3PJSK

Mechanism of activation gating in the full-length kcsa k+ channel
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
139
structure length
139
Chain Sequence
SALQWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGQEQQQQQQFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of activation gating in the full-length KcsA K+ channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords FAB light chain
total genus 32
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3pjsK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3pjsK02
5EBWC 3ABMC 2P7TC 1R3KC 4LBEC 2DWDC 3ABKC 4PDRA 3RW0A 3UM7A 3LNMB 2HVJC 4RAIA 2EIMC 3X2QC 1M57C 2EINC 4MSWC 5B1BC 3E8GA 3SYQA 1P7BA 4WFFA 3SJQC 3AG3C 4MS2A 1K4DC 2WSSH 4WVZA 4R8CA 3LDDA 1BL8A 2WLIB 3UKMA 4F4LA 2WLKA 3E8BA 3LDEA 2A9HA 1OCCC 2YEVA 3K03A 3ZJZA 2A0LA 2ITDC 5B3SC 4YXWH 5CBGA 4QNHB 3TETA 2ZXWC 2Y69C 3SYCA 5KUKA 1JEKA 2Q67A 3E8HA 5EC1C 3FB6C 4MVZA 2IH3C 3ABLC 3E8FA 4CBCA 2BOCC 2QE7H 1OCRC 1LNQA 3IFXA 4QMAA 3IGAC 3USSA 1V55C 2NLJC 3OR6C 3FB5C 3SYOA 3AG4C 3KG2A 3LDCA 4PA6A 2DYRC 3SPHA 4MW8A 1R3JC 4HZ3A 1V54C 4X8AA 4P9OA 3RBZA 1E79H 4R50A 2HJFC 2CK3H 4QE7A 1QLEC 4GX2A 3T4ZA 4BW5A 3ZRSA 2AHYA 4P30A 4TLFA 3FB8C 2AHZA 4UUJC 3E83A 2WLNA 3K08A 2Q6AA 5J9PC 4DJGA 4MTOA 2X6BA 4MW3A 3K04A 3FB7C 4MTGA 3PJSK 4PDVA 4PA9A 3BEHA 3OGCC 4PA4A 4MVUA 1XL6A 3SPIA 2EIJC 1R3IC 1ORQC 4H33A 2ATKC 4GX0A 4OXSA 4R7CA 2DYSC 3OUFA 3SPJA 3HPLC 4MVOA 2A79B 1IFPA 2X6CA 1J95A 2E5YA 3SYAA 3K06A 2EILC 4QE9A 5IY5C 1BSNA 2Q69A 4WFEA 4X89A 5E1AC 4KFMA 3STZC 2ITCC 4P2ZA 1FS0E 1R3LC 2WLJA 3EFFK 3K0DA 4MVSA 3SPGA 1OCOC 1XL4A 3F7YC 3T1CA 4GX1A 3RVYA 4LCUC 3STLC 4DXWA 2DWEC 4WFHA 5EBMC 4PDLA 2WLMA 3WG7C 4JTAB 2X6AA 4RUFA 5EBLC 4G27B 4JTCB 3T2MA 2QTOA 2JK5C 4J9ZB 4GX5A 4XDJA 5BZBA 5EK0A 2WLLB 4P9PA 2E5TA 4G28B 1K4CC 3F7VC 2WLIA 4MTFA 2KB1A 4H37A 2ZD9A 4MVQA 2HG5C 3ASNC 4I9WA 2V7QH 3LUTB 3OUSA 3VOUA 4EKWA 5B1AC 1M56C 1JVMA 4MVMA 4PA7A 2EIKC 1AQTA 2OCCC 3E89A 4WFGA 3K0GA 1G4YB 1BSHA 3OR7C 4JTDB 4XDLA 3F5WC 4LP8A 4PA3A 1OCZC 5EC2C 2R9RB 1KKDA 4MVRA 4R6ZA 3JYCA 2XNDH 3E86A 2QKSA 3RVZA 2W0FC 2WLHA 3GB7C 4RUEA 4ZBMA 1ZWIC 3TCUA 3T4DA 5CBFA 2W6JH 2H8PC 2K1EA 1S5HC 4RO2A 3R65A 2WLLA 3ASOC 2IH1C 5KUMA 2Q68A 4PDMA 5CBHA 4HYOA 4XDKA 4J9YB 2HFEC 2HVKC 3AG2C 4TWKA 3AG1C 3SPCA 4X88A 3SYPA 2JDIH 2BOBC
chains in the Genus database with same CATH superfamily
3P8CD 5EBWC 4J11A 3C3TA 1I08A 3Q1MA 1TGOA 4LFBO 1URQB 1NKDA 2JEEA 4BIOA 3V5BA 3IJ4A 1NTKK 3LSUA 5APQA 4H13C 4RQFA 1EZVI 4FLZA 3RK3E 1WMKA 3E8BA 3AK2A 4B3MO 1HGZA 5CCGA 2WQYC 2QM8A 2ZDIA 1W2BO 4UB8E 1YQ3C 4AQYO 1IFDA 4EFEA 2X0LA 4X64B 3CCVV 1QL1A 1Q86W 1LTTC 1F4MA 2BOCC 2KYVA 4Y28J 3EWKA 1JMBA 2OYHC 2EZPA 2Y4TA 5L3EA 1NTZD 3AG4C 1JCHA 4PI2A 1U7MA 1KILE 4HZ3A 1H2SB 2UXXA 2WAMA 1GW3A 1M1JA 1WRGA 4E2LA 4FFBA 3FB8C 2DN9A 2WLNA 4DJGA 3E22A 4I5SA 1BCCJ 3UQ8A 4WY4A 1YJNP 1ZL8B 4IHJB 4PD4D 4DV6B 4JQ0D 4K0KB 3LSSA 1FYJA 1N7SD 2Q8VA 1PL5A 3H1KD 5LYJB 1R6KA 2P4KA 3MTUE 1EXJA 1URQC 1LT9C 4NPEA 2M5AA 2GSMB 3OM3B 1EDJA 4UB6H 2ZM6B 5APWA 3VYIA 3K0DA 3W68A 2BE3A 3OTOO 1HW7A 2Q9LA 1S3JA 1NOHA 4D6TJ 2QG4A 5CBNA 4NPDA 3VMZA 4PDLA 3VMXA 3GMAA 2GBOA 2UUAO 2LXCB 2Q3EA 4OPHA 2ZT9B 1W2EA 3ZN0A 2KB1A 3JCZA 4PD4H 4PV1D 4HAMA 5B1AC 3FFQA 5C8YB 1SQPJ 1WA8A 3CCJV 4A5UB 2I1KA 1E1RG 4U3JB 3H6PA 4N78D 3CRRA 3H1HJ 1S9KE 1PP9E 3RK2C 1KKDA 1N33B 3I56P 3BVOA 4IL6Z 4NKGB 4TSFG 1OW8A 3X2QB 3M0DA 2EIMB 3CB2A 3N2GB 3H1IJ 3L73E 3PH0A 4H13B 1L0ND 4FLYA 1RPOA 1K92A 1AR5A 1NI8A 4PJ0E 4OGQC 1YCIA 2IBZI 5L3CA 3OW2U 4RESB 3SYPA 1EN6A 1FJGO 3L72D 3SJBC 4CS2A 2CTPA 1R1BA 3VP8A 4DR1B 4BXLA 2KNCB 3AE7C 3ABKC 1YJ9P 2QWOB 2P5OA 2P7JA 1JR9A 1Y76A 1VQKP 4DR2O 3SJQC 4EB6B 1K4DC 2B87B 3QVNA 1BCCE 3M0AA 1VPCA 2DOSA 3ABLB 3O6QB 2LXBA 2IBZH 1YTZI 1GMGA 2UUCB 4NYKA 5CMUA 2Y69C 3Q4HB 2ZIOA 2H94A 1JEKA 5APSA 1VQPP 2Q67A 3CC7P 5LBQA 2IH3C 2ZCEA 1RF0A 5KAIZ 3BAAA 3JCUH 1LNQA 3IGAC 2CAZC 2KLUA 5KX5B 3JAWB 2KS1B 4CPGA 3ASNB 5LP6A 2P6JA 4UB6E 2Q73A 4DUYB 4K35A 1V54C 4X8AA 2KXPB 2WT7B 4LNUA 2YDEA 4FLVA 4R50A 1BGYJ 2QGNA 3H32B 2N1TB 2N9BA 1ENVA 1I5YA 3H1LE 2CTQA 1H8HG 1XILA 2WSFH 1VQ4P 1TUBA 2BASA 1COWG 1Y66A 2ILMA 5BY1A 3SFDC 4X66O 1IXBA 3L71H 2IBZD 3JD3A 1FAVA 5AVTB 3HPLC 2QDOA 1RQVA 3K9AA 3KDPB 4F6RB 1KECA 2YKQA 3D6ZA 4EB6A 1GAXA 5M1BA 4MT8A 2J59M 1VQNP 5IY5C 4DV4O 1BQZA 4WFEA 1S4XA 1BDDA 1JY2P 1GU4A 3QG5A 1KYOD 2KIKA 4D6TD 5B3SB 1L0LJ 3CI9A 2OTJP 4UV9A 5B1AB 2WA4A 4X20A 3RL0D 3CXHH 1RF0C 3K59A 5KKZB 2HPCB 5E79Z 5IDJA 2HYNA 2AZ2A 2FFDA 3KHUA 2JGDB 1KB9E 4PA7A 4Z2WA 4B3RO 1OX3A 1ZV8A 3S3XA 4O2AA 1LTIC 1KKCA 3R4YA 1NU1H 3L72G 4GKKB 1OCZC 1NU1J 2IZ1A 1Y6XA 3L75H 2FTKA 2QKSA 2OQQA 2YXYA 3G6EV 3FKSG 1LT1A 2XAGA 1KB9H 3R65A 1GO3F 1DF5A 1VEWA 3A8TA 3JATA 3RYCB 2IH1C 5KUMA 2Q68A 3K57A 4X65B 2QWNB 2FYNC 3VQXA 1XNRO 4CC6A 1NTKJ 1PGQA 2A06D 4RJTA 2ZT9C 1NTKE 3JALA 2IU0A 3OMAB 3CX5D 5H2FZ 5B5EZ 1E5WA 3X2QC 1SQBJ 3KXDA 4MSWC 2QWQB 3MIWA 4YTPC 1NTMG 2YSUB 1H2GA 2FYUD 2DMXA 1SQBE 2QKAA 3RGUA 3ABVC 2PTMA 1JFFB 3TGUE 4OGQD 2WVRA 1Z56A 1B6QA 2KG7A 2FKXA 3AECC 4JAVA 5KAFZ 4KXRA 4O4LA 2VQEB 1LTJC 1NKNA 1KMIZ 3MUDA 1GRJA 5B5EH 4ZNCA 3FB6C 1EM1A 3CJHB 3OTFA 5CCGC 4MN4C 3KQGA 1Q7YQ 3CCEV 2AXTH 2V7QJ 2FMLA 1GDTA 3CCSV 3HUSA 5AVSB 4L87A 4CS3A 5LMNO 5GTIE 2JRIA 1Y9BA 3MUDC 5KHKA 2Q3IA 1L0LE 3T4ZA 2MK3A 4LC1A 3LW5H 2AW9A 2AHYA 4P30A 5IYZA 5IYZB 2KB7P 5GTIH 2VWKA 4MW3A 3CWBG 3PJSK 5H2FH 2Q4PA 5TISZ 2EIJC 1R3IC 4YJ3B 3II6A 1URFA 3L35A 5AW7B 4PD4F 4UB6Z 2WWWA 1SQQH 4NXNB 3P3PA 5KHIA 4B08A 5J2UB 3H1JH 4LF8B 1SQPK 1US6A 2QR4A 4BR6A 1XMOO 5AVUB 4BIZA 3L74G 4HYTB 5JQGA 2DW3A 2P22C 2RH0A 4ZKPA 3VMAA 2AZ0A 1DIPA 3U10A 5LHIA 2OCHA 1EQ7A 3OT7A 1J2JB 1N0JA 4DUZB 5GONA 5J2UA 1ZRTD 1S5JA 2Q5ZA 3F7VC 4D7SA 3TNUA 2PP6A 4H44D 3CWBH 5C93A 1JB0J 3CCVP 1SQVK 3RGBA 1R8EA 3CCLV 3SJCC 5ITZA 1S5LZ 1N34O 5JQGB 4CZZA 3K0GA 4EDFA 1FXKA 4UCRA 4PA3A 3HKEB 3H1JJ 5BVZA 5TISE 1PNKA 1HJBA 4DV7O 3FAVA 2XNDH 4DW0A 3L75E 2W0FC 5FPRA 4WBNA 2W90A 3JD0A 1ZWIC 1L0LK 1VF6C 3A0HZ 4U3FE 3JSNA 1IFNA 1Y4MA 2RJZA 2A45I 3G6EP 1YITP 1KP2A 2HP8A 1PNLA 1QL2A 2QEXP 2FYUG 4J9YB 3ZHSA 1AB3A 3MHHC 1KFMA 3AE6C 5AVWB 1PD3A 2PI5A 2CTWA 2ZAEB 4J7ZA 4O2BA 1R3KC 2O01H 4DUYO 3J81N 1NR7A 4NB5A 1JY3O 1QU7A 1B06A 3K79A 4EI2A 2QJKC 2QSIA 3AG3C 2A06G 2W6IG 4J80A 2Q0OC 4K0KO 4FZ0A 5AW0B 4UCUA 5JWPA 1U97A 2ZE8A 2HPCA 3ZX6A 3RK2B 3CC7V 1JJ2U 1AROP 2KOGA 2YIAA 4FLWA 1QCEA 1XUQA 4CBCA 2R44A 3BCCJ 4DV0B 3IAYA 2P1JA 3SYOA 3USSA 3WU2E 3LDCA 3VOPA 2DYRC 1LTJA 3V4QA 1NH4A 2JWDA 4DV6O 1K97A 2LJ2A 1X4TA 4DR3O 3C9IA 3FGAD 3TXSA 3FXDA 3QWOC 3E83A 2YKPA 2IJJA 2Q6AA 1N36O 1RE3C 2W0XA 3K5OA 1XOUA 3CMEV 1VQ5V 4K8ZA 4LF9B 1YF2A 2XAQA 2K3RA 3GF7A 2WSEH 2X6CA 1JY2O 3ABMB 2EIKB 4X89A 1IBMB 4I6MC 2HLDG 2QA4V 4YJ2B 1CSBA 5H9CA 1Q3EA 3NFQA 3F5TA 4J41A 2OTJV 2OCCB 2YNYA 2EINB 5GTHZ 1KB9I 4LF4B 3L72J 3WG7C 1J1EB 1TU3F 2GTSA 2GTAA 1S5LX 4XDJA 2JDIG 1FZFA 1K4CC 5K1PA 2WLIA 2Y0EA 3H1IG 4I50B 3AG4B 1S9KD 3ZN1A 3CXHF 4F6EA 1KB9F 2EIKC 3SR2C 1K5QA 1NYHA 1Q5OA 1BSHA 3CMAP 1SQBK 1KYOI 1FXHA 3GB7C 2KI7B 3N2GA 3RL0C 4FPPA 1ZX3A 2P10A 3ASOC 2K9JB 4KHXA 3L9DA 5LYJA 2YI9A 1GN3A 1KD1W 1FFXB 3WB1A 3AG1B 4RKUJ 1R6TA 3CE2A 3AG7A 3PP5A 3CPWO 1JNMA 4B3MB 2XDJA 4IL6H 2P7TC 2A45G 2ZNJA 4X1KA 4N23A 1SQVE 1JQ0A 1JPXA 3OD4A 2Q7EA 3HKBB 5AW4B 2ZYGA 5KLVD 3CX5F 4MTXA 2RNBA 5EZYB 1PIXA 3EFGA 3L70J 5KAFH 4EIJA 1OIPA 1QX8A 1K73W 4ZKUA 3UT5B 4R8CA 2WLIB 3CCMV 3H01A 4DW1A 1SP4A 5CJ4A 4LF5O 3S3WA 3WG7B 1NTKG 4Z1VA 1JTHA 3H1HG 3ML0A 1YTFD 1H0TA 4CS4A 4LF8O 3KCYA 4W4LA 4DV5B 2PGDA 3P8MC 2GUVA 1F51A 5CCHA 4NXNO 5JJEB 1AQ5A 3B40A 2FBWC 1AR4A 1A02F 1NJIW 4PA6A 4U3FJ 1Q7YW 3OW2O 1NTZJ 2E43A 2W27A 4O4IA 3MD0A 2LR2A 2AHZA 1HR0O 3U0ZA 1JOCA 3L70H 3F89A 2K1AA 4U3JA 5DN6G 3LIDA 3ZIAG 1PP9J 1T3UA 2M3BA 3H1IH 3GW6A 5B5EE 2QKCA 1HNZB 2UU9O 3JD1A 4GX0A 1VQ8P 3OA7A 2K37A 3CRQA 1WN7A 3DC6A 1NVPD 4DV2O 4WY4B 2ZVNB 2Q7GA 2H43A 5F2VO 4IFMA 5HFLA 1K8AW 4JI4B 5IJ0B 3RL0g 1BHBA 1Q6IA 1FC2C 3E7KA 2WA3A 2UXDB 4BRYA 1Y74B 2YI8A 4OVNF 3H1KH 3SWFA 3ABTA 1KC8Q 3K5MA 5EBMC 4D6TG 3RN4A 3A7OA 3M06A 1F4NA 1JJOA 2GHYA 4GX5A 4L75A 5EFWB 5LP6B 1EZJA 1WP8A 3JATB 4H37A 1DF4A 1JX9A 4LFAO 4I9WA 4GKGA 1SC5B 3U59A 1QEXA 4IL6X 3WMM0 3CC4V 3JSLA 3NR7A 5LMUB 3C90A 2QJYC 3H1JD 1W59A 2RCVA 3OTOB 3L37A 1U96A 5H2FE 1EDKA 1XMOB 1DD4A 3ABUA 4AHCA 4BAYA 4ASWA 1VQ9P 4R6ZA 1NAYA 4ZBMA 