4QMAA

Crystal structure of a putative cysteine dioxygnase from ralstonia eutropha: an alternative modeling of 2gm6 from jcsg target 361076
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
192
structure length
192
Chain Sequence
SLAPLREFITGLSALLDEQPGEARILREGGALLARLVARDDWLPDAFAQPHPEYYQQMLLHCDSAERFSIVSFVWGPGQRTPIHDHTVWGLIGMLRGAEYSQPFVLDGSGRPVLHGEPTRLEPGHVEAVSPTVGDIHRVHNAYDDRVSISIHVYGANIGGVRRSVYTEAGERKPFISGYSNPYLPNPWDRSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Arg- and Gln-type bacterial cysteine dioxygenase homologs.
pubmed doi rcsb
source organism Ralstonia eutropha jmp134
molecule tags Oxidoreductase
molecule keywords Cysteine dioxygenase type I
total genus 44
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2014-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4qmaA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4qmaA02
4EWEA 3ZDSA 5EZWA 5CADA 1O3TA 1CAVB 3H3ZA 3C3VA 3ETQA 3TNQA 1O5LA 3E5UA 1TQ5A 3DKWA 4IETA 4JTNA 2CK3H 3CLPA 2OYZA 5JR7B 4ORFA 1DZRA 3FZ3A 3H3UA 5AVPA 4F7ZA 1OMIA 1QWRA 5BV6A 4AXOA 4IEWA 4FBFA 4JTOA 4KL1A 5I8TA 3G7DA 1SQ4A 2VQAA 3FJSA 3EBRA 2Y0OA 3NW4A 1JUHA 2BYVE 2ET7A 1NZCA 1WGPA 2V7QH 1DGWA 1UW8A 3E5QA 5D1IA 3OCPA 4HSLA 4Q0SA 4I0AA 3H7YA 2IXHA 1ZRCA 2IC1A 2F4PA 5FQ0A 3UKTA 1WA4A 3LOIA 4AVCA 5I0RA 4HVOA 4D7TA 4EROA 3EO6A 4LA2A 5LEJA 4XEZA 3KMHA 2OZJA 3OTFA 1ZVFA 3M3IA 4MUVA 4O9EA 4XFAA 4PIYA 4QGLA 5JAXA 3IIAA 2QVSB 4X6QB 4KU8A 2ETEA 3RPQA 2HKXA 2XNDH 4Q29A 1H1MA 3WW4A 3BCWA 4N9HA 4QXKA 3NL1A 4I02A 3ROUA 1CAUB 1YFUA 4Z07A 5FLIA 1YFYA 3D0SA 2BEOA 3O14A 3RNSA 1J1LA 4K8FA 1LRHA 2B5HA 2BNMA 4ZU7A 2WSSH 3N4MA 3KGZA 1YFXA 3MYXA 4Z82A 4AQ6A 1QXJA 2CAUA 2QCSB 1I5ZA 5KHIA 3S7EA 1AQTA 3IDBB 4F8AA 3VHRA 2VPVA 5BXXA 1GQHA 4N9IA 1EYBA 3M70A 2UY9A 4FAGA 2D93A 3I59B 4XF3A 5I91A 1ZRFA 4YYOA 1V70A 2EA7A 1RUOA 1J3PA 4HVQA 2XLFA 1J3QA 4PIXA 2XLGA 4YXWH 4J1WA 1ZZBA 4IERA 4IEUA 1JEKA 1FS0E 2ET1A 4Q0QA 4PIZA 4H7LA 2BGCA 1ZZ8A 1CAXB 3LWCA 4I01A 1EP0A 3E6CC 2XLAA 4AQ2A 1LR5A 2BNOA 3HT1A 1IPJA 4GULA 5FPZA 3HQXA 2PAKA 4MGZE 2FQPA 2IXCA 2XL9A 4IESA 1G6NA 1H1IA 2K9ZA 5FPXA 3RYRA 2GU9A 1ZX5A 2I45A 3OD0A 3BPZA 3H9AA 2Q4SA 3SMHA 2H6CA 5C8WA 4BHPA 5J3UA 3IWZA 1O7FA 1CAWB 2UYBA 5FLJA 4KWJA 4OLLA 3SCGA 5KHHA 4EWDA 2JDIH 4E2QA 1LB2A 1PM7A 2CV6A 3DL3A 4LEJA 3JZVA 3FX3A 4BYYA 4BIFA 2QNKA 1CX4A 3USSA 3L2HA 1RC6A 3FFQA 1FXZA 1L3JA 1SFNA 4XF4A 4XETA 1ZRRA 5I0TA 3H7JA 1O4TA 2KXLA 2GH2A 4O9GA 2B9UA 2ZCWA 4EV0A 1CAWA 4HMZA 5I8SA 5BY5A 3H1YA 1CAUA 4UXAA 4XFCA 4QM8A 4IEZA 5EFUA 4XF9A 4L2NA 1CGPA 4IEOA 3E5XA 2GC0A 3GBFA 2XL7A 5JCTA 2E5TA 1OI6A 4LLOA 4YRDA 5KHKA 4IEPA 1U12A 4XFFA 5JSPA 3ES1A 4PJYA 4LUKA 4MH0E 3ST7A 1ZNPA 2PHDA 1O3RA 5E1RA 3LA2A 4KWLA 1ZZ6A 2D40A 3BALA 1VJ2A 4YSFA 4R8HA 5I0UA 5KHJA 3U0ZA 3I54A 4QM9A 4YARA 1NYWA 4I2OA 5LEKA 4JV4A 4XFHA 3PNAA 3WW1A 3ACLA 1ZZCA 1Y3TA 3EQEA 3GYDA 2WFPA 4WBBA 1DGRA 2PTMA 3EJKA 2IXIA 3R6SA 2PAMA 4ZU5A 1VP6A 3E6BA 3U11A 1LKNA 3MDPA 2CGPA 1J59A 1J3RA 4QGMA 3I7DA 3DN7A 2H6BA 5E16A 1I6XA 5J7MA 1IPKA 3EHKA 3H1WA 5LRSA 4KWKA 3CL1A 5KBFA 2PYTA 1WLTA 3D82A 1UCXA 3EFFK 4TLFA 3KCCA 2OZ6A 2CAVA 3H1MA 4HZFA 5KHGA 2ZKLA 2UYAA 3PLQA 4YNIA 1HW5A 3WW2A 4MX3A 2D5FA 4BH9A 2V09A 2XKOA 2GC3A 3FE5A 4KU7A 3LZZA 3NVCA 5HI0A 1NE6A 4OFGA 3B02A 4QMAA 2Z69A 2N7GA 5K8SA 4XFIA 2Q0AA 3IBMA 3LAGA 4UBHA 3QACA 3RYKA 4DINB 5BUVA 4RD7A 4D7SA 1RUNA 2XHKA 3CO2A 2D5HA 3H8UA 1QY4A 1Y9QA 3E6DA 4MGIE 4JVAA 4IEQA 3SXWA 2E5YA 5JSOA 2ATFA 2Q30A 4AVBA 1Q43A 1J58A 4XF0A 4LUMA 4I09A 1ZREA 4EWAA 3E97A 2Z2SB 2VECA 2WC2A 4ONUA 1EPZA 1GQGA 4HBNA 4XFGA 1Q3EA 3CJXA 4UBGA 5C6CA 4FAHA 1E79H 3MZHA 3BB6A 4HLTA 4P9GA 5J48A 5FLHA 2W6JH 1YWKA 3I59A 5JSRA 3LA7A 4MGKE 4L11A 2EVXA 4I3PA 1ZZ9A 1BSNA 3IDCB 1DZTA 3S7IA 2PQQA 2P17A 2UY8A 1RGSA 1X7NA 2H0VA 1IFPA 1ZRDA 4XF1A 4IEXA 1UD1A 3DV8A 2GC2A 2GAUA 2EAAA 2HJIA 1ZZ7A 2IXLA 2OPKA 2Q1ZB 4LA3A 3HT2A 2MNGA 4WVZA 5CVRA 3U10A 5FQ0B 3D0JA 3NSTA 3RYPA 2C0ZA 2QJVA 4HSJA 3FHIB 3S0MA 4NVPA 4HVRA 1OFNA 1O5UA 5I0SA 3CF6E 3HIFA 4QGNA 1RL3A 2PAEA 5T3NA 1YUDA 2B8MA 4MGYE 4FT8A 2K0GA 4XFBA 3BU7A 3NJZA 3SCHA 2FMYA 1UPIA 2OA2A 2XGXA 3OF1A 1Q5OA 1XE7A 2QE7H 1XE8A 5LRRA 5F1RA 1X82A 1X8MA 4AVAA 1OD5A 3SHRA 3SCFA 1X8EA 1QXRA 4E2SA 1NE4A 3MPBA 3QOPA 3KGLA 1EY2A 4IEVA 4Q0VA 2MPFA 5FCCA 3UKVA 4E2GA 1UIKA 2BNNA 4LTAA 3PJSK 5I93A 4CYDA 3RDIA 4META 4WZCA 1RTVA 1SEFA 1O3QA 4IEYA 1CAVA 4MV2A 4LULA 4X6RB 2IXKA 2MHFA 3CEWA 4QX5A 4R52A 2PFWA 2O8QA 1UIJA 2QDRA 3TNPB 1PMIA 4Q0UA 4Q0PA 4ZU4A 4B29A 3ES4A 3FWEA 3OGJA 1YLLA 1FI2A 4A2UA 2GC1A 3LA3A 3KSCA 2IXJA 2PA7A 2XKPA 1YFWA 2PHLA 5FDBA 1NXMA 4I0BA 3ELNA 2E9QA 4HN1A 3UKNA 3WW3A 3PVBB 5BPXA 3H50A 2DCTA 3RZZA 1O3SA 2GZWA 1BSHA 5I8YA 3NKTA 1XRUA 2O1QA 4J1XA 1YHFA 1CAXA 5CU1A 4HN0A 1VR3A 4MZUA 1FT9A 4DJGA
chains in the Genus database with same CATH superfamily
