3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB light chain
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
1LNQA 4J9ZB 4PA3A 3R65A 1R3IC 4LP8A 3LDCA 3AG2C 4MTGA 4PA6A 5EK0A 1G4YB 3ABMC 1OCCC 2EILC 1XL4A 3K03A 2ZD9A 2HFEC 4PA9A 2K1EA 4MW8A 2DWDC 4TWKA 5E1AC 3ZJZA 4MSWC 4PDLA 2WLKA 4MTOA 5BZBA 1V55C 3SYCA 4LCUC 4EKWA 3FB5C 1AQTA 3F5WC 4WFFA 3T4ZA 2WLLA 4P9PA 1J95A 1XL6A 1ZWIC 4R8CA 4RAIA 3E89A 3OR6C 2CK3H 2Q68A 3RW0A 3FB7C 4PA7A 2A0LA 3LNMB 3ZRSA 1BSNA 2BOBC 4X88A 4WFGA 3OUFA 1ORQC 4GX5A 5CBGA 5KUMA 2H8PC 3E8GA 3SPCA 3T1CA 3PJSK 3T2MA 3TCUA 1OCOC 4MW3A 2EIMC 2X6BA 3IGAC 4P2ZA 4XDLA 3SJQC 3UKMA 3TETA 4MVUA 2QTOA 2V7QH 2ZXWC 1R3LC 3BEHA 2EINC 3ASNC 5EBMC 5EC2C 5EBLC 4XDJA 2W6JH 3ABLC 2X6AA 4I9WA 2QKSA 1E79H 2HG5C 5B1AC 2Q6AA 4WFHA 2EIKC 2P7TC 4MVOA 4RO2A 4F4LA 3SYPA 3IFXA 3X2QC 1K4CC 3K08A 4QNHB 4R50A 1BL8A 2HVKC 2QE7H 4YXWH 4X89A 4JTDB 3RVYA 2E5YA 2IH1C 4WFEA 3STLC 4DXWA 4JTCB 2DYRC 3RBZA 2E5TA 3SYQA 5KUKA 2DYSC 4LBEC 3LUTB 3T4DA 3GB7C 4QMAA 1IFPA 4MVSA 4BW5A 1P7BA 1QLEC 2WLNA 2IH3C 1R3KC 1V54C 1JVMA 3E8HA 3LDDA 4QE9A 4XDKA 3WG7C 4GX2A 4X8AA 2WSSH 3ABKC 3SYAA 2WLIB 3AG1C 2AHZA 2NLJC 2Q67A 3F7YC 1KKDA 3EFFK 4J9YB 4PDRA 3E8FA 3USSA 4H37A 4PDVA 2A9HA 2HVJC 2R9RB 5CBHA 2WLMA 3F7VC 4MS2A 2KB1A 4R7CA 4H33A 3K04A 3OUSA 1K4DC 3SPJA 4UUJC 2OCCC 3RVZA 4WVZA 4R6ZA 4RUEA 5B1BC 4DJGA 3OR7C 3K06A 3VOUA 2JDIH 2DWEC 1OCRC 3AG4C 4MVMA 4CBCA 2W0FC 4P30A 1FS0E 3K0DA 3E8BA 3UM7A 5EC1C 1JEKA 4G28B 4PA4A 5J9PC 4MVQA 4MTFA 2A79B 2Y69C 3FB8C 4HZ3A 5EBWC 1R3JC 4HYOA 4GX1A 3E83A 4G27B 2ITDC 4QE7A 5IY5C 2XNDH 3STZC 4TLFA 2JK5C 3FB6C 2ITCC 5CBFA 2ATKC 2EIJC 1S5HC 2AHYA 3HPLC 3SPHA 2WLIA 2X6CA 2WLJA 1M57C 3AG3C 4MVZA 1M56C 4JTAB 4OXSA 5B3SC 2WLLB 2WLHA 2BOCC 4RUFA 3KG2A 4KFMA 4MVRA 4P9OA 4PDMA 4ZBMA 3SPGA 1BSHA 4GX0A 2HJFC 3SYOA 3E86A 3SPIA 3OGCC 2YEVA 3K0GA 3ASOC 3LDEA 1OCZC 3JYCA 2Q69A
chains in the Genus database with same CATH superfamily
1ZUQA 5IYDO 3E1RA 1JTHB 3TK1A 1N0JA 1VF6C 3MHHC 4ZNCA 4DR2O 1ZN5A 1AQ5A 1W2BU 1BE3D 3WUUA 5IYCO 1WMKA 1IBKO 3L73G 4MW8A 4DV7B 2F4VO 1ZOYC 3ZJZA 2GV9A 3ICXA 1OVVA 4H0LC 4EKWA 1YCIA 2FYUH 3SJCC 3BCCE 3QO5A 3OR6C 1PGQA 3NTNA 2Q68A 4DR4B 3H1IG 1Q7YW 4O2BB 4NPEA 1K5SA 2H43A 3UKMA 4B3TO 4LF6O 4MVUA 4DR4O 5H6RA 3N2KA 3H32A 5EBMC 1JMKC 1LT9B 3L70H 3O9OA 1PP9G 1E5WA 2HG5C 1FPOA 3KQGA 4O4LB 1KKCA 5AW4B 1AJNA 2CPBA 1SP4A 1XOUA 2UXCO 1JY3P 3RN4A 2WA3A 2HEPA 4FPPA 3L74J 3NMDA 1AR4A 1WA8B 3CXHI 3ZHUA 1VQ9P 1ZSPA 3L35A 4DXWA 4BWAA 4HYTB 4PELA 3M7MX 2QEXV 4Z1MH 5KHJA 4GODA 2UXBB 4DR3O 2PFXA 1K8AQ 4K0KO 2PGDA 2YIAA 3J81N 4PHZA 1CPYA 3RYFA 2R5DA 3ETGA 3FAVA 5HFLA 5CCGD 3OJAB 2WSSH 5AVWB 1CW5A 1EN5A 5C39A 3SYAA 3Q1MA 4PDVA 5B5EZ 3BVOA 1H89A 2R9RB 1ZV8A 2OYHC 4LFAB 2QJPC 3T1HO 1PPJH 4C7UA 1JY3O 3CPWO 1Q81Q 4LNUB 4OPHA 3U10A 1SZXA 1SQQJ 1PL4A 1M90W 1XTGB 4JGSA 1VQ8V 2HHHB 1KC8Q 4JAVA 4LF4B 1IFJA 3H1HG 3L74D 3HD7A 5JCOC 1VQ9V 1K97A 3HE4A 1L4AC 3G6EP 4UCUA 1R8EA 1URQC 5AVUB 1BDDA 1GH6A 2UXXA 3AEGC 5K5GB 4YXWG 1KILE 2PTMA 2WLJA 1HH0A 5CN0A 3H01A 5B3SC 4GOEA 3T1YB 4ZBMA 5JJNB 2FKWB 3MZWB 1FDMA 5KKZC 2JJ2G 4JV5B 4IHJA 2GM4A 2YXRB 2GTSA 2NN4A 5IY5B 4I1LA 3OT7A 1V9PA 2GUZA 5AVXB 4LP8A 5C93A 1EZVG 5L3EA 3N2KB 2M7WA 3H32B 5AVQB 1ZTEA 3FKSG 1SQQD 1NTZE 4EEQA 4MTOA 3L71J 5JJJB 1RF1A 2YC0A 4ZOLA 1KZUB 4WFFA 3TGUJ 1SQPD 1IFNA 5KLVG 4N21A 1GK4A 3ZEDA 2OIEA 1JB0J 3OMAB 1YJNP 4DT0A 2W8ZA 4X66O 3A3YB 1GW3A 3CHXA 2V4DA 5JH7A 1S9KE 3RYCA 4WY4C 1WP7A 1N32B 1RF0A 2M5AB 1B06A 4XDLA 3Q2YA 1M8OB 2QJYC 3KYQA 2KS1A 3U0ZA 4LF5B 3CCVP 4FJCC 5EC2C 1QLNA 2WSFJ 5CJ4A 1NR7A 2QWNB 3OMIB 3V2PA 3JASA 1QHTA 1LGHB 2H88C 1JUNA 3FAVB 3D36C 2ZVOB 5KA6A 1BZKA 1KU9A 1FXKB 5IWAB 1DD3A 2BSKA 3OA7A 3MUDC 3FFQA 4IFMA 2D2CD 1GL2A 3GHGA 2OCHA 1VQLP 2OIGA 3Q4HA 4JI3O 2D2CB 3L71D 1YYCA 2Q3EA 2QJKB 5AVZB 2UU9O 2AEFA 2VRSA 3T97A 1H88A 3TGUD 4JI6O 2IBZG 1ZX3A 1JJ2U 3H6PA 1X0TA 3TF5A 3SYQA 3HD7D 3A0HH 3W67A 5LMNO 4BW5A 2KK7A 3HD7B 1LP1A 2IBZI 3HE4B 2BCCD 1QR9A 3A0BH 3L36A 3VMAA 4B86A 1W5CE 4D6TE 2ZNJA 1N8RQ 2KSDA 3LDDA 3LNNA 4JYYA 4J80A 1WP8A 3AG1C 1ZMEC 4W4LA 2QKCA 2QM7A 4WF9V 1H8EG 3B5NC 5H2FH 4D6TH 1MOFA 3ZMZA 1IK7A 3CCEP 2ZKOA 4NXNO 1NWQA 3CCRV 4GKKO 1FZAA 4UVAA 1K9MQ 2PF4E 4IHJB 1KB9D 4CS4A 2Q0OC 1U97A 1QVGO 4JI2O 2GUZB 3W68A 1NI8A 1VQLV 1BCCE 2KP8A 4R4MA 2ZT9C 1GD2E 3CX5I 1SQBD 4X20A 3R4YA 1IXBA 5CHXA 5L8RJ 3JD3A 4ZIBA 3L73E 2JK5C 2YXHA 2UXDO 1SQXG 2FKXA 3IN6A 4O9BA 2PZSA 1GMJA 2I8DA 1JY2N 3H1JG 4O4HA 1RF1B 4ZOLB 2KOGA 3AG4B 2YSUB 1GN2A 3RGBA 1Q5OA 3AK3A 1AR1B 3CC2P 3RT3C 2NR5A 4UCSA 3WU2H 1BMFG 1Q6IA 1ZLZA 3H1IE 3HTKA 2NZ2A 5AVRB 5B66E 5JH7B 1M7LA 3H1LD 5IJ0A 2Y0CA 2IW5A 5CA3A 2QKAA 3KHUA 1NU1H 2FYNB 3K03A 2HP8A 4WFAV 4DUYB 2AZ2A 1VQ7P 1LR1A 3JASB 1PIXA 1RQVA 2QGNA 1HW7A 4CS3A 1Q6HA 4LGDE 1GL2D 1HR0B 4WBNA 2BSKB 1LT9C 1VQ4P 5IJ9A 1NTMJ 1KB9F 1GL2B 2IU0A 3GHGB 2ZNIA 3H1KG 1PP9H 2A0LA 3Q4HB 3OTOB 3ZRSA 1KYOH 2BOBC 3CI9A 3G6BA 1KFNA 3AEIA 1SLQA 3SFDC 3E8GA 3T97B 3CXHH 3T1CA 3OW2O 3TCUA 1HNXO 4DV5B 2JS5A 1Y6XA 3CC2V 3CWBJ 1QL2A 3DC6A 1MFTA 3W7UA 1YHQV 2ZFCA 1ZRTD 1LP1B 2Q6QA 1M4UA 1PV0A 3ETEA 1IFMA 1YXBA 2FXPA 3ZN0A 4GYCB 1AI4A 1PNLA 2WA4A 1MNGA 1VQ7V 2UXNA 3HKEA 1IZNB 4DV4O 2XU6A 1FFXA 1T5EA 2CH7A 2P22C 4E2LA 5HFMA 4DR5O 1G2CA 4PD4D 5CCGC 3LSSA 1NVPD 1VQ4V 3IC9A 3SWFA 5CBNA 4LBEC 1NVPB 4QMAA 3H1HE 4YPCA 1NTMG 1TAEA 3BA8A 3X2QB 2FL4A 2LQTA 3PHLA 2Q5UA 4J7ZA 4BW9A 1SQQK 1E1RG 5KMGA 1L0LH 3C1LA 1IBLO 3CWBD 5LHHA 2F23A 4O4HB 1K73Q 4H37A 4YIPA 1XNRB 1FYJA 1SQPK 4R7CA 4CZZA 1P84H 3CCJV 3CRAA 4DV0B 1SKVA 3E2EA 1YJWP 3HTKB 1NJIQ 3K06A 4CBCA 2W6JG 2BTOA 5IJ0B 3TSIA 3HKCB 3P8MC 5JQGB 1IZ3A 2L6LA 3WFVA 4EB6A 1EZVE 1JCHA 1FAVA 1L0NG 4L8JA 1DK1A 2X0LA 4ASWA 1TVKA 5IY5C 2VQFB 3E35A 4EFBA 2W0XA 3BFRA 2A3QA 4DR1B 4JZGA 4WBNB 5KLVE 2IZ1A 4PD4F 5IJ9B 2GDSA 3BPZA 1SQVD 4JASA 1UIIA 4I55A 3JD2A 5KLVH 3QH9A 1FZEA 4FFKA 1RSOA 4LF7B 1YJWV 3AG3B 3VP8A 1XILA 4J11A 4DOJA 1NO4A 2KSJA 4MSWC 2RMZA 3AE9C 1SF9A 3OM3B 4NB5A 2QA4V 1I94O 1R6NA 1KUQA 3L75D 2WSEJ 1IFDA 2FYUJ 2QWQB 3HKEB 4PA7A 5D5QA 5L3BA 1OX3A 1KQLA 1FFXB 3LNMB 2AXCA 1FXKC 3A7OA 2PI5A 1KQSU 3N4XA 1BGYH 2CH7B 1G2CB 3G3ZA 2O57A 3EVKA 3PJSK 5KAIZ 2A06G 1KD1Q 2IBZE 3M8AA 3BCCJ 5A2QN 3J7AU 1V55B 3VMXA 2D2CC 1R3LC 3DTUB 2QJKC 3EXAA 1QBZA 5EBLC 2QM4A 3W7XA 1SQBK 1E79H 1HF9A 5KMGB 2OYIC 2R5BA 3CSXA 4U3FH 4RO2A 4F4LA 3HD7C 3MGNA 1NT2B 3GLMA 3V2NA 1ZAUA 2P5OA 4W4KA 1OCOB 4I9QA 2YKPA 4JYAO 3HUSA 2QE7H 4RESB 1H2SB 1S5LE 3IAOA 3L72H 4DCKA 2KXPB 1L8DA 2FTKA 4KUMA 2DQ3A 3CX5E 3LUTB 1AP5A 2P4VA 1T3JA 2JR8A 5AW2B 1QR8A 2EIKB 3GW6A 4FK5C 2BE3A 2E76D 1K34A 2E76B 3E8HA 2WPQA 3CX5H 3APQA 3U1CA 2Q7EA 1SQXE 3BCCD 1KILA 2Q67A 1US6A 3H1JE 1S0VA 1B04A 4EIJA 3Q5RA 4H33A 5BU5A 3TNUA 2ZR3A 4R6ZA 4RUEA 2EBOA 3UIAA 1RF1C 5JVDA 3NXSA 3AG4C 3L70G 4I55B 3E8BA 5EC1C 2AXTH 1NKZB 3BABA 1EQ7A 1FOSE 1GTWA 1PGPA 1RSOB 3LIEA 2KUBA 4TV8A 1JMBA 2O1KA 1N33B 1RF0C 2N74A 4U3JA 4JI0O 2FYNC 3OFNG 2X6CA 3CD6V 1MG1A 3SDLA 4NR1A 3B8MA 1OJHA 2IFMA 4LH7A 4TV9A 4RUFA 1Y8AA 2QSIA 1BSHA 2WWWA 1HVVA 1FZCC 3CP1A 4O2AA 4CH4A 2O01H 4W80A 2VQEO 4D7SA 2UUAB 1CSBA 4J9ZB 1M57D 1GL2C 2WSSG 5AVYB 1GTOA 2PRRA 3GHGC 3H1KH 1M57B 3CE2A 4LF9O 5APWA 3HKBA 2ZM6O 3OGIB 1FKAO 5BXZA 3V4WA 2ETNA 1NTKH 2RCVA 1NYHA 1Q90D 1PPJG 2FXMA 4ASVA 1I5YA 3K5MA 1N36B 3K58A 3ABUA 2MJZA 1AILA 3HUSB 2N04A 3ABMB 2Q0AA 1NTZJ 2WT7A 3ABTA 1QCEA 3T2MA 2IJHA 1JQ0A 3AEBC 1NAYA 1YEWA 4O4IA 4QIWF 1NTME 4OX9O 1XTCC 2XKMA 2XHBA 1AJYA 1KILD 4Y99B 2XOKG 3CPWU 3GVMA 1KILB 2JGDA 3X2QC 1CI6A 5GTIE 2M0BA 5LL6Y 1VQ6V 3K5OA 1B6QA 1DF5A 5E79Z 3VQVA 4X89A 4DUZO 2JWDA 3TNUB 1AP6A 4UB6Z 5LMUB 1KFMA 5JVDB 1R73A 3CRMA 2QWOB 5GTIH 5B1AB 3K3WA 1JTHA 4H13D 1IFPA 3U1AA 1P7BA 1L0NE 5AVSB 1JO5A 4OGQD 3ZS8C 4H13B 4J42A 1NTZD 3AE6C 2IH3C 5AW3B 1G6UA 4TV8B 1WB7A 3N27A 4OGQB 4YY3B 4U3JB 2E3CA 3KZIH 2JIZG 2AW9A 1L0NH 4RWUA 4UV8A 4TV9B 4UCVA 4DR7O 1VEWA 2H89C 3SGIA 4BRYB 4DK0A 3RYHA 4JI1O 4O2AB 1S9KD 4D6TJ 4FFBB 3SFEC 5J2UA 2NPSA 1NAFA 2A79B 3V2RA 4HYOA 3HKBB 4G27B 5B1NA 2E75D 4RKUJ 1YTFD 1S5HC 4FZ0A 2E75B 4O4LA 2B9ZA 1YTFB 1H2NA 3AG3C 4MVZA 4B3RO 5GONA 1AB3A 1KBHA 1OZHA 1FS0G 1EDLA 5LP6A 1PKXA 2WT7B 1S5LZ 4UVBA 2A06E 3VMZA 4O4IB 2FYUK 3CC4P 1XMOO 2OTLP 4UFZA 4PA9A 4A7PA 4D6TD 1LTTC 3H1IJ 2WLKA 2POHA 3K5BA 2A06H 1V55C 1GKFA 3JSLA 2FYZA 1GZLA 2LGQA 