  4YHH B;  1SFC B;  5C8Y A;  3M06 A;  2YXR B;  3IC9 A;  3OMN B;  2KLV A;  2N9Y B;  4GKJ B;  1TUE B;  1KB9 E;  5AVW B;  4YJ2 A;  2X7R B;  3K5O A;  2H3O A;  1HNX B;  3CWB J;  1GAX A;  1GK9 A;  4PV1 D;  2DWD C;  5KA6 A;  1URQ A;  3PP5 A;  4EIJ A;  5CCG A;  4UCT A;  4J7Z A;  2R3C A;  4OXS A;  2PY5 A;  4X88 A;  4KHP O;  1SQG A;  1NHL A;  2DWE C;  3K06 A;  5EIB D;  2YKQ A;  5L3D A;  2MK3 A;  1M8O B;  4LWS B;  3FKS G;  1G4Y B;  2ZT9 C;  4FK5 C;  1I94 B;  3BCC J;  2EIK C;  1E79 G;  2UUA O;  2Q67 A;  1OW6 A;  2ODM A;  1HR0 B;  1GN6 A;  5H9C A;  4U7N A;  3CCM V;  1LTJ B;  1TVK A;  2OYO A;  4FFK A;  1SP4 A;  2E75 D;  1GTO A;  1S3J A;  3H25 A;  2HOD B;  3Q5P A;  3AEB C;  3STL C;  1Q7Y Q;  2P90 A;  3IFX A;  2UXC B;  1OWA A;  1U7J A;  1W0J G;  5KAI E;  3AG2 B;  1QVG U;  1L1F A;  1G2C A;  2NRG A;  3T1Y B;  2AGA A;  2EIN C;  3M9H A;  3EVK A;  1J1E C;  3D6Z A;  2UXX A;  5LMN O;  2WPQ A;  2E74 C;  1VIB A;  1NR7 A;  2QJY B;  1A32 A;  2K3R A;  2FYU E;  3W7X A;  2R9A A;  1RE3 C;  1QHT A;  4B3T B;  1AA0 A;  1SQP E;  2E3C A;  3G71 V;  2FYZ A;  3M9Q A;  2CE4 A;  1JA8 A;  2WSC H;  3ZHR A;  3DC6 A;  1EZV E;  2EIJ B;  4KHP B;  3N2K A;  3CJH A;  2FFD A;  4U3F D;  3ZDM A;  3HKC A;  3G4S P;  1GL2 C;  1FJK A;  4H37 A;  4QIW F;  4H0L D;  3VP9 A;  1FFT B;  3CMA V;  1XUQ A;  4DV3 B;  4D6T G;  4JI3 O;  3TET A;  2ZE6 A;  4QNH B;  1QEX A;  2UUA B;  3JCU H;  1Y76 A;  4DW1 A;  1NTK E;  1NVP B;  1Q90 D;  1EFR G;  2P2U A;  4W4K A;  2WWW A;  1DEE G;  3A3Y B;  2I1K A;  3A0H H;  3E1I A;  1FDM A;  1VQM P;  3S1K A;  3CYO A;  3L73 D;  3LDD A;  1A02 F;  4NB5 A;  2YMY A;  3GHG A;  1L4A A;  4XFJ A;  3JYC A;  4H0L C;  3QO7 A;  3H6P A;  1QR9 A;  3ETQ A;  1DK1 A;  1KTM A;  3AED C;  5KKZ B;  3ZHV A;  4I9Q A;  3ETD A;  5LMN B;  3B5N C;  1YBK A;  5LA6 A;  2KOG A;  5AVR B;  1JO5 A;  5LL6 Y;  3SWK A;  4IGG A;  1IBM O;  4FVM A;  5CBF A;  2FYN B;  1HWY A;  4JAS A;  5IYD O;  5J2T B;  2KB7 P;  3L72 E;  1BT8 A;  4O4H B;  4ASW A;  1P49 A;  4DO2 A;  3U10 A;  3HKB B;  1SQX E;  2A7W A;  2L5G B;  3L75 E;  4I5S A;  4JI1 O;  2R9I A;  5KUK A;  3DSQ A;  3H1K G;  5EZY A;  2H8P C;  5GON A;  4AQY O;  1DX7 A;  3B40 A;  5EBM C;  1WLE A;  3VQX A;  2UU9 O;  4RUF A;  3OEE G;  3SYC A;  3CC7 P;  5BXZ A;  3QO8 A;  4Z1M G;  3H1J H;  2CAZ C;  2CK3 H;  1OCO B;  2QJP B;  5APU A;  1GN3 A;  2WPV B;  1KN7 A;  1VQ7 V;  5AVQ B;  2O3J A;  3K58 A;  1QLE C;  1FE6 A;  1NH2 B;  3U1C A;  1JY2 N;  3F5H A;  1Q8I A;  1SZX A;  2W90 A;  2Q68 A;  3EHB B;  2RCV A;  3CCU V;  3VYI A;  1I0H A;  4LF6 O;  1IBM B;  3LSS A;  1HGV A;  3O9O A;  1FXV A;  1UFI A;  4JGS A;  5BR8 B;  3L74 D;  1ZL8 A;  2NPS B;  4X1Y B;  3HKE A;  4MW3 A;  3ASO B;  3HD7 B;  1G1J A;  2HFE C;  4I7Z B;  1CPY A;  1SQQ H;  4MN4 C;  3LSQ A;  2WLI B;  1N73 C;  1AJQ A;  2RQ6 A;  4WFB V;  2OYH C;  4X1K A;  3HUS A;  4B3M B;  5KLV H;  4JI1 B;  1IX9 A;  4P9P A;  4WB4 A;  3V6I A;  4IIJ A;  1VQP V;  1PP9 D;  1NZ6 A;  4GKK B;  5AG2 A;  2PI5 A;  5H2F H;  2A06 H;  3OAA G;  4JQ0 D;  1YVW A;  5LP6 B;  3HE5 A;  3TSI A;  2YKP A;  2HPC A;  1L0N H;  4I55 A;  4ASV A;  3H1H D;  2AZ0 A;  1PNL A;  1VQO V;  2M3B A;  1AV1 A;  1N7S A;  3AG3 B;  3FD9 A;  5LHH A;  1BQZ A;  4R50 A;  2DQ0 A;  3N7N A;  4JTC B;  2PI4 A;  3K04 A;  2OYQ A;  2XAH A;  2DW4 A;  4GOF A;  5B3S B;  2CGN A;  1WJZ A;  1GK6 A;  2ATK C;  1OXZ A;  3H1I J;  4LF6 B;  4B3R O;  1VF5 D;  4QPJ A;  3G3Z A;  2GUV A;  3WFV A;  2VQF O;  5LYJ B;  1P84 E;  2R3S A;  3I55 V;  1T5E A;  3TGU J;  2QE7 G;  1USD A;  1SQB E;  4CBC A;  1XL4 A;  1RF0 C;  5A2Q N;  3D8C A;  4FLZ A;  4GX1 A;  3CCM P;  2I1J A;  3JSL A;  3DTU B;  1SFC D;  1T3U A;  3WG7 B;  2EUL A;  5BMV B;  2GV9 A;  4KL1 A;  1EDI A;  2B1I A;  1AVO A;  2KI7 B;  3WB1 A;  2RMK B;  2BCC H;  5KLI C;  4G27 B;  2IH3 C;  1JR9 A;  4NR1 A;  2ZFC A;  3SDL A;  3CX5 I;  1MZE A;  1OCZ C;  1VF5 C;  2MJZ A;  3VQV A;  1BS3 A;  1AB3 A;  5E79 H;  1WP8 A;  1JPX A;  3OUF A;  4DXW A;  1SC5 B;  2D2C B;  2WSE J;  3G71 P;  4TSF G;  1QVF O;  1GW3 A;  4X64 B;  1PPJ D;  4TV9 A;  1NTM K;  4LFA O;  2WLJ A;  1TAE A;  2JP3 A;  