4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type I
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
5JSOA 2IXJA 5EZWA 1ZZ9A 3SHRA 2ET1A 1IPKA 3G7DA 3ES4A 1J3RA 2D93A 3D82A 3KMHA 3M70A 5I8SA 2XKPA 4JV4A 1CAVB 4XFGA 2BYVE 1XE7A 3SCHA 3H7JA 4Q0QA 4Q0VA 2WFPA 2EVXA 4DJGA 5BV6A 2ETEA 2BNMA 4KL1A 5C8WA 1O4TA 4QGLA 1I5ZA 2VPVA 4E2QA 1J1LA 4GULA 1QXRA 1Q43A 1UPIA 3N4MA 1J58A 4QM8A 2XGXA 5FLJA 1NE6A 4HBNA 3NVCA 3CF6E 1VR3A 3ACLA 4E2SA 1O7FA 1AQTA 3PJSK 3TNPB 1O3TA 4PIYA 1XRUA 2FMYA 4Q0SA 3OF1A 5BY5A 5KHGA 3IBMA 3LA7A 4XFBA 1PMIA 1Q3EA 2UYAA 2VQAA 3I59B 5KBFA 2Q1ZB 1UCXA 2B5HA 3IIAA 3SCGA 4R52A 2EAAA 1YHFA 3H8UA 3RYKA 1O3QA 2PA7A 4HSLA 1FI2A 2OZ6A 4IEVA 4YYOA 1WLTA 1RUOA 1YFXA 2IXIA 4XFIA 5JAXA 1FT9A 2D5HA 1O3RA 2MHFA 1LRHA 4YNIA 3H3UA 4QGMA 4ONUA 4UBHA 2CGPA 1J3PA 4I0AA 4IEYA 3EHKA 5BXXA 4QM9A 5BUVA 4MV2A 4MGIE 1UIJA 2XL9A 1ZX5A 5D1IA 3I54A 3R6SA 2GC3A 4L2NA 4LTAA 3RYPA 4I3PA 4HLTA 2ET7A 3BB6A 4EROA 3H7YA 4BYYA 1ZRFA 2GZWA 3BU7A 2PAEA 3S0MA 4XFCA 4KWKA 2FQPA 4META 2CAVA 4LA3A 5F1RA 2P17A 2OYZA 1FS0E 2IXCA 2IXLA 4Q0PA 5HI0A 2KXLA 3KSCA 1CX4A 3HT2A 4FT8A 1O5LA 2H0VA 2Q4SA 4BHPA 4HVQA 4AXOA 3NSTA 3O14A 2XLAA 4J1XA 2K9ZA 4Q29A 3EQEA 4QX5A 2XHKA 2ZCWA 4PJYA 1SQ4A 4AVBA 3U11A 1GQHA 1J3QA 4B29A 3UKVA 1Y9QA 2Q0AA 1L3JA 4FAHA 1RUNA 2BNOA 1UD1A 1X8EA 3TNQA 5I91A 1TQ5A 2QJVA 4MH0E 2EA7A 2Q30A 4HN1A 2D40A 4IEUA 3RPQA 3DV8A 3RNSA 2K0GA 1CAXA 4XFHA 1QWRA 2PTMA 3FHIB 4H7LA 1ZZCA 4FBFA 3GBFA 1Q5OA 2QE7H 5BPXA 2WSSH 2XLGA 4XETA 2MNGA 3HT1A 4MUVA 2OPKA 1I6XA 2CAUA 3D0SA 3E97A 3IDBB 2N7GA 2UYBA 2GC2A 4XF0A 3EJKA 3RDIA 1RC6A 5FPZA 4KWLA 2PHDA 1FXZA 5FCCA 3CJXA 5LRSA 4YSFA 3CO2A 4AVCA 3DKWA 3H1YA 3E6CC 1U12A 5J3UA 2C0ZA 4I09A 4LEJA 4WBBA 1IFPA 4ZU7A 4KU8A 4AQ6A 3BCWA 4XF3A 2E5YA 1YUDA 1LKNA 3ETQA 4EV0A 4IEPA 1QY4A 3U10A 2E9QA 1E79H 5EFUA 1UW8A 3SMHA 4YXWH 4HSJA 3C3VA 3MYXA 4O9GA 5I0SA 2QNKA 2MPFA 2O8QA 1O5UA 3ELNA 4QGNA 5KHHA 3MDPA 4IERA 2XKOA 3LZZA 1X8MA 1GQGA 5FLIA 1OD5A 1ZZ6A 3ST7A 4IEZA 4BH9A 1DZTA 1RGSA 3LAGA 5T3NA 4LUKA 4I2OA 3NL1A 1BSNA 2Z69A 4E2GA 1EY2A 3KCCA 4WVZA 3HQXA 4LLOA 1ZRDA 4K8FA 1JEKA 3UKNA 1NXMA 1YWKA 4EWEA 4XF1A 4JTNA 1CAUA 1EYBA 2CK3H 5JR7B 1CAVA 1CAXB 1PM7A 3LA2A 1QXJA 3CL1A 4NVPA 3OGJA 4MGYE 2ZKLA 3OTFA 4JVAA 1V70A 2W6JH 3QACA 2I45A 1ZNPA 4MGZE 5C6CA 1RL3A 3USSA 1EPZA 2PYTA 1NE4A 1CAWA 4IESA 4XF4A 1DZRA 1ZVFA 3CLPA 1YLLA 2UY8A 3LA3A 4R8HA 3NW4A 2PAMA 2IXHA 4IEOA 3H50A 5FDBA 3WW1A 3IWZA 2XLFA 1H1IA 2IC1A 5K8SA 4MZUA 2GH2A 4XFAA 3LOIA 1LR5A 4ZU5A 4I0BA 1HW5A 3WW2A 4YRDA 2DCTA 5KHIA 2VECA 3D0JA 3IDCB 3H9AA 4J1WA 3B02A 4IEQA 4LA2A 1CGPA 1JUHA 4WZCA 4N9IA 3E6DA 4XFFA 4AVAA 5I0TA 2HJIA 2PQQA 2H6BA 1WA4A 4ZU4A 2H6CA 3E5XA 2Z2SB 1YFYA 4A2UA 5J7MA 2JDIH 4MX3A 2GU9A 2O1QA 1CAUB 4XF9A 4I01A 2V7QH 2OZJA 4IEWA 5CU1A 3SCFA 5KHKA 4O9EA 1J59A 2QDRA 3FJSA 4DINB 1NYWA 3E5UA 5AVPA 4D7TA 1G6NA 3H1MA 4UXAA 5LRRA 4F7ZA 5JCTA 4CYDA 1YFWA 3ES1A 5E1RA 5I0RA 4P9GA 2WC2A 1IPJA 2BEOA 3VHRA 2QVSB 1ZREA 4AQ2A 2D5FA 3L2HA 4KWJA 5I8TA 1DGWA 2BGCA 1CAWB 4MGKE 1WGPA 3FE5A 5FQ0A 3S7IA 3H1WA 1ZZBA 3M3IA 3EBRA 4BIFA 4F8AA 4LULA 4ORFA 3DN7A 4HZFA 3WW4A 5LEJA 2PFWA 4X6QB 5JSRA 1ZRCA 2PAKA 2V09A 2CV6A 2GAUA 3WW3A 4Z07A 3EFFK 3H3ZA 3ROUA 4JTOA 2UY9A 4QXKA 5FPXA 3JZVA 3LWCA 2XL7A 1DGRA 2GC0A 5I93A 1OFNA 2B8MA 5KHJA 3RZZA 4L11A 3KGZA 2F4PA 3CEWA 2ATFA 5LEKA 5CADA 4HMZA 2GC1A 2Y0OA 4EWAA 4X6RB 1NZCA 3E5QA 3KGLA 1EP0A 3FWEA 4TLFA 3OCPA 1SEFA 3NJZA 4UBGA 4EWDA 5JSPA 4LUMA 4PIZA 2B9UA 3NKTA 3DL3A 4IETA 1RTVA 5E16A 3EO6A 4QMAA 3PNAA 4HN0A 1SFNA 3MZHA 1ZZ7A 2XNDH 3FFQA 3MPBA 3HIFA 5I0UA 2OA2A 3SXWA 4FAGA 4RD7A 3BALA 4HVRA 5J48A 3PVBB 1UIKA 4PIXA 5I8YA 3I7DA 1VP6A 4Q0UA 4D7SA 3GYDA 4OFGA 1ZZ8A 4Z82A 3RYRA 4YARA 3FZ3A 1X7NA 3ZDSA 1H1MA 1Y3TA 2BNNA 3BPZA 5FQ0B 1BSHA 5FLHA 3I59A 2E5TA 4I02A 4OLLA 3U0ZA 4IEXA 1ZRRA 3E6BA 2PHLA 1YFUA 3S7EA 1O3SA 4XEZA 3QOPA 1XE8A 1VJ2A 2HKXA 1X82A 3OD0A 3UKTA 1OMIA 4HVOA 2QCSB 1OI6A 3FX3A 4KU7A 3PLQA 1LB2A 5CVRA 2IXKA 4N9HA
chains in the Genus database with same CATH superfamily
1NGMB 3CBNA 2JDHA 2VQTA 2W92A 1Z78A 1J84A 1GR3A 2CDPA 5EP9A 1VBA3 1BK0A 2EF6A 1WZXA 2WPVB 5A6XA 1X8YA 5A33B 5FMBA 4RHV1 1RHI2 1AJOA 4W7ZA 4MXVA 1LGNA 2J42A 3WP4A 3JQXA 1QJY1 4Y26A 4OZXA 1IQDC 4SBVA 5EIYB 3D6EA 2YG0A 3RZLA 2B88A 4XZPA 2D6KA 4FTSA 1D4M3 1H8TC 5TSWA 2CU5A 3ZKUA 2VW2A 2P10A 2NPSD 2OZ6A 4YYOA 5CJ4A 1LP1B 4GJYA 1K05A 3CCVP 1ENRA 5JAXA 4GWJA 1OLME 2FCTA 5IAXA 1AA0A 4QM9A 4MV2A 2FMDA 2E7TA 1AR93 3RMYA 2VO5A 4Q4Y2 1Z7S1 2MEV3 1HRV2 2O01N 4CDUC 1HQWA 3HQUA 4AXOA 2ZGUA 2JWAA 2D3SA 4C8DA 4CUCA 1JOCA 1QGKB 4QX5A 5IAVA 1Q8VA 1GOHA 3SSUA 4YG0A 2GDFA 3WQBA 3WR0A 1VMFA 1WW6A 1DQ1A 4C0HA 1NU1G 4HN1A 2WWJA 5IT6A 3S5QA 3MGUA 3WG1A 2IZWA 2BTVC 1EPWA 2GNMA 3MF6A 1XSQA 3PVNA 3WDUA 2BRTA 1JXNA 1M7LA 4EQVA 5CBLA 1FDMA 3RDIA 5FCCA 4HYTB 1VQ7P 3RG0A 1EDLA 4LEJA 3THTA 2ZT9C 5J96B 3HN1A 2E42A 3CWBJ 1QY4A 1RHI3 3ZDMA 1BCCE 5LBFA 5AVVB 1O4YA 1X9TA 2JEMA 3PMEA 3ELNA 4LHNA 2V4AA 4A7PA 1IC2A 2W1WA 3CCSP 3L37A 3RZHA 1G86A 4FVVA 1H2LA 