3GLMA 4EWEA 1NHLA 5EZWA 5CADA 1NKGA 4I30A 5FOJB 5LA0A 1LOFA 3H3ZA 4Y4RA 4UFHA 5FZ9A 2R32A 3TNQA 1I5PA 3H1KE 3OBAA 1SQPE 2WNOA 4YW7A 3DKWA 1RINA 3CC2P 3VKNA 5C39A 2G9FA 4JTNA 4ZXEA 3B7MA 4H44D 4B86A 1ZXGA 5IVEA 4WWIA 5KLVK 1GL2A 1H6XA 4LITA 5JI7A 4GKXA 4ORFA 4CP9B 4BE3A 1XQNA 2PELA 4R4LA 2QSIA 1W2BO 2KA3A 2YC0A 3M3QA 3PVOA 4C1XA 3APBA 5BV6A 1FMD3 1X33A 1K8AQ 1LENA 5CAZA 1KZUB 3ZXGA 4XUOA 4EN9B 4FBFA 5JMOA 4KL1A 3CWBD 5B5EH 4U3FD 2ZABA 3G7DA 3O1OA 3THTA 4IL7A 1MZEA 2VTXJ 4LBLA 4JZRA 5F6LB 2JP3A 1RUD1 2BV4A 2Y0OA 2C9KA 2R5BA 2VOVA 1VQNP 1QDOA 3NW4A 4OHZA 4AFCA 4PJ0E 4XACA 3PTZA 4L75A 1H89A 2ET7A 4LKSA 4Y4YA 2JKXA 2WFF2 3LDBA 1EDIA 1AUYA 4WY4D 2V7QH 3AL6A 3MUDA 1YQ6A 1DGWA 5AVZB 3CD6P 4LR4A 2JEEA 3OCPA 5FZOA 1BKZA 3J26N 1E5RA 1LTJB 3ZIWA 5JMCA 3H7YA 1ZRCA 1BEV2 1SFPA 1IGOA 4R4XA 3OB8A 4IE7A 4CPGA 3CCUP 2E33A 4AVCA 4E8CA 4GAZA 4PBOA 5BNPC 5A3TA 4HVOA 1N86A 1TG7A 5BUVA 5LY2A 1OW6A 4L73A 3T4VA 4D6SA 1XU2A 4KG8A 2QTWB 3P32A 4DOUA 4AEKA 2OZJA 1LNQA 1A3KA 4WY4C 3OTFA 1ZVFA 2CU5A 3M3IA 4MUVA 4XFAA 3WNMA 4D6RA 1QEXA 5DUWA 2HLEA 1FDMA 3OOXA 3ZN5A 1DQ2A 2XJQA 1IKPA 1Q8VA 4KU8A 2DTWA 2ETEA 1UOBA 1AYM1 5JI9A 1A8MA 4XA4A 4FOQA 2LTNA 5A3PA 1BGYD 1HV1A 3EB7A 2NMNA 1VF5B 1O4ZA 4I02A 4QPIC 4Y22B 1LTSC 5CEHA 4EN0A 1ZM1A 1PZQA 1YJWP 1G2CA 4ASVA 3SWYA 1YFUA 1PNGA 4CDQC 5K9YA 5A6YA 1RE3A 4HJGH 3K3NA 5GZEA 1J1LA 2M5AB 3S9OA 2E7QA 1AR73 4K8FA 1DF0A 1LP1B 2B5HA 2VCCA 2D2CB 2WSSH 3KD4A 3N9PA 4GA9A 4BISA 3N4MA 4Z2AA 1NKZB 2JKVA 1N73A 4NIDA 1VLNA 4CU8A 1BBT2 1YFXA 4M0HA 4MYEA 1Z7S3 5KXEA 1JY2O 5ABJA 4TZDA 4DB5A 5JXHA 2HBUA 2IVJA 1QXJA 2JE7A 3GXUA 4LO4B 1UIXA 3VYIA 1W03A 4JHZA 1Y43B 3P6BA 1FOD2 1AQTA 3A21A 5A7SA 4F8AA 1Q8OA 1OA3A 1PMHX 3VHRA 1KQLA 4C7NB 2VH9A 2WO7A 3I2DA 2KIKA 4GKYA 1JI6A 4N9IA 3H1ID 1K5MC 2HWB1 4PDWC 2JO1A 5IYYA 2UY9A 1VF5D 5A33A 3H1LE 5C7GA 1KDKA 2Z5WA 4CP9A 1F9KA 1UF2C 3PUIA 2D93A 4IE0A 2DVFA 5F5CA 2KLUA 1N2DC 4LO5B 4XUNA 4YVSA 1C5IA 4DXTA 3JC22 5C4WA 5AW7B 2BBAA 5CFDA 4C0HA 4LIUA 1LT1A 4WY4A 1A78A 3HRNA 4JKLA 4ZY9A 4IE4A 3WF2A 1IFNA 5AVWB 3T30A 4AQSA 4CPBD 4HVQA 4Q1PA 5KLVE 2JG9C 4JGZB 1GWLA 1SS1A 3WDYA 5CKNA 4HKLA 1ZZBA 5JLVA 2FYUD 3ZM8A 3ON7A 1JEKA 1WLDA 2R7EB 3VKMA 1SLTA 1XNCA 1FDOA 2A45I 4Q0QA 2AENA 4QHOA 5EPAA 1EDKA 4H7LA 4NPFX 1VAVA 2BWAA 1YQ3C 2HYKA 4GB31 4GMP1 4P9LA 5ACA2 1KYOD 3OUIA 2VNGA 4GT1A 2BCCE 1HRV1 2J1UA 2W08A 4NJ4A 2VOXA 2BNOA 2WAOA 3HT1A 3T2PA 1PGW2 2BWCA 2PAKA 2FQPA 1KC8Q 2J22A 2BP6A 3EFGA 2QZ3A 2W1SA 2Y38A 1C3HA 3M1HA 2D2CD 4XAEA 3RQ0A 1MFTA 5FFOC 4CDXB 2YBPA 5CBNA 2OYOA 3H1KD 3H1JJ 1YQ2A 3MF6A 4P5HA 4LJHA 2VRSA 3BU0A 1W6PA 3JD72 4FPEA 1COV1 1PVC2 1EUTA 3WUUA 1H1IA 2YMZA 3CPWO 1SCSA 1E5IA 1HX6A 1SLCA 2JEMA 3VOPA 2K9ZA 2R041 2XJUA 1QQP2 4LK7A 2VJXA 4RQPA 2FDHA 1W9FA 1H8AA 2M8RA 3BPZA 4GDOA 1PO13 1PZ9A 1HGZA 3BVCA 4HT1T 1Q2NA 3OG2A 5C8WA 1DYPA 4QXHA 2WKKA 1LAJA 4MG2A 1ZN5A 3GHGC 3M0AA 1UXZA 3DPRB 2FDKA 3ZN6B 2XJVA 3AMHA 1M1JA 4P00B 4XXPA 4UFKA 1KB9I 4KQ7A 1JHJA 4KWJA 3V2QA 5FZ1A 1PGSA 1SQXJ 3SCGA 1LTJA 5KHHA 4ARYA 4UYBA 5IFPA 2HFED 1L2PA 4IGOA 2HODB 1PGOA 1B09A 1FZCA 1PM7A 3K75B 5JOYA 1YJ9P 1HV0A 4COZA 4BXLA 5JZGC 3FX3A 5FMCA 2ZGRA 4XCAA 1CX4A 2AR6A 2EAKA 3AJYA 4N43C 4RS5C 2ZYAA 2X29A 4NIIA 1FNYA 1LWUB 4XBQA 4Y1UA 1L0LJ 4CVUA 1OLRA 3J8F3 1O91A 3ZXAC 2DFBA 4NWVA 1S3JA 5SV8A 5F32A 2WZ7A 4DT0A 5AVTB 4MHRA 4E4ZA 2NZ9A 3PURA 3KHBA 4GWNA 2O8OA 5GLZA 3IFMA 1IHMA 4TTGA 3AP7A 2XOMA 2A6ZA 3WP4A 5C71A 2ZOEB 1URQD 1CAWA 1HB4A 2XJSA 2PLV3 1GK6A 1R093 3GCXA 4O65A 4XFCA 1GUIA 2GMMA 4D6TE 2RS52 4QM8A 4IV3A 3N7LA 5J37A 5EP9A 5IVCA 2EIBA 2K9JB 3JD71 4IE5A 5LK5A 1DHKB 3JD73 1UYYA 2MEV1 3IN6A 1L0ND 2KK7A 2GC0A 3GBFA 1VRH1 3POYA 3QH9A 1RUC2 1W9TA 3I2GA 4H0LD 2FMDA 3B5NC 4YVSC 2E5TA 1OI6A 5JCTA 1OLQA 2D6OX 3P3PA 5FYVA 3P5BA 4YRDA 5AFBA 2ZPXA 1NTKK 2WSEH 1U12A 4H3WA 5KHKA 4ZHNA 1EV11 4OQ9A 1OUSA 5LBFA 1HWTC 5A70A 3L75E 1XTCC 5CYYA 1AXYA 1BXHA 4LUKA 4MH0E 5DZEA 3ST7A 3HBKA 3VD3A 1N7SD 2WTYA 4AEDB 4RJTA 3LW5J 2I1KA 1ZNPA 2B9VA 2PHDA 5GM0A 1UOGA 3VN0A 1OW8A 2TUNA 4KWLA 2ZJCA 3WNNA 1NTMK 1U5XA 1VDFA 1N7LA 1VJ2A 1GICA 2HWD2 3AE8C 1WW6A 5DZGA 4FPLA 3VD7A 2A06E 5I0UA 2O01N 1EZVD 4NPLA 5JOXA 4COUA 2BASA 4I2OA 4P9WA 4D69A 5LEKA 3CC4P 4JV4A 2YO3A 2W68A 1PO21 4XFHA 3WW1A 3BPSA 4BQ1A 5KAFE 2IZWA 1TME2 1REFA 5FY1A 2X8KA 4JRLA 3GNEA 1RQUA 2K2SA 3IIIA 1Y9GA 1CGPA 5CJ0A 2WFPA 1DGRA 1PMJX 4MOAA 1RF0C 1NYHA 4Y20A 3R6SA 2IXIA 3T4HB 5DJUB 2J42A 3HD8B 4IV1B 1M57D 3H1IG 2FD8A 4Z92B 2DU0A 3U11A 3ZFGB 2KSEA 1RE4A 5KR7A 1J3RA 1Q8QA 4M4RA 1NH4A 1KGYA 3RMXA 4QGMA 3MLKA 1SBFA 1DYOA 3L70E 2GDFA 4KBBA 1CJDA 3UGFA 4D0QA 4CZSA 1ACCA 3JBG2 1HVVA 5BNPA 1IPKA 4FTSA 2HLOA 1COV3 2O0OA 4MADA 2WSFJ 1JZ6A 1S5LH 1GU5A 4A6SA 1QU0A 4M3CF 2Y0IA 4KWKA 4UW4A 1OLME 1FC2C 1ZBE2 3L74D 3LDKA 5T5JA 3FXEA 1GL2D 4QX0A 5GLWA 3U07A 1N3PA 2ID4A 3W9AA 4AZZA 3PLNA 3N9OA 1VQ6P 1IC2A 4BMBA 5HV0A 1FPN2 2PYTA 3BTAA 3THCA 4QPGA 1YYCA 3KXDA 1UCXA 3EFFK 3ITKA 1R1A2 4H14A 2V4HA 4C8DA 3TNUB 4CCNA 4GMP3 1ST8A 2OQ7A 4GKGA 4RS5A 3W5MA 1KILD 1HRI1 1UXXX 4XBLA 3WG2A 1X8YA 4LC1A 5BU8B 4OGQD 1HRI3 2I74A 2RJKA 4LBKA 1YBKA 5T5LA 3ZFFB 5JIAA 3PH0A 2ZKLA 2YXRB 3N3HA 5AVSB 4O9BA 4YNIA 2QQOA 3IAPA 5FYBA 3AXDA 3CZUA 1KDMA 1PK6C 1WBFA 2ZGLA 1LTIC 4HKZH 3LEGA 2IYOA 1H2LA 2D5FA 3MPPG 1WWYA 5D8AB 3DUIA 3WF0A 4CXWA 4DIQA 4SLIA 3T2OA 4CPBA 1KRIA 3L71D 1DEBA 1XNTA 5TSWA 2K9YA 1N7SA 4GXLA 4I3GA 3ZXFA 2BOJA 1VBB1 2Y26A 3NVCA 2RMU3 2YC4A 4BZ4A 4CEWC 