4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
3I7DA 2ET7A 3BPZA 1RTVA 2PAMA 3TNPB 5D1IA 1O3QA 5J7MA 1ZZ7A 3I54A 1BSHA 3WW2A 2XLGA 2Q4SA 3LA3A 1CAWB 4META 4XF4A 4E2SA 5BY5A 1EYBA 4LLOA 3USSA 5KHHA 4MGZE 1VP6A 3LA2A 1RC6A 4MGYE 4EWEA 1X7NA 5FQ0A 4O9GA 2EA7A 3FWEA 4XF3A 3M3IA 5FDBA 5LRSA 3RNSA 1Y3TA 5FLHA 2Q1ZB 5JAXA 2F4PA 2K0GA 2UY8A 3H7JA 4LULA 1UD1A 4YRDA 5K8SA 3MYXA 5KHGA 3ES4A 3C3VA 2E5YA 1WA4A 4XEZA 2QJVA 1X8EA 3SCHA 1SFNA 4I09A 3SHRA 5J3UA 1HW5A 1OFNA 3SXWA 1UIKA 3TNQA 4F7ZA 2CAUA 3OTFA 1PM7A 4IEXA 3H1WA 4WZCA 2Q0AA 1ZRRA 2MPFA 2OA2A 2PYTA 1WLTA 4ONUA 4UBHA 1RGSA 2B8MA 3HQXA 3L2HA 4PIZA 1CAUA 4JV4A 2XLFA 4WBBA 3ACLA 4KU8A 4MX3A 3CLPA 3LA7A 2Z69A 5HI0A 4LUMA 4PIYA 5E16A 4WVZA 4PJYA 4IETA 4QX5A 1NZCA 1ZRDA 3OCPA 3ES1A 1ZZBA 3CEWA 4IERA 2BEOA 4QMAA 4KU7A 4QM9A 1Q3EA 2OPKA 5CADA 4LA3A 5I93A 3DV8A 5FLJA 4AQ6A 4FAGA 4Q0QA 3S0MA 3OF1A 4RD7A 3FJSA 4J1XA 1LKNA 1XE7A 1FI2A 2XLAA 4GULA 3DL3A 2QCSB 1VJ2A 4XFIA 3IWZA 2Z2SB 2PA7A 5KHIA 3LZZA 4I0BA 4IEPA 1QXRA 2VPVA 4OLLA 2H0VA 5I8SA 4LA2A 4IEWA 4EV0A 4KWLA 2HKXA 4FBFA 2GC2A 4MV2A 2EVXA 3JZVA 4L2NA 2H6BA 4R52A 4L11A 3NJZA 1QWRA 1ZRCA 1EPZA 2D40A 3E6DA 3KSCA 1GQHA 3CF6E 3NVCA 2WFPA 2GZWA 4HBNA 5BXXA 3LOIA 3QACA 3SCGA 3DN7A 5KHKA 4XFFA 5KBFA 3H3UA 2UY9A 2E5TA 3S7EA 3CO2A 3KGZA 1J3RA 3B02A 3EO6A 4HMZA 1SQ4A 2Y0OA 3ETQA 4YARA 3BU7A 3LAGA 3U11A 5FQ0B 3E5UA 5KHJA 4IEOA 1CAXA 4CYDA 3GYDA 4EROA 1X8MA 5C6CA 1YWKA 2B5HA 1Q5OA 4I0AA 4BHPA 2JDIH 4K8FA 3OGJA 4AQ2A 4DJGA 1RUNA 2N7GA 2BYVE 2XL9A 1YFWA 2PAEA 3EQEA 3S7IA 3BCWA 1CAWA 1YFXA 4MZUA 1LB2A 3MDPA 1ZREA 4Q0VA 3IDBB 2PFWA 4H7LA 4LEJA 1ZZ8A 5LRRA 3NL1A 2IXKA 5FLIA 2HJIA 3EFFK 4FAHA 2UYAA 2WSSH 3MPBA 5AVPA 4AVAA 4ZU5A 3PLQA 1O3SA 4IEQA 4XF0A 1NE6A 3E5XA 3FZ3A 4UBGA 3I59A 4FT8A 4IEUA 4MUVA 2O8QA 2D93A 3RDIA 4KWKA 3PVBB 2V09A 1CAUB 5JSOA 4XF1A 3OD0A 4I02A 4LTAA 3EJKA 1CAVA 4QGLA 1QXJA 3WW1A 2EAAA 5FCCA 3PJSK 5JR7B 1JUHA 1SEFA 3SCFA 4HN0A 4MGKE 4NVPA 3IIAA 1ZX5A 2O1QA 2PTMA 4F8AA 2GC1A 3IDCB 2E9QA 4JVAA 1CX4A 2QVSB 5C8WA 3CJXA 3WW3A 3PNAA 1UW8A 1YUDA 1WGPA 3UKTA 1J59A 3GBFA 5J48A 2GC3A 4X6RB 5I0UA 4B29A 4HVOA 2IXLA 3BB6A 2MNGA 3HT1A 4XFHA 2GU9A 5FPZA 4ZU4A 2IC1A 3NSTA 2ZCWA 1H1MA 4AVCA 1OMIA 1DZTA 4HVQA 1IPKA 2IXHA 2BNMA 3H1YA 5FPXA 1ZRFA 4BH9A 1BSNA 3H7YA 4N9HA 3NKTA 2CAVA 2PHDA 1LRHA 4JTNA 3HT2A 2C0ZA 2IXJA 2IXCA 1V70A 5T3NA 5I91A 1EY2A 3FE5A 4JTOA 1E79H 4EWDA 3E6BA 4YYOA 2CK3H 3H50A 1PMIA 4IEZA 1UIJA 1OD5A 2QNKA 2WC2A 4A2UA 3FX3A 3M70A 1J1LA 2Q30A 4I3PA 3ST7A 2ATFA 3EBRA 3O14A 1Q43A 2VECA 3E97A 4BYYA 1H1IA 4IEYA 2BGCA 3ROUA 2ZKLA 1FT9A 2CGPA 4E2GA 1Y9QA 3UKVA 1ZNPA 4HVRA 2KXLA 3CL1A 5CU1A 1UCXA 1ZZCA 4N9IA 1QY4A 3IBMA 1JEKA 2XL7A 4IESA 2ET1A 1O4TA 3HIFA 4Q29A 1XE8A 1OI6A 1YFYA 2QE7H 2VQAA 1RUOA 4MGIE 3RYPA 5I0SA 4TLFA 4Z82A 1DGWA 4I01A 4E2QA 3H9AA 4O9EA 3KGLA 1NE4A 3G7DA 1G6NA 3FHIB 1CGPA 2GC0A 1ZVFA 4HLTA 1LR5A 2XKPA 2P17A 1YLLA 1IPJA 4XFGA 2MHFA 2PQQA 4P9GA 3I59B 2I45A 4J1WA 2BNOA 4MH0E 1O5LA 2OYZA 4Q0SA 3E5QA 5BPXA 1L3JA 3H3ZA 3RYKA 5CVRA 1YFUA 4HZFA 2D5FA 4KL1A 2UYBA 2XGXA 3MZHA 5BV6A 4QGMA 1CAVB 1RL3A 1TQ5A 3ZDSA 4D7SA 1J3QA 2H6CA 3RYRA 3BALA 3FFQA 5JSRA 4AVBA 5LEKA 3KMHA 1NYWA 4AXOA 2DCTA 3WW4A 1YHFA 1EP0A 2FQPA 5I0TA 5BUVA 2BNNA 2IXIA 3U10A 1FS0E 4XFCA 5EFUA 3KCCA 1X82A 4HSLA 4Q0UA 4UXAA 3VHRA 2PHLA 4XFAA 2PAKA 4PIXA 5E1RA 4DINB 1J3PA 1J58A 1IFPA 3D0JA 4X6QB 1I6XA 2GH2A 5F1RA 4QM8A 1O7FA 4EWAA 4QXKA 1AQTA 3D82A 2XKOA 4Q0PA 2ETEA 3E6CC 4KWJA 4R8HA 1NXMA 3LWCA 4D7TA 3DKWA 3RPQA 1FXZA 3UKNA 3N4MA 2OZ6A 2GAUA 4BIFA 4XFBA 1GQGA 3ELNA 4ZU7A 4Z07A 2D5HA 5I8TA 1I5ZA 4YXWH 1VR3A 2K9ZA 2CV6A 3H1MA 5I0RA 4HN1A 2V7QH 5EZWA 1O5UA 2FMYA 1O3RA 1DZRA 5I8YA 3H8UA 1UPIA 1XRUA 4HSJA 3EHKA 3NW4A 3R6SA 4QGNA 2QDRA 1U12A 3QOPA 3U0ZA 4XF9A 1O3TA 1ZZ6A 4YNIA 4I2OA 4IEVA 4ORFA 4LUKA 2XNDH 4YSFA 5JCTA 2W6JH 1ZZ9A 1CAXB 2B9UA 3D0SA 4OFGA 3RZZA 5LEJA 5JSPA 1DGRA 4XETA 2OZJA 3SMHA 2XHKA
chains in the Genus database with same CATH superfamily
1L7RA 1VBC3 1ULFA 1O3QA 1DQ5A 4N3YB 5DAWA 4H3WA 5AVSB 5KHHA 4EWEA 1R082 3B01A 2EXIA 4O9GA 3BI3A 2XQRA 2LALA 4YW4A 4DUWA 2UWAA 2A5ZA 5C3OA 1NTZJ 4XEZA 1LOCA 2OYOA 2CYFA 4DRRA 4UF0B 4KBZA 3CU7A 3L35A 2GSYA 2OGUA 4CP1A 2GMEA 1PZ8A 1IS6A 4IE7A 1XNBA 5KXCA 4IOIH 1LGNA 1WLTA 1NTMK 3UJQA 2Q3IA 3HQXA 3L2HA 2XLFA 2H43A 3ACLA 5APSA 2Z69A 4LUMA 5E89A 1UMIA 4LR4A 2W87A 1WWYA 5C9AB 3AE6C 4CDXC 5FPUA 1JXNA 2VXRA 1XC6A 4ASWA 3RVHA 5KAFE 3PUIA 3I3BA 5A6XA 3ZDMA 1KD1Q 4FAGA 1W0PA 5M1BA 1E5RA 1E57A 1FI2A 1ULPA 1V00A 4RL7A 3GW6A 1LU2A 1LGCA 4N78E 4ZPIA 2IFWA 4D6QA 2GC2A 3TWIA 1F15A 2XVLA 3MI8A 3M3QA 1SQVD 2YPDA 3NKGA 1APNA 4BIOA 3NFQA 1V9U1 4FPGA 1YHQP 1HUCA 1YCIA 3G71P 3ITQA 1VQ4P 1NKZB 1WRGA 2FCUA 3POEA 1NTKG 3JXSA 5IAXA 4P9YA 1A6CA 4CZSA 2FCTA 4R9AA 1Y9MA 3MFCA 5KHJA 3THDA 4M3LA 1X8MA 4G3YC 3CJIC 4PV1C 2JDIH 3NV2A 3T0BA 3CWBE 3N7KA 1FPN3 5JOYA 1NH4A 1KB9H 2H0BA 2XMLA 1FATA 1DP0A 1YIPA 5EYYA 1LOEA 1K42A 3GMAA 1N7SC 2Y0DA 1POQA 4CXXA 3IIIA 4KI5M 4JAAA 3VKFC 4LHNA 4WM8A 3E5XA 4NOTA 1VF5D 