4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
3R6SA 1QXRA 3ROUA 5KHKA 3LA2A 3SHRA 1O3RA 4XFFA 5K8SA 1RTVA 2GC2A 3OF1A 1YHFA 2Q0AA 3CL1A 4AXOA 4Q0UA 2BYVE 4OFGA 3SXWA 4P9GA 3FHIB 2OYZA 5CADA 4UXAA 4LEJA 5FPZA 1CAUA 4MGIE 2PHLA 1NE6A 3H1WA 4F8AA 3DN7A 4QGNA 4F7ZA 4MV2A 4FAGA 1ZRRA 1ZREA 4EV0A 1H1MA 1OD5A 5KHGA 3I59B 4I3PA 2V09A 4Q0VA 3MPBA 1U12A 4QM9A 2CV6A 1ZZBA 4AQ6A 3ST7A 1I5ZA 3RYRA 3WW4A 4AQ2A 3RZZA 4E2QA 2OZ6A 4PIXA 3IDBB 4EWAA 4HN0A 1G6NA 1YWKA 3TNPB 4D7TA 1Q3EA 4X6QB 3S0MA 3USSA 1ZRFA 4HSJA 1CAWB 2UY8A 2XNDH 3SMHA 4BIFA 4KU7A 4YYOA 4IESA 4XEZA 3H3ZA 5I8SA 5BXXA 5AVPA 4KWKA 2PA7A 2K9ZA 1O5UA 4XFIA 4PJYA 3DL3A 4CYDA 3ES4A 1ZRDA 2EVXA 4XFHA 5E16A 2D40A 4JTOA 4XFAA 4HVOA 5BUVA 1ZNPA 5LEJA 3IIAA 1EPZA 4A2UA 2H6BA 5JSRA 2UYBA 4H7LA 1O3TA 3E6CC 4L11A 1NYWA 4HSLA 2N7GA 2DCTA 4MZUA 2Q30A 4IEWA 5FQ0B 4YSFA 4AVCA 1DGWA 3ZDSA 3OTFA 3JZVA 5I0SA 4BYYA 4J1XA 1ZZCA 4UBGA 3RDIA 2V7QH 4Q0SA 4TLFA 2GC1A 4BH9A 4O9EA 1Q43A 2B8MA 1YFUA 1IPJA 4LA3A 1LB2A 5FQ0A 4YXWH 3ETQA 2ZCWA 3H8UA 1FXZA 4RD7A 3U0ZA 1RGSA 4R8HA 3U10A 1J3RA 1OI6A 3FE5A 1EY2A 4IEYA 5T3NA 1WA4A 3RYKA 4QM8A 4YRDA 1J3PA 1ZZ6A 1UCXA 3D82A 1DGRA 1LKNA 2IXHA 5CVRA 5I0RA 3G7DA 3H7JA 3L2HA 2XLAA 1O3QA 2QJVA 3LOIA 1J59A 2CAUA 4MGZE 4FAHA 1YUDA 4WBBA 1ZZ9A 1CAWA 1TQ5A 5FLIA 3O14A 1O3SA 1RUOA 2XLFA 3BPZA 4IEXA 5I8TA 2KXLA 2WSSH 3EO6A 4META 3IDCB 2BNNA 3LWCA 1EYBA 4Q0PA 2XL7A 1WGPA 5LRSA 1FT9A 1PM7A 4UBHA 5CU1A 2Z2SB 4MH0E 2ET7A 1LRHA 1ZZ8A 2IXLA 3E5QA 2OPKA 3IWZA 4LA2A 2Q4SA 3H1YA 3LZZA 3E6BA 2VPVA 1SFNA 4ZU7A 2WFPA 3S7EA 1SQ4A 1XRUA 4IERA 2Z69A 5EFUA 4YARA 4DJGA 4I01A 5D1IA 5FLJA 5J48A 2QNKA 4I0AA 4HVQA 3HIFA 2HJIA 2PHDA 3EFFK 3KCCA 1DZRA 4N9IA 3MDPA 3WW2A 2ZKLA 4XF3A 1NE4A 5C6CA 2XL9A 2HKXA 3OGJA 3H3UA 1OFNA 1QWRA 4KWLA 4EWDA 3B02A 2CAVA 5KBFA 4KU8A 2PYTA 2CGPA 3FZ3A 2K0GA 1OMIA 1BSHA 3UKVA 3E5UA 3PNAA 1UD1A 4LULA 1LR5A 1SEFA 1X7NA 4ORFA 2GU9A 4MUVA 5BY5A 5KHJA 4KWJA 1L3JA 3ELNA 4FT8A 4EWEA 3SCFA 5JCTA 3PLQA 5LRRA 4IEOA 4IETA 2QDRA 1CAXB 5FDBA 1ZX5A 3DV8A 4LUMA 1X82A 3BALA 3NL1A 3OCPA 2BGCA 2PAEA 3EQEA 2OA2A 4XETA 1IPKA 2IXIA 1YFYA 3KGLA 1RL3A 4LUKA 5FPXA 4KL1A 1UIJA 3KMHA 5J3UA 1UW8A 4IEVA 3GYDA 3EHKA 5I93A 2XHKA 3WW3A 4IEPA 2BNMA 3WW1A 3TNQA 2PFWA 4K8FA 1YFXA 2ET1A 1YLLA 3BB6A 3CLPA 3VHRA 5E1RA 5I0TA 3FJSA 4Z82A 1UIKA 2MPFA 3OD0A 2PAKA 1VP6A 1XE7A 2I45A 4XF9A 2IXCA 3M3IA 1JEKA 2ETEA 4I09A 3LA3A 3NSTA 3RPQA 2H0VA 1XE8A 3KSCA 2EAAA 4MGYE 4AVBA 4QGLA 3PJSK 3E6DA 4E2GA 3BCWA 3MZHA 1AQTA 4HZFA 1J1LA 2QVSB 3H9AA 2IXJA 1X8EA 5I0UA 3EBRA 3BU7A 4FBFA 4XFGA 1CAUB 1FS0E 3SCGA 3I59A 2OZJA 4YNIA 4HMZA 2F4PA 4ZU4A 4GULA 3HQXA 3H50A 1CGPA 1DZTA 1VR3A 3U11A 1I6XA 3RNSA 2C0ZA 2JDIH 2XKOA 4HN1A 3MYXA 4HLTA 2IXKA 2D5FA 3QACA 3DKWA 4XFBA 1J58A 3QOPA 3RYPA 2W6JH 2MNGA 4O9GA 4BHPA 1GQGA 5C8WA 3ACLA 2PAMA 2ATFA 1BSNA 2GZWA 5JR7B 3LA7A 4ZU5A 5J7MA 3ES1A 3CJXA 5JAXA 1RC6A 1VJ2A 4R52A 3S7IA 4NVPA 4Q0QA 4D7SA 4EROA 3LAGA 1FI2A 1HW5A 4I0BA 4I02A 4XF0A 3UKTA 2O8QA 3N4MA 3NVCA 4B29A 2UYAA 3NW4A 2P17A 3I54A 3GBFA 2B5HA 2D93A 2Q1ZB 1ZRCA 2E5YA 2QCSB 1QY4A 4JVAA 4XF4A 3M70A 2CK3H 3E97A 4Z07A 5BV6A 1O7FA 1RUNA 3CO2A 4PIYA 1UPIA 4ONUA 1O5LA 2WC2A 2FQPA 5I91A 4HVRA 4N9HA 3NJZA 3I7DA 4QX5A 4XF1A 5KHIA 4WZCA 1O4TA 3CF6E 2GC3A 1WLTA 2Y0OA 2VECA 2UY9A 3UKNA 3D0SA 4MX3A 2GC0A 3KGZA 2D5HA 3EJKA 4MGKE 3IBMA 5JSPA 2O1QA 1ZZ7A 4AVAA 1E79H 5HI0A 3D0JA 1PMIA 3SCHA 4WVZA 2XGXA 4E2SA 2H6CA 1ZVFA 3PVBB 5KHHA 3C3VA 1Y3TA 2PTMA 3FFQA 4LTAA 1CAVA 4HBNA 1J3QA 1EP0A 5BPXA 5LEKA 2EA7A 1CX4A 2IC1A 4PIZA 1H1IA 1X8MA 2QE7H 3E5XA 4IEQA 1CAVB 2MHFA 5I8YA 1CAXA 1IFPA 3H7YA 4XFCA 5F1RA 3CEWA 2PQQA 2E5TA 4Q29A 5EZWA 2FMYA 2GH2A 4I2OA 1NXMA 4QMAA 4IEUA 4X6RB 3NKTA 1NZCA 4JV4A 2GAUA 4L2NA 3HT2A 1V70A 4JTNA 2XKPA 1JUHA 1QXJA 1Y9QA 5FLHA 4OLLA 4QGMA 3HT1A 2B9UA 3FX3A 4IEZA 2BEOA 3H1MA 1GQHA 4LLOA 2XLGA 1Q5OA 1YFWA 2VQAA 4DINB 2E9QA 3FWEA 5JSOA 4J1WA 5FCCA 4QXKA 2BNOA
chains in the Genus database with same CATH superfamily
1U5IA 3R6SA 2CPSA 3AC0A 5IW0A 2E76B 5KKZB 1UOGA 4AEJA 5AVRB 1O3RA 5H2FH 4XFFA 1FJKA 4YM3A 4W50A 2VMCA 2VL4A 3WR0A 2PXJA 4BXLA 1PGW2 2Q0AA 4IW3A 4AI1A 4B1MA 4NIGA 2P6HA 3LIDA 4MN4C 1GK4A 1F4HA 2J22A 3CZJA 4K7JA 1KB9E 3UGGA 4AXOA 4Z2WA 2DVFA 4OFGA 3HQUA 4TSVA 4G3YC 4YW4A 2JB8A 1IPSA 5IK8A 1OVVA 4LO6B 3FHIB 2N1TA 1W8FA 2OYZA 3V64A 5CADA 4C1WA 4OWFA 5FZEA 4LEJA 3AE5C 2V73A 5FXZA 5JXHA 4XTPA 5FPZA 2D98A 1AYN3 1NE6A 2RMU3 3H1WA 1H30A 3HBKA 3OYWA 4LE4A 1YJKA 2VZPA 2E31A 3AVSA 4GWNA 1ZRRA 4MV2A 4QX0A 5GZCA 1L0ND 3O6QB 3DEMA 3GGLA 5A3WA 4BA6A 4CP9A 1H1MA 1ZBE1 1N8RQ 3OBZA 1Y47A 1YTZI 2Q3IA 2OTJP 1VF5B 1VDFA 3H1HG 2WLQA 3FL7A 3AE7C 1Y7BA 2ES3A 2MEV1 2ZGRA 3WF1A 1LEDA 2VW0A 3ZXFA 1U12A 5L9VA 3W58A 2GNTA 4B86A 2VBDA 3A4UA 4N78D 2ADEA 1GNZA 3GZEA 1ONAA 1FV2A 4OZXA 4NIHA 4FXKB 2OYIC 1WRGA 3RZGA 2Q1MA 1BYHA 2R1DA 4CXXA 2FD8A 1COV2 4E2QA 3RK3D 1V6JA 1VBB3 4CUAA 3KD4A 1P8JA 5K5GB 3VD4A 3AFKA 1MS5A 5T50A 4LC1A 5A1AA 1BE3J 3USSA 3W20A 4XUOA 5FP7A 2CY6A 3WLUA 1NTMD 2HBUA 3SSUA 2Q8DA 4GOEA 