4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
2E9QA 4E2GA 5E1RA 1RC6A 3H7JA 1VR3A 2XL9A 2QNKA 1PM7A 2QDRA 4OLLA 4I0AA 1V70A 4EWDA 3WW2A 4Z82A 2IXCA 4MGYE 2V09A 1UD1A 1YFWA 4JVAA 2Q4SA 1UCXA 4ONUA 4YSFA 3TNQA 4ZU7A 3E6CC 3OF1A 1DZTA 4MGZE 4F7ZA 3OD0A 5EFUA 2HJIA 1BSNA 1WGPA 3GBFA 4I2OA 2PAMA 1O7FA 3SXWA 1ZZ7A 4LUMA 4O9EA 2EAAA 4XFFA 1ZNPA 1IFPA 4Q29A 2QVSB 4BYYA 5KHHA 1H1MA 3E97A 2JDIH 3UKVA 3BPZA 1YFYA 2PHDA 1VJ2A 5I8TA 4JV4A 1O5LA 4KL1A 3S7EA 5BY5A 5FQ0A 2F4PA 3FFQA 2XKPA 2P17A 3DL3A 4AXOA 2MHFA 2PAEA 4XFCA 1ZZCA 1OD5A 2WSSH 3BU7A 4HN0A 1OFNA 5I8SA 5BXXA 3FHIB 3EBRA 1Q43A 1YLLA 1SEFA 2XLAA 3H3ZA 1EYBA 4KWLA 1GQHA 3DKWA 1EPZA 5JR7B 1FXZA 4META 5D1IA 3EHKA 3QACA 4FT8A 1X82A 5K8SA 2GH2A 4N9IA 5E16A 1X8EA 4AVBA 5JCTA 2I45A 5FPXA 4ZU4A 2N7GA 4X6RB 3NW4A 4IEOA 1ZRDA 3I59B 3WW3A 4DINB 3D82A 3DV8A 4PIXA 4YRDA 1JUHA 3I7DA 4GULA 4IEXA 5KHGA 1QXJA 3NSTA 3PNAA 3M70A 4EV0A 1RGSA 1WLTA 5F1RA 5I0TA 4PJYA 2XLGA 1FI2A 4HMZA 3MDPA 4XF9A 2BGCA 2GZWA 4I09A 3E5XA 3OCPA 4JTNA 3GYDA 4HLTA 4IEPA 2VPVA 3SCFA 4QX5A 1JEKA 4YXWH 2MNGA 1QWRA 1RL3A 3H3UA 4WBBA 4Q0QA 2BEOA 2E5YA 4ORFA 5CADA 4MGKE 1SQ4A 1AQTA 4XETA 4WVZA 2H6CA 4ZU5A 2OYZA 2VQAA 1EY2A 2QJVA 4HVOA 3RPQA 2O8QA 1CAVB 4KWJA 4HN1A 4D7TA 3BCWA 4L11A 3EJKA 3H50A 2B5HA 4MGIE 3USSA 5C8WA 3EO6A 5JSPA 2Y0OA 1CGPA 3E5QA 5J48A 2OZJA 2MPFA 5LEKA 3ETQA 3U11A 1ZZ6A 4QMAA 3HQXA 3IIAA 3PJSK 3H9AA 4R8HA 1NZCA 3D0JA 2CAUA 3NKTA 1O3RA 1FT9A 4HZFA 4QGNA 2BNOA 1NE6A 2UY9A 4NVPA 1YWKA 3BALA 4XFHA 5KHJA 2IXLA 5KHKA 2IXJA 3JZVA 3MYXA 2ZCWA 4LTAA 5FLHA 3ACLA 1IPJA 5FLJA 4A2UA 2OZ6A 5KBFA 5I0UA 4UBHA 1O3TA 1UPIA 3ST7A 2Q0AA 3RYRA 1CAUB 3H8UA 3C3VA 2XNDH 4EWAA 4IEZA 3I59A 4Q0PA 4CYDA 3IWZA 2E5TA 2KXLA 3LA2A 4HVRA 1LRHA 4IERA 2D5FA 4X6QB 1I6XA 3WW4A 3QOPA 4BHPA 3D0SA 4Q0VA 3MPBA 4IEVA 2ET7A 5BUVA 2W6JH 4XF3A 4R52A 3S0MA 3KGLA 3RYPA 1O3QA 1J58A 1LR5A 3RDIA 4MH0E 4I3PA 5EZWA 3ZDSA 3FE5A 2DCTA 1CAXB 2IXHA 5I0RA 1ZX5A 1FS0E 4EROA 3H7YA 1IPKA 3H1YA 2EVXA 3E6DA 2WC2A 2Q1ZB 2OA2A 3ELNA 2Z69A 3U0ZA 1Q3EA 3ES1A 1Y3TA 4QM9A 4HSJA 2BYVE 3EQEA 2V7QH 3LAGA 4EWEA 4F8AA 1YHFA 3FX3A 2VECA 1EP0A 1CAWA 5FLIA 4MX3A 4FAHA 2HKXA 3U10A 1O3SA 1XE7A 3RZZA 5BPXA 3UKTA 2XL7A 1J59A 4WZCA 4LULA 4BH9A 2ET1A 4AVCA 2XKOA 2K9ZA 4O9GA 3HIFA 4XFIA 4I0BA 2WFPA 5T3NA 3NL1A 5JSRA 4XF0A 4YARA 5JAXA 4I02A 1CAUA 1X7NA 2PAKA 3M3IA 2PYTA 1GQGA 4OFGA 1J1LA 3IBMA 1PMIA 2ZKLA 3FZ3A 5CVRA 1TQ5A 1H1IA 1OMIA 3NJZA 1U12A 1UIJA 4RD7A 3FJSA 3HT2A 4QXKA 4FBFA 5JSOA 3MZHA 3ROUA 3TNPB 2K0GA 2XLFA 2BNMA 3KMHA 4JTOA 1NXMA 2EA7A 5BV6A 3BB6A 1QY4A 2QE7H 2PHLA 3E5UA 4E2QA 5LRSA 1ZRCA 3S7IA 4LA2A 5AVPA 1CAWB 1DGRA 2PQQA 3RYKA 2GU9A 1J3PA 4KU7A 2Z2SB 2D93A 1XRUA 4FAGA 3B02A 1WA4A 2H0VA 3SHRA 1YUDA 1OI6A 4IEYA 5CU1A 1RTVA 3LOIA 2PA7A 4I01A 5HI0A 3N4MA 3KCCA 2D40A 1YFUA 2CV6A 3L2HA 4TLFA 5I8YA 5I93A 3ES4A 5FQ0B 1RUOA 1J3QA 5C6CA 1CX4A 2D5HA 3HT1A 1Y9QA 1UW8A 4D7SA 1QXRA 3R6SA 1BSHA 4IEWA 1ZZ8A 2ETEA 2GC3A 2PFWA 3DN7A 4LA3A 5FCCA 4YYOA 1L3JA 3IDBB 1O5UA 1I5ZA 4PIZA 3VHRA 4AQ6A 2IC1A 4BIFA 3CJXA 1ZVFA 3SCHA 2QCSB 4P9GA 4MV2A 3CF6E 4UXAA 5I0SA 4QGMA 1ZZBA 1XE8A 4DJGA 4XFBA 4HVQA 3CO2A 1SFNA 2B8MA 4KWKA 4AQ2A 4AVAA 3IDCB 5KHIA 2CAVA 4LUKA 2CK3H 2GAUA 1ZRRA 3LZZA 4LLOA 3OTFA 2Q30A 4B29A 3KGZA 4YNIA 3EFFK 3CL1A 4K8FA 1E79H 4H7LA 1DZRA 2XGXA 3CEWA 4UBGA 4Z07A 3H1MA 1ZZ9A 3UKNA 4XFGA 2IXIA 2FQPA 1LB2A 2ATFA 2UYAA 1HW5A 5LRRA 5J7MA 3KSCA 3LWCA 4L2NA 3O14A 2GC0A 3H1WA 4N9HA 1CAVA 1J3RA 4KU8A 3FWEA 4J1WA 5FDBA 4HBNA 2O1QA 4Q0SA 1YFXA 2GC1A 4PIYA 1O4TA 1NYWA 5I91A 4XFAA 4IEUA 2C0ZA 5FPZA 5LEJA 2B9UA 3PVBB 3CLPA 1X8MA 1Q5OA 1UIKA 1LKNA 4J1XA 3LA3A 3I54A 1ZRFA 1VP6A 2PTMA 2GC2A 2BNNA 4IEQA 2OPKA 3PLQA 4XF4A 4XEZA 2CGPA 4MUVA 1CAXA 2H6BA 1RUNA 4LEJA 1G6NA 4QGLA 3G7DA 3OGJA 3LA7A 4MZUA 2IXKA 4IETA 4E2SA 5J3UA 3SCGA 1ZREA 4IESA 1NE4A 2XHKA 4HSLA 4Q0UA 3NVCA 2UY8A 3WW1A 4QM8A 1DGWA 2UYBA 4XF1A 2FMYA 3SMHA 3RNSA 3E6BA
chains in the Genus database with same CATH superfamily
4UYBA 5GKAC 1J83A 1BLZA 1SCRA 1FZAA 3PLNA 1N73C 1EZVE 4UF0A 5E1RA 1WW5A 4FCAA 1M06G 2RMZA 1VR3A 2VC9A 4Y20A 3H1KJ 1PM7A 1YQ2A 1L0NJ 2QDRA 1ZRTE 2WQ4A 5AVTB 5L36A 5GM0A 2VULA 3NV3A 2HWC3 3N7LA 1EZVI 4XQ4A 4EWDA 1EPWA 3X29B 4C46A 3KT1A 1URQC 1GZWB 3ZDMA 4EJRA 2RV9A 5DZFA 3WDXA 5HCHA 5DUWA 5DABA 1OXZA 2KD7A 2XONA 1LWUA 4XQWA 1JU4A 2VMHA 2WN3A 5FWJA 1M8OB 3A2AA 3DPRA 2NPSD 1R082 2OYHB 1QJU3 1QXPA 2DCYA 1IS5A 4UFMA 5LZ6A 2WNOA 4Y33A 4A41A 1YITP 3AP7A 2FDKA 4OZXA 1FZCB 4YG3A 3ITQA 3ZFGB 5FK7A 4JKKA 3SLIA 4Q4V3 4Y4RA 1ZR2A 2PAMA 4WVVA 4TZDA 3HQRA 1RE4A 1XQNA 3LFMA 1LTTC 1ZA7A 5AVUB 1HQNA 1HXS3 2JJ6A 4IGOA 4O9EA 4A3ZA 3ASIA 1D4M3 4ATFA 5KHHA 1H1MA 1HN0A 4LKEA 5APWA 2JDIH 3FC0A 4GJZA 4EQVA 2YMYA 1SFCD 5KJ7A 2OPWA 3AMPA 1JYNA 3BATA 2Q3EA 4W7YA 5TJHA 1PMJX 5DPNA 5EJ3A 1DIPA 2Q5TA 2C9NY 4L74A 3Q2YA 1O5LA 3S30A 4XIOA 3S7EA 1NTKJ 4DY5A 1LJ2A 5LBBA 3RWKX 3CX5D 1W8FA 1NU1J 1XYOA 3W5MA 1OW7A 2XKPA 1BXHA 2A45I 2EALA 4HFSA 1XPWA 4IV1A 2ZYDA 3M91A 1C8NA 4CEYB 2Y6LA 3POYA 3R4UA 1QKQA 2EF6A 