4FT8A 2FYZA 3HD7D 3UL2A 4LTAA 2MEV3 1W3XA 3PJSK 1JUHA 2RV9A 1SQXE 2FDFA 1ZX5A 3AE9C 1HRV1 1PVXA 5C8CC 2W91A 3JBG1 1GOHA 3WW3A 3FUOA 4LNVA 3GBFA 5J48A 5FJHA 4CDQA 2P37A 1HV1A 5L7OA 4PLOA 3JB8A 1KMIZ 1JU4A 1JOBA 4OQ9A 1REDA 3D71A 2E51A 2ZACA 1A02F 1SFPA 2FKWB 1KTMA 2VZQA 3VBSC 2IXJA 5BYNA 1JS9A 2YU2A 1OX3A 2VBBA 1N1SA 2A6WA 3JSVC 3HQUA 4YYOA 2W6BA 2CK3H 4UI9L 4A6SA 2YV8A 1X22A 2ATFA 3EBRA 3H1IE 4ES8A 3H1LG 1TE1B 4CPBD 1FC2C 4QQLA 2Q5UA 1PNGA 4BJ0A 1GSLA 3B5NC 5JZGA 2W6AA 3I3MA 2HWC2 1AR63 3K5BA 2KIKA 1MS5A 3AFGA 2XJRA 3UGFA 4QKDA 2ET1A 4NPLA 3AJYA 2VUJA 5C33A 2QM7A 5FZ9A 2AUYA 1Y43B 3IR9A 3KV6A 3LF7A 4B4QA 3A2AA 1YIFA 4AHYA 1JYIA 4Y5SA 1QHDA 5D21A 2GC0A 5FP3A 2RDSA 4QPIB 4ARYA 1SLTA 5K9YA 4XZUG 2CPBA 4ISQA 3VL9A 3L71G 1S5LH 3NAPC 5KKZB 2D6OX 5CCGC 1RL3A 1W8FA 2JB4A 1QJX2 2AEZA 1J3QA 4Y99B 5CNAA 3WV6A 1DBNA 1YXWA 2ZYGA 2LXCB 5I0TA 5CA6A 1G9CA 2J22A 2FFDC 4WVWA 2OQQA 3U10A 4WM7A 2PHLA 4PIXA 2AEYA 3O0VA 2YXQB 4DINB 1J1DB 1DEBA 5KLVJ 4H0LD 1AVBA 1H0BA 1PIV2 4CCDA 3LWCA 3JUUA 5T5JA 2Q9IA 2WA4A 3TNUA 2CU5A 3D70A 4ZY9A 2OZ6A 2VNOA 3UGGA 2E75C 2D5HA 2VQTA 3LGRA 3FBMA 4CUAA 3ZPOA 2E76D 4M4RA 5G05L 5EZWA 1LESA 1DQ1A 1MEC2 1KB9D 4AQTA 1BCCD 2A6VA 2ZGMA 2WAAA 3DPRC 2G9ZA 4ORFA 1DGLA 2W6JH 1R8EA 3FLPA 4OFGA 1AR71 2FCVA 3O1TA 1MS8A 1H6YA 1URQC 2ET7A 2BTVC 1NU1G 2OYIB 2ARCA 4IE0A 1G1JA 1RC6A 2BCCE 3IMMA 1I3HA 2HWD3 5FQ0A 2MKVA 1EUTA 3B9IA 3GBWA 3M3IA 2HWE2 4CEWC 4Q1PA 2C0WA 1ZBE2 2F4PA 4WM8B 4HKOA 4RYDA 3T3YA 3VBOC 2QQNA 3BN6A 1WKYA 1REFA 1N1YA 2FYUE 1MZ6A 3O1VA 3IN6A 3BTZA 4Y1UA 4IL6E 3T08A 1PM7A 3A7QA 5GZCA 3ZIWA 3ZMNA 1RGSA 4CDQB 1WLWA 5LB6A 4LBQD 4WBBA 4XBLA 3O1RA 1V6KA 3G4SP 3WHTA 2WWSA 5CCHD 4DXZA 1MKMA 2RR13 5DUXA 1COV1 2GN7A 5FUIA 5FYUA 4IERA 1GP4A 4KU7A 4BPZA 1NCRA 1QJU2 3DV8A 1DIWA 3I3DA 3MV01 1C4RA 4BM8A 1LKNA 3P6BA 3A0BE 1LULA 1KFNA 1AL21 4IEPA 2WWJA 3V6IA 4EE2A 1VBA1 2Q6QA 2YXSA 1JMUB 4FBFA 3R05A 2VVEA 2R041 1Z0HA 5JZGB 4BE3A 5IVJA 4OYUA 4JF7A 2D2CC 3VHNA 1SVFA 4E8DA 4CPGA 1WW4A 2NMOA 1BKZA 2HLOA 1RINA 1VQ9P 1DGWX 3QCWA 3EO6A 4JGZC 4CSWA 5JOXA 1LTSC 1RUG1 1JB0J 1PO21 1UX6A 4MOAA 4GWNA 1UYYA 3TF5A 3RL0D 3H1JG 4H44C 1YFWA 3PUAA 2XVGA 1BEV3 2WO3A 3BVCA 3KD4A 4C1WA 1KFXL 2HEVF 1LOBA 3WSOA 1BMV2 5E79H 2IXKA 2HJIA 1VBB1 4RQPC 4KGQA 3RI8A 1EDJA 4RS5C 1JN2P 1TG7A 3L74G 2LM3A 3L73D 3Q2YA 5HCBA 3A22A 1QXJA 4WZFA 3KV9A 1CZSA 3SCFA 2JEEA 5CJ0A 4BA6A 2Z5HA 4JVAA 4CUGA 4ZZ5A 4Y5Z0 2QQLA 3CJXA 2CGOA 4FI9A 4C90A 3LE0A 2ZT9D 4B4PA 1GK6A 2JG8B 1OMIA 4IFFA 2CDPA 1ND2B 1RF1B 2UWBA 5F2SA 1NQJA 4E9KA 3HE5B 4DXTA 1LRHA 1LEMA 3HT2A 4BU2A 3NTNA 2KZIA 3FHQA 5FXXA 4EWDA 1VE0A 3G3ZA 4LO8A 2F17A 2FDKA 2R072 2Q30A 2Y8KA 2BUKA 1GOGA 2YC2A 3TYJA 2OYHC 1SQQD 4YVWA 1Y8AA 3HUSA 4LHKA 1JYNA 2OVUA 1VQNP 1F31A 1RJ7A 1KITA 2WABA 5BNPA 5T5LA 5EPAA 1EV13 2W5FA 5LY2A 1H4HA 1RUE3 1UOBA 1YFYA 2GDFA 5KJ7A 1GL2B 3AEEC 1RUC3 5IYYA 3VHPA 4JDOA 4JZRA 3G7DA 3T2TA 4MGSA 4RR3C 3GBGA 3AXDA 2I45A 1D2SA 2WZ8A 3E5QA 5BPXA 3ILNA 4I1LA 2WZR3 5HCAA 2XGXA 3MZHA 3LOBA 5CKMA 3POGA 5HXVA 4QAWA 3CMGA 1KRIA 1LJ2A 1G7YA 4AVBA 1ENSA 3PRJA 2LS6A 1XNDA 3BYWA 1Q90D 2QQWA 4XURA 2ZMNA 2PHFA 1PNFA 1NCRB 1HJGA 4UW6A 3AE1C 3SFDC 3CC7P 3U78A 5AVWB 1FBMA 3J4UH 1CZTA 3E6CC 1M56D 2X10A 5JPMB 3O1MA 3D5OA 3WNOA 1W6MA 4OI1A 2EXKA 1AJOA 2A6ZA 4YXWH 5L73A 4GQ7A 1GWMA 2HWC3 1SQVG 2V4AA 5I8YA 2WSFJ 3ZYJB 2V5DA 1DEEG 4O9BA 4NPEA 2Z5WA 1HWTC 4AVTA 2FZ1A 5T50A 2XVKA 5LY1A 1W6PB 4BXFA 2VOKA 5C9AC 3ACIA 4IV3C 2ZMLA 4GKGA 2P3YA 2VMEA 3ZPYA 1EYBA 3LA2A 1I9RA 4UFHA 2VW1A 4XZPA 4IV1A 3VDDA 4XCBA 1OQDA 1NT0A 2WPRA 4UB6E 2QBXA 2K0GA 5FIXA 4LULA 4ET7A 3HPNA 1S2EA 3AKQA 4I09A 4R9DA 4A44A 2B45X 3JCUH 2IZ0A 3OA7A 1STMA 2M0BA 5LZ6A 1GZTA 1PK6A 1RE4A 1W39A 1UU6A 2JR8A 5IK4A 5AW6B 4IW3A 5CB7A 2KXPB 1FOSF 1G1IA 2W90A 4DQAA 3EMRA 2OPKA 3AYAA 4LK6A 3ZFFC 1GK4A 2PRRA 3O6QA 3IDAA 4RD7A 1BGYJ 4XE5B 4ZHNA 2R49A 2W1SA 5G04L 1SQXK 1VLNA 1W2UA 1LNQA 1YRZA 2WAOA 1P84H 3H1HD 3WLUA 2EVXA 1M1KQ 1ONAA 3OSDA 4GB32 2PHUA 1Y4WA 5FXZA 3ZMOA 1LHUA 3AXEA 1OVRA 4MGQA 4M4PA 3GDBA 3BKZA 4ASKA 3DN7A 4JQ0D 2DWRA 1Q82Q 1T6AA 1W90A 2AENA 4AR2A 3ACFA 5B4XA 4RO0A 3ZSLA 1OA4A 3RZJA 3M4FA 4P5YA 4R4MA 1ODMA 2KYVA 1BE3E 1IKQA 1HRI2 2HWF2 2ZAAA 2Q7CA 5L8RJ 4MZUA 4XCAA 4KG8A 4R9CA 1VDFA 4LGDE 3PTYA 2JICA 3ZIXA 4LKDA 4AI9A 2A06E 4AI0A 5FY5A 4ZU5A 3AM2A 2GMPA 4K35A 3L9JT 4FCAA 5ISLA 3HD7A 4UW4A 4LXLA 1FZCB 1DG6A 3FWLA 2O1QA 4N43B 4XQWA 5C5TA 2VNGA 2GC1A 4HJGH 1OPMA 3IDCB 1WW6A 5FPVA 4Z1MH 2YROA 1RY3A 3PNAA 5AW0B 1GU3A 1W6MB 3WCSA 4XE9A 2VMHA 1MZ5A 4MHRA 1NWQA 1IS4A 4HVOA 3KHUA 4P9JA 4XFHA 4XJ9A 4QPIC 3BASA 2WJSA 5IHRA 1HQLA 1LT9B 4B7KA 1MS9A 4AHZA 1RHI2 5KLIB 1HB1A 3WG4A 4PCRA 1OF4A 2NPSB 5EFWB 2XXZA 4JTNA 4AYUA 4NWVA 3C2UA 1BCCG 3VBFB 4Y99C 3AYCA 1J1EB 1TU3F 5FOJB 3URFA 1FE6A 3CXHD 1YQ4C 2R3CA 1RQUA 4CPBA 5JXJA 4URAA 1C28A 2W39A 4LO7A 1SS1A 1IQAA 1ULGA 1J1DC 3ME2A 4QQPA 3C1LA 2A45G 3L72D 2PHWA 3CI9A 2AACA 1D0HA 3I2JA 2PLV2 1VBE1 1UPSA 3O8ZA 1REEA 2QFEA 2V4HA 1L0LE 3WXPA 2ZZJA 1AF9A 2WTYA 3ABZA 3ZN6B 1QX8A 3FHIB 3TGUJ 