3RWNA 3G71P 4J25A 3U78A 1OURA 3CJIB 1QH6A 1K42A 1B09A 3CWBD 5L73A 1JYXA 4YYOA 2DU0A 1K5JA 3H8RA 4DEQA 5I8SA 5CB7A 1JCCA 4KWKA 3AP5A 2E7AA 2KK7A 2K9ZA 4XFIA 4PJYA 4TZDA 3L72J 4K35A 3A0BH 1OH4A 3P1IA 3POWA 4HETA 1BCXA 3DECA 3HE5A 3ES4A 1W6OA 1XU2A 2EVXA 4GWMA 4XFHA 1HXS2 2W52A 5FBJA 1SQPD 2CHHA 3WDYA 4YTPC 1NY71 1GICA 4CDXC 5DXDA 3RQ0A 5F7UA 4JF7A 5AC93 1KD1Q 3K46A 4XHXA 4GQ7A 4JDNA 1KYOE 2P37A 3T09A 2FCUA 4G4FA 4OI2A 4BOWA 5BUVA 1EPZA 2NPSC 4U3FE 5GTIH 2BEQD 1BZWA 4Y3OA 3VZMA 5JWPA 1LHNA 1W2UA 1CWPA 4NHYA 3VUOA 4DOJA 3B5ND 1NCQC 1URXA 4GODA 2YMZA 1NYWA 1YIJP 3QLQA 3A0KA 1W2NA 4L11A 4LBKA 1FATA 5EJZB 2DCTA 3WU2H 4DRRA 2RM23 3KF3A 1UU5A 1S5LX 4DY3A 3JD73 4Q4Y1 1W6PB 3LEMA 1OOPA 3BCCG 4LXLA 3AEAC 3ZDSA 1SLLA 2YU1A 4JGYC 1OD3A 1JYWA 1RUD2 3JZVA 4XE9A 1MEC2 4QX1A 3T1LA 3IFMA 3A2AA 4GALA 1BJQA 5F3CA 3O1SA 4I7ZB 5KLVE 5LCWL 5DZGA 1ND3B 3FLRA 1UYXA 2I8DA 1D2QA 2V4VA 3BI3A 1IZNB 2JG8B 3GM8A 4LIUA 4TLFA 1W9SA 4D6SA 1ULEA 4NMIA 3Q3DA 2RKLA 3ZFFA 3ZXLA 2GC1A 2GN3A 4BH9A 4COUA 4O9EA 1L4AA 5A7WB 1F31A 4HANA 1YFUA 5BNNB 2VNOA 1REDA 1I9RA 1W2TA 3AL5A 1DU3D 3HE4A 1YQ8A 3IMNA 4NRPA 2IFMA 1BEV3 1NOHA 5A32B 1LB2A 2CTVA 1XJAA 4MO3M 2W47A 3L72E 4YXWH 1V6IA 2KD7A 3ACIA 2ZCWA 3WUTA 3BYWA 1QH7A 3H3LA 4Y33A 5FYVA 3U0ZA 2KZJA 4R8HA 3I3MA 5FPUA 1W8NA 4A41A 4B7EA 2DUPA 4BQYA 4M4RA 5FY1A 4XZUG 2AXTE 1QVFO 4CCLA 4P9WA 2D3SA 4Y28J 4EZHA 5IVFA 2KIKA 2ZKNA 4JGZB 2WA4A 4RYDA 3CI9A 2W87A 1LOBA 2FYNB 2PRRA 1HRV3 3RYKA 2Q5TA 4YRDA 2P10A 3H1JE 1J3PA 1FMD2 3D82A 4NPRA 5A3UA 2QBXA 2ZX1A 2V7QJ 4JYBA 2W1UA 1JYCA 3QH6A 5D8AC 1S9KD 1LKNA 1KMIZ 2JKVA 5HCAA 3R2PA 3A0HE 1JY2P 2F6BA 4JKLA 3M0AA 5FYYA 1F8VA 3PDQA 3P7KA 1O3QA 3DXUA 2QJVA 5FZ6A 3LOIA 2ZX2A 3BUCA 2VUAA 3JXSA 3ZFEC 3ZO0B 2HWE3 3LSDA 3VBSC 3NMDA 1YUDA 4WBBA 1ZZ9A 4YPJA 1LTEA 1S4CA 3IN6A 3DXTA 4QPIB 4XA4A 3VZJA 3WNXA 5JDBA 2ZMLA 3EB7A 1ENQA 5JXIA 4ZMDA 2E51A 2HEVF 3B9IA 1PGQA 5I8TA 1QOTA 1DIWA 4I0WB 3IDCB 1NKZB 1UWWA 4QPYA 3ZYGA 2HWE2 4WM8C 2E33A 1L4AC 3HE5B 1FT9A 4D94A 1A34A 3TEYA 1ENRA 5CU1A 1G9FA 1LP1A 2BUKA 3H25A 5AVQB 1QVGO 1R1ZA 3B94A 4BB3A 4QPGB 2HODA 4AK3A 1S4XA 4XYXA 1SQXJ 1KFNA 4H44B 1VF5D 4LO7A 5FY7A 2OPKA 3IWZA 3GHNA 1K73Q 4LA2A 5FPLA 3GDBA 4DUVA 5AVYB 4ZU7A 2L5GB 2WKKA 1JTZX 4XHBA 2JDPA 4QB2A 2A3WA 5CHXA 1O8PA 3ME2A 3SKVA 1WD4A 3SH3A 3VTPC 3AMPA 1CSBA 3VBRB 5F5CA 5C5UA 4AFDA 3VD3A 3B00A 3OUIA 1W04A 1JY3O 4DJGA 1VIWB 4B3NA 2NMNA 4D6QA 1OOPB 4QDQA 1IGOA 1PNGA 2YZ4A 4CRQA 1HN1A 5J48A 4TTGA 5FZHA 4YZ1A 4AQTA 5CG8A 1D2SA 2X09A 3KCCA 2PHDA 4QPGA 5C9AC 2ZEXA 5JUVA 1DZRA 1OIPA 5LA1A 2BEZF 4R4XA 2G9FA 2JG8A 3RI9A 3KS7A 4XF3A 2W6AA 4QDSA 1NE4A 2R1BA 3PMSA 5LATA 4LNVA 3ZYJB 4Y1XA 1D4M3 2E43A 1HQWA 3H1KG 4KWLA 2HEYF 1QDOA 5A3OA 1PGJA 3B02A 3K3OA 3MUY1 2RS33 4IV3A 5KR7A 5E89A 3ATGA 4UAPA 2YC2A 1NAYA 1REEA 2NPSD 1DFQA 3CL3D 2PYTA 2VMIA 4R9DA 4YG6A 3T2OA 1OX3A 3PVEA 3J7NA 3NV4A 5GTHH 2LS6A 1LU2A 1UD1A 1JZ3A 4AEKA 2WL1A 3W59A 3ZMNA 2A45I 1REFA 2GU9A 4MUVA 4BQWA 2VW1A 3ZDMA 1HV1A 1L3JA 1YJWP 4KWJA 3I55P 1Z0HA 2X10A 4NIAA 3D70A 1CPNA 1W8UA 2VOVA 2JIJA 2RVAA 2XVKA 3I2FA 3ZXAC 2FDKA 1SQBJ 2HH9A 1UZVA 2WRAA 2W46A 1RINA 1CAXB 1PO23 2BTVC 2DBNA 4YG0A 1NLRA 3DV8A 5FDBA 4LOTA 5KXBA 1JYNA 1O4ZA 2WO2A 2GM4A 2WPVB 5KLIC 4CUGA 1ZRTE 3K4ZA 5FZ1A 5C3PA 3AMHA 1Y9GA 4Z1MH 1E5IA 2ZPXA 4JYCA 1SPPB 1VBD2 4BQ3A 5J3UA 1FZCC 1SG3A 4AYCA 1UW8A 1BLZA 3WF0A 5CISA 3GYDA 2FDFA 1ZRIA 3BRVB 2J1TA 1N3PA 1X79B 4B4RA 2BVBA 5BNNA 5BU8B 1R1A1 3QD6A 4IL7A 4GKXA 2L9LA 4I1LA 3RMYA 1BXHA 2AEZA 1AVYA 3GLMA 4QXHA 4MYEA 1WT6A 4H44C 1F4AA 1ULFA 4UI9L 4CPGA 5HCFA 3UGHA 3ZYIB 4QU1A 2JWDA 1YFXA 3L75J 5GLZA 5JPNB 2ET1A 1DHKB 1V6MA 1YLLA 3BB6A 3PVOA 1AF9A 2YBSA 4AVVA 2LRPA 2VVDA 1OUSA 3IM0A 1H89A 2GP3A 1T6AA 5F3EA 3WF4A 1POV3 2QTWB 2AH2A 2ZMNA 5D2AA 5B4XA 5E1RA 4QB1A 1Q82Q 2FDHA 1GL2D 2JKBA 3FJSA 1RUF2 3ALQA 4HKOA 3L36A 1L0NJ 2WA3A 4D0QA 2Z4EA 3VLBB 2NN8A 1VP6A 4PDWC 1GW4A 2I45A 5CZKA 2IXCA 4L74A 2DDUA 1JEKA 3RFRA 4QKDA 2NZ9A 1FAVA 2KOGA 2F17A 3HR9A 4FQ4A 4D7SA 4LJHA 5KLVK 3RPQA 1U5YA 1IZ3A 1UNBA 1WCQA 4A42A 2K9JB 2D2CB 3KSCA 2RS32 4ZNCA 3L2YA 3R0RA 1FOD3 4QU2A 1KRIA 2OYIA 1VQKP 4P02B 1D0GA 3V6IA 4NPMA 5E6HA 1HRI1 3VN0A 3T2QA 1SCSA 2A3XA 5KJ7A 2QQVA 2FYNC 5H9PA 2QVSB 1GZWA 2ERFA 3AMQA 4WM7C 4IFDK 4PD4I 1H0TA 3UT0A 4BMBA 5HCHA 3BOWA 4AEDA 1X8EA 3CBNA 5C8CB 1UOJA 3WSOA 4XFGA 3L71J 5C33A 2B88A 1PO11 2Q5UA 2OIIA 2RE9A 1CAUB 4GH4C 4XQ4A 1FS0E 1US2A 5EWSA 4AR2A 5F37A 1GMJA 2OZJA 2KZIA 3TGUG 1JXNA 4MHUA 4CCMA 1JU4A 2G19A 2WSFJ 2F4PA 2R073 4ZU4A 3CDZB 3GW6A 4N53B 4XABA 2J1VA 5CNAA 3DYPA 4GULA 3IAPA 3T0DA 1UMZA 3VKMA 2JDYA 1P84I 1HJ0A 2JG9B 5A3NA 3U11A 3VL9A 5LY2A 2K9YA 1XC6A 3O12A 2JXAA 4BMEA 2WT1A 1LT1A 4DT0A 1AHSA 1NYHA 5B66E 1RUG1 3I3DA 1NU1K 4FOYA 1HQLA 4M01A 3I49A 2B87B 2IXKA 3V2QA 2QEXP 1TG7A 1Q8OA 2D5FA 4IE6A 5JVVA 2FBWC 3DKWA 4LHSA 4CPBA 1NAFA 1J58A 2A6XA 5DUWA 5C4WC 2W6JH 4O9GA 2OUJA 5FZ9A 4CDXB 4Q5OA 4RFRB 1PX4A 3BASA 3G4SP 5E8AA 3WDTA 3WHTA 4IE4A 4JQ0D 3DPRA 4JDOA 3J7HA 3LDKA 2IBZG 1NXD1 1GQGA 5C8WA 1HKDA 1KILE 