3CS5A 4RUEA 3ZHUA 3T4DA 5L3GA 1VQMV 1ZSPA 2P67A 4K3AA 3CHXA 2YMYA 4HNAA 4Y99B 3CD6V 1MV8A 3KZIH 1MNGA 2DE0X 4C46A 4DK1A 3CX5E 2JGDA 4I4TA 3HE5A 3M9QA 1T2KC 3ZRXA 1EN4A 3RW0A 3BHPA 1PP9G 2HR3A 1SQXJ 1FBMA 2DJVA 3TYYA 3RYIB 1FJPA 3HTKB 5LA6B 4NPFX 2Z4EA 1W0KG 1N4CA 1I94B 1JCDA 1SQVG 3B71A 5E79E 3BATA 2M6YA 4ZOLA 3OGIB 1S72P 1GL2A 3K03A 1PPJE 1CZQA 3B5NA 3V6IA 4YXWH 3B8EB 1L0NJ 3VBBA 4QNHB 4DV3O 5LGUA 1VQLV 3O9OA 1M8OB 3IFXA 2HFED 5GONB 1HH0A 1KORA 3I5DA 1SQXG 3UO3A 2LGWA 3E1RA 3V4WA 1K33A 3KZIZ 1BE3J 2YEVB 3SDLA 1IJDB 1JMMA 2QJPB 2UWJE 1N32B 5BR8O 1KILC 3L74J 4MTGA 4FLXA 2MW2B 1N8RW 1X9VA 2ZKOA 2IPPA 2Y48A 2M5AB 1LGHB 1ZAUA 1RHZB 1LUVA 5APYA 1NBMG 1VQ8V 3IC9A 5KLIC 4ZI7A 4YXDC 1SQVJ 2B9BA 1QVGU 2ZQMA 3WUVA 3B5NC 1WB7A 2BTQB 1JOYA 1N7SB 2OGUA 1M5IA 2HLOA 2M8RA 2YIBA 4KFMA 3L71D 5L3DA 5LMUO 3CXHE 3FWNA 3K5BA 1NH2D 1RP3B 1NTZK 5CCHD 2YO3A 2YIDA 1N86A 3Q3DA 4O4LB 2Z5IA 1FE6A 3H1JG 4IL6E 2NPSD 3H1LD 4O4IB 1J5EB 2RDCA 2E75C 3CRAA 2E3CA 3W7WA 4X1IB 1Q2NA 2JEUA 5A9GA 1JMKC 2ZVOB 1FZCC 5KJ7C 4TOIA 1HNWO 1EDLA 1L8DA 2RMKB 3ZRWA 3LUTB 1FJGB 2YXQB 5C39A 2N04A 1ZLLA 3QH9A 5CHXA 3CXHD 1M56C 5IY5B 3CCEP 1KB9D 3CRMA 4EOTA 2Z5HA 1YHQV 5AVQB 3P3NA 3HE4B 3L73G 1URQD 3ZRVA 4O4JA 5KKZC 2OTKE 3G71P 1E79G 1Q81W 3MHSC 4GLXA 1SA0A 4TUYA 1S5HC 5CCHC 5DJUB 1PPJH 1NHLA 2CUGA 3BFRA 2HKOA 3MDSA 5IYBO 2Y0PA 2D2CC 1GD2E 4IIJA 2UXDO 1GW4A 4X1KB 2Y9YA 2N1TC 3CC2P 4X88A 2F4VO 2XAHA 2RN0A 1L0LG 3JCUE 5AVZB 2E42A 1NTZH 2RQ6A 1U7JA 1BGYE 4LNUB 3RK2D 1X0TA 1YIJP 1IXMA 2F93B 4TUYB 5IJ9A 1Y8AA 2JJLA 2WMMA 2WSSH 2DYRB 1BL8A 4NTYA 3MGNA 1Q6UA 2D3OW 4QIWF 3LDEA 1GK6A 1LWUC 2AXCA 2R3SA 4XA4A 4EYYQ 2ZFCA 4U7JA 1PPJD 1K73Q 5B3SC 2H8PD 1PP9D 2R9IA 5H6QA 3MZWB 5FNVB 4ZOLB 4DV1B 4G2KA 5FNVA 1SRYA 1BZKA 4RQEA 2CTRA 3AK3A 1UIXA 2QJPC 1VQLP 3VN0A 4Q6GA 3OR6C 4N21A 1PKXA 3I55P 1RE3A 3L75G 3RBZA 2HJFC 2IFNA 1QLEC 4JYYA 1OZHA 1NJIQ 4X9QA 1BDCA 4TLFA 2HHHO 2VWJA 3JAKA 1QVFO 1G1JA 1GTWA 1YJNV 4E4EA 2GUZB 2BCCJ 4JV5O 3BVHA 4I0XB 3ZS8C 4HNAB 1NKZB 1RFYA 4ASUG 1PGOA 4X64O 3SWYA 3FX7A 1M4UA 1HVVA 4RO0A 5AW6B 2E5YA 1FDOA 2EILC 4QE9A 2XHBA 4H0LB 2O1KA 2EJ7A 1LP1B 2WLJA 1ZR2A 2KLVA 1K8AQ 3FYEB 4DR3B 1SFCB 2DWEC 1N7SA 1SF9A 2H88C 1W2BU 2LKMA 4LH6A 5EBLC 4QGPA 3L73D 1SERA 3L71J 3JAMN 2KZJA 5KHHA 1DEEG 2ZYAA 2FFDB 3L71G 4KUMA 2C0XA 3AE9C 4PHZA 3E2EA 3RFRA 3H1ID 2BCCH 1ZOYC 1NTZE 1PM9A 1NVPB 3B2EE 2W6JG 1I5XA 4DR7O 1MA1A 1BHAA 1H38A 2GM4A 2G3AA 1OCZB 1RQUA 3E22B 1T2KD 1NWQA 1F23A 5AW1B 2IU3A 4CH6A 5KAIH 1Q82Q 3QTCA 2WITA 3RK3D 2F95B 3ASOB 1Q86Q 1AILA 2BSKB 1IBKO 1WT6A 4YJ3A 1VQ5P 4GDOA 4I2LC 1SQPD 3ZHVA 4LR3A 3SPCA 2QEXV 2BOBC 5JH7B 4JYCA 3ABMC 1IBKB 2BTQA 2E76D 1Y76B 4NXMB 1PGJA 3ZHQA 2NNUA 4X62B 4IGGA 4IFDK 4JV5B 3ZMTA 1N7SC 1TA8A 1VL2A 5CA3A 2HHHB 1EZVE 3QO8A 2E5LO 1SQPH 3GVMA 2EIJB 2N1TD 1JY3P 4TV9B 3KKYA 1SQQK 2FXOA 1PPJG 3ETDA 2OYIB 2K9JA 1G2CA 2HJDA 2GA1A 2E76C 4O4JB 2MJZA 4W7YA 4D7TA 2DW4A 1P84F 5AVRB 1G8MA 2QM7A 1M90Q 5IT9N 2JJ2G 2KNCA 3VP9A 4PA9A 1EZVG 1V9PA 2ZXWB 2FY8A 1YVWA 4IIJB 4FM2A 3ETQA 4OX9O 4KT0J 1BCCH 1N8RQ 1AP5A 1OVRA 4JI2B 4JYBA 1SFCD 5KJ7D 3OMIB 4FFKA 4I9QA 3C3SA 1UJWB 1BE3G 5CCGD 4Z1MG 1QLED 3H32A 4R4MA 2ETNA 4H0LD 1UIIA 1GU5A 1WNSA 1LR1A 1LJ2A 3E1IA 3O6QA 4JI7O 1EFRG 2YMKA 3K3WA 2WSCH 1SESA 4IOIH 2Z0AA 4YJ2A 4ZKIA 4DR6O 3T2MA 1NS1A 1QVFU 1OZ0A 3HTKA 1AJYA 5AVXB 4NR1A 1L4AC 1DX7A 1XNQB 3OAAG 2D2CD 4O2BB 3W67A 3H1LH 3WFVA 2JO1A 1SQBH 4LF4O 4B7KA 5IE9A 1N7LA 1BGYG 2VRZA 1QR8A 2EILB 3UIAA 1TUBB 1CPYA 3CCJP 2CK3G 2WSEJ 3F5WC 1M1JB 2XTAA 1YJWV 1NO4A 1NTMD 3HUSC 2DYSB 1GZLA 3TGUD 3BA9A 1SQBG 4I7ZB 2QJYB 5JCOA 2NR5A 3Q5PA 4YIPA 2H89C 3BCCE 1OVUA 2C9NY 4H44C 1P84H 2F23A 5APVA 2HVKC 5KAFE 2BCCG 4C7NB 3G67A 5CB4A 2Y0DA 2I1JA 2Q9IA 1JA8A 5LHHA 4UVBA 1HF9A 1PV3A 3UM7A 5LMNB 3AE5C 2EIMC 1YJ9V 3VMYA 2ZINA 4BWNA 1FZCA 5DEDA 3E8GA 1FZCB 2YIUC 4MS2A 3AEFC 3A2FA 1BE3H 2QWRB 4L8JA 2WLKA 1KILB 2YIBD 2YEVA 1OFCX 3FXEA 1GKFA 4W4KA 4DV7B 2N74A 1OV9A 2JJ1G 4Q20A 4U7OA 3W7UA 4BRYB 2C9LY 3W7XA 4IFFA 3OAKA 5DJTB 1CI6B 3ABLC 5B1NA 3CC4P 3DC5A 4EFBA 1IFMA 2YKOA 3AE3C 1GM7A 3L36A 3KG2A 2O3JA 1R73A 3I56V 1VARA 3L74D 1MSDA 5BMVB 3RK3B 4J42A 1FZAA 3A0BE 2CDYA 2WPRA 2JS5A 3CWBE 3GHGB 1BE3D 1V54B 4ABMA 1KUQA 3TDKA 4D6TE 3FX0A 4XBFA 1IFIA 4JPRA 1IURA 2IYOA 1HNXB 3DSQA 1YI2P 2BSKA 2EBOA 2XT9A 2EZOA 4FZ1A 4BIUA 4DOJA 1USDA 2NPSB 2XKMA 2YXLA 1S77D 1MFTA 2XZRA 3B4SA 2CGNA 2UXBO 1OW6A 2FYUJ 3CCUP 5EIBC 2OTLP 2Q7HA 3AEAC 1FOSF 1DTOA 4YHHO 5KLIB 2KKWA 1L0NK 2KG7B 1N32O 3R66A 1RH5B 3H1KG 2B89A 1NT2B 3HRNA 3STLC 4W7ZA 3H1KJ 2Q0AA 2Q6QA 1KQLA 5KJ7A 1I0HA 5JVDB 1VP7A 1MSWD 1AFOA 2P58A 5L3BA 1CI6A 2DQ0A 2E75B 1HWYA 2G38A 2O01N 5DECA 2E5TA 3ZMZA 1SVFA 2BTOA 1XREA 5DM6V 1WJZA 1L0LH 2P90A 1SQFA 4CC5A 4GODA 2V7QH 3FYIB 2QWPB 3VOUA 1GM9A 3S9OA 2Y0IA 3TSIA 2AXTE 1AI6A 4WFGA 4DV4B 4O2AB 4XDLA 4FM0A 1IZNB 2BCCD 2IZ0A 5AW3B 1DEBA 1XNQO 5AW9B 2PAJA 4MVRA 3BABA 1K34A 3E86A 3RVZA 3BCCD 2WLHA 1SA0B 4JZGA 4XFJA 2WLLA 1HNWB 3GWKC 2A3QA 4FJCC 5CA0A 2YICA 4OWFA 1LTSC 5CBHA 4PELA 1L1FA 4HYOA 1AVMA 2HFEC 3AG2B 1B3QA 2KSEA 2ZR3A 1L0LD 1SQQE 4FM1A 1FDMA 2B87A 3AEIA 4GIFA 1IVSA 1FXKB 5B1OA 4WY4D 4B3RB 1H2KA 1P49A 1PL4A 3LNMB 3H25A 5B1BC 1EBOA 1L0NE 2P4VA 2FXMA 3SSUA 1VQOP 3U1CA 1ZP0C 3LDDA 4OH8B 2CPSA 1SLQA 2C0WA 1P4RA 3CCQV 1LT9B 1HNXO 2HODB 2JP3A 1RF1B 3TETA 1HGVA 3N2KB 1L0NH 4UCVA 2UXCO 1AI4A 3JARA 2ZNIA 5BR8B 1VQPV 5GW7A 1YBKA 1SZTA 2QE7H 1G2CB 1H88A 2YO2A 3U1AA 2UXBB 1NVOA 2OYOA 3RYFB 2NLJC 1SZXA 4WBNB 2R5DA 3TJTA 4WY4C 4UVCA 4JAUA 4P9OA 5EYPA 1L4AB 1MZFA 1OWAA 3Q2YA 1IK7A 2LFRA 2ZM6O 1K05A 4UUJC 3C8VA 4N3YB 2RMZA 3K08A 2AXTZ 4LWSA 1X59A 2LW1A 3N2KA 4GOFA 1M93A 4I0XA 3FWLA 3H1LG 1FU1A 1NGMB 3BEHA 3WUTA 3FD9A 3IAOA 3SPIA 4J7JA 1OW7A 2ATKC 3NMDA 2H3OA 5LOVB 1M90W 3OUFA 3WB0A 3DXRA 3B8MA 2E5LB 4FLTA 4C7NA 2W8ZA 3N4XA 1BSNA 4X20B 2ITCC 5KLVJ 1KQSO 1IX9A 1FKAO 3SFEC 1P84I 5JH7A 1MKMA 1YIJV 1H2MA 4PD4E 4JF7A 4MVSA 1SS3A 4GX1A 2XUMA 4TT3H 1MZEA 5B1BB 3G9RA 1M56B 3CCMP 4G27B 1CXZB 2E76B 1AR1B 2V4DA 1MG1A 4J9ZB 1VDFA 1KILD 3BCCG 3NXSA 1Q6HA 2ZD9A 2O57A 1OVVA 4LFBB 4KJMA 1RF1C 5TJHA 2F4VB 5D5QA 3JAKB 1Y47A 2JVDA 1AJQA 4YIOA 1RY3A 2D2CB 3CCLP 1AQTA 5BU5A 3AE1C 3E89A 1QVGO 3QF7A 5KLVG 1IBMO 1YHQP 3RYHA 1KILA 4ASVA 2ZE5A 1AVOA 2FFDC 2N1TA 3TCUA 1KQGB 1TVKB 2AEJA 2H8PC 3CX5I 3OEHG 4DR2B 1RM1B 1SQXK 3H1HD 4LF6O 4PV1C 2KUBA 1UFIA 2E74D 3GF3A 4CH4A 1SQPG 3AG2C 2ZDIC 2VQFO 4B3TB 5KMGB 3BASA 3A5TA 4FMTA 1LP1A 2Q1KA 4U3FH 2OYIC 4DYLA 3T97A 5IYCO 2P06A 1OCOB 4ZHQA 1FZEA 5CMZA 3VQVA 3H1IE 3L73J 1G6UA 2YC0A 3ZCCA 2IJKA 4TV9A 2IJIA 4LF9O 1PZQA 4GYCB 5CB4B 3ETGA 5K5GB 4U3FG 1HUCA 2AGAA 1CP9A 1VQ6P 1N33O 4JI6O 1VF5C 3V2NA 2UU9B 4TV8B 4B3TO 2J58A 1GK4A 1BCCG 2CH7A 2G8YA 3ZRWB 1PL0A 3HKDB 3W7TA 3E8FA 4O4HA 4JI8B 1SKVA 3RBXA 1M57D 4JI3B 2UUBB 1USEA 3SPHA 4MW8A 1CEZA 2R70A 2PGGA 3GHGC 3I55V 3QO7A 1QHTA 3G80A 1M9NA 3CJHA 3L72E 2B9ZA 1HWTC 2WSCJ 1K5SA 3K9SA 3ZDMA 2W83C 1JFFA 4LFCO 1X8YA 1F7YA 2XNXA 1XEQA 4LF5B 1DK1A 2GUZA 3UT5A 1J95A 2HG5D 4TQDA 4TT3G 4N78E 1A32A 4W80A 3WB2A 1B04A 3P32A 2AEMA 2CPBA 2RKLA 2LW7A 1N36B 1KZUB 2GV9A 2VRSA 1XHXA 2WTYA 3B77A 1XTCC 3ABKB 3L74H 3HB3B 1SETA 3UO2A 4QPKA 4I55A 3DGEA 1EN5A 2WPQA 3M7MX 2JK5C 5EZYA 3JAWA 5APXA 4LF6B 4G28B 5LGNA 3HR0A 5AG2A 2YUAA 4PJ0H 3SWKA 2VS0A 1FPOA 4UXNA 1WP7A 2ZJSE 4N6JA 3JARB 4EKWA 1OCCB 4X1IA 3G4SV 1BGYD 3ICXA 3LIEA 3UCSC 1W0JG 5IJ9B 3CPWU 1YQ4C 1Z5WA 4LP8A 4DR5O 3A0BZ 3H1KE 2JS3A 1ZTEA 4DCKA 4DR4O 4I55B 5KX5A 2KS1A 3TGUG 1M1JC 4LH7A 1KQFB 3L70E 1DGSA 2B1GA 1ZN5A 1YITV 4PDMA 3CCRV 4WB4A 2QE7G 2ZXXA 4DRXB 1KN7A 5FPOA 3IC7A 1DD3A 4DV1O 4QJFB 3JASA 4DR7B 2N9YB 2FKWB 5IWAO 5LXTB 4UV8A 4PDRA 4U7NA 4JPZB 2WSSG 1HJ0A 4JZ2A 4JI0O 4LF7O 5H5NA 4AILC 3RYIA 5BXZA 1RPRA 1QQCA 2QVAA 4WFFA 2PF4E 4WVZA 4HJGH 1WPXA 2YXRB 3CYOA 1HBWA 3H9VA 1AI5A 1SQGA 3W7SA 3K5LA 2ITDC 1AVYA 3P7KA 3TF5A 2ZXWC 2R32A 4C7UA 2KSDA 1QR9A 1PV0A 1R6NA 2N05A 5JVDA 2XU6A 5EC1C 3E8HA 5LHGA 3AG3B 4MVZA 3MP7B 3L71E 5GTHE 5KHJA 5CN0A 1ZUQA 5EYPB 1L4AA 2Z5UA 4FIPC 4YY3B 2L35A 3A3YB 3TXQA 1KC8W 1R3JC 1AI7A 4FK5C 3B5ND 3ZMSA 1E79H 3P8CE 3T1YO 4BW5A 1N73C 3RYHB 3ZRSA 1J5EO 1L2PA 1A02J 3N27A 3Q5SA 1QGKB 5J9PC 2XOKG 4MTOA 4AI8A 4AQYB 1HTLC 1L4AD 3DXRB 3K04A 2PZSA 3M0DC 5KLVK 2F43G 2EJRA 1IBLO 1LTGC 4H33A 1OCRB 4OXSA 2V7QG 3CD6P 3M91A 1VF5B 2QSAA 3RYCA 5LA6A 1FDIA 5E79H 1NTKH 2K9PA 2V1DA 