4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine dioxygenase type I
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
5KHHA 2QDRA 2K0GA 1CAWA 2B8MA 1O3QA 3EQEA 1DGWA 3IDBB 4XETA 1O3TA 4HSJA 3GYDA 4HVOA 5JR7B 2D5HA 1UCXA 4MGIE 5D1IA 5KHIA 4MX3A 4PIXA 3E5UA 3IDCB 2KXLA 3JZVA 1YLLA 2QNKA 1J3QA 1CAUB 3TNQA 5BV6A 3CL1A 4Z07A 1ZNPA 2GZWA 4IERA 3OCPA 2UYBA 1ZZCA 1CAVB 3CEWA 3RPQA 3ZDSA 2EA7A 3NVCA 5JSPA 1QY4A 1J3PA 5CADA 1J3RA 2GAUA 3LA2A 1PMIA 1YFYA 2D40A 3MYXA 2UY8A 2V09A 1NYWA 4IEOA 4LA3A 2ET7A 5LRSA 3RYRA 2HJIA 4HVQA 1ZZ7A 1J1LA 1LB2A 4A2UA 2Y0OA 4HVRA 3IWZA 3UKVA 3H1YA 3H7JA 1RUNA 5F1RA 4F8AA 4FAGA 3E6CC 3SCHA 1GQHA 2BEOA 1AQTA 1UW8A 3USSA 4MH0E 2E9QA 2Z2SB 1YHFA 3UKNA 1IFPA 1CAVA 3OD0A 2B9UA 3PNAA 2EAAA 4MGKE 5BPXA 4XF0A 3QACA 2ATFA 1UIKA 2MPFA 4IEQA 5E1RA 1EPZA 2IXHA 3E6DA 3IIAA 4WBBA 3LZZA 1E79H 3KGLA 3ELNA 1NZCA 3LOIA 4GULA 3U10A 2MHFA 2OPKA 4HZFA 1Y9QA 3RDIA 3SCFA 2XGXA 4YSFA 3D82A 3DKWA 2I45A 2PQQA 2VECA 5EZWA 4ONUA 4QM9A 4KU8A 5I91A 1QXJA 5FPZA 1ZRFA 1WLTA 3E97A 4IEPA 2OYZA 2OA2A 4MZUA 3M70A 1ZRRA 3ACLA 5I8YA 3BPZA 2F4PA 3D0JA 4CYDA 3H1WA 1I5ZA 2GH2A 3E5XA 1J59A 3QOPA 3EO6A 4LUMA 4KWKA 2V7QH 1QXRA 4DINB 4R8HA 2XL9A 4XFHA 4IEVA 4I01A 1CGPA 2XL7A 3PJSK 3H8UA 4EV0A 3D0SA 4LTAA 1O3RA 2VPVA 3FX3A 4N9HA 2WSSH 4KWLA 3FFQA 4EROA 4XFIA 2MNGA 2QVSB 4META 2QJVA 1RL3A 4BIFA 3OGJA 3I54A 1I6XA 3I7DA 3E5QA 4D7TA 3OTFA 1SFNA 1RTVA 3S0MA 3IBMA 2PAMA 2K9ZA 4XFBA 3KMHA 4AXOA 4AVCA 4HSLA 2PAEA 5FLIA 1H1IA 5CVRA 4PIZA 2Z69A 4ORFA 1PM7A 3RZZA 4LULA 2QCSB 3EHKA 5BXXA 2ETEA 1CAXA 5I8SA 1EP0A 4RD7A 1GQGA 3S7IA 1NE6A 2ZCWA 2IXCA 4LA2A 1DGRA 4OLLA 4O9GA 1YFUA 4UBHA 3PVBB 4UXAA 4LLOA 3PLQA 4KWJA 4O9EA 1VR3A 2FQPA 4Q0QA 1U12A 2E5YA 4YXWH 5JSOA 2ET1A 1NXMA 4MUVA 3U0ZA 4EWAA 1WGPA 2PYTA 2H6CA 5FQ0B 4JVAA 5JSRA 4TLFA 1X7NA 3I59B 1SQ4A 2DCTA 1CAUA 1FXZA 1OD5A 4IEUA 4QX5A 3SHRA 4LUKA 3ST7A 3OF1A 2GU9A 1JUHA 2BYVE 2W6JH 1ZX5A 3S7EA 2N7GA 1IPKA 3U11A 3BB6A 3VHRA 3FJSA 3HT2A 3KGZA 4Q0SA 2PTMA 2BNMA 5JCTA 3N4MA 2CK3H 4XEZA 1ZVFA 5I0UA 4XFAA 4D7SA 5K8SA 3NKTA 4MGYE 3O14A 1DZTA 1ZREA 3WW1A 3SMHA 4XFFA 2PAKA 1X8EA 2E5TA 3BALA 1H1MA 1Y3TA 5FQ0A 4P9GA 1XE8A 2VQAA 4QMAA 4JTOA 1YFWA 1OMIA 1ZZBA 1RUOA 2C0ZA 3RNSA 2O8QA 1XE7A 3I59A 4FAHA 5I8TA 3SCGA 2B5HA 5I0SA 4AQ2A 5LEJA 2IC1A 5KHKA 4L11A 4N9IA 3L2HA 4IEZA 1TQ5A 3UKTA 4EWEA 3NW4A 4QXKA 5FCCA 5T3NA 2QE7H 5HI0A 1OI6A 1BSHA 3DN7A 1YFXA 3DL3A 4QM8A 4ZU4A 2XKOA 2P17A 2OZ6A 2GC0A 4HBNA 4I0BA 1JEKA 2IXJA 2XLAA 2BGCA 2FMYA 3NL1A 3HT1A 4OFGA 4Q0VA 3RYPA 3WW2A 3DV8A 2D93A 2GC3A 4MV2A 1XRUA 1YWKA 2PHLA 3HQXA 1V70A 2CAUA 3CO2A 4XF4A 4XF1A 5C8WA 2GC2A 1HW5A 2XNDH 3FWEA 2PFWA 4Q29A 2CGPA 3MDPA 4JV4A 4XFGA 3ROUA 5BY5A 1WA4A 3KSCA 4Q0UA 1ZZ6A 4E2QA 4IEWA 5C6CA 4YYOA 2OZJA 1BSNA 3B02A 3EJKA 3H7YA 4J1WA 2EVXA 1Q5OA 3LA7A 1RC6A 5KBFA 1LR5A 1X82A 3H50A 2IXKA 2XLFA 3LA3A 1DZRA 4IEYA 4QGNA 3H3ZA 4KU7A 1X8MA 3ETQA 1O3SA 4L2NA 5FLHA 4WVZA 5BUVA 2IXLA 1OFNA 1UPIA 5J3UA 1UD1A 4QGMA 4BYYA 1O7FA 5FDBA 1J58A 3MPBA 4YRDA 2XKPA 3ES1A 4BH9A 4PIYA 1O4TA 2XHKA 4AVAA 2H0VA 2CV6A 3MZHA 4H7LA 4E2GA 4HMZA 3CLPA 4WZCA 2UYAA 1VP6A 3HIFA 4KL1A 4LEJA 1L3JA 3CJXA 4AQ6A 3KCCA 3TNPB 4UBGA 3EBRA 5LRRA 2JDIH 1LRHA 3NJZA 3EFFK 4MGZE 2BNOA 5AVPA 3SXWA 4B29A 1UIJA 4PJYA 2PA7A 4JTNA 2PHDA 3BU7A 1RGSA 4IEXA 1EY2A 5FLJA 5I93A 1EYBA 1NE4A 3G7DA 3R6SA 4AVBA 3NSTA 1O5LA 4F7ZA 4QGLA 5CU1A 4Z82A 4I0AA 4IESA 2CAVA 4DJGA 1O5UA 4XF3A 3C3VA 4BHPA 2Q30A 4ZU5A 2IXIA 5JAXA 1G6NA 3ES4A 2UY9A 5E16A 2WFPA 1FT9A 4X6RB 2Q0AA 5KHJA 5J48A 3WW3A 1ZRDA 4IETA 4FBFA 3FZ3A 1CAWB 5EFUA 3FHIB 4FT8A 4K8FA 4E2SA 4ZU7A 1LKNA 1YUDA 4XFCA 2XLGA 5I0TA 4HLTA 2BNNA 3H9AA 3GBFA 4R52A 1SEFA 5I0RA 2D5FA 4J1XA 5J7MA 4I2OA 1Q43A 1QWRA 2WC2A 4I02A 1Q3EA 5FPXA 2Q4SA 3CF6E 4EWDA 2Q1ZB 1ZZ9A 4I3PA 1VJ2A 3M3IA 3E6BA 4Q0PA 1FS0E 2H6BA 3RYKA 2HKXA 3LAGA 1ZZ8A 1CAXB 3H3UA 4NVPA 4X6QB 1IPJA 2O1QA 4I09A 1ZRCA 4HN1A 3BCWA 5LEKA 3FE5A 3WW4A 4YARA 1FI2A 2ZKLA 3H1MA 5KHGA 4HN0A 4YNIA 1CX4A 4XF9A 2GC1A 3LWCA
chains in the Genus database with same CATH superfamily
2NPSB 4OGQC 3MHZA 3HNYM 2XB6C 5JR7B 5JXGA 1XJAA 3I2JA 4C46A 3OJAB 1UXZA 2NMOA 4Q4Y1 5FYUA 1RUJ1 2VZRA 5J98B 4AG4A 1XBFA 2RJLA 4JGZC 5CB7A 1N7SC 3SH4A 3P1IA 4IEOA 4X8PA 2ZHKA 4C1XA 2N1TB 1RXFA 1NH4A 5JI9A 5GTHE 1AR83 4XAAA 3VBHB 2KNCB 5LBFA 4IGOA 5LW9A 4XJAA 1QL2A 4D6TG 2OKXA 3PU8A 1REEA 4N78D 1UW8A 4S2FA 3KVBA 4LO5B 2A6VA 4GODA 3ZXAC 4QX8A 1NG0A 2WWJA 2ZX1A 3L73E 4QT6A 3L72J 1NJIQ 1BBT2 3AE2C 1K8AQ 4AEJA 1L0NG 3CCLP 2BU9A 3Q8EA 4RHV2 1BCCD 2I45A 1WMDA 1HTLC 1UYPA 4FPKA 3RVHA 3AL6A 4FOWA 2YGLA 3P5BA 1S9KE 3DYPA 4XUNA 3O6QA 5A70A 2YV8A 3RGUA 3M9BA 3H25A 2WPRA 2VD7A 4EROA 3K3OA 4CP9B 1RL3A 1STMA 4QX7A 3HTKA 3ZFEB 3S0MA 1SLIA 3HD8B 3H1LG 3ZN6A 4DUXA 5KC5A 4WV8A 4PDWA 3KPEA 4M00A 4I30A 4GJYA 3AKPA 3VKNA 2HWD3 4CP1A 2ARXA 1KB9D 3H8OA 3B4SA 1WW5A 4YZ1A 2Q6QA 4OLLA 1G7YA 3ZXDA 4COWA 4KWJA 4XOGA 1NXMA 2KOGA 1K04A 1WGPA 2FDJA 1MEC1 3WP3A 5FQ0B 1DGLA 1ZBA1 3PVNA 4ASLA 5HXMA 2DCTA 4MSVA 2IFWA 4A3ZA 2P6CA 3AFGA 3LEKA 