2XKPA 4L76A 1IPJA 2PQQA 2BNOA 3DYOA 4P5HA 5CVRA 3F5HA 4LKFA 2XB6C 2Y0EA 1KD7A 3PMEA 2ZHLA 1R64A 5FAXA 2OYIC 2XG3A 3ACGA 1YHFA 4Y20A 2J1AA 1P84D 5FO8B 5GTHH 3U4XA 3TN92 2VGDA 1LTEA 3RG0A 2VRSA 1J3PA 3O6QB 4SLIA 2FYUK 4DPNA 2WNEA 2B87A 1O7FA 2NQYA 4WM8C 2BBVA 4Q0PA 1JNMA 2RS51 1QQP1 3GZUC 2P1BA 1W2AX 5I8TA 3UT0A 3SC7X 3FWNA 1BE3J 1Z7S3 3ZXGA 2BRTA 2ZJSE 4OHVA 1FAYA 3H8UA 4A3ZA 4MVTA 3NW4A 2VOVA 1U12A 2YG0A 2HEYF 1N1TA 5IJRA 3OJAB 1GU5A 3FL7A 4D6TD 1QJFA 4U7JA 1DGRA 5BNOC 2PAMA 2XV5A 4XA4A 4HPKA 2VZSA 2Y6GA 2WFF1 1TMF1 3RK3D 1QKQA 1KQSO 4MLOA 1CWPA 4XF3A 3GHGB 2QTWB 2CPSA 1GP5A 1FYUA 3VKNA 3BTXA 1V9U2 3DYPA 5K8SA 3HD7B 1MQTA 5DQ0A 5APYA 1FZFA 3VBUA 5FUPA 3TYYA 5TISH 4ASVA 1ACCA 4GH4B 3L73G 3KV5A 4GALA 4F7ZA 2WSUA 1GICA 1NTMD 3KT7A 1I1EA 2A1XA 4JYBA 1AR91 2AC1A 5APXA 1C8M1 4LBQA 4MX3A 4OMCA 1NYHA 4AFDA 2JDMA 1W9FA 2C0XA 2BPA2 5CCHA 1FDIA 4XFJA 2ITAA 1NZCA 4MXVA 3V56A 3RK2D 1QU0A 3HVDA 3IAPA 4N8MA 5I93A 2Y26A 3N7JA 1XE7A 1NVOA 3TEWA 5DUVA 4YG0A 5H9QA 1V6NA 3J9SA 1J84A 3CCRP 1KQGB 4Q2FA 2ZPXA 5FYZA 1FZGA 1HRV2 2H6BA 2XJSA 4L11A 1SQQG 3VZOA 1DDLA 3RQ0A 5LBEA 1RUD1 4R4LA 1URXA 3V0BA 1NKGA 4U3FJ 2JEMA 4JC1A 1K5MB 2JG8C 1ZBA1 4YG3A 3AP6A 1HXS3 2Y0OA 1CVNA 3II6A 4CP9A 4IEOA 1ND2C 1RF1C 4BRYA 4LBKA 3MTUE 4A4AA 2BWCA 3WDWA 1E5IA 1NCQA 4UT5A 1ZREA 3KHCA 1GU4A 4UW5A 2ZGRA 4MYEA 5H2FH 1UY2A 5M0TA 5APQA 2JJ6A 2XR4A 2PN5A 1PIXA 2PXJA 1A3KA 3KCYA 4IEQA 3OBTA 1LWUB 2QJYB 1GFF2 1NLQA 4YZ4A 2VZ1A 1HGVA 3MGUA 4COWA 4PHZA 4S2FA 3OPZA 1L0NK 3MF6A 5JR7B 1SEFA 3ZFEA 4H0LB 2RHPA 4Q4Y1 1CX4A 3Q9OA 1VAKA 1GL2C 1VRBA 2OPWA 4F3JA 1J59A 3N35A 4YGDA 1GLHA 5DMYA 3CKHA 2JWAA 4YW2A 2WPQA 3NSTA 3GZEA 2VAUA 1EDLA 4UW3A 3VHOA 4HVQA 4AEJA 2I1KA 1QJEA 1ZRTE 4JKKA 2NRGA 2XJTA 2JE7A 3M2MA 5ANQA 3L75E 3S5QA 4JTOA 4PD4H 2QEXP 3DUIA 3E6BA 2R30A 1VQKP 3RZMA 3FLTA 4OHZA 3SEEA 3W58A 1OD5A 1M7LA 4I3PA 1HRI3 4PI0A 2G19A 2K46A 1NCRC 2RMZA 4BYYA 1PX4A 3B7MA 1Y9QA 1ND3A 1IPSA 3QD6A 4YGCA 5H9SA 1GV9A 1SBDA 4JDMA 4RA0A 4K6BA 1UF2C 3M91A 5FPBA 1GYKA 4Q29A 5J37A 1RUF3 3VBUB 1OBNA 4GA9A 1VIWB 1NE4A 1OW8A 4Q5OA 1FDMA 4HLTA 4A6OA 1GW3A 2E32A 1AR72 1L4AA 2OARA 2OYZA 1PGSA 2ZGUA 2KOGA 1RUJ1 5FY9A 3ETPA 3WQ0A 3GALA 3WP6A 4AHWA 3U75A 4M00A 5DUWA 4NROA 5BNQA 4YW7A 4A7PA 1NTKJ 3FFQA 1OQEA 3WG2A 1PGOA 1EP0A 1OA3A 2YDEA 1F35A 3SWKA 4H13D 3VHRA 2NN8A 3VDAA 1H8VA 3TB0A 1K12A 3CBNA 4QX7A 3IPVA 1NGMB 1SQBE 4R9BA 4YZ2A 4G4FA 3A3YB 2GAUA 1VMJA 3H1HG 1QDCA 1US3A 2V7QH 5A3WA 1KILB 2JDHA 1NU1E 1DZRA 2VM9A 4HSJA 1ASJ1 2EIGA 3EHKA 4LIUA 2DTWA 1GOFA 3HNYM 5JIUA 3HQRA 4UB8E 4CVUA 2BW8A 1CQ9A 4TWTA 5BNNA 1O3TA 1MS0A 4IEVA 1COV2 1O59A 2BGPA 4D7YA 1SDWA 1IS3A 4XETA 1SQPE 2KK7A 3P8MC 2WRAA 4AFBA 3KM5A 3B69A 1BVP1 3I54A 1NCQB 1OQ1A 3LA3A 1OURA 4E2SA 1W03A 1AL22 1H6XA 1VBA2 3S4RA 2R042 3ZX7A 3Q5RA 3FXDA 2Q1ZB 3C8XA 4COVA 2JO1A 4YRDA 4G9SB 1QH6A 1DH3A 1PVC1 1DCSA 1L7LA 1H8AA 3H1LJ 1I5PA 2VUDA 3N9QA 3LPFA 4LBMA 2VUAA 1RUG2 5J98B 2CAUA 3H8OA 1PO22 3C9IA 1W8TA 2JKXA 2KR2A 3MEPA 4QPYA 3RBZA 5A6YA 1IK9A 5DUUA 2WNVC 5GLVA 3IF4A 4PD4D 3SWYA 2UU8A 2VVDA 2XDJA 1JYWA 3PHMA 4WBAA 3VTPC 4CCOA 3TOJA 4XBQA 2TBVA 3A4UA 2YMYA 4Q27A 2OTKE 1W8HA 1ZZBA 2BEOA 1WCQA 4TT3H 4AQ6A 1W5CE 3Q8CA 3RI9A 1OUSA 3USUA 3S0MA 3OF1A 3T4HB 2G4IA 2XLAA 3L71J 1SACA 5D8AA 4BLIA 1XU2A 2B4KA 2PA7A 4I0BA 3WU2E 4Q1RA 1RUI3 4FOYA 3ZXEA 5F3GA 1YJWP 1FZCC 1ND3B 1QWRA 2EICA 1H9WA 4N43C 2Q8EA 2E74B 5CG9A 3LOIA 2V5YA 3M3EA 1AZDA 1PO11 3L72G 1OXCA 1JTZX 2YGMA 1ZR2A 5A7WB 1CR7A 1U5XA 2QRXA 1AXYA 1XYOA 5AC91 5FZEA 2ES3A 1LT9C 1CAXA 5KLIC 1YWKA 4Z92B 2NPSC 1EAH2 4AI2A 5FXWA 1L4AB 2E7QA 3VBFC 4I30A 2GNTA 1IJDB 1PV3A 1J1EC 4QPWA 2W46A 3NO8A 4NR1A 4V2WA 4YM0A 4Z8BA 1O3SA 3T0DA 1OW7A 2JB8A 4IEUA 4MUVA 3VD7A 1LJ7A 1NU1J 1L0LK 2CDOA 3NRUA 3MW3A 1TNFA 5CISA 2BGOA 2XZRA 4EN7B 1UKGA 3MUDA 4Q4V3 4AZZA 2UWJE 3ZN5A 3WDVA 2P10A 3OGGA 3JBG3 5AW2B 3HT1A 2C9LY 4XUOA 2ZCWA 2LKMA 1NAEA 2IXHA 1BVVA 2H7HA 5FPLA 3Q3DA 4GWJA 5GJ6A 5KAIE 4JCKA 5BNNB 2YFZA 4LO6B 2GNMA 4KT0J 3AEDC 5ACA1 2VCAA 4CCJA 2WN3A 3HTKA 3ZXDA 4D6TG 5FUNA 3WP5A 2ZHKA 2A3WA 4GWIA 3H42B 1JYVA 1CZQA 2VW2A 2NLRA 1LGHB 5FOBB 2KSEA 3AKTA 3U1CA 2OQ7A 4B1MA 3G9RA 4CCLA 4Q4W1 5IFPA 5AVAA 1R1A2 2YC4A 2CTVA 3POIA 3RYPA 5EWSA 4Z82A 3A21A 3KGLA 2JWDA 2E7TA 4AI1A 3OY8A 2O01J 2MHFA 4Q26A 4RHV1 3PLNA 2E63A 3AYDA 1YFUA 1M1JA 1NTMG 5DDJ2 1KYOI 2WNOA 1RH5B 1TQ5A 2WPVB 4IDZA 3RYRA 4CCKA 4M0NA 1FZBA 1LOAA 3BUCA 5EJ3A 3WOGA 4QX3A 1LGBA 3GHGC 3H1JJ 2EAKA 2R3SA 3USUB 1S4CA 3AE8C 4NO4A 1MEC1 4R4XA 1AQTA 3J8F2 3VN4A 4N90A 2N1TB 3A0NA 3BVHA 4XJZA 1JW6A 1NXMA 3HD7C 1SFCA 3BOPA 1XU1A 1NAFA 4D7TA 3GNEA 1KJRA 3IN9A 3RPQA 1E5SA 3HE4B 3GF3A 3V5BA 5F3CA 3J7LA 3JQXA 4GH4C 1UZWA 4YWAA 3B9CA 2LR2A 4HN1A 1VBD1 3L74J 1C1FA 5C4WB 3R4SA 2D98A 4IGPA 4KJMA 4BQWA 1TZOA 1DQ2A 2VCMA 1H88A 2HWE1 1CAXB 1HKDA 4NIHA 3ENRA 4HG6B 1DQ4A 3VZJA 4Y1YA 1PMHX 4N78D 1VAMA 1YQ6A 1AR73 1RE3A 5JDBA 2X53S 2YGLA 2B9BA 3KVBA 3LCPA 1OWAA 4Y1VA 3FWEA 1QXPA 2L9LA 3PIGA 5FYSA 5F37A 5LRSA 2VBPA 5FMDA 2RH0A 2ZABA 4OUSA 2XKMA 1HJBA 