3OJAB 4MVOA 1ZMEC 4R4LA 2M7WA 1QNMA 4IHJA 2ZXEB 1XDCA 4WWIA 2ARHA 4GKKO 4P2ZA 2PI4A 1OHHG 3ZMVA 5AVYB 1IZ3A 1BT8A 4B3SB 3RVYA 1FS0G 2FYNB 4WFHA 1O9GA 4I50A 3TK1A 4JTAB 2X6AA 4RUFA 2IM9A 3J80N 2Y9ZA 1H8EG 4JTCB 1SQBD 1WA8B 3AEEC 1NR1A 2FYUE 5EK0A 2WLLB 3BRVB 1VQ7P 1ZL8A 2HG5C 5CA1A 1LT9A 2BCCE 1BSMA 1VF7A 3GHGA 1NTKD 2Q5UA 2DQ3A 3TGUH 4JI5O 3AEBC 2V4HA 5LL6Y 1G4YB 1MMMA 1SFCC 3G4SP 4JTDB 1Q8IA 1YTFB 3L70G 3G71V 2A06E 1P84D 3CL3D 3O8ZA 1AJPA 2GUSA 4H0LC 5J2TA 1JCCA 5AVVB 1YZBA 2L6LA 1D2DA 4ZIBA 1NU1D 4L73A 3S4RA 2VQEO 3J7AU 2W6AA 1XQ8A 3JCUZ 3CWBJ 1K9MQ 1S0VA 4LFAB 3H1JE 4PV1B 3SGIA 4JI5B 4FVMA 3QNEA 3H1HH 4LBEC 2PFXA 3CCUV 4NTXA 5AW8B 2HVJC 4UCSA 1S2EA 1J1DB 1UPGA 4EEQA 1GMJA 1M57C 3EVKA 4BWAA 1PP9H 3LNNA 4YY3O 4Y99C 4F4LA 2A9HA 1HR0B 1SQQJ 1S72V 3AE8C 1GM8A 4XE5B 4JGSA 3L74E 1ZR4A 4QPJA 1AV1A 1JUNA 1N73A 1GL2C 2OWOA 1K7DA 2ZR2A 5B66H 2XAFA 3FB5C 3WUUA 2F1MA 1QLEB 2HEPA 3OEEG 4JYAB 1WB8A 1WPBA 5KHGA 1VQ9V 2IBZE 3JSVC 3SJAC 2IYPA 2QJKB 4GX2A 1AP6A 4B3SO 1VF5D 3GLMA 1VQ4V 2O1JA 1PFIA 4AYCA 2WPDG 3HKEA 3VTPC 1KU9A 4PDVA 2H7HA 4NVPA 4X62O 2F66C 3CRCA 2DYSC 2M3EA 2RN9A 1M56D 3M99B 3SPJA 2BEQD 5KA5A 3BPZA 4ZMDA 1IFPA 1QLNA 3K06A 1GTOA 1ZLZA 1K3EA 2QA4P 2KZIA 3ETEA 4JI6B 3STZC 1GL2D 1WAZA 1JY2N 4DR5B 1Q81Q 4JAAA 1R3LC 3JD4A 2QIWA 3EFFK 1RE4C 5APTA 1MFZA 4HKZH 3T97B 5TISH 1M1KW 2ADPA 2KSJA 1PNMA 4J7KA 2M0BA 3CCQP 1YXBA 4JBZA 2B1IA 2PYLA 3CXHI 4JI4O 2OIEA 3L70D 5LOVA 2JR8A 1YSCA 3LW5J 3CP1A 4DV2B 2YIUB 1AJNA 4NTWA 2XV5A 4MVQA 4JI0B 4LF7B 5KLVE 2R3CA 1SQVD 3OUSA 1KYOE 5KMGA 4IYIA 2FB5A 2K9YA 3HKCA 2E74B 5A2QN 2ADQB 2ZT9D 4WF9V 4JI1O 3CLQA 2R9RB 1BQ0A 4JI2O 3V2QA 5GTHH 1KBHA 5AW2B 2W6JH 3L72H 4BW9A 3ZMUA 1R5LA 2UUAB 4I7ZC 3D71A 2PYJA 3CCRP 4UFZA 1K04A 3M8AA 1GN6A 3BCCH 4XDKA 1T3JA 4TWKA 1D5AA 1NAFA 4HH2A 2CE4A 4DV5O 3T1HB 1GK9A 1HP8A 3C1LA 5B66E 4RWUA 2DWDC 4DK0A 5BMVA 3AE4C 4HBNA 3R2PA 4RAIA 2ZE7A 1E1QG 4OGQB 3SYQA 1P7BA 3PHLA 4DR4B 2A45H 3KCXA 3PLNA 1VQOV 4X1YB 4DR1O 1RE4A 2FYZA 1N34B 5AW5B 2A0LA 4TV8A 5CBGA 2ZE6A 2ZIMA 5APUA 1BCCD 2VQFB 3F5HA 5KAIE 2R5BA 2QM4A 1H2NA 1KD1Q 2OYHB 3GWOA 1FFTB 2PY5A 2A7WA 3ZEDA 3HD7A 3U11A 2NRGA 5FL7G 4LFCB 2YXHA 1KFNA 2CK3H 1ZW0A 3CMAV 2ODMA 4QE7A 1BMFG 2FYUK 1FAFA 5JJNB 3RT3C 3BRTB 2X6BA 3FB7C 3B8NA 3D3QA 3OGCC 1XL6A 1SS1A 1DH3A 1L0NG 1GL2B 2OYHA 2FL4A 1P7GA 1YTZT 1TVKA 1KYOH 2OTLV 3A0HE 2A79B 4YXWG 3OMNB 3CSXA 4JI8O 3SYAA 1IK9A 2Y4UA 2Q69A 4PJ0Z 2Z3YA 1NTMH 1Q82W 1FS0E 2ZYDA 3IFMA 1OJHA 3SPGA 3T1CA 4DXWA 3RK3C 1SQPE 4Z1MH 4WFAV 5D5PA 1LTAC 3H1HE 2X7RB 5CA1B 5CBOA 1VQ7V 5BZBA 5H6RA 1RSOA 1EZVH 4L76A 1SQQG 1ROPA 3FAVB 1XTGB 3NTNA 4NXMO 2POHA 3M9HA 4UCTA 2KQXA 2IJHA 1H0TB 1OMIA 1CW5A 1I7FA 3OR7C 2O01J 3T1HO 5KA6A 3D36C 2LP7A 2GDSA 3JYCA 4DUZO 1Y67A 2IX7C 2JWAA 1VQMP 1H2LA 2BEZF 1LTBC 3I5CA 5CBFA 2Y0CA 2LGQA 2KP8A 2NZ2A 2WT7A 1N2DC 2OT5A 4U3FD 4GKJO 3L75D 3CMEP 4UB8H 3JALB 5LP6C 2E75D 1M7LA 4O9BA 1R5SA 5C8YA 2UXCB 3K58A 3CC2V 1G1XB 1FXKC 3IN6A 4DT0A 1NTMK 3JC22 1PGPA 1BS3A 4JYAO 2SPZA 1K9MW 2A06H 2HODA 4PI0A 3DTUB 2P2UA 5GTIZ 5KTBA 3M9BA 4FLUA 1ZRTE 5JCOC 3UKMA 1IDSA 1QBZA 1JM0A 1OCCC 1Y74A 3ZJZA 5IYDO 5B66Z 1P84E 1YDXA 1VQ6V 2JEXA 3JASB 2FYUH 3SYCA 4KHPB 3A0HH 4X1YA 1FZBA 3EHBB 2LQTA 1SQXE 3IF4A 4B86A 1OCRC 4TQFA 5BU8B 2WZ7A 5CJ0A 2XAJA 1FZGA 4C7RA 3MHVA 3D8CA 3L75J 3V2PA 4H13D 3AEDC 1T5EA 1IBLB 4UB8Z 1W5CE 4O4HB 2I8DA 3HE4A 5KLVH 2XNDG 3OFNG 1MABG 3D6YA 3KYQA 1N73B 4AUWA 1TAEA 3L73H 3D36A 4HB1A 4KP4A 1MZ9A 1VMGA 4B7EA 4K8XA 3AE2C 3A2AA 1Q90D 4MVUA 2L5GB 1S5LH 2YS8A 1Q43A 1I94O 1GN4A 1H8AA 2R9AA 1WLEA 2IBZG 1KQSU 4UVAA 2L91A 1J1DC 4PD4I 5LGTA 2Y69B 4DV0O 1T6AA 1DLBA 3ZHTA 4KL1A 3O65A 4ZHQB 2PUSA 4DV3B 3WU2H 3B09A 1VQKV 2KK7A 1SQQD 1EDIA 5HFMA 1D7MA 1MUUA 1H89A 4JI1B 4GCZA 3V2RA 1XMQO 1OCOC 1XL4A 3F7YC 1S76D 1D5NA 3Q4HA 1BE3E 3IR9A 1N0NA 2WLMA 3CWBD 2EX3A 1LWUB 3ZHRA 1YEWA 3HD7D 4A7PA 1M1KQ 3VQYA 1KP3A 2CH7B 4WCEV 3APOA 4MTFA 5EIBD 1URQA 2B5UA 2ITAA 2W6BA 5FLXN 1J1EC 1X22A 1JVMA 4MVMA 3AEGC 4JASA 3B5NB 4LLHA 2OCCC 3BRCA 3LSQA 1XBLA 3CCSP 1IC2A 1GH6A 5EC2C 2JGUA 3PN1A 1LTJB 1KV4A 1Z5VA 3HD7B 2NPSC 2QTSA 4FFBB 1JO5A 3EXAA 2QJ1A 1BGYH 2K1EA 4ICGA 4M3LA 1XI1A 3P30A 1SFCA 5CA0B 3RWRD 2UXNA 1AA0A 3ZBHA 3GG2A 2JDIH 3HD7C 3AG1C 2OIGA 3H1LJ 2QRXA 1EXIA 4I4TB 1O9HA 3APQA 1EC5A 1U57A 1SQVH 3AK1A 4DRXA 2MKVA 1V55B 3G3ZA 1IO4A 1JTHB 3RL0B 2WSFJ 1XNRB 2NN4A 1NZ6A 2EINC 4X66B 2IW5A 2CGOA 3CXCU 2OYIA 4UCOA 1HDJA 5LXTA 2EULA 5L8RJ 2OYQA 4WFBV 3N7NA 1NTZG 3HKDA 2E74C 1NQTA 3HKBA 3L4FA 1G1IA 1NTME 1S5LE 3T1YB 4DZOA 1RSOB 3EQ2A 5KUKA 4CH5A 4OPAA 1XHZA 1YYCA 1TUEB 2LO1A 3K5NA 4I1LA 4OX9B 4X65O 4QMAA 1S1CX 1FOSE 1V55C 4ZI7B 3TNUB 2PRRA 2WPVB 2FXPA 2R72A 3ITKA 3D3IA 2C2AA 1IFJA 4L74A 3E35A 5ITZB 2IFMA 3Q5RA 1XMQB 4H44B 1NU1G 1T8ZA 2JIZG 2B88A 3TGUJ 1RF1A 4F6RA 4CH3A 3S1KA 4GZRB 1FJKA 4YHHB 1NU1E 4PA4A 5IJ0A 1ZXGA 1ORQC 1Z2GA 1FD9A 4R7CA 2IDBA 5J2TB 1MOFA 3RYFA 3A0BH 3D70A 1RM1C 2NPSA 3KPEA 3QO5A 1VF6A 2UUCO 1LUWA 4D6TH 4DR6B 3PTZA 5E1AC 1X79B 1KYOF 1VIBA 1VQNV 1SQXD 1M57B 1JY3N 3THOA 3A0RA 5L3FA 4LCUC 3JD2A 4LGDE 4YPCA 2LFSA 3PRJA 2WPSA 2OARA 2JKVA 4GKJB 2AEFA 4IT5A 4JI3O 1NH2B 2UUBO 2QTOA 4IYHA 1OXZA 4DO2A 3OE7G 4P9PA 2K88A 4GT1A 3HUSB 1HNZO 3BY6A 3ASNC 4AQRD 4JI7B 1FXVA 2Q7CA 4J10A 5IWAB 1YJWP 1THZA 1EZVD 3VQWA 2J5UA 3CEIA 5JJJB 1SQXH 4WBAA 1FFXA 1GN2A 4RO2A 1NTMJ 3WU2Z 3HE5B 1YI2V 4JF3A 3KZIE 1KTMA 5K1XA 4KHPO 2XASA 1LWUA 3CX5H 3MAQA 1NU1K 4GOEA 4GUNA 3HKCB 3BA8A 4LWSB 3G6BA
chains in the Genus database with same CATH topology
3QNEA 5EBWC 2P7TC 5LHHA 4UVBA 4LBEC 1NKDA 3CCUV 4N23A 1JQ0A 1JPXA 3UM7A 2HVJC 2EIMC 1YJ9V 4MTXA 1M57C 3E8GA 4MS2A 1K73W 4RQFA 4R8CA 2WLIB 4F4LA 3CCMV 2WLKA 3H01A 3E8BA 3WG7B 2A9HA 2QM8A 2ZDIA 2YEVA 1GKFA 1S72V 3ML0A 4Q20A 2JJ1G 3W7UA 4U7OA 1YTFD 2X0LA 3W7XA 1GM8A 3CCVV 4JGSA 1Q86W 1F51A 4QPJA 3ABLC 5B1NA 1F4MA 2BOCC 1K7DA 2ZR2A 2EZPA 1GM7A 2XAFA 3FB5C 3AG4C 1QLEB 1JCHA 3KG2A 4PA6A 3OEEG 5L3EA 1R73A 4HZ3A 3I56V 1VQ9V 2UXXA 1Q7YW 2WAMA 4GX2A 3MD0A 4E2LA 3FB8C 2AHZA 2WLNA 1VQ4V 1V54B 4DJGA 2WPDG 4XBFA 4I5SA 5DN6G 4PDVA 4JPRA 3ZIAG 2EBOA 3JD1A 2EZOA 4GX0A 4BIUA 3LSSA 2DYSC 1NVPD 3M99B 3SPJA 1S77D 5KA5A 1IFPA 1R6KA 5HFLA 3K06A 1GTOA 1K8AW 1QLNA 1K3EA 1DTOA 3ETEA 3STZC 2GSMB 3OM3B 1BHBA 1R3LC 3JD4A 3EFFK 3K0DA 1M1KW 1S3JA 3STLC 3ABTA 1PNMA 5EBMC 1MSWD 2B1IA 4PDLA 5L3BA 1F4NA 2DQ0A 1HWYA 1YSCA 2GHYA 4GX5A 2E5TA 3ZMZA 3CP1A 5DM6V 1EZJA 3ZN0A 2KB1A 1AJNA 1DF4A 3JCZA 4H37A 4MVQA 1JX9A 2P90A 4I9WA 2V7QH 3FYIB 3OUSA 4HAMA 1GM9A 3VOUA 5B1AC 3CC4V 3CCJV 1E1RG 1AI6A 4WFGA 4WF9V 4XDLA 3ABUA 2R9RB 1KKDA 4BAYA 4MVRA 4R6ZA 1K34A 3E86A 3RVZA 2WLHA 4RUEA 4TSFG 4ZBMA 3T4DA 3X2QB 2EIMB 5L3GA 1VQMV 2W6JH 3ZMUA 2WLLA 2P67A 4FJCC 1RPOA 3CD6V 1K92A 5CBHA 4PELA 1L1FA 4HYOA 4XDKA 2HFEC 4TWKA 5L3CA 3OW2U 3AG2B 3SYPA 2ZR3A 1GK9A 3AEIA 1FXKB 5B1OA 3ZRXA 2DWDC 3ABKC 3RW0A 3LNMB 4RAIA 2HR3A 5B1BC 1E1QG 3SYQA 1EBOA 1P7BA 3SJQC 1K4DC 1W0KG 3LDDA 1VQOV 1P4RA 3CCQV 3K03A 2A0LA 3ABLB 4YXWH 5CBGA 1GMGA 3VBBA 4QNHB 5CMUA 2Y69C 3TETA 1JEKA 2H94A 1AI4A 5LGUA 2Q67A 5LBQA 1VQLV 2IH3C 1VQPV 5GW7A 1SZTA 2QE7H 1LNQA 3IFXA 3IGAC 3GWOA 1FFTB 2NLJC 3ASNB 2P6JA 4UVCA 1V54C 4X8AA 4JAUA 4P9OA 5FL7G 1K33A 4R50A 2CK3H 3CMAV 4QE7A 1BMFG 1ENVA 2LFRA 2YEVB 4UUJC 1I5YA 3K08A 1H8HG 2X6BA 4MTGA 3FB7C 3B8NA 1N8RW 1COWG 3BEHA 3OGCC 1Y66A 1XL6A 2Y48A 3SPIA 2ATKC 1M90W 1NBMG 1VQ8V 3JD3A 3OUFA 2OTLV 3HPLC 1QVGU 3B8MA 3K9AA 2A79B 1KECA 4YXWG 3OMNB 2ZQMA 3SYAA 4MT8A 1JOYA 5IY5C 1BSNA 2Q69A 4WFEA 4KFMA 2Z3YA 2ITCC 1Q82W 5L3DA 1FS0E 1NH2D 1YIJV 4MVSA 3SPGA 3T1CA 4DXWA 4GX1A 4WFAV 5B3SB 5B1BB 2X7RB 1M56B 4UV9A 5B1AB 4G27B 3W7WA 1AR1B 2JEUA 4J9ZB 1MG1A 5BZBA 1VQ7V 5H6RA 3NXSA 2ZD9A 1ROPA 5IDJA 3ZRWA 3LUTB 1M56C 4PA7A 1AJQA 5IY5B 1AQTA 2IJHA 3E89A 3OR7C 1YHQV 1OCZC 5KA6A 2LP7A 3ZRVA 2FTKA 3JYCA 2QKSA 1E79G 1Q81W 3TCUA 3G6EV 3FKSG 3MHSC 5CBFA 2H8PC 2XAGA 1S5HC 3R65A 1GO3F 1DF5A 3OEHG 2OT5A 2IH1C 2HKOA 5IYBO 1RM1B 5KUMA 2Q68A 3AG2C 2ZDIC 4X88A 2XAHA 3CC2V 4FMTA 1FXKC 2IU0A 5IYCO 3OMAB 1OCOB 1K9MW 1NJIW 3DTUB 3X2QC 1IXMA 4MSWC 3ZCCA 2IJKA 2IJIA 2YSUB 1H2GA 2DYRB 2WSSH 1BL8A 3ETGA 3UKMA 2D3OW 4QIWF 1QBZA 3LDEA 1CP9A 1OCCC 1B6QA 3ZJZA 5IYDO 5B3SC 1VQ6V 2JEXA 2R9IA 3SYCA 4JAVA 5H6QA 4G2KA 1PL0A 3EHBB 3FB6C 3ZRWB 3W7TA 1SRYA 3E8FA 4RQEA 1OCRC 3CCEV 3OR6C 2XAJA 3CCSV 4L87A 4N21A 1PKXA 3SPHA 4MW8A 1CEZA 3I55V 3RBZA 