4CRQA 1Y47A 4OVEA 4DFSA 1OUSA 3L72J 2B89A 1UZWA 3TGUJ 2XUMA 3BU7A 3KQ4B 4L99A 1KMIZ 4WM7A 2WSEJ 2RS51 5TISE 3AZYA 1M1JB 4XE9A 3SFDC 1M1KQ 1Q43A 4OGQC 1SLBA 2QQJA 3H3ZA 1XYNA 3L75J 1TNFA 1EYBA 4RQPC 4AFCA 1AR62 4BWOA 1WT6A 4YW7A 2FYUK 3BCCD 1DQ6A 3EHKA 2XBO2 1HRI1 3JBG3 5FZ3A 4Y5Z0 3J8F2 1NAYA 5AVRB 4ARXA 1W6OA 4N9IA 5E16A 1TG7A 4AVBA 4UFHA 3NV4A 3HJRA 3FFZA 3QCWA 4OMCA 3UESA 1DYKA 1NGMB 1H2LA 3MHVA 5A33A 3HBKA 3LIHA 4L97A 2GH8A 1NTMK 1DLCA 1OW6A 2WQ8A 4CP1A 4E8CA 1JB0J 2D6LX 2VVEA 4CEWB 1ZRTD 2P2KA 5FJHA 2I1JA 3RZJA 1GOHA 2QM7A 1Q86Q 4PBOA 3O1RA 4PIXA 3ZXGA 2XJVA 3K46A 5FYHA 3TOJA 2WPRA 1E5WA 1JUHA 5KHGA 4JBZA 1EAH3 2B4KA 4CEYC 3NSTA 4CE8A 5FY1A 5JUVA 3M70A 1WD4A 3AECC 1RGSA 1WLTA 1XNAA 1KQGB 2R1DA 1PFIA 1BCCG 2VW0A 1BCCD 1HWTC 3CC2P 4D6TJ 3CXHI 1GLHA 2VOTA 2G9GA 1JU3A 5I0TA 2BUKA 2BWAA 4A44A 4MGTA 3J9SA 1FI2A 4TN7A 3PVEA 1VB4A 3MIDA 4HMZA 4ASKA 2BGCA 2M0BA 4CXXA 1LOCA 3WP6A 3ZR5A 4UOJA 3QH6A 3E5XA 1PO13 3CXHE 4JTNA 3D70A 1EQ7A 2CSGA 3CJIA 3GYDA 4HLTA 2RJLA 2VPVA 4JGZA 4OI1A 1JZ4A 4CTEA 2Q1KA 4YXWH 1LAJA 3PH0A 1NQDA 4HOOA 3H3UA 1EV11 3D8CA 2WT0A 2RG4A 4Q0QA 1GSLA 2QJKC 4WBBA 2E5YA 1EAH1 3GZTB 4XJ8A 3RSJA 2A06D 4XETA 1PZQA 4Y5TA 1IFNA 1OW8A 4DMIA 1GL2A 1N3PA 1YNAA 2AUYA 4K1ZA 4ZU5A 2OYZA 2RDSA 2VQAA 1AR83 3LDKA 2GSYA 1ULOA 3PUQA 3MD0A 3IT8A 1ENXA 3BCCG 2O8QA 1JI6A 2W1WA 4C7RA 1CAVB 4KWJA 4X8PA 1GW3A 1POQA 1VF5B 3RK2B 2W6AA 2VUAA 3N7MA 4H3WA 1CIWA 1PO22 3CCRP 1NCRC 4XAEA 5GZEA 4KWUA 4Z2WA 3IR9A 1AR93 1AX1A 3VBFA 4WB4A 5C3QA 3L75G 3EO6A 1KN7A 1N47A 1TME1 2Y0OA 4Q2FA 1NCRB 1W6OB 1NTKD 1MFZA 2OZJA 2VNVA 3CHXA 1ZZ6A 5EPAA 5FMDA 1UF2C 4AI8A 4WM8A 4JAAA 1M57D 1NCRA 2FBWC 2P1BA 3L71J 2H8PD 1SS1A 4EN8B 5JZGB 1NZCA 5A1AA 3D0JA 1NAEA 4IW3A 1J1TA 1YJNP 3BASA 2YG0A 1W0NA 4K35A 2VMIA 1K5MC 2XWJB 4PHZA 2RHPA 1UKGA 2R061 2WNVB 5EJ1B 2BNOA 3HE4B 2VXJA 5IFTA 4AVVA 1JYTA 3Q8CA 1NE6A 4XYXA 2UY9A 1Q8PA 2CGOA 3LSEA 2WO7A 5GLTA 3RS6A 5GTIE 1RXFA 1D0HA 1QJU2 3J8F1 1JN2P 1YWKA 4QQPA 5FYZA 4MGQA 4JDOA 1GW4A 5FO9B 1KILA 5A6YA 1HRI3 1JYVA 2W46A 3CX5E 5H2FE 1URXA 2E51A 2IXLA 3C2UA 2XJPA 3NKGA 4QB6A 5KHKA 2Q7CA 4K20A 2PLV1 1V6LA 1PP9G 4BQYA 5A1LA 5IAXA 3I5CA 2E76B 2RS53 4WVMA 5CYYA 5HCFA 5AW6B 3W20A 5IHRA 2QRXA 2CU5A 3WMM0 2E76C 4A2UA 2VD7A 1RUE3 3B5NB 2N9BA 2E75B 4AQTA 4ASLA 4XMIA 5FMOL 5A7SA 4LC1A 4QX2A 4QU1A 1PK6A 1WCSA 4JQRA 1XJAA 2JENA 2VVDA 3WNXA 1O3TA 3L73J 3VP8A 3ZSLA 5FZLA 3KDPB 2QQKA 5CB7A 3C3VA 1PVC1 1PK6B 1VBB3 3RBXA 2J1UA 3VBOB 3C1LA 1ZBA3 1NKNA 2WITA 1PVC2 2PHWA 4BU2A 1NTZJ 2VMDA 1RMU2 1M7LA 4Q0PA 3QH7A 1S1CX 4XHXA 1OQ1A 2YC2A 3MW2A 2HWE2 5T55A 2KXLA 4Z8BA 5FIXA 2OQQA 4IERA 1M90Q 1I6XA 1JYIA 2BCCD 1HGVA 1BE3G 2O8OA 2OXBA 4Q0VA 2A06E 5A6XA 1HV0A 3H1KG 2DCJA 4IEVA 4PBPA 4QKNA 1OVPA 2PHFA 1CR7A 4XF3A 4AGRA 3K48A 3OD4A 4TTGA 2XZRA 2CNAA 3A0BE 3L73D 4Y20B 4QPIB 3RYPA 5D21A 5CBNA 2QM8A 3UK9A 1KTMA 2VM9A 4FPCA 1OSGA 4Y5SA 5JI7A 2X05A 1O3QA 2HWC2 3RMXA 1R64A 3VMYA 4XJWA 4N90A 2OW4A 4I3PA 5EZWA 4GT1A 2JG9B 3E6BA 4PLNA 1RXGA 3AKPA 2W5FA 5F37A 5DAWA 1PGW2 3D3AA 2D7FA 3ZX7A 1SDWA 4WM8B 4LKFA 5CZKA 1IPKA 1IHMA 3H1YA 3ZSEA 4AI1A 2OTJP 1RQVA 3MIFA 2BGOA 1EZVG 2B7YA 2Z79A 1UU5A 5LBCA 2BPA2 1UL9A 2BZDA 2JIJA 4MHUA 1M4WA 5IVYA 5KHIA 2I07B 4EI2A 4EZ4A 1UMZA 3U0ZA 1Q3EA 3ES1A 4RQPA 1W05A 3VZKA 2LM3A 2VMGA 4GJYA 1B35C 4XCBA 3BYWA 2QTWB 3WR0A 4AG4A 4BQ5A 3LAGA 3V2RA 3AVRA 2BW8A 4F8AA 3OOXA 4OGQB 4U2AA 3V0BB 3L70G 4UB8H 2Z5IA 2B87A 1AR81 2VECA 1T2XA 4ZMDA 5F3CA 3GHGA 1YIFA 3LE0A 3SWFA 3I2KA 5BXXA 1JMUB 5FLIA 4AYUA 3KS7A 1U5YA 4LOTA 2OKXA 4FAHA 1S0GA 1XE0A 2E7AA 1TMF1 5BPXA 5M1BA 2XL7A 1J59A 4NPEA 4JHTA 1UZZA 5K0UB 4BH9A 1SQPE 3AM2A 4OULA 4AVCA 1PGOA 2WZ7A 1H2MA 4O9GA 1UU4A 2C6SA 2W0XA 2ZTNA 4XFIA 2P67A 4KBBA 3RGBA 3CJIB 3SKJE 1W2EA 5APYA 3DPRC 1GL2B 4I0BA 4OHXA 3T30A 4DRVA 5KLVD 2QE3A 4C7NA 2RS11 3AFGA 4ZZ8A 4YARA 5JAXA 5JSRA 5JXJA 3WCRA 2H88C 1X7NA 2PAKA 4L8QA 3M3IA 4DZGA 2PYTA 1NYHA 1AR82 2FKWB 4HKOA 5T50A 2E76D 4A7ZA 4H44D 3PUIA 1UYXA 4CDUB 4DUWA 1RUH3 1RUG3 1FZGA 5CVRA 4BCUA 1SQBK 1N8RQ 3LEMA 4YW6A 4CCOA 1OMIA 3H1JD 1VF5D 3RK2D 4BIOA 1PNFA 1AR92 2YC0A 4QXKA 4NPRA 4AAXA 3TNPB 1BEV3 3L71G 1V9U1 2VY0A 1SCSA 5KXEA 1I1EA 2XU6A 1LHOA 3AE8C 3EWKA 2ITAA 4I2LC 1KS4A 1NXMA 3AFKA 4XUQA 1N7SB 4AE2A 3BB6A 1POV1 4BM8A 5A3TA 3CCVP 5FZAA 2ZGLA 3E5UA 5J96B 1ZRCA 5KAIH 3FLRA 1S5LX 5A33B 4LA2A 3G3ZA 3LDBA 1DGRA 4QT6A 4J6GA 2PQQA 2WFF3 4PD4E 4CUCA 2GU9A 5FZ4A 3VZLA 1J2JB 1QL2A 5AFBA 3MIWA 4LK7A 1XRUA 4EZHA 1WA6X 1IZNB 5FPVA 1WA4A 3SNMA 4V1PA 1HX6A 2IUWA 1BGYD 4I7ZB 3AYCA 5L8RJ 2WJSA 3W9AA 4RS5C 2PLV3 2QQNA 4DUXA 2ZKNA 2ZS6B 1S4XA 3LQCA 4JZRA 4QAWA 5F3EA 5FP9A 4XQDA 5GTIH 2PA7A 4I01A 3O1SA 1SQXK 1IFIA 3CL3D 4MADA 1HUCA 5LW9A 2D40A 2RS52 4MYEA 2RR12 4XMAA 5JR2A 3L2HA 2Z4EA 4LBQA 4Q4V1 2R3SA 3CQOA 4LHNA 4Z92B 1UY0A 1LTSC 1W06A 1RUOA 3HT1A 3PUAA 3OGVA 1W2UA 1ULEA 5JZGC 4NRPA 4DUVA 2OIIA 4LO6B 3R6SA 4G9SB 5ISLA 4NOTA 4KNCA 2A3YA 1VAKA 1KD7A 1VBA2 1YQCA 2Y9ZA 2W83C 4FVVA 2Y64A 2A6XA 3I3BA 4I30A 5IW0A 3TN92 3VKLA 3NNFA 4D6TE 3K3NA 3ZYJB 