2ATFA 5IT6A 3LEKA 4N53A 2VZOA 5GZEA 1LOEA 3LGRA 5FJKA 1RF1A 4WVMA 5DPNA 2CYFA 4IXLA 5CFCB 1OUXA 1BCCD 3IDAA 4ARXA 4XTMA 1JZ5A 1XTGB 2FYUG 3HN1A 3ZN6B 1BGYG 2NPSB 3WNMA 1RF1C 3VMZA 3N9OA 5FO7B 1W99A 4BK4A 2YFZA 4NIDA 2I74A 2VMDA 4Q1PA 5FY0A 2KI7B 1RMU2 1CZQA 2DUOA 1KS4A 2VNGA 3K48A 3GHMA 1MS3A 1V0AA 2W95A 4NHXA 3ZR5A 2KNCA 3K77A 4BK5A 4MG2A 1DF0A 1HXS3 1HW5A 3L75G 4I0BA 4YVSC 4I02A 4HYTB 5BVZA 4M3CE 4XCAA 2O8QA 3A0NA 2W39A 3BCCD 4FPYA 3VB9A 2FZ1A 3HBZA 1H8TB 3RL0C 2YXQB 1LGHB 1CX1A 2IZ0A 2B9VA 3GBFA 3VOPA 5EYYA 2D93A 2Q1ZB 4FP3A 3TF5A 4E4SA 3WQ0A 2B42B 3IAQA 3JSVC 3BATA 1QL2A 3S57A 2RG4A 3RVHA 2E5YA 4U3FJ 1MZ6A 2ZHMA 4LT5A 1FMD1 1QHDA 4AWDA 3RL0D 4XF4A 4Z07A 3IR9A 1RUE1 1O7FA 1RUNA 2YFUA 1VB2A 2R44A 2XBO2 2OYIB 4HVRA 2QQLA 2VW2A 2RR11 1TME3 4EZ4A 5E79H 3CXHD 2W5FA 2R072 1ZXGA 3LSEA 1N7SB 3JBG2 4INDA 4CU6A 5APYA 5ISLA 2EIEA 5I91A 1YQ2A 3BIEA 3D6EA 1TZOA 2JD9A 1N7LA 1M57D 4D6TG 1O4TA 2BW8A 2Y34A 5CFDA 3VV1A 4CU9A 5C4WB 1KJLA 4NHMA 1DGWX 5C7GA 4LORA 5TISE 5IATA 1S0JA 2E76C 5KKZC 4EYYQ 3AEGC 1NQJA 1R083 1TNFA 2GC0A 3C7OA 3FUQA 4DUXA 3EJKA 2JJ6A 3SH5A 1KC8Q 2JDNA 5EJ1B 1J83A 1PO13 3IBMA 1TE1B 2VJXA 1SLAA 5JSPA 3V0AA 3VBUB 2FYUD 3KB5A 3MIGA 2VTXA 5EQUA 4AVAA 2ZXQA 3LDBA 1HUCA 1QJX2 1OW7A 2QSIA 4OGQD 2N1TB 2FKWB 3M06A 5BU5A 1CIWA 1JNMA 2R071 1ODMA 1NCQA 3MO4A 3M4FA 3BCCJ 3FFZA 4WVZA 2RS13 2XGXA 3HPNA 2WSFH 4BE3A 3K4AA 1RE3A 3INAA 4K8RB 2BRTA 4GH4B 2H0BA 4Q27A 5KHHA 1OKOA 3VD9A 4V2VA 2BP6A 2WNVA 3IZOA 1POV1 3VBOC 1HH0A 1VL2A 3B5NB 3L74J 4LBQA 4LTAA 1CAVA 2PAJA 1OF4A 1YCIA 2BDRA 3NV3A 3J9SA 1RUJ1 3VBFC 1PP9J 1HB2A 1EP0A 2EXKA 1V9U2 3FHAA 4CDQC 5L7OB 4RJTA 1JY3N 2Q8CA 5JIUA 1PPJD 3VBFA 5LW9A 2XJTA 4OQ8A 1LTTC 1X8MA 2V4AA 2WZR2 1BCCJ 1D7MA 1AR92 1ZR2A 2JEEA 4C46A 2Q9IA 1HXS1 1S0GA 4IEQA 5JIAA 4C0HA 1W8TA 1CAXA 1LOFA 1K04A 3H7YA 1DQ6A 2Z42A 3O5SA 2FDJA 1NKNA 3A7OA 2XJSA 2D6KA 2B4KA 5DG1A 2O0OA 1AL0G 1UO9A 5EZWA 3C8XA 2GH2A 4I2OA 5KXEA 2P7JA 2VCBA 5APVA 2X53S 3I2KA 1SQBK 3C1LA 2SPZA 4FQZA 4LHKA 4DNYA 4XZPA 1HGZA 2LALA 4X6RB 5GLTA 3B9CA 1IG0A 1Y4WA 2UWCA 2O3JA 5L9BA 1NZCA 4DY5A 3GMAA 2VXRA 1UXXX 3VGIA 1YQ6A 1SFCD 1KQLA 4XJ8A 5IK4A 1JUHA 3TGUJ 4ISQA 3S4RA 1QXJA 5K0UA 3H1JG 5DMYA 1BDCA 4OLLA 2A6WA 2KP8A 1A8MA 2PELA 4QGMA 1H4GA 3JD72 3HT1A 3K2OA 2WNOA 4FP2A 3NNGA 2GSYA 5DZFA 5FYHA 5IAVA 3KCXA 3KHUA 3ACGA 4WB4A 1W8HA 3GG2A 2EF6A 1UMIA 4OHXA 5DN2A 3VL8A 2XLGA 1SQVG 3V2NA 1OT5A 2VQAA 4DINB 5JPMB 4H55A 5FRAA 5A80A 3K5BA 1LHUA 4M0HA 5AC91 3EWKA 3V4WA 4QXKA 4M3LA 3ZLIA 1YBKA 1MS0A 1YI2P 2VZUA 3N36A 3WNNA 1QXRA 5APQA 1S2KA 1AFOA 3HN3A 4A7ZA 1GK6A 4H13B 5KHKA 5KJ7C 1UZ0A 1V6NA 2FZ2A 2MJZA 1XU1A 1RTVA 3L71E 2JE8A 2WN2A 2BFUL 1K5MB 1SFYA 2IVJA 2VMEA 4PF1A 1BEV2 2A75A 2WSVA 1GU4A 2Z4FA 4Z92B 3FBMA 1PZQA 2J1AA 3MZHA 4AI2A 1KORA 3LPGA 2JD4A 2WO7A 2QQWA 2YU2A 5GTHE 4Q0UA 2EIDA 2F4LA 3KVAA 3ZSJA 1O91A 3SEPA 4W65A 3ZYBA 4B7KA 1WCUA 4OUSA 4UW4A 4GT1A 3L73G 3JCIA 5ACA3 2ARCA 4S2HA 1IK7A 3H6PA 2WS93 3HNBM 3N7LA 3PUSA 4ZPIA 5AW4B 1DDLA 3SNMA 5EP9A 5IWFA 4QGNA 2P2UA 5KLVJ 4B1LA 1Q8VA 4F7ZA 1FMD3 4EV0A 1PGOA 2JKXA 4ZKUA 1P84H 5ABJA 3AMNA 3ABVC 3WMM0 1EPWA 3I59B 1YIFA 2V09A 4PHZA 1NHLA 2NYYA 5J1XA 2YC4A 4WBAA 1LNQA 1Z7S1 4JCKA 4QM9A 2Y26A 3A21A 2QQNA 1SS1A 1ZR4A 3NAPB 4CCKA 5JOXA 4RQPA 3USUB 1FOSE 4NHKA 2EIBA 2HWE1 1I5ZA 2B9BA 2JDUA 2ZS6B 3QBQA 2WT2A 1XYOA 2OT7A 5H9RA 5A3MA 5IVEA 2HBTA 2OZ6A 4PIXA 1JZ6A 3IDBB 4UFKA 4S2GA 1G6NA 3B5LB 3RJ2X 1US3A 4WZFA 2J58A 4LKDA 4DZOA 1ND2C 1J1EC 4XVHA 5CKMA 3DYOA 2W1SA 1VQPP 4XJUA 1NJIQ 2VOXA 1PZ8A 3POGA 3VBRC 3WW1A 1ZRFA 4HK8A 3LFMA 4F83A 3GF6A 4MXWB 3URFA 3GHGA 5FZCA 1AR71 2PHUA 1RF0A 2D6NA 2XG3A 4CDUB 1DYKA 5JR2A 1TME1 4KU7A 4KGQA 3WT3A 4WM8A 3H3ZA 1J2JB 4EI2A 1LTIC 1Q8PA 1RF0C 1O5UA 5EHDA 2BASA 1UYYA 4LMFA 3WV6A 4AI9A 4CXWA 4R9BA 5FOBB 1DCSA 2G9GA 1FZEA 3P8MC 1LP1B 2WMMA 3AB0A 5GKAC 4CYDA 1ZRDA 1W6PA 3WUCA 4LR4A 3KV9A 4NRQA 4LO5B 2PN5A 2C9KA 4AVSA 4Y1UA 3I5CA 4JTOA 1NTME 3CLQA 2HYNA 3H1KE 3H1LG 5KLVD 1GV9A 1LNSA 2OTLP 3GF7A 1ZNPA 2VZ3A 3IIAA 3WUVA 1AL22 1KDKA 1ND3C 1VBC2 3DKQA 3SEEA 4AGGA 2Y9YA 2H6BA 3FBYA 2W3JA 4R4ZA 3NNMA 4JX0A 1IFIA 4AI8A 1W9TA 3NV2A 4H7LA 1JHNA 3K4DA 4JGZC 2BV4A 2N7GA 4JGYB 2WQ8A 2W2IA 1WW7A 3WD5A 3L70D 1QLED 4LBLA 1DGWA 2JDKA 1LENA 1D4M2 3GZAA 3I2IA 3IPVB 4YZ4A 5FBZA 3OTFA 3H8XA 1NTZK 4WVWA 3MI8A 1F15A 4BYYA 2YKOA 1PK6C 5AVZB 1ZZCA 5BNOB 5A33A 3KV4A 1NLSA 1NY72 4XUPA 3UK9A 5LY1A 2O01N 2OYOA 2D6PA 1XPWA 2YG0A 2ZEWA 3OBAA 4UBGA 1GL2B 2D7FA 2V7QH 4JBZA 5FZGA 1UZZA 2WPQA 4Q0SA 4YW1A 1PZ9A 4AFCA 1W03A 4FPHA 1AJYA 4BPZA 4A7YA 2SBAA 5J98B 3AZXA 4FPGA 2RMZA 5FUIA 2PGDA 1Q43A 3S1KA 2B8MA 3ZXDA 2O1KA 2ZAHA 4BQ5A 5GZGA 1Y43B 4LA3A 1OLME 3MUZ1 2A70A 3A5TA 3UJQA 1M1JA 2X8KA 3RL0g 4P9IA 4Y20A 5FQ0A 2A06G 3VP9A 3ETQA 3H8UA 4KH9A 4GMP1 1D4M1 1OFCX 4RD7A 4YVSB 4A6SA 1KILB 5A3PA 2AUYA 4AHYA 5FXWA 1H0BA 3TBDA 1IJDB 3POYA 1EUUA 3ZYPA 1CONA 5FP8A 3V56A 2ADDA 2VQUA 3BIWE 1EY2A 3MF6A 3MW4A 1AA0A 4IEYA 1WA4A 5CCHC 1J1EB 4QM8A 3M9HA 3OA7A 5GZFA 1OFSA 1IFJA 3VKFC 1NAEA 1W9FA 