3KPEA

Solution structure of the respiratory syncytial virus (rsv)six-helix bundle complexed with tmc353121, a small-moleucule inhibitor of rsv
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
HLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, fusion protein
molecule keywords Fusion glycoprotein F0
publication title Binding of a potent small-molecule inhibitor of six-helix bundle formation requires interactions with both heptad-repeats of the RSV fusion protein.
pubmed doi rcsb
total genus 22
structure length 49
sequence length 49
ec nomenclature
pdb deposition date 2009-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3kpeA00
1ZV8A 3SWYA 1G2CA 3KPEA 3EFGA 4N6JA 1SVFA 2FYZA 4EIJA
chains in the Genus database with same CATH superfamily
1BGYD 1YTZI 1NU1K 3HUSB 4DCKA 1IO4A 5AW0B 4EYYQ 3CCUP 3F5HA 1S5LE 3RK2C 3AEEC 1IFNA 1EZVG 1RF0C 5AVQB 3AE2C 1FZEA 3SFEC 2YKQA 3Q3DA 2WZ7A 1PGJA 2H43A 2L5GB 1GW3A 3H25A 3IF4A 2ZT9B 5CCGC 1JY3N 1LTGC 1ZR4A 3S4RA 2A45G 2RKLA 3HD7C 3P8MC 2OQQA 1PP9D 1GW4A 4OGQD 1LJ2A 2W83C 3AEAC 2FFDC 5AVTB 1GU4A 1BSHA 2E43A 3L74E 3H1JD 2Y9ZA 3AE1C 2IPPA 1NAFA 1VL2A 1LT9A 4WBAA 1QVGO 1FZAA 4AYCA 2OTLP 3E7KA 2BCCE 3GLMA 4I7ZB 3AE9C 3L4FA 1MUUA 1M57D 3H1HE 4U3FG 1SQBG 3G3ZA 2Z4EA 1L0LE 1SFCA 3CPWO 5DJTB 2OYHB 2IBZD 1T6AA 2ZYDA 3HUSA 1LWUC 1OZHA 1JY2O 2XDJA 2V7QH 3BCCE 1IFJA 2B9BA 1NTZK 2QVAA 1LTSC 1L0NE 4JQ0D 3CCRP 2IFMA 5AW1B 2QSIA 5KJ7C 2FXOA 2KLVA 3PJSK 1IFIA 4GDOA 3NTNA 1ZRTD 1OVUA 5CCHC 1KYOH 3CC7P 1EXIA 2HYNA 1YI2P 1SFCD 4U3FJ 3WUVA 1SQBJ 1FJKA 2Q5UA 3L35A 2RN0A 2WTYA 1YJWP 2ZXEB 2HODB 2A45I 2CPSA 2D2CB 2V4HA 5AVSB 1JY2N 1NU1E 2LXBA 1YITP 4YPCA 1CI6B 2JJLA 4L75A 3L75D 1OW6A 3HE4B 3H6PA 2FY8A 2WPVB 3N7NA 1H89A 1PPJG 1SQQK 2JEEA 1S9KD 2ZT9D 3O6QB 1KYOE 3S1KA 1URQB 3MP7B 5CJ0A 2WSSH 1FDOA 3RBXA 4U7JA 1JTHB 3CCLP 1M56D 2ZXXA 2OYHA 2E5YA 2E74C 1KV4A 4ZKUA 4IL6E 2KLUA 2WSCJ 1HBWA 1OVVA 1OX3A 5K5GB 1LTTC 1NTKG 1BE3J 3TGUJ 3L71E 1ZXGA 4LLHA 2O01J 3AEBC 3H1LG 4JBZA 1X22A 1JEKA 1HTLC 3WUTA 1DIPA 2W6BA 3GF7A 2B87B 1JCCA 1KILB 3ABVC 2N9BA 3MUDC 3RGUA 1USDA 4H13C 