1SVFA 3D71A 4OPAA 2JGDB 1CI6B 3RL0g 3P32A 2H3OA 4DR2B 1PM9A 1MSWD 1X22A 4EFEA 2LP7A 2FY8A 2C9LY 1H0TA 3AK1A 1IBKB 3RYIB 1PP9J 2P6JA 1OCOC 3G80A 3CC7V 1BCCD 3AEEC 3VMYA 2WSCH 3BATA 2FYUE 2N05A 2O1JA 3L73D 3P3NA 4L74A 3ZMUA 5KHHA 3CRRA 3HE5A 1HDJA 2EIKC 5CA1A 5LGNA 2QM8A 3GWOA 2XAJA 2OTLV 4X1IA 1I08A 1FZFA 1CEZA 1QVGU 2QWRB 1YDXA 4I7ZB 4R50A 1L2PA 1J2JB 2E76C 4X64O 4B3TB 4LF6B 1NU1G 3H1ID 1EN4A 4HB1A 5A9GA 3V4QA 3M9QA 4RO0A 3RYHB 1Q81W 1OVRA 3L70E 1JY3N 2NPSD 2ZJSE 4IL6E 5J2UB 1MA1A 1MMMA 3M9BA 3GB7C 4JI8O 2NPSB 2DN9A 2P67A 2HR3A 2UXCB 3IR9A 5DJUB 3S9OA 3J80N 4IL6H 1JNMA 4Q6GA 5KAFH 3WB1A 3H25A 3PN1A 3THOA 1L0LJ 4PDRA 1CP9A 1HBWA 4YJ2A 3H1HJ 1WNSA 4MS2A 1KYOI 3JD0A 1NOHA 5GONB 4BIUA 3C90A 3SPJA 4DR3B 4IYIA 4K0KB 3GG2A 4NTWA 3TJTA 1HJ0A 2DWEC 2Q7CA 4H44D 2BTQA 5LP6B 2K1AA 2PYJA 1V54B 2M5AA 4H44B 2B9BA 1IC2A 3CB2A 3UO3A 1RH5B 4ABMA 1KECA 3FB8C 1RHZB 2XAHA 4ZMDA 5EZYA 4TT3H 5IYBO 3F89A 3ZX6A 3C8VA 4KT0J 1AJPA 2GHYA 3T1HB 2OYQA 1B3QA 1PPJE 4IGGA 1FXKA 3K59A 3B8NA 4LR3A 1M57C 2I1KA 1Q82Q 3OW2U 4K8ZA 1IBMO 2LR2A 2ARHA 3P7KA 2XAQA 4L73A 2E5LO 1Q43A 2R44A 3AE4C 4NVPA 3C9IA 1H0TB 4UXNA 2K9JA 4N3YB 3KCXA 2WAMA 1L0LG 1TUEB 2ZIOA 3H1HD 2OYIA 3HUSC 3ABMC 2ZYAA 5KLVJ 1TA8A 3GF7A 5E1AC 5AW5B 5KJ7A 1NR1A 3WB0A 1FAFA 1NTZK 5APSA 5BZBA 3BRVB 3Q5SA 4YIOA 3HE5B 5CA1B 1OCZB 1J95A 1H8HG 4R8CA 1P84I 2B87A 4X1IB 2W90A 2GBOA 1JR9A 2WZ7A 4Y99C 3AE5C 1OCCB 1QQCA 1KILC 1GM7A 1GN4A 1OZ0A 5APQA 4GKJO 4K35A 3RK3E 3V2QA 1EZVD 2W6BA 4R4LA 2UUBO 2X7RB 3GMAA 1FDIA 1G1JA 3G71P 2GSMB 3K9AA 2X6AA 1KQGB 4DV1O 5B1AC 2J5UA 2Q6AA 2YXQB 4WFHA 4X66B 2YXLA 2PP6A 1VQPP 5KLVD 4H13C 2Q9IA 3G6EV 2YUAA 4YJ2B 1XQ8A 4KL1A 1SESA 4NPFX 1LWUA 4OGQC 1S4XA 2BEZF 4LF8B 5KLIB 4MT8A 3CS5A 4TQDA 4UCTA 3FGAD 4PV1D 4KHPO 4KHXA 2BTQB 3AEFC 1K92A 1MSDA 2A7WA 2JEEA 2QIWA 2CTPA 1BHBA 3M91A 1LT1A 4LF8O 4C46A 3CCUP 5EZYB 2ZE7A 3D3QA 4AQRD 2M8RA 1JVMA 3KKYA 1FZCA 4JI3B 2QTSA 2JKVA 1N0NA 4GLXA 1BGYG 2AHZA 1SC5B 2UU9B 1NHLA 1I5XA 2E42A 4JI6B 3AG7A 3LSQA 1AFOA 2YMYA 4RQEA 5D5PA 5J2TA 3RVZA 5LMNB 3A0HE 2E75C 4UCOA 4IOIH 3RGUA 3EWKA 1FS0E 3A0BE 1SQXJ 1Q86W 2IBZD 2K9JB 1E79G 2N1TA 4JBZA 5C8YA 1N7SA 4UB8Z 3B09A 3H1JJ 1KP3A 2R3CA 3PP5A 2OYIB 4PJ0H 1LTAC 2ZR2A 2QWPB 1NZ6A 5EBWC 3WB2A 4FLXA 1YJNV 4U3FG 1JX9A 5GTHH 5KJ7D 1KORA 4QE7A 3RWRD 5H2FE 4DYLA 2DW4A 5CBFA 2QE7G 4KP4A 4NXNB 1XNQO 4GKKB 2OCCB 2J58A 2KYVA 1VDFA 3L72G 5JJEB 3CCVV 2B87B 3KG2A 1S3JA 4JI2B 1NGMB 2HJFC 5CBOA 3ML0A 2LW1A 1F7YA 3AE3C 1Z2GA 2CTQA 1ENVA 4X1KA 2UXDB 2K3RA 3W7SA 3OAKA 1J1DB 2EIJB 4MTGA 3FWLA 3I55P 3CCQP 1EN6A 1JM0A 3KPEA 2F66C 1ZP0C 3M99B 3H1KJ 1ZR4A 4PDLA 1SQXD 3WU2E 5CB4A 3B71A 2DOSA 3F5WC 3H1JD 3ASOB 1VQNP 1ZWIC 2CK3H 1RQUA 1TU3F 1AI7A 3A0RA 1LWUB 3OD4A 1NU1E 3LW5H 1J1EB 2WTYA 5AG2A 1DX7A 3JAKA 4I7ZC 1JJOA 3IFMA 3HKCA 5LA6A 5JQGA 1KB9I 3S1KA 3CCEV 4K8XA 1J5EO 3BEHA 3TXSA 4J7JA 2ZXXA 1LTGC 4XDJA 5H5NA 1BHAA 1H2LA 1S77D 3WUTA 1FZCB 2RN9A 3VQYA 1KYOE 1PP9E 2NPSC 4MVOA 1BE3H 3JARA 1HNXB 3CXHE 1K73W 3ZHSA 3PRJA 3CX5F 5FNVA 1SRYA 3UO2A 5J2TB 1IK9A 2ITAA 2E5YA 1X79B 1G1XB 3ZRVA 2N1TD 3JC22 3H1LG 1N7SD 1NJIW 3V6IA 5BR8O 5APXA 3C3SA 3ZBHA 1NTKG 2N1TB 5C8YB 1N7SB 1FZBA 4Q20A 2XTAA 1IX9A 5LP6C 2BASA 4DV4B 1V54C 4I0XA 4QE9A 1Q2NA 2L5GB 4KXRA 4GX2A 4X8AA 4H44C 5BMVA 1Q3EA 4DR5B 4TOIA 3DGEA 5EIBD 1EM1A 2A9HA 5CBHA 2UUCO 2WLMA 2KB1A 2DYSB 1L0NJ 5AW9B 4JI7O 1FOSF 3D70A 3JSVC 3VOUA 1WPBA 4X1KB 4PA4A 1IBLB 1L0LE 3E1IA 1R1BA 1NTMD 1NVOA 1R3JC 4GX1A 2LFSA 3OEEG 1FJGO 4FVMA 1P84E 1A02J 2AHYA 4B3SO 5CB4B 3SSUA 1OW6A 1QVFO 1ZR2A 1PV3A 1Q6UA 3IJ4A 1WJZA 1URFA 5KLVK 5CCHA 5CMZA 1FXVA 1YTZI 4XA4A 3APOA 4BAYA 2Y69B 1OCZC 2Q69A 3JAKB 5IYZA 3ABVC 3OTFA 1XREA 3FXDA 5EK0A 1W0KG 5LBQA 4PD4I 5LA6B 1SFCA 1OCCC 2YI9A 2XDJA 4TUYB 2JS3A 3CYOA 4DV3B 4L76A 3QF7A 1HP8A 3ZHQA 5DJTB 2PI4A 3CEIA 2Q4PA 1F23A 3OEHG 4BWNA 2HLDG 3JARB 1GAXA 4DV3O 3FB7C 2CTRA 4WBAA 3D6YA 3VQWA 5FNVB 2EILB 3OUFA 2Y0DA 5CBGA 1PNMA 3SPCA 1YIJP 4J7KA 2X6BA 3MAQA 5L3CA 4DV2O 4B3MO 2IPPA 5TJHA 2JVDA 1Y4MA 2P10A 1I94B 5KLIC 1SZTA 2IZ0A 3KCYA 2WSCJ 2DW3A 2XAFA 2M3BA 1E1QG 4LFBO 5AW8B 4I0XB 4NTYA 5H2FZ 2ODMA 5BMVB 1H38A 1BGYE 1RPOA 2Z3YA 5LOVA 1AI6A 2DE0X 4IIJA 1GM8A 1SQQH 4B08A 2EIMB 2GUVA 2WPVB 2LXBA 1HTLC 1SQVG 1W59A 2ZXWB 1K5QA 2IYOA 3ASNB 1T2KD 1SQPH 4UB6H 1JOCA 2JEXA 2OTKE 3T4DA 2F93B 1R5LA 1AVYA 1AVMA 1WPXA 1H2KA 2R9IA 4I5SA 3M0DA 4U3FE 2NNUA 1JMMA 4BXLA 4JYAB 3BASA 1P4RA 4IFDK 1YVWA 5KX5A 1AV1A 3CJHA 2CGNA 1SQXK 3L70J 1YJ9P 1K04A 4OWFA 5CCHD 3WU2Z 3L72E 4KJMA 4JPRA 1A02F 5AW6B 2VRZA 3MDSA 3CXCU 1LJ2A 5KJ7C 3A2AA 4IFFA 2OCCC 2CDYA 3CCSP 5FPRA 1BQ0A 4MVMA 4J10A 4P30A 2R72A 5IYZB 1FZGA 1SFCD 4JYBA 5B66Z 1DF4A 2GA1A 1HNWO 3L71H 1SFCB 2FYUD 4GIFA 2RH0A 2EJRA 3PH0A 1S76D 4TLFA 4YJ3A 3M0AA 1XI1A 1TGOA 2R32A 1N4CA 1J1DC 2EIJC 2Y4UA 3HPLC 3SPHA 2P2UA 4N6JA 1AI5A 4OXSA 3A8TA 2BCCH 4RQFA 1QNMA 2PGGA 3CRCA 2RMKB 4JI4B 1NKNA 2AXTE 3VYIA 2Y0IA 1RM1B 4BIOA 5BY1A 3ASOC 4YTPC 3JCUH 2JDIH 3L70D 2FBWC 1T3UA 3U59A 5IT9N 3HR0A 2KNCA 2LJ2A 1PNKA 4JI0B 4D7TA 1RE4C 1LWUC 4QPKA 4JI4O 1MUUA 1X8YA 5DECA 2ZD9A 3CCSV 1J1EC 1F51A 5F2VO 1KB9H 2YNYA 3E7KA 4JAUA 5LGUA 5TISH 2QSAA 1AQTA 2VQEB 1FJKA 1XL6A 5LOVB 1SQBH 1VPCA 1HWTC 4IIJB 1NS1A 2WPRA 3MTUE 2ZE6A 5EYPA 4X65B 3OMNB 1M9NA 4BRYA 1IURA 4LF9B 4WFGA 3H1KE 3ITKA 3S3WA 4TT3G 2ZM6B 3PTZA 3Q3DA 2OTJP 3LSUA 4FFBA 1F4MA 1NTKE 2V7QH 2Q3IA 2QTOA 4XFJA 3TDKA 4X65O 1NTMK 1RPRA 3ZIAG 3H1LH 2Y48A 1IJDB 2N1TC 3CMEP 1N7SC 1XUQA 2CAZC 1PPJD 1RY3A 3ZHRA 5KX5B 4QGPA 5APUA 3CJHB 1S2EA 2F43G 1LTJA 2L35A 1SQFA 4PI0A 2LO1A 1LTIC 4WFEA 2EINB 4OX9B 4I50B 1NQTA 4J41A 4FLZA 1ZL8A 1TUBA 4DR6B 2DYSC 3AE2C 5EIBC 4MVSA 1U7MA 2IDBA 2QRXA 1L0NK 2G8YA 2CTWA 3EQ2A 2RDCA 4YJ3B 3K57A 4O4JA 4DUZB 4DR6O 1X9VA 2IYPA 4ZKUA 3QVNA 4JPZB 4FM2A 1Q8IA 2I1JA 3TXQA 3OUSA 2OT5A 1MZEA 4UUJC 2CUGA 4CH5A 5KHGA 2E43A 3RYIA 3RK3D 3Q5PA 5K1PA 3WG7B 2KNCB 1NKDA 5J9PC 1YTZT 3RK3B 1GO3F 2Y69C 4HZ3A 3KZIE 1YQ4C 4PD4H 2XT9A 2A45G 4DR7B 2ITCC 4MN4C 1M1JA 1RE3C 1PD3A 1DD4A 2YICA 4JI1B 1OIPA 2IFNA 3QWOC 2A45I 1IDSA 1Y66A 2WLHA 3QO8A 5DEDA 5EYPB 1ZLLA 5B5EH 1YITP 3E86A 3CWBH 3OGCC 3SPIA 1JOYA 1SS1A 1GRJA 1U96A 1QGKB 1K3EA 2ZE5A 1EC5A 2Z4EA 1UFIA 4PA6A 4Z2WA 2EILC 1XMQO 4TWKA 4B3RB 4DW1A 3SYCA 1PZQA 4HNAA 1UJWB 1JPXA 3T4ZA 2WPSA 4DZOA 1LTJB 2ZYDA 1FBMA 3K79A 1Y74A 3RW0A 1MZFA 3PLNA 3P30A 4JF7A 1BSNA 4X88A 1XMOB 1ORQC 1SERA 1M1KQ 3IAYA 1ZL8B 2EIMC 3LW5J 4P2ZA 1TUBB 3TETA 2LGWA 4X62O 2ZXWC 2Q5ZA 1SQVH 1AR5A 3HKDA 4ASUG 1JCCA 3ASNC 4U7JA 3WUVA 1NU1J 2W6IG 1BQZA 4I9WA 2QKSA 1USEA 1T2KC 2N9YB 4EI2A 4O4JB 1K05A 3CCMP 4FLYA 1K4CC 3K08A 2EJ7A 2QDOA 3JSNA 3CLQA 3FXEA 3OAAG 1VF7A 2G38A 3K9SA 1N86A 4LC1A 4QJFB 3L75H 4EDFA 2IJJA 3RBZA 1YQ3C 2E5TA 5CCHC 1KV4A 2WMMA 4YHHO 4CC5A 2B88A 2WLNA 2QVAA 2CK3G 1K8AW 1DH3A 2FB5A 3F5HA 4X64B 1PFIA 3JALA 1M1JB 3JAWA 3M9HA 4LLHA 1SFCC 3F7YC 4F6RA 1VQOP 5M1BA 3H9VA 2DYRB 4NYKA 1Q82W 3CC4V 2AEJA 2ZIMA 4I6MC 2R9AA 2HLOA 1NU1D 1OVUA 4JI8B 1VQMP 5IDJA 3CRQA 3CCMV 4W7ZA 1DEBA 2Y0PA 2P06A 1NH2D 1Z56A 1BCCG 1EXIA 3BY6A 4FM0A 3SWKA 5ITZA 1SETA 1GDTA 3L37A 1RM1C 4UB8H 2ADQB 1NH2B 1KC8W 1BE3G 5KAFE 4WB4A 3D3IA 5L3GA 3UCSC 2KG7A 3P8CE 2WSEH 1PP9D 1KYOD 4HNAB 3C3TA 4LH6A 5B1OA 1PL0A 3CXHD 2QEXP 4DV7O 1Y74B 4MVRA 2KB7P 2PY5A 4TQFA 1OFCX 2OQQA 3BCCH 1F4NA 2YO3A 1W0JG 1WB8A 1K33A 3JYCA 1VQOV 3W7TA 3VN0A 5AW7B 3G4SP 3R65A 4AQYB 1M56D 1VQMV 2YKQA 1XL4A 3HKDB 1M56B 1N73A 1IBMB 5LHIA 2E5LB 1R5SA 4AQYO 2KZIA 3EHBB 3ZRXA 2GUSA 2KLVA 1OHHG 2WLLA 4GOFA 4P9PA 3M0DC 1VARA 1VQ8P 2JEUA 2F1MA 1Y76B 3O65A 2HFED 2ILMA 1OMIA 5AVTB 3ZHTA 5GTIZ 2K9YA 1CXZB 4GX5A 4FM1A 2VWKA 2WQYC 4B7KA 1MKMA 1L0LD 2V1DA 4JQ0D 2Y0EA 1EDIA 3BA9A 3WMM0 1KYOF 2EINC 2H94A 2ZINA 5LGTA 3MIWA 4AYCA 3KZIZ 1P84D 2YI8A 3CXHF 3G4SV 1LTBC 1PGOA 3JALB 1HNZB 3JAWB 2UXBO 1MZ9A 4GCZA 2WITA 1N2DC 4F6RB 4FMTA 1HJBA 2K37A 4DO2A 2HYNA 2P7JA 1IXMA 4GKJB 3TYYA 1Q7YQ 3RK2D 4U7OA 1D5NA 2IH1C 2UUBB 1HNZO 3II6A 3N2GA 3RK2B 1VIBA 4JTCB 2K9PA 2L91A 4ICGA 2FFDA 4DV1B 1DEEG 2KLUA 1BGYJ 1SQPJ 4LFAO 3L74G 1FE6A 5ITZB 1QVFU 1PL5A 3R2PA 2RKLA 2Q7HA 3IF4A 3U11A 2MK3A 2HHHO 3FD9A 2KG7B 3WG7C 4LF4O 1XDCA 2Z5UA 3UQ8A 1N8RW 3RK3C 1KKDA 4KHPB 1BS3A 1RP3B 1UPGA 4DV6B 2AZ0A 1XHXA 2O3JA 3BRCA 2A45H 3MHSC 3K04A 4ZI7A 2YKOA 1RE4A 3BRTB 4U3FJ 3OR7C 1S5LX 3T1YO 1K9MW 5KA5A 4FLVA 