2JDAA 3MW3A 2H7HA 2ARXA 4OFGA 2KOGA 4XQDA 5IUQA 3JU9A 5ACA3 2P5BA 3IBMA 3RYKA 3HE5A 5K8SA 2WZEA 3L9JT 2K9JA 1JW6A 1OFSA 5DAQA 1S0BA 3O0XA 2C1FA 1W0NA 5DG2A 4RD7A 4BXFA 4D7SA 1RUNA 1JMMA 4P14A 1JOBA 5JOWA 3VZKA 4QKNA 3VBOB 1G86A 1BDCA 3E6DA 3RL0D 1XYNA 2RMZA 2OTJP 1PZ8A 3R4DB 1YEWA 4IEQA 4INDA 3L70G 4Y99C 5C4WC 4JQTA 5J36A 3GGLA 4RS5B 1SQPD 1QVGO 3POJA 1AV1A 3VP9A 2ZVOB 3E1IA 2X10A 4I09A 1W3VA 2RS13 1VQ7P 4JGYA 4LUMA 5FXZA 3L72D 1FYUA 2GN7A 3HVDA 2X05A 3SH4A 3FFZA 4XXAA 1QJFA 1VPHA 1T6BX 1XJAA 2WQ8A 1CR7A 4X8NA 1TMF3 1YJLA 1Q3EA 3FBYA 4AHZA 3WHTA 3R0RA 5CCGC 5F5IA 3WNPA 3H1LD 4LO7A 3LOBA 2BCCJ 3TAYA 4FCAA 1U0AA 1FOD3 1KN7A 4P9GA 2VUCA 4YG3A 5FLHA 2HEYF 2YFUA 1HKDA 1C1FA 3V2NA 5AC91 5JSRA 3V2RA 1OBNA 2EICA 4L11A 4MGKE 5FY4A 1LEDA 4A7ZA 4HL0A 3IDCB 5DXDA 5F8PA 2VZUA 2PQQA 2UY8A 1RGSA 2DURA 2OYIC 1N1TA 1IO4A 3A0HE 3CQOA 5GJ6A 1IFPA 1ZRDA 5IK4A 2BPA2 4FP2A 4FOVA 4Y20B 1UD1A 3ZN4A 3DV8A 2GC2A 2SBAA 3B9CA 5FP7A 3WP6A 2CSGA 2EAAA 2HJIA 5GZFA 1IG3A 5DAVA 4RQPB 4AFMA 4FSJA 2YKOA 2QKDA 4MVTA 3D6EA 4ZXKA 4LA3A 2CDPA 1ZBA3 1GNYA 2A1XA 2ZJSE 3B71A 2GNDA 2VQUA 4ASMB 3U10A 4ES9A 5AVVB 5FQ0B 3THPA 1VQ5P 3NSTA 2C0ZA 2ZZQA 3ZDMA 1ZRIA 2WAAA 3ILFA 2FDIA 3RL0B 1NU1K 4Q4X2 4XOGA 3KT1A 1KYOE 4CDUC 1MEC3 3AMQA 4CDWB 2YO2A 4YPJA 4GOFA 2RJ2A 1YYNA 3I56P 2JD4A 2PHWA 4NVPA 4COVA 3SH3A 1JHNA 1DLCA 1N3QA 3VTPC 1O5UA 1UX6A 2Y33A 2QQMA 5FWEA 4N6JA 3KVBA 3C7HA 3N9QA 4CCKA 3L73E 2R061 4UB6E 3CF6E 3OBZA 4M01A 1OD3A 1XSRA 2FXPA 2R1DA 1RMU3 2K0GA 4PD4H 3KZ4C 1S55A 5DG1A 4XFBA 4AFAA 3BU7A 2B7YA 3TF5A 1MUUA 3NJZA 2FMYA 5A3UA 4Q8LA 2WZR2 2VNRA 1KB9E 1UPIA 2E26A 2YY1A 1W2TA 1UN1A 2OXBA 5DJTB 2WFF3 2XONA 5APUA 3IB3A 2DUPA 4QWNA 2D44A 3JCIA 2OYHB 1WLCA 1E5WA 1ZV8A 2J1VA 2BU9A 1OD5A 3PVNA 4E8DA 5J1XA 1EDJA 1X8EA 5FZDA 5JIUA 1IG0A 3POGA 5IWFA 3UKVA 4Q0VA 4R9DA 5DDJ2 1X79B 4ISQA 1YO8A 4MXWA 1UIKA 1MS4A 4A7PA 3LE0A 2I1JA 3PJSK 1CQ9A 1XNKA 4XHXA 5DAWA 2VQ0A 1NA1B 1XNDA 5AW0B 2QQKA 3ACIA 1ZMEC 3AM2A 5BYNA 3JCUE 1UYPA 3A5TA 1H8TC 2VMGA 4CEWB 1LCLA 4EJRA 2WSCJ 1YI2P 2WSEJ 1W6MB 2XVKA 5AC93 2QRXA 2JB8A 4PDWB 1KJRA 3WG4A 4WM8A 2FCTA 4D6TD 4RL7A 2W94A 4FPGA 4ZONA 1RHI3 2JD9A 1SQQE 1W8UA 3R2PA 1UZVA 2BTVC 1IFIA 4L99A 4QX5A 2VBDA 1SQXG 1W6NA 2A3WA 1UIJA 2O8QA 2P1BA 5AVRB 2QDRA 2QUOA 4LNVA 2B9BA 3I55P 1NQDA 1W39A 4COWA 4Q0PA 5D8AC 4BB3A 1NAEA 3SH5A 4PCRA 4EQVA 2YC2A 5CCGA 5DAPA 5DABA 2QBXA 2Y6KA 5D21A 1NA1C 2WITA 2VD7A 1KYOI 4OQ8A 2WPRA 2GC1A 3FN9A 2Y9ZA 2R062 2EXKA 3WEZA 3AKTA 2W1QA 4K3AA 4YZ4A 3WU2H 4XDOA 3SFEC 1LGNA 2VZPA 4XIKA 1DEEG 4YVWB 1QJU1 5FP8A 2TEPA 2GMEA 5EYXA 5A3WA 3WW3A 3FHAA 4LBQA 3PVBB 1PO23 3NNLA 1IS6A 4NN0A 3H50A 5AFEA 3LGRA 2CNAA 2DCTA 1K9MQ 4UT5A 3LFMA 1G1IA 5KLVG 3GALA 4DUVA 1ND2B 2WNUB 1RE4C 4GH4B 1BSHA 1H30A 1TNRA 4RHV2 1GZ9A 5I8YA 1Y8AA 4EDFA 4AEMA 2Y0DA 3VKOA 1BVVA 4DFSA 1M06G 3HN3A 3VBSC 1Y47A 1AX1A 2NN8A 3LSEA 3H1LG 2OX0A 1QL1A 1H8TA 1QJY1 2P3KA 2Q7CA 2PXJA 2PN5A 1QJY3 2BFUL 2ZTNA 4BXSV 2HWC2 1ND2A 1VR3A 2FY8A 2WNUA 2E53A 3L74J 3PUQA 4GH4A 2BOIA 2YKQA 3ILRA 4DJGA 5FKBA 2JDHA 4QPWA 2Q9IA 3ZDSA 1O3TA 1NOHA 4FFHA 4P9YA 4YXDC 4DY3A 5FZKA 4XTPA 1ND3C 2HEVF 3ETQA 2X5IC 3KCXA 3ZR5A 5C4WB 5FO8B 3E5UA 1PO22 4XCBA 2E74C 3KZIH 3TYYA 1CZTA 1LJ2A 2P10A 2WO2A 3AFKA 3KQRA 5FXWA 3AMPA 4DY5A 1OKOA 1KILB 1N1VA 1JTHA 3OPZA 1PIXA 3A22A 5JR7B 1JYXA 4EOTA 1JUNA 1BLZA 3VBHB 3WVJA 3H1HJ 1DZRA 2B4KA 3BUCA 2XH6A 1LNSA 2Q5TA 4YW3A 1Z7S1 1LGHB 3UJQA 3H3UA 3GW6A 5FYMA 1OMIA 4BQXA 4EZHA 1DP0A 2L5GB 4AXOA 2E76B 1S72P 2D6KA 3NAPA 1BE3J 5AVUB 1VBC2 2DVGA 4HXCA 2Q8EA 5D2AA 5AW4B 2WWUA 3II6A 3TDKA 5DUVA 1SQ4A 4Z1MH 2GSYA 3NNJA 2LRPA 1KFXL 3SC7X 2VQAA 3J8F2 1RHZB 1HJ0A 5GTHH 2MEV2 1AQ5A 2G9GA 2N9BA 3EBRA 2NPIA 3JBG1 3L2YA 5T5OA 4AAXA 1GZLA 2KNCB 2ZAEB 1VRH2 3LB9A 2TBVA 1NTKG 3CCQP 5FPAA 3M0DC 2OPWA 2QJYC 1N73B 1KJLA 2Q6QA 1DIPA 2K46A 3CKHA 3DCQA 4A45A 3L36A 3OW2O 2W8ZA 1H0TA 1H1AA 2A6XA 1BCCD 4FO9A 4BA6A 3LW5H 1JNMA 1GOGA 2I07B 3GDBA 3HNBM 5CKMA 4Q0SA 3TN91 1HUCA 1W2EA 1SFCB 3W67A 3CCMP 5L9RA 1FV3A 5DUXA 1D0GA 3OYWA 4DXZA 4Y22A 3ZFFC 2KS1B 2IC1A 3C2UA 3I3DA 3O1SA 4N53C 3FLTA 4N90A 1EAH3 2JWPA 5FZ3A 4MHUA 1AR81 2LR2A 2R063 4XIOA 5I0RA 5KWRA 1MVQA 3A7QA 3AYEA 1NTKJ 4D7YA 4D7TA 4EROA 3EO6A 3HJRA 5EJ1B 5LEJA 4WVVA 4XEZA 3KMHA 3C7FA 5H9SA 1UYZA 5FBJA 1F5JA 4ZS3A 3TGUG 5IHRA 2BVVA 3GHGA 4PIYA 3IIAA 1OWAA 4QXBA 5LA1A 3BIEA 2RDQA 2RS11 2P2UA 1UKRA 2JE8A 2CY6A 2VR4A 3UJOA 5A3LA 2HKXA 2Y60A 3A3YB 1H1MA 3LIEA 1FJPA 2OARA 1F4AA 3NL1A 1E57A 4JDMA 1QGLA 2A6YA 5C9AC 1J1DC 1CAUB 1QLED 2AZ5A 3IDEA 3N36A 4TT3H 1Q8SA 1YFYA 3D0SA 1G9FA 1JOJA 1VQ9P 1WMDA 2C26A 2JG9B 4JGZC 1AR62 1SZBA 3O14A 4I0WB 1L0LD 4DQAA 3B5ND 1RUH2 1JYNA 3A0HH 5BU5A 5F7UA 4NRPA 1QGKB 1C8M1 3MUY1 1GQPA 2FKWB 2J5UA 3BCCG 1JU3A 4E4SA 3V0AB 3FWLA 1ONAA 4I2LC 2PHUA 2UU8A 4OMDA 3RZLA 3R4SA 1LOAA 4AQ6A 1EZVE 3V0AA 1ZBA2 2O1KA 3AEEC 2QCSB 1FZAA 1SQXD 5KJ7C 4QQOA 3POBA 3GBWA 5C3RA 1CWPA 4BRYB 1NY71 2ZXQA 5FO9B 1VRBA 5C8CA 2E75B 5A32A 1PP9J 1GQHA 5FY0A 3VV1A 2QQUA 2FBWC 3DEMA 3GJAA 3MFAA 3V56A 3ZVXA 1KB9D 2VZQA 3JBG3 1IZNB 3B01A 5LA9A 4CEYA 3SITA 1G9CA 1FU1A 1TE1B 3O1VA 5GTHE 4KGQA 2QA4P 2A45H 