2VRSA 1WCQA 5FZLA 3FXDA 5IFTA 4LLOA 4GAZA 3D3AA 4GODA 4IE4A 4UT5A 4XTMA 4EN9B 4QU1A 2V7QJ 5C4WC 1KMIZ 1PGJA 1OOPC 1LT9A 4EI2A 4URAA 4XUOA 1OKQA 4HANA 1SQVG 2WABA 4BE3A 3IDAA 3RFRA 4IESA 3AE3C 5LA1A 3LA3A 2QTWB 3NWKA 4BU2A 2WZ7A 1H1IA 2IC1A 3FN9A 1ZRTE 3RK3C 1EUUA 5K8SA 4Q4Y3 4Y28J 3HBZA 2KM2A 1HRV3 3M2MA 4YRDA 3SFDC 3KVBA 3SITA 3VBRA 4CCKA 2Y6KA 1QDCA 1UY0A 1AJYA 2Z2SB 2WNOA 3DPRC 2E32A 2JDIH 2F6BA 3KHUA 2JG9A 2ZEWA 4XF9A 4E8DA 1CX1A 3CX5H 3IMMA 3HE4A 4TT3H 2YXSA 5CG8A 3E5UA 2WO3A 3O1TA 1G8WA 1LT9B 1YFWA 2WYSA 5KAFH 5I0RA 3PUIA 2P37A 4AQ2A 3ZVXA 4MGKE 2GM4A 2N1TD 4LBJA 4FP3A 3VDDC 3RI9A 4GA9A 1T2KD 1PGW1 1YYNA 5JSRA 2HFED 4C7RA 3EFFK 2POHA 4AHWA 5K0UC 5GLUA 4DEQA 3VBRB 3HTKA 1SCRA 2HWF2 3CEWA 1S9KD 1L0NG 1WBFA 1PNFA 4HPKA 3CC2P 5KWRA 1W2UA 2WNUC 1D4M1 5GJ6A 1TMF1 4QX3A 2JG9B 5JSPA 3CXHE 3JXSA 3HE4B 1ENSA 1SFNA 2XNDH 1S72P 3GLMA 4FAGA 1W8HA 4GXLA 3PVBB 4ZHNA 2QKDA 1BEV1 2WLQA 2KXPB 1IS4A 4QPWA 3OBZA 4XVHA 3AP4A 1JB0J 1ZLLA 4MXWA 1LOBA 3L36A 4HFSA 1T3JA 1KD7A 2VH9A 3WQ1A 2XZRA 5KC5A 2VNOA 5LWBA 2D6OX 4N9HA 2WN2A 2MEV1 3SNMA 5AVRB 5L7OB 4L76A 2Q5UA 1D4VB 1CAVB 3HTKB 1LODA 2R072 2RV9A 3B5NA 3O1MA 4Q0VA 4A41A 5DAVA 3KCYA 2CY6A 4UW6A 3ZMOA 4FPLA 3ZYGA 4CPBD 1HWTC 1GL2D 4CEWA 2D2CB 4CCOA 1KYOH 5TISH 4GALA 3ILNA 1J58A 4IW3A 2ZA9A 2NQYA 2Q3EA 5E8AA 1IO4A 1JYCA 1TE1B 4Y22A 5H9PA 1GLHA 2A06D 3CIHA 5FXWA 1KILD 4MXWB 3BKZA 3D4KA 1YHQP 3SCGA 4IDZA 2BFUL 1PP9G 2RR11 4P9XA 2W46A 1IQAA 4UB6H 4PD4H 4QB6A 4QGMA 1NA1C 5LY2A 3B5NB 2HWF3 4N53C 4LBQD 4DNYA 2D6MA 3CMEP 3HE5A 3BB6A 3GGLA 4RS5C 4CEWB 1ZRFA 5A3PA 4Z8BA 4CCCA 3I3MA 1OX3A 1W2AX 1JUNA 2P17A 2OYZA 1SQPJ 2WNEA 4YPJA 1C57A 1CX4A 3HT2A 5KLIC 3RI8A 1N1VA 5L36A 1EZVD 4Y22B 4OHZA 2IBZD 2VAUA 1SQ4A 3OBAA 1ULGA 3W67A 1E5SA 3WHTA 1WMDA 4Q5OA 4ZMDA 1NTKK 2XJRA 2VMGA 2K0GA 5LBBA 4TLGA 1VB4A 2J58A 2PTMA 3ZR6A 1NTZJ 4IGOA 2XLGA 1S0CA 5L73A 1PO12 5CCHD 5IYYA 5FPZA 5F37A 2R073 1LTJA 3H1YA 2CSGA 4Y4YA 4QB2A 5CA6A 3VBUB 3HE5B 1DYPA 1YUDA 2E51A 2KIKA 1S4XA 1Y9BA 5A3LA 2ZGNA 4NPRA 4W8JA 1X50A 3WP3A 4P9IA 4PLMA 5IK4A 2B7YA 4CEYC 2O8QA 5A3OA 2H7HA 1FV3A 1FAVA 4E4ZA 1AL22 5FZHA 1GNYA 1SLQA 1SFCC 3PVOA 3MUZ1 2W47A 1H0TA 3D70A 4LGDE 5APWA 2OYHC 5CJ0A 3B94A 1S1CX 4H13B 4CDUA 4UW5A 3AP6A 4CDXC 1BLZA 1LTJB 5KAIH 2PYTA 4YLZA 5F3IA 5JR2A 2FD8A 5FUPA 4YM3A 2GMEA 2IXHA 1NYHA 1H8TB 3NV3A 1M57D 1ULPA 4YZ1A 3CCMP 1LOFC 4NMIA 1GMJA 1HXS2 4A45A 4ASWA 4D6TD 4I0BA 4L99A 1BGYD 3P3PA 2DCTA 4XW3A 5CFDA 1ZV8A 3V5BA 5FZEA 2E74D 4IEQA 3V64A 2PRRA 3A21A 5T54A 2QEXP 5DG1A 5A7WA 5JIUA 2BVVA 2FYZA 1GTWA 4AI3A 4A2UA 2LW8A 3VKMA 1H0TB 2ENRA 1WT6A 1IS3A 4ASLA 2PAJA 2VE1A 5ANNA 1JBCA 2OZJA 1JZ5A 2KS1A 1FX5A 4PDWC 3A0HE 4CDUB 3H1MA 2GN3A 2WT7A 5GLZA 4M3CE 1PO13 1FOD2 1YQ2A 2JP3A 5FZ6A 5I8TA 2YPDA 3Q5SA 1ZBA2 1W8WA 2W27A 2J1UA 2A75A 4FPYA 4WY4D 3H1WA 3T2OA 1Q90D 3SQOA 4ZS3A 3A22A 2C5DA 5C4WA 2QJPB 5C3RA 1HX6A 4XDPA 2VUAA 3AVRA 3JZVA 1QL2A 5CFDB 3H1JJ 1M1JC 3BCCE 1S55A 3NMBA 1AXZA 5IVCA 1AL23 1VQ5P 5A7WB 1RUI2 1IHMA 3O1PA 3NJZA 3CC4P 4B86A 1W8OA 2OVUA 4M4PA 3QH7A 2GA1A 2KS1B 5E79H 1O8PA 2XXZA 4NO4A 3D6ZA 3PNAA 1I9RA 2OKXA 1MS5A 1FBMA 2W95A 1U5IA 2WT7B 3V0BA 5I8YA 2H89C 4MGSA 1H88A 4OMCA 4D7SA 4EN6B 2W83C 3LQCA 2HWF1 2C24A 1YQ4C 2Q8DA 1VL2A 1OPMA 4IEXA 4H14A 1MS1A 4YW2A 1HXS3 3AE7C 2RHPA 5JSOA 5C4WB 5EZWA 1OW8A 5CMZA 1HF9A 5IVVA 1RUC1 2E26A 1AYM2 1NOVA 5I8SA 1FC2C 1ZBE2 1GANA 5FK8A 2PHXA 3AP7A 3F89A 1CR7A 2ETEA 4UW3A 3VDDA 3MIBA 1RUE2 2NPSA 1OXCA 2ZS6B 1W8NA 5DUXA 1S0FA 1E5IA 3H1JD 1OLQA 1USDA 2C9LY 2ZGKA 3ACLA 1O6UA 3PJSK 1GOFA 4WM7A 4ES8A 3V0BB 3K4AA 1FOD3 2M5AA 2DUPA 2FMYA 2R071 5KHGA 4ASVA 2YO3A 1ZBA3 3W21A 1UCXA 2A06G 3RK2D 1MPXA 3DPRB 2WNUA 1HGVA 3FGAD 2JWPA 2Q1KA 1O3QA 4HSLA 4UFIA 4LC1A 1LGCA 3AKPA 3VMZA 3AMMA 3AB0A 3VZKA 5FZ0A 4JX0A 1UZYA 2CGPA 2HYNA 1ENXA 4I0AA 4FPOB 2ZEYA 1OPOA 2G4IA 1OFSA 2KK7A 1ZX5A 5D1IA 2XONA 3L71J 5C70A 3VDDB 3VL9A 1RUI3 1TME1 5FO7B 4P00B 1LU2A 2NPSB 3LIEA 3ATGA 4AI2A 4FQZA 4GB32 3VZMA 2FQPA 5JPMB 1REDA 4MADA 4QKDA 5HXMA 1JCCA 1OZHA 5B66E 3I97A 5IVJA 5HCFA 2M5AB 4Q29A 2K9ZA 2WZ8A 3PUAA 2DURA 1NTKE 3WINE 3H1IJ 4Y3OA 4B29A 1SS1A 2IBZG 4Y24A 5H2FH 3T1LA 2WNUB 3PUSA 5AFEA 2VULA 3O12A 4Z1VA 2DVAA 4DUXA 4XOGA 2WJSA 3GZAA 4CUBA 4MUVA 4ZONA 5LATA 1AR71 4BXLA 1AYM3 1BHGA 4GIQA 2GSYA 4K8RB 2XUMA 1ZBE3 5K7PA 3L70J 4GMP3 3JQWA 1PIV2 4AZZA 5FBZA 3UESA 1W8FA 1RUE3 4D6SA 3ETQA 1S2KA 4CCDA 2RDSA 1V0AA 4HSJA 2NM1A 2IDBA 4OGQD 4OUSA 4QPYA 2FYUK 2YXRB 2XKOA 1PPJD 4BLJA 1YJNP 1AX1A 1BQPA 5T3NA 4XE9A 4RJTA 3WNXA 4IGQA 4QPIA 4P02B 4RS5A 4EWEA 1EYBA 4MYEA 2DVBA 4AW7A 2ITAA 1SQPG 1KB9E 1EAH2 3V2PA 2QA4P 2ZMLA 4DT0A 1HJ0A 3QACA 3J8F1 4ES9A 1AL21 2IZ1A 3M0AA 2VZPA 3TB0A 1PGL2 3FMGA 1PZ9A 5I0DA 3THDA 4B7KA 1IGOA 1HH0A 5KLVJ 4GB33 4MN4C 2ZEXA 4AUWA 3V4WA 1W39A 4H44C 1Y8AA 4YFWA 4D6TG 1KQLA 2K2SA 5KHIA 3H9AA 5KR7A 1BGYG 3L70D 3B4SA 1LCLA 3EWKA 4QQPA 1VMHA 2XBO1 2RN0A 4N9IA 2WLPA 2HJIA 3AEEC 5IJRA 1H2NA 5CYYA 1GSLA 1REFA 4BWOA 4QPIB 4RS5B 2VTFA 1XBFA 2VNGA 3KPEA 1OHFA 1HXS1 4CCEA 5BNNC 2C4XA 1WD3A 