4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
2GC2A 3I7DA 4LA2A 5FDBA 2IXHA 2Y0OA 4L2NA 4R8HA 3BCWA 3OGJA 5KHKA 2CGPA 1UIJA 1H1IA 2QVSB 2K9ZA 3M70A 4AQ2A 1QWRA 4HSLA 2D40A 4META 3HQXA 3S0MA 5FLJA 4MGYE 3RZZA 4TLFA 2H6CA 3IWZA 3E5QA 4HBNA 1Q5OA 3CL1A 4HVRA 5I0UA 2IXIA 2O8QA 3PNAA 4HN0A 3I59B 1O3TA 4EWAA 2B9UA 3ST7A 3H50A 1FXZA 3ETQA 3H9AA 2IXLA 4XEZA 4EWDA 1NE6A 2OPKA 1RGSA 4JTOA 4RD7A 1RTVA 3M3IA 4Z82A 4WZCA 5I8SA 4IEQA 1RUOA 4MH0E 4I01A 4XFBA 1CAXA 4YARA 4Q0PA 4PIYA 4AVAA 2ATFA 1TQ5A 1YFUA 4E2GA 5I93A 1G6NA 4QGNA 1Q43A 3LWCA 2UYAA 1Q3EA 3BU7A 1RL3A 4L11A 2Q0AA 3ELNA 2XKPA 1IPJA 3SHRA 4D7SA 1I5ZA 3E6BA 1QY4A 3UKVA 3NKTA 1U12A 5FCCA 1ZRDA 2MPFA 3ES4A 1YFYA 2XLFA 1ZX5A 3H1YA 4BH9A 4XF9A 5JSOA 2PAEA 5EZWA 4MGZE 4JV4A 2XHKA 3LA3A 2O1QA 1CAWA 3BALA 4Q0VA 3E6DA 1L3JA 2XL7A 4K8FA 3KCCA 4QM9A 3OF1A 4KWKA 4X6RB 3SCGA 5JSPA 1UW8A 1CGPA 2V7QH 5JSRA 1Y9QA 4MV2A 2OYZA 2PHDA 2BGCA 4GULA 3USSA 1EY2A 2XL9A 2MHFA 4XFGA 3LZZA 3N4MA 5FPZA 2CK3H 1DZTA 5KBFA 3ES1A 1YFWA 4BYYA 1DGWA 2Z69A 2QE7H 3IDCB 2CAVA 3MYXA 1GQHA 4XFCA 1BSNA 2HKXA 3H3ZA 2BYVE 3WW1A 2GH2A 1CAUB 3S7IA 4IERA 1J3PA 1ZZ7A 1J59A 3E5UA 4J1XA 4KWJA 1XE7A 1LR5A 3QOPA 3H8UA 5BPXA 5JAXA 2VECA 4EROA 3U11A 4Q0UA 2P17A 4AVCA 1NZCA 1QXJA 4KU8A 3KSCA 2KXLA 3EO6A 3ROUA 1RC6A 1WGPA 3SMHA 3EFFK 5I91A 1EYBA 2PYTA 1CX4A 1H1MA 4R52A 4QGMA 2CV6A 5FQ0A 3H1MA 1ZZCA 5E16A 3KGLA 3FJSA 4LTAA 3RPQA 1NXMA 4FAHA 5KHGA 3RYPA 4QMAA 4XFFA 1CAUA 2UY9A 1DZRA 3DN7A 2XLAA 1UD1A 4I0BA 3IIAA 4MZUA 3PLQA 3ZDSA 5I0SA 3KGZA 3HIFA 2XLGA 3FX3A 4EWEA 2OA2A 2GC0A 1O3SA 1LRHA 3OCPA 1VR3A 3EQEA 2FMYA 1EP0A 2V09A 1WA4A 1O4TA 2H0VA 1OMIA 3UKTA 3WW3A 1CAVB 2PA7A 3I54A 4NVPA 4UBHA 2QNKA 3HT1A 3S7EA 2UY8A 4EV0A 3H7YA 3NVCA 2E5TA 4HVOA 2B5HA 4P9GA 2GAUA 4YNIA 1WLTA 4IEYA 2C0ZA 2ETEA 4IEUA 2BNMA 2N7GA 2ZKLA 1X8MA 4IETA 2Q4SA 3DV8A 1X7NA 4MGIE 3FWEA 3PJSK 2PTMA 2D5FA 2WC2A 3FE5A 1X8EA 2WFPA 2VPVA 3CLPA 3MDPA 4JVAA 1OI6A 4BIFA 2Q30A 3U10A 2GC3A 3EHKA 3BPZA 3D0SA 1RUNA 4LUMA 3OTFA 5C6CA 2PHLA 1FI2A 2F4PA 4IEOA 4O9EA 4ONUA 3DKWA 3H7JA 2GZWA 4I2OA 1YLLA 3WW2A 4HSJA 5AVPA 5LRSA 5CU1A 2I45A 3CF6E 1UIKA 2IC1A 2ET7A 4Q0QA 2DCTA 3SCHA 4F7ZA 4YRDA 4WVZA 1SQ4A 4IEZA 5FLIA 3GYDA 1IPKA 4DINB 4LEJA 2GC1A 2EA7A 1JEKA 4MGKE 3NL1A 4MUVA 1O7FA 3L2HA 1DGRA 4HLTA 1OFNA 3RYKA 1O5UA 4IESA 4IEPA 3NW4A 2PQQA 3NJZA 3NSTA 3TNQA 4CYDA 1NE4A 4X6QB 4WBBA 3D0JA 4QM8A 1HW5A 5FPXA 4I0AA 4LA3A 5LEKA 5I0RA 2XNDH 1J58A 2QCSB 4PIZA 2IXJA 2D5HA 2E5YA 4I09A 4KWLA 2XKOA 3OD0A 1E79H 4HN1A 1XE8A 3PVBB 4HVQA 2HJIA 5JR7B 1YHFA 1AQTA 4OLLA 3E5XA 5T3NA 4XFAA 1ZZ6A 4D7TA 4B29A 1LB2A 1ZZ9A 3LAGA 5LRRA 1CAWB 2IXKA 1J1LA 1UPIA 2Q1ZB 3CEWA 5I8TA 1ZRRA 4LUKA 1I6XA 3IBMA 1ZZBA 2BNNA 5C8WA 1EPZA 4H7LA 4PJYA 2D93A 1ZNPA 4ZU5A 2XGXA 1CAXB 2OZJA 2WSSH 3H1WA 1FS0E 5F1RA 2PAMA 5BV6A 2Z2SB 3BB6A 1ZZ8A 1ZVFA 1ZRFA 2EAAA 4XF3A 1YFXA 5K8SA 3SCFA 3HT2A 2EVXA 4ORFA 5FLHA 4FBFA 5J3UA 5J7MA 4I3PA 3UKNA 4IEWA 4YXWH 4MX3A 2CAUA 5J48A 4YYOA 1GQGA 4JTNA 2FQPA 1ZRCA 4J1WA 3KMHA 4Q29A 4QX5A 3U0ZA 1YWKA 2VQAA 1XRUA 4XF1A 5CVRA 4QGLA 3RNSA 1O3QA 2QDRA 1X82A 4HZFA 4I02A 3JZVA 3WW4A 3MZHA 3R6SA 1SEFA 2MNGA 4YSFA 1IFPA 4IEVA 4O9GA 1BSHA 2PFWA 1LKNA 1PM7A 3FHIB 3IDBB 4BHPA 2H6BA 2IXCA 4KL1A 5I8YA 5HI0A 3O14A 4KU7A 2K0GA 1CAVA 4XETA 4AXOA 1UCXA 5JCTA 3E97A 4QXKA 1ZREA 3LA7A 5KHHA 4OFGA 4N9HA 2QJVA 3DL3A 3EJKA 2E9QA 3FZ3A 3RDIA 1O5LA 5BUVA 1VP6A 5LEJA 4DJGA 3FFQA 3TNPB 2W6JH 4FAGA 2JDIH 4LLOA 1Y3TA 3D82A 3QACA 4AQ6A 5BY5A 1V70A 1YUDA 3VHRA 5KHJA 4Q0SA 2PAKA 5I0TA 5KHIA 1JUHA 1VJ2A 4E2QA 3C3VA 4FT8A 1FT9A 4ZU4A 4HMZA 1OD5A 1QXRA 5D1IA 3CO2A 1J3RA 4Z07A 4N9IA 1J3QA 5CADA 1SFNA 2GU9A 2BNOA 4XF0A 4UXAA 5FQ0B 3I59A 4LULA 4F8AA 3G7DA 3ACLA 2ZCWA 3EBRA 3H3UA 4XF4A 3RYRA 4UBGA 3LOIA 5EFUA 4XFIA 3SXWA 3E6CC 4A2UA 3MPBA 1O3RA 1NYWA 4AVBA 3GBFA 4E2SA 4XFHA 3CJXA 2OZ6A 3B02A 4PIXA 1PMIA 4ZU7A 2ET1A 2UYBA 3LA2A 5BXXA 2BEOA 4IEXA 2B8MA 5E1RA
chains in the Genus database with same CATH superfamily
3L72J 4OQ8A 3SFEC 1S0BA 2E63A 5FDBA 3H1IJ 4L2NA 4JCKA 3BCWA 3OGJA 4IV3C 5CG9A 3AEAC 2WUHA 1BGYJ 1NU1J 1SACA 3O0WA 1KB9D 5EJZB 1DD4A 5FZDA 1IZNB 3TOJA 3W21A 3A3YB 2OYHC 3B93A 3M70A 3HRNA 4RJTA 1F35A 1QWRA 1V0AA 3AMPA 1LOAA 2WQYC 1D0HA 4AQ2A 4CU8A 1Q8VA 2ENRA 4URAA 1SQXD 5D8AB 4GOEA 1YXWA 2M8RA 4JDNA 5ABJB 5HBAA 4MGYE 4ZONA 4LK6A 1AHSA 1FOD3 2B7YA 3IWZA 4CEYB 5DUUA 1DGRN 2VUDA 2VCAA 5I0UA 4JRLA 4CDWA 1EV12 1D4VB 4RA0A 2NLRA 1RIRA 5DG2A 1FC2C 5C33A 4HN0A 1L4AB 2R5BA 4KJMA 1O3TA 1RF0A 2P1BA 2GNDA 1E5SA 1T6BX 4LHKA 3Q5RA 1L2PA 2WLPA 2BP6A 5LA9A 1SQPK 3OAKA 3KF3A 1NAFA 2PP6A 1Q8PA 1QJX3 3H50A 4XBNA 3ORJA 3ST7A 4JHZA 3WV6A 1NTZJ 3H9AA 4EWDA 3U07A 1YJWP 1JMUB 3H1JE 3HUSA 2A06D 1NE6A 3GZUC 4FPLA 2IBZE 1RTVA 2FMDA 2FYUE 4RD7A 4CUCA 3PDQA 4COYA 4HANA 1RUI3 2YMZA 4LBMA 1BE3D 1SQVJ 4IEQA 1XU2A 4BXFA 1GOFA 2CPBA 1RUOA 3CX5E 3G4SP 3FBMA 1IFMA 1KDKA 2JDPA 3CU7A 4XFBA 5FY4A 3T1MA 1PP9G 1DIPA 1Y9MA 4MGTA 4B4RA 3C7FA 1NY72 4CDQC 2IFWA 2ADDA 4EN6B 3WD5A 4XJZA 1YQ6A 1QH6A 4QGNA 1XTGB 4A3ZA 