5FPVA 5FIXA 3DPRA 2L9LA 2VCAA 5B4XA 1U5IA 3Q1MA 1XYOA 4WV8A 1L0NE 3VDCA 3VUOA 2EA7A 1RUOA 2QEXP 1J3PA 1UZ0A 3MEPA 5H2FE 1SFYA 4W7YA 4LO6B 4DRRA 1SQBG 4RKUJ 4YXWH 3N35A 5CKQA 2G4IA 5FYIA 4OI0A 1B35C 3SEEA 2FCVA 4IEUA 1DFQA 4XZUG 4LXLA 2P37A 4PT6A 5TJHA 3C7GA 2ET1A 3BKZA 2FDJA 2RE9A 2Z79A 2FXMA 1DGRN 1TMF2 2JE9A 2BGCA 1NLRA 2WPVB 1A6CA 3I97A 5T50A 2LUWA 4GB33 1XOYA 1WMXA 2ZXEB 4YVWC 2XLAA 3AECC 1BEV1 2Z5HA 2A71A 1S2KA 2ITAA 1WRGA 2QJPB 1IPJA 2VMEA 1Q81Q 2FBEA 3HQXA 4RGAA 3JSVC 5FPZA 3NXSA 1AR63 4MGZE 4CCCA 1KV4A 2ZGQA 1SLQA 5L9BA 1T2XA 3DECA 4GIFA 5APXA 3DYPA 3TGUE 2VXJA 4QQLA 2XL9A 4A7KA 3WCSA 3ACGA 5BNOC 2GP5A 1LOGA 2UWJE 1VBA3 2ARAA 5B66E 2WT1A 3A7OA 3IF4A 2X5IB 3M3CA 1BGYE 4LHKA 4CXYA 4CP2A 2ZYGA 4AEDC 3RYRA 4V2VA 4XURA 1ZX5A 2R3CA 1BQPA 1NU1D 4DZOA 3OD0A 4UW5A 1OPOA 3T97A 4MXVA 4LBQD 3T0BA 4AGVA 4N78D 3MZWB 4W80A 1PGPA 2IZ0A 4PV1B 1BVP1 3NAPB 1GSLA 4FQZA 1T6GC 5T52A 4BHPA 3VN4A 5J3UA 2A7AA 4YVSB 1B35B 3CMGA 5JR2A 1EAH1 4IQPA 2AEYA 2C9NY 2RS53 4AI9A 2MJZA 2IBZE 1JBCA 2H0BA 2O01H 4HYTB 1I3HA 1WMFA 2BRTA 1PPJG 2Q8DA 1RVF1 4P9XA 4BK4A 4CUBA 1MQTB 2YB7A 4LEJA 3U1CA 2W1WA 3INAA 3HPNA 3ABVC 2B88A 4LLHA 4Q27A 4BIFA 5DDJ1 1I9RA 2KZIA 3ZO0B 1UMHA 3L2HA 4QB6A 3O6QA 3NNGA 4URTA 5F37A 1FXZA 1L4AB 4BPZA 1SFNA 2E74D 2GN3A 2Y6JA 5I0TA 2IX7C 4N3YB 1FATA 1HN0A 1JOPA 2VY0A 2RR12 4GIQA 1FZGA 1PK6A 1WLWA 3H1HG 3L72E 2HWB2 3MW2A 4BWOA 1V6MA 4I7ZC 2DCZA 2HWF3 3BTZA 3PUSA 4KI5M 2B9UA 2ZGSA 2YBSA 1WCQA 3I2FA 2PLV1 4DMIA 2GNMA 2P3JA 4EV0A 5LY1A 1HBWA 2W1UA 5I8SA 1YI7A 5FYCA 1EQ7A 4UB8E 1CAUA 3H1YA 4GZ9A 4A6OA 3CX5I 1QH7A 4NAOA 4SBVA 4IL6E 2N1TA 2NYYA 1GZWB 3JQWA 4XF9A 1VAMA 3RBZA 1OZHA 3W20A 1F4HA 4OULA 1N1YA 1LT9B 1NCRB 3WQ0A 5E79E 4IL6X 4QX3A 1SQVG 2NQYA 3GHGB 3AEDC 3DPRC 3G6JB 1W28A 3RVHA 4JAAA 4XFFA 5CZKA 1X36A 4FP3A 1AYM3 1NU1J 1CESA 2VW1A 1RUE3 1SQVE 1R64A 2WZR1 2ZEWA 3BRTB 1UOFA 5IW0A 2AXCA 2DVDA 4GWMA 3H8XA 3OGRA 4XE9A 1JYWA 1LGBA 5E1RA 3WG1A 4R4MA 1PGL1 2W52A 5KLIB 1JS9A 1USDA 4NPEA 1QKQA 2WRAA 1W2OA 3H32B 1NWQA 5KHJA 3QWOC 4RN5A 4AAPA 4DEVA 4N43A 4QM9A 4W65A 1ZRTD 1AHSA 4UF0B 3D71A 1FZFA 3FLRA 3KQ4B 1IFMA 2AEFA 2FYNC 4C0BA 3L74E 4QHBA 3CMEP 5FY8A 4BLJA 1QOOA 2HWE3 2R042 2VL4A 1NX9A 2XR4A 3ACLA 5C5TA 1W6OA 1P8JA 1ULDA 3H1HE 3L72G 1YI9A 1ENQA 2ORZA 1BBT3 3DF0A 3EQEA 3L71E 4NHMA 4WBBA 5FZLA 1TEIA 4YM3A 2RR11 3O12A 3AEBC 1NTZK 4HANA 3ZPOA 5FZFA 3L70D 1OH4A 3PMSA 4ZU5A 1C4RA 3CCSP 1VP6A 4YW6A 3E6BA 3KV6A 5L73A 4BIOA 3LPFA 5IVFA 1J2JB 2JDKA 1J59A 1YITP 1SLLA 3HOBA 2JDUA 1NVOA 2H8PD 3ZSMA 3ACFA 3I2IA 3S6PA 3UGGA 3TEZA 3DN7A 2E32A 3HAGA 5APAA 1SQXE 1LTTC 3WDVA 4A7YA 4IFMA 3THDA 2YU2A 1SQQG 2NRGA 5J7MA 5A32B 4U2AA 3M9HA 4YM2A 3AZVA 2WYFA 3H1WA 1FJKA 1XSQA 1US2A 2RS33 2WT0A 2DYCA 4HPKB 4Y1ZA 5A7NA 3AE4C 2W92A 3B93A 4IGQA 4P5YA 1W05A 3K4ZA 1BYHA 2OS2A 3CLQA 1Z7S2 3O0VA 1PGW1 3CL1A 3MO4A 2JJLA 1R091 3PTRB 5L19A 5HXMA 1H88A 2LM3A 3AP6A 1WLTA 3D82A 1VBC1 3Q8EA 2V73A 3IAOA 2WPQA 2Y8KA 3KCCA 5DZFA 2KI7B 3R4YA 3ZMOA 3RWNA 2D3PA 2KM2A 3S4RA 1BGYG 1XNAA 1V6KA 4AOCA 3H1JE 5BNNC 5GKAC 1AVOA 1R5LA 1IFDA 2ZT9C 3HE4B 1CPNA 3I2JA 4C90A 4KT0J 2AEZA 2WDBA 1ULPA 1W2UA 4WM7C 1JZ7A 3BTYA 3LDRA 3NNFA 4MX3A 2KP8A 3AC0A 4GODA 2BQPA 2DU1A 4BH9A 4ES8A 3P8MC 2V09A 3GHNA 3ZN6A 3RZHA 5DDJ3 1S0CA 2Z4FA 4XJ8A 4AE2A 5K0UB 3RZJA 1SFCD 1S4XA 1J83A 1VBD2 3CCVP 1NKNA 2WLQA 2XKOA 2PFXA 1EXJA 4OGQC 2WQ4A 3L73G 3AB0A 4YG0A 1IZ3A 1GANA 2XUMA 2ZGNA 5EJ3A 5HI0A 4LBOA 3AEGC 5HXVA 3RSJA 3MBWA 4H13B 3UGHA 5IAVA 3DYOA 1J1TA 4QMAA 2BDRA 4WVMA 4IFDK 5EQUA 2XVLA 3LAGA 4UBHA 3RL0g 3QACA 5FO7B 3I2OA 4ISRA 3CCEP 2WT7A 3OJBA 2J1EA 2VZ1A 5KAIH 4HKWA 5FZHA 4Q5OA 2VC9A 4BQWA 1JY3P 3UETA 1SQVD 3N7KA 4RQPC 3WV6A 1L0NG 2GUVA 1N47A 1OVSA 1PVXA 3CO2A 3ILNA 3LEMA 1MS9A 1NTKD 4QU2A 3T08A 1OOPA 1LHOA 3C8VA 2UWCA 4D6TJ 3R05A 4MGIE 1KFMA 3L75D 1MEC2 3SXWA 2ATFA 4NPMA 3EMRA 2CPBA 3H6PA 3TBDA 1FMD2 3TRSB 4AVBA 4MGTA 4QKDA 1AYN2 1MKMA 1ZW0A 5CHXA 3NTNA 2OW4A 3GZEA 4YM0A 1ZREA 2HPCA 2VG9A 4EWAA 4UFLA 5FYZA 2ZGMA 1AJYA 3RJ2X 4W8JA 1LHVA 3HUSA 3E97A 2Q1KA 3VMYA 2Z2SB 2VECA 3J8F1 3D70A 1AX0A 1BCCJ 3PIGA 5F3CA 1POV3 1VMFA 1SPPB 3VHOA 5FZMA 5A7OA 4QHZA 1URQB 1FZCC 2D98A 1WW4A 1WD3A 1OQDA 2ZHMA 1EZVG 3CJXA 3F5HA 4LO8A 1E79H 3HR9A 1O59A 5C6CA 1NA1A 2XPJA 1S5LE 4K8RB 3RJRA 3QCWA 2W6JH 3BCCE 1WUVA 1MS0A 1YWKA 3H42B 3NO8A 3W21A 3VBOA 4LMFA 2LKMA 1M8OB 2YHJA 2YROA 1VQMP 5HCAA 4FTBA 2VZRA 1GTWA 1RF1B 4Q8KA 5A33B 1DZTA 1XYPA 1KILA 2HEWF 2W3JA 4CTEA 2FYUK 3QD6A 5E89A 1JY3N 3I3EA 3LIGA 1RY3A 3POEA 4D6QA 2H0VA 1G9DA 1DQ1A 1IQAA 2OQ6A 2GNBA 1UX7A 2H43A 3NV1A 3H1HD 4FPKA 4XJWA 3MP7B 5AW1B 1S1AA 3K4DA 1LGCA 1S9KD 3AZYA 4QDRA 4RGKA 4DO0A 2RMU2 2OYHC 2AEMA 1DIWA 1N7SB 3BRVB 1Q90D 1ZZ7A 2JXAA 3RK3B 4CUAA 5CG9A 2FFDC 2IXLA 2Q1ZB 1DBNA 5DAXA 3FWNA 3RYPA 3VBSA 1H8TB 2WIIB 3HT2A 5JXJA 2MNGA 4WVZA 4PV1D 3MF9A 4OUMA 1PL5A 4NWWA 3D0JA 4JCKA 3NJVA 2FZ2A 4AYCA 2QJVA 4HSJA 4NO4A 5DMYA 4NIGA 3VD4A 2Q1MA 3L37A 3FHIB 2W6AA 3W5NA 2DTYA 4JX0A 3VHPA 4XAAA 1OFNA 5KC5A 1P84D 1GP5A 1UZYA 1O8PA 1GKBA 4FPCA 3CCRP 2ARCA 4NMIA 2XNXA 3HIFA 3J7LA 5M1BA 4XDPA 1RL3A 2Z4EA 5EYYA 1NCQC 1YUDA 5T3NA 1KD7A 2VO5A 3GHMA 