4UXAA 4CEYA 5KLIB 2ZJCA 2XVGA 4J25A 3H1KD 1KV4A 2Y9ZA 4YTPC 3KZ4C 4YG3A 1PIV3 1H8AA 1R092 2E6VA 2VBPA 3VZLA 1PFIA 1HB3A 1XYPA 3ROUA 3E1F1 5I93A 1OFNA 4Y1ZA 2K9JB 1GQPA 1YQ3C 1JOPA 1GWLA 1DBNA 2GC1A 2RMU2 1COV1 3AC0A 2KZJA 5KLVD 3E5QA 3FWEA 2JE7A 4E4DX 2PLV2 4JKMA 4UBGA 4P5YA 2HODA 1ND3A 4LUMA 4PIZA 2ZAAA 1KFXL 1KQFB 4HN0A 1EAH3 4CEYB 3HIFA 2HWD2 4GIFA 4P9YA 3R4SA 3WOGA 3Q9OA 2V4VA 5FAXA 1NH4A 3GYDA 3J7HA 1ZZ8A 4FFIA 1SQQJ 4CPBA 1PIXA 3S9OA 3BATA 3CXHI 2R32A 2NMOA 1BDCA 1OH4A 3IM0A 3K51A 1RUI1 3O5SA 4CUAA 4Y5Z0 1MACA 4E4HA 2XH6A 5ACA2 3CKHA 2JXAA 2OYHB 5CVRA 3SEPA 5IVYA 5FP8A 5BNQA 5J09A 1RIRA 2P3KA 4GOFA 1SBEA 3K4ZA 1XOYA 1E5HA 4CDXB 5GTHE 1KILA 3JCUE 1DX7A 4RA0A 3H7JA 3U75A 1JTHA 4MO3M 5KXBA 5C8WA 1UX7A 2LROA 3POSA 3POJA 2VL4A 2HLOA 5FZ9A 2HODB 3GJAA 5F32A 1ND3B 2XR4A 5CB7A 3OGGA 3RGBA 2VNVA 1VR3A 3H1JG 4JGYC 3OEBA 4QX2A 3MIHA 1SLCA 3TNPB 1R1A2 4PQ9A 3QCWA 1AYM1 5APAA 3QH9A 4Q0SA 5BY5A 1ZBE1 1SQXD 5APQA 2JKVA 3AEDC 1PGPA 4GMP1 1DCSA 2B5HA 5FKBA 5K9YA 1A8MA 1V6LA 3UYJA 2EAAA 1QVGO 3RYKA 1BDDA 1R093 2NZ9A 2PA7A 2HYXA 4W80A 3BIWE 4R9DA 1HTLC 4BQ5A 2BEQD 1YFXA 4CU6A 1PMJX 1SQQD 3H3UA 5GZCA 5F2WA 1KILB 2HEWF 1RJ8A 3D5OA 1JTHB 3U4SA 2M0BA 2RMU3 2OS2A 1G7YA 1KDKA 2PLV3 2VUDA 3POFA 1C8M3 5T55A 2CAVA 1ONAA 5F1RA 3G6JB 5CCHA 5FYCA 5GLWA 4KG0A 2HWD3 3AZZA 1O5LA 3WDXA 3LSDA 1XNAA 4Z92B 1W2NA 1ULEA 2J7MA 3ZXFA 2Q0AA 4FAHA 3L2YA 2OUJA 4NIHA 3CJIA 3DV8A 5ACA3 2O8OA 5C7GA 4BQ3A 3LF7A 2X29A 3ZFFC 4HONA 1P84H 2A3YA 4GB31 1LWUC 2TEPA 4A6OA 1LTIC 4XETA 3JD72 5FTTC 4AFCA 2CAUA 4HK8A 4DRRA 3CJXA 5EWSA 2JR8A 2Y6LA 3JBG1 3VHNA 5D8AA 3SISA 2E5YA 1YQ5A 2ZX3A 1IFMA 1VF5C 1CESA 3P7KA 3RL0g 3CHXA 3MDPA 3U07A 1R1A3 5FZIA 2LKMA 2R30A 2W1UA 1RGSA 4XAAA 2QRXA 3L71G 3FFZA 4CU7A 3KHBA 4O9BA 1EY2A 2RJ2A 1YRZA 2J22A 1PIV1 2XJTA 3CJIB 5LK5A 1HRI2 4UB8H 1PM7A 4NWWA 1KQGB 4PBOA 2W6JH 1VAMA 1W99A 3OGVA 4KBBA 3USSA 3PIGA 2Y60A 3AEAC 4UFLA 3H1IG 1B35A 5D8AB 1CAWA 1NG0A 2DBIA 4IEOA 1H6YA 1DYOA 3LPFA 5FIXA 1ZYBA 2BWAA 3I2FA 1X0TA 4GH4A 3J9SA 2DUQA 1EAH1 1OVUA 2A71A 1RUD2 3AYAA 3L70G 1N3QA 3BIEA 4WZCA 3CDZB 2KSJA 3ORJA 3VKNA 5C3OA 4DUWA 2BBVA 4ZU4A 2ZX0A 2ID4A 4PCRA 5FY7A 4RR3C 4N7IA 3SFEC 2V7QH 2VMDA 4BA6A 2BEZF 2XB6C 3JD73 4CYDA 2WINB 1LULA 3ES1A 3M06A 3L2HA 3K77A 3U1AA 3H8XA 4HKZH 1CAWB 3DXUA 3PU3A 1LGHB 3ZYPA 3CQOA 3BTAA 3POWA 4F8AA 4D69A 1ZRCA 2Y38A 4Z07A 4GH4B 5FPXA 3AKRA 3LB9A 2GC0A 2RM22 2OARA 4L11A 3IF4A 1KXGA 2XOMA 2AENA 4HMZA 1NUKA 5AC91 1VBB2 1QHDA 4XXAA 5KLVG 2ZXEB 1RF0C 3AYDA 1HRI3 2WUHA 4PV1B 2YKPA 1FATA 1OUSA 1SFPA 1UWWA 4JAAA 1MZ9A 3ACGA 4RD7A 2ZGOA 3RBZA 2I07B 4QHZA 3N4XA 2R3SA 3RYRA 4QU2A 1X7NA 1X9PA 4AFMA 3TF5A 3M4FA 3C8VA 3IZOA 2D3RA 2HWC1 1ND2A 2VZVA 5APYA 4GJZA 2B87A 1OW6A 5AW7B 2IXJA 4NRQA 5FJKA 3ZXDA 3HD7C 1JZ3A 4JV4A 1RUD3 2JDZA 3HPNA 1URQC 2QQVA 3BYWA 3N35A 3CD6P 4AEMA 5BV6A 1KTMA 5A3WA 1F5FA 5C39A 1A3KA 1G9FA 1T2KC 4E2QA 5A7QA 3FL7A 1QH7A 3THCA 5DUVA 1C28A 1VQLP 5ACA1 4H0LD 1OSGA 1G2CA 3NVCA 1NTMK 2JG8C 5CKQA 1O3TA 5L9BA 2GALA 3B9CA 5IW0A 1FZAA 3LA7A 4I30A 4Q27A 5FOJB 5T5OA 3GM8A 1ND2B 5FZDA 1ZA7A 2B87B 4QQOA 3ZDVA 5BNNB 2VZ1A 1RUOA 5BYNA 4GKYA 2IXIA 3GNEA 2FYNB 2MHFA 1YJ9P 1LRHA 3KS7A 2CYFA 1MUUA 2RM23 1SQQG 4A3XA 3EHKA 2JWDA 1Q8PA 3AEGC 3RK2B 3N9NA 1DQ5A 4JDNA 1VBB3 3C1LA 4WM8C 2ET7A 2VGDA 4HOOA 1VQ4P 4BYYA 4XFCA 4KWKA 4ASKA 2OGUA 2VCBA 1G2CB 4Q0PA 3DCQA 5AW5B 2KXLA 2V72A 3SH5A 1L0LD 5JUVA 3AL5A 5FOBB 4LR4A 4LHLA 3AMNA 1IFNA 1RE4C 4K1ZA 3GXUA 2VW1A 2IFMA 2KYVA 2D6PA 2D6LX 4K35A 1O59A 1JY2N 3FHIB 3M7AA 4ITCA 3AE9C 5BPXA 3CI9A 2QJYB 1QDOA 1CIWA 4BK4A 3D0SA 3E97A 1IKQA 1GK6A 1S3JA 1GZWA 4JDOA 3U59A 4CU8A 2ERFA 5KAFE 4TZDA 3GBWA 1UY4A 4UFJA 3I2OA 1DDLA 1Q81Q 4IEPA 2OW4A 3MYXA 2YKOA 3FLPA 2WYFA 1OVSA 3JD71 4DB5A 3LZZA 3CX5D 1S0JA 1W90A 1OA4A 3KB5A 2WRAA 5LA9A 4N90A 3T0DA 4XCBA 3HMYA 1SLBA 2X8KA 1VBD1 4XF1A 1CAUA 4FPKA 1RYYA 3H1LJ 2YYOA 2ZHKA 4TXWA 1EDKA 4XXPA 2VOXA 2QBXA 2ZGPA 4MOAA 2RS52 3AFKA 2AEFA 1GZWB 5FO8B 3RMXA 4XF4A 3I56P 1Y9GA 1KB9I 1SDDB 4E9KA 4XE5B 3A0NA 4LK6A 3WF0A 2CTVA 3N7NA 1HRI1 4AYCA 2NPIA 3LOIA 2OYOA 1LR5A 1U5XA 1ZM1A 1AJKA 3J7LA 3CPWO 1OVPA 3VDAA 1LHVA 5KC6A 4Y4RA 1N1TA 3HUSC 4UFHA 4LA2A 5FZBA 4RGKA 2WZR1 3B9IA 1SBDA 4BXFA 1QJU2 4IV3C 3GF7A 2VBBA 3G9RA 1OIPA 1UOFA 2O1QA 1CAUB 3I2IA 4WWIA 4I1LA 1KYOE 2EXJA 4ZXEA 2QQOA 1NCQC 3WQ7A 1R5SA 3VYIA 4KMQA 5FQ0A 1NTKJ 3H1LD 4M4RA 2ZACA 4KBZA 4WZFA 4HZFA 3WW4A 3ZFFB 1OLMA 3AZVA 1UIXA 2ES3A 3RBXA 4R9BA 5AVAA 2YMYA 3CU7A 3DF0A 4BRYB 3MUY1 2B8MA 2UWJE 3H3LA 3CLQA 2R3CA 4V2VA 4V2WA 1T6GC 2QQUA 2CWMA 2O1KA 4UB6E 3T09A 1CWPA 4PD4E 2GP5A 3AEFC 2Q6QA 2ZKNA 3H42B 5DXDA 4NJ4A 1PGSA 3L74E 3DL3A 2WQ4A 4CVUA 4KGQA 2YZ4A 1NKZB 3LW5J 2ZYDA 1V9U1 5J48A 1CZTA 4PIXA 1OW7A 4MGQA 2RS53 2BWCA 1YQ8A 2VUCA 5FXXA 1X33A 3ZFEA 3ZDSA 1NU1K 3P8CD 5FQ0B 1BSHA 5C5UA 4JYBA 4I02A 1LAJA 1UZZA 2HEYF 5AVSB 4RR3A 1X82A 4HVOA 1S5LH 4LKDA 1OI6A 1I1EA 4HB1A 1NVOA 1GWKA 4A44A 4LJHA 1UMHA 5FY0A 1UNBA 3SWYA 4M3LA 3QH6A 1SMVA 4WY4C 4DY3A 4YVSC 2E31A 5DJTB 4KL1A 3FXEA 1QJU3 4DS0A 3T08A 