1Y8AA 5BNNA 2W90A 1LGNA 3CX5H 3LWCA 1GR3A 2DCZA 3IMMA 1Q3EA 4M3CF 3SISA 1CPMA 4GIFA 3VMAA 1RL3A 2CWMA 2XDVA 1OH3A 3T2OA 2BGOA 2I2SA 1MFZA 3IT8A 3ABZA 1HN0A 4QX1A 2QJPC 1W04A 5FMOS 4B3NA 4Q4W2 1OLMA 4AQSA 1GKBA 1ZMEC 1TMF1 2JDUA 3L72E 2P3IA 3H1IG 4BPZA 1GLHA 5I0RA 5GTHE 3RMXA 3KLSA 4P02B 1M1JB 1U12A 3VBUC 5DPNA 1M1KQ 5KAFE 4BM8A 3H32A 5FCCA 1JNMA 5A1AA 5FXVA 3PUHA 4COZA 3TWIA 3R4YA 3IDAA 5IYYA 1BCCJ 4E9KA 3WUUA 4DT0A 3KQRA 4OGQB 3IAPA 4XF9A 1JS9A 2ZT9C 3MTUE 2E75D 2FXMA 5A3NA 1XNAA 2KYVA 1LENA 1MZ6A 3VMXA 3K75B 1S0JA 1VBB2 2PAEA 4OULA 4OUEA 5FZ0A 4BQ5A 3HQUA 2VG9A 3D3AA 4ASMB 2G9FA 3BTYA 2RM23 2LM3A 5L9RA 3V2RA 1JODA 4W6YA 4LOSA 2XBO3 2XHKA 2O1QA 1CAWA 3BALA 4Q0VA 3SH4A 1HTLC 1VL2A 1QH7A 1H6XA 5GLVA 3V56A 2MEV3 3VKNA 2QJKB 1LJ7A 3WY6A 5GZDA 5AVRB 5JOYA 4JYCA 2IX7C 2WQZC 3VZNA 3ZO0B 1GBGA 4L75A 4JGYA 4DS0A 3AE2C 1RUJ2 4D8MA 1VQKP 1UW8A 2RM21 4K9SA 1CGPA 5JSRA 1LECA 3KF5A 4RESB 1AYN3 4YW7A 1C57A 1YYNA 3T97B 1LTJA 3IAQA 1OW8A 4DXRA 2PHDA 4GULA 3UT0A 3I97A 4CP0A 2VXJA 1L0LJ 2ZOEB 4GWJA 1EY2A 3QLQA 1WMEA 2MHFA 2VNOA 4TN7A 1GK4A 1S5LX 4NPLA 4AW7A 2YMYA 1L0NK 2R1BA 3LZZA 2ZGPA 1RMU2 2V5YA 4W80A 3ZIWA 1O8PA 2TEPA 3NO8A 5C5UA 4NHXA 2XQXA 5BU5A 2AXCA 2UWJE 1DGWA 2D6OX 5FYYA 3VBUA 3VL9A 4EOTA 3OY8A 4N43A 3H1KD 1UY1A 5JMCA 1BSNA 1NJIQ 1ZOYC 3WINE 5CAZA 4PI0A 4EN9B 4Q4V1 3M9QA 4OHVA 2R041 2O01N 3NFQA 4W50A 5GKAC 3ZN6A 1J3PA 4YW1A 1ALYA 4BRYA 4LNVA 1CZTA 1XE7A 1MS4A 5KJ7A 1LR5A 3QOPA 5FIXA 5F37A 3O1TA 3R2PA 3T0DA 3M9HA 2A06G 2JDZA 1D0GA 2WBKA 3ZVXA 2W3JA 3M0DA 2RR12 3W20A 3S9OA 1URXA 4GXLA 3PUQA 3PLNA 4DXSA 5CKNA 3BRTB 4A45A 1R5SA 2W2IA 5SV8A 1UL9A 3M91A 1W6QA 2WL1A 4YM1A 2QQKA 2NPSD 1NHLA 3J9SA 1W05A 1H2MA 1QNWA 3KSCA 2KXLA 5DQ0A 4YVSA 5EV7A 3ZXAC 5KR7A 1RC6A 1SHWB 2H88C 3SMHA 1L0NJ 3PUIA 4U3FD 3DPRC 1VBC2 5CJ0A 1YQCA 2RS11 4LBOA 5FYIA 1L0LK 2JWAA 1H2KA 3A5TA 3I2OA 1KC8Q 1GP5A 4NHYA 4U3FE 3TSIA 1H1MA 4R52A 5DAXA 2CV6A 4DMIA 5K9YA 3THPA 5IHRA 4FSJA 5E79H 2A6ZA 2VR4A 1T3UA 3WX5A 1NXMA 2VMEA 2YGMA 4RR3C 4RS5C 4BK5A 5L7OA 2IFMA 3W68A 1RITA 2G8YA 2QQIA 1OBNA 1C4RA 1CAUA 4YW2A 2WS92 2JKXA 2IBZG 3DN7A 4EN0A 3VP9A 1VBE3 3LEIA 1YCIA 3B9IA 2WNEA 1FU1A 1QJY2 4K35A 3HNBM 1UD1A 4ZS2A 5IAXA 2VAUA 4E4ZA 1AJKA 4K1ZA 1NTMD 4PV1C 3IIAA 4FPOB 1ASJ2 3WXPA 2GMEA 5DZEA 5CA6A 3MHVA 2NPIA 3H1HD 4H44B 2W6BA 3SWYA 1KQSO 3RK3C 1HJGA 4Y28J 1JZ3A 4QU2A 3GBGA 5FBZA 3VBFA 4Y4RA 4PLMA 1FNYA 2OYIB 1ACCA 3KV5A 3OBAA 4ZS3A 1O3SA 4FCAA 2FZ2A 1MS3A 5ABJA 4KH9A 2YC4A 5FV3A 2DUOA 1WCKA 1LRHA 4QKDA 3CXHH 1ULDA 1HRI2 3OCPA 3GJAA 4QAWA 1VQPP 2DCYA 3V0AB 1VAMA 3BUCA 3JSVC 2VXRA 4LBQA 2WITA 3O12A 3WW3A 2HLOA 1CAVB 2ZGNA 2PA7A 5J09A 1OOPC 3LFMA 4QD2A 3S7EA 1W6NA 3EFGA 2PLV2 2ZGTA 4HT1T 5T5OA 2QKDA 3ZFEB 2A6YA 2IUWA 4IV3A 3LSEA 2Z5IA 5C3OA 1N73A 1S1CX 2YGLA 4BU2A 3AZVA 3PP5A 2E42A 3ITQA 4OWFA 4GJYA 3OGGA 1G9DA 2FKWB 4AEMA 2RG4A 3FHQA 2GAUA 4L97A 4QDQA 3B4SA 5FZIA 3ZXKA 5JOXA 5AW1B 4LLHA 2QDNA 2AC1A 3M06A 4P00B 2IVIB 1JW6A 1IHMA 1SVFA 3IAOA 2YBSA 4NE9A 4CXXA 4ASWA 5CZKA 3OA7A 4EJRA 2NPSB 4A6SA 2XG3A 1KILA 3K5BA 1KGYA 3B00A 5FXWA 3WNKA 1NTZK 4YM0A 4IL6H 2CY6A 2E32A 1LT9B 1W9YA 1SQPD 1LU2A 2W08A 2NP0A 2ARXA 4U7JA 3DV8A 4YZ4A 1FMD1 5A6QA 3VBFC 3O1MA 2WYFA 3JD72 4JKKA 1W6PB 4NN0A 1HJBA 4CXWA 1OF3A 5DG1A 4EIJA 3ACIA 1DU3D 2ZHNA 4H14A 4A6OA 4COWA 3R4UA 3NMBA 1SLBA 1L4AD 1LODA 2H89C 2GALA 4IFMA 2HWD2 2PQSA 2Q30A 4IL6E 3J26N 3VBSB 1BMV1 2FXPA 1NKGA 1AVOA 4IE5A 4KGQA 2R0HA 1TNRA 1QOOA 2VZSA 4C7NB 3L71E 1WA6X 4ISQA 5D2AA 5C6CA 2WA3A 2F4PA 4B8EA 4IEOA 4O9EA 4Y24A 3L74J 2LR2A 1U5YA 5EPAA 2IWGB 1FMD2 3NAPB 4GA9A 4I2OA 3FWNA 2ARAA 5AVPA 4AI9A 2HG5D 2QFEA 1KXGA 3IDEA 1VDFA 4Q2FA 2WZR3 4W6WA 1ZR4A 1IG3A 4KHXA 2I45A 3CF6E 1UIKA 2G1MA 3P3PA 1SLAA 2ET7A 1G1JA 1ULCA 3GW6A 3KVBA 1LOFA 2JG8A 5A33A 3NQHA 5DXDA 2I74A 4IEZA 1L0NG 1WW4A 1MS1A 5ACA2 1KQFB 3VHPA 3CCRP 4BZ4A 3ACHA 4PQQA 3AE7C 3H1KJ 1UYZA 3VBRB 4DINB 4BXLA 4HPKB 2I8DA 1N47A 1DX7A 1OA4A 4MGKE 4V1PA 5CYYA 1PVXA 1TNFA 3NL1A 4MUVA 3SWFA 1LHNA 1HGZA 3VBFB 4LIUA 1FYUA 3CBNA 2XHNA 4DZOA 1F4HA 4KWUA 3JB8A 4HLTA 2BBAA 4RGGA 4C8DA 1V6KA 2RS13 3NSTA 3HN3A 1PO22 2XNXA 1VRH2 3L73E 1XQNA 4LOTA 5FMDA 5L73A 4DRRA 3PUAA 2ZKNA 1WD3A 2P5BA 2R1DA 1NTKG 2HWD3 2JE7A 2VY0A 3B01A 1SLTA 4QM8A 2LW8A 3TGUJ 2NRGA 4XYXA 1LWUB 4I0AA 5GZCA 2M0BA 3VL8A 3WSOA 1OVRA 4PHZA 3GMAA 3ZXFA 1FV2A 1AX2A 1MEC3 2VCMA 1W2OA 2XNDH 4IW3A 1IFIA 3BKZA 3HD7B 1ZBE1 4PIZA 1JMMA 2X5IB 2D5HA 4QU1A 3VBHA 1YIFA 1XC6A 1BEV1 3OD0A 4HK8A 4HN1A 3A0HH 1XE8A 4WVMA 1HUCA 1OZHA 3H1LJ 4WY4D 1YHQP 1ND2A 1WCDJ 3E7KA 1XBFA 2XJSA 2OW4A 4HVQA 4AGRA 2EXIA 5JR7B 1IC2A 1PGPA 2UURA 1TMF2 1YI7A 2V4AA 4OZOA 5F8PA 3E5XA 3PTZA 3I2DA 3P8MC 3L74E 1MQTC 2Z42A 3RK2B 3M3EA 4D7TA 1ZZ9A 3B8EB 4R9CA 1FDMA 5LRRA 2OTJP 1NO4A 4CEYA 2WA4A 1W6PA 1PK6C 3EB7A 2IXKA 3AKSA 1UPIA 5FOJB 4H44C 4HONA 3H1JJ 2I1KA 3IM0A 2PFXA 2O1KA 1ZRRA 4LUKA 2ZYDA 5FPBA 4CE8A 1ZZBA 4A41A 5I8TA 3OUHA 3K51A 4JC1A 3TB0A 3ZFFB 1BBT1 4WV8A 1PO13 4ZU5A 2F6BA 2Y33A 3W5MA 2OZJA 3WDTA 2AEZA 1ONAA 1SZBA 2W95A 4W4ZA 4JQTA 