4NE9A 4S2DA 3MW4A 4YVWC 2RS33 1PGL1 3AEAC 2A6WA 1O5UA 1U5IA 3HNMA 1I5ZA 4PIZA 4D6QA 4UB8E 2VZQA 1REEA 3LIDA 3RG0A 1QJX1 3U1AA 2IC1A 4K3AA 2K46A 5DG1A 3SEPA 3B3QE 3VHRA 4DOUA 2ZAAA 1DGLA 1N73B 1JTZX 3MLJA 4XJAA 1FE6A 2QCSB 2DTWA 3I2DA 5F8PA 1CZVA 1LTJB 4BB3A 3E1RA 3HD7A 3ZPYA 1ULGA 4ATEA 3POJA 5D2AA 5I0SA 1W2OA 5A3MA 2KSJA 2D6MA 5BNOC 3GBWA 2W52A 3VBOC 1LGCA 1PPJG 4QXBA 4CXWA 3CX5H 3HQUA 2FDHA 1UMIA 2JECA 5EFWB 1FZCC 4YW5A 5DZGA 1AFOA 2P6HA 1DD3A 2W95A 4ZONA 5T5PA 3U75A 1RUF1 5FYSA 3IDCB 4P9WA 1WWYA 4YM3A 5BNPA 5E89A 2E43A 2PFXA 2WFF1 5IAVA 3SH4A 1H89A 1ZRRA 1GZWA 3LZZA 3GNEA 4ASWA 4GWJA 5FY5A 5CG9A 3ETPA 3WD5A 5IT6A 3I55P 1G9DA 3R0RA 1WW6A 4QKDA 5A6ZA 2JB8A 1DX7A 4H7LA 3J26N 3H8XA 3IB3A 3NNGA 2IWGB 1R1A1 2XGXA 4R9BA 3OYWB 3PP5A 5J98B 1OOPB 1V00A 4XXAA 2FXMA 1AYM1 3L36A 2C4XA 3UKNA 3CIHA 4COWA 1S72P 2A6YA 2IXIA 2JDUA 5A3PA 1G9BA 3M06A 2CWMA 3THDA 4K6BA 1IKQA 3BRVB 3ME2A 3RZLA 2BQPA 1WMDA 1SQXD 3N36A 3JD71 3CPWO 2FDIA 3NRUA 1RUE2 2IZ1A 1FX5A 4Q5OA 3WUUA 1XBFA 3AC0A 3KM5A 3H1JE 2HWE1 1PP9E 3EFGA 1LHVA 3VD7A 5FMOS 5GZCA 1IPSA 3KZIE 3P7KA 3AE4C 2C0WA 5KLVJ 1R083 2YGLA 1N7SD 3IMNA 3UGFA 4W7ZA 3A0BH 5FYUA 3OAKA 1SBEA 1IG0A 4B8EA 1BCCE 1VBB2 2A3WA 1CAVA 3T4VA 4N43C 2P3KA 1AL22 2WWUA 3GF7A 3G9RA 3PL0A 3ZO0B 1UQXA 2O1QA 3PVNA 1LNQA 1YBKA 2G9FA 4QB1A 4K9SA 4Q4V2 4QQLA 1HQWA 4KI5M 3THTA 4H0LC 1RINA 5FPBA 2IDBA 4Q4Y3 4CUGA 1W9YA 4D7YA 2UWBA 1GZCA 5L19A 5CJ4A 1K5JA 1PPJD 3HWJA 5KXDA 5FYCA 5DZEA 2PHUA 4H0LB 1ODNA 1B35B 1H9PA 2DVAA 3GCWA 4XJ9A 5LEJA 2TNFA 1YXWA 1CPMA 3AXDA 3PVBB 4CCLA 1RUC1 1XNDA 2VJXA 5K0UC 1Q5OA 1J1EB 1X8YA 4LUKA 5FUPA 4AFAA 1ZV8A 4J1XA 4G4FA 1VMFA 5K4LA 4KG8A 4CA9A 2KNCA 4GMP0 2IFWA 3H8RA 2LS6A 5KC6A 3C8VA 3ZXLA 1YQ5A 3GZUC 4AFBA 2CPBA 5KAFH 1RUD2 5AVWB 3M3QA 4RESB 1MZFA 1AL21 1Q8SA 4JRAA 1ENSA 2OYOA 3OGJA 1VBC1 2LRPA 4HL0A 3LA7A 4PD4D 4LIVA 4IETA 5FBJA 1S0JA 4YG0A 3G6JB 3HEIA 3SCGA 4MG2A 3L70D 5ACA2 5AW9B 4RKUJ 1WLWA 2XHKA 4OHVA 1KFMA 1NA1A 3NVCA 2R5BA 2UYBA 3QWOC 4PJ0H 1HB4A 2FMYA 3H1JG 1QGKB 2NRGA 2G19A 2ZEZA 4LBQD 3RNSA 3OUHA 3VZOA 2Q1FA 5A7WA 2E9QA 1HJBA 1FAVA 1OWAA 5F2WA 1YYCA 4L73A 1MVEA 3H7JA 3WDWA 2XL9A 1LODA 1DQ5A 2V7QJ 1LOGA 2POHA 3RQ0A 5AVXB 3PU8A 1OF3A 2J1EA 4PDWC 3TEXA 4GH4A 5KJ7D 1GZLA 2D2CB 1SFCA 3SFEC 2DWRA 1VDFA 4NN0A 3ORJA 1W6MA 2FMDA 3VBSB 5C5UA 5F6KA 3BPSA 2NPSB 1T8ZA 2WSFH 4U3FG 4Z82A 1N7SC 1H88A 1FAYA 3K2OA 1IK9A 1UYPA 4KT0J 2RDQA 3RVHA 1K5MA 1YFWA 5C33A 2BGPA 3WG3A 1UZVA 4GA9A 1NWQA 3WF3A 2Q4SA 5AVQB 1RE3A 3WSOA 1UCXA 3WHUA 1RF1A 2C24A 1MR5A 1VRH3 1USDA 3MUY1 3E6CC 1ST8A 1U0AA 1Z56A 1WKYA 4MGZE 1TMF2 3A7OA 3OD0A 4RYDA 5JZGA 1ENRA 4H2AA 1KILD 2WIIB 1FDMA 4QX8A 2M5AA 1RUF2 1HV1A 1EC5A 3CLQA 1BSNA 2XNXA 4PV1D 5GTHE 1LESA 5FYIA 3GW6A 5KLIB 1C5IA 1N1VA 3HVDA 1O7FA 2TBVA 2K37A 2JDNA 3O6QB 3VKOA 5J1XA 4UB6E 2BOIA 1CZTA 5FMCA 3ZYHA 4YFZA 4YWAA 2GA1A 1FDOA 3NXSA 1YEWA 3HMYA 1VQPP 4ZS3A 3H1HD 1IFPA 3T0BA 1BKZA 5HXMA 4Q4X3 4NO4A 3KZIH 5LATA 4HH2A 1W04A 3P3NA 4NRMA 2JDKA 4IOIH 4MXWB 3E97A 3A23A 3NNLA 3UKVA 3MTUE 2R6QA 1XYPA 3MLKA 2WUHA 2VNOA 2JEEA 5I8TA 3FUOA 4HPKA 2Y0DA 4LJHA 1L0LJ 3O1MA 1UOBA 1JY2N 2IPPA 1SHWB 2QQOA 2QZ3A 1SDDB 1W03A 4KL1A 4QDQA 3ZR6A 5FQ0A 5F1RA 2WAOA 4OQ9A 1L7QA 1RUJ3 3HNYM 2ZT9B 4XA4A 2YUEA 2XDJA 1UY1A 3AP6A 3FFQA 1QVFO 2WFF2 5C3OA 2N1TB 2L5GB 1QIQA 4AXOA 5FK8A 1PP9D 1KFXL 4R4ZA 5JMCA 5L7OA 3MF6A 3H1HG 2UURA 4XFCA 1ZZCA 3PUHA 5GZFA 1NTKK 2WSSH 1Q8VA 2I74A 3KV9A 2ARBA 3H1ID 1O91A 4DOJA 3K3OA 2WZR3 3LEKA 4HN0A 4LO4B 1OOPA 1FOD1 3FHIB 1SPPA 1H1AA 2GDFA 3N4XA 3EBRA 4YM2A 4A7KA 2WQYC 4UI9L 1RUG1 1YLLA 2XLAA 5CBLA 3AE5C 2X8KA 4KWLA 5FR3A 1FOSE 5KR7A 3FXDA 2I1KA 4ITCA 4META 5IVCA 1LTJC 5BU8B 3VP9A 1AR61 4FT8A 4NPMA 5AW7B 1E57A 3WUCA 4AVTA 2Y8KA 4AQRD 3ZSMA 5JOXA 4IE7A 4YM0A 3AZXA 2SLIA 1X8EA 2CDPA 3ILNA 2J1SA 4Q4Y1 1OKOA 1RMU1 1W2TA 2YIUB 4MSVA 1AA0A 2KR2A 3I2FA 3LF7A 4CCMA 2I45A 4AAPA 4ZY9A 4PD4I 1OURA 4ZHNA 3D6YA 5L7OC 2GN7A 5LASA 1PGL2 1FV3A 4MVTA 4XE5B 1CONA 1VQ4P 3NW4A 1AJYA 1VBA3 3ZXJA 5JXGA 1IQAA 5IK5A 1ZRDA 3WW3A 2BCCJ 1H6YA 1GMMA 4I3GA 1ULCA 3K75B 5F5AA 1QMJA 1SZBA 1XC6A 3IPVB 3KVBA 2D6NA 3WNMA 2OT7A 3U1XA 1JCDA 1LTJA 2FYUG 1LHUA 2M3EA 3GALA 4KHXA 1VMJA 2IBZD 1ND3B 2DDUA 2JKBA 4HKWA 5C4WC 1H8TA 4P9IA 3GG2A 4P00B 1UIIA 2JWPA 1MUUA 1OOPC 1L0NK 2LW8A 4S2GA 5FFOC 4E4DX 5C3RA 1DCSA 3L74D 1UXZA 2R16A 3B5LB 5E8AA 4XF9A 4OHYA 3CXHD 3EMRA 3LB9A 2IFNA 3N9OA 4I09A 4N7IA 4OMDA 1SFYA 1SQVE 4Q1PA 4IFDK 4PD4H 1RH5B 4NAOA 2AENA 3AXEA 1UOGA 3OCPA 4Q8LA 4IEPA 1OH3A 4NIGA 3MPPG 1E5RA 3SCFA 4CU9A 2JE7A 1XB9A 1RL3A 4LKSA 1PZ8A 4D94A 2Y0CA 4IE5A 4YPCA 5CADA 2RS12 4N53A 4Q4W1 3T2TA 2VBBA 2H6CA 1S0DA 4P9LA 4R4XA 1OX3A 3RL0B 2B39A 4QDRA 2ZAEB 4LBQB 4QWNA 2QJVA 1G1JA 2LKMA 3T97B 1SLQA 3VYIA 4QHBA 3U4SA 3RPQA 3G4SP 1XSRA 3VDBA 2BVVA 2LXCB 2ZVOB 4Q4X1 1RQUA 3OW2O 2Q3IA 1UIXA 3MP7B 2Y34A 3OBZA 4HT1T 3HD7D 1RUC2 1WCUA 2YDEA 2Z42A 2G8YA 3DXUA 2HEWF 4D7TA 5FYVA 1OZHA 2KXPB 1A8DA 1QQP2 2DYCA 2IVJA 1SFCC 3BCWA 2J5UA 3OYWA 4LBMA 4BLJA 4I1LA 5JSPA 5FZIA 3VBHB 3USSA 