2AXCA 5HXMA 3AE7C 3ZYIB 3LSDA 1AR82 4RFT0 1GP6A 1KYOE 4B4RA 3WP3A 4PDWA 1X36A 1H8TA 5A80A 4YW3A 4XDOA 3RZGA 3CWBD 1K5MC 2YYOA 5T5PA 2Q0AA 3AP4A 3C7OA 4XC9A 5GKAC 1POV3 5J96B 4QKFA 3AZVA 4X8PA 4KU8A 3WQ1A 4CXWA 5FR3A 3WDTA 2PGDA 2BEQD 3FX0A 1JY2N 4QQHA 4CDWA 3KQ4B 3O7OA 1GZWA 3FXEA 4WVZA 2W95A 4FFFA 4YVSB 4SBVA 2LUWA 3ES1A 5A33B 4TYSA 4ARXA 3AFKA 5CG8A 4FPFA 4DEVA 4FPKA 1QOOA 4JDNA 1NOHA 1SQXD 1LWUC 2QJYC 1GZCA 5H9PA 3MGNA 2VNVA 5FZ8A 4J6GA 5AVVB 2DF7A 4PV1D 4LA2A 2ZJCA 4KWLA 5FY1A 3LD8A 4QX1A 3LIGA 2BZDA 4R4ZA 5KR7A 1EZVI 3TK1A 4ZNCA 1FNZA 1GQHA 3SCGA 3WINE 3WNPA 3RL0g 1PP9E 3S7EA 1N7SD 4JPZB 2YBSA 2A75A 2KLUA 2J1RA 1ZOYC 2ZGKA 5A7SA 3OY8B 3VGIA 1PO23 3H1ID 4K8FA 3SKVA 4XUNA 2XL9A 1SQVJ 4C1XA 1M06G 4QQOA 4LT5A 2AH2A 2DUOA 2NZ9A 3A0BH 4NJ4A 2BWAA 1DGRN 1VBB3 2VW0A 4XXAA 4HFSA 1PGQA 5EV7A 2HEWF 5AVZB 1SHWB 1UZVA 1JOJA 1QF3A 4HN0A 4NVPA 1SFCB 2E43A 3VOPA 2EXHA 1KFMA 2DUQA 5CFCA 1AUYA 3PURA 5ABJA 1FV3A 2G8YA 3M8LA 3W68A 2IYPA 2J42A 3B5ND 1NKNA 3Q8FA 4LMFA 2CY6A 1N86A 3FE5A 2FXMA 4XACA 2P67A 1U5IA 2LXBA 1XE0A 3W59A 1AQ5A 2M3BA 1PMIA 1EZVE 1LAJA 5AW9B 3ILRA 4EYUA 1S5LX 1YJNP 5FYIA 4WY4A 4QKNA 3QH9A 4K40A 1Q43A 2A71A 4FP2A 4DB5A 1SQBK 3BPSA 4E2GA 4FQ4A 1RQVA 1PFIA 2Q8CA 3ZKYA 2RS52 1QQP2 2ZBJA 1FPN1 3ZYFA 5K4LA 3H3LA 1XPWA 1F8VA 3AKSA 1DHKB 2WWWA 1OSGA 1W2EA 1KILC 2XH6A 2E7AA 5T54A 1DGWA 4E2QA 4PDWB 1S0EA 2LTNA 1OW6A 1H8TB 5KC5A 1G6NA 4Y22B 1V6IA 1OVSA 4XBNA 4LOTA 2ILMA 4CRQA 4TSVA 4DUVA 1SQPK 4YLZA 5IFTA 3E1RA 2MEV1 3P8CE 4XJWA 2BCCD 3PP5A 1CAVB 2WSCH 3KQGA 2WFF2 4ATFA 1XB9A 2E75D 4CDWB 1GZWB 2W47A 1OF3A 1TMF2 1W0NA 1NY72 2OQ6A 2DCTA 3MF9A 3O1UA 3V0AA 2FYUD 2J58A 3M9HA 1X82A 2WSEH 1PP9J 2Y64A 5A3LA 1KILE 3F89A 2RS12 2WWUA 3V2QA 1J1TA 1URQD 3HNBM 2VMGA 2TEPA 4GDOA 4CXYA 1KGYA 2K9ZA 2RN0A 1UO9A 2CV6A 1AL0G 4LC1A 1AR92 4NPRA 4ZONA 2BFUS 1C8M2 2FMYA 4ZXEA 1A02J 3N9MA 2BU9A 4QGNA 1LECA 3VKLA 4XF9A 4I2OA 1AR61 3OAKA 1PL5A 3VZMA 2D6PA 2OZJA 4PIYA 1C5HA 4Q4X2 1BSHA 3ACHA 3KF5A 3Q1MA 4XIOA 4DRVA 4I0WB 3NQHA 4QB2A 1JY3N 4MGZE 5DJTB 1C1LA 4FPEA 5GM0A 2XJUA 2GM4A 4QHBA 4A7ZA 2WO7A 3AZYA 1CJPA 4Z2WA 3T2OA 1BCCJ 1R092 2DCJA 4JHTA 4GJZA 4NIGA 1MV8A 1ND3C 5FXVA 3MYXA 1RUD2 4RKUJ 3MIHA 2E74C 3WNMA 4D6SA 2OW4A 3U1AA 2IZ1A 3FLRA 5LBCA 5J3UA 1CZVA 3BRTB 4BXLA 1PGW2 3J7HA 5A3TA 4BWNA 2GMMA 3VBRA 2J1VA 5CFCB 3AE5C 4JHZA 4NRQA 4S2HA 4PIZA 4JV4A 5A3OA 3A23A 3LA7A 1L4AC 2ZGQA 3D3AA 4PJYA 1D2QA 2D2CD 5AW4B 2FDGA 1W6NB 1SQQE 4YTPC 5LCWL 1NA1A 1QNWA 2P1JA 3WDYA 2P5BA 4L0PA 3UGHA 1YO8A 1NTZE 3U37A 2C24A 2R063 4MSVA 3ZN4A 4XFIA 4WY4B 2Z2SB 1POV0 4UB6H 3LZZA 4QU2A 1M57D 4GIQA 4EV0A 1YI7A 4Q4Y2 4LHLA 4H44D 4R52A 4JYCA 1EPZA 5BVZA 2ZAHA 3PVOA 2XPJA 2GZWA 3G6JB 3ABVC 5FBJA 3OEBA 3O1OA 1FU1A 2ZAEB 1LTJB 3KGZA 2B89A 1J3RA 4PBPA 1BBT3 5LATA 1SQ4A 3LIDA 1N73A 4BXSV 2Y0CA 5LW9A 4IGQA 3E5UA 5DPNA 5AVUB 4I2LC 3WDXA 2F4LA 4E4ZA 5BNNC 1HN1A 4Y24A 2X5IB 4CEYA 4QT6A 1W9TA 5IWFA 2WVRA 3SH3A 3T2QA 1OLQA 2IWGB 2UYAA 2WSSH 2V73A 3B00A 2HODA 1O4ZA 3I59A 1S3JA 4JKLA 2D93A 3V0AB 3AX4A 1L0ND 2ZZQA 2HBTA 1JTHA 5A7PA 1RVF3 1UIXA 1GTWA 5A7QA 1RHI1 2N9YB 4HOOA 2QVAA 4F8AA 2VZVA 1MS3A 3PL0A 3VDCA 3UKTA 4P9WA 4GKYA 3I2OA 5JWPA 5JPNB 4AFCA 3VD9A 2IC1A 2ZEXA 1RUJ2 5E79E 2ZHNA 3P3NA 2CHHA 1ZRFA 5FP4A 3BATA 3L73J 2OTJP 1V70A 5J36A 3OD4A 5FP8A 3RJRA 2Q8OA 1EXIA 3MFAA 4YFWA 5FPAA 1FT9A 5ERLA 4MXWA 2N1TC 2Y9ZA 1O6UA 3KF3A 2KSJA 5FYMA 4MGTA 2VJXA 4N9IA 3S6PA 2DCKA 1RYYA 4GAZA 1EXJA 1BEV1 3WD5A 1VBE3 1BDCA 1ASJ2 5AW3B 1ZYBA 3I2DA 4TLFA 5C4WC 4IGOA 1QEXA 3TN91 4XUTA 3CZJA 3SFEC 3VBHA 5C5UA 1SQQJ 2FDJA 2WT7A 1WA6X 3VBRB 3M0DA 5FJKA 3CWBG 4JGYA 1M8OB 3ZO0B 4E4HA 5BV6A 1NLSA 2HBUA 3AZXA 5CJ4A 5IT6A 2P4EA 2PHTA 1X9VA 5KWRA 2IXIA 1DF0A 1ZA4A 3H1HE 4ZMDA 1NA1B 5E1RA 4COZA 1W06A 1PVC2 3ATGA 2WZ7A 3RWKX 3OUHA 1KDKA 5HCFA 4PF5A 1SQXG 2WYFA 3GXUA 2J1EA 1K05A 1YYNA 4JBZA 1FJPA 4UFJA 1HH0A 2BFUL 5IVBA 2ZKNA 2A70A 1CW5A 2ZEYA 3NXSA 5APVA 4XABA 2WZPP 1N73B 1DZQA 2YKOA 1IKPA 4YVSC 4FXGB 1XNTA 1OUXA 4UOJA 1RUE1 1GMJA 5APTA 3I7DA 2QG4A 2RVAA 3ZSMA 5KLVE 4LKEA 4Q8LA 3WW2A 4LJHA 3H1IG 1FOSE 3NWKA 1W2TA 5K0UA 5B5EE 5APWA 5HV4A 1VQ6P 4D6RA 3HN3A 2WR9A 4S2DA 2HODB 2WZR1 2XBO1 1N47A 4IFMA 1PO12 3A5TA 1JTHB 1WA4A 2RM21 4CDXA 4HKZH 3WNXA 5AC92 1BE3D 5FZKA 2IDBA 2W1UA 5GZDA 1O91A 1JI6A 2ZX0A 2IFMA 4XILA 2A45H 4YW1A 3IFMA 2A06D 1C8M3 3AMHA 4RGKA 1W2BO 3I3QA 4BOWA 3P5BA 2Y38A 5FZ3A 2BASA 2OXBA 2X8KA 1ZV8A 1UN1A 4NIIA 3R4DB 5KC6A 1H2KA 3DGTA 5K5GB 4GKXA 1Q3EA 2JX9A 4Q0QA 3L72E 1HX6A 2WT1A 5CFDC 1VJ2A 5FZAA 3JCUE 3IWZA 4FTEA 4FTBA 1QXRA 1ULEA 4XUPA 5F5IA 3CJIA 4V1PA 2JG9B 2IVIB 4DY5A 1SFCC 2B7YA 4O61A 1YQCA 4M0HA 4Y1ZA 2W3JA 3N7NA 4XFFA 5KBFA 2UY9A 3O1PA 3BCCE 1N7SA 3KZIH 3LW5H 1G9AA 1HB3A 1K5JA 3S1KA 4U2AA 3C7EA 2RMU3 3NNLA 2YXRB 4EROA 1ZBA3 1KC8Q 2B5HA 1Q5OA 2W94A 5ACA2 1QJY3 4EZ4A 3H1HJ 3ZYBA 2JJLA 5FZFA 2JE8A 2P2KA 5EHDA 2K88A 1KQFB 2R0FA 2RDQA 5C8CA 3PUSA 2XWJB 5LRRA 1RF0C 2BCCG 1WCUA 1IO4A 5TSWA 4YFZA 4UBGA 2D6MA 3WNNA 3SWFA 1L0LD 1PPJE 1XTCC 4YZ5A 2V09A 3WF3A 1M90Q 4Q4W2 