4B7KA 2BYVE 3M7AA 4Y20B 4A7YA 1OA2A 1C57A 2YZ4A 5FXXA 1KYOI 3WF2A 1HJFA 5LZ6A 1KB9I 3EMRA 5F3CA 2E5TA 1REDA 2Q8DA 3SWFA 1H8TB 2OVUA 3SCGA 3VB9A 2YPDA 4AHYA 5CMZA 5E79E 4UB6H 2WNVC 3LSDA 2VTXA 4LO6B 3WUTA 5AW0B 2Q1FA 3M3EA 4W7YA 5JUVA 2ZGKA 1K73Q 1PMJX 1YC61 1VQOP 4ZXKA 5EJZB 3P32A 2PHXA 1JU4A 4I0BA 4O65A 1JNMA 5FMBA 4E8CA 5GTIE 3WV6A 2FCTA 4IW3A 1RF1A 4MHRA 3ZYBA 1OUXA 5JOWA 3CJIC 1UZVA 1S4XA 3LPGA 2A71A 1MS3A 3ACHA 2GDFA 4OGQB 1PIV3 2XNXA 3MPPG 4XUQA 1N2DC 1JI6A 1Q8OA 4OHXA 2LKMA 2QJPB 2O01H 1COV2 5J1XA 3AYAA 4JRLA 2W08A 4D7YA 2WZEA 3UJOA 4E2QA 3U1CA 1YHQP 1MS9A 3B02A 1MS1A 4URTA 1E5IA 3H1JE 1FAYA 2Q1KA 2IXKA 3MD0A 1RVF2 1SLQA 4Y3OA 3OB8A 1FMD2 2WABA 4M3CA 1UPIA 2VMCA 4BH9A 4ASWA 4KMQA 3WDWA 3LSEA 4Q5OA 2O1KA 2TEPA 1NLSA 4NIDA 4FPHA 2OYHC 2Y34A 4RYDA 3VBRA 1GQPA 2QFEA 3WDXA 3IDAA 4JDMA 5CISA 4JDNA 4CSWA 3NJYA 3R6SA 5A3NA 2BPA2 4QKDA 1FOD3 1KFUL 3IFMA 1BGYD 3VZLA 4YM1A 5K0UA 4XF3A 4BHPA 1S0FA 1IS6A 1WD4A 4CU9A 5SV8A 4U36A 4R4LA 3UETA 1PVXA 4C90A 4IE6A 3H8XA 1JMUB 1V9U3 2WL1A 3WDVA 2BCCG 1KFXL 4CEYB 4H2AA 1V00A 4A3XA 3CLQA 3HE4A 3F95A 4P9JA 1RUC1 1EZVE 5J7MA 1XYPA 1QWRA 4YM2A 3ZKYA 2R1BA 2Q5TA 3L36A 5DMYA 3I2OA 1W39A 1OLMA 3P6BA 2HKXA 1ZMEC 4OHZA 3H3UA 4INDA 4DUWA 2HWF1 1FDIA 2V5YA 2WVRA 1WLWA 1FI2A 2RS52 2EALA 3WNKA 1F4HA 4XETA 1D0HA 1DBNA 2OW4A 2JWPA 1QNWA 3E5UA 4AHZA 5IATA 3PIGA 1IFMA 4I2LC 2P3YA 2WNUB 2VUCA 5C5UA 1DH3A 3NVCA 2Z4EA 2QQMA 1J3RA 5IW0A 4ZKUA 5FK8A 2Z79A 3K77A 2WITA 3FUQA 3VN0A 2QBXA 3OPZA 2A45G 2YMKA 1WMFA 1Q8SA 1A6CA 4H44D 4HPKB 1RUH3 2JDHA 4DRVA 4FSJA 1QVGO 1PNGA 3NNGA 1APNA 3ALQA 1CSBA 2W83C 3B5NC 4WBBA 3L72E 5T5LA 5JXIA 2OGUA 2K3RA 3RDIA 4FQ4A 1V6IA 5LY1A 3D82A 4NMIA 5IVFA 1UMIA 1LT9A 2P67A 4XE9A 5D21A 1URQB 3ZXGA 1B35A 3IR9A 4ES9A 2YROA 2BFUL 3RK3D 3MLLA 3ZXJA 1IS4A 5AW3B 5DUVA 2R49A 1AXYA 4BQXA 4XFHA 2HLOA 3CJIB 2KSEA 2ZAAA 4PDWC 3VHOA 1NTZJ 1G9DA 1UU4A 4CEWA 2Y33A 3AMMA 4AEKA 1AL21 1I9RA 1SPPB 3I7DA 4ISRA 3E5QA 2Y6HA 4ZPIA 1GP6A 2NRGA 2I1KA 1SFNA 3N7NA 1EDKA 2XR4A 1TE1B 4M3LA 1NCRB 1W5CE 3GHNA 1I5PA 5FZBA 5T54A 4PBPA 2XOMA 5I8SA 2VNRA 4LA2A 1CESA 4L8QA 3M06A 2YFZA 2VH9A 1PPJD 4MGSA 3OY8A 1AR71 4FFFA 1QJEA 1WCSA 4KHXA 3A4UA 4ZY9A 4EN8B 3BYWA 3V4WA 5IJRA 1RQUA 1VRH2 1IQAA 2D6NA 4RL7A 3BCCD 3Q5PA 3OF1A 1RUF2 2YPJA 2IYOA 4YM3A 3RI8A 5JXHA 1F5JA 4AYUA 3PMEA 2E74B 1FNZA 4MGYE 3CXHD 1DZTA 3MW4A 2WFF2 2PAKA 1EXJA 1QJX3 4FPGA 4GAZA 3K48A 3I3MA 5A3TA 3N9MA 2UWAA 2Z5IA 1JMBA 1RF1C 1AYN3 3ZPOA 5BVZA 4FTEA 2DCKA 3ZDMA 5FCCA 4NN0A 5T3NA 4UB6E 2QE7H 1GWKA 3I3DA 3HVDA 3GHMA 4YVSA 4HB1A 1QJFA 3JBG1 5GLWA 1T2KD 2ZEZA 4U7JA 3CXHI 2D93A 1PVC3 1NTKD 4NPDA 1W6OB 1VBA1 4IL6X 5HCFA 4QB6A 1D7PM 5ANNA 1RITA 4NRMA 3V0BA 1WA4A 1WW7A 5FTTC 1AX0A 4H3WA 3N9LA 3TGUD 3LA7A 1PIXA 4XIOA 4PQ9A 1VBB2 1OH3A 4A4AA 3ITQA 2A3YA 1AR93 4QU1A 1E5WA 3O1OA 2YIUB 3VBRC 5GKAC 1S5LH 5CYYA 1J58A 1PK6A 2JO1A 1X33A 1ZBE2 5DAWA 5BNPC 5KXCA 3MZHA 4E2GA 4XIKA 1U5IA 4PV1B 1SQPJ 5K0UC 5A3MA 5HCAA 2E76D 3P7KA 2KZIA 4B29A 3SC7X 3ZX7A 5F3GA 3M1HA 2P1BA 2B4KA 4LBNA 2K2SA 1VQ6P 3KYQA 4I0AA 1IGOA 1LWUA 1U5YA 3L9JT 1F9KA 2Q3IA 1NLQA 1KC8Q 5E16A 2WNEA 2KYVA 5A33A 2I74A 5DZGA 4KG0A 2AC1A 3OEBA 5JXJA 4ZU7A 3VKFC 3VDBA 4XDQA 2FMDA 2XLGA 1YTZT 1SEFA 3DXTA 2QDNA 3POIA 5FZ3A 3JQWA 3BRTB 2VU9A 5C3RA 2HYNA 1NU1D 3VDDB 3H32A 1IPJA 2DTYA 3W5MA 4N90A 2PLV2 2PHUA 1BCXA 3UGHA 4LO4B 2FXOA 4HH2A 3CX5D 3WG2A 5CZKA 3DEMA 5KJ7A 1G9AA 1G2CB 2QDRA 2XJRA 5APYA 4OQ9A 5A80A 1JY3N 3LE0A 5D1IA 1GNZA 4JPZB 5KTBA 1HB1A 1EUTA 2E7TA 3ZN5A 2PQSA 2KIKA 2KLVA 1NTZG 1NA1A 3ZVXA 5IVEA 2C6SA 1L4AC 3SWYA 5DUWA 2GP5A 1QY4A 3M4FA 1QJZA 1KRIA 2GUVA 3WY6A 2D40A 3NNJA 3MYXA 4QXCA 3CX5I 3V0AB 2WA3A 1N1YA 4ZHNA 3HD7B 1PZ9A 1KILA 3A2AA 2R1DA 3WT3A 2ZGSA 1Y4WA 2VG9A 1QU0A 1B35C 2Y64A 2P1JA 3AP5A 1AR63 4RS5C 1K5MC 1E79H 3W20A 2Z42A 3AB0A 2IBZD 1Y9QA 1UMZA 5H9RA 4YG6A 1AV1A 3RRDA 2HEVF 4MGQA 3MIWA 5BU5A 1RUG2 4CEWC 5FZHA 2DVAA 4GWIA 3A0BH 2D2CD 4L75A 1H4GA 2A6WA 4GALA 4DY5A 2IX7C 1NCQA 4H13B 3KV9A 4XJUA 3B3QE 1KYOH 1FDMA 5GZGA 1KB9H 3WUVA 3KT1A 4HOOA 4IFDK 2EXHA 4PI2A 4M3CB 2WS91 2K9ZA 2IBZI 2K46A 4Q4Y3 5FP7A 5F3EA 4WY4B 1RUJ3 2FFDC 3B69A 4YG0A 2JXAA 1FPN2 1J1EC 4PIZA 1KGYA 1TME3 1W8TA 3ME2A 4V2VA 1CJDA 2A73B 4QXHA 1VBE1 2ZX0A 2ETEA 4EI2A 1CAXA 2QZ2A 4W6WA 2JKVA 3VMAA 1QDCA 1TMF2 1NE6A 4AHXA 3H1IE 3ZPYA 4RR3B 1ZRTE 4CDQC 2CDOA 2CTVA 2FQPA 4KNCA 3CIHA 2CHHA 2XJPA 1JZ3A 2PYTA 1F35A 1RIRA 4FPOB 1VAKA 5A6YA 3I59B 1FZAA 4OMCA 5LBCA 3RJRA 1LENA 2EIBA 2VW1A 1D0GA 2WYSA 2P3JA 4C8DA 1RUE1 1HJBA 4QQPA 4MLOA 1SMVA 2GN7A 2EF6A 4AHWA 3WW1A 3M91A 2YC4A 2VRSA 3BPSA 3ACIA 1UY0A 4GOEA 3U59A 4YVSC 1WLDA 2AXCA 2WT7A 1SQPG 4GOFA 5A7NA 2G9GA 2D6LX 2QTWB 5F6LB 2JB4A 1HXS2 3N3HA 2FDFA 2XZRA 1YRZA 3WU2H 4RGAA 3J8F2 3TAYA 1LGHB 1LULA 2R44A 1WCUA 5GZDA 4AE2A 4YVWA 4JKLA 4K1ZA 5FYSA 5BNOB 4HANA 5C33A 3WHUA 5GZEA 1JBCA 1QJU2 2QQVA 1BK0A 1W6NB 3GF6A 3KSCA 1OFCX 3C8VA 1MEC3 3EJKA 5EYXA 2JR8A 2PHWA 1KS5A 1KDMA 1U5ZA 5JPNB 3KQRA 2A6ZA 1R092 2ERFA 5A6ZA 2XVGA 4KU7A 1OFNA 3EFGA 5L7OB 1UD1A 5KC6A 4BYYA 