2A6VA 1PFIA 2FYUE 1C1LA 1BHGA 3SCHA 1NTKE 1AR91 5JWPA 3FUOA 3NV2A 3PVEA 3WNXA 2OA2A 4X8PA 4P9IA 1Q5OA 1XB9A 2QE7H 1T6AA 1XE8A 4HPKA 4NHYA 5LRRA 1YQCA 4H2AA 5F1RA 1G9AA 2PAJA 1PHMA 2XBO1 1EV13 1SDWA 1X8MA 2VULA 1POQA 2BCCD 3WX5A 1L7LA 4AF9A 1QXRA 3ZFEB 2GP3A 3KGLA 3QOPA 1OVPA 4TLGA 5FCCA 5H9QA 4E2GA 4I6MC 1W8FA 4YZ2A 1SFCA 1KQFB 4A42A 3HD7B 4K21A 2BNNA 1T8ZA 4B4QA 1G1JA 1W6NB 3FLPA 4D8MA 4LHSA 1EAH2 4UFJA 3F89A 3RDIA 4HOOA 5LCWL 3ECQA 1SEFA 1WCKA 4NPRA 3Q9OA 1O3QA 2IVIB 1RUJ1 1SQPJ 3D3AA 2IFRA 1CAVA 2QZ2A 3AE6C 4PDWA 5CCHD 1UKGA 1W6MA 3NWKA 1ULGA 5IK5A 3C7OA 1PX3A 1W9SA 3CEWA 3VBRA 4IL6H 3VL8A 2W0XA 1LWUC 1WCDJ 3CNAA 5FJKA 3MD0A 1V00A 2VUAA 4Q4W3 5TISH 3I8TA 5F2SA 3H32A 2RR13 2BUKA 1RJ7A 3VBFC 1YJKA 3ZXEA 1ND3B 3ES4A 4FFGA 3HD7C 3FWEA 3GJBA 3VBUC 1LOBA 1ODNA 2J59M 3NJYA 4A2UA 1VQ4P 4CU7A 2YPDA 4OHYA 3OSDA 1JTHB 4OYUA 2A70A 2IXJA 5CBOA 3JB8A 2RV9A 1NT0A 1QF3A 2BERA 2NPSB 1YFWA 2PHLA 3L71J 4OHXA 1AXKA 3RBXA 2P6CA 2XQXA 3MIGA 4I0BA 1KILC 5FK8A 2E9QA 3LEKA 4RR3A 3BGAA 3KF5A 1UZWA 1SG3A 2ZEYA 1OKQA 3OJAB 1CVNA 3K2OA 4HN1A 1LT9A 1NCRA 1IPSA 2YKPA 1LU1A 2VNOA 3AMNA 3I3MA 5FY9A 5FMOS 5L7OC 1EC5A 4N53B 1QDCA 3V6IA 5J98B 5B2GB 4YGBA 2WN3A 4FPYA 2O1JA 3KDPB 1DGLA 3AMMA 2VBPA 3B5LB 3MHVA 3NKTA 4PQ9A 2VU9A 1JY3O 5BNNB 1W9YA 1KQGB 2FFDA 3L75G 3RFRA 2DCYA 5A3MA 3AKPA 2W27A 1GU3A 4J1XA 1YHFA 1CAXA 5C5UA 4CU9A 3NNMA 3PHLA 1FT9A 3JQXA 1AF9A 1L7QA 1D0HA 2FYNB 1CAVB 4KG0A 1HGVA 4XUQA 5LA2A 5L7OB 2WT2A 3C3VA 1OVVA 3ZYGA 5CB7A 1A8DA 2R073 2M3EA 1S2EA 1TQ5A 3PIJA 3VBFA 1L0LG 1F15A 2JG8B 2OUJA 3ALQA 3OY8A 3RS6A 3RWKX 1NCQA 2R3SA 1GWMA 5D1IA 1IJDB 5JZGA 4W7ZA 3BVHA 1JH5A 2PP6A 3JCUH 4HH2A 1HJFA 3T1LA 5G04L 1XE0A 1V9U1 4D94A 1R083 2WR9A 4Q2FA 5FPBA 4F7ZA 1GK4A 3BI3A 1D7MA 4AFDA 1AVBA 1QWRA 4S2HA 4PD4D 3MIEA 4JRAA 1CPMA 1MS1A 4Q4W1 3SNMA 4D3WA 2NLRA 4GJYA 1NQJA 2RS12 2R0FA 3CI9A 1SPPA 1N7SC 4HK9A 1N8RQ 4RYDA 1VQOP 2WABA 1WMKA 3PU8A 1SBDA 3P8CD 1EDLA 3ETPA 3I4IA 2QFEA 2BW8A 3O1RA 1F35A 3ZMNA 4A41A 5L7OA 1JUHA 4AQRD 2BYVE 2WN2A 4U3FE 3K46A 4K7JA 4LOSA 3OPTA 1IFJA 1NLSA 3OA7A 1NTME 1UNBA 2GM4A 1HJBA 1GD2E 1RUG2 3GZTB 3RG0A 1UW8A 1PO12 3I3QA 1Q86Q 4JDNA 1NJIQ 3UK9A 4CCOA 3A4UA 2IPPA 1H9PA 4I0AA 1QJU3 2GH8A 4ZPIA 3SISA 3VDAA 4B4RA 1MS3A 5F6KA 1W8NA 2IXHA 4Z8BA 2ZEXA 1ZR4A 2F4PA 3EYPA 1ND2C 1AL23 2WNUC 4GH4C 1CX1A 1L0LE 4H0LB 4AEDA 3HD7D 4Q26A 5FZBA 1D4M3 1KORA 2N9YB 1UO9A 2NM1A 5FXVA 5CCHA 1JODA 1SQVJ 3PP5A 2POHA 1V6IA 4EZ4A 3WDUA 4CDWC 4CDUB 4OI4A 2E63A 4NIHA 3JXSA 5CISA 2W87A 2HYNA 4KWUA 1JZ4A 3AYAA 4QGLA 4XJ9A 5JAXA 1OHFA 3ASIA 4X6QB 4NROA 5SV5A 1VIWB 1JYTA 3I3BA 5CFDB 3UIAA 2HWD1 3AE5C 4H44B 4U7JA 1OA2A 2WFF1 2X09A 1DGWX 2XNDH 1AZDA 2DF7A 4Q29A 3WW4A 1VBE3 1QX8A 4QXKA 5JXIA 3LIHA 4FI9A 3ROUA 4ARXA 1CIYA 3N7MA 3PL0A 2D97A 4TN7A 4B1LA 3G6EP 1PGQA 4K3UA 5FLIA 4OH8B 3HE4A 2BEOA 4XABA 1L0LK 5GZDA 4Q4V2 4L74A 4UFMA 4Y5Z0 3RNSA 1A02F 3VD5A 4C7RA 4BRYA 1UY3A 2C9AA 5BNQA 1C8M3 4PLOA 1T3JA 1YIPA 3FHQA 3W59A 2Q3IA 4KGGA 4QU1A 3EWKA 4Y3OA 4Z82A 5FMOL 4YPCA 1MS5A 3K51A 1BCCE 2A5ZA 3NJXA 2LS6A 5LK7B 3P7KA 2CAUA 5KHIA 2HPCB 3O1UA 4NUBA 1SBEA 4AUWA 3IDBB 2XQRA 1ZOYC 5IVBA 2LALA 2VPVA 3HTKA 5BXXA 1RVF3 5BNPB 1URQC 1FZCB 1HF9A 3ITQA 4LKFA 3HQUA 3M70A 5KKZC 1UZZA 3KS7A 2JIGA 4R4ZA 1SMVA 4FAGA 4Y1YA 1G2CB 3CXHD 3NQHA 2VGDA 2AXTE 1C5HA 1OF4A 3D6ZA 3OBTA 3X29B 4AGGA 4OUSA 4B4PA 2ZVNB 4XF3A 5I91A 4K20A 1FPN1 3ZYJB 4HETA 2FZ1A 3ZYIB 4C1WA 4IV1A 1US3A 2RM22 3T0AA 3VBFB 3ZXLA 3M3EA 3ZKUA 1REDA 1V70A 3HTKB 1S0IA 4AI2A 3FMGA 1QJX1 2XLFA 3GMAA 1NG0A 1J3QA 2YGLA 4PIXA 2XLGA 1OURA 1PNFA 4L92A 4XUPA 3RK3C 1IKQA 1QHDA 4XJAA 3Q3DA 4OZXA 1GZTA 1CI6B 3KZIE 3L70J 2GMPA 3D6YA 1FS0E 1VMJA 4PIZA 1TNFA 4JGYB 1WA6X 1YQ5A 4N43B 4BQYA 1ZZ8A 2F17A 2PMWB 3AKSA 4QQ2A 1HLCA 5A7WA 3E6CC 2AREA 2K88A 1VL2A 2B46X 4UW6A 2XMLA 4AVTA 1LR5A 2AUYA 1BEV3 4GULA 4FOWA 3WUDA 3CX5D 1W8TA 1BMV1 4PLNA 1AR82 2IXCA 1KILE 1OXZA 4XQWA 3QH7A 2W5FA 4G3YC 3HQRA 5CJ4A 1D4M2 1S1CX 2R5DA 3S1KA 3KB5A 2VAUA 3FUQA 4LIVA 4QDQA 2ZHNA 4AFBA 1AYN1 1OW7A 1G6NA 4ZMDA 3AL5A 3C8XA 1UQXA 1L0NK 5FPXA 1H8VA 4DEQA 2JG8C 3VBRC 1SQBK 2ZAHA 2I45A 3N9MA 4JKKA 5ANNA 1ZYBA 1G9BA 1DD4A 2Q4SA 1QIQA 3O7OA 3SMHA 3CC7P 3WUTA 1W8WA 4K9SA 3WG3A 4CEYC 1ALYA 2V5DA 1ASJ1 3Q8FA 4Y99B 2J1RA 2D6NA 1OUXA 2W9XA 3TB0A 3NRUA 4GB32 4F83A 5ACA1 4BCUA 1L0NJ 3IWZA 3F95A 1LOFC 1D2QA 2R30A 5KXBA 2FXOA 2W39A 3WDTA 2SPZA 1CAWB 2UYBA 5EFWB 1ND3A 2UWBA 4OLLA 1GMJA 4QT6A 4XMAA 4AI8A 2G9ZA 3CX5E 1ULOA 2JDIH 1CZSA 2XJRA 4J25A 2ZS6B 1VQ8P 2WA4A 4MN4C 1C8M2 1PK6B 2CV6A 3IM0A 1QJX2 1URXA 4JKMA 4WZFA 1GL2C 3JZVA 5FP4A 4CCMA 1ENRA 1LECA 4Y26A 2BEZF 4FOYA 4BQ2A 4PBPA 1KS5A 3RGUA 2JWAA 3VDBA 2A6WA 1ZRTE 3H1IE 4QPGB 4NRQA 3UYJA 1PVC1 5BNNA 2V72A 1V6LA 1LT9C 1NCRC 3FFQA 1L3JA 3FL7A 4Y5SA 4AL9A 5FR3A 4XETA 1GR3A 3WQBA 5AC92 1I1EA 4AW7A 2AXTH 2K37A 1GU4A 4BWNA 1H4HA 4BQ3A 2RS31 5EWSA 2VOTA 3M3OA 2DCKA 2GH2A 2D6LX 4PD4I 4O9GA 2M5AA 2XHNA 2WNVA 4YZ3A 3RZZA 3MIWA 2D7FA 3RGBA 4BDVB 2R1BA 4UXAA 2QM8A 1L7RA 1QL2A 1HQLA 2A06G 2DBNA 4KMQA 1SQPG 3CXHE 1D4M1 2W95A 4IEZA 4RGGA 5JZGB 2QQLA 3VBUB 2QE3A 3ZDVA 3ZFGA 1XU1A 1NAFA 1KTMA 1TME1 5FP3A 