1AFOA 2FYUG 3L37A 1GKBA 5BU5A 1K3IA 1HB4A 5JXGA 2CSGA 2C9AA 5A3NA 1DQ0A 4XVHA 2Q1KA 2VOXA 4PDWC 4CTEA 4Q4Y3 3AZZA 4OHWA 2RDRA 2I1JA 3HAGA 4RHV2 4CU7A 1W04A 1OFCX 2Z5IA 3GM8A 1FMD2 5DZFA 5FWJA 3OUIA 3N9PA 4DEQA 4CP2A 1NJIQ 1UL9A 3H1YA 3ZSEA 5IATA 2P34A 3NKTA 1YJKA 4NAOA 5B2GB 1SPPA 2JDNA 2WQ8A 4CDWC 4LITA 2PELA 3O12A 4HETA 2QNKA 1G9FA 4AW7A 3K48A 2QM8A 2NZ2A 4E4SA 1ENQA 3OGRA 2ZKLA 1RUH3 1VQLP 5K0UB 2DCZA 4HVRA 3CL1A 2HFED 5KXEA 2RS33 3NAPA 1T8ZA 1VBD2 2ZGTA 1NTME 1O4TA 2OT7A 2WZEA 3KQRA 1PMJX 2VQAA 5EP9A 2FBWC 1IG0A 4CDXB 2FFDA 4I01A 1Q8OA 3R2PA 3H9AA 3UNPA 4AGGA 1KN7A 1GZLA 1VRH3 1CGPA 2VUCA 2P3JA 2ZMKA 4LHSA 4MH0E 2JD9A 2ZXQA 3J7NA 2Y9YA 3H3ZA 1OOPA 5FZ1A 3NV3A 3WT3A 3L72J 4ZS2A 2A6XA 4QGMA 3K3NA 3GCWA 1YC61 1UOFA 5LEKA 4LO4B 3WW4A 4H7MA 2FQPA 5FRAA 1S0CA 2HWB2 2Z42A 4GZ9A 4Q0UA 5L7OB 5JCTA 4W7YA 2DVGA 3V2PA 3BCCJ 2YMZA 2OTLP 1B35A 1EUUA 1LTAC 3VD3A 3TEYA 3VZKA 1USDA 3HN1A 5JI7A 1WBFA 3CPWO 4GD4A 1URQA 1NHLA 2PQSA 1FAVA 1UU5A 2B46X 4AI3A 1OA2A 5CFCC 4L9BA 1UPIA 2ZOEB 3L70D 4AVVA 3QOPA 5DABA 1R083 3MIDA 1ZZ9A 4PI2A 3B94A 1IZ3A 3M1HA 2CWMA 1FOD1 4YW6A 1NTZK 5IVFA 2VL4A 3BPZA 3TNPB 5J7MA 2XLGA 1ZA7A 4META 3V4WA 3VN0A 5AW1B 3GGLA 2JIGA 3IB3A 3U59A 3T1MA 5CAZA 3K4ZA 4WY4C 4O65A 1ULCA 2ORXA 4CDUA 4PQQA 3INAA 2ZFCA 3RNSA 4D0QA 1SBFA 1VBC2 4ZZ8A 4AVSA 5KHGA 4Y26A 4D6TJ 1QOTA 4MO3M 2W0XA 1L0NG 1SFNA 1LHWA 4PLMA 1LTJC 3P7KA 4L97A 1ST8A 4YGEA 1QNYA 3OEAA 4CU6A 4QU1A 5GTIE 3DXUA 5FMOS 4WM7B 1S1CX 3KVAA 2YFUA 1U7JA 5IK5A 2KLVA 1JZ4A 1CAUA 1UU4A 4WVMA 3MO4A 2RJKA 3T30A 2X5IC 2C6SA 4AYCA 2IBZI 4IETA 4ES9A 3TNUB 3V2NA 4FPLA 3PMSA 1SPPB 2YBPA 4EI2A 2VTXA 5TISE 1KV4A 4LO5B 3I2GA 4HT1T 4JGZA 2Z4FA 1NTMJ 2JP3A 3P1IA 5KHIA 3RZKA 1W9WA 3OBRA 2Y6KA 1KQLA 1L7QA 1HVVA 3CNAA 1EAH1 3TEXA 3C7HA 4QPGC 1AVYA 2Y6HA 1F4AA 2EALA 1ZRTD 5KHKA 2YPJA 1XBFA 2VCBA 3VLBB 4RQPA 3UETA 4W8JA 1R1ZA 3EQ2A 3L75D 1W8UA 3W5NA 1R5LA 4YARA 3VMAA 3BU7A 4MADA 4RS5A 5FQ0B 3TDKA 5C6CA 3VKOA 2AREA 2RE9A 2KM2A 2A3YA 1BGYE 4EN9B 3OW2O 3HBKA 2N7GA 3MIWA 2PAEA 1AV1A 1OOPB 2QQIA 3AMMA 3VD5A 1GL2D 4H7LA 2QJKB 1K73Q 4OMDA 5FLIA 2V72A 4QB6A 2FYNB 4XF0A 1CONA 5H9RA 3WQ7A 2I07B 2M8RA 1FPN2 1PGL1 4RGGA 1UY4A 1ENRA 5C39A 5TJHA 2FMDA 4BCUA 4XF1A 4NHKA 5F6KA 4Z1VA 4I02A 4D8MA 1B35B 3D6EA 2E9QA 2IBZE 1F2NA 4YZ3A 5C8WA 5T55A 1URQB 3QH7A 4PF1A 2CL2A 1PGPA 4K3AA 2OYHA 2GU9A 1ALYA 4HB1A 1UXZA 2MEV2 3AKRA 4EZHA 1W05A 3MUY1 1GNHA 5FO9B 1W6QA 1ZMEC 4OZOA 4P02B 5KTBA 3PTRB 1EY2A 3SLIA 2MJZA 5FZ4A 1O8SA 1CD3G 3H50A 5F32A 4IEZA 1J1LA 1R1A1 3AZWA 1J2JB 2YHJA 4AQSA 1JCDA 1SQBD 4PJ0E 1NA1C 3PJQA 1HXS1 4KG0A 3E97A 4P9LA 4XAAA 3VD4A 4LORA 4RR3A 3RGBA 2WS91 1QL1A 5KXDA 3GJBA 4CDUB 2BOIA 2QZ3A 1CIWA 1Y9GA 1CI6A 1IK7A 5FZ7A 2JDAA 5DDJ1 3HIFA 1OI6A 3O5SA 4AEDA 4Y28J 2BBAA 1QJX3 2KI7B 5F6LB 4NRPA 1AR62 5C3PA 1WMKA 1SQPD 1KXGA 2W52A 3CXHH 1N73C 5FYBA 2DFBA 1BE3G 1CIYA 1L3JA 4S2GA 4DCKA 2HPCA 3J8F1 4HZFA 5KAIH 5KLVK 1LOFA 1A78A 1D4M1 3HJRA 1H4GA 2RG4A 4D7SA 3SNMA 3BALA 2TUNA 3RSJA 4OWFA 1PIV3 3ZFGA 3KMHA 1V6LA 1IZNB 2BJSA 2A06G 4AF9A 1RITA 2C1FA 4N53A 3H32A 1HGZA 1GANA 1J83A 2W92A 4OZXA 2IVJA 3ZYRA 2ZGPA 1AXKA 5F1RA 4HYTB 3D4KA 3V65A 1USEA 4JGZB 4C7NA 1ZM1A 2R5BA 2ZVNB 4AAPA 3FGAD 2D6NA 1MEC3 1F9KA 3TGUE 1HV0A 2UURA 3LFMA 5FYVA 4IV3A 2M5AA 1MS1A 1NZIA 1KS5A 1HLCA 4OI2A 5FYYA 3Q5SA 2XUMA 4GMP3 1GQPA 4DMIA 4YVWB 4RQPB 3HUSB 4UFIA 3U0ZA 4JKMA 4LOSA 3M9BA 4RS5B 2W2IA 3EXUA 5BNPB 2H89C 4FPHA 3KXDA 2HWE3 3AYEA 3J26N 1ZBE3 1W9SA 1AR81 3OBZA 4J25A 1RUF1 3CD6P 1DYKA 3OGSA 3POWA 3WF4A 1LU1A 2OUJA 2BQPA 1CPNA 1X7NA 2O0OA 2ZS6B 3MUZ1 1N3OA 3WZ1A 3RWNA 1N8RQ 5GZFA 2JG9C 5FZ0A 3WUUA 4AFMA 1L0LG 3SCHA 2G3AA 3SXWA 1UIKA 3ZXFA 3TNQA 3ZFFA 2HYNA 5FMOL 4ZKPA 2WSVA 4EOTA 4LBLA 5LBBA 1QJU3 1QVFO 1EQ7A 3VMZA 4LE4A 4UFKA 1W6QB 4QX5A 3BIWE 2G9FA 1UYPA 1AYM1 2P3KA 1LNSA 2WT0A 1LTTC 3MLKA 1X50A 3AKPA 2BOJA 4BQYA 2R1DA 4K20A 4IXLA 2J1SA 3MZWB 3I2IA 3MLLA 2X29A 4M3CF 4XIKA 2VMDA 5KKZC 2FXPA 2C9KA 2NPSD 2VQUA 4YXDC 5AVQB 4L2NA 3VYIA 4AGVA 1XXNA 3WHUA 1KYOH 1HDKA 1KFUL 3KSCA 3O0WA 5BXXA 1CI6B 1KS4A 4BMEA 1PM4A 3CCJP 2QE3A 5FZIA 3MPPG 3I5CA 1GZ9A 2VZTA 3B02A 4AEDB 4IV1B 3A0HE 1OXZA 3VDDB 2WYSA 3VMYA 2FXOA 2AXTH 1YITP 4I0AA 4BHPA 3LIEA 4NIDA 2VULA 4DJGA 4YG6A 3RRDA 3K46A 2HPCB 3ZXLA 1YQ3C 5SV8A 1CAWA 3M3OA 4FPCA 4LEJA 1VB4A 1WMFA 3B4SA 2VTFA 2PMWB 3ZFGB 3MPBA 3E7KA 4BQ3A 4QPIA 2NPIA 3FZ3A 3AE3C 5AW8B 4L92A 3PTZA 3MP7B 2Q1FA 4N53B 5K0UC 3H32B 1PK6B 1TME1 1MFZA 4U3FE 1BEV2 5JLVA 3OD0A 1IFJA 3UV9A 1QVGO 4QGLA 4AEMA 4C7NB 1ULDA 2GP5A 5F2WA 3PDQA 2J1UA 4XDPA 2KS1A 1XJAA 2DU1A 2XOMA 4IV3B 2M5AB 2DBNA 1SG3A 1X33A 5FPZA 4AVCA 1DYOA 4LKSA 2BDRA 2R073 1Y9BA 5DAPA 5C70A 1RUI1 4BH9A 1G86A 1UZYA 2CAVA 3S5AA 2V7QJ 3L70G 1Z78A 3RZLA 1DU3D 3D6ZA 4YPCA 1SMVA 2PFXA 5JXIA 1YNAA 2HYKA 3CC2P 3ZKUA 4CDQC 3O14A 1OLMA 5L7OC 3ZOIA 4HONA 5JMCA 1UWWA 4W4ZA 2XJQA 4AEKA 4C7RA 3I4IA 2DURA 4Y5TA 2XL7A 4DXRA 5DG2A 1FJKA 1NX9A 3AL5A 4K8RB 2OYIA 1KQRA 4N6JA 1PHMA 5GALA 1X0TA 1DQ6A 1NY71 5I0SA 4C8DA 4O9EA 1V6OA 3ZFFB 1LR5A 3GCXA 