2C9LY 1DEBA 2W91A 3CHXA 1UCXA 4K6BA 3VBUA 5IVBA 3V0AB 3W5MA 5CCHA 2GDFA 4KBZA 1Z7S3 3BN6A 2WDBA 5I0RA 1EAH1 2DFCA 4RS5C 1S55A 4LBNA 3L2HA 1VQ8P 5DDJ3 5LK5A 3PHLA 1WMXA 1GTWA 1W9YA 4A7KA 2FMDA 1E57A 5EXOA 4GH4A 4ZS3A 4WY4B 5JZGC 1NOVA 1VF5C 1CAWA 4H7MA 1CZVA 1OLQA 2C0XA 3ZXJA 4PD4E 1W2BO 4W7ZA 1IS4A 4L92A 4LO4B 3VMYA 2AENA 2XLFA 4MOAA 3THPA 3WG3A 1RUOA 4GB32 1TU3F 5KAIE 2KXLA 3EO6A 3KHBA 4H13C 4JPZB 1WA6X 2BNNA 1CW5A 1SLIA 4YM2A 1S0BA 3VKLA 5F6LB 3MIBA 2I1JA 2Q3EA 2GUSA 3U4XA 1PM7A 4UBHA 5A6YA 1W28A 1L2PA 4OULA 1IFNA 4NPFX 1ZYBA 1M1JC 3CCMP 2PHXA 4NWWA 1ZZ8A 2C4XA 2IXLA 3G9RA 4JHZA 4P9LA 1FDIA 1FZBA 5GLWA 3VKOA 5K0UC 3KF5A 1SQBD 4Q4Y3 1G2CA 1HWTC 1MQTB 3HD7C 3H1KD 3CPWO 3J8F3 1JY2N 1W06A 1SQVJ 3RK3C 2AXCA 1XRUA 3KWVA 3WVJA 5EFUA 4M3CA 3EYPA 1AR72 4NHLA 4I01A 3VBOA 2W6BA 2DUQA 1TME2 5C8CC 4EN6B 3AKTA 2EXHA 4LPLA 5FLJA 1OW6A 2VAUA 4CXYA 4NUBA 1N1SA 1WLDA 3N9LA 4I0AA 4HVQA 1DQ2A 3M3QA 5L9RA 4AE2A 1QQP1 3MW2A 3EFFK 5A6XA 1VBE3 1AR73 3O0WA 1PPJG 3NNJA 2ZKLA 2Y0EA 2W83C 1LWUA 2GMEA 5F1RA 4NN0A 3ILRA 2KM2A 3HUSB 1AZDA 3ILFA 2R5BA 1OLMA 1OFNA 3N35A 5FPBA 2ZYDA 3UL2A 1PVXA 4EN7B 5FZFA 4ASMB 5KBFA 4RGAA 1NKGA 4B8EA 1NTZD 4KU8A 1GUIA 2AR6A 4ZZ5A 2EIGA 1MUUA 3WNOA 2NM1A 2IZWA 4JRAA 2HWC2 3I3QA 1OMIA 1BSHA 4YW3A 3E7KA 4GMP0 5LA2A 2XU6A 3UKVA 1ASJ2 5IAXA 2NQYA 2HWF1 2VTXJ 2BCCE 1SEFA 2ZGQA 4LULA 3VZNA 5KHJA 4PV1D 3ELNA 1OA2A 2RS53 2W0XA 3G6JB 5DDJ2 1C5IA 2I2SA 4FT8A 4D6TJ 1RVF2 1AR63 3SCFA 5JCTA 2XKMA 4OVEA 1AUYA 3PLQA 3QCWA 5LRRA 4M0NA 2QDRA 5A1FA 4JAAA 1ODNA 2BJSA 2E74B 5IJRA 2ZFCA 1L0LK 4CA9A 3BALA 2XONA 1UKRA 1FU1A 2J1SA 2RS52 3OYWB 2NZ2A 2BGCA 3PTRB 3WUUA 2JDZA 1N73B 1IPKA 4NOTA 1RL3A 1Q86Q 1U5ZA 4KL1A 4LUKA 1UIJA 4R4MA 3KMHA 3VBFB 4Q8KA 5CFDC 3CX5I 3ZKUA 1YNAA 2ZXXA 3AE8C 5KC5A 1LAJA 3AK0A 3EHKA 2OKXA 2P3JA 2GH8A 5HXVA 1VBA3 2VZ1A 2LKMA 1B35C 3NKGA 3PH0A 4XBLA 4UB8E 4IEPA 4GD4A 2BNMA 5FP4A 1DD3A 3OGRA 2ZGOA 5FYBA 2G3AA 1AR81 1QJU1 4OVNF 3FHQA 2C24A 3V5BA 2WWUA 3K51A 4GA9A 4L97A 3CJIA 3L74E 2JEMA 1MS1A 2YXRB 1SDDB 2VNVA 2WO3A 3NNFA 4I3GA 3MHVA 1NA1B 2K9JA 4L0PA 5FXXA 3VZLA 3ZSLA 1DX7A 1S1CX 1VMFA 3CLPA 1VQ9P 3FLTA 1PL5A 2XHNA 4XBNA 5EPAA 4CEWB 1YQ4C 3LEIA 4FOQA 1IKPA 3WEZA 3CZUA 3VHRA 3WQ1A 5APUA 1LGBA 1LGCA 3Q2YA 2PLV2 1URQD 4YG3A 5I0TA 4DUWA 3SQOA 1VRH3 3Q5PA 5APWA 1RITA 1FBMA 3PP5A 5KAFE 2MPFA 4LLHA 3T3YA 1DQ5A 5C70A 4AYUA 5C71A 1SQXK 2PFXA 1MQTA 1XE0A 4HKZH 2PAKA 3RZLA 1N7SC 1JS9A 4R9CA 1X9TA 3JBG3 3OUHA 1U7JA 4DEVA 3LIHA 2VO5A 2BGPA 5FZKA 5F3IA 4XE5B 2HWD2 1QNYA 5CBLA 3O8ZA 2W92A 4BM8A 4COZA 4DRVA 2ARXA 3S5AA 1QJX1 1V00A 2TEPA 2AXTH 3B71A 5KJ7D 1WKYA 2NLRA 1KJRA 3ECQA 2UWBA 3E6DA 3MFCA 4H2AA 4QGLA 1BCCG 3BTYA 1L0NE 4GIFA 5IUQA 1SQXD 1AQTA 3KPEA 4NRMA 1J1LA 3VDCA 1HRI2 1RUD3 2QKDA 1HGVA 3HUSA 1GKBA 2IXJA 5C5TA 1QJFA 2RN0A 3BU7A 1LWUB 4LBOA 3H1LD 2XWJB 3WP5A 4BXSV 3GNEA 3RL0B 4P08A 4FBFA 2B87A 3II6A 3T2PA 1AR62 3UNPA 3HD7B 4HH2A 3A3YB 1RUJ2 4YW5A 1O4YA 4XXAA 5BNQA 1OA4A 3A7QA 2XJQA 1GANA 1PVC3 3IN9A 4A3XA 3RJRA 4HMZA 1SQVK 3CKHA 1BGYJ 4MXVA 4XUNA 2O01J 1GNHA 4QQLA 1OBNA 3KZ4C 1M1JB 1JO5A 1JTHB 1PFIA 5AW8B 1S0IA 1WW6A 1AXYA 1DZTA 5FOJB 1P84D 4M4PA 1NTMG 3I56P 1XXNA 2GNMA 1PP9E 1KYOH 1CZTA 1I6XA 1HV0A 1T6GC 2ZGPA 3APBA 4JKKA 1QQP2 2C0ZA 2FYZA 5T55A 3I2JA 4AHZA 1ZW0A 4QQ2A 3MYXA 1LTSC 2QFEA 2WZ8A 3ZPOA 4HLTA 4YZ2A 1UXZA 3PUAA 4YZ5A 4XAEA 2YIUC 4IGPA 2Y0DA 1VMHA 2EICA 3QOPA 4FPOB 2QUOA 5CBNA 1AVBA 3L72G 2XWBB 4OHZA 3ZN6A 1HX6A 5AW2B 4UFMA 4CDUA 3CQOA 3KZIE 1J1TA 5ANQA 5T5OA 2YKQA 1EDIA 2QQJA 3AZYA 1RH5B 2M0BA 4GJYA 1BKZA 2PAMA 4Y4RA 5AVWB 1SZBA 5FYTA 1C57A 1XB9A 3AX4A 4PI2A 3ZXEA 1RHI1 3NRUA 4E8CA 4L75A 2A73B 1RXFA 1W0OA 3L73J 2HPCB 3OBRA 5FZ8A 2XVLA 3ACFA 1OW8A 2CSGA 3AYCA 4AUWA 3CJXA 2X29A 3K75B 1WCSA 5JAXA 2Q7CA 1C8M2 1RC6A 2ZVOB 1F5JA 1SP4A 3S7IA 3F5HA 4BLJA 4DFSA 4P00B 4KHXA 3G3ZA 4UB8H 3BPSA 4NVPA 1RXGA 4Q0QA 4UOJA 1GL2C 3PTZA 4A6OA 4BZ4A 4U3FG 4E27A 3J7LA 3Q8AA 5IFPA 3U1XA 4EROA 4NAOA 2FXMA 2XVGA 1JOBA 5APAA 1WBLA 2ILMA 4ZXEA 5FZOB 1KITA 2WNUA 5BNOC 1RQVA 4R9AA 1UY3A 1UQXA 2HWD3 2QM7A 1NVOA 1M1KQ 4EN8B 1IQDC 2K2SA 2UYAA 2J5UA 3B3QE 3NW4A 4UFJA 3TEZA 2P17A 2K1AA 3JB8A 2ZEYA 2B5HA 4QAWA 1HJGA 4RHV2 1EQ7A 5AFBA 5FFOC 3CWBJ 4EDFA 1ULCA 1ND3A 2ZGSA 1Q81Q 1HRI3 1KFMA 4URTA 2NMOA 1S0EA 2OS2A 1QY4A 2R7EB 2HODB 5BV6A 2CK3H 3AE1C 3E97A 5SV5A 2YBPA 3AMMA 4KGGA 3FLPA 4PIYA 3CO2A 1JYTA 2KB7P 4FSJA 1O5LA 1G2CB 1FZCA 2YGLA 2FQPA 2ZX3A 3O1TA 2YXSA 2XBO1 4N9HA 2G4IA 1A6CA 4YM1A 1PGL2 3L71G 2WQZC 4C7NA 3I7DA 3NJZA 1W0PA 3N9MA 3H1LJ 3AKQA 2RDSA 1MPXA 2VD7A 4RHV1 2GC3A 2WBKA 3N9NA 2N1TD 2XB6C 4Y4YA 2IBZE 1E5WA 5FYCA 4L99A 4AEDB 4UFIA 1VQ7P 1NTZE 1T8ZA 4C7RA 2P5BA 2UY9A 2VECA 5LBCA 2WNEA 3S9OA 3HQRA 3KGZA 2E53A 1ND2B 1N3QA 2XJUA 1YIPA 1VAMA 5BNPB 3C7FA 1FDOA 2O1QA 4JQRA 1ACCA 2UWAA 4XIKA 2VBBA 2VCAA 2BWAA 4CUBA 5HI0A 1JMUB 3OJAB 2JWAA 1PMIA 4PLNA 4WM8B 2RM21 5T54A 2XOMA 2O01H 4JGZA 1I3HA 1KGYA 1JODA 2VNRA 3LF7A 4JC1A 5GLUA 4E2SA 2H6CA 3L74G 4Q4X3 5IVVA 3PVBB 2WLPA 3HRNA 3UETA 3C3VA 2LTNA 1UL9A 3M9BA 