1X79 B;  2UXD B;  3IFM A;  4LH6 A;  3CCV P;  3CMA P;  1SQP K;  2IU0 A;  2YIC A;  1ZP0 C;  1VAR A;  4JTA B;  1K4D C;  4J9Y B;  2YIU B;  4WFF A;  4XA4 A;  1QU7 A;  5EBL C;  1FXK C;  2KNC B;  3SPG A;  3UO3 A;  4BIZ A;  1P4R A;  1EDK A;  1R5S A;  5IYC O;  2AW9 A;  1RQV A;  3I5D A;  3GWO A;  3JCU Z;  3A2F A;  1PV3 A;  2N1T B;  5EYP A;  1KIL B;  3L71 G;  3MD0 A;  4J80 A;  3JD4 A;  2C0X A;  4TUY B;  4DCK A;  3B71 A;  3A0H Z;  2HVJ C;  5DJU B;  1ZRT E;  3H1L E;  4PD4 I;  3K9S A;  1F7Y A;  1WA8 B;  1CEZ A;  1IFN A;  3BRT B;  3CX5 H;  2QDO A;  3CWB H;  3SJC C;  1JTH B;  3Q1M A;  3GLM A;  3G6B A;  5LXT A;  3H1K D;  1K05 A;  1KU9 A;  4DR6 O;  1A02 J;  1XNR O;  1NAY A;  1KV4 A;  4DV5 O;  2CPB A;  1SA0 B;  2CTP A;  2WIT A;  2KZJ A;  1RF1 C;  3KDP B;  2BOC C;  1S2E A;  3GG2 A;  1AJP A;  4OX9 B;  4LNU B;  1EN4 A;  3AG1 B;  1NVP D;  3CC2 V;  4I50 A;  1OW8 A;  3SWF A;  1DTO A;  3BCC H;  1Q2N A;  1M56 C;  2EIJ C;  5EC1 C;  2YKO A;  3S4R A;  1GZL A;  4EB6 A;  1NTM D;  4UVB A;  3BAS A;  3J7A U;  1AQ5 A;  1K33 A;  2FYU D;  2XAG A;  5KHH A;  1WPB A;  5JVD A;  2JGU A;  1HGZ A;  2NR5 A;  1SQP D;  1BCC J;  1IBK O;  1KB9 F;  5KAF E;  5B1O A;  1EZV D;  4RJT A;  1GK4 A;  3CCU P;  4GT1 A;  4WBN A;  4UXN A;  1U96 A;  1RY3 A;  1CI6 B;  4UB6 E;  2GA1 A;  4JZ2 A;  3M7M X;  3NXS A;  4DUY O;  2ZJS E;  1XNR B;  4PD4 H;  1VQ9 V;  2LJ2 A;  3EFG A;  1NTK D;  4X65 O;  5IE9 A;  5JH7 B;  5J2U B;  3RK2 C;  5KKZ C;  4O2B B;  2K9P A;  4C7N A;  1XIL A;  1OIP A;  3PTZ A;  2LXC B;  4DZO A;  4IHJ A;  4N21 A;  1G1I A;  3Q4H B;  1AR1 B;  1JFF B;  1VF6 C;  3L70 E;  2H7H A;  2PP6 A;  2FYN C;  2YS8 A;  2JWA A;  3SPH A;  1R6N A;  2Y69 B;  5LOV B;  2BTQ B;  2VWJ A;  1GDT A;  3JAK A;  2BTO A;  4WFG A;  3BVO A;  1EN5 A;  1M4U A;  1NH2 D;  1V55 C;  2DYS B;  2UUC B;  5H2F Z;  2GM4 A;  1X8Y A;  4DR4 B;  3D36 A;  1KYO D;  1IBK B;  1Q86 W;  2ZQM A;  4KFM A;  2MW2 B;  4ABM A;  1W2B U;  2E42 A;  3L72 D;  2HLD G;  3TCU A;  1N0J A;  4ZI7 B;  2LKM A;  2NPS D;  3EQ2 A;  2B9B A;  2W0F C;  5GTH Z;  1DD4 A;  2QJP C;  3HD7 D;  1OCO C;  1D5A A;  3JCZ A;  1ENV A;  4I0X B;  1VQN V;  1BDD A;  1SQX D;  3L75 D;  1NH4 A;  3CXH I;  1JMK C;  4FZ0 A;  1GU4 A;  5TIS H;  2EIN B;  3J81 N;  3JC2 2;  1M90 W;  3CCS P;  5B66 H;  4X65 B;  2P4K A;  3TGU G;  1BHB A;  1UII A;  3ZED A;  3CX5 F;  1Q5O A;  1F51 A;  2IJH A;  2NNU A;  5HFL A;  1SQB K;  1JX9 A;  1L0L E;  2LFR A;  3ZHU A;  4I7Z C;  3ZMU A;  4YY3 O;  2Q0O C;  2HJF C;  4XDK A;  5CA0 A;  3HPL C;  1ZV8 A;  4OH8 B;  3TXQ A;  1UJW B;  3L73 E;  2FML A;  5L3F A;  4KP4 A;  4PJ0 H;  4DRX B;  1IFP A;  3E22 A;  4O4J B;  5AVT B;  3QWO C;  4JI5 O;  2KS1 A;  1MG1 A;  2GDS A;  1EZJ A;  4I1L A;  3K79 A;  3A0R A;  1AR5 A;  2ZXW B;  1JCH A;  1OX3 A;  3FAV B;  4R7C A;  4E4E A;  1VQ5 P;  3F7V C;  1D7M A;  5BU8 B;  2BSK A;  1KP3 A;  3JAL B;  4CS4 A;  3LW5 H;  4NXN O;  4W7Z A;  2G38 A;  1HTL C;  3II6 A;  1WB7 A;  1FZF A;  1PP9 J;  4OVN F;  5IWA O;  2FB5 A;  3B5N B;  1NTZ E;  4WCE V;  3UIA A;  4LLH A;  4ZKU A;  3CXH H;  2WPS A;  5F2V O;  1M57 B;  2PF4 E;  2OCH A;  4JI0 B;  3H1H J;  5C39 A;  1BE3 G;  2XAJ A;  4OGQ B;  2GUZ B;  3ZS8 C;  2ZE7 A;  3IAO A;  2HG5 C;  4YY3 B;  2YIB D;  2M5A A;  3AEG C;  3WG7 C;  1KOR A;  4X1I B;  2O01 N;  2QA4 P;  4WY4 A;  2QEX V;  1QVF U;  4RUE A;  3T4Z A;  4AI8 A;  1P84 D;  2GHY A;  2R32 A;  2LO1 A;  5JJN B;  3FYI B;  3JD3 A;  1SQB D;  1Q86 Q;  3UT5 B;  4JI5 B;  1SQQ J;  3S3W A;  3BRV B;  3W67 A;  2F23 A;  3WUV A;  2F43 G;  1KQS O;  4LF5 B;  1H2G A;  1LT9 B;  1GKF A;  3H1I H;  3OR7 C;  2OYI A;  4U3J B;  2EIL B;  2D2C C;  3SWY A;  4N78 E;  2AZ2 A;  3DGE A;  1IC2 A;  2AHY A;  3MUD C;  5CHX A;  2OCC B;  3UM7 A;  1M90 Q;  3D6Y A;  3CB2 A;  5K1X A;  2ITD C;  5IJ9 A;  5C8Y B;  2A45 I;  4X9Q A;  2EJ7 A;  2N1T D;  4NXM B;  1L0N J;  1RPO A;  3RYC A;  3VP8 A;  4NVP A;  1RH5 B;  2LQT A;  2HKO A;  3JD2 A;  2WT7 B;  1SET A;  4CZZ A;  4DJG A;  4YJ2 B;  3B8E B;  3C3S A;  3AK1 A;  2YIU C;  2JRI A;  3MHH C;  4JYA O;  1N73 B;  3HR0 A;  1YI2 V;  2C9N Y;  2WA4 A;  3H32 B;  1NT2 B;  3SJA