4DV6O 3B2EE 4PV1B 3L72J 1P84F 3ABKB 4JV5O 1N73B 3F5TA 4JI5B 3E83A 2XNDH 2B1GA 3STZC 1EZVI 1SQQG 3FB6C 2Q73A 4NTXA 2E74D 3GF3A 2Q8VA 4BIZA 1BGYD 3MP7B 2E74B 4JTAB 1SQPG 1OCRB 1M93A 2WLLB 1MABG 1NTZH 3G71V 2BOCC 4JI5O 4P9OA 1VQKP 1T8ZA 4WCEV 2J59M 1P49A 2BCCJ 1GK6A 4PJ0E 3K0GA 3MHVA 3LDEA 1M90Q 5GTHE 1LTJC 3JATA 1YF2A 1VQPV 2OARA 2KKWA 2YO2A 2UWJE 3A5TA 1XNQB 3G9RA 4U3FD 2CE4A 1WRGA 1SA0A 3RYFB 1FFTB 1N32O 3E22A 3NR7A 3CCRP 4LFCB 4LCUC 4LF5O 1QL1A 3L72D 5APTA 2LXCB 1KP2A 5AW1B 3CCUV 3JAMN 1U7JA 4E4EA 1EDKA 1Y9BA 3IC7A 3AG2B 3QO7A 3ETDA 1SQBJ 1NU1K 3L71G 4LFCO 1ROPA 4GZRB 5IWAO 2EZPA 3N2GB 3TGUG 2ZYGA 2PAJA 1VL2A 2B89A 4DRXA 4MW3A 1DIPA 4UV9A 2LKMA 2O01J 3CX5D 1VQKV 2FFDB 3LIDA 5CMUA 1LTSC 2O01N 1HGZA 3RL0D 4IL6Z 2V7QJ 2BCCG 3RL0B 1YZBA 4HAMA 5KAFZ 1X59A 1M5IA 3I5CA 5IE9A 2JO1A 2H8PD 2EULA 4WWIA 3H1LJ 1HWYA 1WAZA 1W2BO 3IFXA 2JDIG 1NTKJ 1EXJA 2KSEA 2KQXA 2Q9LA 1BT8A 2XAGA 2DQ0A 4N78E 4ZI7B 1M1JC 5KAIE 3RVYA 1USDA 1J5EB 4LWSA 3NFQA 2DYRC 3ABLB 2JJ1G 1RE3A 5KAIH 1QEXA 2W27A 2P90A 1N7LA 3VP9A 4TUYA 3G67A 1BE3E 3ZHVA 1G1IA 1SQBG 2C2AA 2G3AA 3VBBA 1GMGA 1R3KC 4RJTA 1G8MA 1BCCH 2KI7B 2R70A 1LUVA 1Z5VA 3I55V 3CCQV 2NRGA 2V4HA 1D5AA 2NLJC 3L4FA 3O6QA 3V5BA 3L73H 4K3AA 5BR8B 1P7GA 2WVRA 3MD0A 2V7QG 1QLED 1WT6A 1K4DC 3VTPC 1YHQP 3H1KD 5LHGA 1Q86Q 1D2DA 1QLEB 4FLTA 3RYCB 3FX0A 4CH3A 2VS0A 1VQNV 3JATB 5DM6V 1NTKD 4FLWA 4G28B 2KS1B 3H1IH 1L0LK 1JY2P 1SS3A 5B66H 2ITDC 1SA0B 2UUCB 1O9GA 1COWG 1T6AA 2ADPA 3E22B 1KQFB 2ATKC 4JYCA 4JI7B 4DUYO 1M56C 3SJBC 5LYJA 2ZE8A 4L75A 4HH2A 4PDMA 1HR0O 2Q7GA 3RFRA 1FJGB 1AA0A 2RNBA 2ZDIA 4DRXB 2C0XA 4BR6A 3I56P 4B3SB 1I0HA 1XBLA 3OTOO 2K88A 4X1YA 1W2EA 4A5UB 1X4TA 2HFEC 2K1EA 1JY2O 1QX8A 3AECC 4Y28J 2Y9YA 2ZAEB 3CCJP 4DV5O 3S3XA 4GKGA 1VP7A 2ZXEB 2CPSA 4JAAA 3E89A 3ZN1A 3AE8C 1IVSA 5L3FA 4LWSB 2XNXA 5KUMA 1Z5WA 2XZRA 3IGAC 3QG5A 3EFGA 3FWNA 3HB3B 5H6QA 3L74E 1KD1W 1FU1A 2N9BA 1L0ND 1BSMA 1JCDA 4N23A 4X20B 3RK2C 1HGVA 1SQVJ 5KTBA 1O9HA 3ZMSA 3H1HH 4C7RA 3I56V 3CWBG 4JF3A 2P7TC 1FD9A 3L74H 3O6QB 4OVNF 4GDOA 2Y4TA 4AI8A 4QNHB 2LW7A 3BHPA 4G2KA 4DV2B 4B3MB 1JA8A 1VF6A 5FL7G 1OXZA 4YXWH 2YIBA 3JCZA 4HBNA 3JD1A 1XNRO 4PJ0Z 3A0HZ 4LFBB 2YIUB 2IM9A 5GTHZ 2QA4P 1EDJA 4DV0O 3L75J 3A0BZ 4M3LA 4NXMB 4UVCA 5DN6G 2DMXA 1SQQE 4I4TA 1VMGA 4PV1C 2Q1KA 1EZVH 3ABKC 2W83C 1GM9A 5E79E 4J9YB 1N73C 3E8FA 1SQPE 3USSA 4NXMO 4UB6E 5LYJB 5LXTA 2IX7C 1R6KA 2VQFO 1HUCA 2OWOA 2EZOA 3KXDA 2ZVNB 4DR1O 2YS8A 2E74C 3DSQA 1OCRC 5E79H 4FIPC 2MW2B 2M6YA 4CC6A 2HKOA 4IL6X 3D6ZA 2A06D 4ZHQA 3UT5A 2M3EA 4X1YB 4CH6A 3CMAP 2F95B 4TSFG 1YIJV 4ZKPA 2PUSA 2WLIA 4LF7O 5B1BB 3D8CA 1MFZA 2SPZA 2Y9ZA 1OV9A 3L75G 4L87A 4EOTA 3ETQA 3SYOA 1HNWB 3W7WA 3L71E 1S72P 2B5UA 4I50A 3ZRWA 3TGUE 2AEMA 1VF5D 1R3IC 1IO4A 3A2FA 3AG2C 3AEDC 1G4YB 1VF5B 2CGOA 1NH4A 3HRNA 3KDPB 2DJVA 2DWDC 2YDEA 1XHZA 2BCCE 2IBZH 1RFYA 3BAAA 3TGUH 1AJQA 2OYHA 2FFDC 3FB5C 4EYYQ 1YSCA 3CL3D 3JCUE 1IFIA 4I2LC 3RL0C 4QPJA 3CMAV 2KIKA 1K7DA 1DLBA 1LUWA 2EX3A 2YIBD 1CZQA 3OE7G 3S4RA 2RN0A 3DXRA 5JCOA 1L4AA 1YJ9V 1URQA 4H0LD 2H8PC 2HPCA 5BU8B 1GN6A 1KB9E 2MKVA 3SJQC 4DW0A 4H0LB 2WSFH 2YMKA 2Z5IA 1NTKK 3CD6P 2FYUG 5TISE 4EB6B 5KHIA 3SJAC 1N34B 1S5LH 1S72V 1TVKB 3ABLC 1D7MA 1SQBE 5K1XA 3AE7C 3P8CD 3CCLP 2RQ6A 4X9QA 4I4TB 3BCCG 4OH8B 1N34O 2QG4A 2ZQMA 2FMLA 5LXTB 1BL8A 1Y47A 2JWAA 1SQXH 2HVKC 2D3OW 3H1JH 3STLC 3ZDMA 2HG5D 1KN7A 3H1LE 1AROP 4F6EA 3B77A 4ZHQB 3O8ZA 3UT5B 1QLEC 2JJLA 3DC5A 2QR4A 3R66A 4XDKA 4FZ1A 5GW7A 2WLIB 4MTXA 1JFFA 2P4KA 4WY4A 3EFFK 4ZKIA 3N7NA 3SWYA 4Z1MG 3AE1C 3P3PA 3CCLV 1N33O 5CA0A 4WVZA 2LFRA 2Z0AA 5BVZA 1H2MA 2W0FC 3K0DA 3UM7A 3ZRWB 1JEKA 3D36A 4C7NA 2XV5A 1PGJA 4FLUA 1KTMA 3MUDA 1QU7A 5CJ0A 1VQ6P 2HODA 2P58A 1ZRTE 1OW7A 1H8AA 3ZMVA 2OTJV 5FLXN 4AHCA 2UUAO 2OYHB 1FC2C 2QJPB 2C9NY 2HJDA 1SQGA 1OW8A 2VWJA 3ZCCA 3L9DA 2R3SA 4KFMA 2BEQD 2IJIA 1L4AD 2YXYA 4GX0A 2KZJA 3CMEV 1URQD 2B1IA 4WFBV 2YEVA 3DXRB 1L4AB 1N36O 4GUNA 1URQB 1YBKA 4PD4E 1VQ5P 3VOPA 2HPCB 5AVVB 5JWPA 1LNQA 1THZA 4PA3A 1M1KW 3LDCA 4UCRA 2PYLA 2FXOA 1ZW0A 1H2GA 5B3SB 3B40A 3I5DA 3VQXA 3ZMTA 3B4SA 3B5NA 1NBMG 5L3DA 5KHKA 5APVA 5KKZB 1FDOA 2JRIA 2H7HA 3QTCA 5B5EE 1NTMH 3CWBE 4U7NA 4RAIA 2AGAA 3FYEB 1KMIZ 1A32A 1OWAA 2W6AA 2OYOA 4NPDA 4HKZH 1SQVK 3AEAC 1AVOA 2P1JA 2XNDG 1XMQB 4Z1VA 1GN3A 5LMUO 2XUMA 4YXDC 1ZXGA 1NTZG 1VQ5V 4GT1A 2W6JH 2YIUC 1DTOA 4IYHA 4AILC 1I7FA 1S5JA 3QNEA 4WY4D 3GWKC 2C0WA 2QJ1A 3SYPA 1JFFB 4WY4B 1U57A 1WLEA 5CA0B 4YY3O 2QJYB 1EFRG 4X62B 4JTDB 1XEQA 4O2BA 5H9CA 3SR2C 1SQVE 3M06A 4AUWA 3K5NA 1Y67A 5AW0B 5KUKA 1R6TA 1MV8A 4XE5B 4C7NB 3B8EB 3AK2A 1YITV 1LT9A 4IT5A 4JZ2A 1UIXA 1KQSO 1FXHA 1FJPA 2YIDA 4NKGB 2HODB 1YI2P 2ZDIC 1S1CX 4HJGH 4XBFA 3FYIB 2XASA 1BCCJ 1BDCA 2HVJC 3L75E 3F7VC 3CC7P 5EFWB 1Y76A 3JCUZ 1WA8A 1BE3J 4PI2A 3L73J 3K5LA 4W7YA 4YHHB 1EZJA 5B1BC 4DJGA 2YEVB 2IJKA 1DGSA 1GU5A 2AXTZ 1GK9A 2OGUA 4MVQA 4MTFA 4DK1A 1GU4A 3B5ND 3AG1B 3FX7A 5APYA 2WPDG 5TISZ 4CS2A 1GW4A 4D6TG 3B5NB 2JP3A 1WN7A 2RJZA 5CCGA 2GTAA 3BVHA 4CPGA 1EBOA 2IU3A 3JD4A 1VF5C 3RBXA 3SPGA 1L1FA 4N78D 2ZT9D 5FPOA 2ZCEA 4B7EA 1YI2V 4LNUA 2JGUA 4UB8E 2ZT9B 2F4VB 2Z5HA
chains in the Genus database with same CATH topology
5IYDO 1VQPV 4J9ZB 2WSSG 1GTOA 5EK0A 1W0KG 3TK1A 3MHHC 5LBQA 1OCCC 1W2BU 1M57B 5IYCO 3CYOA 1FFTB 4MW8A 3ZJZA 2PI4A 4LCUC 4EKWA 1I5YA 1F23A 3OEHG 2HLDG 3QO5A 1KP2A 3ABUA 3OR6C 3CCUV 2Q68A 3FB7C 3IC7A 3AG2B 3QO7A 3ETDA 3ABMB 2EILB 1Q7YW 1ROPA 2EZPA 3OUFA 5CBGA 1K5SA 1PNMA 3SPCA 3ABTA 1QCEA 3T2MA 2IJHA 4MW3A 1JQ0A 2X6BA 4UV9A 3UKMA 5L3CA 1VQKV 4MVUA 5CMUA 1Y4MA 5H6RA 4QIWF 5EBMC 1SZTA 4HAMA 2XAFA 1E1QG 2HG5C 2XOKG 3CPWU 1HWYA 1AJNA 1H38A 3IFXA 1RPOA 2JDIG 2Z3YA 3X2QC 1AI6A 1GM8A 4FPPA 1VQ6V 2EIMB 2XAGA 2DQ0A 1B6QA 1DF5A 2ZXWB 4X89A 3RVYA 1K5QA 3ASNB 1R73A 4DXWA 2DYRC 3ABLB 2JEXA 2JJ1G 4PELA 2QEXV 5B1AB 3K3WA 3T4DA 1IFPA 1WPXA 2P90A 1P7BA 2R9IA 4I5SA 2NNUA 1CPYA 2IH3C 2C2AA 3VBBA 3ETGA 5HFLA 1GMGA 1R3KC 1P4RA 2WSSH 1G8MA 3CCQV 3SYAA 3I55V 2JIZG 2NLJC 4JPRA 4PDVA 4UV8A 2R9RB 3MD0A 3CXCU 2V7QG 1K4DC 2OCCC 5LHGA 1QLEB 4MVMA 1VQNV 4P30A 1M90W 5DM6V 4JGSA 1VQ8V 4G28B 4JAVA 4JYBA 1DF4A 2A79B 1VQ9V 1K97A 4HYOA 4G27B 2ITDC 2EJRA 5B1NA 4TLFA 1S76D 2UXXA 1COWG 1YTFD 4YXWG 2ATKC 2EIJC 1S5HC 3HPLC 4JYCA 3SPHA 1AI5A 2WLJA 1YTFB 3AG3C 4MVZA 1M56C 4OXSA 3H01A 5CN0A 5B3SC 4ZBMA 4RQFA 4PDMA 1RM1B 3ASOC 1FS0G 2JJ2G 2JDIH 1PKXA 5IY5B 2ZDIA 4UVBA 1PNKA 4LP8A 5C93A 4QPKA 5L3EA 2ZD9A 2M7WA 3CCSV 1F51A 2HFEC 4PA9A 3FKSG 2K1EA 2WLKA 4MTOA 4JAUA 5LGUA 1V55C 1AQTA 1GKFA 4WFFA 1XL6A 4N21A 3E89A 3ZN1A 3OMAB 3P32A 3OMNB 1M9NA 5L3FA 1MSWD 4WFGA 2LP7A 4TT3G 5KUMA 1F4MA 2P6JA 1OCOC 3IGAC 4XDLA 2V7QH 3HB3B 5H6QA 2QTOA 3CC7V 1KD1W 4FJCC 5EC2C 1QLNA 4N23A 1NR7A 1RPRA 3OMIB 3ZIAG 2Y48A 3ZMUA 3ZMSA 5KA6A 3I56V 1FXKB 4JF3A 2EIKC 2P7TC 2F43G 5LGNA 2QM8A 3GWOA 2XAJA 2OTLV 4QNHB 1CEZA 1QVGU 4G2KA 4R50A 5FL7G 4YXWH 4WFEA 1Q81W 2EINB 3JCZA 1NQTA 3JD1A 1JJ2U 3SYQA 2DYSC 3GB7C 4MVSA 4BW5A 2P67A 2HR3A 4UVCA 1QR9A 5DN6G 3LDDA 3ABKC 3AG1C 1GM9A 4J9YB 4PDRA 1CP9A 3E8FA 3USSA 2QM7A 4WF9V 1H8EG 1R6KA 4MS2A 3JD0A 1MOFA 3ZMZA 3OUSA 2OT5A 4BIUA 3SPJA 4UUJC 2EZOA 3CCRV 4UVAA 2DWEC 1OCRC 4FIPC 1V54B 2HKOA 3WG7B 1NKDA 5J9PC 1VQLV 1GO3F 1KECA 2Y69C 3FB8C 2XAHA 4HZ3A 3JD3A 5IYBO 2JK5C 2ITCC 4TSFG 1YIJV 1AJPA 2GHYA 1PD3A 2WLIA 1FXKA 5B1BB 3B8NA 1M57C 3AG4B 3OW2U 1Y66A 2YSUB 4L87A 2WLHA 1AR1B 2XAQA 3QO8A 3SYOA 1BMFG 3E86A 3SPIA 3OGCC 3W7WA 1JOYA 4UXNA 2B5UA 3ZRWA 1K3EA 2IW5A 2WAMA 5CA3A 1R3IC 1TUEB 3AG2C 4PA6A 1G4YB 3ABMC 3K03A 2EILC 4WFAV 5E1AC 2DWDC 4TWKA 1NR1A 1AJQA 5BZBA 3SYCA 3FB5C 1UJWB 1JPXA 3T4ZA 1OCZB 1J95A 1YSCA 1H8HG 4R8CA 3K79A 4QPJA 3CMAV 3RW0A 1K7DA 1DLBA 2IU0A 3P30A 3OE7G 2A0LA 1BSNA 3ZRSA 1OCCB 2BOBC 4X88A 3AEIA 1ORQC 1YJ9V 1SERA 2H8PC 3E8GA 1GM7A 1OZ0A 3T1CA 3TCUA 2EIMC 3CC2V 4P2ZA 3SJQC 3TETA 2ZXWC 4ASUG 3W7UA 2X7RB 1YHQV 3ASNC 1S72V 2GSMB 3ABLC 3K9AA 2W6IG 2X6AA 3ETEA 4I9WA 2QKSA 5B1AC 2Q6AA 4WFHA 3ZN0A 1AI4A 1K4CC 1PNLA 3K08A 3G6EV 2ZQMA 1VQ7V 2UXNA 1SESA 1BL8A 3OAAG 2HVKC 2D3OW 4E2LA 3STLC 5HFMA 4MT8A 4LC1A 4QJFB 3LSSA 1NVPD 1VQ4V 2IJJA 3RBZA 2E5TA 1K92A 4LBEC 1AROP 1BHBA 1NVPB 3B77A 4QMAA 3X2QB 1QLEC 2WLNA 2CK3G 1K8AW 4XDKA 1JVMA 1E1RG 5LHHA 5GW7A 2WLIB 4MTXA 3F7YC 2AHZA 3EFFK 4ZKIA 1I5XA 2DYRB 4H37A 4Z1MG 1Q82W 3CC4V 3LSQA 4R7CA 3CCLV 