1NTME 3ZIWA 4LE3A 2CPSA 1UPIA 2XGXA 1BE3D 3NJYA 3P8MC 3N9PA 3GHMA 3ZFEB 4QQHA 4PI2A 5BU5A 2M3BA 1YI2P 1RMU1 5KBFA 3I3DA 1UF2C 4RR3B 2W3JA 2A45G 4R52A 2XDJA 2FZ1A 1W9SA 1IZNB 1SQBD 5GZGA 1TG7A 1EQ7A 2AREA 1RJ7A 4EZ4A 3ZXLA 2WFF1 2R1DA 3OJAB 5IK5A 4ZKUA 3WEZA 1CZSA 2W6BA 3TDKA 5JWPA 3R0RA 4CTEA 5LBEA 4FPGA 2F4LA 3RRDA 4JGZA 2DVGA 5KAIE 3EFGA 2ARCA 2Y34A 2J5UA 4RGAA 5A3TA 2Q4SA 1QL1A 2QQNA 3I2JA 1W6QA 1NY71 1JU3A 1L0LG 4IFDK 1S2EA 1PM4A 5IUQA 4TTGA 2ZHNA 5GLTA 3BOPA 1P8JA 3JU9A 3OBTA 1VQ9P 1UKGA 4COVA 5JXGA 1Z0HA 4UWDA 2RDQA 4TYSA 4YPCA 1UY2A 1FDOA 2FDKA 1Q2NA 1U12A 3MBWA 2BW8A 4ISRA 2AEMA 1F2NA 2WZPP 4D3WA 1JZ6A 4XILA 1UN1A 3VBOA 4B4QA 4JGZB 3U10A 4OI2A 1AUYA 3PUQA 2MPFA 2WWUA 3HD7B 2EXHA 4GKGA 1AR61 1GQGA 4FOQA 1OD5A 1QOTA 2R061 3ST7A 1W6QB 1URQB 4GMP0 3L35A 1J2JB 4YW5A 4JTNA 3R4UA 1GD2E 1DQ2A 4WVWA 1FZCC 3NAPC 1UYXA 1X36A 1S0DA 1D2QA 5DUWA 2V5DA 4K21A 4AQTA 1CQ9A 1IZ3A 2P58A 5E79E 1JOBA 2A3WA 1WLCA 1V6JA 1URXA 4EE2A 3H1HD 1WD4A 2GH2A 1JYXA 2VCMA 2P1JA 3PHLA 1JZ8A 2ZBJA 3WW2A 3T3YA 4JBZA 3I2DA 4D7YA 4EZHA 1QOOA 4Q4X1 2RS51 1JUHA 3TAYA 4AF9A 1EXIA 2D2CD 3M9HA 3RL0B 4XFFA 1DIPA 4BIOA 5FP4A 4S2DA 2IUWA 4WM8B 5C8CA 1L7QA 4MX3A 3TNUA 4OGQC 2ZMKA 3BRVB 1H4HA 4IEWA 5JOZA 3NNLA 1IK9A 4GWIA 1E57A 4D7TA 4ZPIA 4P9WA 1SBFA 3ZXEA 3IN9A 2WL1A 4K40A 2R1BA 3ZN4A 3IB3A 2BGCA 3H8OA 1WGPA 1D7MA 3M3IA 1QJU1 3H1LG 5B4NA 4C1XA 2PAKA 1O91A 3L73E 3B5ND 3AE6C 4CXYA 3LEMA 4OCTA 3ZN6B 1Z7S2 1CSBA 3M91A 4ASMB 2PN5A 2PGDA 3KV5A 5C8CB 1W9TA 3N7MA 3TNUB 2GN7A 1EDJA 3RJ2X 1R5LA 2QDNA 3WU2H 1ZZ7A 3SH4A 1NU1E 1DYKA 1US3A 1AXYA 3BPZA 3CZUA 4WB4A 4ZNCA 4IV3A 1RUJ1 1NKNA 1AQ5A 2WSVA 3OD0A 3GF3A 3UKTA 4KWUA 1D2SA 2H8PD 4ZXKA 3AE4C 5H9RA 1GNZA 3K5BA 5FYBA 3DECA 2X09A 1K5MC 3WT3A 2WMMA 1N86A 2ADDA 3KQ4B 1NTKG 1N1SA 2XJQA 1QJY3 4BZ4A 4GULA 1QXRA 5DAQA 2G9FA 3VN4A 4A3ZA 2QM8A 2AXCA 4U3FD 4GWMA 1W6PA 3TGUD 1K8AQ 4NPEA 3X29B 1BE3G 3B8EB 2J1TA 3C7EA 5LZ6A 5DJUB 2JE8A 2Y9YA 2PHTA 3GHGA 2BDRA 4IV3B 2WKKA 2H43A 4IE0A 4LKFA 2YFZA 2PMWB 1W8TA 1W2BO 1WLTA 3FHAA 3VZJA 2WAAA 1SQBG 4AGVA 1WLDA 5BNOC 4ZZ5A 4FFFA 1Z7S3 4Y20B 4YFZA 5A70A 2W1SA 4JZRA 4W7YA 4UFKA 4EROA 3GF6A 1SQVD 4QHOA 3WNNA 5LA2A 3FUOA 4GZ9A 4LA3A 1ZR4A 1W6PB 1NLRA 1NKGA 1VRH2 1OF3A 2X53S 3BOWA 4LKSA 2C0XA 3O1SA 2I2SA 4YVSA 2ZCWA 3ZXKA 3GHGB 4G4FA 1KQRA 2VMCA 3CNAA 1W9YA 1X8EA 3QD6A 2QJKB 3HBKA 3JCIA 3LPGA 5F3GA 4M3CA 4D6RA 3M3CA 1Q5OA 2QE7H 1USEA 1A6CA 1XTGB 1RC6A 2BPA2 1RF1A 4N3YB 1FXZA 1PGW2 4YSFA 1JYVA 3POEA 2VMFA 3MIDA 1O4ZA 4BISA 5FZFA 2BCCJ 2P3YA 3IN6A 4AQ6A 4CDQA 1PVXA 4EV0A 1K9MQ 3O8ZA 4LIUA 1LT1A 3OB8A 4JYCA 4YGBA 1X9VA 5A6YA 1TMF2 4WVMA 1X8MA 5IK8A 1MFTA 5L9RA 4FTEA 3OUIA 1GZ9A 4LUKA 4YVSB 4JQRA 5IVEA 3KCCA 3AKQA 1SG3A 2VXJA 3NNJA 1BEV2 3ACFA 5A1FA 1BXHA 2R44A 3AKTA 1PHMA 4M3CB 1QXJA 4HXCA 3FWNA 1PZQA 3VKFC 4N43A 3ECQA 2PQSA 1RF1B 3OUHA 1YTZI 1APNA 3MF9A 4BQ1A 4MHRA 2AUYA 1QJFA 3CCJP 4CDQB 1POQA 4Q8LA 3ZM8A 1D7PM 1J1EB 4LBOA 4C0BA 1HW5A 4WVMB 2J59M 3MW2A 3B02A 2BCCD 2CGNA 1VRH3 2XJVA 4AVAA 1CIYA 3RK3D 2H6BA 3V4QA 2DDUA 2YU2A 1JY3P 4NPFX 4DRVA 1MVQA 1IJDB 2GNDA 3TYJA 1VQNP 2ZVOB 4QDSA 5A3NA 4N43B 5LASA 2RR12 3KV6A 1A02J 4OUEA 3ASIA 3UGGA 3PTYA 1LOCA 1L4AC 5FY8A 1N73A 1AHSA 4B7EA 2EAKA 1UPSA 1A02F 4L73A 3DN7A 5FZCA 1FZBA 1KYOI 3FBYA 2YUEA 2VMHA 4FOWA 1W04A 3WW3A 1D0HA 4QXKA 1PP9D 1L2PA 3VBFC 1TMF3 1DLCA 5JZGA 2F4PA 2Y6JA 3ZYJB 2JDPA 1W3XA 3NNGA 2Y0OA 1XB9A 3KGLA 4JQ0D 3OEAA 4TLFA 4EWDA 2YC2A 1BEV3 4JPZB 1HJGA 2TBVA 1NHLA 1DIWA 5BNPC 3C7HA 2ZAEB 4P5HA 3WUTA 1IOAA 1F35A 3HQRA 2KA3A 4D94A 1UIKA 4PD4I 3I7DA 5DN2A 5FBJA 5AVZB 3BN6A 3AP5A 5JOXA 1W6OA 1QGLA 3I59A 2E75C 2JD9A 3URFA 3K4DA 1N73B 4BQXA 3NNFA 2JX9A 3PH0A 4XZUG 3JUUA 1FZCB 4Y5TA 1VBE1 2D7FA 4LNVA 3WCSA 3TEXA 4XUTA 1LEMA 3NJVA 2A3XA 1I5PA 2IFRA 1IK7A 2OUHA 5JZGB 2JIJA 5IATA 1JTZX 3L75J 2OYIC 2BNMA 4XMAA 3MP7B 1I5ZA 1GK4A 4FQ4A 2DV9A 2A45H 4NR1A 4Q1PA 2Q1FA 1NCRA 4U3FG 1EV11 4ZZ8A 3TGUG 5DAPA 2RR13 5DMYA 1P84D 5APSA 4XFBA 2QUOA 4QAWA 1W6OB 3I59B 2ARXA 3B3QE 1RINA 1R1ZA 4D6QA 5T50A 4KHXA 1VMJA 4INDA 1JY2P 2YB7A 4ATFA 4AOCA 3VBHA 4UBHA 4A7KA 2AR6A 4UB8E 1J1DC 4IEYA 4P14A 5BXXA 5C3SA 3FX0A 2GUVA 1MEC1 3GMAA 1PK6C 2JD4A 2KUBA 1OURA 1NCRB 3ACIA 4IOIH 1WLWA 2B39A 4XJWA 4K9SA 2IXCA 3L75D 3D6YA 4DXZA 3VD7A 1YYCA 2KR2A 2H88C 1N7SC 1DD4A 3OBRA 5AVQB 3G71P 1J3QA 1LESA 5LB6A 1DZQA 1N47A 3CCRP 3S5AA 4DXTA 1PVC2 3RPQA 4OVNF 3N9OA 1Q8OA 1M90Q 3GBFA 4XMIA 5FFOC 3CWBD 3ZXGA 3A0HH 2KLUA 1V6NA 3L74J 1R64A 3L72J 1I6XA 3LFMA 4R4XA 3IT8A 3VBHB 3PTZA 4Y1YA 5LRSA 1VRH1 1JZ4A 1W3VA 5LY1A 4Q1RA 1FMD1 2WT2A 4FCAA 4KU8A 3AE8C 1NAEA 1B09A 1YO8A 4RL7A 1LNQA 3ZSEA 3D8CA 3PL0A 1BK1A 4N7UA 2Y6GA 1S9KE 5JI7A 3C3VA 4XHBA 4YVWA 3T97A 1A8DA 2AGSA 4IERA 1K5MB 4Y99C 2OX0A 1A78A 1OLRA 2VVFA 2AYHA 1W05A 2WPSA 1DZTA 4AR2A 5KJ7C 3WSOA 1BSNA 4JCKA 1U57A 3KD4A 4G3YC 1NQJA 3Q1MA 5CFCC 3UKNA 5L7OA 5CKMA 3I8TA 1CAVA 5C71A 5KXEA 1SZBA 1XTCC 3OGJA 4LITA 4O61A 1W8UA 4JVAA 3O1UA 1MZFA 1SFCD 4RQPC 1N8RQ 1VQPP 4L92A 3M9BA 4LQRA 5HXVA 1EPZA 1AFOA 4PF1A 3V6IA 2E43A 