C;  1BGY J;  3C8V A;  4L76 A;  1BCC G;  1FYJ A;  2WLH A;  1URQ B;  4DV4 B;  4JAA A;  3U11 A;  5CMZ A;  2WSE H;  4CH4 A;  3BRC A;  3CC2 P;  2N1T C;  1X4T A;  1T2K D;  1S5L X;  3PN1 A;  1JY3 P;  1H2K A;  2KQX A;  1KIL C;  1PGP A;  1VQ9 P;  1MNG A;  1YTF B;  2IX7 C;  3M8A A;  4RO2 A;  2Y0C A;  3MHS C;  1NR1 A;  1ZR2 A;  4PHZ A;  1H2M A;  1J95 A;  3ABT A;  4YHH O;  5AW8 B;  1SQV J;  3V4Q A;  1PKX A;  2FL4 A;  2W6J H;  1BZK A;  3AK3 A;  1Q81 W;  1P84 F;  3VBB A;  3R65 A;  3ABL C;  4K8X A;  3WMM 0;  3V2P A;  2GTS A;  4JAU A;  5JCO A;  3ABV C;  1SVF A;  4UVA A;  3JAT A;  2N9B A;  1M1J C;  5CA1 B;  4NTX A;  1ZRT D;  3H1L D;  1K7D A;  5IJ0 A;  1SS1 A;  4CS2 A;  1HNX O;  4LF9 B;  2RDC A;  2XAF A;  1FZB A;  1G2C B;  3H01 A;  1F4M A;  3AG1 C;  3PH0 A;  2A45 H;  3E8F A;  4JYA B;  4HBN A;  2Y0P A;  4PA4 A;  1OMI A;  5FL7 G;  4F4L A;  2PFX A;  1H2S B;  4D6T E;  3CXH F;  3O65 A;  2ZIN A;  3CCV V;  1AFO A;  2Y0I A;  2B88 A;  1WAZ A;  4IOI H;  2FTK A;  3CCJ V;  3T4D A;  5JWP A;  3F5W C;  5KLI B;  1JCD A;  1ZAU A;  1YYC A;  4HB1 A;  3N2K B;  3CJH B;  1OCZ B;  1VQ4 V;  2LP7 A;  1DF5 A;  3AEI A;  4QE9 A;  2AXT E;  3HKC B;  3L35 A;  1AP6 A;  3K5L A;  5D5Q A;  3O8Z A;  2M8R A;  1SS3 A;  2GUS A;  4BRY B;  5CBG A;  3F5T A;  5AW2 B;  2ZVN B;  5TIS Z;  1UPG A;  1HJ0 A;  1ZXG A;  1URF A;  4UUJ C;  1OVU A;  4JYY A;  2P7J A;  5B66 Z;  2UXC O;  1G8M A;  3E8G A;  2KSD A;  3RL0 C;  2AEF A;  3WU2 E;  3RYH A;  2K9J A;  2W83 C;  4MVS A;  3O6Q B;  4KUM A;  5AVY B;  3T1Y O;  5GTH E;  4UCU A;  2X6A A;  3PLN A;  2HJD A;  3K03 A;  3CLQ A;  1VQ6 V;  2ZT9 D;  4AHC A;  3UKM A;  3TJT A;  3OEH G;  3GHG B;  1L4A B;  3JAS A;  2XOK G;  3OJA B;  4G28 B;  2Y4U A;  2ZYG A;  1SKV A;  2YMK A;  4B3T O;  1LP1 A;  1W59 A;  1L0L K;  3CRR A;  3EFF K;  3G80 A;  5EK0 A;  4JI6 B;  1FXK B;  1ZTE A;  3JAR A;  5LA6 B;  1BCC H;  2WMM A;  2OGU A;  1IFI A;  1NTK J;  2Y69 C;  4H13 B;  1PGQ A;  2K9Y A;  3ZRV A;  1FJP A;  4PJ0 Z;  4QMA A;  1S5L H;  4L87 A;  4LH7 A;  1LTB C;  4DV3 O;  3ZBH A;  3H1K E;  2DYS C;  1YIT V;  2HVK C;  1BE3 D;  1R3I C;  5GTI H;  4FFB B;  2E74 D;  3ZRW A;  3L70 D;  1FAV A;  3OFN G;  1EN6 A;  3E8B A;  4JI2 O;  1JY2 O;  3CRA A;  3RVY A;  4K0K B;  2Q0A A;  4DT0 A;  2IZ1 A;  1DLB A;  1LTG C;  3W68 A;  5EZY B;  4GOE A;  3D71 A;  3M0D A;  1Q81 Q;  2CK3 G;  3H1J G;  1ROP A;  2ZR2 A;  1GL2 D;  1QL2 A;  2CPS A;  1NTZ K;  3APQ A;  2P6J A;  2W6I G;  2Y48 A;  4UCV A;  4EOT A;  1RF1 B;  1NTM E;  2J58 A;  2OT5 A;  2ZDI A;  2WSF H;  2ETN A;  3VOU A;  2LW7 A;  3NFQ A;  2DW3 A;  4L75 A;  3OAK A;  1SQX J;  1M56 B;  4JF7 A;  1FZC A;  3B4S A;  2Q5Z A;  3ZCC A;  3W7T A;  3CRQ A;  5LGU A;  2OTJ V;  1ZL8 B;  2Q6Q A;  1YZB A;  3HKE B;  1SQQ G;  4ZOL A;  3OTO O;  1XBL A;  2DYR B;  2IBZ G;  5AW4 B;  3ITK A;  3B5N D;  2OQQ A;  4X1K B;  4TWK A;  3HUS B;  4MT8 A;  3CC4 V;  2XDJ A;  2QWO B;  5KLV G;  4JI2 B;  1L0L D;  1M57 D;  3SSU A;  4O2A B;  3HB3 B;  4RQE A;  2ADP A;  2ZXW C;  1QX8 A;  2A06 G;  1W0K G;  2WZ7 A;  3JD1 A;  1S5J A;  1SRY A;  3RYF A;  4DV6 O;  4GDO A;  2VQE B;  1BSH A;  5L3G A;  1L0N G;  3L9D A;  3AE2 C;  3HE5 B;  2R70 A;  2JWD A;  4I55 B;  3RK2 B;  1AJN A;  1SFC A;  4DW0 A;  4XBF A;  1YJN V;  1PD3 A;  2H8P D;  1KFM A;  4ZHQ A;  2IBZ I;  4XE5 B;  2RJZ A;  3KZI H;  2QM7 A;  1M57 C;  5BR8 O;  1KYO E;  1RE4 A;  5KTB A;  2C9L Y;  1BGY G;  1ZME C;  2G3A A;  3VOP A;  1LNQ A;  3THO A;  4OGQ C;  1DH3 A;  2JS5 A;  1QLE D;  1KQS U;  5FLX N;  1VL2 A;  4UV9 A;  1NTZ D;  4ZMD A;  1V55 B;  4IL6 Z;  4B3M O;  3SPI A;  2QJ1 A;  3OTO B;  2P1J A;  3DXR A;  4DR7 O;  2WLK A;  4JYB A;  3B8N A;  4TV8 A;  4XDJ A;  4YJ3 B;  5B1B B;  1SQV G;  4GKK O;  2AEJ A;  1PP9 H;  2BCC G;  2IFN A;  4BW9 A;  2V1D A;  4GX0 A;  4HH2 A;  1KMI Z;  2LXB A;  4I9W A;  2HFE D;  3CD6 V;  1LT9 C;  1Q3E A;  1BHA A;  2IYP A;  4WFH A;  3H1H H;  4DV6 B;  2EIL C;  1QGK B;  3BFR A;  2LR2 A;  4LFC B;  1W2E A;  1LTJ A;  3AE5 C;  3RBX A;  3RN4 A;  1BDC A;  1W2B O;  2OCC C;  1D2D A;  1XHX A;  2AHZ A;  2QWP B;  4GIF A;  1KB9 I;  4DR5 B;  2NN4 A;  2ILM A;  