2WZ7A 1FS0E 3RS6A 1NG0A 3LSDA 1IQDC 4GKGA 4GMP0 1VE0A 1ZZ8A 5FR3A 1WLCA 1IS4A 1WZXA 3MUZ1 2OQQA 1DIWA 1OH4A 2YNYA 2MEV1 2VMGA 2VBBA 3HT2A 1GL2D 1WMKA 5A3PA 1OW7A 3MIFA 4LC1A 3UKNA 3WP3A 1AXZA 1PIXA 2K88A 3KZIH 2VZVA 5J48A 2CAUA 3TYJA 1JY3P 3BGAA 4LIVA 4NR1A 1W0OA 2PRRA 3VMZA 5CCGD 1H2LA 1QDCA 2C24A 1UWWA 4YYOA 4JTNA 3RVHA 1CIWA 3DXUA 1W6OA 1F4AA 2FQPA 5DJTB 1ZRCA 3J7HA 1IO4A 5APVA 3TGUD 3BTAA 4QX5A 1VBA2 1Q90D 1LTGC 1YWKA 3CCQP 1KB9E 2W94A 2WZPP 2VQAA 1L7LA 4I30A 3S4RA 4ASVA 1DGLA 2GH8A 2R042 3GHNA 3F5HA 2N1TB 2NN8A 3AYCA 3LEGA 3AE3C 1NH4A 1D4M3 4LO5B 4NPEA 2P34A 1CESA 1NAYA 3ACFA 3M2MA 5HCAA 1AFOA 4WM8A 1FAVA 3VB9A 1ENRA 5LBCA 1N1VA 4LE3A 3PHMA 1X82A 1UKRA 4HZFA 4I02A 3P8CD 2YG0A 1HV1A 2EXHA 2Z5WA 3DXTA 3BCCD 3A0KA 3MHZA 3U10A 1LAJA 3V4WA 3R6SA 2FDFA 1SEFA 1R081 1BHGA 2PFWA 2DVAA 1LKNA 2JWPA 2V5DA 3QH7A 4S2HA 1LTSC 2B87A 1LESA 2BCCD 2VZRA 2ZEYA 1X8YA 2RS31 2ZX3A 1PGSA 2JG9A 3GF6A 4XZPA 5LB6A 5HCHA 2M5AB 4LXLA 5AW5B 4Z2WA 5F3EA 4FFHA 4LKDA 1FX5A 5HI0A 3O14A 4KU7A 2K0GA 4M01A 1HV0A 1NA1A 2OVUA 4CUGA 3AKRA 5FO8B 1VQNP 1JB0J 4LKEA 4YXDC 2W27A 4N53B 5FUNA 3CCSP 5FYBA 4AI2A 4QQLA 4CDXA 1RVF3 5BNOC 4O7XA 1EDKA 1LTJB 4NROA 3EJKA 2J22A 1W03A 3FZ3A 5M1BA 3VN0A 5FYUA 5BUVA 3L2YA 4WM7C 4COVA 2VZTA 2HWE2 2QZ3A 2WS91 5IW0A 3HE4B 4XBLA 2EIEA 2XONA 3V65A 1RF0C 2OX0A 2W6JH 4FAGA 3O6QA 2JDIH 1Y3TA 3QACA 4EZ4A 3WF4A 5C9AC 2FZ1A 1R64A 2K37A 4GB33 1KZUB 4WBAA 3M7AA 1MFTA 4Q0SA 2PAKA 4RQPB 5CBOA 1FOD2 3GHGC 4UB6E 1B35B 5F39A 5IUQA 3KHCA 5FZEA 2D44A 1VQ4P 3D70A 4H13D 4MLOA 4AQTA 4FQZA 1GZWB 5FZMA 4QQHA 3RWNA 4N78D 4U3FG 2XV5A 4FT8A 4KGGA 2WQ4A 1RINA 1NOVA 1Y9GA 2JP3A 1PGQA 4XE5B 3NJVA 2BASA 1J3RA 1JTZX 1OD3A 4XAAA 1EZVD 1MPXA 1KTMA 1DHKB 4XQ4A 4AOCA 1SFNA 2PGDA 2BNOA 2GU9A 4DCKA 3J7LA 4GJZA 5T52A 3IF4A 2CWSA 3TEXA 3BRVB 1Q8QA 3PRJA 1D2SA 2VOXA 3MIBA 4CP2A 2ZCWA 3H3UA 3OPTA 3EXUA 4XF4A 2V73A 5CCHC 4CEWB 1EC5A 4PD4D 1YJNP 2VC9A 3CNAA 3FMGA 1UU5A 2WIIB 3RYRA 1AR63 1TME1 4FTBA 5IFPA 3MD0A 3LDKA 3OG2A 4XFIA 2QE3A 1DH3A 2WJSA 3UYJA 4P9WA 4BK4A 2ZX4A 1EAH3 2RN0A 3L73D 5FY9A 1NCRA 1YQ2A 4QB1A 5A7WA 3N3HA 3GDBA 4BCUA 1GQPA 3PUSA 2NM1A 4D6QA 1U57A 4U36A 1T8ZA 5AVUB 4GIQA 4JKLA 4WM7B 4AVBA 2R7EB 4N43C 1NVOA 1J83A 2BRTA 4UW4A 1POV3 4N43B 1RHZB 3B5LB 2RMU3 3WNMA 1TME2 3ATGA 4BDVB 2VOWA 3B02A 5A3OA 3U78A 1QOSA 3KQ4B 1HRI1 4TTGA 1PMIA 4ZU7A 2R30A 4XVHA 2QG4A 4BRYB 5FZFA 2B87B 1GNYA 4CSWA 1VBB3 2BEOA 2K9JA 1MZFA 1X79B 3KT7A 1FPN1 2LXBA 1W99A 3LCPA 4ITCA 5E1RA 1JYXA 4LA2A 3A0BE 2P67A 4QKNA 5FYCA 2VCBA 2Y0OA 4XAEA 1K9MQ 2ZMKA 1ZXGA 3UESA 3D6YA 1JXNA 5KHKA 3VN4A 2CGPA 5KJ7C 1GYKA 4XXPA 1JH5A 1COV2 1ND3C 4F3JA 3JXSA 5ABJC 4RO0A 1OC1A 1OUXA 1SFCD 2KUBA 1AUYA 2D40A 3VKMA 2K9YA 1Z56A 1YQ5A 3P6BA 1WWYA 3VTPC 1BK0A 3OOXA 1AR72 2AR6A 3TEZA 2HWF2 2YMKA 2IYOA 3DKQA 4MHUA 4HBNA 1Q5OA 1ND3B 1WCSA 4HVRA 1JY2O 2P2UA 5DMYA 3DEMA 4DEQA 4UAPA 1AVYA 3WUTA 2YY1A 3PNAA 4JX0A 1H8VA 2QTWB 5IK4A 3RK3D 3WG3A 4CDWC 2ZGLA 4FOWA 5LZ6A 5FY0A 2Q1KA 4C0BA 4OHWA 2IYPA 5LBFA 4LK7A 1RUD1 1TE1B 5L7OB 3WR0A 3VZJA 1J1TA 1NTKE 2IXLA 1HJ0A 3MLJA 1COV3 1Z78A 1CIYA 2C9KA 1WLWA 2ZX1A 4LHLA 4MOAA 3U4SA 3AE4C 1NU1G 3CCVP 3M3IA 4KQ7A 2E6VA 1AR93 2DU1A 4WZCA 3OB8A 3TAYA 1ZV8A 1LT9C 3VBRA 2BCCG 4J25A 3Q1MA 3AEGC 2YYOA 4NUBA 1Q82Q 2ZACA 5A32A 5GZGA 3PJQA 2YPJA 3H1HG 1RUD2 1PVC2 2D43A 1DLLA 2A71A 4XW3A 3ZYBA 1YFUA 4YW3A 4E2GA 3IZOA 1P84D 5I93A 1YJKA 4UFMA 1SDWA 4KBBA 5ERLA 1XNCA 4LBKA 1Q43A 1BZWA 2BOJA 4D0QA 1DYPA 2WAOA 4QX7A 3GLMA 2KSEA 3BU7A 2O8OA 1RUC2 5M0TA 1L0LD 3U4XA 1VQ6P 3ZPOA 1MEC1 1LHOA 3RZGA 5HXMA 4GOFA 1YJLA 2ZEXA 4CCLA 2ZMLA 3OD4A 3M9BA 3VDDA 3BATA 2R6QA 5HXVA 3TNUA 1RUF1 1JYIA 1C8NA 4AEJA 2UWCA 1WW7A 1SFCA 3N9OA 4Y26A 3ZX7A 5FYSA 3UKVA 2RS52 1HXS2 1N3PA 5A3UA 3DGTA 4UFJA 2Y26A 3HAGA 1A02J 1DGWX 5FZ3A 3E1RA 2RDRA 1QJX2 1GL2C 4AE2A 1ULEA 1RUC1 3AL6A 3ES4A 2HEWF 2WS93 4Y20B 3ZN6B 2D6NA 1W3VA 1LGHB 3H1YA 1G7YA 1UIXA 3MW3A 1B35C 3NKGA 4R9AA 4ZZ5A 3V2PA 1C8M3 3S5AA 4H0LD 4MN4C 1U5ZA 2VW2A 5FP4A 5K0UC 5EJ1B 1HF9A 2EICA 1ZA4A 3ETPA 5A33B 2PHTA 4KI5M 5C7GA 4IQPA 2HODA 4MADA 4AYCA 4BMEA 2AENA 4JV4A 5C8CB 3LA3A 2K46A 3CD6P 1JOBA 1A34A 3B71A 1JYNA 2JD9A 3E6DA 2DFCA 2XL7A 1N7SD 2GP3A 3G6EP 5C3RA 4K8FA 4YVSB 4AI8A 1QLED 4X8NA 4O9BA 4MO3M 5A7WB 3OF1A 4ZXEA 3M1HA 1OQ1A 2IZ1A 5BNOB 4QPIB 2VU9A 2FYUD 3A2AA 3F89A 2J1SA 3CZUA 4INDA 5GLZA 4IE6A 3A0NA 4MV2A 2OYZA 4IL7A 4W6XA 4IFDK 1DQ4A 3H1KG 1R083 3OJBA 4CP9A 2X10A 5CFCB 2FD8A 4YVSC 3GZTB 3K3OA 3D6EA 2BEZF 3I4IA 4L9BA 3WHTA 3VYIA 2DTYA 3N4MA 2XUMA 1UXXX 1PM4A 3DPRA 4IXLA 3ZYPA 2QQVA 1OW6A 2YO3A 1K73Q 2EF6A 3ES1A 4DZGA 1YFWA 1BCXA 5E88A 4QHOA 5LA2A 3VBHC 1EQ7A 1OXZA 1VBC3 2HKXA 3CQOA 1CX1A 2Y0IA 3WNPA 3ENRA 4NPFX 2QQUA 2X05A 1AJOA 1J59A 1X9VA 1GP6A 3E5UA 1PIV1 1GL2B 4LPLA 1BBT2 2JDYA 2DYCA 4CPBD 3HQRA 5FTTC 4UYBA 3VHOA 1UZZA 4D6TJ 5KLVJ 5BPXA 5A7NA 4ES9A 5AVQB 5JAXA 1FJKA 1M1JC 1NLSA 1SQVE 3O1OA 3N9NA 5KC6A 1O4ZA 4Q8KA 2W83C 1H0BA 4A7KA 2A1XA 2HYKA 4V2WA 2VH9A 4Q0UA 4YVWC 2O01J 3KZIE 2N1TA 3CWBE 1NZCA 4QPIC 3NNLA 