1FBMA 1HQWA 2JG8A 4CE8A 4LBQB 1ZBE3 4PV1C 2ADEA 4V2WA 2OYIB 1AR93 3LFIA 4OHVA 2LXCB 1AR61 1VRH3 3IDAA 1DH3A 5CFCC 2X5IA 3ZYFA 1V6OA 3NFQA 3KWVA 4LLOA 4XUTA 5LB6A 3AE3C 3G4SP 3OGSA 2XDVA 3N7JA 4CUGA 2C0XA 1K12A 1ASJ2 2EIDA 5FPLA 1HXS3 4L9BA 5KKZB 3E7KA 1S0JA 3N9NA 2WINB 1BDDA 2B87B 1UU6A 1OPMA 1YQ8A 4B8EA 5HV4A 4Y24A 1O3RA 3L73D 3HNYM 2KZJA 1WBLA 2XBO2 1ZZ6A 2D40A 2HH9A 3CCJP 1M56D 2CWMA 3H1KJ 1MR5A 3BALA 2YXQB 3IT8A 1W5CE 4W6YA 2YZ4A 2C6SA 3NAPC 1H2MA 3IMNA 3DXUA 4KBZA 3V5BA 1ZA7A 3I54A 4FQ4A 1GYKA 4RA0A 1DDLA 4YARA 1VF5C 1DX7A 3KV9A 1WKYA 1S0FA 2E7TA 4CCDA 1RB8G 1QVFO 2DCJA 4BOWA 1RMU2 4YZ1A 5E8AA 3KPEA 3VHNA 1FOSE 1RQVA 1VB4A 3AZWA 1Y3TA 4N7UA 2CGOA 3Q2YA 5FZ8A 2SLIA 3VZOA 1RUC3 2R072 4JGZA 1RUJ2 3GYDA 1RUC1 3U4XA 2B39A 4PHZA 4OMCA 2D2CC 1CZVA 1NUKA 3VBOC 4JYBA 2VOKA 1YHQP 4YW1A 3K4AA 2ILMA 4AR2A 5JDBA 1WZXA 3DYMA 2FYUJ 4OGQB 1GLHA 3MW4A 3WF1A 2YMYA 3MIDA 1GV9A 2D6MA 3MDPA 4Q4Y3 5DQ0A 5JSOA 4MXWB 2CGPA 2EXJA 4YSFA 4NOTA 3I7DA 3BTXA 1T2KC 1D7PM 2ZGKA 3FXDA 1LESA 3WXPA 1KMIZ 1KS4A 1VBE1 5E16A 1SQPK 4KHXA 2JDNA 1DCSA 3EQ2A 2WSVA 3F2ZA 3LF7A 1QJX3 1VPCA 1IK7A 1H9WA 1UMIA 2HWF1 2ZACA 2DDUA 2DWRA 3H8RA 4K6BA 5LATA 5CFCA 4AYUA 1E5SA 5FUIA 1LHNA 4N8MA 4AI0A 5KBFA 5C3SA 3H1IJ 2W83C 1PP9D 4JDOA 5DPNA 5FJHA 4EYUA 3VZJA 4DUWA 4HK8A 2ZGTA 1DG6A 1FAYA 1WCSA 3OUJA 4Z1VA 1FX5A 5B5EE 3H3LA 1JMUB 5A3NA 2OKXA 2WQZC 1OXCA 2XDJA 2JG9A 3JB4C 1AX2A 1RH5B 3E1RA 1QOTA 5EV7A 2QQJA 4B3NA 3SWFA 1WW5A 2UYAA 4LKEA 1SQQD 1MQTC 3CBNA 3WW2A 3HBZA 1M1JB 2C0WA 3AEAC 5APYA 3MIFA 5BNOB 2XWJB 1HXS1 2G3AA 2WZ8A 4WVMB 3VGIA 5APQA 1SLIA 4OHWA 3L71G 4NR1A 1IK9A 4K1ZA 3RK3E 3FE5A 1GNHA 1LOEA 1UY2A 2ZT9D 2R071 3LZZA 4KU7A 2E6VA 4Y5TA 2NMOA 3L74G 4ZKPA 2XJPA 5HCBA 1NE6A 4ZNCA 4M3CE 1UL9A 1X50A 2W91A 3B02A 4EI2A 2E7AA 1LTBC 2K3RA 5IVJA 2N7GA 3PU3A 2Q0AA 4YW2A 1F5FA 1R1A1 4MGQA 1OSGA 2RG4A 3TEYA 4AHXA 2D3SA 3FGAD 1HRI2 1PGL2 1PIV2 1RUG3 2OTKE 3HN1A 5LASA 2XHKA 3OYWB 1ENSA 3B00A 4OI1A 1VBE2 5J48A 3NMBA 5K7PA 2YNYA 2D5HA 1Y9QA 2WQYC 5FWJA 2VM9A 2E5YA 1HB2A 2LW8A 2OUHA 1NTZG 3CCLP 4M3CA 3RI8A 3USUA 2M3BA 4ET7A 2KD7A 3FBMA 1LJ7A 1Q43A 1J58A 3M7AA 3CU7A 5F2WA 4OI2A 4YWAA 4C91A 1JZ3A 4BU2A 3R4UA 5K5GB 3VZMA 2ZT9B 1DU3D 3ABZA 1S5LX 3LEIA 1QNWA 2CHHA 3ORJA 4ONUA 3NV4A 3CHXA 4HBNA 1S4CA 1K42A 2ZKNA 1GBGA 4M00A 1QMJA 3T2TA 4EE2A 3WP5A 4RFT0 3PTYA 4FAHA 1CIWA 3BB6A 4GD4A 4Q4Y2 3TEWA 4HLTA 2E42A 1N3OA 1WCUA 3V64A 3POWA 1MQTA 3KF3A 5KLIC 3A23A 3KLSA 2WWWA 4GALA 1Z78A 1PO11 3V4WA 1PIV3 4GWIA 4QPIA 4LBMA 4Q4X1 4TSVA 2OIIA 3V0BB 5C33A 4RHV3 4Q4X3 5L9VA 2A06D 4U3FJ 3CWBJ 3RZMA 2EVXA 1ZZ9A 2E51A 1BSNA 1PGJA 1BE3D 3MGNA 2AYHA 2DVAA 4LPLA 4CDQA 4PJ0H 1AL22 1SACA 4P08A 4RR3C 5DUUA 1ULEA 1X7NA 1TME3 4ATEA 3AP4A 2W2IA 5CIRA 3RRDA 2CDOA 4XF1A 1AR72 1BZWA 5FZ4A 3M9BA 3VP8A 3S30A 3T97B 5HPOA 1NO4A 2VZTA 2GAUA 2E31A 3VB9A 4B7EA 4DXSA 4A3ZA 2ENRA 3TN92 1ZP0C 3AYDA 2KUBA 2WVRA 1Q8PA 3KM5A 1RUD3 1X22A 1Y7BA 2ZZJA 1LEMA 1W2AX 2DW3A 2IDBA 4DOJA 2OPKA 2YYOA 1PPJE 5IJRA 4O7XA 4IGPA 2OTLP 3IPVB 4QX2A 2IBZG 2HYXA 3U75A 1O8SA 1VBB3 2VMDA 3N9LA 4HFSA 2W90A 4GMP0 3CJIB 5F3GA 5CMZA 2M0BA 4UI9L 3BOPA 2JKBA 2VE1A 3VBHC 2YXSA 4W6WA 2IFWA 1KQSO 2ES3A 3S0MA 5IK8A 4EN6B 4FPOB 1VBD1 2L91A 2DBIA 3ME2A 2QQNA 4KH9A 3WF4A 1VBD3 4A44A 1O6UA 1FV2A 5I0SA 4NE9A 3UT0A 2ZX1A 5T5PA 5H2FH 2KNCA 4QGNA 1RYYA 4QKFA 3J4UH 1XC6A 1AVYA 2B8MA 2EXHA 4FT8A 4MGYE 2EIEA 3BCCJ 1BCXA 4XTMA 4F3JA 1W0OA 3K3OA 2MEV3 2JDZA 2YPJA 1JB0J 5APVA 1ODMA 3SSUA 1LTAC 4AHYA 1POV0 3OF1A 2I8DA 1NAYA 5FZ6A 3PDQA 2FDFA 3VZNA 5APTA 1D2SA 1JCCA 1SQBJ 2BVBA 3VMXA 2HR3A 4A3XA 4AVAA 3L4FA 3SHRA 3SCFA 4LT5A 4E2SA 5JSPA 1NE4A 2XXZA 2WNVB 4IEVA 5F3EA 1YRZA 1RF0A 1BK0A 2JB4A 3FC0A 3J7HA 4XW3A 5FZOB 2HG5D 1J1DB 2VMHA 4BLIA 3ZFGC 1DD3A 4LTAA 4LHLA 5I93A 5KJ7A 5IATA 4CYDA 1AR71 2P4EA 1UMZA 2QDNA 2PHRA 2XUEA 2ZX4A 4QX8A 1HIXA 4ASWA 2RM21 1Y9MA 2YFZA 1VALA 4UB6H 1X9VA 4FPJA 4IEYA 2P1JA 1SHWB 4K40A 3WOGA 1SDDB 4Y1VA 4MV2A 3WY6A 1JZ2A 4PD4E 1RUD2 2IXKA 2QIWA 3L35A 2ZBJA 2XB6C 2R44A 2IUWA 3H1KG 3AK0A 4QQHA 5F5QA 5FV3A 5M0TA 5CG8A 4R52A 1ZBE1 2PFWA 2D43A 2H88C 1U7MA 1ULCA 1FNZA 3B3QE 4CUCA 2DUQA 1GP4A 2B42B 4JQ0D 1USEA 5LBEA 1ZR2A 4M3CB 4Q0UA 1GWKA 2BJSA 4H44C 5E79H 5AVQB 4AI3A 4B29A 3U14A 1F8VA 1SQVK 3RI9A 1Q7YQ 2NP0A 3O1PA 2IBZD 1YLLA 1AYN3 5APWA 2ZFCA 1YXWA 2ZA9A 3Q8BA 5H9RA 3B4SA 4JBZA 2ZXXA 1YTZT 4RESB 1FI2A 3LA3A 3IKWA 2E76D 5A7QA 2PA7A 5TISE 1QNYA 2RHPA 3B9IA 1GOFA 4GJZA 1HJGA 1TMF1 3H0OA 2RMU1 2ZGOA 5FDBA 2ERFA 4JPZB 4UOJA 1MEC1 5ANQA 2N1TD 3ZSLA 3GF3A 3RK2D 2QJKC 3P3NA 4QXCA 2QJPC 5BPXA 2LROA 2W6BA 1A34A 2Y0EA 1RUF1 1U7JA 1DQ6A 3OD4A 3ZYHA 4YGDA 3NKGA 2VCMA 4W6XA 5AW9B 2KR2A 3A0KA 4Q4W2 1AYM2 1VBB2 2IFNA 2BZDA 5BNOA 1H0BA 4UFIA 2O01J 3BATA 1CONA 1W3XA 1XRUA 1LOCA 1O4YA 2VTXA 1OT5A 4XJUA 5T55A 5JPMB 3LCPA 2O1QA 3WP3A 3RZGA 3MI8A 4CU6A 3SEPA 3POFA 2WS92 2B87A 4AK3A 5FZAA 3SKVA 1S0GA 3IMMA 4HN0A 3AE1C 5I0DA 5J96B 4MGSA 2C24A 4MZUA 4CXXA 3W68A 4G4FA 2ZX0A 4WVWA 1FPN3 3B8EB 1W2NA 3M91A 5KLVJ 3P8CE 1JN2P 4GWJA 2FYZA 3AKQA 4IE6A 1LWUA 2WNEA 4Y1XA 4BM8A 2Y9YA 5AVYB 2VXRA 1UPSA 5A1FA 1AR92 1JUIA 1HRV2 2CL2A 4C46A 3Q8CA 1BCCG 