4Y33A 2DU1A 2ZEXA 2H0VA 1S5LE 4HMZA 5JR2A 1JZ4A 3I4IA 4QQ2A 5JLVA 1HRI2 1LWUC 4UBGA 1L0LJ 3B00A 1TEIA 2LXCB 1LT9B 2X5IB 1R8EA 2AXTE 1S1AA 2PA7A 2ADDA 3RZHA 5APWA 1EV12 3I3QA 3NNFA 1W8UA 1BBT1 1S0BA 4RHV1 3ATGA 4LMFA 3G6EP 3RS6A 1G6NA 1SLTA 2LXBA 2BFUS 4E4SA 4IGQA 1CAWB 2VBPA 2OT7A 2A75A 3NV1A 3WHTA 1LTTC 3MBWA 3LEIA 3T4VA 1LNSA 4WM7B 5KJ7C 2POHA 3THDA 5F9TA 1AX2A 3MGUA 3NMDA 1D2QA 4GQ7A 2JDKA 3SKVA 4Q4X3 2W52A 5C4WC 1NA1C 1EUUA 2K0GA 2FYUD 4Y1VA 2Z4FA 1XNAA 4KH9A 3SEEA 1NXD1 1H2NA 3TNQA 1PL5A 3L74J 2JJLA 1KILC 2P37A 3WUDA 4XZUG 1HGVA 5A3PA 3WP4A 4QPGC 1HGZA 4PF1A 2ET7A 4RFT0 5H9PA 2HJIA 5JI7A 3HQUA 2PRRA 1B09A 3MFCA 2IYPA 3ZDVA 2CY6A 3RK2D 2ZYGA 2RS32 5L19A 3GBWA 1C8M3 2WKKA 3UKNA 1WRGA 2HWC2 1CONA 4MGKE 2VE1A 2MPFA 3K51A 1W6PB 4IUGA 1DYKA 2MHFA 2IVIB 3AXDA 5AW6B 4UT5A 2ZMLA 1ENXA 4QM9A 3G4SP 2XHNA 3B7MA 4U3FG 4AR2A 1RHI3 2WSFJ 3V0BB 3M3CA 4XJ9A 2Y38A 1OX3A 3A0BE 2KK7A 1NTKK 1DQ1A 3RBXA 3H1HD 1RMU2 4YGEA 2VQUA 3WF1A 3I54A 1KYOE 4AI0A 3GW6A 1KZUB 1COV1 1AJYA 1ZA4A 3ZSKA 1BDDA 2J58A 4ZS2A 2WSEJ 2PAEA 3VUOA 3ZYRA 2XBO2 1PK6B 3MLKA 1OIPA 4NHXA 4YW2A 3TK1A 1GU4A 1HQLA 1OZHA 3GG2A 1RVF1 5BXXA 4CU6A 1EP0A 1FMD1 1HN0A 1OXZA 3HUSA 4RD7A 4S2DA 1GBGA 5EJ1B 4B86A 4ZKTB 2ZGMA 2P6HA 2Y9YA 2YKOA 1Y9MA 3Q8AA 2A06G 2P58A 3A0NA 5FZEA 1T2XA 3APBA 1AVOA 4ASKA 4TLFA 2GN3A 2DVGA 1CAUA 4A7PA 2EAKA 1JB0J 3J7HA 1VF5C 4PQQA 2SPZA 1ZX5A 5A33B 3THPA 3RWKX 4RJTA 4FP3A 4CDXA 1VRBA 3O1SA 2JDNA 5I0UA 2KS1A 3INAA 4NPRA 1NLRA 3TF5A 1Y3TA 3C9IA 5CFCA 2OQ7A 3ILFA 1F15A 1M56D 2JG9C 3RNSA 2O8QA 4Q4V2 4NIAA 4RGGA 5EYYA 2Y6FA 4L11A 1XOYA 3N7LA 3MZWB 1A3KA 4L92A 5FY9A 4Y1ZA 4QXKA 2BZDA 1XNBA 5DUUA 3R4YA 3RG0A 2MEV3 4YVWC 5L36A 4PCRA 5GLTA 4UW6A 1NU1K 1LP1A 1VB4A 1CPMA 1QL1A 3O0WA 2R30A 2QJKC 3WW2A 2RS51 1Y9BA 2IZ0A 1SQQG 2IDBA 2ZGLA 1W2UA 5EXOA 3VBOA 4XF4A 2ORZA 4LLHA 4HONA 3WU2E 4Y4RA 3PH0A 3WD5A 3ZR5A 4N43A 3WSOA 4DIQA 5BNNB 2ARBA 4NHKA 5FYMA 4AFDA 1G9BA 4P9WA 1BSNA 4WWIA 2XH6A 1KQLA 5CCGD 5KBFA 1M1KQ 1RC6A 3EXUA 3IB3A 4QGNA 3T1LA 3ETQA 5F5CA 5LBBA 1SBDA 2VAUA 4BXSV 3HEIA 1E5SA 3T2QA 5IFPA 5T5JA 2YXQB 1IK9A 1IG3A 3AKQA 1QKQA 1HUCA 2WWWA 5DN2A 2FKWB 3JCIA 5FZMA 4A6SA 2D3SA 1L0LE 2JDIH 2RM22 2NZ9A 2VTXJ 3L74G 3G71P 2PHDA 1OF3A 2Q1MA 5CBLA 4IEXA 2DUPA 5LA0A 2AH2A 3H1KJ 4QXBA 5C3PA 4COUA 1OVVA 4AVBA 3NSTA 1O5LA 4GH4C 1PP9D 4Z82A 1NCQB 2GMPA 2JKBA 2RR13 1ODNA 3C3VA 2PP6A 4IV3C 3KHUA 2K37A 1F8VA 1YQ5A 3JBG3 5F32A 3CX5H 3CCUP 3KM5A 3K4AA 2QQJA 4D0QA 4YLZA 5EFUA 5A7QA 5I0TA 3L73D 5HXVA 3K4DA 1LHOA 1SLCA 2G1MA 1SLBA 2QIWA 1CAXB 5ACA3 1CW5A 2E26A 2YGMA 5APUA 3VDAA 3O0XA 2XONA 3NO8A 2R32A 3AKSA 5KHHA 1S9KD 1HQWA 1O3QA 2GMMA 3FHQA 1N47A 4AEDA 1N73C 2VC9A 1H6YA 2VO5A 2KXLA 3JZVA 1JUNA 4H44B 1VMJA 2VJXA 1SQVJ 3Q5RA 3GZAA 4QPIA 4I7ZB 3NQHA 1MQTB 4GKXA 2LTNA 1VRH1 3LDRA 2TBVA 1PZQA 4HVQA 1J1LA 2B39A 2W3JA 1LB2A 4NRQA 1SQXJ 3USUA 3KXDA 5DAVA 3DXUA 3EQ2A 4DO0A 3OUIA 1GQHA 1WD3A 2E9QA 4MYEA 2WFF1 3CMEP 2B9UA 5BPXA 5K4LA 3RK3B 1WZXA 4IEQA 2CGOA 1C5IA 4JF7A 1S2EA 2IVJA 5F5IA 4AFMA 1PM4A 2JDYA 3AC0A 1EAH3 1C3HA 1LESA 2HPCB 3RGBA 2XGXA 3DKWA 3D3AA 5DJUB 2NMNA 2R072 1ZN5A 1S0GA 2A6XA 1ZRFA 3ZIWA 3E1RA 4XDOA 2V4VA 3V6IA 5FY4A 2VXRA 4KWKA 3H6PA 3AJZA 2C9NY 1CGPA 1OLRA 1NOHA 1WW6A 5B5EE 4UFJA 4GMP0 5AVWB 4YPJA 4BIFA 2R7EB 1H2LA 3OTFA 3I2IA 3VP9A 3WF3A 5IUQA 1SQBJ 2WLQA 2BJSA 3KT4A 4NAMA 2DYCA 2BBAA 3CCMP 2CYFA 5FZOA 1A8MA 4RESB 1DFQA 5F3IA 2E75D 3AZYA 1LOGA 5FKCA 2X53S 2VUAA 1US3A 4AVTA 4CA9A 1ZBE1 5FY1A 3VBSA 4ET7A 1UY3A 2J7MA 1XNKA 1MS0A 3H1JD 4UFLA 5CEHA 1OH4A 2PHTA 2GU9A 2L9LA 3U11A 2XXZA 1KQFB 3N4MA 1VB2A 5L8RJ 4LIVA 1SFCD 1VPCA 2DDUA 1XQNA 5GLVA 3TN92 2AEYA 2J42A 2KSJA 2CPBA 2CGNA 3DECA 4WVWA 2DUOA 3T2PA 5I8TA 5FPAA 3B5LB 2YBPA 3AVRA 1LOEA 1MZEA 1TQ5A 4EN6B 2Y0DA 2MJZA 1XXNA 1HB2A 3FN9A 2OYIA 1GL2A 3O1PA 3H1KG 4LKDA 3POFA 2W1WA 4N53B 4EE2A 1UNBA 2JD9A 2P10A 3C7OA 1PGL2 2GC0A 3Q2YA 1FOSE 1KDKA 2PLV1 5LY2A 1MZ9A 3HE5B 1W90A 2GSYA 1BVP1 4AAXA 4NIGA 1FV2A 1GOGA 3R05A 2VNGA 5A6QA 2ZT9D 1V6JA 4AL9A 1EZVD 1DHKB 3I2KA 4IFFA 5BY5A 3AE5C 5FYHA 4LKSA 4IEWA 3L70G 4RSUA 3OBTA 5D2AA 2BEZF 2E76B 1UXXX 1N86A 5A3OA 4QKNA 1IK7A 2ZMKA 2OXBA 5BUVA 2OTLP 3GZEA 5C5TA 5JZGA 5FO8B 1CI6B 5LWBA 3FBMA 3T09A 3I3EA 1C1LA 2HWD2 3CLPA 3PUQA 2VZTA 4IOIH 4LITA 4NJ4A 4HT1T 4ZKPA 1ZR2A 5CKQA 1L2PA 3LOBA 5CNAA 2VY0A 3VBFB 1UIJA 2QE3A 1SQVG 3GLMA 4E4ZA 5CCHD 2G9ZA 1JY3P 4F7ZA 3NV3A 4JDOA 2XV5A 2HEYF 3AP4A 1LOFC 1LGNA 5AVXB 3TEYA 2BGPA 3ASIA 1YI9A 1RUG1 4EN7B 3RZKA 1ZRDA 1QHDA 3EB7A 4FBFA 3AZZA 3O1MA 4W80A 1R083 1LKNA 4R9AA 3CX5E 4W50A 3L72D 1H2KA 5EIYB 4I3PA 1VJ2A 3RYKA 4AEDC 4UOJA 3LAGA 5LK7B 3LW5H 2RMZA 3HUSB 3AM2A 4C7NA 2XU6A 3PVEA 2WLPA 1YI2P 2ZKLA 5IK5A 3LW5J 1CX4A 4AZZA 1FPN1 2R0HA 2LRPA 3OYWA 4ARYA 3I56P 1TU3F 3VL9A 3AE7C 1FZCB 4LOSA 1OKOA 1GP5A 4YFZA 3FC0A 2D5HA 4WM8B 4YFWA 1TMF1 1MV8A 1V6OA 1YLLA 1J3QA 1CAUB 2BOIA 1HF9A 1PIV2 2H43A 2UYBA 3L75G 3RPQA 3NKGA 5C8CA 5C9AA 4CDXB 5IVCA 1NOVA 3AJYA 1FU1A 1VQKP 1GZWA 3V2PA 2WPSA 5KKZC 2NPSA 1GWLA 2YFUA 1SQBG 1JZ7A 3AXEA 2GP3A 2YMYA 