2Y34A 3OW2O 1OUSA 1X0TA 1RY3A 3L75E 1HWTC 2BW8A 2FFDB 2PHWA 1W5CE 1PIV2 2WFF1 3KM5A 3OEBA 4IE0A 2E75C 1D2QA 2L9LA 2OT7A 2XJUA 4FVVA 3C7OA 3WG2A 1BCCG 3PHLA 2RH0A 3VBOC 3WF0A 3NV4A 3CCJP 2OS2A 1H0TB 3AZZA 3PMEA 3WLUA 2G9ZA 1NTKD 2PYTA 4CVUA 3CCUP 3ACGA 5FQ0A 4QXHA 2P6HA 5FYTA 1BBT3 2E7QA 3FC0A 4NAOA 4UFLA 1YQ4C 1LTJC 2ILMA 1W6MA 3HOBA 2KOGA 4D3WA 4A42A 3FJSA 4K6BA 3HD7A 3RPQA 2XMLA 1YI2P 1GTWA 1ULOA 4GKXA 4LE4A 2RVAA 1MZEA 4CCJA 5KHGA 1W6OB 2VMIA 3CCLP 3RYPA 3INAA 2VJXA 5HV0A 4RL7A 3S6PA 2E26A 3AMHA 3PVNA 3I3BA 4YLZA 1QDOA 4AFAA 2OIIA 3MGNA 3RJ2X 2OARA 1QJY3 3KD4A 1M7LA 2OPWA 4IGPA 4CDUA 4I0BA 4XBQA 4DOUA 2JIGA 3O5SA 3HD7D 4S2DA 2JJ6A 5IVCA 5K5GB 4MZUA 2BEQD 1PP9D 3L37A 1ZYBA 1S4XA 2KSJA 5I0SA 4OHXA 4JGZA 3QH9A 1SLQA 5BVZA 1DQ1A 3HIFA 2A6VA 3ZXGA 1XXNA 1QQP3 5IATA 3CL3D 3WU2H 4N53A 1H30A 3AB0A 1W8ZA 2VQUA 5K0UB 3C1LA 3FX3A 4S2FA 4QPIA 1G9CA 4M3LA 2WWWA 4D6SA 4UI9L 1PNFA 3NTNA 3JB4C 2VOKA 2VZUA 4AEDA 1AR81 3EQEA 2FMYA 2GSYA 1ZM1A 1N3OA 2VQTA 4XUQA 4ZHNA 3WEZA 4B86A 3MO4A 2O3JA 1F2NA 1GZWA 3N7NA 1V6OA 4KG0A 4BB3A 3H1KE 4CA9A 4BQ1A 4NVPA 4EE2A 1Q86Q 1RMU1 2FDGA 2VTXA 3H7YA 3N7LA 2HWE1 3HBKA 5B4XA 2WNUC 3T08A 1QNYA 2BUKA 3NVCA 2ZTNA 1NUKA 1KB9I 4L74A 1G1IA 1Q7YQ 1LU1A 1T2KD 2HLEA 2JG9B 2Q5TA 2TUNA 3F2ZA 3KT4A 3AP7A 1RUG3 3OPZA 4HVOA 1W9FA 4FP3A 2OGUA 3W5NA 1FDOA 1SPPB 4AK3A 2ZAAA 3AVRA 5CISA 4RR3A 4BLIA 1USDA 1ZW0A 2BNMA 1WRGA 2A7AA 2ZT9D 1J1DB 3SSUA 2N7GA 4YGDA 1LOBA 1JOPA 1RUG1 3TBDA 3J7MA 1IFDA 1X8MA 4RS5B 5FREA 4Q4Y2 2Q4SA 4SLIA 4RQPA 2NZ2A 2ZVOB 2GNMA 5C9AA 5CEHA 1UPSA 5AVZB 5FZOA 2M3BA 3QBQA 4GODA 3KDPB 3I55P 2WO2A 5KTBA 2PTMA 3JBG2 4FXKB 4MGIE 4PDWC 3V6IA 3ZFFC 4NOTA 5L8RJ 1X8EA 1P84I 1NTME 2WSCH 2BWCA 1SQQD 3FE5A 3PIJA 5AVAA 4HKWA 3AKTA 4H3WA 1RE4A 2D6MA 2A6XA 4JVAA 1JOJA 2D6LX 5FZAA 3H1ID 5CBNA 1RUG2 2D97A 2KD7A 3LB9A 3WCRA 4B1LA 4LUMA 3OTFA 1GFF2 2PHLA 2POHA 2ZYGA 3BYWA 1WKYA 3RL0g 4Y1ZA 5G05L 2ZPXA 4L92A 3CC4P 3H7JA 3USUA 1FZCB 3GM8A 3QH6A 1YLLA 2AGSA 2E31A 4ZPIA 5LASA 2JKBA 4RFRB 1UX7A 1NOHA 2SPZA 4P9JA 1LHWA 2B39A 1FOD1 3HNYM 3I3DA 4AHYA 4CDUC 5AC93 2YFZA 3L73G 2P3KA 3HR9A 3R4SA 2IDBA 1VPHA 2JICA 1GZ9A 3JCIA 4JKMA 4Q0QA 4QPYA 4IV1A 5JUVA 2ZXXA 2PLV1 1SQ4A 5FLIA 2O0OA 1EXJA 2WT7A 1AJYA 1QJY1 1Z7S2 2VD7A 3VKOA 1FZAA 4HG6B 4NIAA 4CDQA 1H8AA 1RVF1 2X5IC 4LEJA 2Z79A 2EA7A 2EXJA 5DDJ2 5E8AA 5BXXA 3BCCJ 2WO1A 3BIEA 4ATEA 1XU1A 3LDRA 4FFFA 3L2HA 3ZSEA 3CJIB 3AEBC 4BA6A 1PGW2 2C9NY 3MIHA 1EZVG 3ZDMA 1HN1A 4YW5A 3B94A 4CYDA 3NJZA 2Y9ZA 3C9IA 1NE4A 4X6QB 2NPSC 1AXYA 2VZQA 3RZKA 3S30A 4WBBA 3OPWA 4FPYA 4QDSA 1K5MC 1TU3F 5A7PA 3D0JA 2X8KA 1NX9A 4D94A 3S1KA 1S2BA 2EIBA 1PGL1 1UO9A 2VM9A 1J1EB 2Y6HA 4OI2A 5IVYA 4LA3A 3AK0A 4DNYA 3OEAA 1W2UA 4H44D 1ND2B 2KLUA 4UF0B 3SEEA 3ZYFA 1Z7S3 2JEMA 3N7MA 3MV11 3LIHA 1PFIA 1W9TA 2K9JB 1OA3A 1X50A 2E33A 3AZYA 5FY8A 1DQ6A 3ZLIA 2HBTA 4XJAA 2E5YA 4I09A 1PPJG 4KWLA 3L74G 4YM2A 1OOPB 1VBD3 3WUVA 3CZJA 5FZ1A 4UB6H 4XACA 1U0AA 3P32A 4W7ZA 1GW4A 1T6AA 1D7PM 1GV9A 3RMYA 1LNSA 3VDBA 5CG8A 1BE3J 1SQVD 3WDXA 4YPCA 1RUF2 1W9WA 4N78E 2CSGA 3POYA 2WSEH 3J8F1 4WY4C 2WR9A 3GGLA 4ZXKA 1MZ5A 2RS51 5C3PA 1UYYA 1F8VA 4WB4A 3B9CA 5C4WA 3LAGA 2JE8A 3V2NA 4QT6A 3ZKUA 3DCQA 3TNUB 3NAPC 5JXIA 2H7HA 4D69A 2HBUA 5AW4B 4Y5TA 3EWKA 3FX0A 2Q1ZB 1W2EA 1L7QA 1Q8OA 2YB7A 2PHUA 5L7OC 1OT5A 1JY3N 3PVOA 4RQPC 1T3JA 4E8DA 1EPZA 2IBZI 4H7LA 3A23A 1K5MA 2YC2A 2D93A 3I2JA 2K1AA 3HTKB 1ZNPA 3R05A 1FBMA 2YKQA 2XGXA 4LKFA 5LK5A 4AYUA 2LTNA 1EV11 1PX3A 1YQ8A 1J2JB 1IKQA 2A70A 2ZX0A 1PO21 2ZGOA 3APBA 5FJKA 4RHV1 2PAMA 5D21A 2Z2SB 3BB6A 1AL22 1S5LH 5FXZA 4FPJA 5LBBA 4EN8B 5FFOC 1RHI1 4IOIH 1ASJ3 4XF3A 1LHVA 2AYHA 1S2EA 3H0OA 2VOVA 4CDXC 2ZGKA 1NU1D 4L8QA 3MP7B 1RQUA 5J7MA 3SCHA 1N7LA 3F95A 4AI1A 1JYTA 1AYM1 4LO6B 2YBPA 1FZCC 1LOFC 3L71J 5KLIC 2JG9C 2WAAA 2YIUB 1FV3A 1GQGA 4GT1A 1U5XA 1UYXA 1V6MA 2W68A 4TYSA 5J1XA 1YC61 5CFCA 4J1WA 1CQ9A 1PVC1 1GOHA 2HEYF 3AZWA 1SQVG 3KMHA 5JXJA 3U0ZA 1K8AQ 4B1MA 2P3YA 5AVYB 1BJQA 3QCWA 1WBFA 1KB9H 1WT6A 5EQUA 2ZAHA 2C4XA 3O7OA 5T5LA 3VDDC 2Y6KA 2WPVB 2ZEZA 4Q4V3 3BCCG 3RGUA 3SC7X 4XF1A 4IL6X 5CVRA 2FXOA 2VRSA 4F83A 1N86A 4ZNCA 2HYNA 4G4FA 3RNSA 5EP9A 2BERA 1YTZI 5CCGA 1MQTB 1Q8SA 1SG3A 2WVRA 5B66E 1MACA 1UZ0A 1Y7BA 2CTVA 2DBIA 2PHFA 3C7EA 2D2CB 2QQWA 4PJ0E 3D5OA 4QPGB 3ZFGA 5B2GB 4OUSA 4MXVA 3VD7A 2RMU2 1RE4C 2OYIC 1WCQA 2R062 3WCSA 1TZOA 3SLIA 1W2TA 3LPFA 3AYAA 1SS1A 3ILRA 4AQRD 4XUPA 2YU2A 2B89A 3WW4A 1A02F 1IFNA 1S55A 3P7KA 2MNGA 1NQDA 4ARXA 4YSFA 1MVQA 1PHMA 2L5GB 3TGUG 3FBYA 1PM7A 3FHIB 3ILNA 4FTEA 1KILC 2IFRA 2J7MA 3HD7C 3L75D 2ZGSA 3TN91 4DXTA 2XQRA 4YGCA 2A73B 2R16A 4Q4Y3 3RJRA 3AEFC 4OGQD 1KD1Q 1TEIA 2YZ4A 4CDWB 2LS6A 3RL0B 1Q56A 1NCQC 2BOIA 4XETA 4YG0A 5F2WA 1XJAA 5JCTA 1KFMA 2HPCA 1WMXA 1BDDA 1YQ3C 2R073 4YFWA 3O1VA 2OKXA 3LA7A 3TYYA 1N7SC 3CPWO 2GNTA 3D71A 1MZ9A 2JR8A 1LJ2A 2NMOA 3IIIA 4Y3OA 3VMYA 3H25A 2QJVA 2VMCA 5FYZA 1UYPA 1W28A 2VVDA 2CPSA 3DL3A 4Y99C 2Q8DA 1RF1B 5LY1A 2QJKC 1R5LA 4CPGA 1EZVE 1VP6A 2FFDA 3FFQA 4G3YC 2HWE3 3WVJA 2W0XA 4N7UA 