4CUBA 1JH5A 4GWMA 1CGPA 4OUEA 3KZ4C 1NY71 2P5BA 3AKQA 3BOPA 4XHBA 4Z1MH 4AHXA 3WDVA 1W28A 1BEV2 2JB4A 2C9AA 2XR4A 4Y1XA 5LEKA 1LULA 1QJY3 2ADEA 1F5FA 4QMAA 2CDOA 4OQ8A 4LOSA 3HQXA 1LHWA 2AH2A 3IIAA 4YGDA 3RMYA 3PJSK 3H9AA 4P9YA 2JJLA 1RE3C 2A1XA 2R071 3OPTA 2ORZA 2ZACA 3QLQA 1ND2B 1OC1A 5CHXA 1BGYE 1CN1A 1YI9A 3LEIA 1VRBA 1IFDA 5FPLA 1GL2C 5BVZA 2ZVNB 3VN0A 2DBIA 5CCGD 3A5TA 3AMNA 1UWWA 2P58A 2NP0A 4OHZA 1AL23 4AI2A 1RUE1 2VCBA 3MIGA 4RL7A 5CG8A 1VRH2 2BASA 5FZEA 5FRAA 3BALA 5HCBA 5GLUA 1HH0A 4OWFA 1DLLA 4Z2AA 1D7MA 2PLV2 4OYUA 2FBEA 2YC4A 5BNPB 4UW3A 2XWBB 1FDIA 1F2NA 1ZOYC 3CI9A 2IXJA 1X33A 3JZVA 4XTMA 1QDCA 4UW4A 5H9SA 3AE9C 1YIPA 3MYXA 4CDQA 2AEYA 1VPCA 1W3VA 4LE4A 2KP8A 3TNUB 1JOJA 1WLDA 1WW7A 2Y6GA 5FLHA 1IPJA 2ZFCA 5FLJA 1WBFA 4WWIA 4NJ4A 1Q8QA 4PJ0E 2VO5A 5CCGC 4CDXB 3UJOA 5A3OA 1WZXA 1NTMJ 1WCQA 5JLVA 3FUQA 1NCQB 4XJZA 3VBHC 4AF9A 2R062 3D4KA 2NPSC 3PHLA 4I7ZC 2ZZQA 4LE3A 2Q0AA 4Y22A 4GB32 4ZNCA 3RYRA 4EYUA 2DTYA 1SQQD 5FXVA 2XNDH 4N78E 4RFT0 4NHLA 4COUA 4CPBD 2ADDA 2L9LA 3LCPA 5KLIC 4EWAA 3LDRA 4E4ZA 2YB7A 1VQKP 1WUVA 3SKVA 5A7OA 1FPN3 1JW6A 2WSUA 2BFUS 1LWUB 4QXCA 3T2QA 1WBLA 1POV3 2VGDA 4FPLA 5IATA 4OVNF 3W21A 1IZ3A 4HVRA 2BJSA 2WNVA 4LBKA 4X6QB 1MS8A 1VBE1 4BHPA 1NLSA 3N9MA 4W80A 4M3CA 3VDDC 2R5DA 2ET7A 4N7UA 1V6NA 5BUVA 2W6JH 3HD7C 4AEDB 3M9BA 3ZPOA 4RHV2 2VZSA 2WT7B 2JIGA 2K88A 3AYEA 4UW6A 4XBNA 3TAYA 3U4XA 5LA1A 1L4AD 1OT5A 3MEPA 1YTZT 3BRTB 1J58A 1JM0A 2IYPA 3WX5A 2VR4A 3PVOA 4MH0E 2WNVC 2WNUB 1W8HA 2QUOA 4D6SA 5IVBA 3JCUH 2N1TC 4O61A 5IUQA 3RZMA 1MS1A 5I0RA 1V6JA 1DEBA 1FS0E 3S4RA 2YMZA 2ZGSA 5ABJB 3POIA 4JDMA 2YO3A 2HWD3 5KKZC 3H3LA 1LTAC 5A1FA 4JHZA 2B9VA 4NWVA 3BIEA 3R4DB 4HXCA 3PHMA 4KG0A 3CWBJ 2W87A 4QHOA 4AZZA 2KM2A 3WUVA 2KOGA 1RHI2 1BCXA 2JG8A 1FMD2 4FP2A 1STMA 3U07A 1C3HA 3NV2A 1NG0A 1LHNA 1ZXGA 1K05A 2Q1ZB 5BNOB 2OA2A 3B71A 4DZOA 1FZFA 2Z69A 1MPXA 1W2BO 2QIWA 1AZDA 2VAUA 2KB7P 1JY2P 2WZEA 3DCQA 5IJRA 3LIEA 2PN5A 3AKRA 4QM9A 3RRDA 2BYVE 2YBSA 1EDLA 5BNOA 2WDBA 3WZ1A 4LNVA 1URQB 1RVF2 1UXXX 4EWEA 2OYIA 1JYWA 1KYOD 1G8WA 2RR13 1YHFA 3J7NA 4BZ4A 3OSDA 3B9CA 3FX3A 3N7JA 4Y1ZA 1RVF1 5FBZA 5JOZA 4Q4X2 5I0DA 1BDCA 2HEYF 2AREA 1CAWA 2NQYA 4D3WA 3ON7A 1BK0A 3U10A 4GOFA 4XCAA 4GKGA 5CISA 1XE7A 3RZZA 4XUNA 4WZCA 2HR3A 1TU3F 1RF0C 4R4MA 5AVYB 2NPIA 1WW4A 4IL7A 3T08A 3SISA 1JCCA 3ZYFA 5BNNA 2JWDA 3GF3A 3AE6C 2XQRA 2EAKA 2XKOA 1CJDA 1DYPA 2BTVC 5FOBB 1T6GC 1LP1B 4BQWA 5L7OB 3HOBA 1H8VA 4AEMA 2IYOA 4N78D 3I3EA 2ORXA 5T3NA 1RUD1 4AHWA 4XF0A 3ZMOA 3D71A 3L71E 1C8M1 2ZGQA 2ZX0A 4I02A 3P8CD 1YHQP 4B4PA 4YZ5A 1CAUA 4O65A 4YPJA 4CEWA 1VBD2 2E32A 1CZQA 3OJAB 4OFGA 2W94A 3WNOA 1VMHA 3IBMA 5JPMB 1PMIA 1HDKA 1ND3C 4D69A 1OA4A 5D8AA 3VDDA 4W4ZA 1SQPK 5EV7A 4E8DA 1L0LE 2WSEH 1UIJA 4P9JA 2ENRA 1SMVA 2NZ2A 4Y4YA 3HT2A 1D7PM 4FBFA 1Q7YQ 2ZMLA 2EIEA 2K0GA 2QQUA 3GHGB 2ZEXA 3AX4A 1ZA4A 4TXWA 4CUAA 2KLUA 2WPSA 4D0QA 3OUJA 5BV6A 3VBHA 1M56D 2XJSA 3WDTA 1K12A 3FBYA 3WP5A 4A6SA 4K1YA 4NPFX 1RHZB 2V5YA 4E2QA 5FYYA 5AW2B 1XU2A 1ZYBA 1AYN1 2NPSA 4YFWA 4UB6H 5KLVG 3L70E 3WDYA 1PVC3 1NTMD 2BOJA 5DDJ1 1OHFA 4MXWA 1ASJ2 3N9NA 4IV1B 1UY2A 4NPLA 1UYZA 2WQZC 4GMP1 4KU7A 4QPYA 4RFRB 3T3YA 1S2BA 3O1OA 2HYXA 3BVHA 1W6NA 2VUJA 1REDA 2XHNA 3CCQP 4ASVA 4H13C 1DGWX 1Q2NA 4LXLA 4GZ9A 4I0WB 4LKDA 1X22A 5EHDA 1FV2A 1OI6A 2ZBJA 1YJKA 2DBNA 1PL5A 1LU1A 2FYUD 3AL5A 3GZAA 4AL9A 2VBPA 2Y6FA 3ZLIA 4PV1C 1LOBA 2YXQB 2JDPA 2WT2A 3B9IA 2ZGTA 2XOMA 5HI0A 1S3JA 1S1AA 2JDZA 4AQ6A 2E7TA 2CV6A 1FYUA 1HTLC 4TLFA 1B35A 1W9SA 2WS93 3PTYA 1A78A 5D8AC 5I8YA 5I93A 2EXIA 1D0GA 3BU0A 1JY3N 1J3QA 2X5IB 1CX4A 1OUXA 2D5HA 4K3UA 5BNNC 3KPEA 5CMZA 2AEJA 3NMDA 4DT0A 4WV8A 5LBEA 2DUOA 2P1JA 1BSHA 2X5IC 1KB9D 1ND2C 1VBC3 1W0OA 2QQMA 3C7OA 2RS13 3CDZB 1ZZ8A 2ETEA 1PGW1 4IEWA 2GC3A 2VCMA 4GB33 1X0TA 4DB5A 2Y0IA 3O1UA 1VBA1 2R0FA 4JGYC 2PFWA 4DEQA 5FCCA 3WV6A 3Q8EA 2IZ0A 3C7HA 3IDBB 1XSQA 2W08A 3IZOA 4DXSA 4W65A 1MS9A 3A4UA 3CC4P 3RJ2X 1ULPA 4DXTA 5C9AA 1SQVJ 4CXYA 4JKMA 3TWIA 4DRRA 1IFMA 1Y4WA 4BIFA 3CJXA 4LGDE 1SQBG 3A0HE 4AEKA 4MV2A 5AVAA 3THCA 1KDKA 1Y9MA 1AR63 2VUDA 5CNAA 2IZWA 4XIKA 1JTHB 2BBAA 2WWWA 5GZGA 1T3UA 5C8CB 5E79H 4LBOA 2OYIC 3FN9A 2XBO3 3JBG2 4W50A 4SBVA 1HB3A 3AE3C 2XB6C 3UJQA 5FZ0A 1C8M2 4DJGA 1W8ZA 2WZR1 2YBPA 3HBZA 5DN2A 4KJMA 5FY4A 3F89A 1SFNA 1DDLA 2RKLA 1W2NA 2B8MA 2W68A 1QJZA 2W3JA 5F5CA 4AQ2A 4FXKB 4AVAA 3BOWA 5ACA3 3CWBD 3H1LD 4EOTA 2CAVA 1IQDC 2JG8C 1C28A 2PQSA 3GM8A 1PM4A 3POGA 4ISQA 2YU2A 1IC2A 4LLOA 2HG5D 2JDMA 5F39A 1SFPA 3OTFA 3WCSA 2B46X 1YI7A 2YHJA 3CKHA 1RUJ1 4L92A 4YNIA 3HUSA 2JG8B 5FPUA 3L72G 3CL1A 4IL6H 1XNTA 1URQD 1RHI3 2X53S 1E79H 3GMAA 2O1KA 4FPYA 4X8NA 4BXFA 4DO0A 4ZXKA 5B4NA 1AR71 1MACA 2P3IA 5IVFA 1VQMP 5ANNA 1RUH2 3DYPA 3AEFC 1USEA 3CEWA 4OHWA 1JXNA 1N1SA 5HV4A 1L7RA 1AHSA 3AYDA 4KGGA 4PF5A 1OQEA 3P32A 1AYM3 1BHGA 4LHSA 1QH7A 2VL4A 3UNPA 1WMKA 2ATFA 3BCCE 4GKYA 5K7PA 3WP4A 5KKZB 3CCMP 1HW5A 5FZKA 3KHCA 5LRRA 1VQ9P 1YQ4C 4QKBA 5J09A 1CX1A 4JYCA 5J7MA 4EN9B 3KSCA 2QA4P 1VALA 2PHXA 3ABVC 3LWCA 