3QO7A 2HJFC 1M9NA 2XNDG 1QLEC 1MABG 3OFNG 2MK3A 4LC1A 3T4ZA 2AHYA 4P30A 4TLFA 3D36A 4KP4A 1K5SA 1YJNV 4MW3A 3PJSK 4MVUA 2EIJC 1R3IC 4ASUG 2WWWA 1WLEA 1KQSU 4UVAA 5LGTA 2Y69B 1DLBA 1J95A 2E5YA 4TT3G 2EILC 4QE9A 3P32A 1VQKV 5HFMA 2WLJA 4BIZA 4GCZA 3B77A 1OCOC 1XL4A 3F7YC 3FYEB 3ABKB 2DWEC 1S76D 3HB3B 1W2BU 1SETA 2WLMA 4QPKA 5EBLC 5LHIA 3DGEA 1SERA 2JK5C 1KP3A 4KUMA 4G28B 4WCEV 3F7VC 3E2EA 5LGNA 4MTFA 4UXNA 2B5UA 5C93A 4EKWA 1NVPB 3CCLV 2W6JG 1JVMA 1OCCB 4MVMA 1I5XA 4JASA 3G4SV 1BHAA 4CZZA 2OCCC 1W0JG 3K0GA 3LSQA 3CPWU 1H38A 1FXKA 1OCZB 4LP8A 4PA3A 5EC2C 1PNKA 1F23A 2IU3A 2XNDH 2W0FC 3JD0A 1ZWIC 2K1EA 1Y4MA 3P30A 3ASOB 1KP2A 2B1GA 1YITV 1PNLA 2UXNA 4PDMA 3CCRV 2QE7G 4J9YB 3IC7A 3MHHC 3SPCA 3AG1C 2QEXV 2JDIH 2BOBC 4QJFB 1PD3A 2PI5A 4JYCA 3ABMC 1R3KC 4UV8A 4PDRA 4U7NA 1V55B 2WSSG 1NR7A 3K79A 1RPRA 2EINC 2IW5A 4WFFA 3CXCU 3AG3C 2W6IG 4WVZA 2NNUA 1WPXA 3CYOA 4WFBV 1AI5A 3W7SA 1NQTA 3ZMTA 2ITDC 5CA3A 2ZXWC 3CC7V 1JJ2U 3QO8A 1AROP 1QR9A 1R6NA 5KUKA 5EC1C 1TUEB 3E8HA 3AG3B 4MVZA 5LHGA 1QCEA 4CBCA 5CN0A 2Z5UA 2EIJB 4QMAA 4FIPC 3USSA 1V55C 3SYOA 3LDCA 1KC8W 2DYRC 3ETDA 1R3JC 1AI7A 1K97A 3D3IA 4FK5C 2C2AA 3ZMSA 1E79H 3E35A 4BW5A 3ZRSA 2DW4A 3E83A 2IJJA 2Q6AA 2JIZG 5J9PC 1G8MA 2QM7A 2XOKG 4MTOA 2JJ2G 3K04A 4PA9A 2F43G 4PA4A 2EJRA 2ZXWB 1ORQC 4H33A 1OCRB 4OXSA 3CMEV 4R7CA 2V7QG 1VQ5V 1MOFA 2V1DA 1RM1C 2XAQA 4MVOA 3QO5A 4JYBA 2X6CA 3OMIB 3ABMB 2EIKB 2M7WA 1UJWB 4X89A 5E1AC 4Z1MG 1VQNV 2HLDG 2QA4V 4P2ZA 1M57B 2PI4A 1OHHG 3ZMVA 3A0RA 5H9CA 5L3FA 3RVYA 1EFRG 1FS0G 3JD2A 4LCUC 2OTJV 2OCCB 4WFHA 3K3WA 2LFSA 3TK1A 2EINB 1SESA 3WG7C 4JTAB 2X6AA 4RUFA 4ZKIA 1NH2B 1H8EG 4JTCB 2QTOA 3T2MA 1QVFU 1OZ0A 1NR1A 4XDJA 2JDIG 4DO2A 3OE7G 2WLLB 4P9PA 5EK0A 4GT1A 1K4CC 2WLIA 3OAAG 2HG5C 3BY6A 3ASNC 3AG4B 3WFVA 3ZN1A 2DQ3A 2EIKC 1K5QA 1FXVA 1QR8A 2EILB 1CPYA 1G4YB 1BSHA 4JTDB 1THZA 2CK3G 3F5WC 1YTFB 3G71V 1YJWV 2DYSB 1AJPA 1FXHA 3GB7C 4RO2A 4FPPA 3ASOC 1YI2V 4JF3A 2XASA 1KD1W 3AG1B 2HVKC 1S0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EBW C;  3ABM C;  2P7T C;  1R3K C;  4LBE C;  2DWD C;  3ABK C;  4PDR A;  3RW0 A;  3UM7 A;  3LNM B;  2HVJ C;  4RAI A;  2EIM C;  3X2Q C;  1M57 C;  2EIN C;  4MSW C;  5B1B C;  3E8G A;  3SYQ A;  1P7B A;  4WFF A;  3SJQ C;  3AG3 C;  4MS2 A;  1K4D C;  2WSS H;  4WVZ A;  4R8C A;  3LDD A;  1BL8 A;  2WLI B;  3UKM A;  4F4L A;  2WLK A;  3E8B A;  3LDE A;  2A9H A;  1OCC C;  2YEV A;  3K03 A;  3ZJZ A;  2A0L A;  2ITD C;  5B3S C;  4YXW H;  5CBG A;  4QNH B;  3TET A;  2ZXW C;  2Y69 C;  3SYC A;  5KUK A;  1JEK A;  2Q67 A;  3E8H A;  5EC1 C;  3FB6 C;  4MVZ A;  2IH3 C;  3ABL C;  3E8F A;  4CBC A;  2BOC C;  2QE7 H;  1OCR C;  1LNQ A;  3IFX A;  4QMA A;  3IGA C;  3USS A;  1V55 C;  2NLJ C;  3OR6 C;  3FB5 C;  3SYO A;  3AG4 C;  3KG2 A;  3LDC A;  4PA6 A;  2DYR C;  3SPH A;  4MW8 A;  1R3J C;  4HZ3 A;  1V54 C;  4X8A A;  4P9O A;  3RBZ A;  1E79 H;  4R50 A;  2HJF C;  2CK3 H;  4QE7 A;  1QLE C;  4GX2 A;  3T4Z A;  4BW5 A;  3ZRS A;  2AHY A;  4P30 A;  4TLF A;  3FB8 C;  2AHZ A;  4UUJ C;  3E83 A;  2WLN A;  3K08 A;  2Q6A A;  5J9P C;  4DJG A;  4MTO A;  2X6B A;  4MW3 A;  3K04 A;  3FB7 C;  4MTG A;  3PJS K;  4PDV A;  4PA9 A;  3BEH A;  3OGC C;  4PA4 A;  4MVU A;  1XL6 A;  3SPI A;  2EIJ C;  1R3I C;  1ORQ C;  4H33 A;  2ATK C;  4GX0 A;  4OXS A;  4R7C A;  2DYS C;  3OUF A;  3SPJ A;  3HPL C;  4MVO A;  2A79 B;  1IFP A;  2X6C A;  1J95 A;  2E5Y A;  3SYA A;  3K06 A;  2EIL C;  4QE9 A;  5IY5 C;  1BSN A;  2Q69 A;  4WFE A;  4X89 A;  5E1A C;  4KFM A;  3STZ C;  2ITC C;  4P2Z A;  1FS0 E;  1R3L C;  2WLJ A;  3EFF K;  3K0D A;  4MVS A;  3SPG A;  1OCO C;  1XL4 A;  3F7Y C;  3T1C A;  4GX1 A;  3RVY A;  4LCU C;  3STL C;  4DXW A;  2DWE C;  4WFH A;  5EBM C;  4PDL A;  2WLM A;  3WG7 C;  4JTA B;  2X6A A;  4RUF A;  5EBL C;  4G27 B;  4JTC B;  3T2M A;  2QTO A;  2JK5 C;  4J9Z B;  4GX5 A;  4XDJ A;  5BZB A;  5EK0 A;  2WLL B;  4P9P A;  2E5T A;  4G28 B;  1K4C C;  3F7V C;  2WLI A;  4MTF A;  2KB1 A;  4H37 A;  2ZD9 A;  4MVQ A;  2HG5 C;  3ASN C;  4I9W A;  2V7Q H;  3LUT B;  3OUS A;  3VOU A;  4EKW A;  5B1A C;  1M56 C;  1JVM A;  4MVM A;  4PA7 A;  2EIK C;  1AQT A;  2OCC C;  3E89 A;  4WFG A;  3K0G A;  1G4Y B;  1BSH A;  3OR7 C;  4JTD B;  4XDL A;  3F5W C;  4LP8 A;  4PA3 A;  1OCZ C;  5EC2 C;  2R9R B;  1KKD A;  4MVR A;  4R6Z A;  3JYC A;  2XND H;  3E86 A;  2QKS A;  3RVZ A;  2W0F C;  2WLH A;  3GB7 C;  4RUE A;  4ZBM A;  1ZWI C;  3TCU A;  3T4D A;  5CBF A;  2W6J H;  2H8P C;  2K1E A;  1S5H C;  4RO2 A;  3R65 A;  2WLL A;  3ASO C;  2IH1 C;  5KUM A;  2Q68 A;  4PDM A;  5CBH A;  4HYO A;  4XDK A;  4J9Y B;  2HFE C;  2HVK C;  3AG2 C;  4TWK A;  3AG1 C;  3SPC A;  4X88 A;  3SYP A;  2JDI H;  2BOB C; 
#chains in the Genus database with same CATH topology
 3P8C D;  5EBW C;  4J11 A;  3C3T A;  1I08 A;  3Q1M A;  1TGO A;  4LFB O;  1URQ B;  1NKD A;  2JEE A;  4BIO A;  3V5B A;  3IJ4 A;  1NTK K;  3LSU A;  5APQ A;  4H13 C;  4RQF A;  1EZV I;  4FLZ A;  3RK3 E;  1WMK A;  3E8B A;  3AK2 A;  4B3M O;  1HGZ A;  5CCG A;  2WQY C;  2QM8 A;  2ZDI A;  1W2B O;  4UB8 E;  1YQ3 C;  4AQY O;  1IFD A;  4EFE A;  2X0L A;  4X64 B;  3CCV V;  1QL1 A;  1Q86 W;  1LTT C;  1F4M A;  2BOC C;  2KYV A;  4Y28 J;  3EWK A;  1JMB A;  2OYH C;  2EZP A;  2Y4T A;  5L3E A;  1NTZ D;  3AG4 C;  1JCH A;  4PI2 A;  1U7M A;  1KIL E;  4HZ3 A;  1H2S B;  2UXX A;  2WAM A;  1GW3 A;  1M1J A;  1WRG A;  4E2L A;  4FFB A;  3FB8 C;  2DN9 A;  2WLN A;  4DJG A;  3E22 A;  4I5S A;  1BCC J;  3UQ8 A;  4WY4 A;  1YJN P;  1ZL8 B;  4IHJ B;  4PD4 D;  4DV6 B;  4JQ0 D;  4K0K B;  3LSS A;  1FYJ A;  1N7S D;  2Q8V A;  1PL5 A;  3H1K D;  5LYJ B;  1R6K A;  2P4K A;  3MTU E;  1EXJ A;  1URQ C;  1LT9 C;  4NPE A;  2M5A A;  2GSM B;  3OM3 B;  1EDJ A;  4UB6 H;  2ZM6 B;  5APW A;  3VYI A;  3K0D A;  3W68 A;  2BE3 A;  3OTO O;  1HW7 A;  2Q9L A;  1S3J A;  1NOH A;  4D6T J;  2QG4 A;  5CBN A;  4NPD A;  3VMZ A;  4PDL A;  3VMX A;  3GMA A;  2GBO A;  2UUA O;  2LXC B;  2Q3E A;  4OPH A;  2ZT9 B;  1W2E A;  3ZN0 A;  2KB1 A;  3JCZ A;  4PD4 H;  4PV1 D;  4HAM A;  5B1A C;  3FFQ A;  5C8Y B;  1SQP J;  1WA8 A;  3CCJ V;  4A5U B;  2I1K A;  1E1R G;  4U3J B;  3H6P A;  4N78 D;  3CRR A;  3H1H J;  1S9K E;  1PP9 E;  3RK2 C;  1KKD A;  1N33 B;  3I56 P;  3BVO A;  4IL6 Z;  4NKG B;  4TSF G;  1OW8 A;  3X2Q B;  3M0D A;  2EIM B;  3CB2 A;  3N2G B;  3H1I J;  3L73 E;  3PH0 A;  4H13 B;  1L0N D;  4FLY A;  1RPO A;  1K92 A;  1AR5 A;  1NI8 A;  4PJ0 E;  4OGQ C;  1YCI A;  2IBZ I;  5L3C A;  3OW2 U;  4RES B;  3SYP A;  1EN6 A;  1FJG O;  3L72 D;  3SJB C;  4CS2 A;  2CTP A;  1R1B A;  3VP8 A;  4DR1 B;  4BXL A;  2KNC B;  3AE7 C;  3ABK C;  1YJ9 P;  2QWO B;  2P5O A;  2P7J A;  1JR9 A;  1Y76 A;  1VQK P;  4DR2 O;  3SJQ C;  4EB6 B;  1K4D C;  2B87 B;  3QVN A;  1BCC E;  3M0A A;  1VPC A;  2DOS A;  3ABL B;  3O6Q B;  2LXB A;  2IBZ H;  1YTZ I;  1GMG A;  2UUC B;  4NYK A;  5CMU A;  2Y69 C;  3Q4H B;  2ZIO A;  2H94 A;  1JEK A;  5APS A;  1VQP P;  2Q67 A;  3CC7 P;  5LBQ A;  2IH3 C;  2ZCE A;  1RF0 A;  5KAI Z;  3BAA A;  3JCU H;  1LNQ A;  3IGA C;  2CAZ C;  2KLU A;  5KX5 B;  3JAW B;  2KS1 B;  4CPG A;  3ASN B;  5LP6 A;  2P6J A;  4UB6 E;  2Q73 A;  4DUY B;  4K35 A;  1V54 C;  4X8A A;  2KXP B;  2WT7 B;  4LNU A;  2YDE A;  4FLV A;  4R50 A;  1BGY J;  2QGN A;  3H32 B;  2N1T B;  2N9B A;  1ENV A;  1I5Y A;  3H1L E;  2CTQ A;  1H8H G;  1XIL A;  2WSF H;  1VQ4 P;  1TUB A;  2BAS A;  1COW G;  1Y66 A;  2ILM A;  5BY1 A;  3SFD C;  4X66 O;  1IXB A;  3L71 H;  2IBZ D;  3JD3 A;  1FAV A;  5AVT B;  3HPL C;  2QDO A;  1RQV A;  3K9A A;  3KDP B;  4F6R B;  1KEC A;  2YKQ A;  3D6Z A;  4EB6 A;  1GAX A;  5M1B A;  4MT8 A;  2J59 M;  1VQN P;  5IY5 C;  4DV4 O;  1BQZ A;  4WFE A;  1S4X A;  1BDD A;  1JY2 P;  1GU4 A;  3QG5 A;  1KYO D;  2KIK A;  4D6T D;  5B3S B;  1L0L J;  3CI9 A;  2OTJ P;  4UV9 A;  5B1A B;  2WA4 A;  4X20 A;  3RL0 D;  3CXH H;  1RF0 C;  3K59 A;  5KKZ B;  2HPC B;  5E79 Z;  5IDJ A;  2HYN A;  2AZ2 A;  2FFD A;  3KHU A;  2JGD B;  1KB9 E;  4PA7 A;  4Z2W A;  4B3R O;  1OX3 A;  1ZV8 A;  3S3X A;  4O2A A;  1LTI C;  1KKC A;  3R4Y A;  1NU1 H;  3L72 G;  4GKK B;  1OCZ C;  1NU1 J;  2IZ1 A;  1Y6X A;  3L75 H;  2FTK A;  2QKS A;  2OQQ A;  2YXY A;  3G6E V;  3FKS G;  1LT1 A;  2XAG A;  1KB9 H;  3R65 A;  1GO3 F;  1DF5 A;  1VEW A;  3A8T A;  3JAT A;  3RYC B;  2IH1 C;  5KUM A;  2Q68 A;  3K57 A;  4X65 B;  2QWN