3RZMA 1AYN1 3IAOA 1Z7S2 3FFQA 1H2KA 2A06E 2W27A 5CCGA 4IOIH 1IS6A 1RYYA 2CL2A 2DF7A 4XJWA 1V6KA 1PIV1 4LIVA 4WY4A 4CDWA 4RESB 1YO8A 1CVNA 3AEDC 1JN2P 4Q4X2 2EA7A 1CX4A 3H1IJ 2ZGTA 1TMF2 1BHGA 4RGGA 3WG4A 3TGUD 1RJ8A 4Y20B 2A6VA 4OUMA 1APNA 1LHWA 5C3RA 4MGYE 5FK7A 1X22A 2DURA 3PIJA 3ZFGA 4ASKA 3KXDA 2P4EA 2E5TA 1W2AX 4XMAA 2QVAA 1VQMP 2ZACA 5F39A 4HJGH 3O7OA 5FZOA 2FMYA 1HDKA 2YO2A 4KMQA 2Y9ZA 1OSGA 1Y8AA 1RUC3 3Q8CA 4IV3C 4QMAA 1VBB2 4FFGA 5LASA 3WF2A 3SLIA 1QF3A 3ZX7A 3CXHE 1L0LD 1SQQJ 1PIV2 3FN9A 3OD4A 5FZMA 4D7YA 2POHA 4Q4Y2 1KDMA 2C1FA 2VY0A 4L2NA 3V65A 1NLQA 5C3QA 2WWWA 3BU0A 1E5RA 3MP7B 1BE3E 3RK3B 2WSEJ 1ZN5A 1RHI2 3AM2A 2UWJE 5A7OA 4U3FD 4Y22B 2FCVA 1MS4A 4D6TD 2B39A 3FX3A 3RWKX 1MQTC 3AZZA 3GCWA 1KQRA 2VZVA 3MBWA 2FCTA 1N3OA 1ULDA 1W90A 4OCTA 4YZ3A 4COVA 2ZAEB 2XDJA 5M0TA 2W1QA 1RHI3 2XNXA 1SCRA 2XMLA 4JQTA 4JZRA 4J1WA 4QPGC 3TN93 3ZFEA 3PMEA 5C9AA 2ORXA 1OOPC 3L70J 2M8RA 4ARYA 2BNOA 2ZGLA 4CDWC 5AC92 3GXUA 5B66H 1OXZA 3DF0A 3MLJA 3D5OA 4YW6A 4A7PA 2VULA 3LA2A 2DTYA 2PQSA 4XDPA 3SHRA 2EXIA 4DZGA 5K9YA 5K8SA 4IV3B 1J1DB 2W1WA 3NJXA 2XBO3 4FFHA 5D21A 4AG4A 2OQQA 3POJA 3WG1A 1IK9A 1R5SA 5C39A 1HB1A 2IVIB 3JD71 4YGDA 4FO9A 4O7XA 3HWJA 4E4HA 4PLMA 3CCUP 4ZKPA 4Q4W1 3ZYRA 2BYVE 3AYAA 3C7HA 3I4IA 4CCEA 1YYCA 5GTIE 1CR7A 1ASJ3 4QDRA 4Y99B 1URQA 3MIWA 2CDOA 1VQNP 2BQPA 1AXZA 3RZKA 4IE7A 5DABA 4QXBA 3HD7A 5D8AB 4F8AA 5AVVB 3AECC 3DN7A 1GZCA 5HBAA 3H42B 1EAH2 4RKUJ 3CU7A 5F3GA 4OGQC 2H43A 3AXDA 4DB5A 3EQ2A 5T5PA 1AX1A 3SFDC 4AOCA 1OD5A 2DCYA 2YY1A 2QJYC 4PBPA 4I3PA 1LTJC 2CDPA 4SBVA 4SLIA 5FMDA 3BRTB 3WDVA 1CI6A 3FMGA 4CU7A 3MPBA 2YHJA 1KEXA 1LESA 2JP3A 5APTA 1KILC 1DP0A 1YI9A 2HWD1 4MXWA 3CCVP 1XTCC 4I2LC 3AE4C 1EUTA 4CSWA 1ZZBA 1PP9G 1GSLA 3MIDA 3QWOC 2M5AB 1EV12 3AP4A 4AQ6A 3ST7A 4PQ9A 2NRGA 3RYRA 2RJKA 4LHLA 1A78A 3ILNA 5L8RJ 4MGSA 3RZZA 4MVTA 1VBA2 1QEXA 2A71A 2JICA 2JIGA 1ZV8A 4JRLA 4V1PA 2ZJSE 2C0WA 1HRV1 1YWKA 1YXWA 3GJAA 5J09A 4QKNA 4D7TA 1GYKA 4X6QB 3GCXA 1PGPA 1HRV2 5B2GB 2Y6GA 1OA3A 1YQCA 2K46A 4RQPB 1SDWA 3USUA 3M91A 4HSJA 1COV3 2I1KA 2XNDH 2ZZJA 4X8PA 1F9KA 1JB0J 3Q1MA 3KQGA 1FDMA 4I7ZC 4AEDC 4BIFA 4QPIA 2A5ZA 2C5DA 1AR93 2FBEA 2VUJA 4XEZA 1O3SA 5BXXA 3H1IE 2XZRA 1OH3A 2J7MA 2PA7A 4PF5A 5AVPA 2A1XA 2R5DA 5A6ZA 4UF0B 3C7GA 2QA4P 4Y26A 5JOWA 1WBFA 4ASWA 4PT6A 4FTSA 3E1RA 2RS31 2OYHA 3C9IA 2VOKA 3P6BA 3ZVXA 2R042 4Q4X1 1AV1A 1NTMK 4LKSA 5CKQA 1NTKJ 2D40A 4KBBA 4TWTA 3CCEP 1HB4A 2XH6A 2OYHC 3PUHA 4HVOA 4XFAA 3AEEC 2QIWA 3O1MA 1RUH1 3ZFFB 1M90Q 2QZ3A 3KQ4B 2P3YA 1A8DA 1EDJA 4EN0A 1SQVD 2W90A 5H9SA 4RA0A 1W39A 3E6CC 2QJPC 3ITQA 3F2ZA 1SQQG 3RMXA 1UYZA 3R4SA 5F5AA 3J7MA 1MZEA 1GP6A 1UYPA 2FHRA 3SWKA 2Q30A 3RBXA 3ON7A 4IEWA 5M1BA 3GBGA 3PUIA 4RS5A 4CTEA 5CKNA 1JZ4A 3AJYA 4ES8A 4JKMA 1NU1E 5LBBA 2OGUA 5I0SA 4EE2A 4UWDA 4J1XA 4LE3A 4DXZA 1ASJ1 2WNVB 2XUMA 2HWF2 2RMU2 2FFDC 2VOTA 3MHZA 1QKQA 1RUG2 2DV9A 3OSDA 3MUDC 1W6MA 2OVUA 4AAPA 5FIXA 2OX0A 3TYJA 5FREA 2VZTA 1HLCA 3WINE 2HWF3 4GDOA 5GALA 2KR2A 2G1MA 1RVF3 2BU9A 3AKRA 4TN7A 4AEMA 1Q56A 3T1MA 2RS51 5G05L 1W6NB 4AF9A 4CDWB 1R082 2VZSA 3CD6P 3OAKA 4XIOA 3O1RA 2PLV1 4CEYC 1FXZA 1NUKA 3JBG1 3NAPC 4LBMA 1RGSA 4LHNA 1SQPG 2P6CA 3GZUC 2Y6FA 3U10A 2E32A 3U1CA 1NTZG 2J1RA 2Z5HA 1CN1A 1ULPA 5FZBA 1QJX3 1DEEG 4YXDC 1FZAA 3FE5A 4GOFA 3NMBA 2CNAA 4IDZA 5K4LA 2HYXA 2WS92 1AVOA 2IPPA 3V4QA 4KG0A 3SWFA 1EZVD 4FOWA 3L75D 1RE3C 3CWBG 1JOJA 1GZWB 4G9SB 1ZZ6A 3P3NA 5FMOS 1D7PM 4AZZA 3M8LA 2O1JA 1GU5A 1OQEA 2KXPB 3OPZA 1H4HA 1WW4A 2WNVC 3POBA 2VRSA 4IE5A 3M0DA 1DGRA 5L36A 2DFBA 1U7MA 2JR8A 1M06G 1LCLA 1UKGA 1FV3A 1A02J 1GWKA 1CIYA 3U37A 1PX3A 3G7DA 3H7JA 4AVBA 2XLAA 2HWB1 1JY2O 1K8AQ 2D3PA 4FFIA 1PHMA 1J59A 1DQ4A 1WWYA 3CMEP 4OI4A 5L7OA 4Y5Z0 2XJVA 1H6YA 1AJKA 1W3XA 1SQBE 5B5EH 1OKQA 1TQ5A 2VG9A 5FLIA 2NP0A 2P67A 1DQ0A 3AXEA 3B5NA 4IEXA 4E4DX 3Q9OA 5C3OA 5ACA1 2WSSH 4META 4QX3A 3VBHA 3WP3A 1DD4A 3M3CA 2E76D 1UN1A 4DMIA 4ET7A 1W3VA 2OYHB 1SBFA 1G8WA 1WGPA 2XL7A 1L0LE 4Q0PA 5LRSA 1HQNA 1SQPJ 3OY8B 1X9PA 3V0BA 1EV11 2Z2SB 1H2NA 2ARBA 4YVWA 2ZHKA 2QQKA 4MH0E 4N43A 1LRHA 1GQPA 3H32B 3CX5E 2RM22 4QT6A 5EIYB 4YLZA 3O1OA 1HTLC 2MEV3 2VTFA 3E5QA 1JH5A 1OC1A 2DVDA 3L73E 2Q4SA 4IGOA 4B4PA 3FXDA 4NPEA 1ZMEC 1SFNA 2VPVA 4IGQA 2WPSA 2AYHA 1KYOD 1B35B 3T30A 3AJZA 3TEWA 1YITP 4WWIA 1W8ZA 4KI5M 5APSA 1QGLA 1RY3A 2D6LX 5FXVA 4L73A 3S5QA 4YM0A 4FVVA 3T97B 2Z69A 4RQPC 5JLVA 2E7QA 3B7MA 5C4WA 5CFDB 3L75E 3TNUB 3JC22 1N73C 1G1JA 4NIIA 1VBC3 2GA1A 2XR4A 2YDEA 3DUIA 1FZFA 2WT7A 1N1VA 3HIFA 1KN7A 2Z5WA 4QWNA 1NU1D 2HJIA 5FZAA 1GU3A 3WUDA 5L7OC 2ZA9A 4N9IA 3MF9A 5J96B 2YKPA 1HF9A 2XJRA 1BCCE 5AVXB 1C28A 1C4RA 4OMCA 1GBGA 3HNYM 5C8CA 1SVFA 1BBT2 2XL9A 1C8M1 3N7JA 2QQPA 4CPBD 1LOFC 1RUH2 4H14A 1LTJB 1N47A 5DUUA 4IL6X 2EALA 4N7UA 3MLLA 5AVSB 2CWMA 3AKPA 2QQIA 1SPPA 4QX2A 1BBT3 4BCUA 1YJLA 1BGYD 1SQQE 1URQB 1ZBA1 3CCRP 4DO0A 1W8OA 1SQPE 5EYXA 4HL0A 4IV1C 4BWNA 5CCHD 2LXBA 1LR5A 1X7NA 5BY5A 1GNYA 3CX5D 1AR91 1U0AA 3ZSKA 1SLQA 4H0LC 5KLIB 2IBZD 3Q5RA 1Z56A 1VBD3 2Q8EA 3N7MA 