4CZZA 4RQEA 3CCJV 3RVZA 5IDJA 3E2EA 4WVZA 2LFRA 3CCMV 3K06A 1FS0E 4CBCA 2W6JG 2W0FC 3K0DA 1Q86W 1E79G 3UM7A 3ZRWB 1NH2D 3D36A 1JEKA 3BY6A 1KP3A 1SETA 3WFVA 1RM1C 2ZR2A 1YJNV 1JCHA 5EBWC 1NH2B 1KC8W 1JX9A 2X0LA 4QE7A 5IY5C 3D3IA 5L3GA 3ZMVA 2OTJV 2DW4A 3E35A 5CBFA 2QE7G 4KP4A 2OCCB 5B1OA 1PL0A 3CCVV 3ZCCA 3KG2A 1S3JA 2IJIA 4KFMA 4MVRA 4GX0A 2HJFC 3CMEV 2B1IA 1F4NA 4WFBV 2YEVA 4JASA 1W0JG 1K33A 3JYCA 3ML0A 1VQOV 3W7TA 3JD2A 1LNQA 1ENVA 1THZA 4PA3A 1M1KW 3R65A 3W7SA 2EIJB 3LDCA 4MTGA 1VQMV 1XL4A 1YJWV 1H2GA 3AG3B 1M56B 5B3SB 3ZMTA 5LHIA 3M99B 1NBMG 4MSWC 4PDLA 5L3DA 3OM3B 2QA4V 3F5WC 3ASOB 1R6NA 3EHBB 3ZRXA 1OHHG 2WLLA 4P9PA 1ZWIC 4RAIA 3FYEB 4U7NA 2JEUA 2CK3H 4PA7A 1AI7A 3A0RA 5L3BA 3LNMB 1FXKC 2PI5A 1KQSU 4GX5A 2XNDG 3PJSK 2V1DA 1V55B 1R3LC 3CCEV 3DTUB 3BEHA 2EINC 2H94A 1QBZA 5LGTA 5EBLC 4XDJA 1VQ5V 4GT1A 3W7XA 1BHAA 2W6JH 1E79H 3G4SV 1DTOA 1S77D 3QNEA 4MVOA 4RO2A 4F4LA 4GCZA 3SYPA 4FMTA 4DO2A 1IXMA 1OCOB 1K73W 1WLEA 1EFRG 2QE7H 1SRYA 4U7OA 4JTDB 2E5YA 2IH1C 5H9CA 3ZRVA 1NJIW 4JTCB 2FTKA 4KUMA 2DQ3A 5KUKA 3LUTB 4Q20A 1QR8A 2EIKB 1QVFU 1YITV 4FK5C 1FXHA 1K34A 2MK3A 1V54C 3E8HA 4QE9A 3WG7C 2ZDIC 4GX2A 4X8AA 2Z5UA 1N8RW 2Q67A 4XBFA 1KKDA 1S0VA 3FYIB 3DGEA 2XASA 2A9HA 2HVJC 5CBHA 2WLMA 3F7VC 2KB1A 2DYSB 3MHSC 3K04A 4H33A 2ZR3A 1EZJA 4R6ZA 4RUEA 2EBOA 5B1BC 3OR7C 2YEVB 4DJGA 2IJKA 3NXSA 3VOUA 3AG4C 1K9MW 1GK9A 3E8BA 5KA5A 5EC1C 4PA4A 4MVQA 3ABKB 4MTFA 3AG1B 1R3JC 4GX1A 2WPDG 2LFSA 3E83A 2XNDH 3OEEG 2B1GA 3STZC 3FB6C 2AHYA 3OFNG 2X6CA 4BIZA 1MG1A 3CD6V 1EBOA 2IU3A 3B8MA 1OCRB 3JD4A 2WLLB 4JTAB 1MABG 3G71V 4RUFA 2BOCC 3SPGA 1BSHA 4P9OA 2WWWA 1L1FA 4WCEV 1FXVA 3CP1A 1YI2V 4BAYA 2Y69B 3K0GA 3LDEA 1OCZC 2Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNQ A;  4J9Z B;  4PA3 A;  3R65 A;  1R3I C;  4LP8 A;  3LDC A;  3AG2 C;  4MTG A;  4PA6 A;  5EK0 A;  1G4Y B;  3ABM C;  1OCC C;  2EIL C;  1XL4 A;  3K03 A;  2ZD9 A;  2HFE C;  4PA9 A;  2K1E A;  4MW8 A;  2DWD C;  4TWK A;  5E1A C;  3ZJZ A;  4MSW C;  4PDL A;  2WLK A;  4MTO A;  5BZB A;  1V55 C;  3SYC A;  4LCU C;  4EKW A;  3FB5 C;  1AQT A;  3F5W C;  4WFF A;  3T4Z A;  2WLL A;  4P9P A;  1J95 A;  1XL6 A;  1ZWI C;  4R8C A;  4RAI A;  3E89 A;  3OR6 C;  2CK3 H;  2Q68 A;  3RW0 A;  3FB7 C;  4PA7 A;  2A0L A;  3LNM B;  3ZRS A;  1BSN A;  2BOB C;  4X88 A;  4WFG A;  3OUF A;  1ORQ C;  4GX5 A;  5CBG A;  5KUM A;  2H8P C;  3E8G A;  3SPC A;  3T1C A;  3PJS K;  3T2M A;  3TCU A;  1OCO C;  4MW3 A;  2EIM C;  2X6B A;  3IGA C;  4P2Z A;  4XDL A;  3SJQ C;  3UKM A;  3TET A;  4MVU A;  2QTO A;  2V7Q H;  2ZXW C;  1R3L C;  3BEH A;  2EIN C;  3ASN C;  5EBM C;  5EC2 C;  5EBL C;  4XDJ A;  2W6J H;  3ABL C;  2X6A A;  4I9W A;  2QKS A;  1E79 H;  2HG5 C;  5B1A C;  2Q6A A;  4WFH A;  2EIK C;  2P7T C;  4MVO A;  4RO2 A;  4F4L A;  3SYP A;  3IFX A;  3X2Q C;  1K4C C;  3K08 A;  4QNH B;  4R50 A;  1BL8 A;  2HVK C;  2QE7 H;  4YXW H;  4X89 A;  4JTD B;  3RVY A;  2E5Y A;  2IH1 C;  4WFE A;  3STL C;  4DXW A;  4JTC B;  2DYR C;  3RBZ A;  2E5T A;  3SYQ A;  5KUK A;  2DYS C;  4LBE C;  3LUT B;  3T4D A;  3GB7 C;  4QMA A;  1IFP A;  4MVS A;  4BW5 A;  1P7B A;  1QLE C;  2WLN A;  2IH3 C;  1R3K C;  1V54 C;  1JVM A;  3E8H A;  3LDD A;  4QE9 A;  4XDK A;  3WG7 C;  4GX2 A;  4X8A A;  2WSS H;  3ABK C;  3SYA A;  2WLI B;  3AG1 C;  2AHZ A;  2NLJ C;  2Q67 A;  3F7Y C;  1KKD A;  3EFF K;  4J9Y B;  4PDR A;  3E8F A;  3USS A;  4H37 A;  4PDV A;  2A9H A;  2HVJ C;  2R9R B;  5CBH A;  2WLM A;  3F7V C;  4MS2 A;  2KB1 A;  4R7C A;  4H33 A;  3K04 A;  3OUS A;  1K4D C;  3SPJ A;  4UUJ C;  2OCC C;  3RVZ A;  4WVZ A;  4R6Z A;  4RUE A;  5B1B C;  4DJG A;  3OR7 C;  3K06 A;  3VOU A;  2JDI H;  2DWE C;  1OCR C;  3AG4 C;  4MVM A;  4CBC A;  2W0F C;  4P30 A;  1FS0 E;  3K0D A;  3E8B A;  3UM7 A;  5EC1 C;  1JEK A;  4G28 B;  4PA4 A;  5J9P C;  4MVQ A;  4MTF A;  2A79 B;  2Y69 C;  3FB8 C;  4HZ3 A;  5EBW C;  1R3J C;  4HYO A;  4GX1 A;  3E83 A;  4G27 B;  2ITD C;  4QE7 A;  5IY5 C;  2XND H;  3STZ C;  4TLF A;  2JK5 C;  3FB6 C;  2ITC C;  5CBF A;  2ATK C;  2EIJ C;  1S5H C;  2AHY A;  3HPL C;  3SPH A;  2WLI A;  2X6C A;  2WLJ A;  1M57 C;  3AG3 C;  4MVZ A;  1M56 C;  4JTA B;  4OXS A;  5B3S C;  2WLL B;  2WLH A;  2BOC C;  4RUF A;  3KG2 A;  4KFM A;  4MVR A;  4P9O A;  4PDM A;  4ZBM A;  3SPG A;  1BSH A;  4GX0 A;  2HJF C;  3SYO A;  3E86 A;  3SPI A;  3OGC C;  2YEV A;  3K0G A;  3ASO C;  3LDE A;  1OCZ C;  3JYC A;  2Q69 A; 
#chains in the Genus database with same CATH topology
 1ZUQ A;  5IYD O;  3E1R A;  1JTH B;  3TK1 A;  1N0J A;  1VF6 C;  3MHH C;  4ZNC A;  4DR2 O;  1ZN5 A;  1AQ5 A;  1W2B U;  1BE3 D;  3WUU A;  5IYC O;  1WMK A;  1IBK O;  3L73 G;  4MW8 A;  4DV7 B;  2F4V O;  1ZOY C;  3ZJZ A;  2GV9 A;  3ICX A;  1OVV A;  4H0L C;  4EKW A;  1YCI A;  2FYU H;  3SJC C;  3BCC E;  3QO5 A;  3OR6 C;  1PGQ A;  3NTN A;  2Q68 A;  4DR4 B;  3H1I G;  1Q7Y W;  4O2B B;  4NPE A;  1K5S A;  2H43 A;  3UKM A;  4B3T O;  4LF6 O;  4MVU A;  4DR4 O;  5H6R A;  3N2K A;  3H32 A;  5EBM C;  1JMK C;  1LT9 B;  3L70 H;  3O9O A;  1PP9 G;  1E5W A;  2HG5 C;  1FPO A;  3KQG A;  4O4L B;  1KKC A;  5AW4 B;  1AJN A;  2CPB A;  1SP4 A;  1XOU A;  2UXC O;  1JY3 P;  3RN4 A;  2WA3 A;  2HEP A;  4FPP A;  3L74 J;  3NMD A;  1AR4 A;  1WA8 B;  3CXH I;  3ZHU A;  1VQ9 P;  1ZSP A;  3L35 A;  4DXW A;  4BWA A;  4HYT B;  4PEL A;  3M7M X;  2QEX V;  4Z1M H;  5KHJ A;  4GOD A;  2UXB B;  4DR3 O;  2PFX A;  1K8A Q;  4K0K O;  2PGD A;  2YIA A;  3J81 N;  4PHZ A;  1CPY A;  3RYF A;  2R5D A;  3ETG A;  3FAV A;  5HFL A;  5CCG D;  3OJA B;  2WSS H;  5AVW B;  1CW5 A;  1EN5 A;  5C39 A;  3SYA A;  3Q1M A;  4PDV A;  5B5E Z;  3BVO A;  1H89 A;  2R9R B;  1ZV8 A;  2OYH C;  4LFA B;  2QJP C;  3T1H O;  1PPJ H;  4C7U A;  1JY3 O;  3CPW O;  1Q81 Q;  4LNU B;  4OPH A;  3U10 A;  1SZX A;  1SQQ J;  1PL4 A;  1M90 W;  1XTG B;  4JGS A;  1VQ8 V;  2HHH B;  1KC8 Q;  4JAV A;  4LF4 B;  1IFJ A;  3H1H G;  3L74 D;  3HD7 A;  5JCO C;  1VQ9 V;  1K97 A;  3HE4 A;  1L4A C;  3G6E P;  4UCU A;  1R8E A;  1URQ C;  5AVU B;  1BDD A;  1GH6 A;  2UXX A;  3AEG C;  5K5G B;  4YXW G;  1KIL E;  2PTM A;  2WLJ A;  1HH0 A;  5CN0 A;  3H01 A;  5B3S C;  4GOE A;  3T1Y B;  4ZBM A;  5JJN B;  2FKW B;  3MZW B;  1FDM A;  5KKZ C;  2JJ2 G;  4JV5 B;  4IHJ A;  2GM4 A;  2YXR B;  2GTS A;  2NN4 A;  5IY5 B;  4I1L A;  3OT7 A;  1V9P A;  2GUZ A;  5AVX B;  4LP8 A;  5C93 A;  1EZV G;  5L3E A;  3N2K B;  2M7W A;  3H32 B;  5AVQ B;  1ZTE A;  3FKS G;  1SQQ D;  1NTZ E;  4EEQ A;  4MTO A;  3L71 J;  5JJJ B;  1RF1 A;  2YC0 A;  4ZOL A;  1KZU B;  4WFF A;  3TGU J;  1SQP D;  1IFN A;  5KLV G;  4N21 A;  1GK4 A;  3ZED A;  2OIE A;  1JB0 J;  3OMA B;  1YJN P;  4DT0 A;  2W8Z A;  4X66 O;  3A3Y B;  1GW3 A;  3CHX A;  2V4D A;  5JH7 A;  1S9K E;  3RYC A;  4WY4 C;  1WP7 A;  1N32 B;  1RF0 A;  2M5A B;  1B06 A;  4XDL A;  3Q2Y A;  1M8O B;  2QJY C;  3KYQ A;  2KS1 A;  3U0Z A;  4LF5 B;  3CCV P;  4FJC C;  5EC2 C;  1QLN A;  2WSF J;  5CJ4 A;  1NR7 A;  2QWN B;  3OMI B;  3V2P A;  3JAS A;  1QHT A;  1LGH B;  2H88 C;  1JUN A;  3FAV B;  3D36 C;  2ZVO B;  5KA6 A;  1BZK A;  1KU9 A;  1FXK B;  5IWA B;  1DD3 A;  2BSK A;  3OA7 A;  3MUD C;  3FFQ A;  4IFM A;  2D2C D;  1GL2 A;  3GHG A;  2OCH A;  1VQL P;  2OIG A;  3Q4H A;  4JI3 O;  2D2C B;  3L71 D;  1YYC A;  2Q3E A;  2QJK B;  5AVZ B;  2UU9 O;  2AEF A;  2VRS A;  3T97 A;  1H88 A;  3TGU D;  4JI6 O;  2IBZ G;  1ZX3 A;  1JJ2 U;  3H6P A;  1X0T A;  3TF5 A;  3SYQ A;  3HD7 D;  3A0H H;  3W67 A;  5LMN O;  4BW5 A;  2KK7 A;  3HD7 B;  1LP1 A;  2IBZ I;  3HE4 B;  2BCC D;  1QR9 A;  3A0B H;  3L36 A;  3VMA A;  4B86 A;  1W5C E;  4D6T E;  2ZNJ A;  1N8R Q;  2KSD A;  3LDD A;  3LNN A;  4JYY A;  4J80 A;  1WP8 A;  3AG1 C;  1ZME C;  4W4L A;  2QKC A;  2QM7 A;  4WF9 V;  1H8E G;  3B5N C;  5H2F H;  4D6T H;  1MOF A;  3ZMZ A;  1IK7 A;  3CCE P;  2ZKO A;  4NXN O;  1NWQ A;  3CCR V;  4GKK O;  1FZA A;  4UVA A;  1K9M Q;  2PF4 E;  4IHJ B;  1KB9 D;  4CS4 A;  2Q0O C;  1U97 A;  1QVG O;  4JI2 O;  2GUZ B;  3W68 A;  1NI8 A;  1VQL V;  1BCC E;  2KP8 A;  4R4M A;  2ZT9 C;  1GD2 E;  3CX5 I;  1SQB D;  4X20 A;  3R4Y A;  1IXB A;  5CHX A;  5L8R J;  3JD3 A;  4ZIB A;  3L73 E;  2JK5 C;  2YXH A;  2UXD O;  1SQX G;  2FKX A;  3IN6 A;  4O9B A;  2PZS A;  1GMJ A;  2I8D A;  1JY2 N;  3H1J G;  4O4H A;  1RF1 B;  4ZOL B;  2KOG A;  3AG4 B;  