1SQPD 1DD3A 4C46A 3G9RA 1NHLA 3CWBD 1GL2C 1G1JA 1GMJA 1VF5B 2N1TC 2HODA 1P84D 1NTKJ 4IOIH 5KLIB 1CI6A 1W2EA 3E1IA 3B8EB 3H1LJ 3CXHD 1EZVD 3HE4A 1NTZE 3L70G 2OYIC 3A5TA 5APYA 1BGYE 1GZLA 3CX5D 3O6QA 2L91A 1URQA 3MHVA 3AEGC 1JTHA 2P1JA 4WB4A 3W67A 2D2CD 1HVVA 3VMYA 5KAIH 1MKMA 3WU2H 1VQ4P 1JMBA 1PP9E 1DX7A 3H32B 2B87A 3L70J 3RK2B 1KILA 1URQD 2FYUD 5CJ4A 5AW8B 3K5BA 1SQBD 1NTMJ 2HLOA 2E76C 3SWKA 1KTMA 3H1JE 5H2FH 1USEA 4EI2A 3EFGA 3AE5C 3GG2A 1YYCA 5E79H 2KB7P 1SQXG 1G2CB 2I1JA 2OTJP 5KAIE 2PFXA 5M1BA 3HD7B 2K3RA 3WU2E 5AW7B 3KQGA 1YJNP 4HKZH 1QL1A 2WQYC 1FOSF 3LIDA 2FFDB 4RESB 1ZW0A 2QEXP 1X0TA 1UIIA 1PZQA 4JPZB 1KILD 4D6TJ 1U7MA 2IZ0A 2XV5A 3GMAA 5H2FE 2KIKA 5AVWB 3SFDC 3V2QA 4KJMA 1VF5D 1S72P 3BVHA 2Q6QA 1R5SA 5E79E 1BCCG 3L72D 2JR8A 1YQ4C 3VMZA 1M90Q 2Q1KA 1RE4C 2QE7H 3PHLA 1SQXJ 1CZQA 1ZRTE 1LP1B 2R5BA 1N2DC 2Q7CA 1AJYA 3L73D 5AW4B 3H1KD 1PPJD 2WVRA 1VQ7P 3H32A 1Q81Q 2FBWC 2W27A 2JO1A 3NXSA 2H7HA 1RF0A 1EQ7A 1JY3P 4Z1MH 1KFNA 3CC4P 3L75E 1M1KQ 1IZNB 2CK3H 3BRVB 2KOGA 5CCGA 2G8YA 1G2CA 1SQBK 2POHA 1JOCA 1HGZA 3HD7A 1S9KE 3H1LD 3M06A 2WWWA 1RY3A 4WY4C 2FXMA 4ASWA 2FFDA 2IDBA 3OA7A 4AQRD 4I2LC 4HJGH 5KLVJ 3RK2D 2QIWA 2AEJA 2H88C 3P32A 2YO3A 1L4AC 1P84H 4XE5B 2J59M 3LW5H 1H88A 2K37A 5TISH 3E1RA 5CCGD 3CXHH 1T3JA 3HD7D 1SLQA 2JP3A 4C7RA 3CX5H 1ZP0C 2E74B 3RK3C 1LP1A 1LWUA 1SQVD 1IC2A 1SQPE 1QL2A 1JO5A 2MKVA 3L70D 5AW5B 1MFTA 5BU8B 3CWBE 4WVZA 1NKNA 1M7LA 2J58A 1YHQP 3MTUE 1XTGB 5KJ7A 1FBMA 4IFDK 5TISE 1W5CE 4Y99C 3CXHE 1EZVE 5CCHA 1TU3F 3H1IJ 3L36A 5AW3B 4K35A 4H13B 1M8OB 1NGMB 3CX5E 2R32A 1GL2B 1EC5A 2N1TB 1YQ3C 3V2RA 1S2EA 3C9IA 1T8ZA 1NTKK 3CI9A 3M9HA 1ZOYC 1H8AA 4IL6X 1NVOA 5KJ7D 1X9VA 3Q1MA 3HE5B 2OYIB 1SQQD 5BU5A 5CCHD 4HB1A 4DOJA 2CPBA 2ZVNB 3V4QA 2I1KA 3V4WA 2OGUA 1NJIQ 1GD2E 3OAKA 1KQGB 3G4SP 2FYUE 2Q3IA 4PD4I 1Y8AA 3I56P 1VPCA 1SQBE 1T3UA 1R8EA 1Z56A 1Q86Q 2JWAA 2XNXA 2WSFH 4TT3H 2G3AA 2W90A 1QEXA 2O3JA 2BCCG 2BASA 2ZYGA 1SQVK 3AE3C 2GUSA 2P2UA 2QJKC 4W7ZA 5B66H 1L0LG 3PH0A 1BCCD 4AUWA 3MUDA 2FYZA 2E76B 1FC2C 3I5CA 1KILE 2QJYC 4OVNF 3EWKA 2E74D 1GL2A 2N1TA 5KAFH 3GF3A 5APQA 1PFIA 