4FI9A 4IETA 2HWB3 4YWAA 1NTMJ 3HNMA 3O1VA 3B4SA 4LUMA 2ZZQA 1C8NA 1JW6A 2YNYA 2YGMA 1GWMA 3NL1A 1KB9I 1YC61 1ZA7A 2WT0A 4MSVA 2VMFA 4NWVA 5LBFA 4S2FA 3OCPA 2B46X 4ZY9A 3U75A 1GD2E 2IWGB 1DBNA 3K3NA 2IXIA 4XETA 4AFAA 2M5AA 5FPXA 4EOTA 5CFCA 5LBEA 4K1YA 4IEVA 4S2DA 3U14A 5KWRA 1R081 4IL6H 3F89A 3KT4A 3N3HA 3KT7A 3JU9A 4OQ9A 1CI6B 1N2DC 2Q6QA 2HEWF 2ZABA 1DG6A 2XHKA 1SFCA 3M9QA 2RJ2A 5DDJ1 3WW3A 4UFLA 1RIRA 2JWPA 2YV8A 3EXUA 1L4AD 5APXA 4GXLA 5LB6A 4AVCA 2Y6LA 1RUI1 1BVP1 1UF2C 1SFCC 1LT9B 3KQRA 3I3BA 3KHCA 3CXHH 1WD3A 2O14A 2G8YA 2PFWA 2QZ2A 3P3PA 3TNQA 3VDAA 3AEBC 2ENRA 3U59A 3SH4A 3ORJA 3RK2C 2ZBJA 5IK7A 3H32A 2WNUC 3IIIA 3POEA 3C8VA 2Z79A 1L7RA 4XW3A 3I2HA 1WLWA 2C26A 3PURA 3C7EA 3RK3E 2D6MA 1SLCA 2WO1A 1OF3A 5E79E 1CJDA 4UB6H 1M4WA 3QH9A 1DYOA 2B89A 1JUIA 1UIKA 4Z82A 3AE9C 1X36A 1H1AA 2DWRA 5CG9A 1AX0A 1KV4A 1FOD2 3OD0A 2H8PD 4XJZA 4CDQA 1XE7A 2DTWA 2HG5D 4W6WA 3H1LE 3M3IA 5DUXA 1UPSA 3TN92 1Z78A 2O8OA 1AL23 1VMJA 4GMP3 3LA3A 4I09A 3ZIWA 5HV0A 1Q7YQ 4FTBA 2TBVA 1KILA 2N9YB 1AX2A 2H0VA 3NV1A 4OHWA 2I07B 1UZWA 2EAAA 3VD7A 1L0NK 1HB3A 3PJSK 3RGUA 3AKSA 3WDXA 2PMWB 1XBFA 3W67A 5JZGA 3BCWA 1PPJE 1JU3A 2LXCB 2LROA 3UYJA 1DLLA 3KCYA 3NJVA 4HZFA 3MFAA 2OW4A 1L7LA 2P1BA 3VKNA 2ZXEB 1MVEA 2AEYA 1ZBE2 4P5HA 4OH8B 4Y22A 5I0UA 2DVAA 1W0NA 4NPDA 1T2KC 3W68A 1UX6A 4M3CF 5EV7A 1W6MB 1QGKB 3GBWA 3SCGA 1C5HA 4CEYB 2Y60A 4QPIC 2BCCG 1AYN2 5BNPA 3VZKA 5FPVA 5BNOA 3ZFEB 1EDKA 1PO21 3HQXA 4FPLA 5A32A 1VAVA 3AZWA 3H50A 2ZT9C 1W6NA 3HMYA 5ABJC 4A3ZA 4LK6A 2QE3A 4PD4H 1DYPA 2OXBA 2RV9A 1LTGC 1L4AB 5A7WA 2JDIH 1T6BX 2JE9A 5CA6A 3AP6A 5JMOA 4RR3C 1GFF2 2X05A 4O9BA 2AEMA 5ERLA 3L37A 2CWSA 2V5DA 1PIXA 5TJHA 1UY0A 2FXOA 1PNFA 1EV13 3QACA 4RR3A 3RYPA 5KAFH 1ZLLA 1PK6B 2MNGA 1LECA 1YQ3C 3CNAA 1E5HA 1S9KE 1MV8A 4CU8A 2FXPA 4HB1A 1SQQK 2FDIA 1AYM2 3FUOA 2ZGKA 4QHBA 1JZ7A 1RUI3 2QQOA 3CIHA 3M2MA 1V9U1 1RJ7A 3POIA 4K20A 2E74D 2ZT9D 1NWQA 3KVBA 1I5PA 1M7LA 2E42A 1PZ7A 4I30A 4UF0A 5H9QA 1PK6A 2C6SA 3ZFGB 1HJBA 4KWUA 5DJTB 3AZVA 3ES1A 1X50A 4D3WA 2DVGA 3GHGB 2QG4A 3VN4A 2XQXA 1PIV3 1H8VA 2R49A 2XXZA 4LKFA 3THCA 4D69A 4WM7B 3JCUH 1YQ5A 4R52A 1OQ1A 3AYEA 1BMV1 3F95A 1X9VA 4ES9A 2JG8C 1G9BA 2WTYA 1VQ4P 1JOCA 1LEMA 5ABJB 1KZUB 5GJ6A 2A45H 5F5QA 2OTKE 2PP6A 2AEFA 2EXJA 3LAGA 1AYM1 1QDCA 2GUVA 1NT0A 1OPMA 3N4XA 5A3TA 2DCJA 1JYVA 3MV11 4XF0A 3ZSEA 3T0BA 3NWKA 4L8QA 3UKTA 3N4MA 2E6VA 2WR9A 4TYSA 5IK5A 1FNYA 4P9YA 2KSJA 2KUBA 1LTBC 3LIGA 2WWSA 2R062 3IB3A 1I1EA 2KSEA 3H8OA 2JENA 1JZ8A 1ZRCA 1KXGA 3OW2O 3MIEA 4YPCA 1QX8A 2BWCA 4MHRA 3AE3C 4C7NB 5CBOA 1T2XA 3BVCA 3N7KA 4BXFA 4M00A 1ZRTD 2R0HA 1IOAA 1QOSA 4XC9A 5K7PA 3O0VA 1ND2A 1ALYA 1H8AA 2WVRA 1MEC3 1TVGA 1UPIA 2CU5A 2G9ZA 3A22A 3IT8A 3CC2P 2D44A 4LGDE 4N6JA 2IDBA 3VMXA 2ZGUA 2FYUJ 4UYBA 1S0FA 5ANNA 4C8DA 2ZT9B 4TLGA 1VBD1 2VQTA 1HVVA 2J59M 3HOBA 5C3SA 2GN7A 1N1TA 4HFSA 5DAQA 1HJFA 2WYFA 4XF1A 3RK2D 4HONA 2R32A 1UZYA 4CCDA 4EN9B 2W8ZA 4HOOA 2D3RA 1NCQB 4GB31 4LITA 1LODA 2YIUB 1BVVA 1W5CE 3MUDA 3VBRA 4CCCA 4OGQB 4GAZA 2WZ7A 4CDUC 1CZSA 1TNRA 1LWUC 3M3EA 5KC6A 4QPWA 1DLCA 4CE8A 3UKNA 3D0SA 2Y38A 4COWA 4XDOA 3MD0A 4Z1VA 5A7NA 5IHRA 1POV0 1SQQD 1FZCB 2PHRA 2VR4A 3VDBA 4B4QA 2TNFA 2QDNA 4QQHA 4AGVA 3LB9A 4KNCA 4BJ0A 1DZQA 2RJLA 1SBEA 3PU8A 3ZSMA 1UMHA 1ZZ7A 3S30A 5I0DA 2DVBA 2VC9A 4LBQD 1Y9BA 1VPCA 4Q1RA 1G7YA 2YO3A 1JM0A 1NZIA 3B69A 4PJ0E 4UW5A 3ZDVA 4PDWA 4U36A 4CZSA 1PO12 1ZVFA 5FKBA 2QQUA 2JECA 2WABA 2WWJA 3PJQA 3O6QA 2AREA 1SBDA 4ZKTB 1GR3A 1HIXA 4OI0A 1Y3TA 1EZVG 4AL9A 4DXRA 1VQ5P 3WNLA 5A3LA 4HBNA 1RMU3 2RS12 1J3QA 4XDQA 2KS1B 2WSUA 1MKMA 1OVRA 1H2MA 2R041 4XQWA 2IC1A 5A1LA 1H1IA 5CEHA 4EIJA 3GZTB 2QE7H 1FX5A 2ZHLA 2E75B 3AVRA 3EMRA 3G6EP 3I2DA 4QKFA 3THDA 4A44A 1RVF1 3D6YA 1TMF1 3OPWA 1CAVB 4WVVA 2R30A 5I8YA 2FDGA 1FYUA 1NG0A 1IFPA 3ABZA 4RSUA 4XFCA 1PVC1 3CEWA 2PQQA 4Q4V1 4QB6A 1C3HA 1LT9C 3P8CE 1UIIA 1N86A 2IZ1A 4D6TE 1HN0A 1QNWA 2SLIA 2A06D 1F2NA 5FZDA 5A70A 5LZ6A 4WM7A 2B45X 3TEXA 1Q2NA 1K5MC 3JCUE 1LHOA 3UGFA 1ZP0C 2W68A 1K45A 4QHOA 1YJ9P 2KNCB 3TSIA 3HVDA 4OYUA 3U07A 2IYPA 1G9CA 3KV5A 4DXTA 1SHWB 4EYUA 2E7TA 4JV4A 4W80A 1MR5A 3TRSB 1K3IA 3BKZA 3U1AA 1UY2A 2XKPA 1RUE3 3AFGA 4JTNA 1CD3G 2BCCJ 1NA1C 2XJPA 5FLHA 3D8CA 1NU1J 2A45G 2P34A 1SQXE 2PLV3 3LFIA 5FAXA 1FPN2 2E74C 2VMHA 1WMDA 4HT1T 3H1MA 1GQHA 4MGQA 4Q4V2 4HK9A 4DPNA 1USDA 4ZZ8A 5B4NA 5L19A 1SACA 2R0FA 2HYKA 1L0LG 1KTMA 1JTHA 1YFWA 4BISA 5AVTB 2W9XA 3ZN4A 3FWEA 3POFA 5JSOA 2A6YA 3VBUC 5J36A 5LA9A 1N7SA 2JB4A 5FCCA 3RI8A 5LEJA 5T52A 1RUG3 4N7IA 3MPPG 4Y1YA 1ENXA 5KXCA 2FYUK 3OY8A 1QJEA 1WCKA 4Q8LA 3RGBA 5JOZA 3VMAA 1BE3D 3NFQA 2R16A 1NTKE 1QOOA 1ULGA 2VM9A 2ZX0A 4K1ZA 3ROUA 4BWOA 5JXGA 1GOGA 1YEWA 3LOBA 4Y24A 1GMMA 2GC2A 3OF1A 3H1JJ 1YHFA 1IC2A 2RR13 5FPAA 3UJOA 3WQ7A 1GZLA 2ORZA 4OHYA 4P9JA 2P3KA 3TOJA 3CXHI 4CCNA 2ID4A 1R64A 3A0BE 1BK0A 3HTKB 2VVEA 1WMFA 2N1TC 3OEBA 3FX0A 4XXPA 3HUSC 3CL1A 5IVJA 2K37A 2WZEA 4N90A 3SXWA 3JQXA 4XPVA 4P9GA 1SQVE 3WY6A 1XQNA 1QXPA 1JYIA 2HPCA 4UXAA 3V2RA 3KLSA 3SFEC 4HPKB 