2YSU B;  1GN2 A;  3RGB A;  1Q5O A;  3AK3 A;  1AR1 B;  3CC2 P;  3RT3 C;  2NR5 A;  4UCS A;  3WU2 H;  1BMF G;  1Q6I A;  1ZLZ A;  3H1I E;  3HTK A;  2NZ2 A;  5AVR B;  5B66 E;  5JH7 B;  1M7L A;  3H1L D;  5IJ0 A;  2Y0C A;  2IW5 A;  5CA3 A;  2QKA A;  3KHU A;  1NU1 H;  2FYN B;  3K03 A;  2HP8 A;  4WFA V;  4DUY B;  2AZ2 A;  1VQ7 P;  1LR1 A;  3JAS B;  1PIX A;  1RQV A;  2QGN A;  1HW7 A;  4CS3 A;  1Q6H A;  4LGD E;  1GL2 D;  1HR0 B;  4WBN A;  2BSK B;  1LT9 C;  1VQ4 P;  5IJ9 A;  1NTM J;  1KB9 F;  1GL2 B;  2IU0 A;  3GHG B;  2ZNI A;  3H1K G;  1PP9 H;  2A0L A;  3Q4H B;  3OTO B;  3ZRS A;  1KYO H;  2BOB C;  3CI9 A;  3G6B A;  1KFN A;  3AEI A;  1SLQ A;  3SFD C;  3E8G A;  3T97 B;  3CXH H;  3T1C A;  3OW2 O;  3TCU A;  1HNX O;  4DV5 B;  2JS5 A;  1Y6X A;  3CC2 V;  3CWB J;  1QL2 A;  3DC6 A;  1MFT A;  3W7U A;  1YHQ V;  2ZFC A;  1ZRT D;  1LP1 B;  2Q6Q A;  1M4U A;  1PV0 A;  3ETE A;  1IFM A;  1YXB A;  2FXP A;  3ZN0 A;  4GYC B;  1AI4 A;  1PNL A;  2WA4 A;  1MNG A;  1VQ7 V;  2UXN A;  3HKE A;  1IZN B;  4DV4 O;  2XU6 A;  1FFX A;  1T5E A;  2CH7 A;  2P22 C;  4E2L A;  5HFM A;  4DR5 O;  1G2C A;  4PD4 D;  5CCG C;  3LSS A;  1NVP D;  1VQ4 V;  3IC9 A;  3SWF A;  5CBN A;  4LBE C;  1NVP B;  4QMA A;  3H1H E;  4YPC A;  1NTM G;  1TAE A;  3BA8 A;  3X2Q B;  2FL4 A;  2LQT A;  3PHL A;  2Q5U A;  4J7Z A;  4BW9 A;  1SQQ K;  1E1R G;  5KMG A;  1L0L H;  3C1L A;  1IBL O;  3CWB D;  5LHH A;  2F23 A;  4O4H B;  1K73 Q;  4H37 A;  4YIP A;  1XNR B;  1FYJ A;  1SQP K;  4R7C A;  4CZZ A;  1P84 H;  3CCJ V;  3CRA A;  4DV0 B;  1SKV A;  3E2E A;  1YJW P;  3HTK B;  1NJI Q;  3K06 A;  4CBC A;  2W6J G;  2BTO A;  5IJ0 B;  3TSI A;  3HKC B;  3P8M C;  5JQG B;  1IZ3 A;  2L6L A;  3WFV A;  4EB6 A;  1EZV E;  1JCH A;  1FAV A;  1L0N G;  4L8J A;  1DK1 A;  2X0L A;  4ASW A;  1TVK A;  5IY5 C;  2VQF B;  3E35 A;  4EFB A;  2W0X A;  3BFR A;  2A3Q A;  4DR1 B;  4JZG A;  4WBN B;  5KLV E;  2IZ1 A;  4PD4 F;  5IJ9 B;  2GDS A;  3BPZ A;  1SQV D;  4JAS A;  1UII A;  4I55 A;  3JD2 A;  5KLV H;  3QH9 A;  1FZE A;  4FFK A;  1RSO A;  4LF7 B;  1YJW V;  3AG3 B;  3VP8 A;  1XIL A;  4J11 A;  4DOJ A;  1NO4 A;  2KSJ A;  4MSW C;  2RMZ A;  3AE9 C;  1SF9 A;  3OM3 B;  4NB5 A;  2QA4 V;  1I94 O;  1R6N A;  1KUQ A;  3L75 D;  2WSE J;  1IFD A;  2FYU J;  2QWQ B;  3HKE B;  4PA7 A;  5D5Q A;  5L3B A;  1OX3 A;  1KQL A;  1FFX B;  3LNM B;  2AXC A;  1FXK C;  3A7O A;  2PI5 A;  1KQS U;  3N4X A;  1BGY H;  2CH7 B;  1G2C B;  3G3Z A;  2O57 A;  3EVK A;  3PJS K;  5KAI Z;  2A06 G;  1KD1 Q;  2IBZ E;  3M8A A;  3BCC J;  5A2Q N;  3J7A U;  1V55 B;  3VMX A;  2D2C C;  1R3L C;  3DTU B;  2QJK C;  3EXA A;  1QBZ A;  5EBL C;  2QM4 A;  3W7X A;  1SQB K;  1E79 H;  1HF9 A;  5KMG B;  2OYI C;  2R5B A;  3CSX A;  4U3F H;  4RO2 A;  4F4L A;  3HD7 C;  3MGN A;  1NT2 B;  3GLM A;  3V2N A;  1ZAU A;  2P5O A;  4W4K A;  1OCO B;  4I9Q A;  2YKP A;  4JYA O;  3HUS A;  2QE7 H;  4RES B;  1H2S B;  1S5L E;  3IAO A;  3L72 H;  4DCK A;  2KXP B;  1L8D A;  2FTK A;  4KUM A;  2DQ3 A;  3CX5 E;  3LUT B;  1AP5 A;  2P4V A;  1T3J A;  2JR8 A;  5AW2 B;  1QR8 A;  2EIK B;  3GW6 A;  4FK5 C;  2BE3 A;  2E76 D;  1K34 A;  2E76 B;  3E8H A;  2WPQ A;  3CX5 H;  3APQ A;  3U1C A;  2Q7E A;  1SQX E;  3BCC D;  1KIL A;  2Q67 A;  1US6 A;  3H1J E;  1S0V A;  1B04 A;  4EIJ A;  3Q5R A;  4H33 A;  5BU5 A;  3TNU A;  2ZR3 A;  4R6Z A;  4RUE A;  2EBO A;  3UIA A;  1RF1 C;  5JVD A;  3NXS A;  3AG4 C;  3L70 G;  4I55 B;  3E8B A;  5EC1 C;  2AXT H;  1NKZ B;  3BAB A;  1EQ7 A;  1FOS E;  1GTW A;  1PGP A;  1RSO B;  3LIE A;  2KUB A;  4TV8 A;  1JMB A;  2O1K A;  1N33 B;  1RF0 C;  2N74 A;  4U3J A;  4JI0 O;  2FYN C;  3OFN G;  2X6C A;  3CD6 V;  1MG1 A;  3SDL A;  4NR1 A;  3B8M A;  1OJH A;  2IFM A;  4LH7 A;  4TV9 A;  4RUF A;  1Y8A A;  2QSI A;  1BSH A;  2WWW A;  1HVV A;  1FZC C;  3CP1 A;  4O2A A;  4CH4 A;  2O01 H;  4W80 A;  2VQE O;  4D7S A;  2UUA B;  1CSB A;  4J9Z B;  1M57 D;  1GL2 C;  2WSS G;  5AVY B;  1GTO A;  2PRR A;  3GHG C;  3H1K H;  1M57 B;  3CE2 A;  4LF9 O;  5APW A;  3HKB A;  2ZM6 O;  3OGI B;  1FKA O;  5BXZ A;  3V4W A;  2ETN A;  1NTK H;  2RCV A;  1NYH A;  1Q90 D;  1PPJ G;  2FXM A;  4ASV A;  1I5Y A;  3K5M A;  1N36 B;  3K58 A;  3ABU A;  2MJZ A;  1AIL A;  3HUS B;  2N04 A;  3ABM B;  2Q0A A;  1NTZ J;  2WT7 A;  3ABT A;  1QCE A;  3T2M A;  2IJH A;  1JQ0 A;  3AEB C;  1NAY A;  1YEW A;  4O4I A;  4QIW F;  1NTM E;  4OX9 O;  1XTC C;  2XKM A;  2XHB A;  1AJY A;  1KIL D;  4Y99 B;  2XOK G;  3CPW U;  3GVM A;  1KIL B;  2JGD A;  3X2Q C;  1CI6 A;  5GTI E;  2M0B A;  5LL6 Y;  1VQ6 V;  3K5O A;  1B6Q A;  1DF5 A;  5E79 Z;  3VQV A;  4X89 A;  4DUZ O;  2JWD A;  3TNU B;  1AP6 A;  4UB6 Z;  5LMU B;  1KFM A;  5JVD B;  1R73 A;  3CRM A;  2QWO B;  5GTI H;  5B1A B;  3K3W A;  1JTH A;  4H13 D;  1IFP A;  3U1A A;  1P7B A;  1L0N E;  5AVS B;  1JO5 A;  4OGQ D;  3ZS8 C;  4H13 B;  4J42 A;  1NTZ D;  3AE6 C;  2IH3 C;  5AW3 B;  1G6U A;  4TV8 B;  1WB7 A;  3N27 A;  4OGQ B;  4YY3 B;  4U3J B;  2E3C A;  3KZI H;  2JIZ G;  2AW9 A;  1L0N H;  4RWU A;  4UV8 A;  4TV9 B;  4UCV A;  4DR7 O;  1VEW A;  2H89 C;  3SGI A;  4BRY B;  4DK0 A;  3RYH A;  4JI1 O;  4O2A B;  1S9K D;  4D6T J;  4FFB B;  3SFE C;  5J2U A;  2NPS A;  1NAF A;  2A79 B;  3V2R A;  4HYO A;  3HKB B;  4G27 B;  5B1N A;  2E75 D;  4RKU J;  1YTF D;  1S5H C;  4FZ0 A;  2E75 B;  4O4L A;  2B9Z A;  1YTF B;  1H2N A;  3AG3 C;  4MVZ A;  4B3R O;  5GON A;  1AB3 A;  1KBH A;  1OZH A;  1FS0 G;  1EDL A;  5LP6 A;  1PKX A;  2WT7 B;  1S5L Z;  4UVB A;  2A06 E;  3VMZ A;  4O4I B;  2FYU K;  3CC4 P;  1XMO O;  2OTL P;  4UFZ A;  4PA9 A;  4A7P A;  4D6T D;  1LTT C;  3H1I J;  2WLK A;  2POH A;  3K5B A;  2A06 H;  1V55 C;  1GKF A;  3JSL A;  2FYZ A;  1GZL A;  2LGQ A;  1SVF A;  3D71 A;  4OPA A;  2JGD B;  1CI6 B;  3RL0 g;  3P32 A;  2H3O A;  4DR2 B;  1PM9 A;  1MSW D;  1X22 A;  4EFE A;  2LP7 A;  2FY8 A;  2C9L Y;  1H0T A;  3AK1 A;  1IBK B;  3RYI B;  1PP9 J;  2P6J A;  1OCO C;  3G80 A;  3CC7 V;  1BCC D;  3AEE C;  3VMY A;  2WSC H;  3BAT A;  2FYU E;  2N05 A;  2O1J A;  3L73 D;  3P3N A;  4L74 A;  3ZMU A;  5KHH A;  3CRR A;  3HE5 A;  1HDJ A;  2EIK C;  5CA1 A;  5LGN A;  2QM8 A;  3GWO A;  2XAJ A;  2OTL V;  4X1I A;  1I08 A;  1FZF A;  1CEZ A;  1QVG U;  2QWR B;  1YDX A;  4I7Z B;  4R50 A;  1L2P A;  1J2J B;  2E76 C;  4X64 O;  4B3T B;  4LF6 B;  1NU1 G;  3H1I D;  1EN4 A;  4HB1 A;  5A9G A;  3V4Q A;  3M9Q A;  4RO0 A;  3RYH B;  1Q81 W;  1OVR A;  3L70 E;  1JY3 N;  2NPS D;  2ZJS E;  4IL6 E;  5J2U B;  1MA1 A;  1MMM A;  3M9B A;  3GB7 C;  4JI8 O;  2NPS B;  2DN9 A;  2P67 A;  2HR3 A;  2UXC B;  3IR9 A;  5DJU B;  3S9O A;  3J80 N;  4IL6 H;  1JNM A;  4Q6G A;  5KAF H;  3WB1 A;  3H25 A;  3PN1 A;  3THO A;  1L0L J;  4PDR A;  1CP9 A;  1HBW A;  4YJ2 A;  3H1H J;  1WNS A;  4MS2 A;  1KYO I;  3JD0 A;  1NOH A;  5GON B;  4BIU A;  3C90 A;  3SPJ A;  4DR3 B;  4IYI A;  4K0K B;  3GG2 A;  4NTW A;  3TJT A;  1HJ0 A;  2DWE C;  2Q7C A;  4H44 D;  2BTQ A;  5LP6 B;  2K1A A;  2PYJ A;  1V54 B;  2M5A A;  4H44 B;  2B9B A;  1IC2 A;  3CB2 A;  3UO3 A;  1RH5 B;  4ABM A;  1KEC A;  3FB8 C;  1RHZ B;  2XAH A;  4ZMD A;  5EZY A;  4TT3 H;  5IYB O;  3F89 A;  3ZX6 A;  3C8V A;  4KT0 J;  1AJP A;  2GHY A;  3T1H B;  2OYQ A;  1B3Q A;  1PPJ E;  4IGG A;  1FXK A;  3K59 A;  3B8N A;  4LR3 A;  1M57 C;  2I1K A;  1Q82 Q;  3OW2 U;  4K8Z A;  1IBM O;  2LR2 A;  2ARH A;  3P7K A;  2XAQ A;  4L73 A;  2E5L O;  1Q43 A;  2R44 A;  3AE4 C;  4NVP A;  3C9I A;  1H0T B;  4UXN A;  2K9J A;  4N3Y B;  3KCX A;  2WAM A;  1L0L G;  1TUE B;  2ZIO A;  3H1H D;  2OYI A;  3HUS C;  3ABM C;  2ZYA A;  5KLV J;  1TA8 A;  3GF7 A;  5E1A C;  5AW5 B;  5KJ7 A;  1NR1 A;  3WB0 A;  1FAF A;  1NTZ K;  5APS A;  5BZB A;  3BRV B;  3Q5S A;  4YIO A;  3HE5 B;  5CA1 B;  1OCZ B;  1J95 A;  1H8H G;  4R8C A;  1P84 I;  2B87 A;  4X1I B;  2W90 A;  2GBO A;  1JR9 A;  2WZ7 A;  4Y99 C;  3AE5 C;  1OCC B;  1QQC A;  1KIL C;  1GM7 A;  1GN4 A;  1OZ0 A;  5APQ A;  4GKJ O;  4K35 A;  3RK3 E;  3V2Q A;  1EZV D;  2W6B A;  4R4L A;  2UUB O;  2X7R B;  3GMA A;  1FDI A;  1G1J A;  3G71 P;  2GSM B;  3K9A A;  2X6A A;  1KQG B;  4DV1 O;  5B1A C;  2J5U A;  2Q6A A;  2YXQ B;  4WFH A;  4X66 B;  2YXL A;  2PP6 A;  1VQP P;  5KLV D;  4H13 C;  2Q9I A;  3G6E V;  2YUA A;  4YJ2 B;  1XQ8 A;  4KL1 A;  1SES A;  4NPF X;  1LWU A;  4OGQ C;  1S4X A;  2BEZ F;  4LF8 B;  5KLI