1RUC2 2R7EB 3MV01 2G19A 1AVYA 1KD1Q 3L72D 4ZY9A 1Q86Q 3QWOC 4YVWB 3E7KA 3T97B 2XKMA 2ZOEB 5BNOB 2JJLA 3U1CA 2X5IC 3APBA 2PXJA 1AZDA 2BCCG 3N7LA 4KGGA 2FXMA 1FZEA 1FZGA 3KCXA 5B4XA 2GU9A 2ZFCA 3NQHA 1K42A 1PVC3 3T2PA 3SCFA 4DINB 3CMGA 4YW6A 2A06E 1R8EA 4F7ZA 1IFDA 4MG2A 1JS9A 3H0OA 2L9LA 3WF4A 2VQUA 5FUIA 4XJZA 5IFPA 2WSFJ 3O7OA 4FXKB 5EJ1B 1C5HA 2AXTH 3I4IA 4BIFA 2D98A 3LIGA 4XCAA 1GDTA 3M0DC 2CV6A 3DGTA 3CCUP 4A42A 3T2QA 4CP9A 1TME2 1Q82Q 3LWCA 2XL7A 4AI9A 2CHHA 3MPPG 2QQKA 5CCGC 1LHUA 5D2AA 2AC1A 2ATFA 3VUOA 4HH2A 4QXBA 1SEFA 4FOVA 2K88A 2YC4A 1EZVE 3TOJA 5CEHA 5JXHA 2IBZE 3LSEA 3VBUA 4TWTA 3EMRA 5B66H 1QOSA 5SV5A 3VLBB 1DU3D 1WCDJ 1Y3TA 4L0PA 4LO6B 1BBT2 1AR81 1SHWB 4YM1A 1YFUA 1AR72 1RUC3 4YZ5A 2OTJP 3ZYIB 1OMIA 3OA7A 3INAA 1H1AA 1FU1A 5AW2B 1W5CE 4CP9B 1YIFA 1KS5A 2HLEA 1BVVA 4XFGA 3UL2A 4BB3A 3TEWA 2C9AA 5AVWB 3SCHA 3TEYA 2D3PA 5JI9A 5FMCA 5IK7A 4QGLA 3BUCA 4TN7A 4EDFA 3ZYFA 5FP7A 4QM8A 2DFCA 3TRSB 3LW5H 2BV4A 1VQOP 1H8TA 1NJIQ 2W5FA 5A3UA 2P2UA 1XRUA 1TNRA 2E53A 4XJAA 3V0AA 2VQAA 3VGIA 1Y9MA 3IPVA 2R042 4OHYA 3J8F2 5F5QA 2E7AA 2JDYA 2VZTA 4PJ0H 5EFWB 4B1LA 1IG3A 4HKLA 1TME3 1RUG2 2VOWA 1UIIA 2DU1A 1SQPD 4P08A 5APVA 1JYWA 4QPGC 1OA2A 3Q5PA 3HVDA 3HNYM 4D6TE 2VC9A 3I54A 4XA4A 1BGYE 1H30A 3BU7A 3ZPOA 2XBO2 2MJZA 4CRQA 2AH2A 3PJQA 4IE6A 5EQUA 3L73J 5AW0B 2UU8A 1NTZD 1LGBA 3K48A 3L75G 4J1XA 2FY8A 3PDQA 1M4WA 3V0AB 1GQHA 4OI1A 1BBT3 3UKVA 1Y9QA 3IPVB 5HV4A 4HL0A 1HLCA 4OULA 1AR73 3ZYRA 3UNPA 2KB7P 3PLNA 1DP0A 5BNPB 3B7MA 3CWBG 5AW4B 1YI9A 4AVCA 5AW9B 4YW7A 1JODA 4OQ8A 3MD0A 1U7MA 1JUIA 2E75B 2ZX4A 1OQEA 2Z42A 4X8PA 1NT0A 2P1BA 2CWSA 1E79H 1PVC1 4QQLA 3II6A 5TJHA 1COV2 2QQLA 4AG4A 2IYOA 2G9ZA 1KGYA 2YGLA 5KLVK 1JM0A 1V6KA 2QQPA 2VNRA 2QG4A 4U2AA 4PV1D 2R043 1OOPA 3S57A 1JH5A 3RZMA 3J8F3 1LOEA 5CZKA 3MLKA 1XNDA 1V6MA 2YIUC 2ZT9B 4DUVA 1RUG3 1DH3A 2YKQA 3AYEA 2FZ2A 4IL6H 1N7SA 4Q8KA 2FXPA 2OIIA 3CLPA 1AXKA 1YLLA 1LT9C 2EXIA 2B4KA 2P3JA 1MFZA 3AKSA 2XBO3 1POV3 4XFAA 2R0HA 3L74G 2VW0A 3L72G 1DG6A 4DY5A 3DPRA 4J1WA 1FV2A 3IKWA 3MFCA 3NV4A 1SACA 3VHPA 2ZAHA 3H1JE 1V00A 5I0TA 2H6CA 3AMHA 2FFDC 3ABZA 1OOPB 5ISLA 2D6NA 3VBRC 2RDRA 1ENQA 1GP5A 1C1FA 1H9PA 5AVPA 5K4LA 3VMXA 1G6NA 5HCBA 5HPOA 5JCTA 4CP0A 3MUDC 2O3JA 2JG9C 4LMFA 4N78D 4P9GA 3FLTA 2ZX1A 1VLNA 1SQXK 3RK3B 3VV1A 1JYIA 5KJ7A 1SCSA 1YCIA 1N7SB 3MW4A 3O0VA 5CFCA 5HCHA 4K6BA 3LIHA 1OT5A 4QQ2A 5K0UA 1OQDA 5LEJA 4ZKTB 3TBDA 1TVGA 2GAUA 5JOYA 1COV3 1VALA 1SQQK 3H3ZA 3UETA 4AQSA 4C46A 3W58A 2NN8A 4QB1A 3LE0A 3GZUC 3SEEA 3HNMA 2R0FA 4RQPA 3KGZA 1MS0A 3ZLIA 5CADA 1XYNA 2YMKA 4EWAA 1LTTC 2HPCA 4OH8B 3GCWA 2PHWA 1S0EA 3ALQA 1JY3O 2BGPA 3BRTB 2J1VA 4UFMA 3OOXA 2JO1A 4IETA 2PP6A 1G1JA 2SPZA 1H6XA 2BOIA 3FFQA 3SXWA 2OA2A 4FOYA 1YQ6A 4U7JA 2OPWA 5FYIA 2ZTNA 5F8PA 4Q0UA 2TNFA 5DUUA 3Q8EA 5CNAA 1W9FA 5FMDA 4YARA 3KT7A 3M3OA 1A34A 3WUDA 1YJLA 3E1IA 1NLQA 5CFCB 5L19A 1ZRRA 3CCQP 1VPHA 5K0UB 3VD3A 2QCSB 3NTNA 3JBG2 1QX8A 1G9BA 1JCDA 4QT6A 3JC22 1GWMA 4AAPA 3W20A 1ZZ9A 3VZNA 2ET1A 3WNPA 2BZDA 4RQPB 3VD9A 4DOJA 5FXZA 2C26A 3T1MA 3AECC 3CCLP 3W68A 3PMSA 3WDVA 4Q0QA 2XUEA 2HPCB 1QH6A 1BBT1 2A1XA 1X22A 2RH0A 3BTXA 1PPJE 5FV3A 3B5NC 1CJDA 1UO9A 2Z79A 1P84I 1PMHX 2IWGB 5FP9A 2FHRA 1AQTA 2PHRA 1PO22 2A6XA 4CEWC 1OUXA 1RQVA 2WR9A 1GNHA 4XJ9A 3DEMA 1U7JA 1DGLA 1VIWB 4Q2FA 3VL8A 3F5HA 1W03A 3K2OA 1NA1A 1ULOA 1RVF1 3L71D 4DIQA 4N53A 3LCPA 1CW5A 3FLRA 5EYYA 1CZQA 4JQTA 2HBUA 2DW3A 2GC3A 3KF3A 4H55A 2R041 5JPNB 3H1ID 5J1XA 4OMDA 3L70E 1GKBA 2FDHA 1MV8A 2GUSA 3KQRA 3KSCA 5GM0A 1WRGA 2H0VA 4HVQA 1RUG1 5JIAA 4AK3A 4E8CA 3GZEA 1JI6A 4OI4A 1NTZG 1XNBA 2XHKA 5FMOL 2W91A 1GOGA 3U11A 2WSEJ 1L3JA 4MLOA 2WN3A 2BBAA 2FCVA 1NA1B 3H1KE 3AEBC 5FZ3A 3JBG3 2K9JA 1JY2O 1NXD1 4N53B 1POV1 2O14A 1Y43B 1AYN1 3M3QA 1ZR2A 3ZSKA 2UYBA 2GC2A 2VXRA 2WS92 3H25A 3VBSC 1UYZA 4H13C 3H32A 2CGOA 1QJEA 4COUA 2C1FA 1WMXA 2QZ3A 1LTJC 3N7JA 2JB4A 5F39A 4D8MA 5AC92 5FRAA 1ZP0C 1SFCA 1JNMA 2WVRA 4FPHA 1UYYA 5KLVE 5KHHA 1PO23 3N3HA 2OYHA 2J1AA 3AZXA 4NUBA 4QPGA 5GLVA 3BI3A 1GW4A 2A70A 1VF5D 2ORZA 2YBSA 2NZ2A 1J83A 1YWKA 4CDXA 2FDGA 4QDQA 3LA2A 3HOBA 4NVPA 2ZKLA 2W6AA 3OTFA 2HWC2 3L73G 3A4UA 4RKUJ 3K3NA 1LOFA 2K3RA 1YTZT 1LEDA 3CC7P 3WU2E 4Q4V2 2HR3A 5FYSA 1BCCJ 4YGCA 3H32B 4FPFA 2ZVNB 4YXDC 3IWZA 4JDMA 1REEA 4NHYA 1CPNA 4PQQA 4XJUA 4ARYA 3RZGA 1SFCB 1FOSF 5T5LA 4L8QA 5FYHA 3VKLA 1FPN1 3VDBA 2VU9A 4EYUA 2I1JA 4QPGB 1UU6A 3POIA 4PDWA 2QJPC 1ZMEC 2YROA 2PELA 1XSRA 5CFDC 5J7MA 2YXQB 1RB8G 1BKZA 1GZCA 4M0NA 1N3OA 5KHKA 2DCZA 1KFUL 2LXBA 3PVEA 1SQXE 2O1JA 1VBC1 5G04L 2DTYA 2BEOA 1ZREA 2XWBB 2WS93 1LHNA 3A0BE 4XUPA 3AYCA 1DGWA 3ZSJA 4EJRA 4W50A 3K75B 3HNBM 3LD8A 5T5PA 1SQQE 1M1JA 1UOJA 4LULA 3T4HB 2PFWA 1R081 4X6QB 2V09A 1IS5A 4CCNA 5AC93 3Q3DA 5E89A 3TK1A 4OUMA 4AVSA 4IFMA 2X10A 4P9LA 1GU3A 1FDIA 3HAGA 1STMA 3HN3A 2IFWA 1BCCD 3W5MA 4PDWB 3I5CA 3HEIA 2JECA 4OHXA 3GJBA 2ZGRA 1EP0A 2E76C 2YMZA 5LA0A 3OCPA 3WDTA 1H2MA 1YITP 2XQRA 3FUQA 1EDIA 1HVVA 5GTIE 3Q2YA 1L0LK 2HWC3 1BYHA 1KJLA 2BQPA 5C3QA 5BU8B 3P1IA 4Q4V3 