4S2GA 4YG6A 2AEYA 2V7QJ 2HWC3 2UWAA 2JKVA 3D82A 4LLOA 4AQ6A 4FPEA 4CUAA 3L35A 1JY2N 3PTRB 1YUDA 3UV9A 5FYMA 1A6CA 2WFF2 4AAXA 5ISLA 5KHIA 5GTIH 2EIDA 3HWJA 3ZXJA 1JZ6A 4FOQA 3O1PA 3CWBG 2VTXJ 4Q4W3 3RSJA 3OGVA 5APWA 1GUIA 1ND2C 2KK7A 2DFBA 1YIPA 1NYHA 2ZBJA 4GWMA 4OH8B 1PPJE 3SFDC 3AEEC 3EQ2A 1J1EC 1QQP1 4HMZA 2UU8A 3WDYA 3H32B 3RZMA 1H9WA 1VBB1 4RYDA 4WVWA 5G04L 5F9TA 3CCEP 4AI0A 5TSWA 5DAPA 2AACA 3BCCE 2JDHA 2WNVA 3GZEA 5FKBA 1BDCA 4A44A 3ECQA 1L4AA 3ZXLA 3N9PA 1JY2P 5KWRA 4A7YA 1UMHA 4BXSV 1ZBA2 1FJPA 3LIGA 5JOZA 1W0PA 1OVUA 1NZIA 3L4FA 4M4RA 5FP3A 3VZLA 1RUJ1 2E53A 4LHSA 3T4HB 4BWOA 2VW1A 3WHUA 2WN2A 1POV1 4JF7A 2XDJA 3H1LD 3Q8FA 5DZGA 4TSVA 3E6CC 4OMDA 5A3MA 1M06G 2J58A 1NQJA 2EALA 3HE4A 1NGMB 1EAH2 1ENQA 5FMBA 5BNQA 2XPJA 2ZGRA 3AYEA 2R0FA 4AHZA 4BISA 3NV1A 2XVKA 3POIA 4PF1A 1NYWA 2C6SA 2YPDA 2AXTE 1C5HA 5F2SA 3V0BA 1NAEA 4PLOA 1LOGA 3W67A 1VBD2 2HYXA 3VBOA 3AE5C 2OZ6A 2RDSA 1OURA 1FZEA 3RL0D 3VP8A 1AR61 1B35A 1REDA 1TME3 2F4LA 5FRAA 5FZ8A 5GLUA 2ET1A 1NTMJ 2WT1A 4Q8LA 1T2KC 4Z07A 5C8CC 2ZHLA 4BH9A 5JWPA 2FDIA 3C7HA 4XIKA 2OQ7A 4CU7A 2IXHA 3L70J 3WDUA 2JX9A 3N36A 4YPJA 3AP5A 3OY8B 5LBEA 3C8VA 3KB5A 1H89A 2P6CA 1UIJA 4BLJA 1K45A 1G9AA 1RUE3 4E4SA 3LOBA 1MV8A 2K9ZA 5BNNC 4GQ7A 3AL5A 1D4M2 2D2CD 2P1JA 1SQBG 1M56D 5APYA 3MW2A 4OVEA 5GZEA 1SFYA 3THDA 5AC91 2FBWC 2A45H 2ZJCA 4AVSA 2ZHMA 2Q8OA 3CXHI 2Q3IA 1FNZA 2H6CA 3L9JT 2WLQA 4FPGA 2EIGA 3E5QA 1R093 1W3XA 5AW9B 3AFGA 3CL1A 1ZRTE 2XXZA 1V6JA 4OMCA 1EDJA 1EV13 2O8QA 2W52A 1QGKB 3CHXA 4UWDA 3I59B 1YITP 1YIJP 2XU6A 3NMDA 4EWAA 4Z2AA 2DCKA 3B3QE 1S9KE 3N35A 3POBA 3D8CA 1SQXK 1XSQA 2OQ6A 3NNGA 4BOWA 5L36A 3U14A 3ETQA 3OGRA 2FCTA 4XEZA 3NNMA 4XUNA 5LATA 5JVVA 5C71A 5DUWA 2OPKA 1H1AA 1GANA 4JTOA 4XTPA 2WZEA 3L70G 4I0WB 3AECC 1ENXA 3O1UA 4Z82A 4CDQB 1W8WA 1UOBA 1MR5A 5LA1A 3HN1A 4Q5OA 4QKFA 1XSRA 3GALA 5FY1A 3V0AA 2JB8A 5JPMB 1IK7A 3J8F3 5H9RA 4UB8E 4I01A 3THCA 2R49A 1NKZB 4FXGB 1CAXA 5ANQA 3U1XA 2XBO2 3JQWA 2GN3A 3HPNA 4AVAA 3GCXA 5DABA 4Z92B 3VDDB 3FGAD 2PAJA 1I5PA 1YBKA 1CVNA 2VL4A 5HCFA 1ZBA3 1AYN2 2A75A 3KYQA 2D6PA 2VGDA 1GU4A 3OUJA 4Q4Y1 3ZPYA 2YO2A 1L4AC 2QEXP 2JWDA 2R5DA 3N7JA 1H8TB 2W1SA 4P9IA 1QJFA 4XUTA 2VNGA 3VD5A 2Q0AA 3BVHA 1CI6B 1F31A 1RXFA 2XKPA 3CI9A 3LGRA 5L9BA 3V2QA 1I5ZA 3BOWA 2RDNA 3U37A 1AVBA 4D7SA 1AR71 1QY4A 3K4DA 3NKTA 3VKFC 1UX6A 3J8F2 3WQ0A 3DF0A 4ZY9A 2CYFA 3WNLA 2IPPA 4Z1MH 1ZRDA 1BEV3 2MPFA 5EXOA 3HMYA 3M3QA 2MKVA 1O91A 1JU3A 2XLFA 1ZX5A 2ZGUA 1Y4WA 3IR9A 3W9AA 4E27A 3UIAA 5HV4A 1LCLA 1W8HA 2BVVA 5GLWA 2ZZQA 5JSOA 4MGSA 1AR92 4JAAA 4Z8BA 3CJIC 1RJ8A 2VBDA 4MGQA 3URFA 1W6NB 3ZFEA 2KIKA 2WSEJ 3U75A 5IFTA 1EDLA 5APXA 2XJTA 3NWKA 1Y47A 4MGZE 2YHJA 1PVC3 1JZ8A 2WSVA 2P7JA 1L7RA 2XH6A 3CJIA 4YW6A 2X29A 3K48A 1QVFO 1RUE2 2BVBA 1IKPA 3KCCA 1LNQA 3JCUE 5CNAA 5EYXA 1EUUA 2V72A 3OYWA 4QM9A 5F5QA 4L73A 2VVEA 4RHV2 4X6RB 4CCCA 5JSPA 3L74D 4SBVA 5DDJ1 2V7QH 1AYM3 4V2VA 3KPEA 5A6XA 1Y9QA 1JHNA 3MFCA 3L71D 1DEEG 2C9AA 3KS7A 4UFIA 4AF9A 1C1LA 2QRXA 3WDWA 5F7UA 1POQA 2X53S 2BGCA 3MIEA 3L75G 2ARBA 2GUVA 1KD7A 3TRSB 2BPA2 3USSA 5EHDA 1SQQK 4XFGA 3RWKX 1NA1B 4ZZ8A 2ARCA 2CK3H 4LO8A 5T5JA 1YYCA 4H55A 3IDCB 1BQPA 2CAVA 3J7NA 4C0HA 2Q1MA 1PGL2 4XFCA 4N3YB 2G4IA 4K40A 5FY5A 2BYVE 3WW1A 3M0DC 2GH2A 2VVFA 3FL7A 1DP0A 1W90A 4IERA 3ZN5A 1NTKJ 1ZZ7A 4D6RA 1X22A 3BIWE 1JTHB 3MUDA 1C8M2 1HKDA 4KWJA 4Q27A 2C9LY 2JO1A 2W6AA 1L0ND 3E1IA 1QVGO 1SDDB 2G19A 5FZ6A 2XR4A 4XABA 2RR13 3RQ0A 3VDAA 5I0DA 3LEKA 5LCWL 1IFJA 1NKNA 4EROA 1LWUA 3U11A 2GM4A 4JBZA 2B45X 4LBQB 3GF7A 1OHFA 2FCVA 1Y9BA 2P17A 1VMFA 4MVTA 2YDEA 3SH5A 4Y1XA 4AVCA 3FN9A 3ZSMA 1SQQG 3PIGA 3RL0C 4LMFA 3WG4A 1SQBD 3WDVA 1OX3A 2VMHA 3EO6A 1EUTA 1TVGA 3LFIA 1AYM2 1QF3A 4UW5A 4HB1A 3MGUA 2NQYA 1HRI3 1GZCA 2UWBA 4XPVA 3JCUH 4CCEA 5BNOA 3WP5A 4URTA 1WD4A 2KS1A 1HB3A 5LA0A 5FZHA 2EXKA 1URQB 2XVGA 4QGMA 4CEWC 2GUSA 2O01H 4AZZA 4LT5A 3ZSJA 2J1RA 1SQXJ 3H1MA 5KBFA 1HB2A 3KGLA 4QX2A 3Q8AA 1K42A 4LTAA 5KXDA 2ZT9B 4XHXA 5A70A 5FO7B 4CDUB 1HXS1 4QPGC 5AC92 2WSCJ 3BPSA 4HOOA 1Q2NA 4IDZA 1V9U2 4FPCA 5BNPC 4QMAA 4M00A 4XFFA 3VOPA 1E5RA 2FDJA 5F6LB 2E76D 1DZRA 5FP8A 2BU9A 1S0EA 2GMPA 2XLAA 4FPKA 2FBEA 1GK6A 2J5UA 5BU8B 2R061 3ZYJB 2FYUJ 2VZOA 3LQCA 2VE1A 4FO9A 1LULA 2A06E 3L75J 1AR73 1LGBA 4MSVA 3B5NC 2WZR2 3CMAP 3PLQA 5JXHA 2VUJA 1JOCA 3RK3E 1V9U1 3KGZA 3H8RA 2IVJA 1JYVA 1H8TA 2RDQA 2HPCB 2ID4A 3I2GA 3HE5B 1OLME 1HB1A 1LOCA 4EWEA 4QX8A 5JLVA 3KV9A 3DYOA 4Y22B 3E1F1 2VMFA 1DDLA 1NTMK 1ZRTD 2XWJB 3T30A 1S2KA 2ZFCA 1IQAA 1QX8A 1WA4A 1O4TA 4PDWA 5FZ7A 4AI3A 3AXDA 2D3RA 3PJYA 4PQ9A 2H0VA 1BCCD 3LW5H 1OMIA 3SKVA 3UKTA 1HQWA 5IVBA 4UB8H 2KI7B 5K7PA 1HH0A 4K8RB 1LT9A 2CDPA 3I54A 3M3OA 2QNKA 4KBZA 1FMD3 2UY8A 4EV0A 1PP9J 1APNA 1VRH3 2A6WA 1F9KA 1VMHA 1YO8A 2B46X 3AM2A 4XHBA 5H9PA 1URQD 1BGYE 3CCMP 4NHMA 2QUOA 4KG8A 4D7YA 5A6YA 5TISE 4K7JA 2B5HA 4P9GA 3Q8BA 3PTYA 5CB7A 2MEV2 2Y38A 4ARYA 2WNUB 1WMFA 1WLTA 1ULFA 3N4XA 2C0ZA 4Y4YA 5F5IA 3TN92 3GCWA 5J37A 1K04A 4IEUA 1KFUL 1RUJ3 3A22A 4RN5A 3OUIA 5E79E 5JZGA 