B;  4MT8 A;  3CS5 A;  4TQD A;  4UCT A;  3FGA D;  4PV1 D;  4KHP O;  4KHX A;  2BTQ B;  3AEF C;  1K92 A;  1MSD A;  2A7W A;  2JEE A;  2QIW A;  2CTP A;  1BHB A;  3M91 A;  1LT1 A;  4LF8 O;  4C46 A;  3CCU P;  5EZY B;  2ZE7 A;  3D3Q A;  4AQR D;  2M8R A;  1JVM A;  3KKY A;  1FZC A;  4JI3 B;  2QTS A;  2JKV A;  1N0N A;  4GLX A;  1BGY G;  2AHZ A;  1SC5 B;  2UU9 B;  1NHL A;  1I5X A;  2E42 A;  4JI6 B;  3AG7 A;  3LSQ A;  1AFO A;  2YMY A;  4RQE A;  5D5P A;  5J2T A;  3RVZ A;  5LMN B;  3A0H E;  2E75 C;  4UCO A;  4IOI H;  3RGU A;  3EWK A;  1FS0 E;  3A0B E;  1SQX J;  1Q86 W;  2IBZ D;  2K9J B;  1E79 G;  2N1T A;  4JBZ A;  5C8Y A;  1N7S A;  4UB8 Z;  3B09 A;  3H1J J;  1KP3 A;  2R3C A;  3PP5 A;  2OYI B;  4PJ0 H;  1LTA C;  2ZR2 A;  2QWP B;  1NZ6 A;  5EBW C;  3WB2 A;  4FLX A;  1YJN V;  4U3F G;  1JX9 A;  5GTH H;  5KJ7 D;  1KOR A;  4QE7 A;  3RWR D;  5H2F E;  4DYL A;  2DW4 A;  5CBF A;  2QE7 G;  4KP4 A;  4NXN B;  1XNQ O;  4GKK B;  2OCC B;  2J58 A;  2KYV A;  1VDF A;  3L72 G;  5JJE B;  3CCV V;  2B87 B;  3KG2 A;  1S3J A;  4JI2 B;  1NGM B;  2HJF C;  5CBO A;  3ML0 A;  2LW1 A;  1F7Y A;  3AE3 C;  1Z2G A;  2CTQ A;  1ENV A;  4X1K A;  2UXD B;  2K3R A;  3W7S A;  3OAK A;  1J1D B;  2EIJ B;  4MTG A;  3FWL A;  3I55 P;  3CCQ P;  1EN6 A;  1JM0 A;  3KPE A;  2F66 C;  1ZP0 C;  3M99 B;  3H1K J;  1ZR4 A;  4PDL A;  1SQX D;  3WU2 E;  5CB4 A;  3B71 A;  2DOS A;  3F5W C;  3H1J D;  3ASO B;  1VQN P;  1ZWI C;  2CK3 H;  1RQU A;  1TU3 F;  1AI7 A;  3A0R A;  1LWU B;  3OD4 A;  1NU1 E;  3LW5 H;  1J1E B;  2WTY A;  5AG2 A;  1DX7 A;  3JAK A;  4I7Z C;  1JJO A;  3IFM A;  3HKC A;  5LA6 A;  5JQG A;  1KB9 I;  3S1K A;  3CCE V;  4K8X A;  1J5E O;  3BEH A;  3TXS A;  4J7J A;  2ZXX A;  1LTG C;  4XDJ A;  5H5N A;  1BHA A;  1H2L A;  1S77 D;  3WUT A;  1FZC B;  2RN9 A;  3VQY A;  1KYO E;  1PP9 E;  2NPS C;  4MVO A;  1BE3 H;  3JAR A;  1HNX B;  3CXH E;  1K73 W;  3ZHS A;  3PRJ A;  3CX5 F;  5FNV A;  1SRY A;  3UO2 A;  5J2T B;  1IK9 A;  2ITA A;  2E5Y A;  1X79 B;  1G1X B;  3ZRV A;  2N1T D;  3JC2 2;  3H1L G;  1N7S D;  1NJI W;  3V6I A;  5BR8 O;  5APX A;  3C3S A;  3ZBH A;  1NTK G;  2N1T B;  5C8Y B;  1N7S B;  1FZB A;  4Q20 A;  2XTA A;  1IX9 A;  5LP6 C;  2BAS A;  4DV4 B;  1V54 C;  4I0X A;  4QE9 A;  1Q2N A;  2L5G B;  4KXR A;  4GX2 A;  4X8A A;  4H44 C;  5BMV A;  1Q3E A;  4DR5 B;  4TOI A;  3DGE A;  5EIB D;  1EM1 A;  2A9H A;  5CBH A;  2UUC O;  2WLM A;  2KB1 A;  2DYS B;  1L0N J;  5AW9 B;  4JI7 O;  1FOS F;  3D70 A;  3JSV C;  3VOU A;  1WPB A;  4X1K B;  4PA4 A;  1IBL B;  1L0L E;  3E1I A;  1R1B A;  1NTM D;  1NVO A;  1R3J C;  4GX1 A;  2LFS A;  3OEE G;  1FJG O;  4FVM A;  1P84 E;  1A02 J;  2AHY A;  4B3S O;  5CB4 B;  3SSU A;  1OW6 A;  1QVF O;  1ZR2 A;  1PV3 A;  1Q6U A;  3IJ4 A;  1WJZ A;  1URF A;  5KLV K;  5CCH A;  5CMZ A;  1FXV A;  1YTZ I;  4XA4 A;  3APO A;  4BAY A;  2Y69 B;  1OCZ C;  2Q69 A;  3JAK B;  5IYZ A;  3ABV C;  3OTF A;  1XRE A;  3FXD A;  5EK0 A;  1W0K G;  5LBQ A;  4PD4 I;  5LA6 B;  1SFC A;  1OCC C;  2YI9 A;  2XDJ A;  4TUY B;  2JS3 A;  3CYO A;  4DV3 B;  4L76 A;  3QF7 A;  1HP8 A;  3ZHQ A;  5DJT B;  2PI4 A;  3CEI A;  2Q4P A;  1F23 A;  3OEH G;  4BWN A;  2HLD G;  3JAR B;  1GAX A;  4DV3 O;  3FB7 C;  2CTR A;  4WBA A;  3D6Y A;  3VQW A;  5FNV B;  2EIL B;  3OUF A;  2Y0D A;  5CBG A;  1PNM A;  3SPC A;  1YIJ P;  4J7K A;  2X6B A;  3MAQ A;  5L3C A;  4DV2 O;  4B3M O;  2IPP A;  5TJH A;  2JVD A;  1Y4M A;  2P10 A;  1I94 B;  5KLI C;  1SZT A;  2IZ0 A;  3KCY A;  2WSC J;  2DW3 A;  2XAF A;  2M3B A;  1E1Q G;  4LFB O;  5AW8 B;  4I0X B;  4NTY A;  5H2F Z;  2ODM A;  5BMV B;  1H38 A;  1BGY E;  1RPO A;  2Z3Y A;  5LOV A;  1AI6 A;  2DE0 X;  4IIJ A;  1GM8 A;  1SQQ H;  4B08 A;  2EIM B;  2GUV A;  2WPV B;  2LXB A;  1HTL C;  1SQV G;  1W59 A;  2ZXW B;  1K5Q A;  2IYO A;  3ASN B;  1T2K D;  1SQP H;  4UB6 H;  1JOC A;  2JEX A;  2OTK E;  3T4D A;  2F93 B;  1R5L A;  1AVY A;  1AVM A;  1WPX A;  1H2K A;  2R9I A;  4I5S A;  3M0D A;  4U3F E;  2NNU A;  1JMM A;  4BXL A;  4JYA B;  3BAS A;  1P4R A;  4IFD K;  1YVW A;  5KX5 A;  1AV1 A;  3CJH A;  2CGN A;  1SQX K;  3L70 J;  1YJ9 P;  1K04 A;  4OWF A;  5CCH D;  3WU2 Z;  3L72 E;  4KJM A;  4JPR A;  1A02 F;  5AW6 B;  2VRZ A;  3MDS A;  3CXC U;  1LJ2 A;  5KJ7 C;  3A2A A;  4IFF A;  2OCC C;  2CDY A;  3CCS P;  5FPR A;  1BQ0 A;  4MVM A;  4J10 A;  4P30 A;  2R72 A;  5IYZ B;  1FZG A;  1SFC D;  4JYB A;  5B66 Z;  1DF4 A;  2GA1 A;  1HNW O;  3L71 H;  1SFC B;  2FYU D;  4GIF A;  2RH0 A;  2EJR A;  3PH0 A;  1S76 D;  4TLF A;  4YJ3 A;  3M0A A;  1XI1 A;  1TGO A;  2R32 A;  1N4C A;  1J1D C;  2EIJ C;  2Y4U A;  3HPL C;  3SPH A;  2P2U A;  4N6J A;  1AI5 A;  4OXS A;  3A8T A;  2BCC H;  4RQF A;  1QNM A;  2PGG A;  3CRC A;  2RMK B;  4JI4 B;  1NKN A;  2AXT E;  3VYI A;  2Y0I A;  1RM1 B;  4BIO A;  5BY1 A;  3ASO C;  4YTP C;  3JCU H;  2JDI H;  3L70 D;  2FBW C;  1T3U A;  3U59 A;  5IT9 N;  3HR0 A;  2KNC A;  2LJ2 A;  1PNK A;  4JI0 B;  4D7T A;  1RE4 C;  1LWU C;  4QPK A;  4JI4 O;  1MUU A;  1X8Y A;  5DEC A;  2ZD9 A;  3CCS V;  1J1E C;  1F51 A;  5F2V O;  1KB9 H;  2YNY A;  3E7K A;  4JAU A;  5LGU A;  5TIS H;  2QSA A;  1AQT A;  2VQE B;  1FJK A;  1XL6 A;  5LOV B;  1SQB H;  1VPC A;  1HWT C;  4IIJ B;  1NS1 A;  2WPR A;  3MTU E;  2ZE6 A;  5EYP A;  4X65 B;  3OMN B;  1M9N A;  4BRY A;  1IUR A;  4LF9 B;  4WFG A;  3H1K E;  3ITK A;  3S3W A;  4TT3 G;  2ZM6 B;  3PTZ A;  3Q3D A;  2OTJ P;  3LSU A;  4FFB A;  1F4M A;  1NTK E;  2V7Q H;  2Q3I A;  2QTO A;  4XFJ A;  3TDK A;  4X65 O;  1NTM K;  1RPR A;  3ZIA G;  3H1L H;  2Y48 A;  1IJD B;  2N1T C;  3CME P;  1N7S C;  1XUQ A;  2CAZ C;  1PPJ D;  1RY3 A;  3ZHR A;  5KX5 B;  4QGP A;  5APU A;  3CJH B;  1S2E A;  2F43 G;  1LTJ A;  2L35 A;  1SQF A;  4PI0 A;  2LO1 A;  1LTI C;  4WFE A;  2EIN B;  4OX9 B;  4I50 B;  1NQT A;  4J41 A;  4FLZ A;  1ZL8 A;  1TUB A;  4DR6 B;  2DYS C;  3AE2 C;  5EIB C;  4MVS A;  1U7M A;  2IDB A;  2QRX A;  1L0N K;  2G8Y A;  2CTW A;  3EQ2 A;  2RDC A;  4YJ3 B;  3K57 A;  4O4J A;  4DUZ B;  4DR6 O;  1X9V A;  2IYP A;  4ZKU A;  3QVN A;  4JPZ B;  4FM2 A;  1Q8I A;  2I1J A;  3TXQ A;  3OUS A;  2OT5 A;  1MZE A;  4UUJ C;  2CUG A;  4CH5 A;  5KHG A;  2E43 A;  3RYI A;  3RK3 D;  3Q5P A;  5K1P A;  3WG7 B;  2KNC B;  1NKD A;  5J9P C;  1YTZ T;  3RK3 B;  1GO3 F;  2Y69 C;  4HZ3 A;  3KZI E;  1YQ4 C;  4PD4 H;  2XT9 A;  2A45 G;  4DR7 B;  2ITC C;  4MN4 C;  1M1J A;  1RE3 C;  1PD3 A;  1DD4 A;  2YIC A;  4JI1 B;  1OIP A;  2IFN A;  3QWO C;  2A45 I;  1IDS A;  1Y66 A;  2WLH A;  3QO8 A;  5DED A;  5EYP B;  1ZLL A;  5B5E H;  1YIT P;  3E86 A;  3CWB H;  3OGC C;  3SPI A;  1JOY A;  1SS1 A;  1GRJ A;  1U96 A;  1QGK B;  1K3E A;  2ZE5 A;  1EC5 A;  2Z4E A;  1UFI A;  4PA6 A;  4Z2W A;  2EIL C;  1XMQ O;  4TWK A;  4B3R B;  4DW1 A;  3SYC A;  1PZQ A;  4HNA A;  1UJW B;  1JPX A;  3T4Z A;  2WPS A;  4DZO A;  1LTJ B;  2ZYD A;  1FBM A;  3K79 A;  1Y74 A;  3RW0 A;  1MZF A;  3PLN A;  3P30 A;  4JF7 A;  1BSN A;  4X88 A;  1XMO B;  1ORQ C;  1SER A;  1M1K Q;  3IAY A;  1ZL8 B;  2EIM C;  3LW5 J;  4P2Z A;  1TUB B;  3TET A;  2LGW A;  4X62 O;  2ZXW C;  2Q5Z A;  1SQV H;  1AR5 A;  3HKD A;  4ASU G;  1JCC A;  3ASN C;  4U7J A;  3WUV A;  1NU1 J;  2W6I G;  1BQZ A;  4I9W A;  2QKS A;  1USE A;  1T2K C;  2N9Y B;  4EI2 A;  4O4J B;  1K05 A;  3CCM P;  4FLY A;  1K4C C;  3K08 A;  2EJ7 A;  2QDO A;  3JSN A;  3CLQ A;  3FXE A;  3OAA G;  1VF7 A;  2G38 A;  3K9S A;  1N86 A;  4LC1 A;  4QJF B;  3L75 H;  4EDF A;  2IJJ A;  3RBZ A;  1YQ3 C;  2E5T A;  5CCH C;  1KV4 A;  2WMM A;  4YHH O;  4CC5 A;  2B88 A;  2WLN A;  2QVA A;  2CK3 G;  1K8A W;  1DH3 A;  2FB5 A;  3F5H A;  4X64 B;  1PFI A;  3JAL A;  1M1J B;  3JAW A;  3M9H A;  4LLH A;  1SFC C;  3F7Y C;  4F6R A;  1VQO P;  5M1B A;  3H9V A;  2DYR B;  4NYK A;  1Q82 W;  3CC4 V;  2AEJ A;  2ZIM A;  4I6M C;  2R9A A;  2HLO A;  1NU1 D;  1OVU A;  4JI8 B;  1VQM P;  5IDJ A;  3CRQ A;  3CCM V;  4W7Z A;  1DEB A;  2Y0P A;  2P06 A;  1NH2 D;  1Z56 A;  1BCC G;  1EXI A;  3BY6 A;  4FM0 A;  3SWK A;  5ITZ A;  1SET A;  1GDT A;  3L37 A;  1RM1 C;  4UB8 H;  2ADQ B;  1NH2 B;  1KC8 W;  1BE3 G;  5KAF E;  4WB4 A;  3D3I A;  5L3G A;  3UCS C;  2KG7 A;  3P8C E;  2WSE H;  1PP9 D;  1KYO D;  4HNA B;  3C3T A;  4LH6 A;  5B1O A;  1PL0 A;  3CXH D;  2QEX P;  4DV7 O;  1Y74 B;  4MVR A;  2KB7 P;  2PY5 A;  4TQF A;  1OFC X;  2OQQ A;  