1X8YA 1SQXE 4BE3A 5CFCB 4A2UA 2O3JA 1JY2N 2L91A 3HPNA 4RHV3 1RUNA 3FHAA 2ZMNA 1PGJA 1CZSA 5SV5A 2JE9A 4KJMA 2D2CB 5A32B 4RA0A 1D7MA 5FO9B 2W5FA 4LGDE 2IXHA 1OURA 1GMMA 1OLME 4IE5A 2G8YA 5FPLA 2N1TA 4FPLA 3WDYA 2A45I 2R0FA 2RV9A 2VECA 3N7MA 3VKMA 1HXS1 1MZ5A 4DS0A 1PO22 3T2OA 1WWYA 3VBOB 1SFYA 1XYNA 1VMFA 5KLVJ 3VLBB 1YJ9P 3RZGA 2BEQD 5B2GB 2GH2A 2V72A 4CRQA 3PUSA 1J59A 4N43B 1G8WA 3J8F1 4EV0A 4HFSA 1V9U2 3DYMA 3OGJA 5KR7A 4D7TA 3ZSMA 5FPUA 4XFBA 1QJU1 4YW6A 4UFKA 1GU3A 3UV9A 4CCLA 1RXGA 3TDKA 1W9FA 5IK7A 3L37A 3M9HA 4BZ4A 3VBSC 3O12A 3BI3A 2AYHA 1R091 2W1SA 3CDZB 4QU2A 1VLNA 2IFNA 3THCA 1ZXGA 3PLQA 4X8NA 4MUVA 1K5JA 3NTNA 3ZFEA 1BGYJ 4YGDA 4AGGA 4BXLA 1HRI1 1YIJP 2FDGA 4XILA 1NWQA 2C1FA 1W0OA 3THTA 2D43A 1EV11 1WA6X 1IPKA 4H0LD 3CHXA 2WBKA 4Q0SA 5CFDB 1S2KA 4R9CA 2E43A 4CCNA 4XFFA 2OYIC 5FQ0A 1GL2C 2C5DA 5TISH 4QMAA 4JTOA 5FWJA 1GD2E 4HKZH 1NTMK 2C0ZA 4FO9A 1H30A 1RUH2 2FCVA 4FAHA 1DEBA 1BCCG 3PVOA 3MIFA 1FZBA 1SZBA 2C26A 2VTFA 1LTAC 3MFAA 4GKYA 2J1SA 1NKZB 3NW4A 5A7WA 2R6QA 2FBEA 4QM8A 4BU2A 2V7QJ 1AFOA 1VMHA 1JEKA 1HJ0A 3FLPA 2BQPA 2WRAA 2DUQA 4Q1RA 5AW7B 1V70A 2CAUA 1RVF3 3ILNA 3WMM0 4WBAA 3CQOA 3SLIA 4QPIB 4CUCA 1IZ3A 3FWEA 2ZGRA 4QQHA 1AXKA 4Q29A 2W1QA 5GJ6A 3UGGA 1VQ4P 3BTAA 3V65A 5JZGC 1FATA 4HK9A 4W8JA 3H7YA 4FTSA 1T6AA 3D6EA 3AE6C 1X82A 1BJQA 1QH7A 5AW4B 3LA3A 4E9KA 2DW3A 1AYM2 4L2NA 3D70A 5FLHA 3JC22 3BRVB 1UZ0A 2WWSA 4KI5M 5L9VA 4AI3A 5FDBA 3POGA 4KT0J 1U0AA 2JE8A 2JDZA 1BEV3 3TB0A 1LECA 2RS31 3TNPB 5FY5A 1KITA 2HWC1 1GOHA 4XABA 3RSJA 4ZZ8A 3IAPA 1V6MA 4XBNA 3AMQA 1PO12 3BVCA 2F17A 2Q30A 2V73A 2QQWA 1JHNA 1P84H 3M0DA 1EDLA 3PIJA 1Q56A 2XWJB 4NO4A 1LOBA 1OW6A 5C70A 3HBZA 4XW3A 4BJ0A 1YIPA 4BRYA 3OG2A 4BQ4A 2Q4SA 1BMV2 1N3OA 2VUDA 1RMU1 5H9QA 4JHTA 3AX4A 5FZ1A 1AYN2 2O1QA 3AEBC 5JVVA 1OFSA 4YG3A 2JDAA 1Y7BA 5H2FE 2XBO1 3SNMA 2I07B 4CEYA 3I8TA 4LE4A 2J1VA 1NO4A 3D6YA 5KHIA 2NPSC 4GMP1 2QM7A 3BCCJ 1LTGC 2BUKA 3RK2B 2GZWA 3H0OA 2KLUA 4QHBA 1OSGA 3GHGA 3BUCA 4QX0A 2P34A 2GMEA 4OUMA 4NIIA 4B8EA 3S30A 4QD2A 3GF7A 1AR92 1NGMB 2N1TC 4S2GA 2BEOA 3HBKA 1UF2C 5JWPA 4CCOA 4UF0A 3VBHC 1VAMA 3KT7A 5KAIH 1MS4A 3VZOA 1BGYG 4Q4V1 2YDEA 3L2YA 1OWAA 2HWE2 1WMEA 4L9BA 1Q8VA 2W6BA 3KV5A 2WTYA 4ZZ5A 4UW5A 5KLVE 3ACLA 5FZ8A 2FZ1A 1GYKA 2VCMA 3H1WA 3WOGA 2K88A 4BMBA 4TSVA 2OQ6A 4C0HA 3S57A 3RL0D 3OD4A 1PX3A 3U37A 4LTAA 3LGRA 1WKYA 2JE7A 4AFBA 1W8HA 1KD1Q 3AKTA 2JDUA 1URQA 1UN1A 2J1RA 4E4DX 1QH6A 3ZFEC 1UX7A 1VRH3 1LTIC 2WS92 1YJKA 4LORA 1KILE 2KZJA 2AUYA 1W28A 3CZJA 3ZO0B 1RUF3 5F37A 1VQPP 3SEPA 4C7RA 1JUIA 4UBHA 1JYIA 5F8PA 1YQCA 2D6OX 2NM1A 1SPPA 5EP9A 1FAVA 4YXWH 2R063 5DZFA 4XBQA 4Z2AA 4OHWA 3PP5A 2RM21 5FOBB 2BERA 2WAAA 5H9SA 2C9KA 5IYYA 4MVTA 2O1JA 3ST7A 3BASA 3HT2A 3POEA 5GM0A 1M1JB 2XKMA 3GCXA 4KBBA 1WCQA 4FFHA 3NKTA 1PZ7A 3ETPA 1W2EA 1X8EA 1ZLLA 3OGRA 3NRUA 2E53A 1NU1J 2VZ1A 1W6MB 3PTRB 3W21A 5TISE 1RF0A 3OA7A 4KQ7A 3H3LA 1SVFA 3POSA 1K3IA 3CKHA 1H8TC 3WR0A 4OI2A 1IFNA 1AR62 4BB3A 1Z7S3 2B46X 2YXSA 1C28A 4GZ9A 4NWVA 5AVTB 2Y0IA 5D8AA 4HBNA 4IE7A 2WPQA 5JDBA 3HT1A 2SBAA 3POBA 2PHLA 1GR3A 2UWBA 1VBB3 1Y47A 1R64A 4XMIA 2GH8A 5C8CB 5C9AB 3CD6P 4DXRA 1KQRA 2XQXA 1H88A 3Q8CA 3MDPA 1XU2A 2J1AA 4Q0UA 1C1FA 4CXWA 4YWAA 1HV0A 3P8MC 2QJPC 4J1WA 3GF3A 1UAIA 2QJYB 2XLFA 3TYJA 1IKQA 1G1JA 1YQ2A 4WVZA 2IXLA 4LQRA 4HK8A 4LLFA 2Y6GA 1PPJG 1W6OA 4DQAA 1QGKB 1TME2 2YO2A 4HETA 3ES1A 2KUBA 2DV9A 3T2TA 3R4UA 4WZCA 1VP6A 1RE4A 1PP9E 1OOPA 2RKLA 2ID4A 4IE4A 3BCCG 1LRHA 2ZZQA 4LBMA 3M0DC 3AEDC 1X79B 2BCCJ 2HODB 3L71E 1UX6A 5K9YA 4KWUA 1EYBA 1H0TB 1NTME 2R043 4YTPC 4LBQD 4LKEA 5IFTA 4BQ5A 3GJAA 1OC1A 4GT1A 4OYUA 2R071 5J09A 5JAXA 2B87B 3ES4A 2UY9A 3V2NA 5KHJA 2PLV3 4IETA 1AZDA 4XQDA 1P84E 4HLTA 3H9AA 3GBFA 2VOVA 4I02A 2WC2A 2J1TA 1RUD3 4CEYC 1ZZ9A 4JX0A 4LO8A 4DEQA 5APAA 2M0BA 2VW2A 4X6QB 4I09A 1GANA 1NTKG 1TNRA 3CNAA 1K12A 2HLEA 1MZ6A 3SFDC 5A7OA 5A7PA 3EQEA 2ZVOB 3GCWA 3N35A 2A45H 1J1DB 2GUSA 2Q7CA 4GD4A 1KFMA 4Q8LA 2RG4A 4MX3A 4ES8A 4CPBD 3PJQA 3EWKA 3V64A 1K42A 3TGUG 3OCPA 4OGQD 1KYOD 3KZ4C 3VDDA 4D6TE 1N7LA 3A7OA 3VD3A 4W6YA 3LDKA 2JWAA 4HL0A 2EIEA 3FXEA 3JQXA 2WNUC 3LIHA 2JECA 1G2CA 4YW5A 1CX1A 4CXXA 5FUPA 4NE9A 2N9BA 5FMCA 1KV4A 1L0NE 5F1RA 2QVAA 2ZGTA 5FBZA 1RUG3 3QCWA 1N7SD 4MH0E 4JHZA 1GP4A 1YHFA 4QX3A 2YC0A 5A7WB 3TN91 3PNAA 1BKZA 1BE3J 5LBEA 1IOAA 2WN3A 4Y4YA 3CWBJ 3E6DA 1AL0G 3W9AA 3LZZA 1TG7A 2EIGA 3V0AA 5KAIE 2CNAA 2LUWA 5FP3A 1M8OB 1W2BO 3HD7A 1LJ2A 4KU8A 1MR5A 2VMGA 4N8MA 2K9JA 4B4PA 1YQ8A 2D3PA 1PGL1 3H1LE 3U78A 1OVSA 4LUMA 1URQC 4ZMDA 4XVHA 2QQLA 4JQ0D 2Y0EA 1DQ4A 2E75B 3PJSK 2OUJA 5APSA 4D94A 4N9HA 3NFQA 1NU1G 3VOPA 3FFQA 1JZ5A 2G19A 3A22A 2OARA 5AC93 1POQA 3GMAA 2VZUA 4RQPB 1MFTA 1CIWA 1I1EA 3DPRB 4K3UA 5FLIA 4CE8A 5AW2B 3T4HB 1W9YA 5CVRA 2YC2A 1PM7A 3EHKA 2QQIA 1NCRC 4Q4X2 5APQA 1N3QA 4URAA 2NZ2A 3J26N 2HWB3 3WZ1A 5FAXA 3M3QA 2JG8A 2DBIA 2RJKA 4UYBA 1SFCB 5EFWB 2L5GB 5JSOA 3MIHA 1WBFA 1DU3D 2HWD1 2XUMA 4ATEA 1EDJA 2W27A 4WY4A 2IZWA 1Q90D 4U2AA 4CPGA 4QX5A 1DIWA 2JIGA 1JUHA 1MVQA 4QDRA 2W6JH 