1U7MA 5DJUB 2O14A 4NJ4A 5FZKA 1OVSA 2ZXQA 5T5PA 1KQLA 2WZ8A 3O8ZA 2ZKLA 2ZVNB 2K3RA 3ZYRA 2CHHA 4NIHA 3DUIA 2ZJSE 3CWBD 2KZIA 4IE4A 2D3PA 2RS33 2ZABA 1E5WA 1K5JA 1N3QA 1SLCA 2VOTA 5JIUA 4OZXA 4ET7A 3AEDC 3FWEA 5FZ9A 5APTA 2D5FA 2WC2A 1URQC 4PD4E 2QBXA 2WFPA 5KC5A 5A3WA 2W46A 3NNFA 3KZ4C 1W8OA 5CFDB 1RJ7A 1GP4A 3C7GA 1LTAC 2B4KA 1OI6A 4L0PA 4XZUG 3ZDVA 1UKGA 2FCUA 3IN9A 2P3JA 3UGGA 4BIFA 1SQBJ 4I3GA 3D0SA 4QQPA 3FWLA 4YZ5A 1NTZD 1VF5B 3ZM8A 4Q1PA 2FDKA 1UF2C 4ONUA 4CDXB 5AW6B 2QQMA 2YU1A 5DUXA 3ZFGC 2PLV3 1AR82 4LLFA 3WW2A 4HSJA 1G86A 3EYPA 1GOGA 5KJ7D 1SBDA 1VALA 1MVEA 2GNBA 1RB8G 1CSBA 1TG7A 4IGQA 3C8XA 4WY4A 4GH4B 4NHKA 1V6IA 1RE3A 5F5AA 2IC1A 2K2SA 2RS32 1YEWA 5A1FA 2QQLA 3O6QB 4F7ZA 4EQVA 2NMNA 4LO4B 2E74D 3H1HE 4WVZA 4NWVA 4Q4X2 4A3XA 4A7PA 2JDAA 3GYDA 1KMIZ 1U7JA 1IPKA 1FAYA 1NXD1 1W06A 1MS9A 1REFA 4E4DX 2GDFA 1QOTA 5AVXB 2GC1A 3O0XA 4M3CA 1AL0G 4IV3B 4XE9A 3VBSA 3ZFFA 2E75B 1HJFA 1O7FA 2DUPA 2XUEA 3B7MA 3T2QA 3S57A 2WQ8A 4J6GA 3VBOB 4D6TG 1RH5B 5KLVG 1DGRA 2E7AA 5FZOB 1OFNA 2R071 2HWC1 4IESA 3RYKA 2J1AA 3NW4A 3UGFA 2DW3A 2RS12 3TN93 3L72D 4YZ2A 1SQPG 1PK6B 3IFMA 1RF1C 5FUIA 5BNPA 2WPRA 3G71P 4QPWA 1FZGA 4DQAA 5KKZB 1D4M1 3OGSA 1IZ3A 4AG4A 4PD4I 1HW5A 1PO12 5LW9A 1VPCA 1HRV2 4A7ZA 2R043 3SKJE 4EYUA 1P84H 2N9BA 2DURA 2VULA 4BQWA 4CEWA 4DUWA 1YNAA 2VCCA 4FPHA 1J58A 1S9KD 2QCSB 5EJ3A 2B9BA 2IXJA 2RR11 1CJPA 4PT6A 4XJ8A 3CLQA 4H0LB 4YVWA 2VZ3A 1C28A 2QIWA 2XKOA 4LORA 1XE0A 1E79H 5LY2A 3AP4A 3KWVA 1PMHX 5GTIE 3PVBB 3PU3A 3BODA 1B09A 2QVAA 2JECA 2ORZA 3DYMA 4FOYA 4XTMA 2RKLA 4C7NA 1X33A 2HEVF 3IPVA 4FFIA 3WP6A 5F3CA 3PU8A 4OLLA 5GTHH 1TMF3 1WBLA 4N6JA 3KT1A 1AQ5A 1XNTA 1QJU1 2JD4A 1UXZA 3AXEA 3LPGA 5T3NA 4C90A 1R1ZA 4B29A 4CRQA 1AV1A 3GJBA 2D2CC 1H9PA 1PZ9A 3M3CA 4NIDA 3V64A 1UOFA 3T09A 1K5MB 3WNOA 4EDFA 3OSDA 2BTVC 3RK2D 1LEDA 2W1UA 4D6TE 5KLVE 1QMJA 1SCRA 4ISRA 1J1LA 1EXIA 1BVP1 1H2NA 3TK1A 1GWLA 2JG8B 2ZX2A 1LTIC 1MUUA 1VF5C 2Y6JA 3R4DB 4LBLA 1S72P 1QKQA 4C1WA 5KLVD 4D6TD 3IBMA 3LDBA 4DXZA 2VTFA 1KILB 2BNNA 4PJYA 1UZVA 2YFUA 1M90Q 2DVDA 1W2BO 1CAXB 1UOGA 2Q8CA 2ZYAA 4OHYA 5AFEA 1JM0A 2WT2A 3POEA 5AVTB 1UU4A 3CX5I 3I8TA 3O1SA 2P37A 5F1RA 5ACA3 5AVWB 1KV4A 1JO5A 1S0DA 3FUOA 3WUDA 3ZMOA 3FLPA 2EAAA 3DECA 2IBZD 1NT0A 3ZN4A 1YFXA 5CMZA 2JIJA 3I2FA 3KHUA 5GLTA 1VQ8P 2PELA 2FYZA 4OCTA 4ORFA 5FLHA 1JZ5A 3AE6C 5FWJA 1KN7A 5C5TA 2IFNA 1VB2A 1N73C 4I3PA 3RI9A 5JDBA 2WSUA 3Q8EA 4IEWA 2WSFJ 2AH2A 4YXWH 1F15A 4MX3A 5EWSA 3JD73 5EIYB 4GWNA 1H8TC 4RFT0 3T2PA 1PO23 2N1TC 3RFRA 1RUI2 2RJKA 4BJ0A 2QJPB 1V6LA 2OUJA 5AVVB 1RVF2 3Q9OA 1MS8A 4Q29A 4HFSA 3GG2A 2J59M 3L70E 2JG8C 4FQ4A 1S3JA 4HKZH 4FI9A 1AF9A 3HJRA 5FKCA 3SEPA 5L19A 1OQEA 1YTZT 1OVPA 4UOJA 4CCNA 1GZTA 4YW4A 1PK6A 2IZWA 2ADEA 3H42B 4QGLA 1C8M1 2HWD1 3SITA 4B7KA 3CX5D 5JIAA 4ES8A 4AGVA 4MG2A 1O3QA 2XOMA 2QDRA 5FWEA 2E51A 5AW3B 4HYTB 3I56P 3OBZA 2LALA 1N2DC 3MV01 1R1A2 3K2OA 1JTHA 3JZVA 4HL0A 1LTBC 4XCBA 3H8XA 3MZHA 1CWPA 1RXGA 1IFPA 4IEVA 1BSHA 2KXPB 5FP9A 3AP6A 5FZ4A 4P14A 1RYYA 1H4GA 1S5LE 4BHPA 3T4VA 1RHI3 2GP5A 2Y60A 3UJQA 4XDPA 2IXCA 2YBKA 5T50A 3OBTA 1OF4A 1YJ9P 1KILD 1IGOA 2W91A 4JGYC 4AXOA 1NLQA 2HWB1 4XILA 1L0LE 3JD71 1XPWA 4QX0A 4WM7A 3IKWA 1ZREA 2YKOA 4C1XA 2QQOA 1H6YA 5FO9B 2XJRA 4WWIA 1EZVI 1XNDA 4N9HA 3RBZA 4TWTA 2WTYA 2ZMNA 1VQMP 1VBA3 2CNAA 1HLCA 3MIDA 3MUY1 3RZHA 2E9QA 3RDIA 1O5LA 3HNMA 4PLNA 3T2TA 1VRH1 1NU1E 1CI6A 3V4QA 4OI0A 1SPPA 3P1IA 1MEC2 3ZMNA 1JYCA 1VMJA 2OTLP 1UY0A 4IUGA 3TF5A 4MXWA 2HWB2 4P5HA 1KYOI 3C2UA 4DRVA 2OYHB 1IG0A 1GWMA 3TEYA 2ORXA 3VBHB 5AW2B 3VGIA 3VHRA 1I1EA 1XYPA 3DYPA 2R063 4UT5A 4XJUA 3ZXEA 1JUHA 3MLLA 1VJ2A 4Y5SA 1CONA 1R1A3 2QM7A 1S0FA 2BFUL 2KM2A 5FMOL 3VLBB 4Q4X3 1OPMA 4X8PA 4BQ4A 2VW0A 5A3TA 1AX0A 2Y0CA 4L76A 1HIXA 1D7MA 1PX4A 3R0RA 1BK1A 3VHNA 2P2KA 1HXS3 4OI1A 1RHI2 1LWUC 3AP9A 4JDOA 1QXRA 5D1IA 3CO2A 5AW0B 2HR3A 5IK8A 4H13B 3A21A 1C1FA 1J3QA 2ZHKA 1GMMA 4N53C 4N9IA 4YZ3A 3GF3A 4AVVA 1LEMA 1PGJA 2QJYC 4LULA 3M0AA 4F8AA 1URQA 2OTKE 2RJLA 1WUVA 1KITA 3POFA 3G7DA 1FZCA 1L0LG 2Y6LA 3ACLA 3U1CA 3EBRA 5GALA 3ZSLA 3KXDA 1W8TA 4LQRA 4GALA 4WVVA 5FZGA 4UBGA 5AW7B 3V0BB 1DEBA 2WNOA 2O1JA 3LOIA 1OXCA 2R3SA 1RF1A 5EFUA 3SXWA 3WG1A 2GA1A 3CIHA 4BQXA 5CCHD 2PN5A 3II6A 4A2UA 3ITKA 3BTXA 4C46A 2ZGQA 1AL23 1GWKA 3MPBA 1G9BA 3SQOA 5C3QA 4QKBA 3I2IA 1QJEA 4NPDA 1POV0 2V4VA 4CU6A 4GB32 5A32B 4TZDA 2AEMA 4U2AA 4XFHA 4MHRA 1MKMA 1EDIA 2C26A 4AEDC 1ZR2A 1CW5A 1BEV2 3JU9A 2W5FA 3LE0A 1F5JA 4QWNA 1J1DC 1EPWA 2C0XA 2RE9A 2OUHA 5EYYA 5FYHA 5AW8B 3WNXA 1CPNA 1DLCA 3PL0A 2YKPA 2X09A 3GHMA 5KAIH 3NXSA 3LA2A 3Q5PA 1RMU3 3GHGB 2W8ZA 1VQLP 4IEXA 1ZLLA 1HX6A 1RGSA 2B8MA 3GBWA 2GC2A 2Y64A 3I7DA 5C39A 3VBSC 1SQXG 5KXCA 4NIGA 1LP1A 1VF5D 4LBNA 4OUMA 4P5YA 4R8HA 2WNUA 4EN7B 3AVSA 5FBJA 5F6KA 5C4WC 4R4LA 4O61A 4NO4A 5FK7A 3WOGA 1H1IA 2QVSB 3POGA 4PDWB 1RE3C 1GSLA 4FFGA 4PJ0H 4DO0A 1JZ4A 1VQOP 4YFZA 4PI2A 3HE5A 1N1SA 4CCOA 1W0NA 4HSLA 5C70A 3EMRA 1SLLA 1L0NE 2R44A 2P4EA 3MBWA 4Q4W1 4O65A 4FTSA 4META 3A0BH 1UY3A 3HQXA 