5AVX B;  4U7O A;  3LW5 J;  4N78 D;  1YJ9 P;  2Z4E A;  1GU5 A;  4FMT A;  1QNM A;  3N27 A;  1JOY A;  2JKV A;  3WUU A;  2RN9 A;  1ZLZ A;  2IBZ H;  2WVR A;  1B6Q A;  4CH3 A;  4TQD A;  3ZMV A;  3AK2 A;  3OMA B;  5KLV K;  3CPW O;  4DR7 B;  3CME V;  3L71 E;  3E1R A;  1KBH A;  1URQ C;  2DJV A;  3BEH A;  1NU1 J;  2V7Q J;  2L35 A;  3JAW A;  5CCG C;  3FX7 A;  4IYI A;  1G1X B;  5FPR A;  1T6A A;  1OV9 A;  1JEK A;  3SYQ A;  1JUN A;  3HKD B;  1VQ6 P;  2Q3I A;  1DIP A;  5EYP B;  3ABU A;  2RKL A;  1WB8 A;  4OPH A;  1XTC C;  3U1A A;  1FZE A;  3RL0 g;  1M93 A;  4UB8 H;  4X64 O;  3ZRS A;  2WA3 A;  2V4H A;  1PPJ H;  1Z56 A;  4PDR A;  3CWB G;  4IFF A;  4PA7 A;  4MTX A;  4J11 A;  1FU1 A;  2B87 B;  1VQ8 V;  2UXD O;  1KUQ A;  1IK9 A;  3GWK C;  2BEQ D;  1BGY H;  2DE0 X;  5LXT B;  4BXL A;  1JNM A;  2A9H A;  1JCC A;  1Q6H A;  3VQW A;  1FD9 A;  3LDE A;  4DR2 O;  1W5C E;  2HLO A;  4G2K A;  4O4I B;  3A0B H;  1AI4 A;  2AXC A;  2GSM B;  4D7T A;  4LF8 O;  2QSI A;  2ZVO B;  2XAS A;  5LGN A;  1WRG A;  3C3T A;  4CH6 A;  1QCE A;  4NPD A;  3D70 A;  2Y9Y A;  1H89 A;  1KB9 H;  3N2G A;  3L37 A;  4I2L C;  5B1A B;  3BCC G;  5DN6 G;  3UO2 A;  1F23 A;  3JSV C;  5GTI Z;  4H44 B;  4I50 B;  5DJT B;  2L91 A;  1U7M A;  1SQV H;  1EZV I;  3FB8 C;  1I7F A;  1GO3 F;  1N4C A;  5JJE B;  1LT1 A;  4EB6 B;  2FFD C;  1Y66 A;  4RQF A;  1IVS A;  4UCS A;  3OA7 A;  3T1H O;  2WLL A;  1KIL E;  2XND H;  2JGD B;  2XZR A;  4D6T D;  4CH5 A;  1J1D B;  5HFM A;  1M9N A;  1TUB B;  4GKG A;  3OM3 B;  1PGJ A;  4NPF X;  4WBN B;  4Q20 A;  1XHZ A;  4WVZ A;  2OTJ P;  1I5Y A;  2YXQ B;  2X0L A;  5KHK A;  1ZN5 A;  4YIP A;  1R73 A;  3ZHQ A;  4DR2 B;  3SPC A;  5CB4 B;  4OX9 O;  3GHG C;  1L4A C;  2JEX A;  4LF8 B;  5AVV B;  4KT0 J;  4JTD B;  4XDL A;  2IZ0 A;  2J59 M;  5LGT A;  5KUM A;  2FXM A;  5KAI H;  1WMK A;  1MZ9 A;  2QRX A;  2WSS G;  1GM8 A;  3RK3 C;  4H13 C;  1HP8 A;  1RP3 B;  1GN4 A;  2NPS A;  3EWK A;  4X1Y A;  2M6Y A;  3HD7 A;  4BWN A;  2F4V B;  1LTS C;  2YXL A;  3RGB A;  3MZW B;  2MKV A;  2FYU H;  2PGG A;  2WLI A;  3JAK B;  1JMM A;  4AQR D;  1SQP H;  2Q7G A;  1KC8 W;  1H0T B;  2CTW A;  3T1H B;  2R5D A;  2Y0E A;  3G6E V;  2Q6A A;  1EZV H;  3ABK B;  3B77 A;  4R4L A;  5KJ7 A;  4LCU C;  1M56 D;  4KJM A;  3A8T A;  3CCL V;  1IXB A;  3ABL B;  2PTM A;  1JY2 P;  3MHV A;  1K5S A;  5ITZ A;  2P22 C;  3TGU E;  2OTL V;  5LP6 A;  2JDI H;  1M1J B;  1AVY A;  3KZI Z;  1NTK H;  3MAQ A;  1KKD A;  2IYO A;  2W8Z A;  3MIW A;  3ZHT A;  1FDO A;  2JK5 C;  1NKN A;  2ARH A;  2X6C A;  1HVV A;  3RW0 A;  1WNS A;  2KZI A;  3AE4 C;  2ZIM A;  1KD1 W;  2XU6 A;  1XOU A;  2OWO A;  3IC7 A;  3F89 A;  1FAF A;  5EFW B;  2E5L O;  2YXH A;  1LWU A;  1VQ7 P;  1MZF A;  3AEC C;  3M9B A;  5AVS B;  2UUC O;  1OW7 A;  2VRS A;  2B89 A;  5IT9 N;  2DYR C;  1PL5 A;  2GTA A;  3RK2 D;  4AIL C;  4DR4 O;  2YEV A;  1S5H C;  1M5I A;  3B09 A;  5CA0 B;  2QG4 A;  4IL6 E;  4MVR A;  3QH9 A;  3ZRX A;  1JVM A;  2IU3 A;  3HUS C;  4L73 A;  3F7Y C;  1AR4 A;  4U3F J;  3OR6 C;  3L72 H;  1S0V A;  2E76 B;  4IYH A;  3TXS A;  2IFM A;  4C7U A;  3E22 B;  3A2A A;  3RL0 B;  1K97 A;  2KS1 B;  3BA9 A;  4DK1 A;  1SQX H;  3L75 H;  1YIJ V;  2X6B A;  2Q4P A;  2BSK B;  4PA6 A;  1Q6U A;  1S72 V;  1SF9 A;  2IJK A;  1N7S C;  3CME P;  1WN7 A;  1IXM A;  2XTA A;  1AP5 A;  1GN2 A;  1BE3 E;  3P8C E;  1XTG B;  3TDK A;  1VQP P;  3V4W A;  2Y0D A;  1SER A;  3L73 J;  2WSS H;  3TNU A;  3CWB D;  4HNA A;  1KQF B;  3OW2 O;  3Q5R A;  2R44 A;  3P7K A;  2WSF J;  2Q73 A;  1NU1 G;  2D3O W;  1P84 I;  4DV1 O;  2E5L B;  3N4X A;  5CCH D;  3PHL A;  1FC2 C;  1VQO P;  1EM1 A;  5AW3 B;  4K3A A;  1FOS E;  4EEQ A;  3OTF A;  1N36 B;  3IJ4 A;  4ZBM A;  4DV0 B;  2KNC A;  1Q82 W;  3K0D A;  1NKZ B;  1KC8 Q;  3OMI B;  5B1B C;  1VQ8 P;  1FBM A;  3BCC D;  3I56 V;  4JPR A;  3CRC A;  3WUT A;  4WY4 B;  1BMF G;  1LGH B;  3ASN B;  1YQ3 C;  4DV2 B;  1NYH A;  3I55 P;  1X0T A;  4O9B A;  2O1K A;  2WPR A;  1FKA O;  3H1I G;  5CCH C;  1K9M W;  3A0B Z;  2P58 A;  3MP7 B;  2OYI B;  3FWL A;  3ICX A;  1MFT A;  4HJG H;  4DR1 O;  1NI8 A;  3CPW U;  4MTF A;  