1EV12 3AP9A 1VF5B 2Z79A 5JZGC 1RUE2 1RUC2 2ZX2A 2J59M 2RS11 4CUBA 1Q2NA 4AXOA 4A3XA 4Q4V1 5AW5B 3LPGA 5A1LA 3CX5I 1S0IA 2OIIA 5AFBA 4HH2A 4NHLA 3KCCA 1ZRIA 2WZR2 3GLMA 2XBO2 2XDVA 1KYOD 2LW8A 1J58A 3WX5A 4BK4A 1KJLA 4X6QB 5JUVA 3D82A 2W8ZA 2RM22 4R8HA 5T52A 2DVAA 3KCXA 3D8CA 4LBJA 5BNOA 1VAVA 1XNCA 4Z07A 1UQXA 3P32A 1N2DC 4Q4X1 1LTBC 1MZEA 1GW4A 3MIFA 4WM7C 1NTKE 4NMIA 3R6SA 5B66E 1EDKA 1IC2A 3AP5A 4QDQA 1JY2O 2XNDH 1R091 3F2ZA 4NPMA 3L75G 3QH6A 5LK5A 1E5HA 3GHMA 1ENXA 3KWVA 2O14A 2ZYDA 1ZZ7A 4RN5A 1CAWB 3KV4A 4GMP0 1VP6A 1PGW1 5A7NA 5AVRB 5CBLA 1FNYA 1PP9D 2CNAA 1NOVA 3H7JA 5L36A 2DW3A 3ES4A 2JXAA 3Q8BA 1Z56A 1AA0A 3BGAA 2M3EA 1OFNA 3CQOA 5A6QA 2HLEA 4L73A 1MUUA 4Y20B 1TVGA 4WZCA 2KS1B 2QDNA 2ARXA 4I7ZB 4CA9A 4DS0A 3CX5E 4IL6X 2B87B 4DY3A 5HI0A 3OB8A 1ZP0C 1OOPC 3T1LA 2A7AA 5A1FA 3VV1A 4GB33 4EQVA 2QJKC 3P3PA 4B3NA 4JRLA 2E76B 2FYNC 2JG8A 3CWBJ 3H1LE 5C3RA 2WDBA 1ND2A 1RF1A 5I8SA 1WW5A 3HE5A 1SDDB 2HKXA 3H1KD 1AVOA 1SQBG 3RBXA 1B35C 1VB2A 3W21A 3NNGA 1RMU1 1X9PA 3NVCA 4A45A 1L2PA 2HG5D 2XJPA 2E5TA 4QXBA 2HWF3 4E8CA 4HPKB 3H0OA 4H2AA 3EWKA 2D3PA 2QSIA 1GWLA 3WG3A 2FZ2A 1SQXJ 5AW7B 4E4DX 4BWOA 1BLZA 1S9KD 1EZVD 4XHBA 3FBYA 4ASMB 3OGJA 3SKJE 4LPLA 3L71E 3ZSKA 1SQPG 1MQTB 1PZ9A 3M0AA 2JE9A 4FOVA 5A32A 1BYHA 5FBZA 3THPA 1GL2A 1ZZ8A 3NL1A 3NJYA 4Y4RA 1H2LA 2ADDA 4LE3A 3QWOC 5FY7A 1QH7A 5FZ6A 1POV1 1AX1A 3IAQA 4JQTA 4KQ7A 1JU3A 4BQ4A 4CDUC 4LBQB 2P3IA 1K9MQ 5F9TA 1W8NA 2Y6FA 3H1IJ 3W67A 4FQZA 5L19A 1W3VA 1YQ5A 1BZWA 1RHI3 4X8NA 5FZCA 3I2HA 1JYCA 1LENA 4QB1A 1UW8A 3B8EB 5BNOB 3P8CD 1US2A 3B71A 2JDYA 4QWNA 2KUBA 1GNYA 3IMNA 1H1MA 2RKLA 2QQKA 1M4WA 1CJDA 4AL9A 1RB8G 1BSNA 3BOWA 2R0HA 1KEXA 1FZEA 1HQNA 3N4XA 1W0OA 1WCKA 3QLQA 2PLV3 1KILD 4A2UA 4CCEA 4EJRA 3V0BB 1YJ9P 1JZ8A 1SLCA 3N9OA 2BGCA 3W5MA 4K3UA 4CP9B 4CCCA 4NHMA 3ZR5A 4BRYB 5A1AA 1GWKA 1W6PA 3RL0B 4IESA 3ITKA 3B3QE 4ISRA 1UY3A 2ZEWA 1Q86Q 3CIHA 4ZKUA 5DZGA 2IX7C 2C26A 3E1F1 2AEJA 1FX5A 3POYA 1VQOP 4YVWC 1ZVFA 3HUSC 4P9GA 1Q56A 1XOYA 1S0DA 4WVVA 3TN93 5BNPC 1FOD2 2Q3EA 3WVJA 2D5FA 3KZ4C 2K1AA 5ANNA 3ZFEB 2H6CA 4IQPA 2P6HA 2WLPA 3AVRA 3I97A 2D6LX 5JSRA 1IFMA 1JH5A 1WCSA 2VY0A 5KJ7C 1JY3O 2XU6A 1C3HA 2O3JA 1GDTA 1UY1A 3CCLP 4HSLA 3LEKA 3JD71 1RJ8A 2ZT9B 2XUEA 1XYNA 4P14A 2AR6A 2W1WA 3NMDA 4F83A 2VH9A 3AEFC 3POSA 2BCCJ 5T5OA 4XAEA 1OFSA 2Q8DA 2VOWA 4CU9A 4XHXA 3AB0A 1VR3A 3H1MA 1WD3A 5I0RA 5F5AA 2R6QA 3KLSA 2FYUJ 2QDRA 3MIEA 4K1ZA 4IE5A 1OKOA 3WF0A 1FZAA 2B9UA 1NTZD 5L9VA 1Z7S2 1WLCA 3ZYGA 5FY4A 2E74D 3H1JE 2UWCA 1V9U3 2DTYA 1RTVA 3RMYA 1D7PM 4XF4A 5A32B 1S0BA 1L0NE 2PAJA 2WINB 4MGYE 3LEMA 1JZ3A 2EA7A 2WNVA 3NNMA 4XJUA 3SH5A 3HOBA 1SP4A 4INDA 1JMBA 4KGGA 4C0BA 3OG2A 1L4AD 1YQ2A 3L74E 3MHZA 5A6ZA 1A8DA 5KAFH 1QJZA 3OOXA 2O1JA 2XBO3 1X8EA 1T2KC 2CWSA 1OVUA 3HR9A 3N36A 2RM23 4AEDC 2WPSA 2QJPB 1AX0A 4B8EA 2L5GB 4IV1C 3VDDC 4ZKTB 4ONUA 4UBHA 2VG9A 3HMYA 2ENRA 3ZXKA 5FP7A 2DU0A 3RFRA 3V64A 1FZCA 5E16A 4A7YA 3IPVB 4N43A 1LOFC 3OCPA 2E6VA 5AFEA 1HRV3 5DJUB 5CADA 2JDZA 1PGL2 3ZFGC 5CBOA 3FJSA 4XUQA 3AL6A 3I3EA 5B5EH 5F7UA 4N53C 1PK6C 1LT9A 1N3PA 1RE4C 4YM2A 2NPSA 3PHLA 4MV2A 2IFNA 1QGKB 3L2YA 1LT1A 3NJZA 3VBFA 4AWDA 1JYXA 1W99A 2HR3A 3E6DA 2QQJA 2FY8A 4QKBA 3EFGA 2CGNA 3H3UA 1VQPP 3CO2A 2ZA9A 2VTXJ 2D7FA 5FREA 4OH8B 1OPOA 2IUWA 4CYDA 2TNFA 5LA2A 4DUXA 2JDUA 3NJXA 5IAVA 4AQ2A 2VMIA 2BYVE 1AYN1 4QX2A 2ADEA 1MZFA 1LB2A 4Q0VA 1HXS2 1QOSA 2RJLA 1SLAA 3ZN6A 2WS92 1IGOA 1OKQA 4FAHA 4AVAA 3ZR6A 3PLQA 4DNYA 1LHNA 1MACA 1NE6A 1D4VB 3T2PA 1FMD1 5JIAA 5C3SA 1YBKA 2WSCJ 1E5WA 1T6BX 5GLUA 3RS6A 5JSOA 4E27A 4FFHA 2D6KA 2VU9A 5FO7B 3DYMA 2ZGLA 1JOCA 3VMXA 2WSEJ 3AJZA 2YMKA 4M3CA 2QVSB 4OGQD 1DLCA 3CHXA 3NNFA 4OVNF 4IL7A 5CBNA 1KDMA 4X6RB 3ZSJA 1SLBA 1SQVE 5DZEA 2R061 3N9LA 4NHXA 4ZU4A 1VF5C 1D4M2 5D8AB 4BB3A 1K8AQ 2N1TD 3WG1A 3H7YA 1L0NJ 5FKBA 4KHXA 4L99A 1G8WA 5L9RA 3E1IA 2ZHMA 5FYTA 3MICA 1UIJA 1BBT1 3WNKA 2W08A 4QD2A 4ASLA 3HRNA 3JB4C 2CGPA 3LEIA 1PX3A 3LKJA 2GALA 1LHVA 1SLIA 2WNVB 5C7GA 1UCXA 3IBMA 2EIDA 2IYOA 2AGSA 4CP0A 4GIFA 1WLDA 2GN3A 1XE8A 1NTKK 1PP9G 5GLWA 1HJ0A 4MGIE 3KT1A 3IZOA 1DD3A 1VQ5P 2ID4A 4COUA 2WN2A 3RJ2X 2JWPA 2ZX3A 2YKQA 3GHGA 1GMMA 3ZVXA 2HWB1 1YLLA 1H0TA 1UKRA 4H14A 5KLVD 1Q8SA 1OIPA 4IE4A 1RVF1 3X29B 3L36A 1GR3A 3AMPA 1OVVA 1RUF2 1U5ZA 3R0RA 3ZDSA 4XMAA 5JXHA 4Y4YA 4GH4A 1HN0A 2KP8A 1RXFA 3WMM0 1K45A 1VMFA 1FDOA 2YIUB 1OHFA 2JKVA 4GJYA 2VZRA 4OUMA 2F6BA 1IFPA 1U5YA 2GH2A 5LA1A 4QM8A 4FPJA 1T3JA 1VPCA 4WV8A 1VPHA 1HIXA 1UZZA 4BQ5A 1KB9I 4LBOA 1JO5A 2GP3A 3N4MA 3T97A 4XFBA 2RJ2A 1COV3 1CX1A 1I5ZA 1OLRA 3H1KG 4TN7A 2QQOA 3THCA 3HTKB 4AG4A 5C71A 5F3IA 1MFTA 5FZMA 4I7ZC 2IFRA 4WB4A 1NAYA 1UOJA 2QQMA 3GZTB 4XJ8A 4DT0A 2A45I 1AL23 1CPMA 4GXLA 4EN0A 1VBA3 1ZZ6A 3HEIA 4LUKA 1AYM2 4H0LC 1LCLA 1VBC1 2R043 5LEJA 2ZGSA 4IL6H 5E88A 4MN4C 1EZVG 3W9AA 4P9XA 3KPEA 5IVYA 3NV4A 2E76C 1FOD3 4GT1A 2ZVOB 5BY5A 3UK9A 1K5MA 5L9BA 2YO2A 4FTSA 1RUG3 3ALQA 1Y3TA 3BCCD 5FLHA 4M01A 2B39A 1M1JB 2EF6A 3IKWA 1LP1A 2R16A 3DKQA 5AVXB 3SHRA 4A7KA 1HW5A 1G2CA 