3BCC H;  1F4N A;  2YO3 A;  1W0J G;  1WB8 A;  1K33 A;  3JYC A;  1VQO V;  3W7T A;  3VN0 A;  5AW7 B;  3G4S P;  3R65 A;  4AQY B;  1M56 D;  1VQM V;  2YKQ A;  1XL4 A;  3HKD B;  1M56 B;  1N73 A;  1IBM B;  5LHI A;  2E5L B;  1R5S A;  4AQY O;  2KZI A;  3EHB B;  3ZRX A;  2GUS A;  2KLV A;  1OHH G;  2WLL A;  4GOF A;  4P9P A;  3M0D C;  1VAR A;  1VQ8 P;  2JEU A;  2F1M A;  1Y76 B;  3O65 A;  2HFE D;  2ILM A;  1OMI A;  5AVT B;  3ZHT A;  5GTI Z;  2K9Y A;  1CXZ B;  4GX5 A;  4FM1 A;  2VWK A;  2WQY C;  4B7K A;  1MKM A;  1L0L D;  2V1D A;  4JQ0 D;  2Y0E A;  1EDI A;  3BA9 A;  3WMM 0;  1KYO F;  2EIN C;  2H94 A;  2ZIN A;  5LGT A;  3MIW A;  4AYC A;  3KZI Z;  1P84 D;  2YI8 A;  3CXH F;  3G4S V;  1LTB C;  1PGO A;  3JAL B;  1HNZ B;  3JAW B;  2UXB O;  1MZ9 A;  4GCZ A;  2WIT A;  1N2D C;  4F6R B;  4FMT A;  1HJB A;  2K37 A;  4DO2 A;  2HYN A;  2P7J A;  1IXM A;  4GKJ B;  3TYY A;  1Q7Y Q;  3RK2 D;  4U7O A;  1D5N A;  2IH1 C;  2UUB B;  1HNZ O;  3II6 A;  3N2G A;  3RK2 B;  1VIB A;  4JTC B;  2K9P A;  2L91 A;  4ICG A;  2FFD A;  4DV1 B;  1DEE G;  2KLU A;  1BGY J;  1SQP J;  4LFA O;  3L74 G;  1FE6 A;  5ITZ B;  1QVF U;  1PL5 A;  3R2P A;  2RKL A;  2Q7H A;  3IF4 A;  3U11 A;  2MK3 A;  2HHH O;  3FD9 A;  2KG7 B;  3WG7 C;  4LF4 O;  1XDC A;  2Z5U A;  3UQ8 A;  1N8R W;  3RK3 C;  1KKD A;  4KHP B;  1BS3 A;  1RP3 B;  1UPG A;  4DV6 B;  2AZ0 A;  1XHX A;  2O3J A;  3BRC A;  2A45 H;  3MHS C;  3K04 A;  4ZI7 A;  2YKO A;  1RE4 A;  3BRT B;  4U3F J;  3OR7 C;  1S5L X;  3T1Y O;  1K9M W;  5KA5 A;  4FLV A;  4DV6 O;  3B2E E;  4PV1 B;  3L72 J;  1P84 F;  3ABK B;  4JV5 O;  1N73 B;  3F5T A;  4JI5 B;  3E83 A;  2XND H;  2B1G A;  3STZ C;  1EZV I;  1SQQ G;  3FB6 C;  2Q73 A;  4NTX A;  2E74 D;  3GF3 A;  2Q8V A;  4BIZ A;  1BGY D;  3MP7 B;  2E74 B;  4JTA B;  1SQP G;  1OCR B;  1M93 A;  2WLL B;  1MAB G;  1NTZ H;  3G71 V;  2BOC C;  4JI5 O;  4P9O A;  1VQK P;  1T8Z A;  4WCE V;  2J59 M;  1P49 A;  2BCC J;  1GK6 A;  4PJ0 E;  3K0G A;  3MHV A;  3LDE A;  1M90 Q;  5GTH E;  1LTJ C;  3JAT A;  1YF2 A;  1VQP V;  2OAR A;  2KKW A;  2YO2 A;  2UWJ E;  3A5T A;  1XNQ B;  3G9R A;  4U3F D;  2CE4 A;  1WRG A;  1SA0 A;  3RYF B;  1FFT B;  1N32 O;  3E22 A;  3NR7 A;  3CCR P;  4LFC B;  4LCU C;  4LF5 O;  1QL1 A;  3L72 D;  5APT A;  2LXC B;  1KP2 A;  5AW1 B;  3CCU V;  3JAM N;  1U7J A;  4E4E A;  1EDK A;  1Y9B A;  3IC7 A;  3AG2 B;  3QO7 A;  3ETD A;  1SQB J;  1NU1 K;  3L71 G;  4LFC O;  1ROP A;  4GZR B;  5IWA O;  2EZP A;  3N2G B;  3TGU G;  2ZYG A;  2PAJ A;  1VL2 A;  2B89 A;  4DRX A;  4MW3 A;  1DIP A;  4UV9 A;  2LKM A;  2O01 J;  3CX5 D;  1VQK V;  2FFD B;  3LID A;  5CMU A;  1LTS C;  2O01 N;  1HGZ A;  3RL0 D;  4IL6 Z;  2V7Q J;  2BCC G;  3RL0 B;  1YZB A;  4HAM A;  5KAF Z;  1X59 A;  1M5I A;  3I5C A;  5IE9 A;  2JO1 A;  2H8P D;  2EUL A;  4WWI A;  3H1L J;  1HWY A;  1WAZ A;  1W2B O;  3IFX A;  2JDI G;  1NTK J;  1EXJ A;  2KSE A;  2KQX A;  2Q9L A;  1BT8 A;  2XAG A;  2DQ0 A;  4N78 E;  4ZI7 B;  1M1J C;  5KAI E;  3RVY A;  1USD A;  1J5E B;  4LWS A;  3NFQ A;  2DYR C;  3ABL B;  2JJ1 G;  1RE3 A;  5KAI H;  1QEX A;  2W27 A;  2P90 A;  1N7L A;  3VP9 A;  4TUY A;  3G67 A;  1BE3 E;  3ZHV A;  1G1I A;  1SQB G;  2C2A A;  2G3A A;  3VBB A;  1GMG A;  1R3K C;  4RJT A;  1G8M A;  1BCC H;  2KI7 B;  2R70 A;  1LUV A;  1Z5V A;  3I55 V;  3CCQ V;  2NRG A;  2V4H A;  1D5A A;  2NLJ C;  3L4F A;  3O6Q A;  3V5B A;  3L73 H;  4K3A A;  5BR8 B;  1P7G A;  2WVR A;  3MD0 A;  2V7Q G;  1QLE D;  1WT6 A;  1K4D C;  3VTP C;  1YHQ P;  3H1K D;  5LHG A;  1Q86 Q;  1D2D A;  1QLE B;  4FLT A;  3RYC B;  3FX0 A;  4CH3 A;  2VS0 A;  1VQN V;  3JAT B;  5DM6 V;  1NTK D;  4FLW A;  4G28 B;  2KS1 B;  3H1I H;  1L0L K;  1JY2 P;  1SS3 A;  5B66 H;  2ITD C;  1SA0 B;  2UUC B;  1O9G A;  1COW G;  1T6A A;  2ADP A;  3E22 B;  1KQF B;  2ATK C;  4JYC A;  4JI7 B;  4DUY O;  1M56 C;  3SJB C;  5LYJ A;  2ZE8 A;  4L75 A;  4HH2 A;  4PDM A;  1HR0 O;  2Q7G A;  3RFR A;  1FJG B;  1AA0 A;  2RNB A;  2ZDI A;  4DRX B;  2C0X A;  4BR6 A;  3I56 P;  4B3S B;  1I0H A;  1XBL A;  3OTO O;  2K88 A;  4X1Y A;  1W2E A;  4A5U B;  1X4T A;  2HFE C;  2K1E A;  1JY2 O;  1QX8 A;  3AEC C;  4Y28 J;  2Y9Y A;  2ZAE B;  3CCJ P;  4DV5 O;  3S3X A;  4GKG A;  1VP7 A;  2ZXE B;  2CPS A;  4JAA A;  3E89 A;  3ZN1 A;  3AE8 C;  1IVS A;  5L3F A;  4LWS B;  2XNX A;  5KUM A;  1Z5W A;  2XZR A;  3IGA C;  3QG5 A;  3EFG A;  3FWN A;  3HB3 B;  5H6Q A;  3L74 E;  1KD1 W;  1FU1 A;  2N9B A;  1L0N D;  1BSM A;  1JCD A;  4N23 A;  4X20 B;  3RK2 C;  1HGV A;  1SQV J;  5KTB A;  1O9H A;  3ZMS A;  3H1H H;  4C7R A;  3I56 V;  3CWB G;  4JF3 A;  2P7T C;  1FD9 A;  3L74 H;  3O6Q B;  4OVN F;  4GDO A;  2Y4T A;  4AI8 A;  4QNH B;  2LW7 A;  3BHP A;  4G2K A;  4DV2 B;  4B3M B;  1JA8 A;  1VF6 A;  5FL7 G;  1OXZ A;  4YXW H;  2YIB A;  3JCZ A;  4HBN A;  3JD1 A;  1XNR O;  4PJ0 Z;  3A0H Z;  4LFB B;  2YIU B;  2IM9 A;  5GTH Z;  2QA4 P;  1EDJ A;  4DV0 O;  3L75 J;  3A0B Z;  4M3L A;  4NXM B;  4UVC A;  5DN6 G;  2DMX A;  1SQQ E;  4I4T A;  1VMG A;  4PV1 C;  2Q1K A;  1EZV H;  3ABK C;  2W83 C;  1GM9 A;  5E79 E;  4J9Y B;  1N73 C;  3E8F A;  1SQP E;  3USS A;  4NXM O;  4UB6 E;  5LYJ B;  5LXT A;  2IX7 C;  1R6K A;  2VQF O;  1HUC A;  2OWO A;  2EZO A;  3KXD A;  2ZVN B;  4DR1 O;  2YS8 A;  2E74 C;  3DSQ A;  1OCR C;  5E79 H;  4FIP C;  2MW2 B;  2M6Y A;  4CC6 A;  2HKO A;  4IL6 X;  3D6Z A;  2A06 D;  4ZHQ A;  3UT5 A;  2M3E A;  4X1Y B;  4CH6 A;  3CMA P;  2F95 B;  4TSF G;  1YIJ V;  4ZKP A;  2PUS A;  2WLI A;  4LF7 O;  5B1B B;  3D8C A;  1MFZ A;  2SPZ A;  2Y9Z A;  1OV9 A;  3L75 G;  4L87 A;  4EOT A;  3ETQ A;  3SYO A;  1HNW B;  3W7W A;  3L71 E;  1S72 P;  2B5U A;  4I50 A;  3ZRW A;  3TGU E;  2AEM A;  1VF5 D;  1R3I C;  1IO4 A;  3A2F A;  3AG2 C;  3AED C;  1G4Y B;  1VF5 B;  2CGO A;  1NH4 A;  3HRN A;  3KDP B;  2DJV A;  2DWD C;  2YDE A;  1XHZ A;  2BCC E;  2IBZ H;  1RFY A;  3BAA A;  3TGU H;  1AJQ A;  2OYH A;  2FFD C;  3FB5 C;  4EYY Q;  1YSC A;  3CL3 D;  3JCU E;  1IFI A;  4I2L C;  3RL0 C;  4QPJ A;  3CMA V;  2KIK A;  1K7D A;  1DLB A;  1LUW A;  2EX3 A;  2YIB D;  1CZQ A;  3OE7 G;  3S4R A;  2RN0 A;  3DXR A;  5JCO A;  1L4A A;  1YJ9 V;  1URQ A;  4H0L D;  2H8P C;  2HPC A;  5BU8 B;  1GN6 A;  1KB9 E;  2MKV A;  3SJQ C;  4DW0 A;  4H0L B;  2WSF H;  2YMK A;  2Z5I A;  1NTK K;  3CD6 P;  2FYU G;  5TIS E;  4EB6 B;  5KHI A;  3SJA C;  1N34 B;  1S5L H;  1S72 V;  1TVK B;  3ABL C;  1D7M A;  1SQB E;  5K1X A;  3AE7 C;  3P8C D;  3CCL P;  2RQ6 A;  4X9Q A;  4I4T B;  3BCC G;  4OH8 B;  1N34 O;  2QG4 A;  2ZQM A;  2FML A;  5LXT B;  1BL8 A;  1Y47 A;  2JWA A;  1SQX H;  2HVK C;  2D3O W;  3H1J H;  3STL C;  3ZDM A;  2HG5 D;  1KN7 A;  3H1L E;  1ARO P;  4F6E A;  3B77 A;  4ZHQ B;  3O8Z A;  3UT5 B;  1QLE C;  2JJL A;  3DC5 A;  2QR4 A;  3R66 A;  4XDK A;  4FZ1 A;  5GW7 A;  2WLI B;  4MTX A;  1JFF A;  2P4K A;  4WY4 A;  3EFF K;  4ZKI A;  3N7N A;  3SWY A;  4Z1M G;  3AE1 C;  3P3P A;  3CCL V;  1N33 O;  5CA0 A;  4WVZ A;  2LFR A;  2Z0A A;  5BVZ A;  1H2M A;  2W0F C;  3K0D A;  3UM7 A;  3ZRW B;  1JEK A;  3D36 A;  4C7N A;  2XV5 A;  1PGJ A;  4FLU A;  1KTM A;  3MUD A;  1QU7 A;  5CJ0 A;  1VQ6 P;  2HOD A;  2P58 A;  1ZRT E;  1OW7 A;  1H8A A;  3ZMV A;  2OTJ V;  5FLX N;  4AHC A;  2UUA O;  2OYH B;  1FC2 C;  2QJP B;  2C9N Y;  2HJD A;  1SQG A;  1OW8 A;  2VWJ A;  3ZCC A;  3L9D A;  2R3S A;  4KFM A;  2BEQ D;  2IJI A;  1L4A D;  2YXY A;  4GX0 A;  2KZJ A;  3CME V;  1URQ D;  2B1I A;  4WFB V;  2YEV A;  3DXR B;  1L4A B;  1N36 O;  4GUN A;  1URQ B;  1YBK A;  4PD4 E;  1VQ5 P;  3VOP A;  2HPC B;  5AVV B;  5JWP A;  1LNQ A;  1THZ A;  4PA3 A;  1M1K W;  3LDC A;  4UCR A;  2PYL A;  2FXO A;  1ZW0 A;  1H2G A;  5B3S B;  3B40 A;  3I5D A;  3VQX A;  3ZMT A;  3B4S A;  3B5N A;  1NBM G;  5L3D A;  5KHK A;  5APV A;  5KKZ B;  1FDO A;  2JRI A;  2H7H A;  3QTC A;  5B5E E;  1NTM H;  3CWB E;  4U7N A;  4RAI A;  2AGA A;  3FYE B;  1KMI Z;  1A32 A;  1OWA A;  2W6A A;  2OYO A;  4NPD A;  4HKZ H;  1SQV K;  3AEA C;  1AVO A;  2P1J A;  2XND G;  1XMQ B;  4Z1V A;  1GN3 A;  5LMU O;  2XUM A;  4YXD C;  1ZXG A;  1NTZ G;  1VQ5 V;  4GT1 A;  2W6J H;  2YIU C;  1DTO A;  4IYH A;  4AIL C;  1I7F A;  1S5J A;  3QNE A;  4WY4 D;  3GWK C;  2C0W A;  2QJ1 A;  3SYP A;  1JFF B;  4WY4 B;  1U57 A;  1WLE A;  5CA0 B;  4YY3 O;  2QJY B;  1EFR G;  4X62 B;  4JTD B;  1XEQ A;  4O2B A;  5H9C A;  3SR2 C;  1SQV E;  3M06 A;  4AUW A;  3K5N A;  1Y67 A;  5AW0 B;  5KUK A;  1R6T A;  1MV8 A;  4XE5 B;  4C7N B;  3B8E B;  3AK2 A;  1YIT V;  1LT9 A;  4IT5 A;  4JZ2 A;  1UIX A;  1KQS O;  1FXH A;  1FJP A;  2YID A;  4NKG B;  2HOD B;  1YI2 P;  2ZDI C;  1S1C X;  4HJG H;  4XBF A;  3FYI B;  2XAS A;  1BCC J;  1BDC A;  2HVJ C;  3L75 E;  3F7V C;  3CC7 P;  5EFW B;  1Y76 A;  3JCU Z;  1WA8 A;  1BE3 J;  4PI2 A;  3L73 J;  3K5L A;  4W7Y A;  4YHH B;  1EZJ A;  5B1B C;  4DJG A;  2YEV B;  2IJK A;  1DGS A;  1GU5 A;  2AXT Z;  1GK9 A;  2OGU A;  4MVQ A;  4MTF A;  4DK1 A;  1GU4 A;  3B5N D;  3AG1 B;  3FX7 A;  5APY A;  2WPD G;  5TIS Z;  4CS2 A;  1GW4 A;  4D6T G;  3B5N B;  2JP3 A;  1WN7 A;  2RJZ A;  5CCG A;  2GTA A;  3BVH A;  4CPG A;  1EBO A;  2IU3 A;  3JD4 A;  1VF5 C;  3RBX A;  3SPG A;  1L1F A;  4N78 D;  2ZT9 D;  5FPO A;  2ZCE A;  4B7E A;  1YI2 V;  4LNU A;  2JGU A;  4UB8 E;  2ZT9 B;  2F4V B;  2Z5H A; 