3ZFGC 3QBQA 4LO8A 1EZVI 3PUHA 1KORA 2IBZI 4S2HA 2FFDA 1M1JB 2HKXA 3PLQA 1LB2A 1FJKA 2DCKA 3GDBA 4LORA 2ZX2A 3MIGA 1UOGA 2W08A 2YIUB 4LPLA 3THPA 1SFYA 3MUDA 3G7DA 2OXBA 3D82A 3RVHA 1ZRTD 1CJPA 5FZ4A 1XE7A 1MQTC 4FPEA 3B71A 5JMOA 4C1WA 2YDEA 4AFBA 4ATEA 4KI5M 2Q8CA 5FY9A 2YO2A 3HD7D 2I8DA 3ZOIA 1VBA1 1NE6A 3J26N 3JB4C 1URQD 4E2SA 1NZIA 1YNAA 1VBD2 2NPSC 3GCXA 2ZYAA 4EN7B 2FYUE 1HBWA 3OF1A 3IBMA 4A7YA 1WUVA 1JW6A 4BMEA 1LHWA 1Q3EA 4I2LC 1SLIA 2ADEA 1ASJ2 2FFDB 4WM7C 2JJ6A 2YBPA 2LUWA 3ZYHA 4E27A 2JICA 2VMIA 2XG3A 4HETA 3B93A 2YHJA 3PJYA 1Q8SA 1VQMP 3O6QA 1PX4A 5F5AA 4XHXA 1PO21 2TUNA 2RG4A 5BUVA 2Q8EA 2HWB2 3KVAA 2KP8A 4GOEA 4BQYA 5AVXB 5DDJ2 5ABJC 4PBPA 3RQ0A 2WZR2 1AX0A 3LDKA 1FS0E 4OI0A 3I2KA 2RS32 3RL0D 2WSCJ 1AR91 4BHPA 2BOJA 5A3MA 3AZYA 3NSTA 3VD5A 4IFFA 3CXHD 1MZ5A 1UY3A 1T2XA 4PJYA 5KKZC 2XJPA 2ZXQA 2BNOA 3H8RA 1XU1A 2VMEA 2E33A 3OSDA 4P9JA 2BERA 5CAZA 3HWJA 4HPKB 3KT4A 1SP4A 2WSSH 2OPKA 3O6QB 2N7GA 3RSJA 4Y1XA 3A2AA 1WW7A 3E6CC 4DCKA 1WMKA 4XF3A 3C9IA 3CCEP 1LKNA 3IAPA 4Y1VA 3Q8BA 4Y33A 2B9VA 3MO4A 4O9GA 3IIIA 1YJKA 1O5UA 1GICA 4RGGA 3A3YB 4QGNA 4QXHA 1VBD3 1PV3A 2VOKA 2A7AA 5AVTB 3R05A 1JHJA 1RHI1 3HR9A 3WDYA 4IEZA 2NP0A 1N3PA 2WS91 2XV5A 3VMAA 1V9U2 1ASJ3 1JEKA 3WP6A 1NXMA 3WMM0 2CK3H 1XNTA 3C2UA 2J1RA 1TU3F 5APUA 4UF0A 4K3AA 4HKWA 2WWSA 4QX0A 3KYQA 3WY6A 4QPIC 1UXZA 3P32A 4MGZE 1K45A 2LR2A 1EXJA 1LOGA 3ZR5A 2ZGQA 5FPAA 1W2OA 4WV8A 1PL5A 4F3JA 2WO1A 4R8HA 2HWB3 3W5NA 5DDJ3 1YI7A 4CXWA 4N8MA 4YGEA 2WZR3 3T0BA 1BVP1 3UJQA 3LEKA 2RS33 4XAEA 2D43A 2FDIA 2Q1MA 5L9VA 4Q4Y1 3VBSA 3E6DA 5BNNA 2OQ6A 4Q4V1 2CDOA 4LHKA 1WA4A 4NOTA 1HRV1 4IQPA 1OA3A 4D6TJ 3PURA 1BGYJ 2N1TC 1J59A 3N36A 4UF0B 1RMU2 3H6PA 2I74A 2XVLA 3DKQA 5EV7A 5LRRA 4CZSA 2WC2A 2QVSB 2VG9A 2Z5WA 2VY0A 4BMBA 3Q5RA 3A0KA 4H44B 1SLLA 1ZZBA 4LXLA 1GV9A 1S1AA 3EBRA 1IKPA 1S0GA 2WFF2 2ZMNA 4OHVA 4B8EA 4AHYA 1SQBK 1UOBA 4JF7A 2QQIA 2WO2A 3I2HA 1HGZA 1FE6A 2JDAA 2JIGA 3RWKX 3KQGA 3BTYA 4JTOA 4AFAA 1LTGC 3C7FA 3ZSMA 2W9XA 5HBAA 1KJRA 5KHJA 1OD3A 3MW3A 2L91A 1HB1A 2Y6HA 1RUH2 4QX1A 3VBSB 5LEKA 4YW3A 2VVEA 3MIEA 3OGSA 1BCCG 3U78A 1V9U3 5ERLA 3ZXJA 3MV11 4URTA 1L0LE 1NY72 3LKJA 1MS8A 4QMAA 3ON7A 4LIVA 2QFEA 1LOAA 4AVVA 1CD3G 4B3NA 1M8OB 2KLVA 1ND3C 1QLED 2XJSA 2WSFH 4KH9A 2V4HA 3AP9A 1T6BX 2PHLA 4R4LA 1AVOA 3QOPA 3FX3A 2ZXXA 1NOHA 5A1LA 3ZX7A 5FY5A 2A73B 1HQLA 3ZPYA 1GL2C 3BCCJ 3A23A 4C91A 1SLAA 2WT1A 2LRPA 2W1QA 2ZGMA 5DZFA 3ZMNA 4PF5A 4BDVB 4R4ZA 1F4HA 2UURA 4JGYA 1AR62 1GP6A 3CX5E 2R062 1Q43A 4H3WA 1KILC 2VM9A 4CXXA 4WVVA 3WG4A 3ITKA 1RMU3 2XJUA 5IWFA 1GU4A 3MHZA 1SLTA 1HKDA 1QF3A 3KHCA 1MZ6A 4NPMA 2C9NY 1NQDA 3LEIA 3ZYBA 4GD4A 2WFF3 4HT1T 1BMV2 1XYOA 2GNTA 1FI2A 4D0QA 1RE3C 1T8ZA 4NHXA 3I49A 2ZPXA 3F95A 4HK9A 2N9BA 3AXEA 3ENRA 5IVFA 1HDKA 5F6LB 3T2TA 1U5YA 1RUH3 3ZFGA 2WIIB 2FCUA 3RZKA 2VOTA 3SC7X 4L2NA 4JGYB 1K3IA 2GP3A 3WX5A 3SWFA 3ZXAC 1CPMA 1ASJ1 3BCCD 3UIAA 2PAEA 2WQZC 4Q4X2 3FWLA 5E6HA 2WITA 2XDVA 2DYCA 4QKNA 1IFJA 2WA4A 2VBDA 3O14A 1JMBA 1MQTA 3ZFFA 2KI7B 4B1MA 2Y26A 3ILRA 1LWUA 3BTZA 4A7ZA 4UAPA 5CCHC 3OUJA 3USUA 5F9TA 2HWB1 4I0WB 2E76B 2XWJB 2I1KA 4BRYA 3KM5A 4IXLA 5DDJ1 2EA7A 4RFRB 3JSVC 4NIAA 2AZ5A 4H7LA 4FBFA 4GT1A 3A5TA 2EIEA 4IGPA 1WCSA 5E88A 2WZEA 3GZTB 1XPWA 1TNFA 4XTPA 3ZO0B 3H1LE 2RS31 2DVDA 3CJIC 4XF0A 2E7QA 2XNXA 1OF4A 2ZGTA 3MEPA 3CO2A 1RXGA 3WNLA 3ZFGB 1I3HA 3SKJE 3B69A 4F83A 1MR5A 4ZKPA 5EXOA 5J36A 4EYYQ 1AR63 5TISE 1K73Q 2R063 2E9QA 1UW8A 4L9BA 4YXWH 5D8AC 1WCKA 2AXTE 4XURA 2NMNA 5GZDA 1MQTB 5AVUB 3ITQA 4BH9A 5CIRA 1LWUB 2RKLA 4WVZA 2A6YA 3USUB 1ZRDA 5LBCA 2WA3A 5ABJA 1KS4A 5JR7B 4AI1A 2DTWA 4QHBA 1KQSO 3POGA 3CL1A 2EIDA 5GZEA 2IZ0A 3P8CE 4MGYE 1RUJ2 3DXTA 4XQWA 2LS6A 1ZNPA 1WW5A 3AJYA 1VF5B 4ARXA 2E74C 2XHNA 2Y6FA 2C9KA 1U5ZA 3OAKA 2VOVA 4QX7A 4WM7B 2VZ3A 3WF2A 1B35C 2YU1A 4Q4X3 4UW4A 1EZVG 4ZU5A 1DEEG 3S30A 4A4AA 5KTBA 3IDCB 4UYBA 1HIXA 1C3HA 2PHFA 2RVAA 4RO0A 3RGUA 1BE3E 2PQQA 4GH4C 3V65A 4CPGA 3NKGA 3DYMA 5ABJB 3WVJA 1POV0 4AGRA 1NTKD 4I01A 3U1XA 2B42B 2YPJA 1NYWA 1DF0A 3LEGA 3GHNA 4MVTA 4IV1C 4LHSA 5APXA 2D5FA 4PV1C 2XU6A 3I3QA 3FE5A 1SQBE 4PT6A 5KKZB 3PP5A 4PI0A 2IPPA 2Z4FA 1PO11 2A6ZA 5J37A 3M8LA 4C90A 3ABVC 3C7GA 2D97A 3UGFA 3MI8A 3H1KJ 3Q8CA 2Y8KA 5F7UA 5FZKA 1UMZA 1DGRA 3NRUA 3AE5C 1WKYA 2WQYC 2SBAA 2RJLA 1RF0A 5B5EH 1JU4A 4PJ0E 3GALA 1H2KA 4X6RB 4ZS2A 2H0BA 2B46X 5CISA 1SQVK 3MGNA 1FNZA 1FAYA 4CDWC 3PIJA 3WG3A 2OQQA 3VZOA 5F3CA 1J1TA 1RUJ3 4FI9A 4NIGA 2B89A 4W4ZA 2N9YB 2DFBA 1KITA 2ZHLA 4GKXA 5IHRA 3FBMA 4NAMA 3OD4A 1HB4A 1JMUB 1XE0A 3NFQA 1YBKA 1KB9D 3EB7A 5FZMA 2BNNA 1RUH1 3KT1A 4IL6X 1Y7BA 5FPLA 3HD7A 3IAQA 4ISQA 2A6WA 1UU4A 2ZZJA 4YWAA 3IMNA 4DFSA 2N1TA 1URQA 2ZJSE 4R4MA 4EIJA 5FPUA 1ND2C 5FY1A 1IPKA 4FP2A 2D93A 1ZOYC 3OGRA 3AE2C 1W0OA 2W0XA 3T0AA 2WFPA 2EVXA 2A5ZA 2JG8A 5HV0A 1O4TA 2FYNC 3DYPA 1J1LA 1ZRIA 3WUVA 4CUGA 4LBMA 3AZWA 3RK2C 4HBNA 3KLSA 1OKOA 4CCLA 1O7FA 5KXDA 1QIQA 3U14A 4XQDA 1PMIA 2UYAA 1L0NK 2NLRA 1UMIA 1FOD1 2N1TB 3NXSA 4XDOA 1ZBA1 4CSWA 2W39A 4WM8A 2FBEA 4YNIA 2G9GA 1SQXJ 