B;  2FYN C;  3VQX A;  1XNR O;  4CC6 A;  1NTK J;  1PGQ A;  2A06 D;  4RJT A;  2ZT9 C;  1NTK E;  3JAL A;  2IU0 A;  3OMA B;  3CX5 D;  5H2F Z;  5B5E Z;  1E5W A;  3X2Q C;  1SQB J;  3KXD A;  4MSW C;  2QWQ B;  3MIW A;  4YTP C;  1NTM G;  2YSU B;  1H2G A;  2FYU D;  2DMX A;  1SQB E;  2QKA A;  3RGU A;  3ABV C;  2PTM A;  1JFF B;  3TGU E;  4OGQ D;  2WVR A;  1Z56 A;  1B6Q A;  2KG7 A;  2FKX A;  3AEC C;  4JAV A;  5KAF Z;  4KXR A;  4O4L A;  2VQE B;  1LTJ C;  1NKN A;  1KMI Z;  3MUD A;  1GRJ A;  5B5E H;  4ZNC A;  3FB6 C;  1EM1 A;  3CJH B;  3OTF A;  5CCG C;  4MN4 C;  3KQG A;  1Q7Y Q;  3CCE V;  2AXT H;  2V7Q J;  2FML A;  1GDT A;  3CCS V;  3HUS A;  5AVS B;  4L87 A;  4CS3 A;  5LMN O;  5GTI E;  2JRI A;  1Y9B A;  3MUD C;  5KHK A;  2Q3I A;  1L0L E;  3T4Z A;  2MK3 A;  4LC1 A;  3LW5 H;  2AW9 A;  2AHY A;  4P30 A;  5IYZ A;  5IYZ B;  2KB7 P;  5GTI H;  2VWK A;  4MW3 A;  3CWB G;  3PJS K;  5H2F H;  2Q4P A;  5TIS Z;  2EIJ C;  1R3I C;  4YJ3 B;  3II6 A;  1URF A;  3L35 A;  5AW7 B;  4PD4 F;  4UB6 Z;  2WWW A;  1SQQ H;  4NXN B;  3P3P A;  5KHI A;  4B08 A;  5J2U B;  3H1J H;  4LF8 B;  1SQP K;  1US6 A;  2QR4 A;  4BR6 A;  1XMO O;  5AVU B;  4BIZ A;  3L74 G;  4HYT B;  5JQG A;  2DW3 A;  2P22 C;  2RH0 A;  4ZKP A;  3VMA A;  2AZ0 A;  1DIP A;  3U10 A;  5LHI A;  2OCH A;  1EQ7 A;  3OT7 A;  1J2J B;  1N0J A;  4DUZ B;  5GON A;  5J2U A;  1ZRT D;  1S5J A;  2Q5Z A;  3F7V C;  4D7S A;  3TNU A;  2PP6 A;  4H44 D;  3CWB H;  5C93 A;  1JB0 J;  3CCV P;  1SQV K;  3RGB A;  1R8E A;  3CCL V;  3SJC C;  5ITZ A;  1S5L Z;  1N34 O;  5JQG B;  4CZZ A;  3K0G A;  4EDF A;  1FXK A;  4UCR A;  4PA3 A;  3HKE B;  3H1J J;  5BVZ A;  5TIS E;  1PNK A;  1HJB A;  4DV7 O;  3FAV A;  2XND H;  4DW0 A;  3L75 E;  2W0F C;  5FPR A;  4WBN A;  2W90 A;  3JD0 A;  1ZWI C;  1L0L K;  1VF6 C;  3A0H Z;  4U3F E;  3JSN A;  1IFN A;  1Y4M A;  2RJZ A;  2A45 I;  3G6E P;  1YIT P;  1KP2 A;  2HP8 A;  1PNL A;  1QL2 A;  2QEX P;  2FYU G;  4J9Y B;  3ZHS A;  1AB3 A;  3MHH C;  1KFM A;  3AE6 C;  5AVW B;  1PD3 A;  2PI5 A;  2CTW A;  2ZAE B;  4J7Z A;  4O2B A;  1R3K C;  2O01 H;  4DUY O;  3J81 N;  1NR7 A;  4NB5 A;  1JY3 O;  1QU7 A;  1B06 A;  3K79 A;  4EI2 A;  2QJK C;  2QSI A;  3AG3 C;  2A06 G;  2W6I G;  4J80 A;  2Q0O C;  4K0K O;  4FZ0 A;  5AW0 B;  4UCU A;  5JWP A;  1U97 A;  2ZE8 A;  2HPC A;  3ZX6 A;  3RK2 B;  3CC7 V;  1JJ2 U;  1ARO P;  2KOG A;  2YIA A;  4FLW A;  1QCE A;  1XUQ A;  4CBC A;  2R44 A;  3BCC J;  4DV0 B;  3IAY A;  2P1J A;  3SYO A;  3USS A;  3WU2 E;  3LDC A;  3VOP A;  2DYR C;  1LTJ A;  3V4Q A;  1NH4 A;  2JWD A;  4DV6 O;  1K97 A;  2LJ2 A;  1X4T A;  4DR3 O;  3C9I A;  3FGA D;  3TXS A;  3FXD A;  3QWO C;  3E83 A;  2YKP A;  2IJJ A;  2Q6A A;  1N36 O;  1RE3 C;  2W0X A;  3K5O A;  1XOU A;  3CME V;  1VQ5 V;  4K8Z A;  4LF9 B;  1YF2 A;  2XAQ A;  2K3R A;  3GF7 A;  2WSE H;  2X6C A;  1JY2 O;  3ABM B;  2EIK B;  4X89 A;  1IBM B;  4I6M C;  2HLD G;  2QA4 V;  4YJ2 B;  1CSB A;  5H9C A;  1Q3E A;  3NFQ A;  3F5T A;  4J41 A;  2OTJ V;  2OCC B;  2YNY A;  2EIN B;  5GTH Z;  1KB9 I;  4LF4 B;  3L72 J;  3WG7 C;  1J1E B;  1TU3 F;  2GTS A;  2GTA A;  1S5L X;  4XDJ A;  2JDI G;  1FZF A;  1K4C C;  5K1P A;  2WLI A;  2Y0E A;  3H1I G;  4I50 B;  3AG4 B;  1S9K D;  3ZN1 A;  3CXH F;  4F6E A;  1KB9 F;  2EIK C;  3SR2 C;  1K5Q A;  1NYH A;  1Q5O A;  1BSH A;  3CMA P;  1SQB K;  1KYO I;  1FXH A;  3GB7 C;  2KI7 B;  3N2G A;  3RL0 C;  4FPP A;  1ZX3 A;  2P10 A;  3ASO C;  2K9J B;  4KHX A;  3L9D A;  5LYJ A;  2YI9 A;  1GN3 A;  1KD1 W;  1FFX B;  3WB1 A;  3AG1 B;  4RKU J;  1R6T A;  3CE2 A;  3AG7 A;  3PP5 A;  3CPW O;  1JNM A;  4B3M B;  2XDJ A;  4IL6 H;  2P7T C;  2A45 G;  2ZNJ A;  4X1K A;  4N23 A;  1SQV E;  1JQ0 A;  1JPX A;  3OD4 A;  2Q7E A;  3HKB B;  5AW4 B;  2ZYG A;  5KLV D;  3CX5 F;  4MTX A;  2RNB A;  5EZY B;  1PIX A;  3EFG A;  3L70 J;  5KAF H;  4EIJ A;  1OIP A;  1QX8 A;  1K73 W;  4ZKU A;  3UT5 B;  4R8C A;  2WLI B;  3CCM V;  3H01 A;  4DW1 A;  1SP4 A;  5CJ4 A;  4LF5 O;  3S3W A;  3WG7 B;  1NTK G;  4Z1V A;  1JTH A;  3H1H G;  3ML0 A;  1YTF D;  1H0T A;  4CS4 A;  4LF8 O;  3KCY A;  4W4L A;  4DV5 B;  2PGD A;  3P8M C;  2GUV A;  1F51 A;  5CCH A;  4NXN O;  5JJE B;  1AQ5 A;  3B40 A;  2FBW C;  1AR4 A;  1A02 F;  1NJI W;  4PA6 A;  4U3F J;  1Q7Y W;  3OW2 O;  1NTZ J;  2E43 A;  2W27 A;  4O4I A;  3MD0 A;  2LR2 A;  2AHZ A;  1HR0 O;  3U0Z A;  1JOC A;  3L70 H;  3F89 A;  2K1A A;  4U3J A;  5DN6 G;  3LID A;  3ZIA G;  1PP9 J;  1T3U A;  2M3B A;  3H1I H;  3GW6 A;  5B5E E;  2QKC A;  1HNZ B;  2UU9 O;  3JD1 A;  4GX0 A;  1VQ8 P;  3OA7 A;  2K37 A;  3CRQ A;  1WN7 A;  3DC6 A;  1NVP D;  4DV2 O;  4WY4 B;  2ZVN B;  2Q7G A;  2H43 A;  5F2V O;  4IFM A;  5HFL A;  1K8A W;  4JI4 B;  5IJ0 B;  3RL0 g;  1BHB A;  1Q6I A;  1FC2 C;  3E7K A;  2WA3 A;  2UXD B;  4BRY A;  1Y74 B;  2YI8 A;  4OVN F;  3H1K H;  3SWF A;  3ABT A;  1KC8 Q;  3K5M A;  5EBM C;  4D6T G;  3RN4 A;  3A7O A;  3M06 A;  1F4N A;  1JJO A;  2GHY A;  4GX5 A;  4L75 A;  5EFW B;  5LP6 B;  1EZJ A;  1WP8 A;  3JAT B;  4H37 A;  1DF4 A;  1JX9 A;  4LFA O;  4I9W A;  4GKG A;  1SC5 B;  3U59 A;  1QEX A;  4IL6 X;  3WMM 0;  3CC4 V;  3JSL A;  3NR7 A;  5LMU B;  3C90 A;  2QJY C;  3H1J D;  1W59 A;  2RCV A;  3OTO B;  3L37 A;  1U96 A;  5H2F E;  1EDK A;  1XMO B;  1DD4 A;  3ABU A;  4AHC A;  4BAY A;  4ASW A;  1VQ9 P;  4R6Z A;  1NAY A;  4ZBM A;  3CS5 A;  4RUE A;  3ZHU A;  3T4D A;  5L3G A;  1VQM V;  1ZSP A;  2P67 A;  4K3A A;  3CHX A;  2YMY A;  4HNA A;  4Y99 B;  3CD6 V;  1MV8 A;  3KZI H;  1MNG A;  2DE0 X;  4C46 A;  4DK1 A;  3CX5 E;  2JGD A;  4I4T A;  3HE5 A;  3M9Q A;  1T2K C;  3ZRX A;  1EN4 A;  3RW0 A;  3BHP A;  1PP9 G;  2HR3 A;  1SQX J;  1FBM A;  2DJV A;  3TYY A;  3RYI B;  1FJP A;  3HTK B;  5LA6 B;  4NPF X;  2Z4E A;  1W0K G;  1N4C A;  1I94 B;  1JCD A;  1SQV G;  3B71 A;  5E79 E;  3BAT A;  2M6Y A;  4ZOL A;  3OGI B;  1S72 P;  1GL2 A;  3K03 A;  1PPJ E;  1CZQ A;  3B5N A;  3V6I A;  4YXW H;  3B8E B;  1L0N J;  3VBB A;  4QNH B;  4DV3 O;  5LGU A;  1VQL V;  3O9O A;  1M8O B;  3IFX A;  2HFE D;  5GON B;  1HH0 A;  1KOR A;  3I5D A;  1SQX G;  3UO3 A;  2LGW A;  3E1R A;  3V4W A;  1K33 A;  3KZI Z;  1BE3 J;  2YEV B;  3SDL A;  1IJD B;  1JMM A;  2QJP B;  2UWJ E;  1N32 B;  5BR8 O;  1KIL C;  3L74 J;  4MTG A;  4FLX A;  2MW2 B;  1N8R W;  1X9V A;  2ZKO A;  2IPP A;  2Y48 A;  2M5A B;  1LGH B;  1ZAU A;  1RHZ B;  1LUV A;  5APY A;  1NBM G;  1VQ8 V;  3IC9 A;  5KLI C;  4ZI7 A;  4YXD C;  1SQV J;  2B9B A;  1QVG U;  2ZQM A;  3WUV A;  3B5N C;  1WB7 A;  2BTQ B;  1JOY A;  1N7S B;  2OGU A;  1M5I A;  2HLO A;  2M8R A;  2YIB A;  4KFM A;  3L71 D;  5L3D A;  5LMU O;  3CXH E;  3FWN A;  3K5B A;  1NH2 D;  1RP3 B;  1NTZ K;  5CCH D;  2YO3 A;  2YID A;  1N86 A;  3Q3D A;  4O4L B;  2Z5I A;  1FE6 A;  3H1J G;  4IL6 E;  2NPS D;  3H1L D;  4O4I B;  1J5E B;  2RDC A;  2E75 C;  3CRA A;  2E3C A;  3W7W A;  4X1I B;  1Q2N A;  2JEU A;  5A9G A;  1JMK C;  2ZVO B;  1FZC C;  5KJ7 C;  4TOI A;  1HNW O;  1EDL A;  1L8D A;  2RMK B;  3ZRW A;  3LUT B;  1FJG B;  2YXQ B;  5C39 A;  2N04 A;  1ZLL A;  3QH9 A;  5CHX A;  3CXH D;  1M56 C;  5IY5 B;  3CCE P;  1KB9 D;  3CRM A;  4EOT A;  2Z5H A;  1YHQ V;  5AVQ B;  3P3N A;  3HE4 B;  3L73 G;  1URQ D;  3ZRV A;  4O4J A;  5KKZ C;  2OTK E;  3G71 P;  1E79 G;  1Q81 W;  3MHS C;  4GLX A;  1SA0 A;  4TUY A;  1S5H C;  5CCH C;  5DJU B;  1PPJ H;  1NHL A;  2CUG A;  3BFR A;  2HKO A;  3MDS A;  5IYB O;  2Y0P A;  2D2C C;  1GD2 E;  4IIJ A;  2UXD O;  1GW4 A;  4X1K B;  2Y9Y A;  2N1T C;  3CC2 P;  4X88 A;  2F4V O;  2XAH A;  2RN0 A;  1L0L G;  3JCU E;  5AVZ B;  2E42 A;  1NTZ H;  2RQ6 A;  1U7J A;  1BGY E;  4LNU B;  3RK2 D;  1X0T A;  1YIJ P;  1IXM A;  2F93 B;  4TUY B;  5IJ9 A;  1Y8A A;  2JJL A;  2WMM A;  2WSS H;  2DYR B;  1BL8 A;  4NTY A;  3MGN A;  1Q6U A;  2D3O W;  4QIW F;  3LDE A;  1GK6 A;  1LWU C;  2AXC A;  2R3S A;  4XA4 A;  4EYY Q;  2ZFC A;  4U7J A;  1PPJ D;  1K73 Q;  5B3S C;  2H8P D;  1PP9 D;  2R9I A;  5H6Q A;  3MZW B;  5FNV B;  4ZOL B;  4DV1 B;  4G2K A;  5FNV A;  1SRY A;  1BZK A;  4RQE A;  2CTR A;  3AK3 A;  1UIX A;  2QJP C;  1VQL P;  3VN0 A;  4Q6G A;  3OR6 C;  4N21 A;  1PKX A;  3I55 P;  1RE3 A;  3L75 G;  3RBZ A;  2HJF C;  2IFN A;  1QLE C;  4JYY A;  1OZH A;  1NJI Q;  4X9Q A;  1BDC A;  4TLF A;  2HHH O;  2VWJ A;  3JAK A;  1QVF O;  1G1J A;  1GTW A;  1YJN V;  4E4E A;  2GUZ B;  2BCC J;  4JV5 O;  3BVH A;  4I0X B;  3ZS8 C;  