1HN1A 3RK2B 1LTJC 3TGUD 1O5LA 3MLJA 4XJZA 1AJOA 2BGPA 3LIDA 2Y6GA 2J1SA 3IN9A 4IETA 5FUPA 3TEXA 1IS4A 3WNLA 1FOD1 3KYQA 2CK3H 3HD7A 1V6JA 1RVF2 3CLPA 3VL9A 3VBUA 1H2KA 1K73Q 1FZBA 2OYZA 1P84H 5GTIE 1GZWA 2CYFA 4IV1C 2YIUB 4RHV1 5FBZA 5BVZA 1NTZJ 3FZ3A 2BBVA 3KQGA 1COV2 5C9AA 1UIIA 2VVDA 5AVPA 5LBCA 1KEXA 5F5AA 4YGCA 2QVAA 2IWGB 1KYOH 4IEWA 1HB3A 5ERLA 3LKJA 1K45A 2IYPA 2ZX3A 4CP1A 1GW3A 4JTOA 4NHLA 3AEFC 1NCQB 3PJQA 2NZ2A 1RE3C 5AW8B 1F2NA 2R16A 3RK3D 4L0PA 4O61A 3ZYRA 1BJQA 1P84I 2O14A 5KTBA 4I7ZB 3FJSA 3J7MA 1V0AA 5FRAA 1Q82Q 2P3YA 3AFGA 1OF3A 5FOBB 3VD9A 2JICA 1BK1A 1UYXA 1FE6A 3H1LJ 4N78E 1NZCA 3I2KA 2YV8A 5ABJC 3PJYA 4IV3C 1WGPA 2VVEA 1NU1E 3L73J 4AEJA 3NV3A 1VE0A 3E5QA 4JF7A 4FXGB 5AW3B 4LE4A 3CWBG 3MGUA 4HSLA 2E75D 4LORA 1YNAA 4OCTA 1W8OA 5JOZA 3SWKA 3L72J 4IFFA 4LBJA 5A80A 4JYCA 2E76C 2P67A 1HTLC 1QH6A 5JPNB 2FFDB 3J9SA 1MFZA 4AQTA 3FX0A 3AKRA 5FQ0A 3B5NB 1WA4A 3UKTA 1H6YA 2G19A 3LOIA 2B89A 2ZEZA 3MV11 2VVFA 5FYTA 2ARBA 2WL1A 5F39A 4LA2A 1GFF2 4LOTA 3WQ1A 4IOIH 2VBBA 4FFFA 4FXKB 2FDGA 2VUDA 3HUSC 4V1PA 1JY2P 1NTMG 1ZLLA 2E75C 1KD1Q 3Q5SA 1RMU1 3B94A 3WNOA 2DV9A 3O0WA 2WSCH 4ZKUA 3CMAP 1HRV3 1TZOA 2GNTA 3M8LA 4O9EA 4CDUA 4U3FG 3V4QA 2QVSB 1RUE2 4DRVA 4YZ5A 1VQPP 4QPGC 3ZXJA 2KSJA 3A0BH 3RPQA 5FREA 3WSOA 3W58A 5FK7A 2QQPA 2D6PA 4CDXC 1G7YA 1KQRA 2J1TA 5K4LA 3BCWA 2VQTA 4N9HA 4QX7A 2RDSA 5JVVA 3WINE 2OGUA 3A0NA 2E43A 3MFCA 2RDRA 4Z07A 3U59A 4LLFA 1W8ZA 2YMKA 5DN2A 1LRHA 5A7WB 5C3QA 1DQ0A 4C7NA 2IBZI 2BNMA 5CNAA 4CA9A 4ZU7A 3KGZA 1ZA4A 3MYXA 4AVVA 4COYA 1GMMA 1C57A 1JM0A 2O3JA 2HWE1 1SFCC 4LQRA 4DPNA 4G9SB 2PGDA 5A6XA 1I5ZA 4W4ZA 4CEWA 3SKJE 3S7EA 4DUXA 1BMV2 1LP1A 3O8ZA 1D4VB 1PZ7A 1EYBA 3K48A 5GALA 1OH3A 2XV5A 1UY4A 1V9U2 1UOJA 2ZGPA 5EJZB 5C70A 4WM8C 3VBHA 2P2KA 1OVUA 1K3IA 1R092 1M90Q 1UAIA 4YM1A 3ACHA 3T1MA 5FZCA 3TSIA 2A45G 3I59B 1LULA 1WW7A 4CEYB 2KYVA 1AXZA 4CCEA 4XQ4A 5CCHC 3V0BA 3MV01 1ZRFA 4YYOA 5GLUA 1RXGA 5I8TA 3WHUA 3KT4A 1MZ5A 2ZGUA 2OQQA 4AGRA 5C3PA 1JYVA 2JWDA 1LHWA 3ZPYA 5J09A 4J1WA 1ULFA 4IERA 2MKVA 2BEQD 3WDWA 1YCIA 1KXGA 4YW5A 1RUG1 4M3LA 5E6HA 1EV12 1Y4WA 1JU4A 1CAXB 4HG6B 1PP9E 4XE5B 2V4VA 3LWCA 1QJU2 1EP0A 4I01A 1QOSA 2EALA 5FP9A 5FZ7A 3RMYA 2YDEA 4AQ2A 4FTEA 1PPJD 2D3RA 1RUI1 2UWAA 1VQLP 3HWJA 1KFUL 1J1EC 1XBFA 3AJZA 2JENA 3SFDC 3WQ7A 5FPUA 4E27A 2VUJA 3PUAA 5HCFA 3MIHA 3QH6A 1H2NA 2JR8A 3OGGA 3P1IA 2XJTA 4IESA 5E88A 1LTGC 4QB2A 2RS32 2VCBA 3GZUC 5C9AB 2XKMA 3ZLIA 2HWE2 2R043 2Y6LA 1CI6A 4CDXA 2E74B 4GOEA 2GU9A 1QJZA 2F4LA 1VMHA 2DVBA 2YBKA 1EPWA 1OOPC 3H9AA 3K77A 4MSVA 3TN93 1YQ4C 3ZXKA 3S57A 5AVAA 2H6CA 5L36A 4EIJA 1ENXA 4BJ0A 1JZ5A 4QKBA 4OWFA 1C8NA 3AVSA 3KT7A 1FDIA 5A3OA 4CSWA 3PMEA 1R081 3WF3A 2Q1FA 5LZ6A 1RF1A 1O7FA 2JJ6A 3MICA 2JECA 5FLJA 4AWDA 3ZX7A 1JO5A 1AFOA 1NLQA 3ZXDA 4B7KA 4ZKTB 4EWDA 5FZ0A 4E2QA 3A2AA 2A3YA 2WS93 5A6QA 3T0DA 5KXCA 1LB2A 1EUUA 2WBKA 5GLVA 2IFMA 3AE9C 2X53S 3DL3A 4XDQA 3WUCA 5EIYB 3CL3D 1H0TB 4ASLA 2AEJA 3VBRB 4BYYA 2QNKA 4WM8B 3ZR6A 3USSA 5FYYA 2VZOA 5C3OA 4RFRB 1PVC3 1JZ8A 2PHXA 4LHNA 1RC6A 1VQKP 1DZQA 1W6OB 5APSA 3QLQA 2FYUG 2WJSA 4XF4A 1CJPA 3A0BE 1ZRRA 4KNCA 1KFNA 4PI2A 3AE7C 3H7JA 1O4TA 4S2FA 5CFCB 2K1AA 1J1EB 1E5HA 2KXLA 3AYCA 1PV3A 2ZYDA 4M0NA 5FMDA 2WA3A 4YTPC 1MZ9A 4I1LA 1QQP1 2VW0A 1Y9BA 1HH0A 2Y6FA 2ZCWA 3OBRA 4FFIA 2B45X 3T2QA 4HMZA 3U4SA 1OOPB 3LSDA 4XZPA 1BE3G 5BY5A 5JXGA 3M0DA 4LK6A 2OYHA 5KXDA 5FTTC 2WLPA 1GNZA 5FZGA 3LPGA 3BODA 3LD8A 3V65A 5EFUA 3V2PA 2WT7B 4OUEA 3VKFC 1OVRA 4L2NA 3HE5B 3ZYBA 5GZCA 2J7MA 4IEOA 3UNPA 5AVXB 3E5XA 1TU3F 1CW5A 1JY2N 3M06A 2JDMA 4NIAA 3DGTA 4E4HA 1X9PA 1A02J 4XILA 4ZS2A 2XL7A 4Q4V1 5LW9A 3CIHA 4HONA 3GF7A 2A73B 4PLMA 3HEIA 4HB1A 1AJKA 1LHUA 3T09A 2Z5IA 4WM7B 4IEPA 4LBNA 1J84A 3CXHH 5EHDA 3ZSEA 4EN7B 4JC1A 1MACA 2WSFH 2Y0CA 3TK1A 2VMFA 3ES1A 4PJYA 1MS8A 4ASKA 1XPWA 3GBGA 1JOCA 3M9QA 4CCJA 5HCHA 2DUOA 2HWF2 3WUVA 4QDSA 4CDWA 2QM7A 3C7EA 1OLMA 3AE2C 3N4XA 5D8AA 3LA2A 2PRRA 4DS0A 4WB4A 3M2MA 2PLV2 3H1JD 3ENRA 4R8HA 3OUHA 4OZOA 2RM23 1WD4A 3S5AA 2HWC3 2VMCA 3CXHI 3CJIC 3U0ZA 1L4AC 1BE3E 1T2KD 3VBSB 1NYWA 2P7JA 3BASA 1W04A 4Y33A 4CRQA 2AC1A 2LXBA 2WPSA 3PNAA 3WD5A 5AW2B 1CSBA 2DFCA 2JX9A 1MPXA 1P84E 2RS51 1ZZCA 2W47A 3JUUA 3O6QB 2A3XA 4L8QA 2RH0A 5LBBA 4TWTA 3U37A 2Y64A 3MTUE 1NOVA 4E9KA 1MV8A 1R8EA 2RN0A 4RSUA 2Q5UA 2PTMA 3EJKA 3VMZA 1RJ8A 3N7NA 4JHTA 3CX5H 1EZVI 5A1AA 2NPSA 1NTZD 2HWB3 2PAMA 2FCUA 3WNKA 1DQ5A 3OEBA 1LKNA 3K5BA 5FYHA 3SLIA 5FKCA 1W0PA 3GCWA 1UY0A 5A1LA 5IK7A 1X0TA 4PF5A 2Y34A 3GF6A 4QAWA 2WWSA 1F31A 3OGVA 1U57A 2CGNA 2XBO3 5FUNA 1RITA 3TGUJ 2H6BA 3BOWA 4ATFA 1I6XA 4S2GA 2TNFA 3EHKA 4XYXA 3RL0C 1W99A 3OAKA 3AVRA 5LRSA 2GA1A 4H13C 4XC9A 1M1JC 3OY8B 1FAVA 2I2SA 2PHFA 3UESA 4B1MA 5KAFH 2Q3EA 1DLLA 2ZAAA 1K05A 2XWBB 3PRJA 5ABJB 1QXPA 5A6ZA 1PIV1 5B66H 3LQCA 4JGYC 4H13D 4IDZA 1HQNA 1OC1A 4TLFA 4UB8H 2C4XA 2OZ6A 4IXLA 4NAMA 5JUVA 2CAVA 3H1MA 2AACA 4HZFA 1OX3A 1RHI1 2Q8CA 1RUF2 4UF0A 3ZSJA 2YUEA 5IT6A 4FPHA 2Q8OA 5KHGA 4UWDA 1NXD1 1PX4A 2Z42A 1RUI3 4FPFA 4TXWA 3CJIA 4Q4V3 1DYKA 3T3YA 3PLQA 4IW3A 1HW5A 3PHMA 1W90A 2JDPA 3UV9A 5KJ7D 5B4NA 1AA0A 1WT6A 4WBAA 3BN6A 