4D69A 3VHRA 4DXZA 1O91A 1W2NA 4RR3A 2OTKE 1Q8QA 5K8SA 1RF0C 2B9BA 2P3IA 1GICA 1GK4A 1OKQA 2H0BA 4BRYB 1ASJ3 2PAJA 5ABJB 2E74C 4P9GA 1XE8A 3PUHA 1L0LD 2IBZG 4Q4W2 4YW1A 3I59A 4C1WA 1QOTA 2HBTA 5FYYA 1C8M2 3J8F3 5KXDA 1YO8A 4DXTA 1QQP3 5DJTB 2ZT9B 2FYUJ 3RZJA 1GZTA 1HDKA 1OLQA 3IF4A 1QJU3 4FXGB 3MTUE 3N7JA 3G9RA 2IXJA 1KORA 4Q0VA 1REFA 1WLCA 1WBLA 2CWSA 1UYYA 2LM3A 3POJA 4TWTA 4XF1A 1UOBA 2QA4P 1RHI2 5FZ0A 3GHGB 2GALA 1X9TA 2V4HA 3BVHA 2W39A 3PUAA 1NTZK 1YBKA 2XUEA 2QZ3A 4NUBA 1PIV1 4MO3M 4V1PA 3BIEA 3OUJA 2YYOA 4XTMA 1AF9A 4Q26A 1YIFA 1HRI3 3H50A 1RE4C 1DZRA 2Q8CA 3KLSA 4CCEA 2B45X 1O3SA 1T8ZA 4UF0B 1D4M2 1F4AA 1GZLA 3VGIA 1S1CX 3P3PA 2RHPA 5BNOA 1X0TA 3SSUA 1JYVA 4JQRA 2XHKA 3U4SA 3OJBA 2YIUC 1W6NA 1LTJB 1AA0A 4KL1A 3GXUA 4QKFA 3L74D 1NUKA 4MGZE 2E33A 3WNLA 4PV1C 3MW2A 2DFCA 2BCCE 1VBC3 2TNFA 4BK4A 3MI8A 5L7OA 2Y60A 1H8AA 4LBKA 3LEMA 4DZGA 2D6MA 2W6AA 3PTZA 4IL7A 2WZR3 3C8XA 1UYXA 2VCCA 4XURA 4FQZA 3MUZ1 1PO21 1E57A 5LA2A 3WW3A 2IWGB 3DUIA 2ZJSE 5LCWL 5LK5A 3FZ3A 3JD73 2X5IA 3R4DB 3OBAA 1XYOA 3Q8FA 5EQUA 1VQ5P 1BE3G 4TT3H 4R4MA 4YGBA 4EWDA 2Q1ZB 1V9U1 3CWBG 1KXGA 1JY2P 4CCDA 3S5QA 3GBGA 4FTBA 3AYCA 1SLAA 2MEV2 1HBWA 3I2HA 3HMYA 3IN6A 1CAWA 3VDDC 4P14A 4LC1A 3O1RA 4NPEA 1ODMA 2OTJP 4HVOA 5CJ4A 2W92A 1EC5A 4WM7A 4PLOA 2QNKA 2VM9A 2ZA9A 4Z07A 1UKRA 3ZYFA 3VYIA 1HKDA 1CAVB 3TEZA 1RY3A 3MF9A 1R1A3 1YFYA 1YITP 2FYNB 2VULA 2N9YB 4IQPA 3AYDA 3WQBA 3RYRA 1KQSO 2WQYC 1ZZ7A 2OYOA 1MS5A 1VAVA 3UKVA 5CBOA 3LF7A 3OGSA 2EXKA 3UIAA 3F2ZA 1JS9A 2CDPA 2M5AA 3TNUB 3USSA 1GNHA 3HD7C 3OD0A 4XUOA 4XF0A 3C7GA 5FUIA 2WT0A 1A8DA 1SQPK 5FMOS 2WMMA 4PV1D 1RUH1 4M01A 5D8AB 3ELNA 3NMBA 1ULFA 1VIWB 1Q2NA 1RMU3 5EZWA 2RVAA 2VGDA 4ONUA 2YMZA 5G05L 1LHNA 3B5ND 3ZFGB 1ZYBA 2Q3EA 4XBLA 4OH8B 2RR12 1GK6A 3T97B 1FE6A 1W6PA 4GKGA 1JZ6A 4LIUA 3SWKA 3FX3A 4JAAA 1MACA 5C3OA 5IAXA 3ZYIB 3DYOA 2QJVA 4H13C 4EN0A 5HV0A 1R5SA 3RWNA 4AXOA 2FYUG 3QH9A 1BZWA 4CP0A 3MO4A 5DUXA 4CPBA 3BATA 2Q8EA 5ACA2 4NIHA 2V4AA 5DG2A 2J59M 4LULA 4MADA 4WY4C 4PBOA 4QDSA 1FZEA 2C9LY 1PGW2 1AYM1 1OOPB 1DGRA 4H0LB 2ZGOA 3PVBB 5F7UA 4UXAA 1VR3A 3ILRA 3KS7A 2HYXA 1AXZA 3U0ZA 2HFED 3M2MA 3KVAA 1ZA7A 4RR3C 4A6OA 3N9NA 4A7KA 4W6XA 2JKXA 3AP7A 5JPMB 1FXZA 1CZQA 3CCEP 5C3QA 2AXTH 2JIJA 3UT0A 1FNYA 2VXJA 1PO11 3PU3A 2ZS6B 4D7SA 3L73J 1JYXA 1JY2O 1SFPA 3QLQA 5F5QA 3CBNA 3ZYPA 2GNDA 1H1MA 4IFMA 1OA3A 4XJZA 2AEFA 5T55A 4N6JA 3CC4P 1XE7A 3W67A 4FPYA 4Z2WA 1VPHA 2Y26A 4XJ8A 2ZOEB 3AE9C 2YY1A 3CC2P 3FMGA 1VQMP 3ZYGA 3L2HA 4IEZA 2VZSA 1D4VB 3DF0A 1OXCA 3T30A 1BMV1 2W90A 5HI0A 1FC2C 1YFXA 3DL3A 1EAH2 3MIDA 5FY0A 1NKGA 1VQLP 2D6PA 1AYN1 2ZKNA 4GIQA 2RJ2A 1AUYA 4OFGA 3RYPA 1OVPA 1IS3A 3ZXKA 3H1HG 5FYVA 3SISA 1W8OA 3IIIA 4XACA 2M3EA 2XNDH 3I2GA 2PFWA 1W03A 2EXIA 4L73A 2CGPA 4XFGA 1NY72 1H4HA 4XA4A 1UOJA 1VQNP 1BXHA 4W65A 4KBZA 2RS12 1WCKA 5BNOC 4RN5A 1JW6A 1HRV3 4AWDA 3LIGA 3S6PA 4O61A 5FYIA 4XPVA 1O7FA 4UW4A 1LT1A 1ENSA 2BOJA 2WPVB 5F2SA 4BQ1A 2HEWF 1IPSA 3BTZA 4H7LA 3A21A 5L7OC 1AR91 5BNNA 2KR2A 3CJXA 3K4ZA 3S5AA 2XG3A 3A7QA 3EBRA 3VZNA 1DQ0A 4OCTA 3CCQP 4AEMA 4CDUB 4PJYA 2K9JB 3M8LA 4DOJA 5JMCA 1QJY3 1SBEA 1LT9C 2X5IC 2HWE1 1RYYA 5F2WA 2WSVA 4IESA 1SQXD 4OI0A 1JZ2A 2H8PD 1PGSA 1KD7A 2WFPA 4TLGA 2Q0AA 1JTHA 3URFA 2B7YA 1GW3A 1K05A 3Q1MA 4UFMA 2OPWA 1DCSA 3LB9A 3VDCA 3AKRA 2ZEYA 1RUI2 5E6HA 3VTPC 4I2OA 4OQ8A 2ZBJA 5FP8A 4ATFA 1ZV8A 3CF6E 4BOWA 3WNNA 3RJ2X 4AVSA 5LASA 3HNBM 4WM7C 1DP0A 2NYYA 1NTZE 2WT2A 4YARA 1ZR4A 2JG8B 1UY2A 1FZFA 1XNTA 3LWCA 1U7JA 1NAEA 3IDBB 3OAKA 2A70A 4Q2FA 3H1JJ 1S0IA 1OF4A 1G86A 3ENRA 3T0AA 4HYTB 3VBUB 1QOOA 1S55A 1MS8A 3J7NA 4GJZA 1POV0 1RH5B 2OS2A 4EZHA 5J36A 2Y6JA 2V09A 2ZXXA 2WO1A 3ZSJA 2ZYDA 1IHMA 3IWZA 1L4AD 3H1YA 4FPFA 4NPLA 3UK9A 4AAPA 3Q5SA 1USDA 4OVNF 3C2UA 4CU7A 2Z2SB 4IDZA 2ZJCA 4LBOA 5DDJ2 1LOCA 1NAYA 2ATFA 3S1KA 4U3FJ 1MQTA 1U5XA 1L0LK 5AW9B 2QEXP 3RL0B 2AEJA 4G4FA 2KP8A 1JU3A 4UI9L 4YSFA 4B4RA 4YM0A 4GXLA 1AR61 2OA2A 4MZUA 1GFF2 2WAOA 4LO7A 4BPZA 5AW5B 4XHXA 4CDWB 3L73G 1M57D 2R5DA 3IPVB 3C1LA 2ZFCA 2NPIA 1LOAA 2X09A 5A6XA 1FJKA 2HPCA 1A02J 1R082 1JO5A 4G9SB 4CCCA 4Z1VA 2LALA 3ZXEA 1UU6A 4Y26A 4F83A 3ZFFB 1LCLA 4DY3A 2K9YA 4I0WB 5GZFA 1QF3A 4YZ5A 3MIGA 5FZKA 1RINA 1Q8PA 1DYOA 4XJWA 4IV1B 1PK6C 1ND2A 1DYPA 2IXCA 1ZBA3 1MPXA 3WEZA 1TME1 3VZJA 2EXJA 4B1MA 4GIFA 3WG1A 2E5YA 5AVQB 4XMAA 4AW7A 4HKOA 3TN93 5FY8A 2ARAA 3BOWA 2WZPP 3A3YB 4BK5A 1DQ6A 3PURA 5KLIB 2ES3A 3O1TA 1VBD2 1SQPE 1JMMA 4P08A 3WNXA 2R3SA 2BNMA 4OVEA 4XFAA 1XE0A 5APXA 2VBBA 3MIEA 1JYNA 4CCJA 1GW4A 1CZTA 4QPYA 2KXPB 2QQKA 2XJQA 1PZ8A 4I3GA 2IPPA 3LD8A 1OMIA 1OVUA 1BHGA 1KN7A 1T6GC 1O8PA 2WDBA 1SQQJ 5FBJA 4Y22B 3B5NA 4Y99B 3UKTA 4YZ4A 4R9DA 4CXYA 3SITA 2ITAA 4AFCA 5A3WA 1Y9GA 5FZGA 2XLAA 5IWFA 4I6MC 4NRPA 3DV8A 2Y6LA 2WQ8A 3A5TA 5K7PA 1DQ5A 2AR6A 3IAQA 1HIXA 3HRNA 3BU0A 3ROUA 1KJRA 4AI9A 3WXPA 1GTWA 2QSIA 4YYOA 4N53A 2RMU2 3KV6A 4K7JA 2YKQA 1SG3A 2G9FA 3HE5A 5BNNC 2M5AB 1YJNP 2WQ4A 4QGMA 1QMJA 2IFMA 3KB5A 4LBQB 2CL2A 2CSGA 2VZ3A 3R0RA 4PLMA 1Y8AA 4K1YA 3KF5A 4Y28J 2IFRA 