4HNA B;  1NKZ B;  1RFY A;  4ASU G;  1PGO A;  4X64 O;  3SWY A;  3FX7 A;  1M4U A;  1HVV A;  4RO0 A;  5AW6 B;  2E5Y A;  1FDO A;  2EIL C;  4QE9 A;  2XHB A;  4H0L B;  2O1K A;  2EJ7 A;  1LP1 B;  2WLJ A;  1ZR2 A;  2KLV A;  1K8A Q;  3FYE B;  4DR3 B;  1SFC B;  2DWE C;  1N7S A;  1SF9 A;  2H88 C;  1W2B U;  2LKM A;  4LH6 A;  5EBL C;  4QGP A;  3L73 D;  1SER A;  3L71 J;  3JAM N;  2KZJ A;  5KHH A;  1DEE G;  2ZYA A;  2FFD B;  3L71 G;  4KUM A;  2C0X A;  3AE9 C;  4PHZ A;  3E2E A;  3RFR A;  3H1I D;  2BCC H;  1ZOY C;  1NTZ E;  1PM9 A;  1NVP B;  3B2E E;  2W6J G;  1I5X A;  4DR7 O;  1MA1 A;  1BHA A;  1H38 A;  2GM4 A;  2G3A A;  1OCZ B;  1RQU A;  3E22 B;  1T2K D;  1NWQ A;  1F23 A;  5AW1 B;  2IU3 A;  4CH6 A;  5KAI H;  1Q82 Q;  3QTC A;  2WIT A;  3RK3 D;  2F95 B;  3ASO B;  1Q86 Q;  1AIL A;  2BSK B;  1IBK O;  1WT6 A;  4YJ3 A;  1VQ5 P;  4GDO A;  4I2L C;  1SQP D;  3ZHV A;  4LR3 A;  3SPC A;  2QEX V;  2BOB C;  5JH7 B;  4JYC A;  3ABM C;  1IBK B;  2BTQ A;  2E76 D;  1Y76 B;  4NXM B;  1PGJ A;  3ZHQ A;  2NNU A;  4X62 B;  4IGG A;  4IFD K;  4JV5 B;  3ZMT A;  1N7S C;  1TA8 A;  1VL2 A;  5CA3 A;  2HHH B;  1EZV E;  3QO8 A;  2E5L O;  1SQP H;  3GVM A;  2EIJ B;  2N1T D;  1JY3 P;  4TV9 B;  3KKY A;  1SQQ K;  2FXO A;  1PPJ G;  3ETD A;  2OYI B;  2K9J A;  1G2C A;  2HJD A;  2GA1 A;  2E76 C;  4O4J B;  2MJZ A;  4W7Y A;  4D7T A;  2DW4 A;  1P84 F;  5AVR B;  1G8M A;  2QM7 A;  1M90 Q;  5IT9 N;  2JJ2 G;  2KNC A;  3VP9 A;  4PA9 A;  1EZV G;  1V9P A;  2ZXW B;  2FY8 A;  1YVW A;  4IIJ B;  4FM2 A;  3ETQ A;  4OX9 O;  4KT0 J;  1BCC H;  1N8R Q;  1AP5 A;  1OVR A;  4JI2 B;  4JYB A;  1SFC D;  5KJ7 D;  3OMI B;  4FFK A;  4I9Q A;  3C3S A;  1UJW B;  1BE3 G;  5CCG D;  4Z1M G;  1QLE D;  3H32 A;  4R4M A;  2ETN A;  4H0L D;  1UII A;  1GU5 A;  1WNS A;  1LR1 A;  1LJ2 A;  3E1I A;  3O6Q A;  4JI7 O;  1EFR G;  2YMK A;  3K3W A;  2WSC H;  1SES A;  4IOI H;  2Z0A A;  4YJ2 A;  4ZKI A;  4DR6 O;  3T2M A;  1NS1 A;  1QVF U;  1OZ0 A;  3HTK A;  1AJY A;  5AVX B;  4NR1 A;  1L4A C;  1DX7 A;  1XNQ B;  3OAA G;  2D2C D;  4O2B B;  3W67 A;  3H1L H;  3WFV A;  2JO1 A;  1SQB H;  4LF4 O;  4B7K A;  5IE9 A;  1N7L A;  1BGY G;  2VRZ A;  1QR8 A;  2EIL B;  3UIA A;  1TUB B;  1CPY A;  3CCJ P;  2CK3 G;  2WSE J;  3F5W C;  1M1J B;  2XTA A;  1YJW V;  1NO4 A;  1NTM D;  3HUS C;  2DYS B;  1GZL A;  3TGU D;  3BA9 A;  1SQB G;  4I7Z B;  2QJY B;  5JCO A;  2NR5 A;  3Q5P A;  4YIP A;  2H89 C;  3BCC E;  1OVU A;  2C9N Y;  4H44 C;  1P84 H;  2F23 A;  5APV A;  2HVK C;  5KAF E;  2BCC G;  4C7N B;  3G67 A;  5CB4 A;  2Y0D A;  2I1J A;  2Q9I A;  1JA8 A;  5LHH A;  4UVB A;  1HF9 A;  1PV3 A;  3UM7 A;  5LMN B;  3AE5 C;  2EIM C;  1YJ9 V;  3VMY A;  2ZIN A;  4BWN A;  1FZC A;  5DED A;  3E8G A;  1FZC B;  2YIU C;  4MS2 A;  3AEF C;  3A2F A;  1BE3 H;  2QWR B;  4L8J A;  2WLK A;  1KIL B;  2YIB D;  2YEV A;  1OFC X;  3FXE A;  1GKF A;  4W4K A;  4DV7 B;  2N74 A;  1OV9 A;  2JJ1 G;  4Q20 A;  4U7O A;  3W7U A;  4BRY B;  2C9L Y;  3W7X A;  4IFF A;  3OAK A;  5DJT B;  1CI6 B;  3ABL C;  5B1N A;  3CC4 P;  3DC5 A;  4EFB A;  1IFM A;  2YKO A;  3AE3 C;  1GM7 A;  3L36 A;  3KG2 A;  2O3J A;  1R73 A;  3I56 V;  1VAR A;  3L74 D;  1MSD A;  5BMV B;  3RK3 B;  4J42 A;  1FZA A;  3A0B E;  2CDY A;  2WPR A;  2JS5 A;  3CWB E;  3GHG B;  1BE3 D;  1V54 B;  4ABM A;  1KUQ A;  3TDK A;  4D6T E;  3FX0 A;  4XBF A;  1IFI A;  4JPR A;  1IUR A;  2IYO A;  1HNX B;  3DSQ A;  1YI2 P;  2BSK A;  2EBO A;  2XT9 A;  2EZO A;  4FZ1 A;  4BIU A;  4DOJ A;  1USD A;  2NPS B;  2XKM A;  2YXL A;  1S77 D;  1MFT A;  2XZR A;  3B4S A;  2CGN A;  2UXB O;  1OW6 A;  2FYU J;  3CCU P;  5EIB C;  2OTL P;  2Q7H A;  3AEA C;  1FOS F;  1DTO A;  4YHH O;  5KLI B;  2KKW A;  1L0N K;  2KG7 B;  1N32 O;  3R66 A;  1RH5 B;  3H1K G;  2B89 A;  1NT2 B;  3HRN A;  3STL C;  4W7Z A;  3H1K J;  2Q0A A;  2Q6Q A;  1KQL A;  5KJ7 A;  1I0H A;  5JVD B;  1VP7 A;  1MSW D;  1AFO A;  2P58 A;  5L3B A;  1CI6 A;  2DQ0 A;  2E75 B;  1HWY A;  2G38 A;  2O01 N;  5DEC A;  2E5T A;  3ZMZ A;  1SVF A;  2BTO A;  1XRE A;  5DM6 V;  1WJZ A;  1L0L H;  2P90 A;  1SQF A;  4CC5 A;  4GOD A;  2V7Q H;  3FYI B;  2QWP B;  3VOU A;  1GM9 A;  3S9O A;  2Y0I A;  3TSI A;  2AXT E;  1AI6 A;  4WFG A;  4DV4 B;  4O2A B;  4XDL A;  4FM0 A;  1IZN B;  2BCC D;  2IZ0 A;  5AW3 B;  1DEB A;  1XNQ O;  5AW9 B;  2PAJ A;  4MVR A;  3BAB A;  1K34 A;  3E86 A;  3RVZ A;  3BCC D;  2WLH A;  1SA0 B;  4JZG A;  4XFJ A;  2WLL A;  1HNW B;  3GWK C;  2A3Q A;  4FJC C;  5CA0 A;  2YIC A;  4OWF A;  1LTS C;  5CBH A;  4PEL A;  1L1F A;  4HYO A;  1AVM A;  2HFE C;  3AG2 B;  1B3Q A;  2KSE A;  2ZR3 A;  1L0L D;  1SQQ E;  4FM1 A;  1FDM A;  2B87 A;  3AEI A;  4GIF A;  1IVS A;  1FXK B;  5B1O A;  4WY4 D;  4B3R B;  1H2K A;  1P49 A;  1PL4 A;  3LNM B;  3H25 A;  5B1B C;  1EBO A;  1L0N E;  2P4V A;  2FXM A;  3SSU A;  1VQO P;  3U1C A;  1ZP0 C;  3LDD A;  4OH8 B;  2CPS A;  1SLQ A;  2C0W A;  1P4R A;  3CCQ V;  1LT9 B;  1HNX O;  2HOD B;  2JP3 A;  1RF1 B;  3TET A;  1HGV A;  3N2K B;  1L0N H;  4UCV A;  2UXC O;  1AI4 A;  3JAR A;  2ZNI A;  5BR8 B;  1VQP V;  5GW7 A;  1YBK A;  1SZT A;  2QE7 H;  1G2C B;  1H88 A;  2YO2 A;  3U1A A;  2UXB B;  1NVO A;  2OYO A;  3RYF B;  2NLJ C;  1SZX A;  4WBN B;  2R5D A;  3TJT A;  4WY4 C;  4UVC A;  4JAU A;  4P9O A;  5EYP A;  1L4A B;  1MZF A;  1OWA A;  3Q2Y A;  1IK7 A;  2LFR A;  2ZM6 O;  1K05 A;  4UUJ C;  3C8V A;  4N3Y B;  2RMZ A;  3K08 A;  2AXT Z;  4LWS A;  1X59 A;  2LW1 A;  3N2K A;  4GOF A;  1M93 A;  4I0X A;  3FWL A;  3H1L G;  1FU1 A;  1NGM B;  3BEH A;  3WUT A;  3FD9 A;  3IAO A;  3SPI A;  4J7J A;  1OW7 A;  2ATK C;  3NMD A;  2H3O A;  5LOV B;  1M90 W;  3OUF A;  3WB0 A;  3DXR A;  3B8M A;  2E5L B;  4FLT A;  4C7N A;  2W8Z A;  3N4X A;  1BSN A;  4X20 B;  2ITC C;  5KLV J;  1KQS O;  1IX9 A;  1FKA O;  3SFE C;  1P84 I;  5JH7 A;  1MKM A;  1YIJ V;  1H2M A;  4PD4 E;  4JF7 A;  4MVS A;  1SS3 A;  4GX1 A;  2XUM A;  4TT3 H;  1MZE A;  5B1B B;  3G9R A;  1M56 B;  3CCM P;  4G27 B;  1CXZ B;  2E76 B;  1AR1 B;  2V4D A;  1MG1 A;  4J9Z B;  1VDF A;  1KIL D;  3BCC G;  3NXS A;  1Q6H A;  2ZD9 A;  2O57 A;  1OVV A;  4LFB B;  4KJM A;  1RF1 C;  5TJH A;  2F4V B;  5D5Q A;  3JAK B;  1Y47 A;  2JVD A;  1AJQ A;  4YIO A;  1RY3 A;  2D2C B;  3CCL P;  1AQT A;  5BU5 A;  3AE1 C;  3E89 A;  1QVG O;  3QF7 A;  5KLV G;  1IBM O;  1YHQ P;  3RYH A;  1KIL A;  4ASV A;  2ZE5 A;  1AVO A;  2FFD C;  2N1T A;  3TCU A;  1KQG B;  1TVK B;  2AEJ A;  2H8P C;  3CX5 I;  3OEH G;  4DR2 B;  1RM1 B;  1SQX K;  3H1H D;  4LF6 O;  4PV1 C;  2KUB A;  1UFI A;  2E74 D;  3GF3 A;  4CH4 A;  1SQP G;  3AG2 C;  2ZDI C;  2VQF O;  4B3T B;  5KMG B;  3BAS A;  3A5T A;  4FMT A;  1LP1 A;  2Q1K A;  4U3F H;  2OYI C;  4DYL A;  3T97 A;  5IYC O;  2P06 A;  1OCO B;  4ZHQ A;  1FZE A;  5CMZ A;  3VQV A;  3H1I E;  3L73 J;  1G6U A;  2YC0 A;  3ZCC A;  2IJK A;  4TV9 A;  2IJI A;  4LF9 O;  1PZQ A;  4GYC B;  5CB4 B;  3ETG A;  5K5G B;  4U3F G;  1HUC A;  2AGA A;  1CP9 A;  1VQ6 P;  1N33 O;  4JI6 O;  1VF5 C;  3V2N A;  2UU9 B;  4TV8 B;  4B3T O;  2J58 A;  1GK4 A;  1BCC G;  2CH7 A;  2G8Y A;  3ZRW B;  1PL0 A;  3HKD B;  3W7T A;  3E8F A;  4O4H A;  4JI8 B;  1SKV A;  3RBX A;  1M57 D;  4JI3 B;  2UUB B;  1USE A;  3SPH A;  4MW8 A;  1CEZ A;  2R70 A;  2PGG A;  3GHG C;  3I55 V;  3QO7 A;  1QHT A;  3G80 A;  1M9N A;  3CJH A;  3L72 E;  2B9Z A;  1HWT C;  2WSC J;  1K5S A;  3K9S A;  3ZDM A;  2W83 C;  1JFF A;  4LFC O;  1X8Y A;  1F7Y A;  2XNX A;  1XEQ A;  4LF5 B;  1DK1 A;  2GUZ A;  3UT5 A;  1J95 A;  2HG5 D;  4TQD A;  4TT3 G;  4N78 E;  1A32 A;  4W80 A;  3WB2 A;  1B04 A;  3P32 A;  2AEM A;  2CPB A;  2RKL A;  2LW7 A;  1N36 B;  1KZU B;  2GV9 A;  2VRS A;  1XHX A;  2WTY A;  3B77 A;  1XTC C;  3ABK B;  3L74 H;  3HB3 B;  1SET A;  3UO2 A;  4QPK A;  4I55 A;  3DGE A;  1EN5 A;  2WPQ A;  3M7M X;  2JK5 C;  5EZY A;  3JAW A;  5APX A;  4LF6 B;  4G28 B;  5LGN A;  3HR0 A;  5AG2 A;  2YUA A;  4PJ0 H;  3SWK A;  2VS0 A;  1FPO A;  4UXN A;  1WP7 A;  2ZJS E;  4N6J A;  3JAR B;  4EKW A;  1OCC B;  4X1I A;  3G4S V;  1BGY D;  3ICX A;  3LIE A;  3UCS C;  1W0J G;  5IJ9 B;  3CPW U;  1YQ4 C;  1Z5W A;  4LP8 A;  4DR5 O;  3A0B Z;  3H1K E;  2JS3 A;  1ZTE A;  4DCK A;  4DR4 O;  4I55 B;  5KX5 A;  2KS1 A;  3TGU G;  1M1J C;  4LH7 A;  1KQF B;  3L70 E;  1DGS A;  2B1G A;  1ZN5 A;  1YIT V;  4PDM A;  3CCR V;  4WB4 A;  2QE7 G;  2ZXX A;  4DRX B;  1KN7 A;  5FPO A;  3IC7 A;  