3NNMA 4FPHA 3CU7A 2K3RA 4U3FD 4L2NA 5DAQA 3L72E 2F17A 4Y22B 4AI0A 2XXZA 2Y26A 3JUUA 1BE3E 1L0LK 2FZ2A 2VTXJ 2WSCJ 1H30A 2A5ZA 3PMSA 5A7QA 3NJYA 4FP3A 4UW5A 5LA2A 3L75E 3KB5A 1JTHA 2E42A 4CCJA 3MHZA 1GK6A 1E5SA 4Q0SA 4AEJA 4AGVA 1LT1A 1VLNA 2FYZA 2GC1A 2VZRA 4YZ2A 2BFUL 4BXLA 5FYBA 2N1TD 2WVRA 1O4TA 5H9QA 2OTLP 5FY8A 1SQXJ 3G71P 1HVVA 1RE4C 3ACGA 4GD4A 3M3EA 1NTME 1KJRA 1AV1A 4IEUA 2RM21 4L75A 2C0ZA 3A7QA 3IAQA 3NAPC 5FPZA 3KYQA 3MLLA 3L73E 2XVKA 5FXZA 2WZPP 5EIYB 2FFDB 5BU5A 4XDPA 5LY1A 2D97A 4GH4B 3VBFC 4COYA 2VCAA 1LKNA 4C90A 1SBFA 5C70A 3VD3A 1ZRFA 1GWKA 3P6BA 1GOGA 2WA3A 2ZGRA 2JDAA 5C7GA 1GU5A 1RYYA 4FQZA 5FO8B 1OF4A 2VW1A 5F5IA 3FHAA 2Q8OA 1AYN3 3PLQA 2YKOA 4XF4A 2Y0EA 3ZIWA 2BCCG 4QX0A 4CDUA 4HKZH 1GWMA 4MUVA 2CGPA 2ZMNA 1CAXA 5FZ7A 5C4WB 1KFNA 5FZGA 4LEJA 4DQAA 3D6ZA 5LK5A 3WG4A 1V0AA 3URFA 2W92A 2K9JA 5KWRA 3S5QA 1HRV3 1OLMA 3V2PA 2C9LY 2IXKA 3IMMA 3S0MA 3IF4A 2AGSA 2RS32 1NE4A 4URTA 2NN8A 1IJDB 2KA3A 1AQ5A 1QNYA 2ERFA 2JXAA 2UY8A 3B00A 4QM8A 1DGWA 2XJQA 2R49A 3Q9OA 2ARAA 1GK4A 3B93A 1WLCA 1OFCX 2LALA 1LOAA 1H0TA 1W39A 3ACHA 4P5YA 3AMHA 1Q56A 1RVF3 4QQ2A 1HJ0A 1DQ4A 4Z1VA 2KK7A 2NMOA 1BMV1 3IFMA 3O1PA 4BPZA 1TME3 5BYNA 4OLLA 1QDOA 3PIGA 2WTYA 3VKMA 2DFCA 3VN4A 1GUIA 1W6PB 3ACIA 3CWBE 2HYKA 2VZTA 3H0OA 3GCXA 4WM7B 2QBXA 1DZQA 2UU8A 4R9DA 3HAGA 4LT5A 2J58A 1H4HA 2VMFA 3ZSKA 2C5DA 2G9ZA 4C1WA 2JICA 3ATGA 4Q4W3 4CP2A 4JVAA 4JKLA 3PJYA 1NU1G 1UPSA 1REFA 1S9KE 1JY3P 1N7SA 1VQ5P 3RL0C 1AL0G 2KZJA 3VMAA 1WMXA 4ONUA 2YPDA 3OF1A 1P84E 2KLVA 1QX8A 4ZKPA 3EB7A 1DZTA 4YG6A 2PELA 1UYYA 2WO3A 2XJTA 5EFUA 3PURA 4JYBA 4CCKA 2HJIA 2VZOA 1WGPA 2CYFA 3USUB 1Y9BA 3ZXDA 1EXJA 3LEGA 3MICA 3QBQA 4JGZC 4I2OA 1OVUA 1MEC3 1UMHA 3SXWA 1W8UA 3JC22 5BNNB 3OY8A 2FD8A 1KJLA 1UKRA 4XFFA 1ZNPA 3MIBA 3SH5A 4Q29A 1YJ9P 5H9RA 5HPOA 4MN4C 3PDQA 3Q1MA 1RJ8A 4CEWC 3WF0A 5KXCA 3M0DA 1RIRA 4LBNA 4YSFA 1XTGB 2J1TA 2ZGPA 3BPZA 1YFYA 4QDSA 1T2KC 1OH4A 1R1A3 4YGBA 4LO7A 2PHDA 3M9HA 1VJ2A 2AXTE 2WZ8A 1IKPA 2XG3A 1V6MA 4JV4A 4Y1YA 5C4WA 3V4QA 2YXSA 1GL2D 4AVSA 2WSCH 2FXPA 1DH3A 4RN5A 3MFCA 3TB0A 1HF9A 2QKDA 1RF0A 4YW1A 4V2VA 4CDUC 4HB1A 1Q8OA 5AVSB 1XNBA 1NQJA 2MJZA 3CC7P 3N3HA 3VLBB 2V5DA 1RF1B 1DGRN 2D3RA 2P17A 4OZOA 5JXHA 1AJOA 4JGYB 3DL3A 1NTMG 5AC92 2R7EB 3BI3A 3AEGC 2FYNB 2PAEA 2JWAA 1SQQK 1W8NA 1OD5A 3VBUA 5A7PA 4AOCA 1NO4A 3KHUA 1S0FA 3M9QA 1OFNA 2YKPA 3NAPA 3VHNA 4XVHA 5JI9A 5LA9A 4QPGB 5TSWA 5JOYA 1BBT2 2OYHC 1NZIA 5JR7B 1P84D 3M3OA 3ALQA 3M0AA 2WS91 1LCLA 4HANA 5D1IA 1HLCA 4AHYA 1X82A 5IK4A 4QPGC 5K8SA 2OYIB 2GH2A 1NTZE 1GICA 3Q5PA 4J25A 4D6TD 3OBRA 4QPWA 5CFCC 3AP9A 3UGGA 2Y6KA 2HODB 2KSEA 4GAZA 1VQNP 1OA2A 4XXPA 1VQ6P 1ZN5A 1BYHA 2IVIB 2A45H 3IIIA 4PT6A 1KZUB 4YGCA 4ZU4A 3ELNA 5AW8B 4YVWA 5T5LA 2VZUA 4IEOA 3B7MA 4E4SA 1C57A 3CMEP 2YFUA 3U78A 3WP3A 1S2EA 4DINB 1LWUC 2YNYA 1L0LD 1FMD3 4QHZA 4ES8A 1KQLA 1T2KD 4YRDA 1SBDA 1SLIA 2E7QA 3JBG1 2ZJCA 2MEV3 1F4AA 4GULA 4IEXA 4WVMB 3TK1A 1MS5A 1QJFA 1K9MQ 3VDCA 1GANA 3ZMNA 4ZKTB 1BVVA 3Q5RA 1QXJA 3ZN5A 3J7LA 2X09A 3PNAA 4P9XA 2XDVA 1VAMA 5DUVA 3ZIXA 1RUG2 4BMBA 4COZA 3HPNA 3K51A 3A3YB 4BRYB 3L71D 1T6BX 4D6TG 2R042 4QD2A 1G1IA 5FZDA 5IK7A 3KV5A 4PJYA 3L4FA 3VHPA 4FOQA 3MV01 1KITA 1EUUA 4JF7A 3GF6A 3MDPA 3FLTA 2KUBA 4KBZA 5DUUA 4XBQA 3VV1A 2RM22 3WQ7A 2C1FA 4IL6E 1YJWP 1UNBA 1QVGO 1UZYA 5CFDB 4NHMA 3ZXKA 1KS5A 3B94A 1FBMA 1GDTA 4RS5A 2ZZJA 4BLIA 2QJYB 2GP3A 2WPVB 4LK6A 5EYYA 5KC5A 1FJPA 3QD6A 2MNGA 2BVBA 1S2KA 1GNZA 4NAMA 5CFDC 1YTZI 5B5EH 4BWNA 1ULFA 3DF0A 5APTA 3KV6A 3Q8BA 4ORFA 1YJLA 4CCCA 4MGKE 1SQ4A 2WNUA 3TRSB 1L0NE 1EXIA 1JHJA 3FX0A 4HYTB 5IWFA 3S9OA 5F5QA 3VBOA 2ZXXA 1ZBE1 3WF2A 1DQ0A 4W6XA 2JKXA 4YW4A 1W6QA 2E74D 3MGNA 1KQSO 1GD2E 3VBFB 3TF5A 4HN1A 4QX7A 1AVOA 2IX7C 1F31A 4HK9A 3KT4A 4Y28J 4L11A 3GBGA 2B5HA 3H50A 3HNBM 5FUNA 5SV8A 3IPVA 4JX0A 3AE2C 4QX3A 2OX0A 3E5QA 5J48A 3MV11 1LOEA 4BQ1A 2PHRA 1NKZB 4WBAA 2JP3A 2WNEA 4Y1VA 4D8MA 3JXSA 1IK7A 5APXA 2WSFJ 4Z07A 4R8HA 1EDJA 1PIXA 5FZCA 4HK8A 2EXJA 2CAUA 2QJPC 3NKTA 1O3RA 2X5IA 2C26A 1D2SA 1FT9A 3JB8A 4ZS2A 5FZ1A 5IFPA 1OVSA 2DVGA 3FGAD 4W6YA 3WF1A 4FFHA 4B7KA 4C0BA 3CX5I 1ASJ3 2KZIA 3O7OA 1R093 2J59M 3HE4A 5K9YA 3WUTA 2WT7A 2ZABA 4IUGA 4YW2A 3ZM8A 5HV0A 4XABA 3BCCJ 4IE0A 1OPOA 1PPJE 1P84I 2YY1A 4XFHA 4M3CB 5EQUA 2UWJE 4KMQA 1AXZA 2E6VA 1DEEG 2OQ7A 1W2AX 3MBWA 4A45A 3EQ2A 5KAIE 1NY72 4B4RA 5AVZB 1PP9J 1NOVA 2IFRA 1CESA 3M4FA 3TGUD 2HWB1 4COVA 3ZXFA 5H9PA 2Z5WA 4LTAA 4M00A 3WUDA 1BVP1 2JE9A 3ZDVA 1BE3J 3ACLA 3UT0A 3EYPA 1NJIQ 2B87B 3IDEA 2H43A 1GNYA 2OZ6A 1MS3A 1AR72 2DURA 4M4PA 1NKGA 5LY2A 5ACA1 5I0UA 3HE5A 3UIAA 3DGTA 1S5LE 5FZBA 1O8PA 3ZVXA 4CP9B 1NU1D 1HQLA 1DQ2A 3II6A 2QDNA 4M4RA 2AC1A 1N7LA 1E5HA 3H8UA 4A42A 3ZYPA 4LBLA 5CFDA 4K40A 1LJ7A 4FPKA 1R081 4JGZB 4RO0A 2M5AB 4IEZA 3SQOA 4HETA 1QLED 2ZGUA 1JHNA 4CU8A 5C8CA 3I59A 1COV2 5DXDA 5FOJB 5IVJA 3L73G 5J36A 4CDWC 3L37A 1CI6A 2WT1A 2VVFA 4CYDA 2RH0A 5FP3A 2FYUJ 1ULDA 2VQ0A 4Y26A 3ZFEC 2GNMA 2Q8DA 3AZVA 3WLUA 1GP4A 4A6OA 3KWVA 4BJ0A 5APAA 2D5FA 5C3SA 2QQPA 