5FY5A 3WCRA 1OQ1A 4AHWA 1W9WA 3D5OA 1GZCA 3H1JG 1WMEA 2GC3A 4EN8B 1PP9G 3Q5RA 2ZMNA 2KB7P 1YIFA 1OFCX 3I5CA 5IVYA 1BGYJ 1IQDC 5FYUA 2J1AA 3VLBB 3ZIXA 5GZGA 1JYIA 2NPSC 4EYYQ 3C9IA 1K04A 4RR3B 2VZ3A 1CD3G 4CCLA 1SLAA 1ASJ3 4WY4B 1QQP3 1R1A3 2Z69A 2AH2A 1O3SA 4XFIA 5HBAA 4FVVA 4QQPA 5K0UA 4DINB 1MZ6A 5H9PA 3C1LA 3B5NA 3MUDC 4KJMA 1AL21 1S0EA 2RKLA 2WMMA 1G8WA 1RUF3 3AP5A 4CDQB 1IS3A 1UU4A 3IZOA 4S2DA 2OVUA 3WT3A 5KC6A 1BBT1 4QPIB 2VNVA 1QY4A 3H8UA 1RUH3 3E1F1 2XVGA 3OPWA 4JVAA 4NHXA 3BYWA 4QPYA 4R9AA 3TOJA 3ZFFA 1OQEA 1QJEA 3SQOA 1LTEA 3WR0A 3VDDB 2FHRA 2Q30A 3KV5A 5AW5B 5C8CB 3RK2C 3HNMA 4XF0A 2NPSD 4ZZ5A 4PQQA 1FZEA 2CWSA 2A75A 1S9KE 2VW2A 4PI0A 2PHTA 4PF1A 4BQ5A 1L4AA 2QQVA 2WC2A 1EPZA 1MVEA 1GQGA 1K5JA 4XFGA 1EXIA 1HB1A 4H55A 5FZIA 1RHI2 3J7NA 2AGSA 1M4WA 2BFUS 2UURA 4UBGA 3VDDA 2VTFA 3O1TA 4D6TG 2ZMKA 3MZHA 3WMM0 1C28A 3AP9A 3I49A 5KAIE 5G05L 2WO1A 4NHKA 1JYCA 2HWC1 3I59A 4MLOA 4A4AA 2QQWA 4ITCA 4AVSA 1SCRA 3LA7A 4I3PA 1V9U3 1R1ZA 3ZFEA 4BMEA 5IFTA 5AW6B 3BIWE 3S7IA 3D8CA 2P17A 2RJLA 3DKQA 1STMA 1S0DA 2OT7A 2HBTA 2P3IA 1T3UA 2XG3A 4L76A 3O5SA 4LGDE 1FMD1 1GOHA 2VMIA 2ZHLA 3KCYA 1UY1A 2R6QA 2YU1A 4NPDA 3Q5PA 2WNVC 1LODA 4IEXA 3MLLA 2ADDA 4XVHA 1XTGB 4L97A 2R49A 5FAXA 4J6GA 3S5QA 1R5SA 4YLZA 5K0UC 2IZ1A 3ATGA 1VB2A 1NTZE 3GZAA 1JXNA 3PUHA 3WZ1A 2WZR3 1RUE1 3M4FA 5GTIH 1YIJP 4H0LC 5CVRA 5C8CC 3IAQA 4CP0A 1REEA 1RIRA 2ZHKA 3HMYA 5KLVD 1RF1C 1K5MA 3D4KA 1UU5A 2CPSA 3H25A 1TVGA 3KV4A 5F3IA 5FMBA 3KHCA 4DZGA 2C5DA 3AXEA 5IVVA 4XMIA 5CBLA 3TYJA 3URFA 4W50A 1GP6A 2VZVA 3ZOIA 2KLVA 4AI1A 1NGMB 1U5ZA 4ZZ8A 4N7IA 4HVRA 1AR83 4QD2A 3TWIA 1VBA2 2WWJA 1QJY2 3CDZB 5CFDC 3ZSKA 1S2BA 3MUZ1 1NTMJ 1VBC3 3G9RA 1CN1A 1JTZX 3CWBE 1JCDA 1XNBA 2WO3A 4BQ4A 2PAEA 2P58A 1RXFA 4LE3A 1Z0HA 2P6HA 1NU1G 3IR9A 3U1AA 2Y6HA 3VDDC 1L4AD 3OEAA 2WYSA 4YFWA 3VZLA 3Q8AA 1SQXK 2PQSA 4P02B 2XGXA 1XE7A 5L8RJ 4XFJA 1HDKA 2N1TB 3O1MA 1MZFA 4IV3B 3WLUA 1X82A 4MO3M 2GALA 1W8HA 3U78A 2QJKB 2BCCG 4JQRA 5ISLA 4YW4A 2QG4A 4TYSA 1M1KQ 1POV1 2V5YA 3MPBA 2WSUA 4IUGA 1EY2A 1H4GA 2XZRA 2MPFA 4QB1A 5A7PA 5CA6A 1NZIA 1GL2B 4XPVA 1U5YA 5IAXA 3MHZA 1W6QA 2ZMLA 4XBNA 3B69A 4Q1RA 3POIA 1YJNP 1VAKA 3AZZA 2YG0A 4H7MA 2QQIA 4META 3TNUA 1RTVA 1V6NA 2V4AA 1URQA 4WZCA 4U36A 1OA4A 2H89C 4AG4A 1IOAA 3RZKA 2R0HA 4URAA 1RUJ3 1PM4A 4LULA 3ZYPA 4X6RB 2P34A 2YIUC 3HUSB 3L75J 4Y28J 1APNA 1HXS2 2EF6A 2F6BA 2MHFA 3EXUA 3U1XA 4K1YA 2JIJA 3CZJA 5FYSA 2RVAA 2VZSA 2GUSA 2HODA 1W6QB 5EXOA 5FXXA 3GM8A 3POSA 4XHBA 2WS91 1YC61 2WZPP 1Z56A 2C9LY 2YGMA 1RUH1 1PMIA 3TNPB 1SVFA 3USUB 4ZU4A 3KHUA 5FZEA 4P9JA 4DCKA 4DXRA 2W46A 1LU2A 3I2HA 3OGJA 4UW3A 1B35A 4LKDA 1RUI2 4HKOA 4UAPA 5CCGD 3UL2A 2BGOA 3WDXA 1VBA1 2ZX2A 3KSCA 2EXIA 2V7QJ 3VMAA 1ZBA1 3H8OA 4E4DX 2XKPA 1N1SA 2ORXA 3ZFEC 3G71P 3G3ZA 1KITA 1NXMA 1NY72 4WM7A 2JDYA 1SQBD 4YVWA 1FOSF 3ELNA 4YFZA 2EIGA 2RDNA 3AX4A 4OVNF 2OYIA 3UKNA 2KXPB 1W6PB 4M4PA 4OVEA 4DNYA 3NMDA 2J58A 4Z2WA 1SQQJ 1YTZI 1W06A 3KVAA 1SQBE 3MIBA 2VOWA 3AZXA 1JMBA 1OIPA 4GQ7A 4NRMA 1Q56A 4YG6A 5FY7A 3BCCD 3QBQA 2GZWA 4QX1A 1DQ4A 4R9BA 3DXTA 5T54A 3WU2E 2WUHA 5LWBA 4BK5A 1NTMD 3ZKYA 4K35A 1X9TA 2KS1A 2QJYB 1CZQA 1N73C 2G8YA 1IS5A 1K5MB 1R082 2G1MA 5GLTA 5F9TA 1AL0G 1GW4A 1SQQK 3GG2A 4Q4Y1 4RO0A 2N1TC 1UWWA 1GDTA 1SLBA 2CTVA 2XU6A 2HWD3 3IPVA 4R9CA 1SP4A 5CU1A 3VKLA 1M7LA 4N53A 1KB9H 4YGEA 1XXNA
chains in the Genus database with same CATH topology
4EWEA 5FOJB 5EZWA 5CADA 4I30A 1LOFA 3H3ZA 2R32A 3TNQA 3DKWA 1RINA 2G9FA 4JTNA 3B7MA 5JI7A 4GKXA 4ORFA 4BE3A 1XQNA 2PELA 2KA3A 2YC0A 3M3QA 4C1XA 3APBA 5BV6A 1FMD3 1X33A 1LENA 5CAZA 3ZXGA 4FBFA 4EN9B 4KL1A 2ZABA 3G7DA 3THTA 4IL7A 1MZEA 4LBLA 5F6LB 1RUD1 2Y0OA 4AFCA 3NW4A 2VOVA 1QDOA 4OHZA 2ET7A 4Y4YA 2WFF2 1AUYA 2V7QH 1DGWA 4LR4A 3OCPA 1BKZA 3J26N 3ZIWA 5JMCA 3H7YA 1ZRCA 1BEV2 4R4XA 1IGOA 4AVCA 5BNPC 4PBOA 4HVOA 1XU2A 4KG8A 4DOUA 2OZJA 1A3KA 3OTFA 1ZVFA 3M3IA 4MUVA 4DMIA 4XFAA 5DUWA 3ZN5A 1DQ2A 2XJQA 1IKPA 1Q8VA 4KU8A 2DTWA 2ETEA 1AYM1 5JI9A 1A8MA 4FOQA 2LTNA 1HV1A 4QPIC 2NMNA 1O4ZA 4I02A 4Y22B 4EN0A 1ZM1A 1YFUA 1PNGA 4CDQC 5K9YA 5GZEA 1J1LA 2E7QA 4K8FA 1AR73 1DF0A 2B5HA 3U4XA 2WSSH 3KD4A 4GA9A 3N4MA 1VLNA 1BBT2 1YFXA 4M0HA 4MYEA 1Z7S3 5KXEA 5ABJA 4TZDA 4DB5A 1QXJA 2JE7A 4LO4B 1Y43B 1FOD2 1AQTA 4F8AA 1Q8OA 1OA3A 3VHRA 2VH9A 3I2DA 4GKYA 4N9IA 1K5MC 2HWB1 4PDWC 2UY9A 5A33A 1KDKA 2Z5WA 1F9KA 1UF2C 2D93A 2DVFA 4LO5B 4YVSA 1C5IA 5C4WA 5CFDA 4C0HA 1A78A 5HCAA 4AQSA 4HVQA 4Q1PA 2JG9C 4JGZB 3WDYA 4HKLA 1ZZBA 5JLVA 1JEKA 1WLDA 3VKMA 1SLTA 1XNCA 4Q0QA 2AENA 4H7LA 1VAVA 2HYKA 2BWAA 4GMP1 4GB31 4P9LA 5ACA2 2VNGA 1HRV1 2W08A 2VOXA 2BNOA 3HT1A 1PGW2 2BWCA 2PAKA 2FQPA 2QZ3A 2Y38A 1C3HA 3M1HA 3RQ0A 4CDXB 5FFOC 3MF6A 4P5HA 1W6PA 3JD72 4FPEA 1COV1 1PVC2 1H1IA 2YMZA 3VZNA 1SCSA 1SLCA 1HX6A 2JEMA 2K9ZA 2R041 2XJUA 4RQPA 1QQP2 3BPZA 1PO13 1PZ9A 4HT1T 5C8WA 1DYPA 2WKKA 3DPRB 3ZN6B 2XJVA 3AMHA 4XXPA 4KQ7A 4KWJA 3SCGA 1PGSA 5KHHA 1PM7A 1B09A 5JOYA 1HV0A 4COZA 5JZGC 3FX3A 2ZGRA 1CX4A 2AR6A 2EAKA 3AJYA 4N43C 4RS5C 2X29A 1FNYA 4XBQA 4Y1UA 1OLRA 3J8F3 1O91A 3ZXAC 2DFBA 4NWVA 5SV8A 4E4ZA 2NZ9A 4GWNA 2O8OA 5GLZA 1IHMA 3AP7A 3WP4A