2YSU B;  3P3P A;  4JI0 O;  4FJC C;  1R5L A;  1X59 A;  1VQL V;  1NAF A;  1PGO A;  4DUZ O;  5IJ9 B;  1EDJ A;  4YTP C;  4X20 A;  1R1B A;  2YI9 A;  1KD1 Q;  1BCC E;  4DV1 B;  4PD4 D;  4FM1 A;  1RM1 B;  4NPE A;  4LNU A;  5L3C A;  4YIO A;  1EXI A;  4K8Z A;  5IYZ B;  4UCO A;  1H8A A;  4LF7 B;  1P7B A;  2FKW B;  1KP2 A;  2XV5 A;  1FJG O;  3KCY A;  4MVO A;  4FLU A;  2FBW C;  3L74 J;  3OGI B;  2W6B A;  3GMA A;  5E79 Z;  4F6E A;  1P84 H;  2OIE A;  4ZNC A;  1HDJ A;  3K0G A;  5GW7 A;  1HJB A;  2KG7 B;  1RSO A;  4LC1 A;  3U0Z A;  1OVV A;  1F4N A;  4LF5 O;  1GH6 A;  1NQT A;  2HG5 D;  1FFX A;  3L71 D;  1E1R G;  2ZIO A;  1KYO F;  1ZUQ A;  5FPO A;  4B7E A;  4ASU G;  2W6J G;  3D3Q A;  5JQG B;  1PNK A;  4LR3 A;  4DR1 B;  3VMY A;  1LTI C;  1NJI W;  1U57 A;  4NXM O;  3C1L A;  1AIL A;  1ORQ C;  1CZQ A;  2Q7H A;  4LP8 A;  5KAI Z;  2QTS A;  5CMU A;  1N32 O;  2V7Q H;  1NU1 H;  3JAT B;  4DUZ B;  5H5N A;  5IYB O;  3K5M A;  2PRR A;  1LTT C;  2Q3E A;  2KLU A;  3P32 A;  3FB5 C;  5IJ0 B;  4B08 A;  5L3E A;  2D2C D;  1VP7 A;  2A45 G;  3Q5S A;  5B1A C;  1IBL O;  3Q4H A;  4FM0 A;  1JFF A;  4DV4 O;  1XNQ B;  1FJG B;  4H44 C;  2CDY A;  2KIK A;  4X62 O;  2OTL P;  3QG5 A;  1H8H G;  1Q82 Q;  3JCU E;  1USE A;  1N34 O;  2QGN A;  2ZCE A;  5KMG B;  4J42 A;  5BY1 A;  4QPK A;  3SJB C;  2Q1K A;  2JS3 A;  1IUR A;  5DM6 V;  3D3I A;  1YJW V;  2QWN B;  1Y47 A;  3E7K A;  2M7W A;  3ZIA G;  2Z5U A;  5K1P A;  2M0B A;  4GOD A;  5E1A C;  4GX2 A;  1J1D C;  2CH7 B;  3A0H E;  3QTC A;  2ZKO A;  2KXP B;  4AYC A;  4UV8 A;  4GZR B;  5IY5 B;  4U7J A;  1K9M Q;  1KIL D;  2RNB A;  4F6R A;  2JR8 A;  4D6T J;  3H1L H;  4LF9 O;  2B1G A;  3BAB A;  3RYH B;  1N32 B;  2K9J B;  4YPC A;  2EIM C;  3KZI E;  2JEE A;  4B86 A;  2Q9I A;  3JAS B;  4TOI A;  1RE3 A;  1YF2 A;  1IBL B;  3CEI A;  2DQ3 A;  1OCR C;  1RFY A;  4UVC A;  2YO3 A;  2FY8 A;  1FS0 G;  3JAR B;  4U3F G;  3OGC C;  1OFC X;  3RFR A;  2K37 A;  1JJ2 U;  4X62 B;  4CS3 A;  4IFD K;  1N34 B;  1N33 B;  1GL2 A;  3B8M A;  3RYI A;  2EBO A;  4YXW H;  1S72 P;  3DC5 A;  4PI0 A;  4B7K A;  4JI7 B;  1COW G;  3ABK C;  4UCR A;  1YEW A;  2IM9 A;  4OPA A;  3H1J E;  4LFB O;  1YTZ I;  3I5C A;  1J5E O;  2YUA A;  3D36 C;  4ZKP A;  2K1E A;  2XNX A;  5LHG A;  4O4J A;  2Q7E A;  5FNV A;  1TVK B;  3KYQ A;  4P9O A;  3FB7 C;  1YCI A;  3AG4 B;  5AW1 B;  2Q5U A;  2QWR B;  4K35 A;  3L73 G;  4QE7 A;  3KQG A;  5KAF H;  3APO A;  5JJJ B;  3JAL A;  2EX3 A;  3LID A;  1NJI Q;  1J2J B;  1NOH A;  4PEL A;  4UB6 H;  3TYY A;  5B5E H;  3H1I D;  5APX A;  3LNN A;  1FZG A;  3STZ C;  2ZXE B;  3H1K J;  1L2P A;  3B5N A;  1LUW A;  4JI6 O;  2N74 A;  5K5G B;  2UXN A;  2ADQ B;  3TGU D;  2E76 D;  2YID A;  3NMD A;  1GMG A;  1SQQ E;  2QR4 A;  2VWK A;  2IBZ E;  3RL0 D;  3H9V A;  2KSE A;  2P7T C;  1KQG B;  1VQN P;  1N0N A;  2HYN A;  3RK3 E;  5KLV E;  1L8D A;  2FFD B;  4AUW A;  4MTO A;  5KX5 A;  3SFD C;  2YXY A;  2CTR A;  3L70 H;  1LUV A;  5APY A;  2F66 C;  1XMO O;  4ZOL B;  5H2F E;  5J9P C;  2A06 E;  4K0K O;  1NTM J;  2H89 C;  1GD2 E;  3HTK A;  2O01 H;  3CCR V;  4FM2 A;  4LFB B;  4X66 O;  4I4T A;  2DOS A;  1J5E B;  1Y76 B;  1L0N E;  1SLQ A;  2E76 C;  1M1K W;  1VQL P;  1HBW A;  2ZYD A;  4JF3 A;  2FYU J;  4QGP A;  3OW2 U;  3MTU E;  1SQP J;  1US6 A;  4KXR A;  1LR1 A;  2EZP A;  3KHU A;  1JOC A;  2PYJ A;  4EFB A;  4O4L A;  2CTQ A;  4TLF A;  3L36 A;  2L6L A;  1BGY E;  2JJ1 G;  3K5N A;  4C7R A;  2GBO A;  4FLY A;  3GF7 A;  2QKC A;  4WY4 D;  2BEZ F;  1DD3 A;  1VEW A;  2H88 C;  1WP7 A;  4L74 A;  3RK3 B;  4ZHQ B;  1B3Q A;  3L74 G;  4U3F H;  4R4M A;  2WT7 A;  1P7G A;  5AW7 B;  4J9Z B;  2HR3 A;  3IN6 A;  5KHI A;  1OJH A;  1SQV E;  3KXD A;  4DV7 B;  3P8C D;  1Y74 A;  2N05 A;  1FZA A;  2BCC E;  3K5B A;  1N73 A;  2OYH A;  3H32 A;  1XMO B;  3ETE A;  3MDS A;  3DXR B;  3PJS K;  1L0L H;  4R6Z A;  1SES A;  1Z5W A;  4WY4 C;  2K88 A;  1PP9 G;  4X66 B;  5E79 E;  3ASN C;  1PV0 A;  4TV8 B;  4Y99 C;  5GON B;  5A9G A;  2Z5I A;  2JO1 A;  4EKW A;  2VQE O;  2R9R B;  3L73 H;  5APW A;  3X2Q B;  4P2Z A;  4JI4 B;  1R3K C;  1HUC A;  3H1H G;  3LDC A;  2UXB