1C1FA 3VBRB 3QOPA 4NWWA 1ZM1A 3MPBA 1ZLLA 2W1UA 2W9XA 3OGGA 3WY6A 4NROA 1HJGA 3ZKYA 2BERA 1V6IA 4LPLA 1JNMA 5B5EE 5CIRA 3K4AA 5LBFA 4CDQB 3HUSB 2ZHMA 4UFIA 1H9WA 2F4LA 2XVLA 1Z78A 5B2GB 2YGMA 3RDIA 2RS31 3T1MA 5C5TA 1H6XA 3IM0A 3ZDSA 1G7YA 3VBUC 5EJZB 4UAPA 2HODA 2O01H 4GIFA 1CQ9A 1CJPA 2IXHA 3IAPA 3H1KE 3RGUA 1AX2A 3WQ0A 4EROA 1R091 3H7YA 5FY9A 1GV9A 1EV12 3I3MA 2EVXA 3E6DA 3I2HA 4LQRA 2BEQD 2WC2A 1I9RA 3IDAA 4EYYQ 1HRV1 3WQ1A 4ASMB 5HCAA 3TGUG 2BU9A 2E75C 4M3LA 5BNPC 3W67A 2WMMA 1CZSA 3P1IA 2J1VA 1QOTA 2GMPA 3I2OA 5FWEA 3L74J 1F15A 1FC2C 1TNRA 3AMQA 1D4M1 1QQP3 3H1IE 3J7HA 1U7JA 1ZR4A 4HSJA 4PI2A 4FO9A 3EQEA 4E9KA 4CPBA 3P5BA 1NTKG 4AGGA 3RI9A 1R1ZA 2WS92 1ZBE3 4MOAA 4DS0A 1EP0A 2TUNA 1I3HA 4NIHA 5T5JA 1KYOI 4B4QA 4MX3A 2QFEA 1VRH1 3FWNA 2FFDA 1O3SA 4YVSB 2D6KA 4NRQA 1G2CB 3UKTA 5DAVA 3S5AA 2FCUA 3TEYA 4JC1A 2JDHA 3Q8AA 4LULA 3BTXA 5HXVA 1HGZA 1KYOE 2Y60A 3SH3A 4AQSA 2K2SA 4ET7A 3C9IA 2DV9A 3HIFA 3AYAA 4NMIA 4OH8B 1VBC2 1LTIC 2FDFA 3NL1A 3V2QA 4ISRA 4BK4A 5AC93 5DJTB 3MUZ1 1GU4A 3PIJA 2JG9C 1NTKE 4R9CA 1K42A 3RK3B 1GQGA 1V6OA 3P8CE 1NX9A 1J1LA 1JOCA 2H89C 4AEDC 4OGQD 5ABJA 1JZ7A 3H1KD 1NU1E 3FZ3A 2D43A 4WM8C 4CCNA 1H1IA 2C9KA 3V0AB 1NHLA 1Y7BA 3KLSA 4MGSA 4ES9A 3E7KA 4WY4D 2YXRB 3ZFFA 1U12A 1HXS1 3FJSA 1CW5A 1F4HA 1QJX2 1QNWA 3JU9A 4L9BA 4P08A 5FREA 1BCCJ 1JMBA 2ZGMA 3WNKA 1PGJA 4ZPIA 4U3FJ 1LOFA 4YVWB 2BNMA 4BK5A 4XC9A 4N43B 3VD4A 3V4WA 2W8ZA 3AL6A 3O8ZA 4HJGH 2EA7A 5ABJC 2QE7H 2QJYC 1LECA 1DFQA 5AVVB 2ZHLA 2R063 5LRSA 3H1LG 1S0CA 5A80A 2X10A 2WINB 3QH9A 2DUPA 3AZZA 4Q1RA 5AVPA 4AUWA 1CAWB 1OLQA 5AW1B 4L0PA 1WRGA 1R8EA 4LLFA 1RJ7A 1RUI1 4N53C 1ZP0C 2XMLA 3RK3E 2LTNA 3RYKA 1POV0 1J3PA 3KVAA 1TMF3 2J22A 4GH4C 3OPZA 4R9AA 2HWF1 2XBO1 4LHKA 3WQBA 1UX6A 1ENQA 3HTKB 2Y9YA 1V9U3 3ITKA 2DU1A 1PZ9A 1G9AA 1SPPB 5CU1A 4YW3A 2HBUA 3FXEA 3ZFGA 2FY8A 2YROA 2ZX4A 2RVAA 3KCCA 1W0PA 2P7JA 5F9TA 2E53A 1H2NA 1YFUA 2D6PA 3H1LJ 3GJAA 4INDA 4RSUA 3T09A 2E63A 3ZKUA 1VQOP 3MZWB 4IE4A 1JZ3A 1AYM2 3CD6P 2VOWA 5C6CA 1GQPA 2SBAA 2OARA 2HWF3 1H0BA 2ZGNA 4M01A 2FCTA 1LENA 1UW8A 2P37A 4FXGB 4D7SA 1QXRA 3ZSJA 3LKJA 5JMOA 2DU0A 3WT3A 3H8OA 2A45G 2Y6HA 4PLOA 4QXHA 1RUI2 4XILA 5A70A 1VE0A 4C7NB 4IFMA 2VOKA 5JXIA 2MKVA 3B5NA 1A3KA 2WWSA 3DXTA 3LIGA 4RGGA 1PZ7A 1KB9I 4LORA 5GALA 3WVJA 3KF5A 2XV5A 1GYKA 2PXJA 2W27A 4BQ3A 3HN1A 3JSVC 2QJKB 1X9TA 1MQTC 3AJZA 1JO5A 3ZYRA 3I97A 3M8LA 5CCHC 1AX0A 4BQXA 1KB9E 3FWLA 3O6QA 3CZUA 1KILE 1ZVFA 2KNCB 3SCHA 4P9GA 1IO4A 3K77A 2R1BA 3GHGC 4M3CF 4F83A 3GZEA 4XAAA 2R0HA 5FP8A 3PTRB 4UWDA 1IFJA 4H14A 1JUNA 1X9VA 4UXAA 2GNDA 3O1VA 1ZZBA 4CP0A 4XFBA 1LTGC 1SQVK 1BQPA 1QF3A 2A6ZA 3CO2A 4K21A 4B3NA 2EXHA 3TN93 5DDJ2 1SQQG 1S0EA 4DIQA 1NLRA 2VRSA 4N8MA 1W6PA 1F5JA 4IV1C 3H25A 4DCKA 2UWCA 3M3CA 2CK3H 4P5HA 1QGLA 1OPMA 2FHRA 3GLMA 5KTBA 2P34A 3POSA 4C8DA 1VAVA 2R3CA 4H13B 3T97A 4B29A 2P3YA 1R092 2B42B 5A6QA 2R073 3L74G 3ZN4A 4K8FA 1DZRA 1SQPJ 1N3OA 1W9WA 1LTBC 2OUHA 2RMU2 3BGAA 1YQ3C 3UYJA 5KJ7C 2JO1A 1RB8G 1H2KA 1NXD1 4LLHA 3S1KA 1KD1Q 4AW7A 1L0NG 3T0DA 3VZNA 2QQVA 5KAFE 1OIPA 1L4AB 4Y99B 1UZ0A 1OLRA 1ZZ9A 3VMZA 2VZPA 3L72D 2ZAHA 3C8XA 3O0XA 5FTTC 2E31A 1LT9B 1W99A 5B4XA 3CNAA 4S2FA 2GNTA 3CCSP 3AK0A 1G9FA 2UYAA 1GZTA 2A3XA 3O12A 3HUSC 5H2FH 1O8SA 4ARYA 3RJRA 4OUSA 3H32B 2VMCA 1O59A 2ZGOA 1KXGA 2OS2A 5C9AC 5JIAA 3VL8A 2ES3A 1D4VB 4NIDA 2RE9A 2ARXA 4LMFA 1DG6A 1C4RA 1SQBE 3O14A 4UFLA 2E75D 1QOOA 2HFED 5FMBA 3H1WA 3S6PA 3T2PA 4N9HA 1FZEA 2XPJA 4A7YA 1RF1C 3B5NC 1J3RA 2FXOA 2LUWA 1OVRA 4KU8A 1J1DC 2FDJA 4Q4W2 1JZ6A 1K3IA 5FDBA 2FYNC 3LFIA 2XJUA 5CBOA 3CMAP 1YFXA 4JQ0D 3KQRA 1SP4A 2D2CC 4WY4B 4GOEA 1Q81Q 1URQA 3G6EP 3OJBA 1US3A 4MXVA 3RBZA 3VBSC 3TYYA 4CU7A 3BTZA 2KI7B 1NLQA 4BE3A 3ZYGA 3CXHH 5C39A 1VQ8P 1W6QB 2DF7A 3ZXEA 3L70J 4N6JA 2R043 3VB9A 4BOWA 1MEC2 2B9UA 2XKMA 3V0AA 3CLPA 3ZFEA 1ONAA 4C1XA 2RM23 4EN6B 1UIKA 5A3LA 1JZ2A 3BUCA 3LA3A 3I54A 1VP6A 3C7GA 2GC2A 1FMD1 3OPWA 4V2WA 2BNNA 4IEQA 4B1MA 1RUD3 4BQ2A 3KHBA 1EDKA 5GTHH 4BISA 1JBCA 4XEZA 4LBJA 2H6BA 1I5PA 4NIAA 3RI8A 1RUNA 1ZW0A 1G6NA 1UN1A 3B5ND 3O5SA 2OQ6A 1SQVD 3OGRA 4QGLA 2L91A 2Y6JA 3O0WA 1KILB 1EV13 1UY3A 4P14A 5FJKA 3ZOIA 1NT0A 3RK3D 1FJKA 2WYFA 4MLOA 4MZUA 2HWC1 4CPGA 2KS1A 3CCJP 4OI0A 5T5OA 1PX3A 1LGNA 4XZUG 2ARCA 1OD3A 4HSLA 5AC91 3WW1A 3AJYA 3POFA 2O1JA 5IVEA 3FBMA 1A02J 4XF1A 4YZ3A 2Q9IA 2LR2A 1KGYA 2O0OA 3I56P 2WBKA 5APSA 1GTWA 1V9U2 5T52A 2HWB3 2AACA 4E2GA 1MFTA 3H6PA 1O6UA 1RC6A 1U5ZA 1AR91 1AXKA 1VBE3 3N9QA 2VZVA 3OGSA 3VTPC 2QVAA 2QNKA 1EZVD 2HEVF 4HONA 4KH9A 4A7PA 2ZJSE 1M1JC 1V70A 3CBNA 4I0AA 3WOGA 1G9CA 5LK7B 1E5IA 5DG2A 2QSIA 2HH9A 3WW2A 2R44A 2VTXA 4AEDA 1CPNA 3I8TA 4C0HA 1R5LA 2RMU1 2IXCA 2M3BA 1FATA 1UAIA 4FTSA 2AR6A 4MGYE 1PX4A 5SV5A 2R30A 1UD1A 2V09A 4FOWA 3OUIA 4H55A 5E88A 3S57A 1IS3A 1X79B 1LU2A 2WRAA 4CP9A 1A6CA 3N35A 2HPCA 1L2PA 1C1LA 2YZ4A 1J1EC 3MFAA 4AI9A 2WPQA 1NH4A 3H1IJ 1FPN1 4QPIA 3INAA 3TNQA 1L0LG 1X50A 2D6OX 4ZU7A 5GZDA 4F7ZA 3A0NA 1KQFB 4GDOA 2EXKA 1IGOA 1YCIA 2G4IA 4K7JA 1RY3A 2CGNA 