3HAGA 4NE9A 3PTYA 1CAUA 2GMPA 2PHLA 3MLKA 4MGIE 5CYYA 4AHXA 3WNKA 5IVCA 1URQC 5FYZA 2A7AA 5IFTA 1N1YA 4FAGA 2ZMKA 1ZREA 2HWB2 3AL6A 1VE0A 4K40A 3JB4C 5FZ7A 2VVFA 2H7HA 4QX7A 5F9TA 5KHGA 5LA0A 3LE0A 4Q0VA 1R1A2 5FJHA 4XACA 1GP5A 1MS9A 1MS8A 2B7YA 3UIAA 2CV6A 5LK7B 5DAVA 2HR3A 3B8EB 3V2PA 4Q4W2 4HPKA 3KM5A 3H1ID 3LW5H 2DCZA 1D4VB 2WSEH 1QL1A 1MZFA 3WW4A 1EC5A 1RE4C 5G04L 1X8YA 3W9AA 3Q5SA 3BGAA 2E26A 1Y9MA 4AQ2A 1V6OA 3DPRC 5BNNC 4HN0A 3PVNA 3TNPB 4BIOA 4COYA 1YJNP 1ULOA 1PGSA 3CCJP 1Q3EA 2VZQA 5FUPA 3S0MA 1BBT1 1XOYA 2WITA 5AW9B 2OPWA 1RUF1 2PHFA 1GW3A 5DAPA 3WP6A 3NXSA 5CJ4A 4Y1ZA 3L71D 5FUNA 4O61A 1CAWB 2UY8A 5F6KA 2LUWA 4AHWA 1LOCA 3SMHA 1WLCA 5A7QA 1JMMA 4OZOA 5AW5B 2QRXA 3OPTA 3CCLP 1TEIA 4IESA 3ZXKA 5HXMA 5FWEA 1NCRC 4ASLA 1C8M3 2A6ZA 4Q4V3 5FP3A 2BFUS 5FO8B 5CIRA 1VQLP 3OGSA 3DL3A 4QQOA 3Q8EA 1MFZA 4YGBA 3WCSA 4UB6E 4H13D 1WZXA 3O0XA 4RS5B 4BQ4A 1BDDA 1RUC1 4LQRA 3WDUA 3I2GA 3LKJA 5E16A 3VHNA 1IFDA 1S2EA 5KXDA 1VALA 3MTUE 2CGNA 3PRJA 4EQVA 2GNBA 3PLNA 1GZ9A 4BDVB 4A2UA 1RMU1 4ASVA 2FFDB 2X5IA 2HLEA 4GWJA 3L35A 4D8MA 5JI9A 5JSRA 2N9BA 2UYBA 3A0HH 5CCGC 1UAIA 5FMCA 1O3TA 1VPHA 1AR61 1FNZA 3CMAP 1IO4A 4HSLA 4JHTA 4A4AA 4W4ZA 2Y6HA 3J4UH 1Q8QA 3LW5J 4MZUA 5DUVA 4QQPA 3VHOA 5FQ0B 4N53C 3WOGA 2Y0CA 3WQBA 1S0DA 1MZ9A 3TDKA 4YSFA 1G9AA 3LPFA 3LD8A 1NTKG 1HBWA 1W6OB 4M3CB 4MADA 1KD7A 2VQ0A 3BTAA 4I6MC 4QXCA 3SC7X 3BCCE 1FJPA 4IUGA 1NTKD 1F35A 1OVPA 3CJIC 1XYNA 3ZFFC 3CCQP 2WN3A 3ZM8A 4ZS2A 3E1IA 5A7SA 5KLVG 2ARAA 5F2SA 4IE0A 5FZIA 3HD8B 2AC1A 2FFDA 2X5IB 3J26N 2ZOEB 3R05A 2JG9C 2ZJCA 3SITA 3ZYHA 1WMKA 4AQRD 1IPJA 1SFPA 3T2TA 4GZ9A 3MIFA 2KS1A 2JDHA 1YRZA 5FY9A 5FYUA 4N3YB 3IPVA 5JOYA 5EJ3A 2H88C 1AR83 4XFJA 1QJU3 2ZHNA 2ZTNA 1PM4A 1XYPA 3T0AA 2R6QA 2BBAA 2JX9A 4W6XA 3WF3A 3AE2C 3TWIA 1T3JA 1J3RA 1OI6A 3B01A 4DCKA 2YPDA 5T5JA 4GKGA 4BQ1A 4CDXA 1W2OA 1FOD1 4HG6B 2EAKA 4NROA 2RDNA 1QU0A 3WNPA 3FXEA 5FY8A 5FMOL 3CC7P 3RBZA 5T3NA 3MIHA 3NTNA 2ZVNB 3FGAD 3KT1A 1RUI2 4AFMA 4E4ZA 1JHJA 5FWJA 1MFTA 2RDRA 4WVMB 2CPBA 2OARA 1T2KD 2WINB 4PQQA 5A6QA 2D2CC 3QH7A 4W8JA 2DU1A 2IFWA 4YGCA 3VZOA 5AW6B 2IXHA 2Y6KA 4RGKA 5CVRA 3MGUA 3L70E 1BGYE 1SQPK 1L0LJ 1EDLA 2CAUA 3L4FA 3MW3A 4YVWB 4LOSA 4MGZE 3I2OA 1JMBA 2WPRA 1VQOP 1D0HA 2JDMA 2WAAA 4PDWB 4FAHA 3CX5H 2QJPB 4CCOA 5FYSA 1UY4A 3ZMOA 5CAZA 3O14A 3TN91 2D97A 3BPZA 1EZVE 1IHMA 4H44D 4UW3A 4XUTA 4XAAA 5JXJA 2FY8A 3KYQA 4EWAA 3H1HE 3LWCA 4C90A 1EYBA 4DXSA 2R3SA 5AW7B 3T4VA 5TISH 2YROA 1COV1 2M3BA 1IQAA 4NAMA 1XSQA 5F8PA 2JO1A 5GZDA 2Q8OA 4CEWC 2BPA2 5FY5A 4UT5A 4Q2FA 5DAWA 4DQAA 2XPJA 1EXIA 2P2KA 2ET7A 2K88A 1F5FA 1H9PA 2R063 3S6PA 3UV9A 4CEWA 4CVUA 4FPEA 2Y8KA 3LCPA 1NA1A 3I3EA 3H1YA 3LZZA 3E6BA 4FPCA 4FOVA 1GLHA 5FV3A 4ATFA 1O8SA 2WFPA 1XNDA 1J1DC 3HTKA 3OEAA 3S7EA 1ST8A 3VDDB 1SQ4A 1E5SA 2IYOA 1R093 2WIIB 1K05A 4IERA 3T4HB 2Q1KA 4HKLA 1S5LE 2DW3A 2R3CA 4YARA 2JJLA 4HXCA 1G9DA 1XSRA 5D1IA 4RL7A 3DGTA 1NU1G 5CJ0A 1W6QB 2KYVA 1ZBE3 1XNBA 4KQ7A 1CESA 1LULA 3J8F2 2QNKA 3NO8A 2Y64A 4YW2A 4PLOA 2J1UA 1FC2C 1KQGB 1LJ7A 1QJY2 4K3AA 2V5YA 2VGDA 3DCQA 3RG0A 3BTXA 2IUWA 2XV5A 3M7AA 3MDPA 4O65A 3WW2A 3O1PA 1AL21 1GL2A 3BVHA 4K3UA 5C6CA 3VHPA 3BOPA 4FPJA 3WG2A 2GNDA 2BZDA 2HKXA 3THTA 3OGJA 5H2FE 3X29B 5HV4A 2ZAAA 3H3UA 3NJYA 1QWRA 3OBTA 5BYNA 2QJYB 4FPKA 4EWDA 1VBB1 2CAVA 1OXCA 2Y33A 4L76A 4FTEA 3O1UA 2WQYC 1O6UA 3HE4B 5FZ4A 2WAOA 2YC0A 1XNTA 3GJBA 3R4UA 4URAA 2CGPA 3FZ3A 2K0GA 1KB9H 4U7JA 3E5UA 3PNAA 4YVSA 2MKVA 1PP9D 1ZBA2 2VMGA 4PJ0H 3TGUE 4QX8A 1YYNA 3H1IG 4ORFA 3WHUA 1IS5A 4XMIA 5GLVA 2IFNA 1FZGA 4OHVA 1VB4A 1MEC1 3FC0A 4C0BA 1DGRN 3IMMA 4EWEA 3WDWA 2AEJA 3ZPYA 3WXPA 1N7SD 1EAH3 5E88A 2HWC3 4E9KA 1SFCB 3POSA 1G1IA 3ETPA 4IEOA 4AW7A 2E75C 1ZX5A 3MV01 2QJKC 1U5XA 1V9U3 4XJAA 1X82A 1H2LA 3PJYA 1BMV2 2HFED 4GB33 1FAYA 2VBPA 1NTZJ 2PAEA 5FYIA 4BRYB 1MACA 2OA2A 2RHPA 1Q8SA 3EQEA 1YFYA 3KGLA 1RE4A 4HKWA 4DOUA 5F5IA 3L9JT 2E75D 5FZLA 4CP2A 2ITAA 3WZ1A 5A7PA 4AI3A 3D71A 2V72A 4CUCA 4LK7A 1JBCA 5I93A 4DIQA 2OQ7A 1LOGA 2W08A 4CP0A 2QJKB 4JGYA 2AACA 5AW1B 5DZEA 1A02F 2R061 4PBOA 3V0BB 5K0UB 3A23A 4FFFA 4NJ4A 1CJPA 4YW7A 4K8FA 1S72P 1VQ6P 2AGSA 1NCRA 4Y1VA 1W05A 3BTZA 1OQDA 5FZ3A 1K12A 3PL0A 2J1EA 4BRYA 1CQ9A 5C9AB 1SQXG 2YMKA 3LIEA 1C1FA 1FPN3 4Y5SA 3B93A 2D2CD 1KQSO 1PGL1 3OG2A 1JUNA 4CP1A 3VDDA 4TT3H 1SLBA 1Q90D 2PHTA 3MGNA 2R043 4XUQA 5KAIH 5DAXA 2DBIA 5IVYA 4ZONA 1WW5A 1K9MQ 3PU3A 4ZHNA 1BEV1 4WY4C 5JZGB 1ZM1A 3FWLA 3MZWB 2E63A 4LLFA 4PI0A 4XF9A 3VDDC 3VBSB 1S3JA 3W5NA 3RZHA 5DG2A 2BOJA 2ETEA 2MEV2 1VRH2 4BLIA 2WT7B 1ZA4A 1RQUA 1SQBG 1H9WA 2GP5A 1UX7A 3NSTA 2OQ6A 3UESA 1RB8G 4KT0J 5J7MA 1XE8A 1S5LH 1H6XA 2DYCA 1NH4A 3R4DB 3TNUA 1U57A 4WY4D 5FY4A 1QJZA 1ZOYC 2QQMA 1G86A 4XCBA 5F2WA 5DQ0A 4E2GA 2RH0A 3NQHA 1RUJ3 1LOAA 1R8EA 4RHV3 5F32A 4CDQB 5D8AA 3IDEA 5JMCA 1IKQA 2P1JA 1OPOA 2UURA 4XILA 4ISRA 5TSWA 1JZ2A 1ZBA3 3CC4P 3B5NC 2XQRA 3H9AA 1OZHA 3GHGC 4OUEA 1GDTA 3EBRA 2K3RA 4IL6E 4ITCA 3H1KJ 5AFEA 1QIQA 3ZFGC 1AJOA 3VBSA 1UOBA 3JQWA 5FK8A 3PUQA 2RDQA 3I59A 5SV8A 4YNIA 