4QHZA 5DAQA 1LTEA 4HH2A 1FPN3 2BQPA 2JDMA 5FLJA 3RZZA 2ITAA 4TLFA 1AA0A 2N1TD 2OYOA 3JQXA 5J96B 5IT6A 1SQBK 1AX1A 4XMIA 4XXAA 1LTTC 4ATFA 2Q9IA 5A6ZA 3WUCA 2IXIA 1KFXL 1OA2A 1DZQA 1GD2E 4GMP1 1GU5A 3KHBA 4Q4X1 2B9UA 4BE3A 3CXHD 3WP4A 5JZGB 2I07B 4CTEA 3BI3A 3MPPG 2DTWA 1KS5A 4XCAA 5C8CA 3AFKA 1KDMA 1H88A 4K21A 1R082 1FXZA 3NRUA 1G2CA 1EAH1 5DAWA 3RGBA 2YC0A 1KQRA 4LKSA 2H43A 1S1AA 2KA3A 1O59A 1JCDA 2R072 4M3CE 4NRPA 5I8SA 2JE9A 3WQ7A 1QU0A 1U5IA 4TLGA 1DYKA 3K4AA 4MH0E 4B7EA 1CZSA 1JCCA 4P9LA 1AR62 2RM22 4R9BA 4XURA 1JUNA 1VBA1 4CEYC 4E4HA 4YARA 1N7SA 4Q0PA 4R4XA 4IFFA 5B5EH 4XDOA 1ODMA 2Y8KA 2ATFA 4PIYA 4AEKA 1TQ5A 2FYUG 3OYWB 1PZ8A 5FAXA 2HFED 1G6NA 4M3CB 1XNBA 3NAPA 5IVJA 3WZ1A 3H6PA 5A80A 5GZFA 1OWAA 2WPQA 2UYAA 1ZBA1 4EI2A 2D98A 3T97A 4XFJA 1UZYA 2DVGA 2YROA 2Z4FA 3POWA 2BZDA 1VQ5P 3L70D 2Q1FA 5KLIB 2Y9YA 2QJYB 1IJDB 4L11A 2F17A 4Q26A 4WM8C 3ZXDA 5KAFH 2AXTH 2M5AA 1PZ7A 4JZRA 5JPNB 3ELNA 1GL2A 1IPJA 2B42B 1BVVA 2DWRA 3BOPA 3KCXA 3LEMA 3POJA 3SHRA 4AVTA 2A5ZA 3E6BA 2EAKA 5IK5A 1PIV3 2XB6C 4BMBA 1DBNA 5D8AC 2P10A 1IPSA 3U59A 3N7KA 4XQDA 3T3YA 2GN7A 1T2XA 2VZPA 4JHTA 5DZFA 2FY8A 4ZMDA 1VBD1 2C0WA 2H8PD 2PHRA 1ULGA 1YFYA 4WY4B 2XVLA 2ZA9A 1MS5A 3L71G 1JY3O 4GH4A 3VV1A 3IPVB 3GHGA 2XJVA 1I9RA 3WQ1A 4KMQA 3OJAB 1OFCX 1QEXA 4PBPA 2FYUK 4FOVA 5EZWA 3VD9A 1ASJ1 1HRV1 4LO7A 3DPRB 1QHDA 1S0IA 1H0TA 1M57D 2AEJA 1M4WA 2A3XA 1RQVA 4CU9A 3D6ZA 5IVVA 1S0GA 5H2FE 4YWAA 4AWDA 5JR2A 2FFDC 4XC9A 1JZ2A 1DD3A 1L3JA 4Y33A 4YG3A 1HQNA 1IOAA 1GNHA 2E7TA 2GMMA 5CKQA 1C3HA 1XYOA 4KWKA 1ST8A 2SLIA 4NWWA 1LHUA 4RHV3 3SCGA 1AXKA 1UQXA 3ILFA 5JXGA 4I1LA 3RK2C 2WYSA 4HJGH 4GDOA 5BNPB 2WFF3 3I2HA 3KV4A 5AVSB 1OVVA 1Q81Q 2BDRA 3FFZA 3MIGA 3N9MA 1YRZA 4LBQD 2KP8A 4OVNF 1QJU2 1CJDA 1PGW1 2XL9A 5FXXA 5JI7A 1BLZA 3ZR6A 2J1TA 2ZZJA 1O8SA 1WW5A 3IB3A 5DUVA 5FPZA 4B4QA 1KQGB 1HGVA 1FZFA 1DZTA 1WMDA 2KLVA 2RS53 3N9QA 3T0BA 1UIIA 3MF9A 5SV5A 2Z69A 4BYYA 5FOBB 2QE7H 1KYOH 4R9DA 5F3GA 3S0MA 1PO11 1R091 3MYXA 1LP1B 1OLRA 1GQHA 1ULPA 1CZQA 2DVFA 4W65A 3H3ZA 1QIQA 4DEVA 4IV1C 1CAUB 4IGOA 3UNPA 3S7IA 3FXDA 4N8MA 4J1XA 1DG6A 4GZ9A 3LW5J 3J4UH 4YZ1A 2ZEWA 3H8UA 4UFKA 3USUB 3A7OA 5H9QA 3H1JD 2VUCA 1CR7A 3H1LG 1NTKK 1RUC3 1PL5A 1Z7S1 2QQJA 2VECA 4JGZC 5FY7A 5ANNA 1K05A 1R092 3AC0A 3RRDA 2YXRB 1QJU3 2VMDA 2W1QA 2KS1B 1CZVA 2WABA 3RG0A 2WMMA 1SCSA 2XKMA 4CXYA 1QXJA 2Q3EA 1W2AX 4KU8A 2CU5A 2KNCA 3UGHA 2HWF1 4M0NA 4Y22A 5CFDC 1PZQA 4GWIA 1WGPA 1I3HA 5KXBA 2WWJA 5APQA 4P08A 2VUAA 4PBOA 3EFFK 5FUPA 4BIOA 2D3SA 5IK7A 1BMV2 2CDOA 5I91A 1W8FA 1W6QB 1EYBA 2WINB 5IJRA 4XA4A 1CX4A 1KS4A 5FPVA 3LIDA 2G9GA 3D4KA 1PV3A 2ERFA 3H8OA 1SQPJ 1UZWA 5FYVA 3ROUA 1ZZCA 5E16A 5FZLA 2Z5HA 4AFDA 1JZ7A 3L36A 4CP9B 3POSA 1VQ9P 5IWFA 4NIIA 5CBLA 3MZWB 1NTMG 4UW3A 3MI8A 5APUA 3VZMA 4A4AA 4FAHA 5KAIE 1FDIA 5FPAA 2Q8EA 3O1RA 1UU6A 4ASKA 1FATA 4Y5Z0 1XNKA 1N7SB 4AL9A 2UY9A 2YUEA 3H3LA 4P9XA 5LK7B 3Q2YA 1ZA7A 4UW6A 2JENA 1XB9A 4XIOA 3AKQA 4CCKA 5ACA1 1GDTA 2JJLA 2A3WA 1SQQE 1WCUA 2W87A 1QJZA 2XWBB 4WM8B 4JPZB 4ZKPA 4R4ZA 3ZDSA 1PGOA 5FZBA 1O4YA 3AJZA 2V4HA 4M0HA 2C1FA 4QHBA 1VAVA 3GNEA 2J1UA 2HH9A 3JUUA 3NV2A 3KQGA 2RJ2A 2DVBA 4MXWB 2XLGA 5F3IA 4OQ9A 5LWBA 5HPOA 1S0CA 4FPFA 1SP4A 1VIWB 1VAKA 1GZLA 4R4MA 2GC0A 2OA2A 5D8AA 1X36A 1JYWA 4W7YA 3W58A 1NTZG 4RR3B 1WW6A 1X9PA 1VR3A 4C91A 5FPUA 4QDRA 2V09A 1A3KA 1EP0A 4W8JA 2WKKA 5J36A 3BVCA 4DPNA 3NJYA 3MEPA 2AEFA 4RS5A 2A45G 2WWUA 2ZGMA 1HBWA 2LXCB 4Y1YA 4UBHA 2BBVA 1JI6A 3HT1A 3M4FA 5FP7A 2TNFA 4PF5A 4K1YA 3H1HJ 4CZSA 3ZOIA 1W8UA 4Q1RA 3NNJA 2E5TA 1JHJA 2AZ5A 1AL21 2E74B 2RMU1 3LKJA 3ZFEC 1F5FA 3NV3A 4YNIA 3QD6A 4IEYA 4QQOA 1HB4A 2ETEA 3FUQA 4I7ZB 3VZKA 3CC2P 2DF7A 2JB4A 3ZYHA 1OKOA 4HXCA 4AEDB 2G3AA 3TDKA 1W6MB 1ZRIA 1AR83 4LHNA 5APSA 4XQWA 4CPBA 1FZBA 1N73B 2CGNA 1OPOA 2RHPA 3FLRA 3IN6A 5A7SA 4CCDA 3AE1C 1SQBE 1MS0A 4IETA 5CFDA 4GMP3 5H9SA 2VZ1A 3H1JG 1X9TA 4N90A 3VD3A 4AUWA 3WT3A 1T6GC 3G6JB 3ZKYA 2MJZA 1X7NA 3AE9C 2J1VA 3PJSK 5CCGC 3JBG3 4YRDA 2W9XA 5FMCA 2WZR1 5KLVK 2VPVA 3CLPA 3N9LA 3RZJA 1JBCA 2W47A 4HK9A 4XDQA 2VNVA 3MDPA 3RK3B 1E5HA 1K3IA 1HQLA 1QJX1 3H1LE 1JN2P 2BGPA 1AZDA 2FYNC 3AE8C 4H0LC 2GC3A 2J42A 3EHKA 3B5ND 3BPZA 1JUIA 2PMWB 3HVDA 4NPRA 5HCBA 1RUNA 5A7OA 5B66H 2ZS6B 4PV1B 1FI2A 2WWSA 3ON7A 2A3YA 4AFCA 2QZ2A 2Y6GA 2GZWA 3DKWA 1M1JA 4K20A 2DDUA 4YVWB 3O0VA 1BE3E 5LRSA 1E57A 4UFHA 2WPSA 2YV8A 5CU1A 5J98B 4QPGA 3ZFGB 3VD4A 2DCJA 1E5IA 1GICA 1KEXA 1SQPE 1CN1A 4LBJA 1SBFA 3ZIXA 2VQ0A 4GB31 1DCSA 1DFQA 1DQ2A 2QM8A 1LGCA 1N1YA 1STMA 1UMIA 2DCTA 2KR2A 1PP9E 1IS6A 1NCRB 1QGLA 1VBE2 2D6KA 2LUWA 3L73J 2N9YB 4I2LC 2VBPA 3AMQA 4DB5A 3RZLA 3LF7A 3SH3A 2E43A 1JEKA 3WMM0 3VDCA 4DOJA 2QSIA 4YGBA 3ZYGA 3CKHA 1NA1C 1DF0A 4K3UA 4Y1VA 4AHXA 4BWNA 1NCRC 1UY4A 3CMGA 3P3NA 5T54A 5TISH 1O5UA 1QXPA 4IEPA 5KKZC 2PQQA 1N8RQ 4NPMA 1FOSE 1VBE1 3TNQA 5KXEA 1QL2A 2OXBA 1HVVA 1LT1A 5C3SA 5E6HA 3VKLA 5CCHA 4BQ3A 3G3ZA 2JXAA 3KCYA 4GH4C 1UOJA 5IVFA 1P84E 1US2A 5FPXA 2DUQA 1NY71 3Q8CA 5CIRA 1OKQA 3MUDC 1HRV3 2JEEA 3ASIA 3K4ZA 2PHXA 