3CCSP 3DXTA 5FZBA 3AEAC 4FP3A 4M3CB 1LWUA 2OA2A 2I2SA 2PYTA 4LBNA 1MR5A 2B8MA 2E26A 1S1AA 4Z2AA 2PHXA 1MVEA 4PQ9A 1MQTC 3O0XA 3VUOA 5FY0A 1U7MA 1SFCD 2ARBA 5CHXA 3VBUC 1OLME 1KB9E 3ZXJA 1BCCE 3AEBC 1PPJD 3N7LA 5JVVA 4QXCA 4LA3A 1S72P 3I2FA 3CC4P 4KMQA 4FPYA 1TME2 4J1XA 3DL3A 3M06A 3I55P 5EYXA 4IEWA 3JZVA 2WSFH 3AK0A 2E42A 3POBA 2L91A 1Y47A 1UNBA 5CCHC 5IVVA 2KD7A 3CF6E 2WFPA 3V2RA 1MVQA 1EAH3 5JMOA 3WP4A 3H6PA 5GTIH 4CCMA 1YTZT 5LWBA 1RUI2 2YO3A 2R44A 3RK3B 3U11A 2P2UA 1ZW0A 1PZQA 1YTZI 5CCGD 2XQXA 5C3QA 3HWJA 1H0TB 1NU1K 2ZYAA 1G9DA 2O1KA 3MDPA 1JUIA 3F95A 3EYPA 3WUTA 3LDBA 2VXJA 1UYXA 3VL8A 4JX0A 4KBBA 2H88C 3M3CA 4XDQA 4KWKA 3KZIE 3PVBB 5B4NA 3HNMA 3RL0C 3C8VA 4GOFA 2VZUA 1NCQC 1LTGC 1FV2A 5IVEA 3M7AA 3T97B 2X05A 3L70E 3RK2B 3CCUP 4B29A 3BB6A 2YY1A 1O8PA 2XNXA 1DZTA 3OPWA 4LQRA 1L0LJ 4N9HA 5F5CA 1VQ7P 2I74A 3T09A 1S5LE 2C0ZA 2XWBB 4Q4V2 3ZFEC 2WL1A 1E79H 4D94A 3JBG2 4HK9A 1X9TA 3K4AA 3FX3A 5HV0A 1KILA 3M70A 1NTZG 1S0GA 3ST7A 3AECC 4BK5A 4RESB 2ZT9C 5DAXA 2RMU1 4AOCA 1H1IA 1R1A3 3K75B 3PJYA 5JOWA 2ZTNA 2VZ3A 3O1SA 1QJY1 2KXLA 5A3UA 2WS93 3K51A 1HQWA 2H8PD 1JEKA 5E6HA 4UYBA 1WZXA 1V0AA 1DX7A 4NIAA 5DDJ3 1LP1B 4K9SA 3L73E 3HD8B 5AVTB 1G2CB 4LIVA 3KHBA 3IM0A 1IG3A 2VC9A 3AC0A 1RHZB 2P17A 1JZ7A 4J1WA 2JDPA 4Q0SA 5APAA 1W2OA 2W27A 3K4DA 1JOPA 3LFIA 2VCCA 3J8F3 2FD8A 1D4M3 3V4QA 2JD4A 1WMEA 2Y60A 5BUVA 4RJTA 4PJ0H 4AGRA 2R1BA 3K77A 5ABJB 1FS0E 5EFUA 2NYYA 3SEPA 2R7EB 2P58A 4XFAA 4OHYA 2AEFA 4NRMA 1SLQA 4ATEA 2Y34A 1AXZA 2KNCA 4HK8A 2VBDA 2AYHA 3TSIA 4BDVB 3WR0A 2WT2A 3ELNA 3OUJA 1Q81Q 2WQ4A 3J7MA 2QJPC 4OUEA 2DFCA 1O5UA 1HTLC 2B9VA 3DECA 4WY4D 3CDZB 1RUH1 2ZX1A 3GZAA 2XHNA 2GH8A 5CEHA 2RS31 4D69A 5JSPA 2K9YA 2XHKA 3LW5J 4C46A 4N7IA 5D1IA 3JCIA 4P9IA 5IW0A 5AVYB 2Q4SA 2HWD1 1AR83 2Y33A 1OC1A 5IUQA 4CU8A 1XTGB 5A7WA 4UFLA 1VRH1 3DF0A 2ZEZA 2BV4A 2JKBA 3H25A 3T4VA 3L70J 4Y33A 5F8PA 3WQBA 5A7OA 2UY8A 1RMU2 4WWIA 5FP9A 2QKDA 2V4VA 1JODA 2QQVA 3LB9A 4YM3A 2E5YA 2GA1A 2B42B 3AEGC 1JUNA 4XOGA 3NV1A 1BDDA 5DG1A 2JIJA 1BGYD 3CCMP 4L8QA 1H9PA 3THTA 4QXHA 3DCQA 4H13B 4AFAA 2WNUA 1UMHA 2SBAA 3N3HA 3APBA 3LDRA 1LEDA 4YM1A 3DEMA 2ARAA 2RR11 3FUQA 3FFZA 4FXKB 1ZRDA 4NPDA 1W8WA 1JYTA 2WO1A 3GHNA 4W50A 5FTTC 1Q8VA 3CEWA 1SCRA 4COYA 2GNBA 2DCYA 5FYHA 3BRVB 3ZLIA 1AYM3 3ZDVA 3RMXA 2VR4A 3GG2A 3KDPB 3S9OA 4A41A 4PLNA 4A42A 1VALA 2IBZD 5K7PA 2J5UA 2VPVA 4BQXA 3S57A 1R081 3PU8A 5FV3A 2VE1A 1SQVK 2W83C 1LOGA 1LODA 3PVEA 4JRAA 1MS4A 2DYCA 1SZBA 2WQYC 3W20A 2YU1A 4AI8A 2A3XA 2Y6JA 5D8AC 3GYDA 2ZX4A 1SBEA 1H2NA 4OULA 1T6GC 4C91A 1A34A 5KLVG 1AX2A 2O01N 3RGUA 1BK1A 1WMDA 1KZUB 4HXCA 3L75J 2YC0A 2PP6A 3AP7A 2E33A 1TME3 3WDUA 5FCCA 4ITCA 3IIAA 2KNCB 2PTMA 1SCSA 1DFQA 4W6YA 3Q5PA 2DUPA 4KNCA 1T3UA 1VBB2 1YUDA 2KB7P 4HKWA 4OCTA 4NPFX 5I0UA 1S4XA 4HL0A 2BP6A 5JI9A 3A0HH 3I56P 1JZ6A 1IPKA 4LLFA 5F3EA 2N1TA 4W7ZA 3CXHI 2W1QA 1UIIA 2X09A 3HE4A 1PGJA 2IXCA 1C57A 5T3NA 5FY8A 3BTYA 2RS53 4N7UA 2WQZC 1QQP3 1S2BA 2NP0A 5CIRA 2DVDA 3MUDC 2K9JA 1W6OA 3JD72 5A3MA 2YIUC 1OH3A 5EJZB 5F5QA 3U1XA 5C4WA 5HBAA 3TGUD 3MHVA 2VECA 2BERA 3ROUA 4DFSA 4GOEA 1EV11 3WF1A 4DXSA 4NWWA 5FK7A 3UKVA 1H2MA 5CZKA 1QMJA 1QY4A 4CEYB 1QDOA 1RUC1 1BQPA 3BCCG 3WCRA 3I49A 3A7OA 4DOJA 5LA0A 1S55A 5FWEA 2YZ4A 2WFF3 4TZDA 1U57A 1TMF3 1SQBJ 4AQRD 1IOAA 2DVFA 5FZOA 4XFGA 1WBLA 2D97A 1P84I 3I59B 2AZ5A 1YYCA 1T2XA 3RYKA 3JQWA 4KL1A 2WNUB 2UYBA 3PIJA 3VZNA 1F5FA 2YBKA 3TEZA 1VQ8P 4FOWA 4EYYQ 4CE8A 1CN1A 1V6JA 2RS13 4Q8KA 1AJKA 2BNNA 2JECA 3PVNA 3L4FA 1PZ7A 1JZ5A 1MPXA 4UXAA 1PPJG 3D0JA 4QDRA 1XNKA 1SQPJ 4QXKA 1AR93 3CLQA 2WKKA 4MHUA 2ETEA 3I8TA 1M1JC 3CXHE 4YVSA 3DKWA 1OZHA 4XTPA 3UKNA 5A33A 4BIFA 2A73B 4W65A 1OVPA 2HWC1 2VOTA 1ZXGA 4TXWA 4MG2A 1Q8QA 4NN0A 4OI0A 5IK7A 4DZGA 2BVVA 4Q4X3 3UIAA 2C4XA 1H89A 3JU9A 2WLQA 4MXWB 2SLIA 3Q8EA 2WBKA 4AUWA 3RZZA 4L74A 2C5DA 1R093 1D7MA 1NLRA 1O3RA 3FMGA 4Y1XA 1RUD3 2HYXA 1O4YA 1QJX1 2QQUA 3USSA 3VBHB 3HBZA 2WT7B 1DLLA 1P84E 4JGYB 4M3CE 3FHAA 3OPTA 1BHGA 3M9QA 3ZYPA 2Y6LA 3I2KA 1PIV1 4UAPA 5CKNA 1RE3C 2G1MA 3OTFA 4CUCA 4IEXA 1X8YA 2J1TA 4DO0A 4P08A 1ZRRA 3RK3C 4OHXA 4OGQB 5B66H 5CFDA 1NXD1 2DV9A 4I3GA 4K21A 4PBOA 1AYN2 1R5SA 3NNJA 3VBSA 3CLPA 1Y7BA 2K2SA 1F4HA 2E53A 1XQNA 5CMZA 3MW4A 2DDUA 2HH9A 4RSUA 5EJ1B 2D3RA 4URTA 4U3FD 2JENA 1H8TC 4QMAA 4GMP1 4QM9A 3ILFA 3IT8A 3TRSB 1UXXX 4D6TE 1V6MA 2K9JB 3B5NA 1W6OB 4GULA 1S2KA 1DIPA 3MV11 2QCSB 3OGVA 5CYYA 2FDHA 2ZGNA 2H0VA 3TBDA 3CL3D 5FZDA 3GF6A 2N9BA 3CCEP 3UYJA 3RK3E 1ZBE1 1EC5A 4FOQA 4U36A 4Y3OA 2YUEA 2R062 3G6EP 2VVFA 3RK2C 1RMU3 4XYXA 1RF0A 2ERFA 3CX5H 4HMZA 3S30A 5EIYB 2P7JA 3SITA 1EPWA 4V2VA 4KWUA 1XNAA 4QX0A 5FMBA 2FBEA 1QIQA 3MLJA 1IS5A 4AE2A 5CCGA 3VP9A 2YKPA 5FZOB 2ZGOA 2AEMA 3EQEA 1VL2A 2QZ2A 2OUHA 3BCWA 1N3QA 4YGBA 1BBT2 3R4YA 2LRPA 1H1AA 4AK3A 3IDBB 4B86A 1OD3A 2G9GA 3LQCA 5EXOA 2ZXXA 3ORJA 2R5DA 1W9YA 5A70A 3EFFK 5AVPA 4Y22A 1TNRA 2D44A 3FC0A 1QJU1 3ASIA 3AMQA 4DOUA 1XYPA 1RUJ3 3EJKA 1CAVA 3WW1A 3ZYHA 2AXTE 4FFGA 2DBIA 3VB9A 1NG0A 4MGKE 1JY2P 3VZLA 3PH0A 3BIEA 