1DD3 A;  4DV1 O;  4QJF B;  3JAS A;  4DR7 B;  2N9Y B;  2FKW B;  5IWA O;  5LXT B;  4UV8 A;  4PDR A;  4U7N A;  4JPZ B;  2WSS G;  1HJ0 A;  4JZ2 A;  4JI0 O;  4LF7 O;  5H5N A;  4AIL C;  3RYI A;  5BXZ A;  1RPR A;  1QQC A;  2QVA A;  4WFF A;  2PF4 E;  4WVZ A;  4HJG H;  1WPX A;  2YXR B;  3CYO A;  1HBW A;  3H9V A;  1AI5 A;  1SQG A;  3W7S A;  3K5L A;  2ITD C;  1AVY A;  3P7K A;  3TF5 A;  2ZXW C;  2R32 A;  4C7U A;  2KSD A;  1QR9 A;  1PV0 A;  1R6N A;  2N05 A;  5JVD A;  2XU6 A;  5EC1 C;  3E8H A;  5LHG A;  3AG3 B;  4MVZ A;  3MP7 B;  3L71 E;  5GTH E;  5KHJ A;  5CN0 A;  1ZUQ A;  5EYP B;  1L4A A;  2Z5U A;  4FIP C;  4YY3 B;  2L35 A;  3A3Y B;  3TXQ A;  1KC8 W;  1R3J C;  1AI7 A;  4FK5 C;  3B5N D;  3ZMS A;  1E79 H;  3P8C E;  3T1Y O;  4BW5 A;  1N73 C;  3RYH B;  3ZRS A;  1J5E O;  1L2P A;  1A02 J;  3N27 A;  3Q5S A;  1QGK B;  5J9P C;  2XOK G;  4MTO A;  4AI8 A;  4AQY B;  1HTL C;  1L4A D;  3DXR B;  3K04 A;  2PZS A;  3M0D C;  5KLV K;  2F43 G;  2EJR A;  1IBL O;  1LTG C;  4H33 A;  1OCR B;  4OXS A;  2V7Q G;  3CD6 P;  3M91 A;  1VF5 B;  2QSA A;  3RYC A;  5LA6 A;  1FDI A;  5E79 H;  1NTK H;  2K9P A;  2V1D A;  3OJA B;  4MVO A;  1ZME C;  4R4L A;  2M7W A;  1QNM A;  4IHJ A;  2ZXE B;  1XDC A;  4WWI A;  2ARH A;  4GKK O;  4P2Z A;  2PI4 A;  1OHH G;  3ZMV A;  5AVY B;  1IZ3 A;  1BT8 A;  4B3S B;  3RVY A;  1FS0 G;  2FYN B;  4WFH A;  1O9G A;  4I50 A;  3TK1 A;  4JTA B;  2X6A A;  4RUF A;  2IM9 A;  3J80 N;  2Y9Z A;  1H8E G;  4JTC B;  1SQB D;  1WA8 B;  3AEE C;  1NR1 A;  2FYU E;  5EK0 A;  2WLL B;  3BRV B;  1VQ7 P;  1ZL8 A;  2HG5 C;  5CA1 A;  1LT9 A;  2BCC E;  1BSM A;  1VF7 A;  3GHG A;  1NTK D;  2Q5U A;  2DQ3 A;  3TGU H;  4JI5 O;  3AEB C;  2V4H A;  5LL6 Y;  1G4Y B;  1MMM A;  1SFC C;  3G4S P;  4JTD B;  1Q8I A;  1YTF B;  3L70 G;  3G71 V;  2A06 E;  1P84 D;  3CL3 D;  3O8Z A;  1AJP A;  2GUS A;  4H0L C;  5J2T A;  1JCC A;  5AVV B;  1YZB A;  2L6L A;  1D2D A;  4ZIB A;  1NU1 D;  4L73 A;  3S4R A;  2VQE O;  3J7A U;  2W6A A;  1XQ8 A;  3JCU Z;  3CWB J;  1K9M Q;  1S0V A;  4LFA B;  3H1J E;  4PV1 B;  3SGI A;  4JI5 B;  4FVM A;  3QNE A;  3H1H H;  4LBE C;  2PFX A;  3CCU V;  4NTX A;  5AW8 B;  2HVJ C;  4UCS A;  1S2E A;  1J1D B;  1UPG A;  4EEQ A;  1GMJ A;  1M57 C;  3EVK A;  4BWA A;  1PP9 H;  3LNN A;  4YY3 O;  4Y99 C;  4F4L A;  2A9H A;  1HR0 B;  1SQQ J;  1S72 V;  3AE8 C;  1GM8 A;  4XE5 B;  4JGS A;  3L74 E;  1ZR4 A;  4QPJ A;  1AV1 A;  1JUN A;  1N73 A;  1GL2 C;  2OWO A;  1K7D A;  2ZR2 A;  5B66 H;  2XAF A;  3FB5 C;  3WUU A;  2F1M A;  1QLE B;  2HEP A;  3OEE G;  4JYA B;  1WB8 A;  1WPB A;  5KHG A;  1VQ9 V;  2IBZ E;  3JSV C;  3SJA C;  2IYP A;  2QJK B;  4GX2 A;  1AP6 A;  4B3S O;  1VF5 D;  3GLM A;  1VQ4 V;  2O1J A;  1PFI A;  4AYC A;  2WPD G;  3HKE A;  3VTP C;  1KU9 A;  4PDV A;  2H7H A;  4NVP A;  4X62 O;  2F66 C;  3CRC A;  2DYS C;  2M3E A;  2RN9 A;  1M56 D;  3M99 B;  3SPJ A;  2BEQ D;  5KA5 A;  3BPZ A;  4ZMD A;  1IFP A;  1QLN A;  3K06 A;  1GTO A;  1ZLZ A;  1K3E A;  2QA4 P;  2KZI A;  3ETE A;  4JI6 B;  3STZ C;  1GL2 D;  1WAZ A;  1JY2 N;  4DR5 B;  1Q81 Q;  4JAA A;  1R3L C;  3JD4 A;  2QIW A;  3EFF K;  1RE4 C;  5APT A;  1MFZ A;  4HKZ H;  3T97 B;  5TIS H;  1M1K W;  2ADP A;  2KSJ A;  1PNM A;  4J7K A;  2M0B A;  3CCQ P;  1YXB A;  4JBZ A;  2B1I A;  2PYL A;  3CXH I;  4JI4 O;  2OIE A;  3L70 D;  5LOV A;  2JR8 A;  1YSC A;  3LW5 J;  3CP1 A;  4DV2 B;  2YIU B;  1AJN A;  4NTW A;  2XV5 A;  4MVQ A;  4JI0 B;  4LF7 B;  5KLV E;  2R3C A;  1SQV D;  3OUS A;  1KYO E;  5KMG A;  4IYI A;  2FB5 A;  2K9Y A;  3HKC A;  2E74 B;  5A2Q N;  2ADQ B;  2ZT9 D;  4WF9 V;  4JI1 O;  3CLQ A;  2R9R B;  1BQ0 A;  4JI2 O;  3V2Q A;  5GTH H;  1KBH A;  5AW2 B;  2W6J H;  3L72 H;  4BW9 A;  3ZMU A;  1R5L A;  2UUA B;  4I7Z C;  3D71 A;  2PYJ A;  3CCR P;  4UFZ A;  1K04 A;  3M8A A;  1GN6 A;  3BCC H;  4XDK A;  1T3J A;  4TWK A;  1D5A A;  1NAF A;  4HH2 A;  2CE4 A;  4DV5 O;  3T1H B;  1GK9 A;  1HP8 A;  3C1L A;  5B66 E;  4RWU A;  2DWD C;  4DK0 A;  5BMV A;  3AE4 C;  4HBN A;  3R2P A;  4RAI A;  2ZE7 A;  1E1Q G;  4OGQ B;  3SYQ A;  1P7B A;  3PHL A;  4DR4 B;  2A45 H;  3KCX A;  3PLN A;  1VQO V;  4X1Y B;  4DR1 O;  1RE4 A;  2FYZ A;  1N34 B;  5AW5 B;  2A0L A;  4TV8 A;  5CBG A;  2ZE6 A;  2ZIM A;  5APU A;  1BCC D;  2VQF B;  3F5H A;  5KAI E;  2R5B A;  2QM4 A;  1H2N A;  1KD1 Q;  2OYH B;  3GWO A;  1FFT B;  2PY5 A;  2A7W A;  3ZED A;  3HD7 A;  3U11 A;  2NRG A;  5FL7 G;  4LFC B;  2YXH A;  1KFN A;  2CK3 H;  1ZW0 A;  3CMA V;  2ODM A;  4QE7 A;  1BMF G;  2FYU K;  1FAF A;  5JJN B;  3RT3 C;  3BRT B;  2X6B A;  3FB7 C;  3B8N A;  3D3Q A;  3OGC C;  1XL6 A;  1SS1 A;  1DH3 A;  1L0N G;  1GL2 B;  2OYH A;  2FL4 A;  1P7G A;  1YTZ T;  1TVK A;  1KYO H;  2OTL V;  3A0H E;  2A79 B;  4YXW G;  3OMN B;  3CSX A;  4JI8 O;  3SYA A;  1IK9 A;  2Y4U A;  2Q69 A;  4PJ0 Z;  2Z3Y A;  1NTM H;  1Q82 W;  1FS0 E;  2ZYD A;  3IFM A;  1OJH A;  3SPG A;  3T1C A;  4DXW A;  3RK3 C;  1SQP E;  4Z1M H;  4WFA V;  5D5P A;  1LTA C;  3H1H E;  2X7R B;  5CA1 B;  5CBO A;  1VQ7 V;  5BZB A;  5H6R A;  1RSO A;  1EZV H;  4L76 A;  1SQQ G;  1ROP A;  3FAV B;  1XTG B;  3NTN A;  4NXM O;  2POH A;  3M9H A;  4UCT A;  2KQX A;  2IJH A;  1H0T B;  1OMI A;  1CW5 A;  1I7F A;  3OR7 C;  2O01 J;  3T1H O;  5KA6 A;  3D36 C;  2LP7 A;  2GDS A;  3JYC A;  4DUZ O;  1Y67 A;  2IX7 C;  2JWA A;  1VQM P;  1H2L A;  2BEZ F;  1LTB C;  3I5C A;  5CBF A;  2Y0C A;  2LGQ A;  2KP8 A;  2NZ2 A;  2WT7 A;  1N2D C;  2OT5 A;  4U3F D;  4GKJ O;  3L75 D;  3CME P;  4UB8 H;  3JAL B;  5LP6 C;  2E75 D;  1M7L A;  4O9B A;  1R5S A;  5C8Y A;  2UXC B;  3K58 A;  3CC2 V;  1G1X B;  1FXK C;  3IN6 A;  4DT0 A;  1NTM K;  3JC2 2;  1PGP A;  1BS3 A;  4JYA O;  2SPZ A;  1K9M W;  2A06 H;  2HOD A;  4PI0 A;  3DTU B;  2P2U A;  5GTI Z;  5KTB A;  3M9B A;  4FLU A;  1ZRT E;  5JCO C;  3UKM A;  1IDS A;  1QBZ A;  1JM0 A;  1OCC C;  1Y74 A;  3ZJZ A;  5IYD O;  5B66 Z;  1P84 E;  1YDX A;  1VQ6 V;  2JEX A;  3JAS B;  2FYU H;  3SYC A;  4KHP B;  3A0H H;  4X1Y A;  1FZB A;  3EHB B;  2LQT A;  1SQX E;  3IF4 A;  4B86 A;  1OCR C;  4TQF A;  5BU8 B;  2WZ7 A;  5CJ0 A;  2XAJ A;  1FZG A;  4C7R A;  3MHV A;  3D8C A;  3L75 J;  3V2P A;  4H13 D;  3AED C;  1T5E A;  1IBL B;  4UB8 Z;  1W5C E;  4O4H B;  2I8D A;  3HE4 A;  5KLV H;  2XND G;  3OFN G;  1MAB G;  3D6Y A;  3KYQ A;  1N73 B;  4AUW A;  1TAE A;  3L73 H;  3D36 A;  4HB1 A;  4KP4 A;  1MZ9 A;  1VMG A;  4B7E A;  4K8X A;  3AE2 C;  3A2A A;  1Q90 D;  4MVU A;  2L5G B;  1S5L H;  2YS8 A;  1Q43 A;  1I94 O;  1GN4 A;  1H8A A;  2R9A A;  1WLE A;  2IBZ G;  1KQS U;  4UVA A;  2L91 A;  1J1D C;  4PD4 I;  5LGT A;  2Y69 B;  4DV0 O;  1T6A A;  1DLB A;  3ZHT A;  4KL1 A;  3O65 A;  4ZHQ B;  2PUS A;  4DV3 B;  3WU2 H;  3B09 A;  1VQK V;  2KK7 A;  1SQQ D;  1EDI A;  5HFM A;  1D7M A;  1MUU A;  1H89 A;  4JI1 B;  4GCZ A;  3V2R A;  1XMQ O;  1OCO C;  1XL4 A;  3F7Y C;  1S76 D;  1D5N A;  3Q4H A;  1BE3 E;  3IR9 A;  1N0N A;  2WLM A;  3CWB D;  2EX3 A;  1LWU B;  3ZHR A;  1YEW A;  3HD7 D;  4A7P A;  1M1K Q;  3VQY A;  1KP3 A;  2CH7 B;  4WCE V;  3APO A;  4MTF A;  5EIB D;  1URQ A;  2B5U A;  2ITA A;  2W6B A;  5FLX N;  1J1E C;  1X22 A;  1JVM A;  4MVM A;  3AEG C;  4JAS A;  3B5N B;  4LLH A;  2OCC C;  3BRC A;  3LSQ A;  1XBL A;  3CCS P;  1IC2 A;  1GH6 A;  5EC2 C;  2JGU A;  3PN1 A;  1LTJ B;  1KV4 A;  1Z5V A;  3HD7 B;  2NPS C;  2QTS A;  4FFB B;  1JO5 A;  3EXA A;  2QJ1 A;  1BGY H;  2K1E A;  4ICG A;  4M3L A;  1XI1 A;  3P30 A;  1SFC A;  5CA0 B;  3RWR D;  2UXN A;  1AA0 A;  3ZBH A;  3GG2 A;  2JDI H;  3HD7 C;  3AG1 C;  2OIG A;  3H1L J;  2QRX A;  1EXI A;  4I4T B;  1O9H A;  3APQ A;  1EC5 A;  1U57 A;  1SQV H;  3AK1 A;  4DRX A;  2MKV A;  1V55 B;  3G3Z A;  1IO4 A;  1JTH B;  3RL0 B;  2WSF J;  1XNR B;  2NN4 A;  1NZ6 A;  2EIN C;  4X66 B;  2IW5 A;  2CGO A;  3CXC U;  2OYI A;  4UCO A;  1HDJ A;  5LXT A;  2EUL A;  5L8R J;  2OYQ A;  4WFB V;  3N7N A;  1NTZ G;  3HKD A;  2E74 C;  1NQT A;  3HKB A;  3L4F A;  1G1I A;  1NTM E;  1S5L E;  3T1Y B;  4DZO A;  1RSO B;  3EQ2 A;  5KUK A;  4CH5 A;  4OPA A;  1XHZ A;  1YYC A;  1TUE B;  2LO1 A;  3K5N A;  4I1L A;  4OX9 B;  4X65 O;  4QMA A;  1S1C X;  1FOS E;  1V55 C;  4ZI7 B;  3TNU B;  2PRR A;  2WPV B;  2FXP A;  2R72 A;  3ITK A;  3D3I A;  2C2A A;  1IFJ A;  4L74 A;  3E35 A;  5ITZ B;  2IFM A;  3Q5R A;  1XMQ B;  4H44 B;  1NU1 G;  1T8Z A;  2JIZ G;  2B88 A;  3TGU J;  1RF1 A;  4F6R A;  4CH3 A;  3S1K A;  4GZR B;  1FJK A;  4YHH B;  1NU1 E;  4PA4 A;  5IJ0 A;  1ZXG A;  1ORQ C;  1Z2G A;  1FD9 A;  4R7C A;  2IDB A;  5J2T B;  1MOF A;  3RYF A;  3A0B H;  3D70 A;  1RM1 C;  2NPS A;  3KPE A;  3QO5 A;  1VF6 A;  2UUC O;  1LUW A;  4D6T H;  4DR6 B;  3PTZ A;  5E1A C;  1X79 B;  1KYO F;  1VIB A;  1VQN V;  1SQX D;  1M57 B;  1JY3 N;  3THO A;  3A0R A;  5L3F A;  4LCU C;  3JD2 A;  4LGD E;  4YPC A;  2LFS A;  3PRJ A;  2WPS A;  2OAR A;  2JKV A;  4GKJ B;  2AEF A;  4IT5 A;  4JI3 O;  1NH2 B;  2UUB O;  2QTO A;  4IYH A;  1OXZ A;  4DO2 A;  3OE7 G;  4P9P A;  2K88 A;  4GT1 A;  3HUS B;  1HNZ O;  3BY6 A;  3ASN C;  4AQR D;  4JI7 B;  1FXV A;  2Q7C A;  4J10 A;  5IWA B;  1YJW P;  1THZ A;  1EZV D;  3VQW A;  2J5U A;  3CEI A;  5JJJ B;  1SQX H;  4WBA A;  1FFX A;  1GN2 A;  4RO2 A;  1NTM J;  3WU2 Z;  3HE5 B;  1YI2 V;  4JF3 A;  3KZI E;  1KTM A;  5K1X A;  4KHP O;  2XAS A;  1LWU A;  3CX5 H;  3MAQ A;  1NU1 K;  4GOE A;  4GUN A;  3HKC B;  3BA8 A;  4LWS B;  3G6B A; 