4FFGA 4URAA 3POEA 1NAFA 3NAPB 5CKQA 3K4DA 3GBFA 3DYOA 5CFCA 1PO23 3WU2E 5KHJA 4A4AA 1N73A 4M0NA 3U37A 1S9KD 4TWTA 4AFMA 2Z5HA 1F9KA 1ND3A 2QJPB 1ZZ7A 2AEFA 2D44A 3V6IA 2EAAA 3KCXA 1BGYJ 4LUMA 5FY0A 5CKNA 3VUOA 4WY4A 1QHDA 2D3SA 2J7MA 1QH6A 2QVSB 1NUKA 4QB2A 4BYYA 4NHYA 1BJQA 1GKBA 4CEYA 5F7UA 2CWSA 2YFZA 1MZ9A 3I4IA 3NJXA 2GUVA 1KEXA 4PF1A 1H8TB 2W2IA 2ILMA 1HBWA 4EIJA 2DVFA 2WA4A 3F95A 3ILFA 5FYMA 2W1SA 1VBD1 4FTBA 4PCRA 4BQ4A 5T54A 4CVUA 4FSJA 2QQIA 2A6VA 5DDJ3 5BY5A 2YMKA 3N7NA 1GR3A 2HWD2 3MIEA 5JOWA 5AFEA 2W6BA 4ZZ5A 1Z7S3 3OBTA 2HYNA 2F4PA 2WABA 4FPJA 3NFQA 4GALA 2YKQA 3WG2A 4RA0A 4BXSV 2DCZA 1COV3 2PHTA 4NR1A 2FDGA 3UL2A 1JZ5A 1O4ZA 5FUIA 3GXUA 3H1HJ 2MHFA 4E4HA 4XDOA 3AEDC 4KGQA 1SQBD 5E79E 1BMV2 4MO3M 5K0UA 4U3FE 1MZEA 3HTKA 1DD4A 5ERLA 5I8SA 1APNA 4XBLA 2GM4A 4QQOA 3AMMA 5CCHD 3J4UH 1SEFA 3ENRA 3LPFA 3NQHA 1GQHA 3DKWA 1EPZA 2KYVA 1FXZA 2VXRA 2R041 2QQWA 3FLPA 1LT9A 2B9BA 1BBT1 4GODA 1J84A 1SLTA 2E26A 3KCYA 3QACA 1TEIA 1MV8A 2HLOA 1SQQJ 1JUIA 2CY6A 1CIYA 1GP5A 2DVDA 3GGLA 2I8DA 4DNYA 4I6MC 2VOVA 5JCTA 1KB9H 4N43A 2IFMA 4DXRA 3O0VA 2CL2A 2P3JA 5FPXA 2AEMA 1MS0A 2IBZG 1IS4A 2Y38A 4GXLA 2N7GA 4RR3A 4X6RB 3VBRC 4CDWA 1SFCB 3HE5B 5FP7A 3CCUP 3CZJA 5FZMA 3I59B 3T2OA 4FTEA 1S55A 1UX7A 5AW3B 2E74B 2TEPA 1JZ8A 3I2JA 2VG9A 1GWLA 1PGQA 3E1IA 2QG4A 2NLRA 3L75D 1JYCA 1XOYA 2EIGA 3D82A 3DV8A 3I7DA 1H0TB 4GWIA 1DQ1A 5A32B 1QJY1 1LT9C 1VBD3 3AVSA 3H1LE 4TT3H 1L0ND 2GUSA 1GBGA 4RGAA 3WF4A 2J1RA 5CCGA 2Q1MA 3DEMA 1PIV2 3UV9A 3VBUB 4LHLA 3ZXAC 4EV0A 1NTZD 1V6KA 1NTZG 1D4M2 5A3NA 1IG3A 4FOVA 1QQP1 4FQ4A 5CCHA 1B09A 2XLGA 4CDQC 5F6LB 1HXS2 1MQTA 3PMEA 3RZGA 5B66E 1TME2 2GZWA 1ACCA 1XXNA 4NHXA 5FZ6A 1LP1A 3DKQA 2A06G 2BRTA 1VIWB 1K04A 5AW5B 2YYOA 4YXDC 3M7AA 4OI4A 5DAPA 2YU1A 5G05L 4CZSA 1F8VA 1J1DB 2ZX3A 1GFF2 1HB2A 1JEKA 1PNGA 1S0BA 2MEV1 4QX5A 1JMMA 1QWRA 4OI2A 3Q5SA 2VQUA 2BEOA 4IV3B 3RL0g 2ZX2A 4PI0A 3RWNA 3SEEA 1KRIA 1AQTA 5EXOA 2ID4A 5EWSA 1FZCA 4D6RA 4WVZA 2KS1B 1EY2A 1SQVG 2WO2A 2JEMA 3ECQA 4HVOA 3M0DC 4K8RB 4WVWA 3W68A 1RUC3 2Q8CA 2YIUC 3FL7A 3NJVA 4WY4C 4YVSC 2P10A 5FV3A 3SC7X 3ZFGC 4IE6A 4OUMA 1KV4A 3EJKA 3OG2A 3UETA 4H44C 5C8WA 4MGIE 4XACA 1A02F 3MF9A 3PUSA 4LR4A 4AFDA 4G3YC 1NA1B 4U7JA 1JS9A 3PU3A 5L73A 2MPFA 5JWPA 1KC8Q 3ETQA 3U11A 1OA3A 1HJFA 5APVA 1ODMA 1P8JA 1JYXA 1KFUL 5A7WB 1R1A2 1AUYA 1W90A 1QJY2 4QPIC 2BP6A 3TEWA 3RK3C 1US2A 1U7MA 2VE1A 1NU1K 1KORA 2PMWB 1W6NB 1SG3A 2VUCA 1LTEA 4HZFA 4QGNA 5DAXA 5F3IA 4Q8KA 3U1CA 3F2ZA 3AB0A 3HD7B 3JD73 2NYYA 1U5XA 2BWCA 2JKVA 1PO11 1CI6B 3KV4A 2HWD1 1BDDA 2GNBA 2WO1A 3APBA 3AP5A 3KT7A 4MHRA 4NVPA 2JDYA 3H1JJ 4CU6A 1OVVA 2A71A 3SWYA 1KYOH 1M1JA 1LEDA 3BIWE 2RDRA 4E27A 3O1TA 3OBAA 1MEC1 1ZRIA 2VU9A 4IGPA 1IOAA 4NUBA 4B86A 2AEZA 2HBTA 3M2MA 1LGHB 2GALA 4W6WA 1MZ6A 3WNLA 3BKZA 1AVYA 5A7NA 1X36A 2BBVA 1FOD3 4FPOB 4XTPA 3THPA 2ZCWA 1SQBJ 2Q6QA 3D5OA 4N53B 4WZFA 5FZHA 2WLPA 1LEMA 4H0LD 2ZMKA 1NTZK 1ZBE2 2I2SA 3BTAA 3V56A 3V64A 3RFRA 1DU3D 2V73A 3MIHA 1ASJ1 2ZYAA 1H4GA 3TSIA 1PO12 1SLLA 4UBHA 3USUA 3M1HA 3VZMA 4EDFA 2QEXP 1RITA 2XQXA 3RL0D 2YV8A 1UPIA 3ST7A 4CDXA 3BVCA 2O01J 2JX9A 4ZXEA 1CAUB 1RUI3 1X9PA 1NCQA 2ZYGA 3VMXA 1DYOA 2W39A 3L2YA 3LSDA 3HD8B 3JQWA 1SQXE 1FPN2 1HB1A 1W3XA 3I2GA 4FPEA 3KMHA 5DQ0A 3TN91 2V72A 4B1LA 4DPNA 1HKDA 2RJKA 1SACA 4H7MA 5FYTA 3AP4A 3IWZA 1JOPA 1RUF3 2NM1A 4IV3A 2E5TA 1QEXA 3AE7C 1KQRA 3DPRB 3LA2A 4XW3A 1LRHA 4BDVB 4QU2A 3CWBG 3UGHA 5GLZA 3WW4A 3ILRA 1QU0A 3D0SA 3Q8FA 2IBZI 2X29A 2RJ2A 4RHV3 3TYJA 1UOJA 1QJX3 2EICA 3VZJA 2BCCE 1H8TC 2ZXQA 1W6MB 4QKFA 3VBSA 3H32A 2QQLA 3DECA 3LGRA 2P2UA 1YQ8A 4R52A 2F6BA 2FCVA 3KGLA 2OYHA 4OCTA 2P6CA 3B01A 1DF0A 4FOYA 1LR5A 5FXXA 3BTYA 5C3PA 1W9FA 3BODA 2QZ2A 3TDKA 3ACFA 1K8AQ 3WG1A 3GDBA 4BMEA 3L35A 3WU2H 2V4HA 3MUDA 3I3DA 4Q27A 2WAAA 3WXPA 2OUJA 3FE5A 4TYSA 2DCTA 1WCDJ 1CAXB 1L7LA 5KBFA 4XZPA 1SVFA 3H1IG 1JOBA 1ZX5A 2DUQA 1FZBA 2GN3A 2H0BA 3MO4A 2R32A 2SPZA 1RUJ2 2DCKA 4JGYA 4PDWB 3RZHA 1AXYA 1MZ5A 1DP0A 4UT5A 4XFJA 4DXZA 2WWJA 4JQTA 2XH6A 1GOFA 3ZFFB 5LWBA 3W5NA 1PV3A 1DHKB 2O14A 3V2NA 3CCEP 1A8MA 2R072 2W91A 5FKCA 2OVUA 1XNCA 4CDXC 1VQLP 4CSWA 4F3JA 1O4YA 1YO8A 1DBNA 3KQGA 3ABZA 5A3WA 1K73Q 1Y3TA 2N9YB 2WZR2 4DY3A 5IVVA 2K1AA 5AW0B 1HRI2 3FMGA 3OEBA 3OA7A 3PRJA 2J1AA 2XJRA 3WDUA 2V7QH 4WM7C 1CSBA 4Y24A 3R05A 4EE2A 1PIV1 1SQXG 2LROA 2ZOEB 3MI8A 4LO8A 2Q8EA 3SITA 3WINE 5A32A 5IYYA 2XVGA 1MS4A 1N2DC 4AYCA 2WSVA 1TVGA 4Q26A 1N3QA 3SSUA 1MKMA 1Y43B 2HWF2 1QOSA 1QJU1 2HKXA 3OEAA 5ANQA 2E74C 4UFJA 4Y1UA 1JY3O 3PTZA 5CA6A 1QL1A 4O7XA 4AI3A 2ET1A 3LPGA 4LO5B 4XURA 3B4SA 2B45X 4AR2A 2K9ZA 2W1QA 4NPDA 2NMNA 2YBKA 1HN1A 4XJUA 4Y3OA 3NV1A 3E1F1 3MUDC 4PV1B 3ZFEB 1Q90D 2WFPA 2VZ3A 4HKLA 2W90A 1Y8AA 1ZBA2 2WL1A 4YZ4A 1FOSF 2VNRA 2ZX1A 2ZEYA 5JPNB 1AF9A 5D8AB 1LNSA 5AW4B 2CTVA 1H8AA 1TE1B 1BE3D 2ZT9C 4IFFA 4YGEA 3IKWA 2ZKLA 1GNHA 3KD4A 4YTPC 3GHMA 5C9AB 1TQ5A 3R4YA 3T4HB 1FNYA 5LA0A 3NJZA 1YQ6A 3JCIA 1YIJP 5KLVE 2AXCA 2P4EA 4RD7A 3ZFFC 4B7EA 1OFSA 5JSOA 3MZHA 1SQPD 1PHMA 1SQPG 2BEZF 1PGSA 