B;  3L72 J;  3RGU A;  2KKW A;  2PGD A;  2OYI C;  2P5O A;  2KSJ A;  3OE7 G;  2QEX P;  4PV1 C;  4DK0 A;  1K92 A;  3LSU A;  3L75 J;  1CP9 A;  1R3L C;  4BWA A;  5CA1 A;  4FLX A;  2E43 A;  1GRJ A;  2Y9Z A;  1VPC A;  2QWQ B;  5EIB C;  1HW7 A;  1K04 A;  3FXE A;  1YJW P;  1RM1 C;  1DF4 A;  4JBZ A;  1PM9 A;  1NTZ H;  1RF0 A;  2IDB A;  3AE6 C;  4Y28 J;  3ZHS A;  4BR6 A;  2HEP A;  3CRM A;  3M91 A;  3R2P A;  1NS1 A;  2E75 C;  1BCC D;  1CSB A;  3HE4 A;  3P3N A;  1U97 A;  3CS5 A;  4YXD C;  2WAM A;  3JAW B;  1JJO A;  4IIJ B;  3T97 A;  4OGQ D;  1M1K Q;  1O9H A;  2Q9L A;  3CWB E;  3CX5 E;  3CSX A;  1N7L A;  4LFC O;  3E89 A;  1X9V A;  2XUM A;  3K59 A;  4BRY A;  2HPC B;  1YI2 P;  2FXO A;  4NTW A;  2PUS A;  1N7S B;  1XEQ A;  5EC2 C;  1AQT A;  1PPJ G;  2FXP A;  2P4V A;  4DR5 O;  1BSM A;  2IJJ A;  1OCC B;  1QR8 A;  2R72 A;  3T2M A;  1BL8 A;  3ZN1 A;  3HRN A;  1XDC A;  2XT9 A;  1DEB A;  3L71 J;  3O6Q A;  1FOS F;  3Q2Y A;  5JCO C;  3L74 H;  3WB2 A;  2YDE A;  4HAM A;  4BW5 A;  2PZS A;  3BCC E;  1HNZ O;  1EBO A;  1S77 D;  3J80 N;  5LMU O;  2QIW A;  3IAY A;  3ZMT A;  1FXK A;  1MSD A;  3EXA A;  2QTO A;  4GUN A;  1NGM B;  2YIA A;  3N2G B;  2HHH O;  4HYT B;  3QF7 A;  4JPZ B;  3QNE A;  5L3B A;  2JJ2 G;  4ZIB A;  1T3J A;  3GF3 A;  3E86 A;  4LWS A;  1T8Z A;  2QJK C;  1PZQ A;  3R4Y A;  1TU3 F;  4LF4 O;  1NO4 A;  5AW9 B;  4J41 A;  2XND G;  4QJF B;  4JV5 O;  4FFB A;  3P8M C;  3V2Q A;  2WLL B;  4RO0 A;  5KAF Z;  1E79 H;  4JI3 B;  4Q6G A;  4WF9 V;  5IY5 C;  5CBO A;  1SQB J;  1GM9 A;  4PD4 E;  1RQU A;  1YSC A;  4MSW C;  3ZJZ A;  1URQ D;  1N2D C;  2Y4T A;  2HOD A;  4GX5 A;  4UB6 Z;  4MS2 A;  5B5E Z;  3ABM B;  2AEM A;  2LFS A;  5KA5 A;  4B3S O;  5CCG D;  1SZT A;  3CCJ P;  3VMX A;  4TV9 B;  3P30 A;  3AEF C;  1YTF D;  1VQ4 P;  1PL0 A;  2O57 A;  1RF1 A;  1SQQ K;  1HNZ B;  1VQK V;  3CCR P;  5LMU B;  2ZXX A;  4JZG A;  3QVN A;  1B06 A;  3GVM A;  1AVM A;  1Y67 A;  2HHH B;  1NTM G;  1YHQ V;  2C2A A;  2F93 B;  4JI8 O;  1IK7 A;  2P10 A;  3GW6 A;  2E5Y A;  3IR9 A;  3OD4 A;  2FYU G;  2R5B A;  1MAB G;  5H6Q A;  1L0N K;  1IJD B;  1SQP G;  4FZ1 A;  4LF4 B;  4HYO A;  1FPO A;  4JV5 B;  4D6T H;  1K5Q A;  1EZV G;  1MMM A;  4PI2 A;  2IJI A;  5DEC A;  3U59 A;  5TIS E;  3FWN A;  4O2A A;  3RBZ A;  1UIX A;  4RKU J;  5B66 E;  1ZW0 A;  2AXT H;  3AG4 C;  2H43 A;  2XHB A;  4B3S B;  4AQY B;  4GLX A;  3OT7 A;  2UU9 B;  3M0D C;  2JDI G;  5ITZ B;  1YIT P;  3H1J D;  1NTK G;  1H2N A;  1Y4M A;  1YDX A;  1AI5 A;  4NKG B;  5KHG A;  1S5L Z;  2ZDI C;  1CXZ B;  3WU2 H;  2BE3 A;  2Q69 A;  4BIU A;  4N6J A;  5GTH H;  3E8H A;  2W27 A;  1VF6 A;  5AW0 B;  1SQV K;  3H1L J;  2C0W A;  1H88 A;  1X22 A;  5APV A;  3KG2 A;  2F4V O;  5J2T A;  1BSN A;  1FZC C;  3VQY A;  3AE7 C;  4MVU A;  1H2L A;  4O4H A;  4PJ0 E;  5CBH A;  4JI8 B;  5LBQ A;  2CUG A;  1LWU B;  3JD0 A;  1L4A D;  1EC5 A;  1PL4 A;  3CE2 A;  3HKB A;  4J7J A;  1SQQ D;  2BOB C;  3KKY A;  5JVD B;  2H94 A;  2IBZ D;  5AVU B;  1VDF A;  3CCS V;  2YEV B;  1HH0 A;  4YJ3 A;  3L72 G;  3A7O A;  1EQ7 A;  1Q6I A;  3S3X A;  1Z5V A;  3RK3 D;  2ZE5 A;  4H13 D;  5KLV D;  3H1K H;  2A3Q A;  1YTZ T;  2FKX A;  4J10 A;  5BU5 A;  1V9P A;  2QKA A;  1SQX G;  3CP1 A;  3L75 G;  4A7P A;  4Z1M H;  2A06 D;  3LNM B;  5CCH A;  3CXH E;  2EIM B;  1ZOY C;  4RES B;  1L0N D;  2VS0 A;  1S76 D;  1NU1 E;  3CC4 P;  4D7S A;  1RPR A;  4MVM A;  1SFC C;  4C7N B;  2ZNI A;  2N04 A;  2XAQ A;  4BIO A;  4CC5 A;  1AI7 A;  1KYO I;  3V2R A;  4IHJ B;  1OCR B;  1V54 B;  2Z3Y A;  1NTM H;  3TNU B;  3NR7 A;  3BA8 A;  4HNA B;  1GM7 A;  1RE4 C;  1BGY D;  3E83 A;  2FYU K;  4GYC B;  4B3R B;  2BAS A;  1G6U A;  2VQF B;  1MKM A;  1VQ5 V;  2WTY A;  3CCE V;  2VRZ A;  4J7K A;  2WPD G;  1YJN P;  2EZO A;  1JM0 A;  1NVO A;  4HZ3 A;  3K08 A;  1Z2G A;  1KB9 D;  1NBM G;  4W80 A;  1QQC A;  3H1I E;  1JY3 O;  1GW4 A;  4HKZ H;  3FB6 C;  1SQV D;  3HKD A;  1BE3 J;  2BCC D;  2I8D A;  3L70 J;  2J5U A;  4A5U B;  3X2Q C;  2WLN A;  1NTK K;  3VMA A;  1N8R W;  2O01 J;  3AE8 C;  1XMQ O;  4CC6 A;  4JAV A;  1LTJ C;  3LUT B;  3E2E A;  1OZH A;  1VMG A;  1Q43 A;  