1QDOA 5LATA 3H1JG 2BRTA 3KF3A 5LB6A 4K9SA 2M8RA 1NVOA 4BISA 3SXWA 2W8ZA 1ZRIA 4I1LA 1ULOA 5CKNA 5FZ4A 5CU1A 4FOVA 2CAVA 1NAFA 1CI6A 1O5UA 1GWMA 5JOZA 1RUC3 3NAPB 1FT9A 4JGYB 1NCQC 4YW7A 2FCUA 4XAEA 1JOPA 1RHZB 4OHVA 1W3XA 3MV01 4ASMB 4JYBA 4P5HA 2FD8A 3VBFA 1OW8A 1VQ7P 2WSFH 2HWF3 5I0RA 2D5FA 1OHFA 4H7MA 1UOFA 5FPXA 3NJVA 4XCAA 5B5EH 2SLIA 1D2SA 3AE1C 4ZNCA 2AGSA 2WO2A 1LEDA 1ZRCA 3AZVA 4WZFA 5LEKA 2UWCA 5KLVD 5KJ7D 4XXAA 4AQSA 4Q8KA 2PMWB 2YKPA 3AMNA 2WSEH 1EZVG 2DU0A 1O3TA 3K2OA 3M9QA 2O01J 1UCXA 4Q4X1 2BVVA 4PIXA 4MHUA 4NR1A 2KM2A 2WQZC 1VDFA 4JGZB 3WP5A 1N7SB 2WIIB 5CJ0A 1Q86Q 2BTVC 1S0DA 4PD4H 3TOJA 4H44C 1S4CA 5CADA 2GAUA 3LA2A 2K1AA 2UY8A 1FOSF 3WF0A 4FFIA 1FZCA 4I7ZC 1MQTC 1KILD 5FK7A 1H1AA 4HVRA 2JWDA 4WM8A 3S9OA 3VKOA 3HWJA 4NPFX 2E32A 4TTGA 4FAGA 3LCPA 4BLIA 1AQTA 1PO23 5BNPA 4ZXEA 3R2PA 4AGRA 1IFPA 2Z5HA 1WMXA 3N4XA 3U07A 1BEV2 3BTYA 3VN4A 1IG0A 1QEXA 4U3FE 5E1RA 2ZX2A 4Q4W1 4DNYA 4CTEA 1NZCA 1C8M1 3D4KA 1H8VA 4M4RA 2X05A 2P2UA 3RK3C 4LT5A 1U57A 1PGOA 3MW3A 3LIEA 3TSIA 4UFHA 4K20A 1WLTA 4GB32 2ZHNA 4AOCA 1I5ZA 3HOBA 1AL23 2FYZA 2PFXA 5A32A 3CCJP 1VE0A 3L72G 2XL9A 5M0TA 1YYCA 2LROA 3MUY1 2YUEA 4I01A 2XL7A 2PN5A 3UYJA 3SFEC 4L0PA 2E63A 2VL4A 3HN1A 1RHI1 1I6XA 2AENA 3OEAA 2BP6A 1ND2C 2F4LA 1TNFA 4HSLA 3A0KA 3WVJA 2A06E 2Z69A 3FWNA 2KA3A 3D71A 4FFGA 1AR73 3PDQA 1D4M1 4AQTA 5GZCA 1NQJA 1HB4A 5CG8A 2B89A 1ALYA 3GZUC 2ET1A 4R4ZA 2VOTA 2W9XA 1IZNB 3AECC 1O6UA 2QQOA 5JSRA 1ULGA 1SQVK 1L4AA 1GZCA 4YPCA 2JICA 3DCQA 3SHRA 2YNYA 1JTHB 4M3CF 4A44A 2RE9A 4TYSA 2A1XA 2XPJA 4B7EA 2PTMA 3KQ4B 4XDPA 1SQXK 2W0XA 1PGPA 3Q3DA 1VF5D 2WNVB 2ZX3A 3O7OA 1ZZBA 1BLZA 4AQ2A 1SQQE 5KHKA 4RS5A 3L71D 4BQYA 1T2KC 1K5MA 3S4RA 1A34A 2WSUA 1NTMD 4KGQA 1W2TA 5IT6A 3AFKA 5CFDA 1DD4A 4P5YA 1UIIA 2LS6A 1VBA3 2OZ6A 3IMNA 2BGCA 3L70J 2DBNA 2MEV1 2GC3A 4MV2A 4N53C 4XXPA 2ZGUA 5IVBA 1QNYA 1LTBC 1P84D 1AYM3 4F3JA 4XQWA 5C8WA 2B88A 1W3VA 3GDBA 5DPNA 2UWJE 1A78A 1LHWA 3B94A 1W6QA 4SLIA 3H1IJ 5FOJB 3VMXA 2FFDA 1JTZX 5DAQA 1SQBK 3PHMA 1URXA 4K21A 3H3ZA 1JCCA 3ZYHA 2RDRA 3L74E 1JHJA 5J3UA 5HV4A 1ENQA 2E76C 1W8NA 3ZXFA 3KZIH 2A3XA 1GV9A 1Q82Q 4PIYA 1PO13 2OYHB 4MG2A 1LU1A 4AVAA 1P84I 4YZ2A 1UIXA 3IZOA 4COZA 4CDQA 3TYYA 4QHZA 2UYAA 3I3BA 3WNPA 3KCCA 4SBVA 1EDIA 2ZHLA 3OBRA 3RFRA 4D6TD 2YU1A 1DG6A 1RQVA 4AQRD 1POV1 2CPSA 1DF0A 2R062 2WINB 3BU7A 1IFDA 3ZMOA 2G3AA 3BGAA 2W46A 4QGLA 1LJ7A 3VBFC 3JXSA 2AACA 2VUJA 4DJGA 1DX7A 1V6NA 2I1JA 1C5HA 1L0ND 2ZABA 3K3NA 1V6LA 2FY8A 1PFIA 4Y1XA 3L35A 4XYXA 4NWWA 1HX6A 1J84A 1CIYA 2RR11 3TEWA 1AJOA 3OSDA 3WP6A 1Q43A 2B42B 4JQTA 5T50A 3LQCA 3AP9A 3D8CA 4BDVB 3PL0A 1QVFO 2JP3A 2O0OA 3UJQA 1FBMA 2ORXA 3AMPA 1ND2B 3L75J 1Z7S2 4QDQA 3H1LD 3HUSC 2ARCA 4JYCA 3LEGA 5ACA1 3GYDA 2Y6KA 3R4SA 1JYWA 1PGW1 3IDCB 4PLNA 1FZCC 5BV6A 3CL1A 1W05A 4WM8C 2G4IA 1ZZCA 3CEWA 1SDDB 2WR9A 3JUUA 4DMIA 3N9PA 2O8OA 4HKLA 4LA3A 1J2JB 4PD4E 4CDXC 5K5GB 3JCUH 3AZXA 2HWE3 3H7JA 1M06G 4XFJA 3QH6A 1H0BA 3SCHA 5CFCC 3B5NB 5EPAA 3E1F1 4S2HA 3WLUA 2ZACA 4RO0A 5A3LA 3O6QB 2EIDA 3IIAA 4BWNA 1UL9A 1K9MQ 1GDTA 2D2CC 4GULA 2JEEA 5F6KA 1AR82 4Y24A 5KXEA 3SCFA 5AW1B 4CU8A 3K46A 2W87A 3B93A 3UGFA 3WCRA 3HTKB 5I91A 3E97A 2OYZA 2R042 3MV11 5EHDA 5FKBA 4IL6H 1EAH1 3D0JA 5DG1A 3ZN6B 4PDWB 4N7IA 3QOPA 3EO6A 2FDKA 3VBOC 4R8HA 2WS93 4D6SA 3H8UA 4LOTA 2BWCA 3D0SA 4Y5SA 4DXSA 4A42A 4N43C 3HR9A 3PMSA 2VMHA 2MNGA 3WG4A 2GNMA 1NX9A 5FV3A 5FYTA 5KXBA 3JU9A 1VBE3 1QLED 1S0JA 1NY71 1HWTC 2PAMA 1VQ9P 4OZXA 1RUD2 2RS11 1NQDA 3T0BA 1R5LA 3RMYA 2AEMA 5C4WA 1VQ8P 1YCIA 3C7EA 4YXDC 1JH5A 1FJPA 1FDOA 5FRAA 3CL3D 2OQQA 2H6CA 3KHBA 1X36A 4JVAA 4P02B 1RUE3 1X7NA 2ZYAA 3ZM8A 3PRJA 1R1ZA 4IEUA 4EZ4A 5FWEA 3CCVP 3H1IG 4A45A 1BCCJ 4QPGA 1GKBA 2JB8A 2N7GA 3DGTA 2DTWA 5HBAA 1ZVFA 2J1UA 2W2IA 5T5PA 1ZREA 3H1KE 1AHSA 3WQ0A 2WJSA 2ZGPA 5CFDC 1RF1B 2VQAA 3AP6A 3HAGA 3O5SA 2Q8OA 2JDMA 5TJHA 3J4UH 2BCCD 4EQVA 2UU8A 3M0AA 1J83A 1RUI1 3WCSA 1IS5A 2E31A 4FXKB 2DVFA 5FZ9A 1IKPA 1M1JA 1BSHA 2XKOA 3AE8C 1KMIZ 4B3NA 5CAZA 3L70E 5KLVK 4AGVA 1P8JA 3HQXA 2IUWA 1W6MA 5FREA 3W59A 3Q9OA 5H2FH 3CO2A 2GC2A 1XNCA 4M3CE 2VQTA 1OA4A 4QQOA 3AMHA 4QPIC 3ACFA 3W5NA 3VBRB 1UMHA 2EVXA 2HYKA 1XC6A 5AC92 5CCGA 3VHNA 2LR2A 2E7AA 1W8ZA 5BNPB 1BVVA 1SQVE 2Q5UA 1LGCA 5B4NA 4M4PA 5K0UB 3ZKUA 2CV6A 3IAOA 3KZIE 2HWB2 1L3JA 1AJKA 3NV2A 1W04A 1X9VA 1OUSA 1BBT3 5LRRA 1E5HA 5B4XA 3AL5A 4D3WA 3VD7A 3NJZA 3EFFK 5DDJ1 2I2SA 5AVAA 3HE4B 4JTNA 4JCKA 3ACGA 1EY2A 4QHOA 4D6QA 2FXPA 1Q7YQ 1UZYA 3HNMA 2IXIA 3KQGA 1YXWA 1JN2P 1SACA 4EDFA 2HR3A 5J48A 4PT6A 1LNQA 4NPMA 4DOUA 1ASJ2 1BE3D 4BIOA 4XFCA 3B71A 2JG9A 2HODA 3CWBD 1X9PA 1FOD2 1BQPA 1H0TA 1Q3EA 2QQUA 2NN8A 3M3IA 3E6BA 1FS0E 3MUDA 3TBDA 1Z78A 4MOAA 4Z8BA 5J96B 1R081 2ZEWA 4NVPA 1QQP2 2B87A 4LBLA 3ZMNA 3L75E 3T08A 1KFNA 5CIRA 3MEPA 4XF9A 2GC1A 2DURA 2Y0CA 2B8MA 3II6A 4QX2A 1SQBE 5EV7A 4JRAA 2W94A 1L4AB 1LODA 2WSCH 4NAOA 2VNVA 1S2BA 4IERA 3VD4A 5DAXA 2WSCJ 2P2KA 2EA7A 1UQXA 3I2DA 3RK2C 2VOWA 4QQLA 1XPWA 3QD6A 4ARXA 1V6KA 5LRSA 3V4QA 5BU8B 1VBD1 1EQ7A 3J7LA 1UZZA 