4IV3C 3ROUA 5LCWL 1W8OA 1T3JA 4L76A 3TGUE 2WLQA 2DFBA 2XLFA 3AZWA 3FHQA 3HN3A 2K9JB 2H7HA 1AR73 3P8MC 1FU1A 3LW5H 1K45A 4JTOA 2C0XA 4FPFA 4SLIA 2D3PA 5EP9A 1QY4A 3VOPA 4GWNA 2PHLA 3WEZA 3H1HE 2D2CD 1ND2A 1VQ7P 1QJEA 3S7IA 5C71A 5JDBA 2PAJA 4BA6A 5B66H 1CD3G 1PK6C 2GMEA 1WMFA 3I2IA 5KLVK 1N1YA 5CAZA 3AKSA 4GQ7A 4M0HA 1CVNA 1PGPA 4H44B 2Q5UA 3JD72 2RMU3 2Z2SB 4UF0B 4P02B 3V65A 4AHZA 2PGDA 4PDWA 1W9TA 2D93A 3EXUA 4M3CE 4FAGA 3B02A 2H0VA 3SHRA 2PP6A 4Q4Y2 1SQQE 1YUDA 5FPAA 1N1TA 2A73B 5APUA 1PIV3 4IEYA 1GP6A 2OGUA 1RTVA 5CFCB 2G1MA 3LOIA 1VBE2 3ZYBA 4A3XA 3R2PA 3TBDA 4LITA 3N4MA 2BDRA 1WD3A 5IK8A 1KILC 1NA1C 1FOD2 1UOFA 2FYUE 2RN0A 1XU1A 3DUIA 5FZ9A 2EIDA 3BN6A 3ES4A 5FQ0B 5FKBA 5E6HA 1OKQA 4IQPA 4XUPA 5JIUA 5M0TA 3KF3A 4FFIA 4H13D 4GMP3 1WCKA 1Y9QA 2VBDA 2JG9A 4PQQA 5FXWA 5A3UA 4ZKUA 5DJUB 3F5HA 2VCCA 4HPKB 5FZ8A 3PJQA 1OQDA 1AJKA 2AZ5A 2DVBA 2Y33A 3TEZA 3V5BA 3P3PA 4DEVA 3DN7A 1GMJA 4LA3A 5K5GB 5CEHA 3IN6A 4YYOA 1LOFC 1L3JA 4RR3C 4JDNA 2XUEA 2VZ1A 4AWDA 4NIIA 3JCUE 4XUTA 5LB6A 2ZPXA 1Y9GA 5FAXA 3VGIA 5CJ0A 5BNQA 4QX1A 1ALYA 4RR3B 2O01N 3VKNA 2AYHA 4R4LA 2VOXA 4RQPB 3MGUA 2A70A 4EN0A 3A21A 4KQ7A 1BBT3 5F32A 1BGYG 3LOBA 1WMEA 4YVSA 3CF6E 4C91A 3K5BA 3VD9A 3B69A 1NVOA 4IL6X 3T0AA 4YLZA 2PRRA 4QGMA 3OB8A 3VL9A 1XE8A 4BRYA 1VL2A 2KIKA 5TISH 3L74E 1ZBA1 4TSVA 4HVQA 3SWKA 1EDIA 4O9BA 2G3AA 2ZEWA 2K9YA 2ZT9D 2HLEA 1C8M3 3IN9A 4KWKA 4NHKA 3DYMA 5FZOA 3HR9A 1G2CA 1S4CA 1MVQA 3Q3DA 1FNZA 1XNKA 3VBRA 4FPGA 2BV4A 3W59A 2Z4FA 2VMEA 4IGQA 1SLAA 2GAUA 2OTKE 1OBNA 1Z7S2 1YI2P 2A75A 1OXCA 2VTFA 3N7KA 4XDQA 3VHOA 4YZ1A 3NNJA 3U59A 2D98A 2Q30A 3AEEC 3HRNA 1Z7S1 1UY4A 2YO2A 2FFDC 1VBB1 2VQTA 3A0KA 3CJIC 3KGZA 5GLWA 4QPGA 3WNPA 1SLCA 2NZ9A 1W8TA 3W58A 3EFFK 1BEV1 4U36A 2MEV2 5APQA 4FFFA 3VD5A 2J42A 2YPJA 3C7FA 1GU3A 3KXDA 1VPHA 4TLGA 4W8JA 4GIQA 2ZGKA 3POWA 2HWB2 2WKKA 3NO8A 5FO7B 2AXTH 1IS6A 4RGKA 3U14A 4CCDA 2DW3A 1T6AA 2CPSA 4UBGA 3CMGA 1KDMA 2ZA9A 3H1MA 3POBA 4JPZB 1OLME 1RUH1 2ZHNA 1F35A 4FI9A 4QQHA 4XFGA 3WHTA 1ZMEC 4RHV1 3WNNA 2JD4A 1VB2A 3J8F3 5GLVA 3I49A 1A34A 1R5SA 1LGBA 2FQPA 4IDZA 1LB2A 2UWAA 3TNUA 3AEBC 3LW5J 3JQXA 4UFKA 1COV1 4HG6B 4RJTA 5FZFA 4CCEA 5HBAA 2JR8A 1PO21 3H42B 1JY2O 1U57A 3ZN6A 5L9RA 1YYNA 1TZOA 3CCLP 3A0HH 3L9JT 1GZ9A 1RHI1 2LXBA 3GHNA 4JCKA 2GC0A 2GP5A 2JD9A 4XOGA 5DUXA 1JODA 3ZN6B 5L9VA 3B8EB 2WR9A 1EUTA 2M8RA 2N1TA 5F3GA 5C8CC 4XPVA 1MQTB 3R4SA 5KXBA 2E33A 4GKXA 3FWEA 4J1WA 4LIUA 4S2HA 1S5LH 4HBNA 5GJ6A 1NCQC 1EAH2 1YC61 2RR11 2VNGA 3I3QA 3N9PA 3OY8B 5J37A 2VH9A 2O3JA 1BK1A 2V4AA 2WYSA 3NMBA 4PIYA 5F2SA 1NYWA 5I91A 5FZOB 1CWPA 4XFAA 3LD8A 1D2QA 4RS5B 5FY7A 1Q82Q 2ZXEB 1UU6A 1PMHX 2W47A 3MW3A 3JB4C 4AK3A 2B88A 3RZKA 1X8MA 3NTNA 1VF5C 3RK2C 1N86A 2HPCB 1PVXA 1Z0HA 1XTCC 1P84H 2RDNA 3AKTA 3GJBA 2PTMA 5G04L 3VDDB 3V0BA 3J7MA 1YRZA 1HIXA 2OPKA 5JVVA 1L4AA 5L9BA 1G86A 4N3YB 3NWKA 1K5MB 3VDAA 3ZYIB 4XUOA 4CDWB 1AYN2 1HRV2 5EYXA 1C5HA 2ZHKA 3G7DA 3K4ZA 4JRLA 5DMYA 3VKFC 1W8WA 3A22A 4E2SA 5J3UA 2FZ1A 2WNUC 1BZWA 1AVBA 1RMU3 2WN2A 4GB31 1UO9A 3T1LA 4IESA 4PQ9A 4EN7B 1S0IA 1ZREA 2IBZE 3AE1C 2A7AA 2EIBA 2V4VA 2JE8A 5CKMA 4Q0UA 4PLMA 2HWE3 3IAOA 3N9LA 1L4AC 1W5CE 4Y99C 2GMMA 1DIWA 4IXLA 4YM1A 5FP4A 2CHHA 3SMHA 3C7EA 1NOHA 2VW2A 3D6EA
chains in the Genus database with same CATH topology
5GKAC 1SCRA 5E1RA 1WW5A 4FCAA 1M06G 1VR3A 4Y20A 1PM7A 2QDRA 2WQ4A 5L36A 5GM0A 2VULA 3NV3A 2HWC3 3N7LA 4EWDA 4XQ4A 1EPWA 3X29B 3KT1A 1GZWB 4EJRA 5DZFA 3WDXA 5DUWA 4XQWA 2VMHA 3DPRA 1R082 1QJU3 1QXPA 2DCYA 1IS5A 3AP7A 4OZXA 4YG3A 3ZFGB 3SLIA 4Q4V3 4TZDA 2PAMA 4WVVA 1XQNA 1HQNA 1HXS3 2JJ6A 4O9EA 3ASIA 1D4M3 4ATFA 5KHHA 1H1MA 3FC0A 2JDIH 3AMPA 5EJ3A 2Q5TA 1O5LA 3S30A 4XIOA 3S7EA 4DY5A 1XYOA 2XKPA 1BXHA 2EALA 4HFSA 4IV1A 1C8NA 3POYA 3R4UA 1QKQA 2EF6A 4CRQA 4OVEA 4DFSA 2XUMA 4L99A 3BU7A 4WM7A 2RS51 3AZYA 4XE9A 1Q43A 1SLBA 3H3ZA 1XYNA 1TNFA 4RQPC 1EYBA 4AFCA 1AR62 4BWOA 3EHKA 1DQ6A 2XBO2 1HRI1 3JBG3 4Y5Z0 3J8F2 1W6OA 4N9IA 5E16A 4AVBA 3NV4A 3FFZA 3QCWA 1DYKA 1H2LA 5A33A 4L97A 2GH8A 4CP1A 2D6LX 2VVEA 4CEWB 2P2KA 4PBOA 4PIXA 3ZXGA 2XJVA 3TOJA 1JUHA 5KHGA 1EAH3 4CEYC 3NSTA 3M70A 1WD4A 2R1DA 1RGSA 1WLTA 2VW0A 1GLHA 5I0TA 2G9GA 2BUKA 2BWAA 3J9SA 1FI2A 3PVEA 1VB4A 3MIDA 4HMZA 2BGCA 1LOCA 3WP6A 3QH6A 3E5XA 1PO13 4JTNA 3GYDA 3CJIA 4HLTA 4JGZA 2RJLA 2VPVA 4OI1A 4CTEA 4YXWH 1NQDA 3H3UA 1EV11 3D8CA 2WT0A 4WBBA 4Q0QA 1GSLA 2E5YA 1EAH1 3GZTB 4XJ8A 3RSJA 4XETA 4DMIA 1N3PA 1YNAA 2AUYA 4K1ZA 4ZU5A 2OYZA 2VQAA 1AR83 2GSYA 3IT8A 1ENXA 2O8QA 1CAVB 4KWJA 4X8PA 3N7MA 4H3WA 2VUAA 4JCKA 1CIWA 1PO22 1NCRC 5GZEA 4Z2WA 1AR93 1AX1A 3VBFA 3EO6A 1N47A 2Y0OA 1TME1 4Q2FA 1NCRB 1W6OB 2OZJA 1ZZ6A 4AI8A 1UF2C 4WM8A 4JAAA 1NCRA 4EN8B 5JZGB 1NZCA 3D0JA 1J1TA 2VMIA 2XWJB 1K5MC 2RHPA 1UKGA 2R061 2WNVB 2BNOA 4AVVA 1NE6A 4XYXA 2UY9A 1Q8PA 2CGOA 3LSEA 5GLTA 3RS6A 1D0HA 1QJU2 3J8F1 1JN2P 1YWKA 4QQPA 4JDOA 5FO9B 1HRI3 2IXLA 1URXA 2E51A 3C2UA 5KHKA 2XJPA 3NKGA 4K20A 2PLV1 1V6LA 2RS53 4WVMA 5HCFA 4A2UA 1RUE3 4ASLA 4AQTA 4XMIA 5FMOL 1PK6A 1WCSA 4JQRA