2JJL A;  2QKS A;  2B87 A;  3WB0 A;  5APS A;  1ZSP A;  4ICG A;  2V4D A;  4TQF A;  2QA4 V;  1N86 A;  3ETG A;  3G67 A;  4LFA B;  5LYJ A;  3CD6 P;  2NZ2 A;  4O4I A;  1HF9 A;  2P06 A;  3AG2 C;  3AEE C;  1R3J C;  1S9K E;  1IDS A;  4X20 B;  4PDM A;  1N36 O;  2QE7 H;  4JYC A;  1TGO A;  5C93 A;  4C46 A;  1N7S D;  4DV0 O;  3SYA A;  2QJY C;  1KYO H;  4RWU A;  1Y6X A;  3IGA C;  1PFI A;  5BMV A;  2UUB O;  2KP8 A;  4FLT A;  3USS A;  4EDF A;  3CI9 A;  3AG7 A;  4DV2 O;  1SQB G;  1XI1 A;  1OHH G;  4ZKI A;  4FLW A;  4W7Y A;  1SQX K;  3RT3 C;  4OWF A;  1RSO B;  2CGO A;  1VF7 A;  1B04 A;  2JGD A;  1VQK P;  3CXC U;  5AW6 B;  1L0L J;  4WBA A;  1FFX B;  2YIB A;  1TUB A;  3RWR D;  3BY6 A;  3ZN0 A;  1XMQ B;  1JQ0 A;  2RMZ A;  3MUD A;  3FX0 A;  1I5X A;  1NKD A;  2QM8 A;  1OCC C;  5B5E E;  3CX5 D;  1GMJ A;  1YHQ P;  1IZN B;  3SR2 C;  2V7Q G;  4CPG A;  4DR6 B;  3GB7 C; 
#chains in the Genus database with same CATH homology
 2ATK C;  4PDL A;  4QPJ A;  1M56 B;  3WFV A;  3W7S A;  3ZCC A;  2DQ3 A;  3W7T A;  3I55 V;  1ARO P;  1OCR C;  2QE7 G;  4UVC A;  4E2L A;  4CBC A;  5LGU A;  1XL4 A;  3CCQ V;  2OTJ V;  1FS0 G;  3OGC C;  4GX1 A;  1JJ2 U;  3DTU B;  2DYR B;  3WG7 B;  3B8M A;  2EBO A;  4R8C A;  3RVZ A;  3M99 B;  2B1I A;  4YXW H;  3SJQ C;  1COW G;  4TWK A;  3ABK C;  4MT8 A;  3CC4 V;  4G27 B;  2IH3 C;  1H38 A;  4FPP A;  1OCZ C;  2K1E A;  3HB3 B;  4FIP C;  5LHG A;  4RQE A;  2EIK B;  2ZR3 A;  2ZXW C;  1W0K G;  1ZWI C;  3JD1 A;  1K73 W;  4P9O A;  3FB7 C;  1SRY A;  2A0L A;  1JPX A;  4GCZ A;  3AG4 B;  3ABM C;  1BSH A;  5L3G A;  3OUF A;  4DXW A;  4PA3 A;  4QE7 A;  4TSF G;  4LBE C;  2WLM A;  1AJN A;  1E1Q G;  2WLJ A;  4PEL A;  1PD3 A;  4XBF A;  1YJN V;  3STZ C;  1XL6 A;  1K34 A;  3W7U A;  2UXN A;  1FS0 E;  4PDV A;  2QM7 A;  1M57 C;  4MW8 A;  2KB1 A;  1GMG A;  2IU0 A;  1LNQ A;  4JTA B;  1K4D C;  5CN0 A;  2P7T C;  4J9Y B;  4WFF A;  1KQS U;  4UV9 A;  5EBL C;  1V55 B;  1FXK C;  3SPI A;  4MTO A;  3SPG A;  4X8A A;  1P4R A;  4BIZ A;  5IYC O;  3ASO C;  2WLK A;  3GWO A;  4JYB A;  3B8N A;  5J9P C;  1OZ0 A;  4XDJ A;  5B1B B;  4YXW G;  1QLN A;  4RAI A;  3W7W A;  3CCR V;  2V1D A;  4GX0 A;  4TT3 G;  3MD0 A;  1MOF A;  3JD4 A;  4I9W A;  1M1K W;  4JF3 A;  3CD6 V;  2HVJ C;  3OW2 U;  1BHA A;  3TK1 A;  4WFH A;  2EIL C;  2EZP A;  1K8A W;  1CEZ A;  4MVZ A;  4TLF A;  2ZD9 A;  2OCC C;  2JJ1 G;  2AHZ A;  3AG3 C;  2A79 B;  2NLJ C;  5IDJ A;  4U7O A;  2BOC C;  1AJP A;  3AG1 B;  4FMT A;  3ZMZ A;  5B3S C;  1NVP D;  4J9Z B;  1JOY A;  2HR3 A;  3CC2 V;  1DTO A;  1B6Q A;  3T1C A;  3ZMV A;  1M56 C;  3OMA B;  2EIJ C;  2IW5 A;  2IH1 C;  5EC1 C;  3CME V;  3SYO A;  3BEH A;  4UVB A;  3ETE A;  3PJS K;  1JEK A;  1K33 A;  4R6Z A;  1SES A;  3SPJ A;  3E35 A;  3SYQ A;  2XAG A;  2E5T A;  3QO5 A;  2JIZ G;  5EBW C;  3ASN C;  4H33 A;  3ABU A;  1FXH A;  3K9A A;  4EKW A;  5CA3 A;  1QBZ A;  4MVQ A;  5B1O A;  2R9R B;  4GT1 A;  3X2Q B;  4P2Z A;  4UXN A;  2P67 A;  1R3K C;  1H8E G;  3LDC A;  3K3W A;  3ZRS A;  4PDR A;  4PA7 A;  3OE7 G;  4MTX A;  3NXS A;  1R6K A;  3FYE B;  3G4S V;  1VQ8 V;  1QLE B;  1K92 A;  1VQ9 V;  4X89 A;  2A9H A;  3LDE A;  5BZB A;  1CP9 A;  4G2K A;  1AI4 A;  1R3L C;  2ITC C;  2GSM B;  4WFA V;  1V54 C;  2XAS A;  5LGN A;  4N21 A;  1QCE A;  1RM1 C;  1DF4 A;  1AR1 B;  5B1A B;  5DN6 G;  1VQM V;  3SPH A;  1F23 A;  1R6N A;  2Y69 B;  4N23 A;  3FB8 C;  4WFG A;  1GO3 F;  5LHI A;  3ZRW B;  1NH2 D;  1V55 C;  2DYS B;  3ML0 A;  1Y66 A;  4RQF A;  2WAM A;  1AI6 A;  2WLL A;  3D36 A;  2XND H;  1Q86 W;  2ZQM A;  4KFM A;  1W2B U;  2B5U A;  5HFM A;  3E89 A;  2HLD G;  3TCU A;  1M9N A;  3OM3 B;  2W0F C;  1OCO C;  3JCZ A;  4Q20 A;  5EC2 C;  1AQT A;  4WVZ A;  1ENV A;  1VQN V;  1I5Y A;  3ZMS A;  3OUS A;  2IJJ A;  1OCC B;  1QR8 A;  2EIN B;  2X0L A;  1BL8 A;  4P30 A;  3SYP A;  3T2M A;  3ZN1 A;  4WFE A;  1Q7Y W;  1M90 W;  1R73 A;  2JEU A;  3SPC A;  1THZ A;  1BHB A;  4HAM A;  1WPX A;  4BW5 A;  2JEX A;  4JTD B;  4XDL A;  1EBO A;  1F51 A;  2IJH A;  2NNU A;  5HFL A;  5KUM A;  5LGT A;  3CC7 V;  1S77 D;  1PNM A;  2WSS G;  1GM8 A;  1JX9 A;  3ZMT A;  4MTG