3E6CC 1B35B 1YNAA 3JCUE 3MICA 4RS5B 3VZKA 1S72P 1K5MB 2KI7B 1UIKA 3V2RA 1N1VA 4CUGA 3AK0A 2QKDA 4CEWB 4MGTA 4J6GA 2Y9ZA 5KAFH 3JB4C 1X22A 3O1UA 1AX1A 1Z0HA 1J1TA 2VCBA 4GH4A 5FPZA 1VBC2 2KB7P 2E6VA 2JDPA 1ND3A 3V5BA 1IFJA 1N3PA 2WT1A 4IV3A 3MHVA 2WZR2 2V7QH 1QXRA 4IL6E 1COV3 4IEVA 3IT8A 5G04L 3O1VA 1W6QB 5AVVB 3RI9A 2GNTA 4KWLA 2FFDB 3JD72 4EYYQ 4XFIA 2QVSB 1J1EB 4CP2A 1JOCA 3C7FA 1C4RA 4YGCA 1RTVA 3GM8A 3OY8B 3KMHA 1FMD3 5FZFA 4JC1A 2RMU1 4P9IA 1H1IA 4IGPA 3AEEC 4MXWA 4BQWA 1JYCA 4CDQB 4XCBA 3NV4A 3WG3A 4O9GA 1N73A 3QWOC 4N78E 4TN7A 4LLOA 3GNEA 1LHVA 4OWFA 4Y1YA 1JOJA 4LJHA 2C9AA 4RQPA 4FPJA 3DPRA 1CQ9A 4AVVA 1O59A 4EYUA 2ZGQA 2DCJA 1SP4A 4Q4W3 3ZN4A 1BCCE 3S7EA 2A3WA 1JZ8A 2DCZA 4HKWA 1R1A2 4XEZA 4YVSB 2D98A 2O01N 1SFCA 3CI9A 1L0NK 3OUHA 2H89C 3C7HA 1M1JC 4LKFA 2XVKA 3CCSP 5I0SA 5IK4A 4RKUJ 5FYCA 1O4YA 4K8RB 1FX5A 2ZAHA 2TUNA 2NP0A 3K75B 1ONAA 1GL2D 2RS53 3WDTA 1CVNA 1OI6A 1CZVA 1W8WA 3DN7A 1QJX2 2VQ0A 3TWIA 5ABJA 3IM0A 3P8CD 4LK6A 2CU5A 5AFEA 2VOKA 1JM0A 1KB9E 5CCGC 3QBQA 1D4M3 1WCDJ 4MXVA 4XZPA 1BYHA 1W2AX 3MLJA 1QGLA 5C8CC 5C9AC 3RZLA 4UW3A 4L99A 4DFSA 1NTZD 2PGDA 1PVC2 2XJUA 3CXHH 4M0HA 4LBJA 4PI0A 2QJYC 4FOQA 3B8EB 3MPBA 3T3YA 1LWUB 3ZLIA 2YBSA 4DPNA 5T52A 4D8MA 2VVFA 1H9WA 1PX4A 4AI2A 3HIFA 1I3HA 5FXWA 1NHLA 2WZ7A 1AVYA 2D3RA 2PELA 1JYTA 4AUWA 5AVPA 3G3ZA 1GOFA 1X50A 1BEV1 3GZTB 5BNQA 1OBNA 3RMXA 4E27A 3BN6A 5I93A 2QRXA 2H88C 5FFOC 5CCHA 4J25A 4UFIA 3H32B 5KWRA 3HJRA 2H7HA 1L0LG 4GB31 1LTJA 1QXPA 2ILMA 3MUDC 5ISLA 2DFBA 2ZHMA 1NTKJ 1W9WA 3OPWA 3JB8A 4FP2A 2BNNA 2RH0A 1L7LA 1N8RQ 5L73A 1UO9A 3AZWA 3F89A 3MF6A 5C4WB 1FZGA 1NA1B 4N7UA 2WWUA 3TGUJ 1SLLA 4DRRA 3FE5A 3WW4A 1W2OA 5KHGA 2WA4A 4YNIA 4X6RB 3SH5A 1OPOA 5APVA 4HSJA 3WUCA 1SCRA 1NYHA 4MGIE 1ST8A 1KILB 4AK3A 4AI1A 1J1DC 1MZFA 1ZNPA 3ZXLA 4QPGB 1HV1A 1UY4A 3HN3A 3OW2O 3TEXA 3ZDSA 5JSPA 3G6JB 2NPSD 4ZS3A 3J9SA 1POV3 1PMIA 4XUPA 2WO7A 3POYA 4BXFA 1HVVA 2OIIA 3B9CA 4BWOA 2FHRA 4P9YA 1HRV2 1SHWB 1BGYE 2WFF3 2Y0OA 5I0DA 3LFMA 3KDPB 3AE3C 1JODA 2JENA 3B9IA 1CPNA 2QG4A 1T6BX 3LDBA 4DZOA 2E42A 2C0XA 3BTXA 1JXNA 5B66H 1CAVA 4RGKA 1KEXA 4L97A 2EAAA 1ND3C 2J1EA 3SQOA 2NLRA 4AF9A 5DABA 2N1TD 4EIJA 5IVVA 4OHYA 3U10A 3FGAD 4HZFA 1TVGA 4FI9A 2PQQA 1SQPD 5FXVA 2VMIA 5JIAA 4UB8H 4R9BA 1QJY2 1LOFA 5KAFE 1LTEA 5FMOL 3TNUA 3UL2A 4CYDA 2VW0A 3RL0g 4DINB 2GM4A 5M1BA 2P5BA 3X29B 4LHKA 2VPVA 3U14A 4META 4PJ0H 3U1XA 2E75C 4CUBA 4DB5A 2RDQA 4CVUA 4AVCA 3ZFGA 4B1LA 2WUHA 4ORFA 1USEA 5JOYA 2BDRA 2W1UA 3T97A 1ZBE3 4RQPC 3M3OA 2ZX4A 3DPRC 1ULPA 5HCBA 4FPCA 2ZCWA 1F31A 1HJGA 4OZOA 2VBDA 1HLCA 4Q4Y2 3PTYA 1U12A 1RUJ2 2ZXQA 4JZRA 2X10A 4B4QA 4C0BA 1RUF1 1VF5B 3RQ0A 3UESA 3IDEA 1LAJA 1SFCC 5CA6A 2WT7B 5E89A 4OULA 3ZSLA 3MGNA 2R061 4LUKA 2WN2A 5JCTA 2CK3H 1MUUA 3L4FA 4BQ2A 2JG9B 2Z5WA 1Q81Q 3A23A 3RK3E 1RUOA 4OUSA 1VL2A 5LA9A 2ZGNA 5ABJC 4YVWB 1S0CA 3I2FA 3B01A 2VMFA 2W47A 4ZONA 4COYA 3ECQA 2QJKB 5JMOA 3V2QA 3ZIXA 4ZU4A 3CC7P 2ZT9C 4OI4A 3U1AA 2RS13 3NL1A 1XRUA 3LKJA 2I8DA 4PHZA 1Z7S1 5IVJA 4AI8A 4N3YB 3I97A 3SKJE 2BW8A 2DWRA 4AYCA 3VV1A 1T3UA 3NNLA 2OX0A 3VMZA 1YQ3C 1PPJE 1UOGA 3FX0A 1VBB1 1ZZ6A 5C6CA 4DCKA 2OZJA 3GHGC 4AFAA 3WUUA 1Q5OA 1OQEA 4CZSA 1LR5A 2WZ8A 3IN9A 2VZQA 3BCCE 4LE3A 2XVLA 1MKMA 4YRDA 2VVEA 1PV3A 1Z56A 5FP9A 4LR4A 3CXHE 4Q27A 1O4TA 2W95A 1SDWA 4JKMA 1ZW0A 2D97A 1PNFA 1F2NA 1ACCA 1MEC2 5CCHC 1CR7A 1CWPA 1EPWA 4AQ6A 1ZBA2 2ZZJA 3ZSEA 5TSWA 1M90Q 3FXDA 1UYZA 1MFZA 2WO3A 1U7MA 4GH4B 5C3SA 2MKVA 1LTJC 1ND3B 2PHFA 2V5DA 1IQDC 4IV3B 1NE4A 3NWKA 4TXWA 3G7DA 1WUVA 1RUI3 2VNOA 1RJ7A 1AR81 3D5OA 3PLNA 2YB7A 4ZU5A 3WDUA 4GWJA 2VCAA 2R041 1VALA 1NTKE 5E8AA 4FT8A 4Y5TA 1XNDA 4CDUA 4Y5Z0 4U3FD 1IO4A 4J1XA 5GALA 1Y43B 1YYNA 4MXWB 1FPN3 4Q0PA 1OPMA 2FYUK 4FCAA 4JBZA 4D6RA 1W0NA 3OOXA 3TGUE 3CZUA 4HN1A 5APTA 1NT0A 1GLHA 2JX9A 5ANQA 5FJKA 1US2A 1RUD1 1N73B 1FYUA 3H1MA 1TMF3 4Q0QA 5DQ0A 1DGWA 5F39A 5FUNA 3N7KA 4CUAA 3LPFA 4IXLA 5IK8A 5A3UA 5LA1A 2C4XA 4UAPA 1XTCC 3VKLA 1G9FA 5AVRB 3FLRA 3PJYA 3WNMA 4L74A 5DDJ3 1AVBA 4WVMA 1PMHX 1JCDA 2A06D 5FZIA 5FYZA 1DLCA 1NYWA 5CHXA 3F5HA 3I5CA 1EZVI 1DZQA 1XSRA 1DDLA 2XWBB 4BLJA 3IKWA 2QQNA 1KJLA 3A0HH 4NOTA 3BIWE 5EWSA 1DGRN 2R5BA 3O8ZA 2FYNC 4F8AA 3FBYA 2DF7A 3IMMA 1SBFA 3FWLA 2P3KA 3VBUA 3E7KA 3FUOA 1T3JA 4ASVA 2WNOA 3QACA 1HXS3 5AVZB 2VR4A 5B66E 1SQXG 1YEWA 3LOIA 2BGOA 2OPKA 3D6ZA 1E5RA 4R4XA 3WNOA 5ERLA 2ZAEB 4OI1A 3ABZA 1NU1E 3KCYA 2A6YA 1QXJA 5D8AC 1KS4A 2UURA 3M70A 5DXDA 1ZRRA 4C91A 5I8YA 2F4PA 1MVEA 3E5XA 4YZ3A 5A1LA 1G1IA 4UB8E 4NHMA 1YJWP 5C39A 1RUC2 3ZFGC 4LPLA 2D6KA 3PUIA 4E4HA 3WF4A 1RJ8A 3FFZA 4V2WA 1O3RA 4OMDA 1SQQD 1JOBA 1DGWX 4Y1UA 1URQD 2HWF2 1FV3A 1R093 2XMLA 4L76A 2E7QA 4PJ0E 3CMGA 2F6BA 5C7GA 3LIDA 5FO7B 5CBNA 4A41A 4CDWA 2FZ2A 5AC91 2VVDA 3I49A 3GJBA 3IPVA 4DT0A 1XU1A 2ENRA 5FP4A 5A1FA 1VBD3 5AVSB 3KHCA 1YFUA 1CJPA 4O9EA 2KS1B 2FXMA 2W68A 1OOPC 5CKMA 3RZMA 4EWAA 1EV13 4H0LC 3ZFFA 5FR3A 2HWB1 4GA9A 1SQ4A 4QAWA 1OD5A 5EJ3A 5GLUA 2IBZE 3CU7A 5IHRA 5FY7A 4XC9A 1OT5A 4IV1A 3BB6A 3FJSA 3KGZA 2EICA 2P4EA 