2NYYA 4ONUA 1RXFA 1J3PA 4RN5A 1C8M2 3P6BA 3MLLA 3H1HE 2YY1A 3VDCA 5EPAA 1UIJA 4FFGA 2QJYC 2Q9IA 2JG8B 1H8VA 3I3BA 1HJFA 3BASA 4HLTA 3KZIH 5G05L 2GZWA 3FC0A 2BVBA 3AFGA 1RE4A 4IL6E 1BMV1 3BCCG 1SVFA 4LE4A 1GL2A 1RUF2 5HI0A 1AV1A 2ZZQA 2AEJA 4JRAA 1ZA4A 3WP5A 4FSJA 4DZOA 2OTKE 4DQAA 1CZVA 1E5WA 4IEUA 2ARBA 3DUIA 3ZN6A 1CAXA 4AAXA 5F6KA 5FYYA 2GNBA 1UQXA 3WLUA 1NAFA 2UWAA 1UXXX 2MNGA 4QX8A 3SWKA 2D44A 1UY1A 3KF5A 1S0BA 3DKWA 1IS6A 2PFXA 1VAVA 1CVNA 3KV9A 5J3UA 4YM2A 2LM3A 3BCWA 2J1SA 1GP4A 5FY4A 1Y4WA 4LBQA 4YZ2A 3VP9A 1RE3A 1QKQA 1Y47A 5I0SA 1GL2B 1E5RA 4XFJA 3VKOA 4QXCA 1DHKB 5C33A 1RUE1 1F5JA 4CP1A 5FZGA 2WSEH 2VCCA 2HWE2 4E2GA 3HQXA 2JB8A 5B2GB 4NE9A 1GBGA 1JYNA 1CAXB 3J7MA 3S1KA 4JKLA 4COWA 1V70A 1HN0A 2A6VA 3M9QA 3AM2A 2RJKA 1OWAA 1XC6A 3Q8AA 1VBE2 2Z4EA 1LENA 1PZ7A 5CBNA 3AXDA 2FYUJ 2Z5HA 3H50A 3OG2A 2XLFA 4FTBA 1YQCA 3HUSA 4LBQB 2ORXA 1RUF3 4IE5A 4BOWA 2Y0DA 3D71A 4JHTA 3TN92 4FFHA 5FK7A 1QQP2 4U3FE 1EV12 1W06A 5H2FE 1YFYA 3TGUE 2O01J 2OQ7A 1Q56A 1OH3A 4XDQA 2QQJA 1NCQA 5CU1A 4Y20A 3FJSA 2Z5IA 4B4PA 3P5BA 1C1LA 5GALA 3PRJA 2LALA 1VRBA 4CU9A 5T5JA 5FYUA 2DCYA 4LBLA 5SV8A 2G8YA 3O0XA 3S7IA 4DPNA 2Q5TA 1DQ4A 2A45I 3HUSB 4Z1MH 1PPJG 4RFT0 5A6QA 4LLHA 4YW1A 1MEC2 2UY9A 3N9MA 3GG2A 1YIJP 3CZJA 3I55P 1U0AA 1L4AD 2EICA 1BJQA 2FYUD 2G3AA 1SQVE 4NHLA 5FREA 4JKKA 3O1VA 1IFIA 2HWE3 4AE2A 2PHUA 3VOPA 1M1KQ 3UGHA 3WG2A 3LOBA 1G9CA 5A7PA 3G6EP 4CP2A 5FYVA 3AE1C 1PGQA 1FNYA 1NCQB 2ZYGA 5E16A 3EO6A 3K46A 4YZ4A 1MS4A 3K3OA 2KNCA 4ET7A 1TZOA 4M00A 2GMMA 4Z82A 1VPCA 3FZ3A 1VBE3 2KSEA 2VVDA 2JDMA 3SLIA 2V5YA 3ILFA 2E5TA 4OLLA 2XPJA 4L75A 4HKOA 3S7EA 4LO7A 1O3SA 4XEZA 4E4SA 1CI6A 1YJWP 1FMD2 4WY4A 3ZFEC 4PLOA 1UZVA 4JRLA 5F2SA 4NHMA 4O65A 4DXRA 3E1RA 1F15A 3MHVA 1PGL1 3ES4A 4IV1A 1J3RA 3M70A 3TN93 2E75D 1F8VA 5AVYB 2VZSA 2EIBA 1QQP3 5AW6B 4DJGA 2E74B 1EV13 1VE0A 5A7SA 3LFIA 3H1KG 1B35B 1G9AA 5FLJA 4K20A 4OWFA 4OYUA 3CF6E 4FPCA 4W65A 2KNCB 3F2ZA 4FXGB 3RS6A 2Q7CA 4NPDA 1L0NE 3CX5I 1ODNA 4W6WA 2Y0CA 2SLIA 4SLIA 1YHFA 4Q26A 2ZT9D 5GZFA 3UT0A 4CDWA 1NO4A 1CI6B 1ACCA 1LU1A 4EN0A 4WY4B 1KFMA 2WT0A 1MEC3 4XFIA 4NPLA 3ETPA 1FT9A 1O3RA 4AEDC 3WUUA 1JY3N 3MTUE 2Y33A 4IV1B 2KOGA 2YFUA 5A32A 1R091 4CCMA 2R5BA 1AL0G 3AVSA 3CXHH 5FXVA 3WNMA 2XL9A 1F31A 3C7OA 3R6SA 3I2GA 2W8ZA 3RYPA 4I3PA 2WNVC 5EYXA 3U37A 1N2DC 2BCCE 3I3EA 1D0GA 4META 3B00A 1DGRN 2JDKA 4GQ7A 3QLQA 1HB2A 3BVCA 5CBOA 3RK3E 2RMU1 2HYKA 4BM8A 2PLV1 2XLAA 4JGZC 1GFF2 3IR9A 1C8M1 1LTBC 3EQEA 1LJ2A 1SPPA 4AGGA 3WCRA 4AVBA 1RUNA 1UD1A 2HWD1 1XJAA 3WNOA 2QJVA 4MH0E 2X05A 3LIDA 2GMPA 4CDWB 1W2EA 4XFHA 1QWRA 1DFQA 1FMD3 1L0LJ 4LBKA 1EUTA 4H2AA 3FHQA 1RUF1 3HT1A 3G3ZA 2XQXA 3IDBB 1N7SD 2IFNA 3O0WA 2WPRA 4OZOA 1G1IA 5A32B 2VTXJ 3J4UH 4OVEA 3MICA 2OT7A 4NIIA 4V1PA 4WBBA 4ZU7A 4Z2AA 1HV1A 1PP9E 1ST8A 1GUIA 1KFNA 3S4RA 5FWJA 4PLNA 1ODMA 1KZUB 3PU8A 2WSCH 3WD5A 1SQXG 4LBNA 1M56D 3VBOC 4AEJA 3VP8A 4R9CA 1FZCA 1SPPB 2R5DA 3NAPA 4I2OA 1UL9A 1H0BA 3NL1A 1YXWA 2P7JA 2NRGA 1OBNA 3RZJA 1R1A1 4XUNA 4BPZA 2R6QA 1XQNA 4YM0A 1S0IA 3AMPA 1LNSA 5J98B 3RL0C 5M1BA 1KRIA 1AR82 1C5IA 3WXPA 4I7ZC 3IFMA 2DCJA 5KJ7D 3W59A 5C6CA 1RL3A 4M3CF 1DQ0A 4M0HA 3NMDA 1DZRA 2UY8A 5F3EA 1ULFA 1JZ7A 4Y1UA 2OTLP 2HWE1 1AVBA 3WW1A 4LT5A 5DAXA 4AYUA 1VQ8P 2HG5D 4I3GA 1DLLA 3D0JA 2RS12 2WWWA 1Q8QA 4LK7A 1GW3A 3NAPB 1FZFA 2JKBA 4UI9L 1PNGA 4NROA 5FZ8A 2XMLA 1P84E 1QXPA 1GU5A 4O9EA 2QDRA 4L97A 2JEEA 5FYTA 2KZIA 3J7NA 3AL6A 2FBWC 1RQUA 3WHUA 1CN1A 1ULDA 5C8CC 5GKAC 3DYOA 3TN91 1WMEA 4XUQA 3ZSLA 3T30A 2FKWB 1QQP1 2J1EA 1UYPA 3SH3A 2W94A 5A1AA 2M3EA 3KWVA 2EALA 1F4AA 2DBNA 1FOSE 5JXIA 4NRPA 4NWVA 1DEBA 5JVVA 2IX7C 2C0WA 4S2GA 3NJXA 1SQPK 2BASA 4OGQB 1IG0A 2FYUG 4HJGH 2DVFA 4AWDA 4QDRA 3L75E 4JC1A 2P2KA 4JHZA 2WSUA 3NKTA 5CCGD 5FYZA 2B9BA 1JOJA 1SDWA 1AR83 1NTZK 1VP6A 4OFGA 1HUCA 5FR3A 3V56A 4COZA 4BJ0A 1JYTA 4COYA 2P5BA 3CWBE 3JB8A 4NHKA 3U0ZA 2VZUA 3E6BA 4J6GA 2CPBA 1XE8A 1K5MA 2FXOA 4DOUA 4W6YA 1H89A 3SHRA 3G4SP 3MFAA 4H0LC 2VQ0A 4EOTA 2WDBA 2RS13 1QVFO 1US2A 3EXUA 1ALYA 3BVHA 4YG6A 2CL2A 2XVKA 2VPVA 2Q8OA 1XU2A 1PX3A 4Z2WA 2AEZA 3AK0A 2JDNA 3N4MA 1RUD1 1JN2P 3OJBA 2BU9A 3VN0A 3LDRA 2UWCA 3KXDA 1W9WA 1V6IA 1VB2A 1HV0A 4H7MA 3VTPC 4BQWA 2VR4A 4K1YA 2VD7A 2QQMA 1QU0A 2Q1ZB 1EC5A 5BNOA 1KYOD 3IIAA 3ZN5A 1BE3J 2K46A 1M06G 5DPNA 1C4RA 1DGWX 1JZ2A 2Q3IA 3A7OA 1W2TA 1RHZB 4XYXA 3GHGC 4XPVA 1BZWA 3POBA 4QKBA 2QJKC 3L4FA 4IL7A 1LHOA 5M0TA 2YC0A 4OQ9A 3L72E 1NTMJ 3AJZA 4MGIE 4XBNA 1K04A 5AFBA 5JXJA 4QKFA 1SQBJ 3PTRB 3UV9A 2RM21 4LOSA 4PD4D 3S6PA 2IXLA 1HJBA 1VBB1 4FT8A 1GZTA 5FMOS 1MKMA 2MKVA 1O8SA 4EN8B 4I6MC 3L74D 3R4DB 4XIKA 2ZABA 1W28A 4IE7A 5FZAA 3R4YA 3TNQA 5I91A 1XXNA 4RSUA 2D40A 1DQ6A 3RNSA 3AX4A 3POYA 5AW1B 1UX6A 3EJKA 1WWYA 1CONA 2PHDA 3BGAA 3ZIXA 3MIFA 1OQ1A 2C0ZA 1KN7A 4U36A 3HJRA 1KILE 3WZ1A 1F9KA 1RF1C 4KQ7A 1T6AA 4UOJA 2BJSA 1S4CA 5C9AC 2QE3A 4AEDA 4CDQC 1NTMD 5FP3A 1FYUA 1QJX2 5FLIA 1ZZ6A 2HBTA 3LAGA 1J1EC 2EIGA 4DO0A 4X8NA 4LO4B 2BUKA 3Q8FA 3VHOA 2WQ8A 2WNVA 3BODA 3KDPB 2DWRA 4DXSA 4B4RA 1AF9A 