2WSEH 3L74J 4BRYB 1L0NG 3L72E 1BE3G 3TGUG 1QGKB 1ZV8A 3HE5A 2OYIA 2BCCJ 3KHUA 3TK1A 1N73C 3OJAB 3AE7C 1RF1C 3USSA 5B66E 1VQOP 3HRNA 3R2PA 3H1HJ 3L73E 4H13D 3H1KE 1PPJE 1L0LJ 1GL2D 2N1TD 5KAFE 2O1JA 3JC22 5APSA 1SQXK 3BCCJ 4GKGA 2AEFA 1FDMA 1L0NJ 3G71P 1KQLA 3WMM0 1RQVA 2IX7C 1IJDB 1FS0E 1JB0J 3MZWB 3Q5SA 1Q2NA 3A0BH 4DZOA 1K73Q 3O8ZA 3M9BA 3L71G 4A7PA 3KYQA 1N7SC 2XNDH 2WPRA 3M91A 1BSNA 2V7QJ 1PL5A 3TSIA 1S4XA 1NU1J 4BRYA 2KZIA 4UB8H 2C9LY 4DT0A 3AEDC 4WY4B 3TDKA 2YO2A 2AEMA 4B86A 4PJ0H 1SQVE 1Y9BA 1L4AB 2E76D 3OW2O 3L70E 1RE3C 3Q5RA 1HF9A 5CMZA 1Q7YQ 1IK9A 3A2AA 1NTMG 1SP4A 1VQKP 3L71J 3AEFC 2GA1A 1RE4A 1J1DC 2Z5IA 3RK3B 3I55P 2FKWB 4C7NB 1VDFA 2KP8A 1MZ9A 2J5UA 4PJ0E 3TF5A 1KB9D 2XU6A 1IFDA 4KT0J 4YXDC 1J1EC 3CCQP 4D6TG 1KYOI 3CCEP 1OVRA 1NYHA 1LTIC 5APWA 1J2JB 2M5AB 4Y99B 1SQQE 2ZFCA 4U3FD 2JWDA 2PGDA 3MD0A 2AXCA 1GK4A 1FZCC 3B4SA 1PGOA 2N9YB 3B5NC 1JNMA 1QX8A 2QM8A 4WY4A 4YTPC 3IAOA 4BXLA 2W6AA 1NTZJ 3CL3D 2NRGA 1BGYJ 3GHGC 2QG4A 4R4MA 1D7MA 1EDIA 1OIPA 2LXCB 2B89A 3P8CD 3H1JG 1L4AA 3FXEA 1VQ9P 4JYBA 4OH8B 3RBZA 1LTJC 2HG5D 5BVZA 2Y0CA 1R5LA 3CCMP 1EDKA 2IBZE 1YIJP 2R3CA 2R3SA 2SPZA 1ZLLA 1N8RQ 4DJGA 2ZVOB 1T2KC 3VMAA 1IFMA 4WY4D 1S5LX 2K1AA 2M3EA 1VQ5P 1BCCE 2PP6A 2WITA 1BE3D 3TGUD 2LR2A 2NPSC 4C7NA 5CBOA 2NZ2A 3U59A 1PP9J 1YJ9P 3FWLA 3PP5A 4N6JA 1KQFB 1L4AD 1M1JC 3NMDA 2IFNA 2KSEA 2KS1B 5KLVG 4L76A 3H1JJ 2MJZA 3QWOC 2ITAA 2E5TA 1N7LA 1RH5B 2KUBA 3M0DC 2QJKB 2M5AA 3CCSP 4UB6H 3KPEA 4GODA 3S9OA 2KXPB 2YMKA 1OWAA 1OXZA 2QM7A 2QJYB 5AVYB 1NAYA 3RK3D 3A7OA 1NOHA 1K8AQ 1NTKD 1S3JA 1EDJA 1OFCX 4GOEA 3AECC 2YIUC 1ZR2A 1NKZB 3A0HH 3PLNA 1HH0A 4NPEA 3M0AA 1X8YA 1E5WA 2C0XA 3L75G 1W2BO 1N73B 1SS1A 4QMAA 4KHXA 1MV8A 1RF1B 2I8DA 3BRTB 4UB6E 3EFFK 3L71D 4PV1C 1AV1A 3FX0A 2QJPC 2QRXA 2R5DA 4JF7A 1GTWA 1PGPA 3H1IG 3R4YA 3A0HE 1XTCC 2HR3A 2Z5HA 2KS1A 3FGAD 2IBZI 1K04A 2R44A 1HJBA 3CLQA 2E75C 2YKPA 2A45H 3KXDA 3WUUA 3CMEP 3L75J 1NTMD 1P84E 3SWFA 1JY3O 4H44C 1AVYA 1KB9H 2A06G 3AE4C 4W80A 1Q82Q 1SQPG 1Q90D 1N7SB 1K9MQ 5KKZC 3HTKB 3VMXA 3CWBG 3AE6C 1KORA 3FXDA 3D6ZA 1JY2P 2KI7B 1FAVA 2RH0A 1BDDA 