1KB9D 3EFGA 1SMVA 3OOXA 5JI7A 5IYYA 4H0LD 4IFFA 4PV1C 4PCRA 4YVWC 2CGOA 5A33B 1KQFB 1AXKA 4AFBA 2VZRA 1KILD 5BNPC 1DGLA 2VCCA 1VR3A 3J8F1 2IBZI 4N8MA 2BBVA 2W94A 3ACHA 3RNSA 3D3AA 2H89C 1QJY1 4XBQA 2XKOA 1PVC2 1LHVA 4HN1A 4CEYA 1XNKA 3WCRA 5GM0A 3NAPA 1PV3A 1JY3P 1BQPA 2YUEA 3CCSP 4ZXKA 3BODA 3ZYFA 3U4SA 4D6RA 4XFBA 4A45A 4BQ2A 2AZ5A 2WZR3 3SKJE 3AYDA 3P5BA 4GJZA 3GF3A 1GZTA 4RO0A 1QQP3 3MICA 1YI7A 2HWC1 5EFWB 1OLRA 2VUCA 3D6ZA 2LM3A 2WYSA 3IKWA 4K9SA 4NR1A 4BHPA 4C1XA 4IQPA 2RS11 3ACLA 4PV1B 2NPIA 4FCAA 1MZ5A 1PMJX 2V4HA 1BSNA 4Y5TA 2XUEA 2JDAA 1PO22 2ZGMA 4QD2A 2GZWA 2PHWA 4LBQB 1WCDJ 4W6YA 5JR7B 1R091 3M1HA 2WFF1 3RS6A 1GWLA 1W9WA 1L0NG 3LA7A 4ZU5A 5FKCA 5FTTC 1BK1A 3LQCA 2WFF2 5HPOA 2P58A 3I97A 4RFT0 2BERA 4RR3B 3GALA 1LT9A 3H1HD 5FMBA 1VJ2A 2DCKA 1VBC1 1H8TA 4XQDA 2WZPP 3ZR6A 1R5LA 2KLVA 1RUE2 2YB7A 1LJ2A 1RF1B 1K5MA 1VBE1 2ZGNA 2A3YA 4GIQA 3ZOIA 4MLOA 1FI2A 1H8TC 4QKBA 5CCGD 1TMF3 1KFUL 4IV1A 4XOGA 2C9NY 2KLUA 1MVQA 4OI1A 2Y0IA 4LO8A 3NVCA 4Z2AA 5KTBA 2GMMA 1UU4A 1CPMA 2VCMA 4B29A 2XDVA 2J42A 4L9BA 5J37A 1S2BA 4R4LA 3I54A 4UFHA 2GALA 2D6OX 3KV6A 2WS91 4AVTA 2RMU1 1V6LA 3AEFC 4UW6A 2NPSA 1S1AA 2X5IC 2BVVA 4GWIA 5FZ0A 1FPN1 3OUJA 4FPFA 2QCSB 3H0OA 3N9PA 4LKEA 3PIGA 4U2AA 1VRBA 4JVAA 2D43A 2LR2A 3M70A 4MGTA 2VU9A 3SWYA 1RUF3 4YFWA 3TAYA 1UY1A 4NPLA 1WUVA 4JDMA 2WNUB 4ONUA 2RR12 3OJBA 5CFCC 2WC2A 1VBA1 1UOFA 2Y6JA 3HD7D 3T97A 3PHMA 5HCBA 3WX5A 4KJMA 2BGOA 2IFRA 3VYIA 3LEGA 1M8OB 1A3KA 1XNAA 2YYOA 3CMGA 3ZXGA 1AQ5A 3ZN5A 4QX5A 5B5EE 1QMJA 1W6QA 3ITKA 4TXWA 3RZJA 2YMYA 2ZYGA 1VAKA 1NCRB 2TUNA 4P9XA 5KHIA 4WZCA 5ACA2 2VH9A 1JI6A 3IF4A 3KZIH 1W2EA 1NQDA 1STMA 1H0TB 1WLTA 2VE1A 2Y0OA 3CF6E 4WV8A 3D4KA 4C91A 3H1JD 2VOWA 1S0CA 2P3IA 3L74D 3L70G 1DQ1A 1LU1A 1AR82 1QJU2 3I8TA 3H1HJ 2JG9A 3MEPA 4MX3A 3P32A 4NO4A 3W21A 1CGPA 2D5HA 1RUH3 2YPJA 2HLOA 5AVAA 1OHFA 1VRH1 1POQA 4MGKE 2IX7C 3RK2B 2BOIA 2Z5IA 1EZVI 1XNCA 2OUHA 4LBJA 1UIXA 1R1A3 2WZR1 1LGNA 1E79H 4Z8BA 3SISA 5LWBA 2VUDA 3D0JA 1IG3A 4Q26A 3JUUA 3SCHA 1NTKK 3WP4A 4Q4W3 2WSCJ 1NGMB 1DIPA 4XJ9A 1FE6A 3HJRA 1LTJA 2VXJA 1OVSA 1ENSA 2M3EA 1X33A 3N7NA 3C2UA 5FYMA 3T08A 5AVUB 1C1LA 3Q8BA 5FP9A 2WQ4A 2QM8A 3M0DC 4W7YA 1OVUA 3AE6C 2WFF3 3Q8FA 2PTMA 4CP9B 3LDRA 4GKYA 4F3JA 5DJUB 4AQSA 1M56D 3NNLA 4FXGB 1GP4A 4P5YA 1YHQP 5BPXA 3R4YA 3DPRB 3HEIA 3TYYA 3ZIXA 1N73A 4YFZA 5LEKA 4H3WA 4OMDA 3M3OA 4PIZA 3FWNA 4IFMA 5AW0B 1YTZT 1LTAC 3E5XA 3L73D 2ZYAA 3OB8A 2BCCD 1IS3A 4XURA 3RRDA 1RHZB 1RUC2 4AGRA 4V2WA 1AYM3 4AAXA 4BU2A 5FR3A 2MHFA 3VBHC 4H0LB 1UU6A 1H88A 3VBHB 3OGVA 3CWBE 1KS5A 3OGGA 4Q29A 3KDPB 1JOPA 1X0TA 1B35A 3RSJA 3ASIA 3DYMA 3ZKYA 3VP8A 4IV1B 1SLTA 1KYOI 2L91A 1J84A 1NXMA 4IEUA 4N43C 4QHZA 1RUD1 4K21A 1BE3G 4N43B 4YGEA 1WMEA 1EXJA 3NKTA 1P84E 3TK1A 4KG8A 3TB0A 5FO9B 1GOHA 2GAUA 3L72D 1GOFA 2KA3A 2UU8A 1V70A 3HT2A 4E8DA 1NX9A 3VBOB 4Y99C 4DS0A 1IFMA 5CMZA 4PD4D 1Y9QA 1PGW1 1VLNA 2WSCH 2ZX4A 2WJSA 4P14A 1DH3A 1FOSF 1R092 4EJRA 1W8WA 3P8CD 2B9UA 5T5LA 3E1F1 4IEZA 2BEOA 4N78E 4LLOA 2C9AA 2LW8A 1JCDA 1T3UA 1KFXL 3WU2E 2WUHA 2YBKA 1USEA 1PMHX 3N9QA 1Q5OA 1NO4A 4AI0A 4BQXA 3ENRA 1L7QA 3VD5A 3RDIA 2E9QA 1OWAA 4X8NA 1QJY3 2FYUE 2JE7A 5AW3B 4J6GA 4CCJA 1VBE2 2ZEZA 3AP9A 4ATEA 2Q1FA 4RN5A 1O59A 3AP7A
chains in the Genus database with same CATH topology
1U5IA 3R6SA 4AEJA 1O3RA 4XFFA 4YM3A 4AI1A 3WR0A 2Q0AA 1PGW2 4K7JA 4AXOA 4Z2WA 2DVFA 4OFGA 4TSVA 4G3YC 4YW4A 4LO6B 3FHIB 2OYZA 3V64A 5CADA 4C1WA 4LEJA 2V73A 4XTPA 5FPZA 2D98A 1AYN3 1NE6A 2RMU3 3H1WA 1H30A 3OYWA 4LE4A 1YJKA 4GWNA 4MV2A 1ZRRA 5GZCA 4BA6A 1H1MA 1ZBE1 2WLQA 1Y7BA 2ES3A 2MEV1 2ZGRA 3ZXFA 1LEDA 2VW0A 1U12A 3W58A 2GNTA 3A4UA 1GNZA 1ONAA 1FV2A 4OZXA 4FXKB 2Q1MA 1BYHA 2R1DA 1COV2 4E2QA 1V6JA 1VBB3 3KD4A 3AFKA 1MS5A 5T50A 3USSA 2CY6A 3WLUA 3RWNA 3CJIB 1QH6A 1B09A 5L73A 4YYOA 2DU0A 5I8SA 5CB7A 4KWKA 3AP5A 2E7AA 2K9ZA 4TZDA 4XFIA 4PJYA 4HETA 3POWA 1BCXA 3ES4A 1W6OA 1XU2A 2EVXA 4GWMA 4XFHA 1HXS2 2W52A 3WDYA 1NY71 1GICA 4CDXC 5DXDA 3RQ0A 5AC93 4XHXA 4GQ7A 4JDNA 2P37A 4BOWA 5BUVA 4G4FA 4OI2A 1EPZA 1BZWA 3VZMA 5JWPA 1LHNA 1W2UA 3VUOA 1URXA 1NCQC 2YMZA 4L11A 1NYWA 3QLQA 3A0KA 4LBKA 4DRRA 1FATA 4DY3A 2DCTA 2RM23 1UU5A 3JD73 4Q4Y1 1W6PB 1OOPA 3ZDSA 1SLLA 4JGYC 1RUD2 3JZVA 4XE9A 1MEC2 3T1LA 4GALA 1BJQA 5DZGA 1ND3B 3FLRA 1D2QA 2JG8B 4TLFA 1ULEA 3ZFFA 3ZXLA 2GC1A 2GN3A 4BH9A 4COUA 4O9EA 1F31A 4HANA 1YFUA 5BNNB 2VNOA 1REDA 1I9RA 1DU3D 3IMNA 5A32B 1BEV3 1LB2A 2CTVA 4YXWH 1V6IA 2ZCWA 3U0ZA 1QH7A 4R8HA 4B7EA 2DUPA 4P9WA 2D3SA 4JGZB 2ZKNA 2WA4A 1LOBA 1HRV3 3RYKA 2Q5TA 4YRDA 1J3PA 1FMD2 3D82A 4NPRA 2ZX1A 3QH6A 5D8AC 1JYCA 1LKNA 5HCAA 2F6BA 1F8VA 1O3QA 2QJVA 3LOIA 2ZX2A 2VUAA 3ZO0B 3ZFEC 2HWE3 3LSDA 3VBSC 1YUDA 4WBBA 1ZZ9A 3VZJA 1LTEA 4QPIB 3WNXA 5JDBA 2ZMLA 1ENQA 2E51A 2HEVF 3B9IA 5I8TA 1QOTA 1DIWA 4I0WB 3IDCB 3ZYGA 4QPYA 2HWE2 4WM8C 1FT9A 4D94A 1ENRA 5CU1A 1G9FA 2BUKA 3B94A 1R1ZA 4QPGB 4AK3A 4XYXA 4LO7A 2OPKA 3IWZA 3GHNA 4LA2A 4ZU7A 2WKKA 1JTZX 4XHBA 2A3WA 3ME2A 1WD4A 3SH3A 3AMPA 3VBRB 4AFDA 4B3NA 3B00A 4DJGA