5JOWA 4Q4W2 3IDEA 1ULCA 3ACHA 3KV4A 4RYDA 1HQNA 2I45A 3SKVA 4BWNA 4N6JA 5DAWA 1MZEA 2GH8A 5H9SA 2YGMA 1DD3A 1JO5A 5ANQA 4AI8A 1ZVFA 4CE8A 3WV6A 2PAMA 4CA9A 4N43C 3EQ2A 2DUOA 3TSIA 1K12A 5A7OA 3V2NA 2P3IA 2QZ2A 4W6XA 4AEDB 3WQ0A 4L74A 2CNAA 1H9WA 4XABA 4RESB 1CGPA 3A7QA 5C3PA 3OPTA 1KDMA 1W6NA 2KD7A 2QVAA 4GWNA 4XIOA 3H1HJ 3E5XA 4BQ4A 1W8ZA 4DEVA 1ZXGA 2WNVB 3AMQA 2VJXA 1NAYA 2QQWA 4R9AA 5DQ0A 5IVBA 2LXCB 3LGRA 1L4AA 3TWIA 5DZEA 2M8RA 2K37A 1VDFA 5FZOA 3NNMA 1N1YA 1IPJA 1RVF2 2QM7A 1WMFA 3V2QA 4MGTA 2RS11 3NV2A 1W0NA 1QNYA 4G9SB 4XACA 2IYPA 2RMZA 3VBFA 3LDBA 1GZLA 2W90A 1S2BA 1SQPE 1N7LA 5T52A 1QJZA 3MIWA 4FO9A 1N73C 5A6ZA 3V2RA 1QJX3 2YNYA 2W87A 3WF3A 5CG9A 3OW2O 1W6NB 4MSVA 3C8XA 5BNPA 1NZCA 1MS3A 1KB9H 1NTZE 1RITA 5JZGC 4CCJA 1WW4A 1RTVA 3PHMA 4Q4W3 1UZ0A 1L4AB 4XBLA 5I0UA 3ZKYA 1IPSA 1WCUA 4HVRA 5H9QA 4AL9A 3VBOB 4QD2A 4OHWA 5FZOB 1WBLA 2HH9A 4PHZA 4DZGA 2W52A 3M3EA 5EJ3A 1UZWA 3OYWA 1AYN2 2P34A 2B45X 1QNWA 5JMCA 2ZHMA 3VBFB 4RHV2 1BCXA 3BU0A 2ILMA 4KU7A 1HN1A 5FWEA 2OYIA 5FYMA 5KXCA 4WBAA 4BQ2A 4I7ZB 1QJY2 5DABA 4A6SA 5FZ7A 3W9AA 1MS9A 1FJPA 2FDFA 3KMHA 4AQRD 1W6MA 2XKPA 2BYVE 3WUCA 1S5LX 2ZGSA 4AVTA 5DG2A 4NAOA 4KJMA 5FUNA 5LK7B 2VCAA 3RWNA 1K5JA 4LOTA 1NU1J 3MZWB 1PZ8A 4AHXA 3WF1A 1VQKP 5A7NA 5EHDA 4PIYA 1RVF3 1NCRC 2P4EA 4YGDA 1GYKA 3RJRA 3OYWB 1QMJA 4U3FJ 1KEXA 2P6CA 3TEZA 3H8UA 2E63A 1OVRA 3TGUJ 4KT0J 2JDUA 4IEVA 3N9QA 3CL3D 2OYIB 5DZGA 1OFCX 5FJHA 2D5HA 2Y0IA 2O0OA 1ZW0A 1TEIA 1PK6A 5AW3B 1W6MB 2VUJA 1VAKA 2IVJA 3O1OA 3L73D 4XC9A 2EXKA 2P6HA 4LTAA 1AX2A 2C6SA 1FPN2 2RE9A 3H7YA 3VBHC 2ZGLA 2VZQA 3S0MA 1LTAC 4LKEA 2R49A 3GBGA 1OC1A 2WPQA 4O7XA 2VZOA 1GMMA 1T3UA 2Y64A 3WDWA 3N7KA 1X79B 1G9DA 5JDBA 1W0PA 1SQVJ 2QIWA 1AYN3 1NU1D 4LLFA 1VBC2 4MHUA 1JHNA 1TQ5A 4RHV3 4AI0A 1S5LE 4N78E 2Q30A 1NX9A 5F5CA 4NIDA 1J1DB 5GTHH 5A80A 4KNCA 1ZZCA 5BVZA 3JCUH 1PGOA 4XJ8A 2ZEZA 1PK6B 4KWLA 4H44D 1R082 3VMYA 2K1AA 3A0BH 1NLSA 4I09A 1IFPA 4QWNA 4BK5A 3VB9A 4BCUA 5K5GB 3BPSA 3OY8A 1RY3A 2FDJA 5D21A 1MVEA 3NO8A 5EFUA 3OPZA 3SMHA 2BFUS 2K9YA 4BLIA 2QNKA 1L7RA 2ARAA 3ME2A 1YC61 2UWBA 3HD8B 4H13D 4H0LB 1LJ7A 4K3UA 1NTMG 2HEVF 4NRMA 3WNKA 4YVWC 2Z69A 2V73A 2WAOA 2BP6A 4K8FA 5FPVA 5L8RJ 3MLJA 5B5EE 5EJZB 3M1HA 2WTYA 3OPWA 2VTXA 5AW8B 5FZ1A 3TYYA 5GTIH 3O1RA 5L7OC 4LO5B 1UKRA 5CHXA 1QJX1 3HRNA 1NE4A 1L0NJ 1V6OA 5CKNA 3NW4A 5FDBA 1FPN3 1LECA 1KC8Q 1YEWA 3OY8B 2D2CC 2X5IA 4Y99B 4GDOA 2W68A 2AEYA 4MZUA 2R16A 1H4GA 4DMIA 1VQ6P 4Q4W1 2L5GB 2F17A 1OVVA 2VECA 4XBQA 1QEXA 3GW6A 1VBA2 5FKCA 1Q7YQ 4Y5SA 3L9JT 4C7NA 2Y0EA 3UJOA 2DU0A 4TSVA 2WO7A 1VBC3 4NN0A 2JE9A 4BXSV 1C8NA 4XQ4A 5C9AA 5E1RA 2WBKA 2RDNA 4AFDA 3VHRA 3CMAP 1R083 5LW9A 3L71E 4KWJA 3U4XA 2IVIB 3M0DA 2DF7A 1UAIA 1D4M2 4YZ3A 3B01A 2VZRA 1WA6X 3P3NA 4AHZA 5C5TA 2YV8A 5CCGA 2X5IB 1NWQA 4HG6B 4ORFA 1JMMA 4FPJA 3UK9A 2JENA 2JKXA 1L0ND 3NV1A 3H1IE 3RZZA 1LTSC 5JLVA 1Z56A 1YIPA 1L7LA 3N9LA 2O01H 4C7NB 1AR92 5A33A 4K7JA 2B9UA 5LCWL 1PP9J 5F5IA 2MEV2 1XNKA 5FPBA 5C9AB 3MZHA 3MPBA 2LTNA 3KZIE 2P67A 3BALA 3EYPA 4M01A 2QSIA 2YBKA 3VD4A 1OXZA 2E76D 4KG8A 3IAOA 1LTEA 2G1MA 3H1HG 1H1MA 5HCAA 5FLHA 5APTA 3R2PA 3VBUC 5FO9B 4AEKA 1UU5A 1RH5B 2BGOA 1VJ2A 3B5LB 4YW4A 4S2FA 4IUGA 1ZN5A 2AACA 3T4VA 2IXKA 1XNCA 2W2IA 1LP1A
chains in the Genus database with same CATH topology
2IXJA 3ZXDA 1YIFA 1KS5A 1ND2C 1Z78A 1GR3A 1IPKA 4FP2A 1BVVA 2D93A 4JV4A 4XFGA 3UL2A 1RUD3 2JDZA 2C9AA 3SCHA 1VBA3 1W0OA 2EF6A 2W0XA 3N35A 2WFPA 4AEMA 2D3PA 2EVXA 5BV6A 5JI9A 1F5FA 2A5ZA 2JG8A 1A3KA 1O4TA 5IK7A 1G9FA 4QGLA 4E2QA 1J1LA 1QH7A 5A33B 5DUVA 4RHV1 1RHI2 1C28A 4LBMA 3AZWA 1AJOA 4QM8A 2DFCA 5ACA1 4MXVA 1LGNA 1OSGA 4HBNA 3TRSB 3KLSA 3NVCA 3WP4A 3JQXA 2JG8C 1O7FA 1H8TA 1QJY1 1O3TA 4Y26A 4OZXA 2GALA 3B9CA 5KXDA 1XRUA 4SBVA 3D6EA 1TNRA 2E53A 3LA7A 4XJAA 4XQDA 3V0AA 4I30A 1PMIA 2UYAA 2VQAA 4XZPA 3VGIA 2D6KA 4Q27A 4FTSA 3IPVA 2R042 5T5OA 5FOJB 1D4M3 2NLRA 1H8TC 5TSWA 1ND2B 2VW2A 4OHYA 3J8F2 1FOD1 5F5QA 2OZ6A 4QQOA 4YYOA 5BNNB 2E7AA 1RUOA 5BYNA 4GKYA 1ZBA1 2IXIA 1ENRA 3GNEA 5JAXA 2W39A 2MHFA 4HKLA 1TME3 4WM8A 1RUG2 1LRHA 2FBEA 2G9GA 2VOWA 3KS7A 4YNIA 2NYYA 2CYFA 4ONUA 1J3PA 2DU1A 2RM23 1C8M2 3MLLA 4A3XA 3EHKA 2YY1A 4QM9A 1Q8PA 4QPGC 1OA2A 4MV2A 1UIJA 2FMDA 2JG8B 3I54A 1DQ5A 1H8VA 2E7TA 1VBB3 4JDNA 4WM8C 1AR93 4HLTA 2ET7A 2VGDA 4BYYA 1H30A 2GZWA 3RMYA 3BU7A 3FC0A 4XFCA 4KWKA 2BVBA 2XBO2 4Q4Y2 3AFGA 1Z7S1 1BMV1 2MEV3 4LE4A 4CRQA 1HRV2 1RUF2 2AH2A 3PJQA 4CDUC 4Q0PA 5HI0A 1HQWA 2KXLA 2ZZQA 3SH5A 2UU8A 4AXOA 5FOBB 4JRAA 4LR4A 1LGBA 1ZA4A 2ZGUA 3K48A 2D3SA 4LHLA 3AMNA 4J1XA 4K1ZA 4QX5A 3WP5A 1Q8VA 2VW1A 1M4WA 4FSJA 3V0AB 1GQHA 4OI1A 1BBT3 3UKVA 1Y9QA 4YG0A 2D6PA 3IPVB 4HL0A 2GDFA 4DQAA 1HLCA 4OULA 3WR0A 1WW6A 1DQ1A 2D6LX 1AR73 4C0HA 4HN1A 2ARBA 4IEUA 3DUIA 3ZYRA 5IT6A 3ZN6A 1CAXA 5F6KA 3MGUA 3WG1A 3FHIB 2IZWA 2GNBA 5BNPB 2BTVC 3M7AA 1EPWA 4ITCA 3WLUA 5BPXA 2GNMA 3MF6A 1QDOA 2UWAA 3PVNA 2MNGA 3WDUA 3B7MA 1CIWA 1JXNA 3D0SA 3E97A 1IKQA 5CBLA 3RDIA 2D44A 1S0BA 1YI9A 5FCCA 4AVCA 1GZWA 3DKWA 1IS6A 4JDOA 1VAVA