4Q4V2 3U1AA 1SLIA 5DN2A 3FLTA 5K0UA 5LEKA 3T0AA 2QQNA 3IMNA 4PCRA 1JMBA 1J84A 3MLKA 2ZAEB 3ALQA 1P8JA 3T1LA 1PMJX 4COUA 5E89A 3I5CA 3AMMA 3K46A 4BQ2A 3I49A 3PMSA 3LIEA 4HKOA 1ZN5A 4DY5A 1ND3A 2E76B 1K12A 1QQP2 3B5NA 1VLNA 1BYHA 2H0BA 2YXSA 2BCCE 2HJIA 4NRMA 1YHFA 1KJRA 3FXEA 2WRAA 1AQTA 2WO7A 4HKLA 2R32A 2WDBA 1RUF3 4CUBA 1KRIA 1SQXE 2IZ0A 5CFCC 2ES3A 3WQBA 3PVEA 4XFAA 1ZZ6A 3K77A 4HPKA 4L99A 3RBXA 1M8OB 1NWQA 3A4UA 1LB2A 1VBC1 1UY2A 1GU3A 4XMAA 3TEWA 4I7ZC 1CAWB 4RSUA 4K3AA 5FZCA 1XYNA 1RUH3 2FYNB 4YGEA 3JC22 2M3EA 5CKMA 4MYEA 1FE6A 3CEWA 1SQVK 2E74C 2W39A 4GAZA 4JGYB 1I6XA 1OSGA 4OYUA 3WNNA 3Q3DA 3S5QA 2R3CA 1V9U3 1W9SA 1WLDA 1SQQJ 4AFBA 5C8WA 4NHLA 3AJYA 3AX4A 2BCCJ 5AFBA 1G2CB 2WSSH 3A0HE 4EYYQ 2KB7P 3BN6A 2C5DA 2RV9A 3H1WA 4NRQA 3VBRC 4AHWA 5BV6A 2WNVC 1ZVFA 1ZRFA 3AYDA 1IS3A 1W39A 1Y43B 5K8SA 1OLQA 4JQRA 3SCFA 2EVXA 4G9SB 4FBFA 2Z4EA 1W8NA 3VBUB 3THTA 5A7QA 4P9YA 5J3UA 2KZJA 1NCQA 3AKPA 1BXHA 5JZGC 1SFPA 4LJHA 3AZXA 2FHRA 1IK9A 2PXJA 4QB6A 5DAVA 1SFCB 1USEA 4H7MA 1DQ5A 2QA4P 3B69A 2B88A 1VB4A 3I2KA 2LKMA 1BE3G 3VZOA 3ZR5A 4HETA 1SBEA 3JBG1 3OBRA 4XOGA 4QX3A 1NU1K 4QB2A 4LGDE 2BJSA 4EZHA 1US3A 1XRUA 3KV6A 2CL2A 2Y6FA 2OYIA 2WO3A 4TT3H 1SFCC 1BKZA 4IE7A 4DUVA 1UN1A 2OYHA 2W1WA 2HWC2 5GJ6A 5C9AB 4ZKUA 3MIWA 4QXCA 2YXQB 1R8EA 5K4LA 4BQYA 1ZBE3 4AR2A 3HBZA 1BCCE 2HODB 4JQ0D 2W92A 3GZAA 1XOYA 2WNVB 5H2FH 4I6MC 1OFSA 4YTPC 1REEA 2Y0EA 4YM3A 1O6UA 1UMZA 3VUOA 2RMZA 1VRBA 4DUXA 2VNRA 3UJOA 5BNNB 4O9GA 5B4NA 3X29B 3MF6A 4NAMA 1ODNA 3IDBB 1JU4A 4JDMA 4LITA 2XZRA 3CXHE 4JRAA 1GMJA 4PV1D 2H6BA 5DDJ3 1DYOA 1KILE 1KFNA 3FHAA 3CC7P 4N7IA 4XJWA 3B5NB 4C7RA 1H4HA 2ZXEB 4U3FJ 1LOEA 4KL1A 5IAVA 3WF2A 5I8YA 5IVEA 1PNGA 3LD8A 2FDHA 2YIUC 1COV1 3BTZA 1CAVA 3NJXA 2WN3A 3UL2A 3A7QA 1UCXA 2XBO1 1GNZA 3E97A 1AR91 3BASA 4QXKA 3ZSKA 5A1LA 4RGAA 4PD4H 4H13C 1Z0HA 5KHHA 1BGYG 4OFGA 2DBNA 1KYOD 3CMEP 3P5BA 3UETA 3P8CE 1G9FA 3ABVC 2A45I 4NMIA 4Y20A 4XUOA 5APAA 2CGOA 1KORA 3PURA 1RUD3 4WZFA 2B9VA 1AYN1 4QQ2A 1KYOE 4DJGA 5JMOA 5LEJA 2KNCB 1QL1A 1RUI1 3W59A 1RUH2 5L9VA 3TNPB 4H2AA 5TJHA 5GM0A 4GD4A 2I1JA 2BV4A 4IV1B 2Q6QA 3WF3A 5FPLA 4M4PA 1V70A 5BY5A 5JI9A 1V6NA 2AREA 2WT7B 3CDZB 1XTCC 2E76C 1OOPA 1FPN2 1NTZE 5KHJA 2JDKA 3G9RA 3CWBJ 4OI4A 4JYBA 5I0TA 2L91A 2WSFH 5B5EE 2Q7CA 2P58A 3AMNA 1A8MA 4RGKA 5C4WB 2LRPA 2Y0DA 5FJHA 3ZYIB 4XJ9A 4E2QA 4CP1A 2DV9A 5F32A 3HUSB 1SMVA 1RUH1 1KJLA 1OQDA 3C3VA 1FT9A 4ZU4A 3RI8A 3I3MA 5FK8A 3WU2E 1A8DA 1OD5A 2QQPA 5BYNA 2XJPA 2Q5UA 3HEIA 2NZ9A 4Y1UA 3WF1A 1CD3G 1OIPA 4LR4A 5CADA 4WVMB 3HTKA 1N1TA 2XJQA 4XF0A 2VO5A 1GW3A 3Q5SA 1DQ0A 3I3EA 4UXAA 2J1EA 1V00A 3L72G 1FOSF 2SBAA 3I59A 4FP2A 5FQ0B 4ZKTB 4AAPA 1ENSA 1IS5A 2NYYA 3V5BA 3QWOC 5CJ4A 1C5IA 1RUE1 3MFAA 4GKYA 4UF0A 3SNMA 3PH0A 4ASLA 1S4CA 5A3LA 3BU0A 5CHXA 4QXBA 4TXWA 4AFMA 4DIQA 2HWF3 2NPSA 3KVAA 1A78A 3M8LA 5T55A 4CCMA 2JDNA 3H1IE 4RKUJ 3SWKA 1BGYD 2TBVA 2WT0A 3K3NA 3MICA 1VQ7P 4E8CA 4OGQC 3MW4A 4Y99B 3TGUE 4B4PA 1PPJD 1O3RA 4OHZA 2HWB3 4Z1VA 5F5CA 2AUYA 3GBFA 4E2SA 3HD8B 1ZBE2 2D7FA 4KNCA 3CJXA 5EFWB 4KT0J 4DFSA 4DY3A 4AGGA 3I3QA 4JGZB 3HUSC 3UK9A 4PIXA 5JOWA 1NCQB 1NLRA 2LROA 3ME2A 1R1A1 1ZP0C 2BWAA 2UYBA 1G8WA 1HDKA 1W2NA 1UAIA 1YI9A 3GXUA 1UNBA 2BFUS 2X5IA 2DU0A 1MQTA
chains in the Genus database with same CATH topology
1S0BA 2E63A 5FDBA 4L2NA 4JCKA 3BCWA 3OGJA 4IV3C 5CG9A 1SACA 3O0WA 3TOJA 3B93A 3M70A 3V65A 4AQ2A 1QWRA 3AMPA 1LOAA 1D0HA 1Q8VA 2ENRA 5D8AB 1YXWA 4JDNA 5HBAA 4MGYE 1AHSA 1FOD3 2B7YA 3IWZA 4CEYB 5DUUA 1DGRN 5I0UA 4CDWA 4JRLA 1EV12 1D4VB 4RA0A 2NLRA 1RIRA 5DG2A 4HN0A 1O3TA 2GNDA 4LHKA 2WLPA 4XBNA 3ST7A 1Q8PA 1QJX3 3H50A 3H9AA 4EWDA 3U07A 1NE6A 4FPLA 4RD7A 1RTVA 2FMDA 4HANA 1RUI3 2YMZA 4LBMA 4IEQA 1XU2A 1RUOA 3FBMA 1KDKA 3CU7A 4XFBA 3T1MA 4B4RA 1NY72 4CDQC 2IFWA 4EN6B 3WD5A 4XJZA 1QH6A 4QGNA 1LGNA 3LWCA 1GR3A 2DCZA 1Q3EA 4M3CF 3SISA 1CPMA 2CWMA 1RL3A 2I2SA 3IT8A 5FMOS 4B3NA 4Q4W2 4AQSA 1GKBA 1TMF1 2P3IA 4BPZA 1GLHA 3RMXA 3KLSA 3VBUC 1U12A 4BM8A 5FCCA 4COZA 3TWIA 4E9KA 3KQRA 4XF9A 1LENA 1MZ6A 4OULA 1S0JA 1VBB2 2PAEA 4ASMB 2VG9A 2G9FA 2RM23 2LM3A 4W6YA 2XBO3 2XHKA 2O1QA 1CAWA 3BALA 4Q0VA 3SH4A 1QH7A 3V56A 5GLVA 3VKNA 2MEV3 1LJ7A 3WY6A 5GZDA 5JOYA 2WQZC 3VZNA 3ZO0B 1GBGA 4JGYA 4DS0A 1RUJ2 1UW8A 2RM21 4K9SA 1CGPA 5JSRA 1LECA 1AYN3 1C57A 1YYNA 2PHDA 4GULA 4CP0A 2ZOEB 1EY2A 3QLQA 1WMEA 2MHFA 2VNOA 4AW7A 3LZZA 2R1BA 2ZGPA 1RMU2 2V5YA 3ZIWA 2TEPA 3NO8A 1DGWA 2D6OX 3VBUA 3OY8A 4N43A 5JMCA 1BSNA 5CAZA 4EN9B 4Q4V1 2R041 5GKAC 3ZN6A 1J3PA 4YW1A 1ALYA 4LNVA 1XE7A 1MS4A 1LR5A 3QOPA 2JDZA 3ZVXA 1D0GA 2RR12 1URXA 4GXLA 5SV8A 1UL9A 2WL1A 1W6QA 4YM1A 3J9SA 1H2MA 1QNWA 3KSCA 2KXLA 4YVSA 5EV7A 3ZXAC 1RC6A 3SMHA 3DPRC 1VBC2 2RS11 4LBOA 1H2KA 1H1MA 4R52A 2CV6A 4DMIA 5K9YA 3THPA 4FSJA 2A6ZA 3WX5A 1NXMA 2YGMA 4RR3C 4RS5C 5L7OA 1RITA 1C4RA 1CAUA 4YW2A 2WS92 3DN7A 4EN0A 1VBE3 1YCIA 3B9IA 2WNEA 1QJY2 1UD1A 4E4ZA 1AJKA 4K1ZA 3IIAA 4FPOB 1ASJ2 3WXPA 2GMEA 5DZEA 5CA6A 2NPIA 4QU2A 3GBGA 5FBZA 3VBFA 4PLMA 1FNYA 2FZ2A 1O3SA 4FCAA 1MS3A