#chains in the Genus database with same CATH homology
 3QNE A;  5EBW C;  2P7T C;  5LHH A;  4UVB A;  4LBE C;  1NKD A;  3CCU V;  4N23 A;  1JQ0 A;  1JPX A;  3UM7 A;  2HVJ C;  2EIM C;  1YJ9 V;  4MTX A;  1M57 C;  3E8G A;  4MS2 A;  1K73 W;  4RQF A;  4R8C A;  2WLI B;  4F4L A;  3CCM V;  2WLK A;  3H01 A;  3E8B A;  3WG7 B;  2A9H A;  2QM8 A;  2ZDI A;  2YEV A;  1GKF A;  1S72 V;  3ML0 A;  4Q20 A;  2JJ1 G;  3W7U A;  4U7O A;  1YTF D;  2X0L A;  3W7X A;  1GM8 A;  3CCV V;  4JGS A;  1Q86 W;  1F51 A;  4QPJ A;  3ABL C;  5B1N A;  1F4M A;  2BOC C;  1K7D A;  2ZR2 A;  2EZP A;  1GM7 A;  2XAF A;  3FB5 C;  3AG4 C;  1QLE B;  1JCH A;  3KG2 A;  4PA6 A;  3OEE G;  5L3E A;  1R73 A;  4HZ3 A;  3I56 V;  1VQ9 V;  2UXX A;  1Q7Y W;  2WAM A;  4GX2 A;  3MD0 A;  4E2L A;  3FB8 C;  2AHZ A;  2WLN A;  1VQ4 V;  1V54 B;  4DJG A;  2WPD G;  4XBF A;  4I5S A;  5DN6 G;  4PDV A;  4JPR A;  3ZIA G;  2EBO A;  3JD1 A;  2EZO A;  4GX0 A;  4BIU A;  3LSS A;  2DYS C;  1NVP D;  3M99 B;  3SPJ A;  1S77 D;  5KA5 A;  1IFP A;  1R6K A;  5HFL A;  3K06 A;  1GTO A;  1K8A W;  1QLN A;  1K3E A;  1DTO A;  3ETE A;  3STZ C;  2GSM B;  3OM3 B;  1BHB A;  1R3L C;  3JD4 A;  3EFF K;  3K0D A;  1M1K W;  1S3J A;  3STL C;  3ABT A;  1PNM A;  5EBM C;  1MSW D;  2B1I A;  4PDL A;  5L3B A;  1F4N A;  2DQ0 A;  1HWY A;  1YSC A;  2GHY A;  4GX5 A;  2E5T A;  3ZMZ A;  3CP1 A;  5DM6 V;  1EZJ A;  3ZN0 A;  2KB1 A;  1AJN A;  1DF4 A;  3JCZ A;  4H37 A;  4MVQ A;  1JX9 A;  2P90 A;  4I9W A;  2V7Q H;  3FYI B;  3OUS A;  4HAM A;  1GM9 A;  3VOU A;  5B1A C;  3CC4 V;  3CCJ V;  1E1R G;  1AI6 A;  4WFG A;  4WF9 V;  4XDL A;  3ABU A;  2R9R B;  1KKD A;  4BAY A;  4MVR A;  4R6Z A;  1K34 A;  3E86 A;  3RVZ A;  2WLH A;  4RUE A;  4TSF G;  4ZBM A;  3T4D A;  3X2Q B;  2EIM B;  5L3G A;  1VQM V;  2W6J H;  3ZMU A;  2WLL A;  2P67 A;  4FJC C;  1RPO A;  3CD6 V;  1K92 A;  5CBH A;  4PEL A;  1L1F A;  4HYO A;  4XDK A;  2HFE C;  4TWK A;  5L3C A;  3OW2 U;  3AG2 B;  3SYP A;  2ZR3 A;  1GK9 A;  3AEI A;  1FXK B;  5B1O A;  3ZRX A;  2DWD C;  3ABK C;  3RW0 A;  3LNM B;  4RAI A;  2HR3 A;  5B1B C;  1E1Q G;  3SYQ A;  1EBO A;  1P7B A;  3SJQ C;  1K4D C;  1W0K G;  3LDD A;  1VQO V;  1P4R A;  3CCQ V;  3K03 A;  2A0L A;  3ABL B;  4YXW H;  5CBG A;  1GMG A;  3VBB A;  4QNH B;  5CMU A;  2Y69 C;  3TET A;  1JEK A;  2H94 A;  1AI4 A;  5LGU A;  2Q67 A;  5LBQ A;  1VQL V;  2IH3 C;  1VQP V;  5GW7 A;  1SZT A;  2QE7 H;  1LNQ A;  3IFX A;  3IGA C;  3GWO A;  1FFT B;  2NLJ C;  3ASN B;  2P6J A;  4UVC A;  1V54 C;  4X8A A;  4JAU A;  4P9O A;  5FL7 G;  1K33 A;  4R50 A;  2CK3 H;  3CMA V;  4QE7 A;  1BMF G;  1ENV A;  2LFR A;  2YEV B;  4UUJ C;  1I5Y A;  3K08 A;  1H8H G;  2X6B A;  4MTG A;  3FB7 C;  3B8N A;  1N8R W;  1COW G;  3BEH A;  3OGC C;  1Y66 A;  1XL6 A;  2Y48 A;  3SPI A;  2ATK C;  1M90 W;  1NBM G;  1VQ8 V;  3JD3 A;  3OUF A;  2OTL V;  3HPL C;  1QVG U;  3B8M A;  3K9A A;  2A79 B;  1KEC A;  4YXW G;  3OMN B;  2ZQM A;  3SYA A;  4MT8 A;  1JOY A;  5IY5 C;  1BSN A;  2Q69 A;  4WFE A;  4KFM A;  2Z3Y A;  2ITC C;  1Q82 W;  5L3D A;  1FS0 E;  1NH2 D;  1YIJ V;  4MVS A;  3SPG A;  3T1C A;  4DXW A;  4GX1 A;  4WFA V;  5B3S B;  5B1B B;  2X7R B;  1M56 B;  4UV9 A;  5B1A B;  4G27 B;  3W7W A;  1AR1 B;  2JEU A;  4J9Z B;  1MG1 A;  5BZB A;  1VQ7 V;  5H6R A;  3NXS A;  2ZD9 A;  1ROP A;  5IDJ A;  3ZRW A;  3LUT B;  1M56 C;  4PA7 A;  1AJQ A;  5IY5 B;  1AQT A;  2IJH A;  3E89 A;  3OR7 C;  1YHQ V;  1OCZ C;  5KA6 A;  2LP7 A;  3ZRV A;  2FTK A;  3JYC A;  2QKS A;  1E79 G;  1Q81 W;  3TCU A;  3G6E V;  3FKS G;  3MHS C;  5CBF A;  2H8P C;  2XAG A;  1S5H C;  3R65 A;  1GO3 F;  1DF5 A;  3OEH G;  2OT5 A;  2IH1 C;  2HKO A;  5IYB O;  1RM1 B;  5KUM A;  2Q68 A;  3AG2 C;  2ZDI C;  4X88 A;  2XAH A;  3CC2 V;  4FMT A;  1FXK C;  2IU0 A;  5IYC O;  3OMA B;  1OCO B;  1K9M W;  1NJI W;  3DTU B;  3X2Q C;  1IXM A;  4MSW C;  3ZCC A;  2IJK A;  2IJI A;  2YSU B;  1H2G A;  2DYR B;  2WSS H;  1BL8 A;  3ETG A;  3UKM A;  2D3O W;  4QIW F;  1QBZ A;  3LDE A;  1CP9 A;  1OCC C;  1B6Q A;  3ZJZ A;  5IYD O;  5B3S C;  1VQ6 V;  2JEX A;  2R9I A;  3SYC A;  4JAV A;  5H6Q A;  4G2K A;  1PL0 A;  3EHB B;  3FB6 C;  3ZRW B;  3W7T A;  1SRY A;  3E8F A;  4RQE A;  1OCR C;  3CCE V;  3OR6 C;  2XAJ A;  3CCS V;  4L87 A;  4N21 A;  1PKX A;  3SPH A;  4MW8 A;  1CEZ A;  3I55 V;  3RBZ A;  3QO7 A;  2HJF C;  1M9N A;  2XND G;  1QLE C;  1MAB G;  3OFN G;  2MK3 A;  4LC1 A;  3T4Z A;  2AHY A;  4P30 A;  4TLF A;  3D36 A;  4KP4 A;  1K5S A;  1YJN V;  4MW3 A;  3PJS K;  4MVU A;  2EIJ C;  1R3I C;  4ASU G;  2WWW A;  1WLE A;  1KQS U;  4UVA A;  5LGT A;  2Y69 B;  1DLB A;  1J95 A;  2E5Y A;  4TT3 G;  2EIL C;  4QE9 A;  3P32 A;  1VQK V;  5HFM A;  2WLJ A;  4BIZ A;  4GCZ A;  3B77 A;  1OCO C;  1XL4 A;  3F7Y C;  3FYE B;  3ABK B;  2DWE C;  1S76 D;  3HB3 B;  1W2B U;  1SET A;  2WLM A;  4QPK A;  5EBL C;  5LHI A;  3DGE A;  1SER A;  2JK5 C;  1KP3 A;  4KUM A;  4G28 B;  4WCE V;  3F7V C;  3E2E A;  5LGN A;  4MTF A;  4UXN A;  2B5U A;  5C93 A;  4EKW A;  1NVP B;  3CCL V;  2W6J G;  1JVM A;  1OCC B;  4MVM A;  1I5X A;  4JAS A;  3G4S V;  1BHA A;  4CZZ A;  2OCC C;  1W0J G;  3K0G A;  3LSQ A;  3CPW U;  1H38 A;  1FXK A;  1OCZ B;  4LP8 A;  4PA3 A;  5EC2 C;  1PNK A;  1F23 A;  2IU3 A;  2XND H;  2W0F C;  3JD0 A;  1ZWI C;  2K1E A;  1Y4M A;  3P30 A;  3ASO B;  1KP2 A;  2B1G A;  1YIT V;  1PNL A;  2UXN A;  4PDM A;  3CCR V;  2QE7 G;  4J9Y B;  3IC7 A;  3MHH C;  3SPC A;  3AG1 C;  2QEX V;  2JDI H;  2BOB C;  4QJF B;  1PD3 A;  2PI5 A;  4JYC A;  3ABM C;  1R3K C;  4UV8 A;  4PDR A;  4U7N A;  1V55 B;  2WSS G;  1NR7 A;  3K79 A;  1RPR A;  2EIN C;  2IW5 A;  4WFF A;  3CXC U;  3AG3 C;  2W6I G;  4WVZ A;  2NNU A;  1WPX A;  3CYO A;  4WFB V;  1AI5 A;  3W7S A;  1NQT A;  3ZMT A;  2ITD C;  5CA3 A;  2ZXW C;  3CC7 V;  1JJ2 U;  3QO8 A;  1ARO P;  1QR9 A;  1R6N A;  5KUK A;  5EC1 C;  1TUE B;  3E8H A;  3AG3 B;  4MVZ A;  5LHG A;  1QCE A;  4CBC A;  5CN0 A;  2Z5U A;  2EIJ B;  4QMA A;  4FIP C;  3USS A;  1V55 C;  3SYO A;  3LDC A;  1KC8 W;  2DYR C;  3ETD A;  1R3J C;  1AI7 A;  1K97 A;  3D3I A;  4FK5 C;  2C2A A;  3ZMS A;  1E79 H;  3E35 A;  4BW5 A;  3ZRS A;  2DW4 A;  3E83 A;  2IJJ A;  2Q6A A;  2JIZ G;  5J9P C;  1G8M A;  2QM7 A;  2XOK G;  4MTO A;  2JJ2 G;  3K04 A;  4PA9 A;  2F43 G;  4PA4 A;  2EJR A;  2ZXW B;  1ORQ C;  4H33 A;  1OCR B;  4OXS A;  3CME V;  4R7C A;  2V7Q G;  1VQ5 V;  1MOF A;  2V1D A;  1RM1 C;  2XAQ A;  4MVO A;  3QO5 A;  4JYB A;  2X6C A;  3OMI B;  3ABM B;  2EIK B;  2M7W A;  1UJW B;  4X89 A;  5E1A C;  4Z1M G;  1VQN V;  2HLD G;  2QA4 V;  4P2Z A;  1M57 B;  2PI4 A;  1OHH G;  3ZMV A;  3A0R A;  5H9C A;  5L3F A;  3RVY A;  1EFR G;  1FS0 G;  3JD2 A;  4LCU C;  2OTJ V;  2OCC B;  4WFH A;  3K3W A;  2LFS A;  3TK1 A;  2EIN B;  1SES A;  3WG7 C;  4JTA B;  2X6A A;  4RUF A;  4ZKI A;  1NH2 B;  1H8E G;  4JTC B;  2QTO A;  3T2M A;  1QVF U;  1OZ0 A;  1NR1 A;  4XDJ A;  2JDI G;  4DO2 A;  3OE7 G;  2WLL B;  4P9P A;  5EK0 A;  4GT1 A;  1K4C C;  2WLI A;  3OAA G;  2HG5 C;  3BY6 A;  3ASN C;  3AG4 B;  3WFV A;  3ZN1 A;  2DQ3 A;  2EIK C;  1K5Q A;  1FXV A;  1QR8 A;  2EIL B;  1CPY A;  1G4Y B;  1BSH A;  4JTD B;  1THZ A;  2CK3 G;  3F5W C;  1YTF B;  3G71 V;  1YJW V;  2DYS B;  1AJP A;  1FXH A;  3GB7 C;  4RO2 A;  4FPP A;  3ASO C;  1YI2 V;  4JF3 A;  2XAS A;  1KD1 W;  3AG1 B;  2HVK C;  1S0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...