#chains in the Genus database with same CATH homology
 5IYD O;  1VQP V;  4J9Z B;  2WSS G;  1GTO A;  5EK0 A;  1W0K G;  3TK1 A;  3MHH C;  5LBQ A;  1OCC C;  1W2B U;  1M57 B;  5IYC O;  3CYO A;  1FFT B;  4MW8 A;  3ZJZ A;  2PI4 A;  4LCU C;  4EKW A;  1I5Y A;  1F23 A;  3OEH G;  2HLD G;  3QO5 A;  1KP2 A;  3ABU A;  3OR6 C;  3CCU V;  2Q68 A;  3FB7 C;  3IC7 A;  3AG2 B;  3QO7 A;  3ETD A;  3ABM B;  2EIL B;  1Q7Y W;  1ROP A;  2EZP A;  3OUF A;  5CBG A;  1K5S A;  1PNM A;  3SPC A;  3ABT A;  1QCE A;  3T2M A;  2IJH A;  4MW3 A;  1JQ0 A;  2X6B A;  4UV9 A;  3UKM A;  5L3C A;  1VQK V;  4MVU A;  5CMU A;  1Y4M A;  5H6R A;  4QIW F;  5EBM C;  1SZT A;  4HAM A;  2XAF A;  1E1Q G;  2HG5 C;  2XOK G;  3CPW U;  1HWY A;  1AJN A;  1H38 A;  3IFX A;  1RPO A;  2JDI G;  2Z3Y A;  3X2Q C;  1AI6 A;  1GM8 A;  4FPP A;  1VQ6 V;  2EIM B;  2XAG A;  2DQ0 A;  1B6Q A;  1DF5 A;  2ZXW B;  4X89 A;  3RVY A;  1K5Q A;  3ASN B;  1R73 A;  4DXW A;  2DYR C;  3ABL B;  2JEX A;  2JJ1 G;  4PEL A;  2QEX V;  5B1A B;  3K3W A;  3T4D A;  1IFP A;  1WPX A;  2P90 A;  1P7B A;  2R9I A;  4I5S A;  2NNU A;  1CPY A;  2IH3 C;  2C2A A;  3VBB A;  3ETG A;  5HFL A;  1GMG A;  1R3K C;  1P4R A;  2WSS H;  1G8M A;  3CCQ V;  3SYA A;  3I55 V;  2JIZ G;  2NLJ C;  4JPR A;  4PDV A;  4UV8 A;  2R9R B;  3MD0 A;  3CXC U;  2V7Q G;  1K4D C;  2OCC C;  5LHG A;  1QLE B;  4MVM A;  1VQN V;  4P30 A;  1M90 W;  5DM6 V;  4JGS A;  1VQ8 V;  4G28 B;  4JAV A;  4JYB A;  1DF4 A;  2A79 B;  1VQ9 V;  1K97 A;  4HYO A;  4G27 B;  2ITD C;  2EJR A;  5B1N A;  4TLF A;  1S76 D;  2UXX A;  1COW G;  1YTF D;  4YXW G;  2ATK C;  2EIJ C;  1S5H C;  3HPL C;  4JYC A;  3SPH A;  1AI5 A;  2WLJ A;  1YTF B;  3AG3 C;  4MVZ A;  1M56 C;  4OXS A;  3H01 A;  5CN0 A;  5B3S C;  4ZBM A;  4RQF A;  4PDM A;  1RM1 B;  3ASO C;  1FS0 G;  2JJ2 G;  2JDI H;  1PKX A;  5IY5 B;  2ZDI A;  4UVB A;  1PNK A;  4LP8 A;  5C93 A;  4QPK A;  5L3E A;  2ZD9 A;  2M7W A;  3CCS V;  1F51 A;  2HFE C;  4PA9 A;  3FKS G;  2K1E A;  2WLK A;  4MTO A;  4JAU A;  5LGU A;  1V55 C;  1AQT A;  1GKF A;  4WFF A;  1XL6 A;  4N21 A;  3E89 A;  3ZN1 A;  3OMA B;  3P32 A;  3OMN B;  1M9N A;  5L3F A;  1MSW D;  4WFG A;  2LP7 A;  4TT3 G;  5KUM A;  1F4M A;  2P6J A;  1OCO C;  3IGA C;  4XDL A;  2V7Q H;  3HB3 B;  5H6Q A;  2QTO A;  3CC7 V;  1KD1 W;  4FJC C;  5EC2 C;  1QLN A;  4N23 A;  1NR7 A;  1RPR A;  3OMI B;  3ZIA G;  2Y48 A;  3ZMU A;  3ZMS A;  5KA6 A;  3I56 V;  1FXK B;  4JF3 A;  2EIK C;  2P7T C;  2F43 G;  5LGN A;  2QM8 A;  3GWO A;  2XAJ A;  2OTL V;  4QNH B;  1CEZ A;  1QVG U;  4G2K A;  4R50 A;  5FL7 G;  4YXW H;  4WFE A;  1Q81 W;  2EIN B;  3JCZ A;  1NQT A;  3JD1 A;  1JJ2 U;  3SYQ A;  2DYS C;  3GB7 C;  4MVS A;  4BW5 A;  2P67 A;  2HR3 A;  4UVC A;  1QR9 A;  5DN6 G;  3LDD A;  3ABK C;  3AG1 C;  1GM9 A;  4J9Y B;  4PDR A;  1CP9 A;  3E8F A;  3USS A;  2QM7 A;  4WF9 V;  1H8E G;  1R6K A;  4MS2 A;  3JD0 A;  1MOF A;  3ZMZ A;  3OUS A;  2OT5 A;  4BIU A;  3SPJ A;  4UUJ C;  2EZO A;  3CCR V;  4UVA A;  2DWE C;  1OCR C;  4FIP C;  1V54 B;  2HKO A;  3WG7 B;  1NKD A;  5J9P C;  1VQL V;  1GO3 F;  1KEC A;  2Y69 C;  3FB8 C;  2XAH A;  4HZ3 A;  3JD3 A;  5IYB O;  2JK5 C;  2ITC C;  4TSF G;  1YIJ V;  1AJP A;  2GHY A;  1PD3 A;  2WLI A;  1FXK A;  5B1B B;  3B8N A;  1M57 C;  3AG4 B;  3OW2 U;  1Y66 A;  2YSU B;  4L87 A;  2WLH A;  1AR1 B;  2XAQ A;  3QO8 A;  3SYO A;  1BMF G;  3E86 A;  3SPI A;  3OGC C;  3W7W A;  1JOY A;  4UXN A;  2B5U A;  3ZRW A;  1K3E A;  2IW5 A;  2WAM A;  5CA3 A;  1R3I C;  1TUE B;  3AG2 C;  4PA6 A;  1G4Y B;  3ABM C;  3K03 A;  2EIL C;  4WFA V;  5E1A C;  2DWD C;  4TWK A;  1NR1 A;  1AJQ A;  5BZB A;  3SYC A;  3FB5 C;  1UJW B;  1JPX A;  3T4Z A;  1OCZ B;  1J95 A;  1YSC A;  1H8H G;  4R8C A;  3K79 A;  4QPJ A;  3CMA V;  3RW0 A;  1K7D A;  1DLB A;  2IU0 A;  3P30 A;  3OE7 G;  2A0L A;  1BSN A;  3ZRS A;  1OCC B;  2BOB C;  4X88 A;  3AEI A;  1ORQ C;  1YJ9 V;  1SER A;  2H8P C;  3E8G A;  1GM7 A;  1OZ0 A;  3T1C A;  3TCU A;  2EIM C;  3CC2 V;  4P2Z A;  3SJQ C;  3TET A;  2ZXW C;  4ASU G;  3W7U A;  2X7R B;  1YHQ V;  3ASN C;  1S72 V;  2GSM B;  3ABL C;  3K9A A;  2W6I G;  2X6A A;  3ETE A;  4I9W A;  2QKS A;  5B1A C;  2Q6A A;  4WFH A;  3ZN0 A;  1AI4 A;  1K4C C;  1PNL A;  3K08 A;  3G6E V;  2ZQM A;  1VQ7 V;  2UXN A;  1SES A;  1BL8 A;  3OAA G;  2HVK C;  2D3O W;  4E2L A;  3STL C;  5HFM A;  4MT8 A;  4LC1 A;  4QJF B;  3LSS A;  1NVP D;  1VQ4 V;  2IJJ A;  3RBZ A;  2E5T A;  1K92 A;  4LBE C;  1ARO P;  1BHB A;  1NVP B;  3B77 A;  4QMA A;  3X2Q B;  1QLE C;  2WLN A;  2CK3 G;  1K8A W;  4XDK A;  1JVM A;  1E1R G;  5LHH A;  5GW7 A;  2WLI B;  4MTX A;  3F7Y C;  2AHZ A;  3EFF K;  4ZKI A;  1I5X A;  2DYR B;  4H37 A;  4Z1M G;  1Q82 W;  3CC4 V;  3LSQ A;  4R7C A;  3CCL V;  4CZZ A;  4RQE A;  3CCJ V;  3RVZ A;  5IDJ A;  3E2E A;  4WVZ A;  2LFR A;  3CCM V;  3K06 A;  1FS0 E;  4CBC A;  2W6J G;  2W0F C;  3K0D A;  1Q86 W;  1E79 G;  3UM7 A;  3ZRW B;  1NH2 D;  3D36 A;  1JEK A;  3BY6 A;  1KP3 A;  1SET A;  3WFV A;  1RM1 C;  2ZR2 A;  1YJN V;  1JCH A;  5EBW C;  1NH2 B;  1KC8 W;  1JX9 A;  2X0L A;  4QE7 A;  5IY5 C;  3D3I A;  5L3G A;  3ZMV A;  2OTJ V;  2DW4 A;  3E35 A;  5CBF A;  2QE7 G;  4KP4 A;  2OCC B;  5B1O A;  1PL0 A;  3CCV V;  3ZCC A;  3KG2 A;  1S3J A;  2IJI A;  4KFM A;  4MVR A;  4GX0 A;  2HJF C;  3CME V;  2B1I A;  1F4N A;  4WFB V;  2YEV A;  4JAS A;  1W0J G;  1K33 A;  3JYC A;  3ML0 A;  1VQO V;  3W7T A;  3JD2 A;  1LNQ A;  1ENV A;  1THZ A;  4PA3 A;  1M1K W;  3R65 A;  3W7S A;  2EIJ B;  3LDC A;  4MTG A;  1VQM V;  1XL4 A;  1YJW V;  1H2G A;  3AG3 B;  1M56 B;  5B3S B;  3ZMT A;  5LHI A;  3M99 B;  1NBM G;  4MSW C;  4PDL A;  5L3D A;  3OM3 B;  2QA4 V;  3F5W C;  3ASO B;  1R6N A;  3EHB B;  3ZRX A;  1OHH G;  2WLL A;  4P9P A;  1ZWI C;  4RAI A;  3FYE B;  4U7N A;  2JEU A;  2CK3 H;  4PA7 A;  1AI7 A;  3A0R A;  5L3B A;  3LNM B;  1FXK C;  2PI5 A;  1KQS U;  4GX5 A;  2XND G;  3PJS K;  2V1D A;  1V55 B;  1R3L C;  3CCE V;  3DTU B;  3BEH A;  2EIN C;  2H94 A;  1QBZ A;  5LGT A;  5EBL C;  4XDJ A;  1VQ5 V;  4GT1 A;  3W7X A;  1BHA A;  2W6J H;  1E79 H;  3G4S V;  1DTO A;  1S77 D;  3QNE A;  4MVO A;  4RO2 A;  4F4L A;  4GCZ A;  3SYP A;  4FMT A;  4DO2 A;  1IXM A;  1OCO B;  1K73 W;  1WLE A;  1EFR G;  2QE7 H;  1SRY A;  4U7O A;  4JTD B;  2E5Y A;  2IH1 C;  5H9C A;  3ZRV A;  1NJI W;  4JTC B;  2FTK A;  4KUM A;  2DQ3 A;  5KUK A;  3LUT B;  4Q20 A;  1QR8 A;  2EIK B;  1QVF U;  1YIT V;  4FK5 C;  1FXH A;  1K34 A;  2MK3 A;  1V54 C;  3E8H A;  4QE9 A;  3WG7 C;  2ZDI C;  4GX2 A;  4X8A A;  2Z5U A;  1N8R W;  2Q67 A;  4XBF A;  1KKD A;  1S0V A;  3FYI B;  3DGE A;  2XAS A;  2A9H A;  2HVJ C;  5CBH A;  2WLM A;  3F7V C;  2KB1 A;  2DYS B;  3MHS C;  3K04 A;  4H33 A;  2ZR3 A;  1EZJ A;  4R6Z A;  4RUE A;  2EBO A;  5B1B C;  3OR7 C;  2YEV B;  4DJG A;  2IJK A;  3NXS A;  3VOU A;  3AG4 C;  1K9M W;  1GK9 A;  3E8B A;  5KA5 A;  5EC1 C;  4PA4 A;  4MVQ A;  3ABK B;  4MTF A;  3AG1 B;  1R3J C;  4GX1 A;  2WPD G;  2LFS A;  3E83 A;  2XND H;  3OEE G;  2B1G A;  3STZ C;  3FB6 C;  2AHY A;  3OFN G;  2X6C A;  4BIZ A;  1MG1 A;  3CD6 V;  1EBO A;  2IU3 A;  3B8M A;  1OCR B;  3JD4 A;  2WLL B;  4JTA B;  1MAB G;  3G71 V;  4RUF A;  2BOC C;  3SPG A;  1BSH A;  4P9O A;  2WWW A;  1L1F A;  4WCE V;  1FXV A;  3CP1 A;  1YI2 V;  4BAY A;  2Y69 B;  3K0G A;  3LDE A;  1OCZ C;  2Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...