1XSRA 3CMEP 3A0KA 1G9BA 1W28A 2GC3A 2IXLA 1RVF2 5APUA 1D0GA 3DPRA 4W6WA 1SFYA 3C7GA 3AE2C 1TEIA 1U0AA 1DYPA 3LEGA 1JMMA 3K3OA 1LHOA 3CJIB 4PV1B 4I6MC 4CCNA 2PHDA 3OYWA 2JDKA 4XQ4A 2B88A 4UWDA 3U14A 2WITA 2WC2A 1ZN5A 5ABJC 3B5LB 1N7SB 5GTHE 4CEWA 4GWMA 4IEYA 1ASJ3 2VZPA 1BMV1 3CZUA 1BK0A 4P00B 1SQQK 3VBOA 5HPOA 4FO9A 3WUVA 3VP8A 3KS7A 5FMCA 5CU1A 5E8AA 2W9XA 1JCCA 1OH4A 1DD4A 1N7LA 5KXBA 1NTKD 4JQRA 2KA3A 1WT6A 3OJBA 5C8CB 2EIBA 3POJA 3IAOA 3CCQP 1C5IA 2SPZA 2K37A 2PHRA 5EQUA 4NHYA 4EDFA 1JZ2A 1QLED 5CFDB 4LLHA 1BGYG 3ZXAC 1RXGA 1VBE2 3UJOA 5BU8B 1HJFA 5FZLA 2K3RA 1YJLA 1PVC3 2RDNA 3VBSB 5DN2A 1BXHA 4OI4A 4EIJA 1NYWA 1JBCA 4QDSA 5IK8A 2R32A 1RIRA 4UB8H 1ULOA 3BU0A 4TLGA 3CMAP 2IZWA 3H1KE 2OS2A 3PUHA 1I6XA 2R071 4W80A 4ZS3A 3B5NB 1JHNA 2QIWA 3JD73 4C0HA 4KWJA 1Q7YQ 4K7JA 3CX5D 4B1LA 2IBZG 5GZEA 1Z7S1 1GQGA 1W6NA 3NMBA 4XJAA 1S0JA 2QUOA 2OKXA 3VDBA 1UOGA 4GODA 2D3SA 1HBWA 1IQDC 1IFDA 1S9KE 3N7MA 3TAYA 1YEWA 2Y0IA 4QX8A 1YI9A 2EXJA 4H13C 3AE4C 4L75A 1MZ9A 4AAXA 4EN6B 3OBAA 4W6XA 1GUIA 2ZXEB 3NAPB 3H1LD 4XTMA 5FKCA 2XONA 3WF2A 5DXDA 1IHMA 4YPJA 4XXPA 1LTJA 1JM0A 1PO13 4NE9A 1B09A 2POHA 3AVSA 1HB2A 4LLOA 4LK7A 3SH4A 2FFDB 3CCVP 1KORA 3GJAA 2E31A 1NQDA 5AC93 2WA3A 2VMFA 5FDBA 5J09A 5I0DA 5F39A 2D43A 4FSJA 5JAXA 4EN8B 1UD1A 2X5IA 2O01H 3AMNA 1W8OA 2O8OA 4XPVA 4PD4I 3C3VA 2VNRA 2QJVA 4O7XA 3IDEA 3SISA 1XSQA 3WEZA 2VZOA 2E75B 1GD2E 2ORZA 2OX0A 1K04A 3L71D 3H1WA 3MBWA 4RGAA 3WU2H 2MPFA 1UZ0A 3SSUA 4DIQA 3DPRB 3LIHA 1UY0A 1WD4A 1BCXA 1CESA 3ZM8A 1EDIA 3NJVA 4FPOB 4QPGA 3R4UA 2KZJA 3OYWB 5LA9A 4D3WA 4ZXKA 4FFIA 5H2FE 5FLJA 1QL2A 1IFNA 4BMBA 3VBRC 4NAMA 1A8MA 1ODNA 4QQ2A 3WY6A 1IFIA 2FDIA 4OLLA 4CEWB 2VO5A 3TGUG 2GUSA 1JHJA 3VBOB 1H30A 1ZRCA 1OT5A 2D40A 4PT6A 1UAIA 5ACA3 3U07A 4HBNA 2W68A 3QACA 1WCDJ 5IVCA 5FYCA 3N9NA 4OQ8A 1P8JA 1JY3P 3ETQA 1LTIC 1WW7A 3LAGA 1AHSA 5JR2A 4XMIA 1NU1D 4YZ1A 3LSEA 1W8ZA 1UYZA 3EB7A 1RUNA 3H1KJ 1Q8PA 3MD0A 4QHZA 2GNDA 3SQOA 3S7IA 1YFXA 2GUVA 4QHOA 1ZLLA 3H8XA 1VQMP 4Q4W3 4RFRB 2XJVA 1F5JA 2VD7A 3WNLA 1AYN3 4PD4E 2PFWA 2RMU2 1YI2P 2FHRA 1ZR4A 3T0AA 1ZBA2 2QQPA 5JOZA 1QJY2 3MIBA 1WUVA 5A3PA 2O8QA 3RDIA 4RHV3 5DAVA 1CAUB 4WVMB 1FMD3 2EAAA 4CEYC 1N1VA 3K2OA 4UF0A 3POFA 4YW5A 4UFMA 1VMHA 3LDKA 2D2CB 4GB31 1NUKA 4B7EA 1WGPA 4BISA 4BZ4A 2MNGA 2DVBA 2BNMA 1HF9A 3FN9A 3RZHA 3ECQA 4FVVA 5FPXA 2VQ0A 2WNUC 5C9AA 1CSBA 3KYQA 3BTAA 4BLJA 4H44B 1SLLA 5I91A 4H55A 3D6YA 4BQ2A 1HRI1 2HWF1 4IE6A 2IPPA 2NMNA 2NM1A 5GZGA 1VBD3 3U4SA 2C9NY 2YB7A 4OVEA 4TTGA 3WUDA 1NO4A 2J7MA 5FZHA 2Q1MA 3KT4A 5J1XA 5FZGA 3H8RA 4XW3A 1ZNPA 2A6YA 3JC22 5SV5A 1ZZCA 4IFDK 2WMMA 1GNZA 4BQ1A 1AJYA 2P6CA 2QE7H 5LASA 5KJ7D 1RUH2 3H1JD 2RS32 2WO2A 4AHXA 1O5LA 4HANA 2EIEA 3B93A 2HWB3 3ON7A 3MIGA 5D2AA 3WUCA 2HWD2 1C8NA 2I8DA 1VRH2 5FK8A 2QA4P 4QPGB 1X79B 3L74D 1YQ8A 3KB5A 1WMXA 4XFCA 3BODA 1QGLA 3C7FA 4K1YA 3PUQA 5DAQA 2OYHB 1RUOA 2PAKA 2Q5TA 3VBHC 4U3FG 4XQDA 4NUBA 4EWAA 1YIJP 1S0FA 4HKLA 3Q8AA 3M0DC 2XKOA 3GF7A 4JGYC 3MW2A 2BEZF 5LBFA 3UESA 5HCHA 1BJQA 1FXZA 1GBGA 2Z4EA 3QBQA 4ZU7A 2WIIB 2PLV1 2YNYA 4KH9A 5FFOC 5GLZA 4DZOA 5CKQA 2LROA 1W2NA 4OGQC 1UMZA 1XRUA 2RR12 4RR3B 5LK7B 4YNIA 3VKMA 4YSFA 2VMCA 3D0SA 2JG9A 4IUGA 2WUHA 3PU3A 5GLTA 1UX7A 2BVBA 3SMHA 1T2KD
chains in the Genus database with same CATH topology
4AFBA 3KM5A 3BPZA 1VBC3 3TNPB 3W9AA 4P9XA 1ULFA 1O3QA 1DQ5A 5J7MA 3B69A 1BVP1 3I54A 1NCQB 3NV4A 4H3WA 1OQ1A 2XLGA 1FOD3 4META 3LA3A 4E2SA 3UK9A 5BY5A 1K5MA 1AL22 5KHHA 1VBA2 3T1MA 1R082 3B01A 4EWEA 5CAZA 2EXIA 4O9GA 1ULCA 4FTSA 4CDUA 2R042 1RUG3 3INAA 3ZX7A 3RNSA 3ALQA 1Y3TA 2LALA 4YW4A 5FLHA 2Q1ZB 1SBFA 4COVA 2UWAA 1VBC2 4M01A 4YRDA 2B39A 4G9SB 1QH6A 2EF6A 4AVSA 2A5ZA 4Y26A 5KHGA 3IKWA 1PVC1 4XEZA 1QOTA 2W0XA 2R16A 1LOCA 1SFNA 3SHRA 4A7KA 1HW5A 1LHWA 2CYFA 4PLMA 4LBMA 4DRRA 4L97A 2VUAA 1RUG2 3CU7A 2GSYA 5J98B 2CAUA 4CP1A 1PO22 4YGEA 1QNYA 4FP3A 2GMEA 1PZ8A 3MEPA 1IS6A 4QPYA 4M3CB 1XNBA 5KXCA 5FMOS 2OA2A 4WM7B 2I2SA 5DUUA 1LGNA 2PYTA 1WLTA 2WNVC 4LBNA 1MR5A 2B8MA 3UJQA 5GLVA 5IK5A 1S1AA 3HQXA 3L2HA 2PHXA 1CAUA 1MVEA 2XLFA 4PQ9A 3ACLA 1UU4A 2UU8A 2VVDA 4WVMA 2Z69A 2RJKA 3PHMA 4LUMA 2X5IC 5E89A 1MQTC 3O0XA 3VUOA 4IETA 4LR4A 3TOJA 2ARBA 4ES9A 4XBQA 3VBUC 2TBVA 3A4UA 5C9AB 4Q27A 4CDXC 3ZXJA 1JXNA 2VXRA 1ZZBA 3N7LA 4FPLA 3PMSA 2BEOA 5JVVA 4LA3A 4AQ6A 4FAGA 3RI9A 4FPYA 1W0PA 1TME2 3USUA 4LO5B 3OF1A 3S0MA 4HT1T 4JGZA 4J1XA 2G4IA 1E57A 1FI2A 2XLAA 1SACA 3DL3A 1V00A 5D8AA 4BLIA 4RL7A 1LU2A 1XU2A 2PA7A 1LGCA 5KHIA 4I0BA 4Q1RA 2IFWA 5EYXA 3OBRA 4IEWA 2GC2A 1RUI3 4FOYA 3JZVA 3AK0A 3ZXEA 3TWIA 2XVLA 3MI8A 3CNAA 3M3QA 1ND3B 1QWRA 1EAH1 3NKGA 1H9WA 1APNA 4N43C 4QPGC 4BIOA 1V9U1 4FPGA 3CF6E 2WFPA 1YCIA 1MVQA 5CG9A 1EAH3 3LOIA 2EALA 2V5YA 3M3EA 1AZDA 5KHKA 2YPJA 1PO11 3VLBB 3WP4A 4RQPA 1JTZX 2YGMA 1R1ZA 4P9YA 1RUI2 1A6CA 1CR7A 1U5XA 4CZSA 1AXYA 1XYOA 4YARA 4R9AA 5AC91 3BU7A 3U11A 2ES3A 4RS5A 5FQ0B 3MFCA 5KHJA 1CAXA 1X8MA 4G3YC 5C6CA 1YWKA 4Z92B 3VKOA 2AREA 3CJIC 2RE9A 2JDIH 2KM2A 1EAH2 4AI2A 3HWJA 2A3YA 3NV2A 3N7KA