A;  1FXK A;  2LFR A;  2QTO A;  3ZMU A;  4XDK A;  2HJF C;  3HPL C;  3QNE A;  5L3B A;  2JJ2 G;  5B1N A;  1UJW B;  2WLI A;  2EJR A;  3E86 A;  5L3F A;  1KC8 W;  1K4C C;  4KP4 A;  3G6E V;  2XND G;  2Q6A A;  3ABK B;  1K3E A;  4QJF B;  1IFP A;  3B77 A;  4BAY A;  4PA9 A;  1MG1 A;  1EZJ A;  2WLL B;  3K79 A;  4LCU C;  1E79 H;  3A0R A;  3CCL V;  4WF9 V;  3ABL B;  5IY5 C;  2ZXW B;  1JCH A;  1YJ9 V;  1GM9 A;  1K5S A;  4R7C A;  1YSC A;  4MSW C;  3F7V C;  3ZJZ A;  5H6R A;  4GX5 A;  4MS2 A;  1KEC A;  3ABM B;  2LFS A;  5KA5 A;  1KP3 A;  1SZT A;  2OTL V;  1MSW D;  2JDI H;  3P30 A;  1YTF D;  1KKD A;  3OMN B;  1PL0 A;  1TUE B;  4WCE V;  2JK5 C;  2X7R B;  1VQK V;  2X6C A;  3RW0 A;  1M57 B;  1KD1 W;  3IC7 A;  2XAJ A;  1GK9 A;  2HG5 C;  2DWD C;  5KA6 A;  1YHQ V;  4OXS A;  2C2A A;  2DYR C;  4X88 A;  3WG7 C;  2E5Y A;  1MAB G;  2YEV A;  1S5H C;  2DWE C;  5H6Q A;  2QEX V;  3K06 A;  4RUE A;  3T4Z A;  4MVR A;  1QVF U;  5L3D A;  2GHY A;  1JVM A;  2IU3 A;  2MK3 A;  4HYO A;  3ZRX A;  3F7Y C;  1K5Q A;  3FYI B;  3JD3 A;  3OR6 C;  3FKS G;  1G4Y B;  1S0V A;  4FK5 C;  2IJI A;  2EIK C;  2F43 G;  1E79 G;  2Q67 A;  1H2G A;  3RBZ A;  1K97 A;  1GKF A;  5H9C A;  3OR7 C;  4U7N A;  3CCM V;  3AG4 C;  2EIL B;  1YIJ V;  2X6B A;  2JDI G;  1GTO A;  1S3J A;  3DGE A;  4PA6 A;  2AHY A;  1Y4M A;  2OCC B;  1AI5 A;  3STL C;  2IJK A;  3UM7 A;  2P90 A;  3IFX A;  1S72 V;  2ITD C;  1W0J G;  1IXM A;  3AG2 B;  2ZDI C;  1QVG U;  1L1F A;  1RPO A;  2EIN C;  1SER A;  2WSS H;  2Q69 A;  2HKO A;  2UXX A;  3JD2 A;  4BIU A;  1SET A;  3E8H A;  4CZZ A;  4DJG A;  1NR7 A;  2D3O W;  3W7X A;  3KG2 A;  3MHH C;  1BSN A;  3G71 V;  1YI2 V;  4MVU A;  5CBH A;  2EIJ B;  5LBQ A;  4ZBM A;  3JD0 A;  2WLH A;  1Q82 W;  3K0D A;  2BOB C;  3OMI B;  5B1B C;  2H94 A;  4H37 A;  4QIW F;  3I56 V;  4JPR A;  1FFT B;  3CMA V;  2YEV B;  3CCS V;  1YTF B;  3TET A;  1BMF G;  3ASN B;  4RO2 A;  4QNH B;  3MHS C;  1NR1 A;  1J95 A;  1NVP B;  3ABT A;  1EFR G;  1PKX A;  3CP1 A;  1K9M W;  2W6J H;  2WWW A;  3LNM B;  1Q81 W;  3VBB A;  3R65 A;  3ABL C;  2EIM B;  4JAU A;  3CYO A;  4UVA A;  3LDD A;  3CPW U;  1S76 D;  4MTF A;  2YSU B;  3JYC A;  1RPR A;  4FJC C;  3QO7 A;  4MVM A;  1QR9 A;  1K7D A;  1VQL V;  2XAQ A;  3ETD A;  1AI7 A;  2XAF A;  1OCR B;  1V54 B;  2Z3Y A;  3H01 A;  1F4M A;  3AG1 C;  1GM7 A;  1RM1 B;  5L3C A;  3E8F A;  3E83 A;  4PA4 A;  5CBF A;  1P7B A;  1HWY A;  5FL7 G;  4F4L A;  1KP2 A;  1VQ5 V;  4JAS A;  5IYD O;  4MVO A;  3CCE V;  3CCV V;  2WPD G;  2FTK A;  2EZO A;  3CCJ V;  3T4D A;  3F5W C;  4HZ3 A;  3K08 A;  4DO2 A;  3K0G A;  1NBM G;  1OCZ B;  5GW7 A;  1VQ4 V;  2LP7 A;  1DF5 A;  3AEI A;  4LC1 A;  4QE9 A;  1F4N A;  4I5S A;  3FB6 C;  2R9I A;  5KUK A;  1NQT A;  5CBG A;  2H8P C;  5EBM C;  1E1R G;  1WLE A;  2WLN A;  3X2Q C;  4RUF A;  3OEE G;  3SYC A;  4UUJ C;  4ASU G;  1N8R W;  3QO8 A;  2W6J G;  4Z1M G;  2CK3 H;  1OCO B;  1G8M A;  3E8G A;  1PNK A;  1VQ7 V;  4JAV A;  4MVS A;  3LUT B;  1QLE C;  4KUM A;  1NJI W;  3E2E A;  2X6A A;  1ORQ C;  2QKS A;  3K03 A;  1NH2 B;  1VQ6 V;  4LP8 A;  5CMU A;  2QA4 V;  3UKM A;  2V7Q H;  3OEH G;  3ETG A;  5IYB O;  2Q68 A;  2XOK G;  4G28 B;  3EHB B;  3P32 A;  3CCU V;  3FB5 C;  3AG2 C;  1R3J C;  3EFF K;  5L3E A;  5EK0 A;  3LSS A;  1FXK B;  4PDM A;  1FXV A;  4JGS A;  5B1A C;  2QE7 H;  4JYC A;  4MW3 A;  5C93 A;  3ASO B;  2Y69 C;  2HFE C;  3SYA A;  3ZRV A;  3IGA C;  1CPY A;  4QMA A;  4L87 A;  3LSQ A;  2WLI B;  1AJQ A;  4WFB V;  1H8H G;  3USS A;  2DYS C;  1YIT V;  2HVK C;  1R3I C;  4QPK A;  1OHH G;  3ZRW A;  5DM6 V;  4ZKI A;  3D3I A;  3OFN G;  1YJW V;  2M7W A;  3ZIA G;  2Z5U A;  3E8B A;  4P9P A;  5E1A C;  4GX2 A;  1VQP V;  3RVY A;  2PI5 A;  1DLB A;  3CXC U;  4UV8 A;  5IY5 B;  3OAA G;  3ZN0 A;  3BY6 A;  1JQ0 A;  2CK3 G;  1ROP A;  2ZR2 A;  1PNL A;  1VQO V;  1I5X A;  1NKD A;  3AG3 B;  2QM8 A;  1OCC C;  2P6J A;  2W6I G;  2Y48 A;  4R50 A;  5LHH A;  2DQ0 A;  2OT5 A;  2ZDI A;  4JTC B;  2B1G A;  2PI4 A;  3K04 A;  2XAH A;  2EIM C;  2DW4 A;  2V7Q G;  3VOU A;  3GB7 C;  5B3S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...