3GGLA 1OW7A 2HBUA 3O14A 1LP1B 1WMKA 3FLTA 2ZVNB 2RDSA 1G9CA 1YFWA 3VBHA 2KNCA 5A1AA 3TRSB 3H1HJ 1ASJ1 3CCRP 3GALA 1FOD1 1DIPA 3OPTA 1DQ2A 1PHMA 2DVDA 2E74D 1K45A 4LHNA 1RE3A 3H42B 2P17A 1ENRA 1QQP1 2ZTNA 2O14A 5FZDA 2RMU3 3AYEA 4FVVA 4K3AA 4K6BA 3N9OA 3T0DA 2QM8A 3W68A 4EOTA 1AL22 1HW5A 4Y22A 2J22A 2RDNA 2FDHA 5J37A 4YW4A 3ZYJB 4JV4A 2YU2A 1HB3A 1RB8G 3O0VA 1ZP0C 1M4WA 5CG9A 1DLLA 2WYFA 2B9VA 4LXLA 3POWA 4LHLA 2X8KA 4Z1MH 1JY3O 1ZM1A 4CP9A 2AREA 1X8MA 5IVYA 3U75A 3AVSA 2RS33 2XKPA 3CPWO 1DD3A 5FIXA 2HWC3 5FZLA 2C24A 3VMYA 1AR72 2KD7A 4LEJA 5F5AA 3SH3A 4GWNA 3I55P 2Q9IA 1CN1A 2BNOA 3VP8A 4WVVA 1RGSA 2HH9A 5FZ6A 2Y8KA 3EYPA 2D7FA 5FLJA 1LU2A 2BASA 1S0EA 1S5LX 1H2MA 4PD4D 4CDUC 2BVBA 4LBQA 1BE3E 1LGBA 3CWBE 1HH0A 1VBC1 1W9SA 1WT6A 1GZ9A 4Y20A 4A7ZA 1V0AA 2WZR1 3FL7A 4P00B 4AEDB 1YUDA 5FPVA 4QPWA 3VL8A 3N9QA 3CMAP 1HQNA 1GMJA 2CWMA 2XBO3 3JD71 3KD4A 3NJXA 1H8TA 1ZZ8A 2P7JA 4H14A 3JBG2 1HN1A 4PD4I 1YQ4C 3NAPA 4JGYA 2JD4A 3AEAC 2VZPA 4GMP3 3KV4A 2JEMA 2VZOA 1VBA2 3UNPA 1L7QA 2JG8C 3USUB 3E1IA 4HJGH 4UWDA 4HG6B 1N1SA 2YXRB 2GNBA 5T5OA 4QB2A 5KKZB 3AEGC 1OD3A 1J3PA 1UU5A 5GTHH 1GNYA 2XJSA 3VBUC 1PP9J 3Q8BA 1ZOYC 1QX8A 3ABVC 2E51A 1QOSA 4LHSA 4RFRB 5DAPA 1NZIA 5FZCA 4XUTA 1YI7A 2NQYA 1R1A1 4ISQA 4PF5A 3L71J 2GA1A 3A0HE 4BMEA 4Q4V3 3H8RA 3JSVC 4GB33 4JGZA 1NTMJ 3ZOIA 4JKKA 2BWAA 1N7SA 4YW3A 2BBVA 3LFIA 3J7MA 4GDOA 1KQGB 3V56A 2YO3A 1YQ6A 3RBZA 1SCSA 2R16A 1EPZA 2DCYA 2YBKA 4LK7A 3KGLA 4FOYA 2DVBA 3VZMA 3PHLA 3HD7D 2ZPXA 3AE4C 1WW4A 3WINE 2RN0A 3QH7A 3MP7B 4O9BA 3RL0C 4IEPA 1IFIA 4EJRA 2R3CA 1F5FA 1UZWA 3BPZA 5FZOB 1QJX1 3WQ1A 2FYUE 3VD5A 3H1KD 1GUIA 1W8FA 3ORJA 4HXCA 3P3NA 4ITCA 4E8DA 4NROA 4CCKA 4CDWC 2WSSH 1YJLA 5KLVG 5FZ7A 3VBSB 3IBMA 1UPSA 4XE5B 5A7SA 2HG5D 3OGGA 3MIBA 2XDJA 2AZ5A 3VD9A 4BM8A 2VZVA 5L9RA 1ULCA 3L70D 3RZZA 2QCSB 3ZFFC 4H13D 5JIUA 1PVC1 1IJDB 1OQ1A 4D6TJ 2W91A 1GQGA 3S7IA 1H89A 1QIQA 5FPBA 2ZXEB 1XB9A 2RM23 4QX1A 3OGVA 5AVUB 2D44A 4IV1C 2QQPA 1S3JA 4WY4D 2XJTA 3N36A 1IC2A 5L9BA 2AEZA 2FDIA 4XHBA 1OQDA 1L0NJ 3H1ID 1GU5A 4M0NA 2BV4A 4K40A 1ZRTD 2J5UA 1AQ5A 2WNUA 4EN9B 1W99A 1SQVD 1BK1A 3BKZA 2OYIB 2IZ1A 1GL2B 2LW8A 5KLIC 5HCHA 1OVRA 3SMHA 3BALA 2M3BA 1KTMA 1RE3C 5E79H 5HPOA 1DEEG 1H6XA 4O7XA 2B5HA 1XSQA 2A5ZA 3ITKA 5C71A 4HPKA 5LEJA 5FYBA 5FZAA 2IC1A 4QB1A 3H1HE 4N9IA 1NKNA 3P8CE 3H1LJ 1BDCA 3T1MA 4EWEA 1O4ZA 4P9XA 1H9PA 5GTIH 3ON7A 5FMDA 4QKBA 3DKQA 1N1TA 4Y99C 2FMYA 5FXZA 1O8SA 1W06A 4COVA 2WNVA 4K35A 2XJVA 4XTPA 1YTZI 1L7RA 1YWKA 5FJHA 1CD3G 3W58A 4WB4A 1GSLA 2QUOA 5JZGB 1PGQA 2VMDA 1UWWA 4IE0A 4G3YC 4WVMB 2YHJA 1XTGB 3OBZA 2YG0A 4NHYA 1C8NA 4BQ3A 5IAVA 4DUVA 3CJIA 4TZDA 3WX5A 4BCUA 1LHUA 5GLZA 4QWNA 1VBE2 3L75D 1W9TA 4IEYA 3K5BA 1EXIA 4BA6A 2OUHA 5AVYB 4W7ZA 5BYNA 5AW8B 2X29A 1NCRA 1HRV1 1ULEA 1SQBD 1ULDA 4XQ4A 3HQRA 1A02F 1M7LA 2XDVA 2VMEA 4GWMA 4LNVA 3BODA 1W0PA 3BOPA 2VOXA 2R073 5JOXA 4DEVA 2C0WA 1UY1A 4MN4C 1TZOA 4CCMA 5AFBA 1RUE2 4W4ZA 5DZEA 3NXSA 4NHLA 3U4XA 4FPEA 4KGGA 2OYHA 1SS1A 4H55A 1LEMA 1PP9G 2FBWC 1LTSC 4C7NB 4KG8A 3ZR6A 1QJY1 2ADEA 3OYWB 3VHPA 3L71G 2A7AA 3FHIB 4K8FA 4E2SA 2PXJA 3AEFC 4Z92B 1NTMG 3NAPC 3WQ7A 4JGYC 3KWVA 4R52A 5E88A 4P9LA 2PHRA 1SQQK 2H6BA 1UKGA 2XQRA 2JJ6A 3NNMA 4OUEA 3BCWA 4Q1PA 1GZWB 4HN0A 3KCXA
chains in the Genus database with same CATH topology
2DURA 3AKSA 5KHHA 1HQWA 1CAWA 3VDDC 4P14A 2B8MA 1O3QA 2GMMA 1N47A 4AEDA 2XB6C 4HVOA 5JR7B 5EV7A 4JRAA 4WM7A 1LODA 2KXLA 3JZVA 4PLOA 2QNKA 1S2BA 2ZA9A 4Z07A 1UKRA 4IERA 2NMOA 4Q4Y1 1RUJ1 1HKDA 1CAVB 3GZAA 4QPIA 2P2KA 2EA7A 3I2DA 1MQTB 5J98B 3MF9A 4AG4A 4GKXA 1R1A3 2LTNA 2RJLA 4JGZC 1YFYA 2VOWA 5CB7A 4QQLA 1VRH1 3QD6A 3SH4A 2VULA 4IEOA 4X8PA 1V6KA 2TBVA 4IQPA 3AYDA 2ZHKA 4C1XA 5LRSA 3RYRA 4HVQA 1ZZ7A 1J1LA 2B39A 1LB2A 1MS5A 5JI9A 1VAVA 1AR83 3UKVA 3USUA 1VBD1 3VBHB 2EXKA 1UZZA 3E6CC 4XJAA 1B35B 1YNAA 1GQHA 1REEA 1UW8A 3MICA 3USSA 1WD3A 4S2FA 2E9QA 1GNHA 4MYEA 4RS5B 3VZKA 4LO5B 1K5MB 2A6VA 2WFF1 3OD0A 3ZXAC 2B9UA 5BPXA 1NG0A 4XF0A 1UIKA 1N1VA 2WT0A 1A8DA 4IEQA 3AK0A 2CGOA 1C5IA 2ZX1A 5FMOS 4AFMA 1RUH1 2QKDA 4M01A 4QT6A 5D8AB 3ELNA 1BBT2 4CEWB 1EAH3 4AEJA 1ULFA 1C3HA 1LESA 4J6GA 1VIWB 4RHV2 2XGXA 3JB4C 3DKWA 2I45A 2R072 2NMNA 1AX1A 1Z0HA 1J1TA 1RMU3 1WMDA 5EZWA 1S0GA 2A6XA 2VGDA 2YMZA 4GH4A 4ONUA 1ZRFA 5FPZA 1VBC2 3ZIWA 2E6VA 1ND3A 4FPKA 1LHNA 3ZFGB 1N3PA 1ZYBA 2WT1A 4IV3A 4FOWA 2YGLA 4XBLA 2RR12 2VXRA 4KWKA 2WZR2 2V7QH 1QXRA 3AJZA 1COV3 1W6PA 4IEVA 1CGPA 3IT8A 1OLRA 2YV8A 1W6QB 3RI9A 1WW6A 3FX3A 4JAAA 1MACA 2GNTA 4KWLA 4GMP0 3JD72 4EROA 4XFIA 3ZYIB 2QVSB 2QJVA 1RL3A 4BIFA 4CP2A 1H2LA 3OTFA 4EN0A 1C4RA 4YGCA 1RTVA 3OY8B 3ZFEB 3S0MA 3RWNA 3KMHA 1SLIA 4AXOA 1FMD3 3HD8B 5IUQA 2WLQA 4JC1A 1BZWA 3KT4A 4CP0A 2DYCA 2CYFA 2RMU1 4P9IA 1H1IA 3ZN6A 4WV8A 5KC5A 1A8MA 4PDWA 5DUXA 4M00A 4MXWA 5ACA2 5DG2A 1JYCA 1DFQA 4LULA 4I30A 4CDQB 4PBOA 3AKPA 3AZYA 3VKNA 3NV4A 2HWD3 1PGW2 1AYM1 1OOPB 4CP1A 2ARXA 1LOGA 1WW5A 2X53S 3WG3A 4YZ1A 1DGRA 4OLLA 1G7YA 2ZGOA 2VUAA 4O9GA 3ZXDA 4COWA 3PVBB 4UXAA 4LLOA 4AVTA 3GNEA 1LHVA 4KWJA