4D6TD 3MGNA 1JM0A 1N73A 2W6JH 3M9QA 1RF1A 2Y9YA 4GIFA 1KMIZ 3NFQA 2YXRB 3JCUH 1NH4A 2C9NY 2M0BA 2GUVA 1KB9E 3D71A 1NWQA 3RL0C 4EOTA 1WMKA 4N3YB 2Q3EA 3L37A 4H0LC 2IZ1A 1SQPJ 1OW7A 1SQXD 1VQPP 4N78D 1BDCA 2XKMA 3CWBJ 1J1DB 2HPCB 1EDLA 2BEZF 1EXJA 3T97B 4U3FE 1WRGA 1HJ0A 3LW5J 3V6IA 3L74G 4BWNA 1VQ6P 2UWJE 3PTZA 3SWYA 1A02J 2WMMA 3VYIA 2WSCH 3II6A 3JCUE 1YTZT 2O01H 1CSBA 5APUA 2FYUG 1J1EB 2ZYAA 3P8CE 3H1HG 1FJPA 5AVZB 1N7SA 5L8RJ 1NTMK 3V2PA 3HTKA 2PAJA 3P7KA 3PRJA 4HYTB 3TNUB 1KQSO 1FZCB 1VQ8P 3B5NB 1VQNP 3BATA 1GK6A 3B71A 3BCCG 5KLVD 3Q5PA 1AQTA 1P84I 4OGQC 4LGDE 3CD6P 3IN6A 3GHGB 2HFED 1BE3E 3TGUE 3W68A 3VOPA 4YXWH 3U1AA 4M3LA 2P10A 1RE3A 1LTJB 3VP8A 3CXHI 1EZVI 3UIAA 1ZN5A 4LC1A 2VRSA 2FYUJ 1N7SD 1U7JA 3CX5I 1A02F 1JUNA 3L72G 2ZJSE 4OWFA 4IL6H 2H8PD 2HPCA 2FYNC 2W8ZA 2WPQA 2KYVA 4L74A 3KZIH 3T97A 2NPSB 5KTBA 1LTBC 1NU1G 2OYOA 2K9YA 2O01N 3RK3E 1JCDA 3L73G 1M1JB 5CBNA 1KB9I 3H1KG 1NTKE 1IFPA 1KD1Q 1DD4A 1VQMP 1LT9C 3H1LE 5CHXA 4Y28J 4NPFX 5APVA 3H1ID 1UIXA 4PD4D 1KFMA 3TNUA 2WSFJ 1FZCA 2Q9IA 3B5NA 3KZIE 3L72J 3QH9A 4EDFA 1FOSE 1DEBA 1SFCC 3LIEA 3C1LA 1S1CX 3HUSC 3GHGA 2YIUB 4GOFA 3VTPC 4IFMA 1NO4A 2YKOA 1ZMEC 3U1CA 4I1LA 3L73J 3H1KJ 1LTJA 5KLVK 3V5BA 1FZFA 1L2PA 2A06D 1LT1A 4PV1B 5AW9B 1RQUA 4NPDA 3A0BE 2WT7B 2QJPB 2WSEJ 5GTHH 3B5ND 2OARA 2ZT9C 1NTME 1HUCA 1FE6A 4I6MC 2NPSA 1GU5A 1SQVG 4CPGA 4UB8E 3CC2P 1M1JA 1U57A 1NTZG 2Y0EA 5EFWB 1AVOA 1BGYG 2P67A 2E75B 4MN4C 2P7JA 3M0DA 4JYCA 2RMZA 3JSVC 5B5EH 2KNCB 3MIWA 2IYOA 4I7ZC 4ASVA 2YNYA 4WWIA 4D6TE 4XFJA 5GTHE 1T2KD 4EIJA 4H44B 4RKUJ 2PRRA 3A3YB 3IR9A 2NPSD 5KKZB 4HH2A 2KSJA 4R4LA 3L74D 3V2NA 2KK7A 2OYHC 4GT1A 1FZBA 5AVRB 1SQVJ 1JMMA 3RL0g 1PP9G 1SQXE 3EQ2A 2BCCD 4N78E 3CCVP 2GM4A 1AQ5A 3ITKA 5B5EE 1G1IA 1SQQG 3H1HD 1H0TB 1FZGA 4RO0A 1L0LD 2K9JB 2WT7A 3BASA 4L73A 1YBKA 1OW8A 1IK7A 2B88A 3D6YA 3RL0B 3IFMA 4O9BA 1SQPK 4H0LB 3BCCD 3N4XA 5APXA 1CW5A 3F89A 1KC8Q 1KZUB 1L0ND 2D2CC 2P58A 1LNQA 1GDTA 1VQLP 5APTA 2IBZG 5AVUB 2WPSA 4PV1D 5DJUB 3FWNA 2KNCA 5KLVE 2AXTH 1SQQJ 4IFFA 4ZNCA 1RHZB 2K88A 1URQC 2BEQD 3D70A 4TLFA 2E42A 4ZKPA 1NU1D 4ZMDA 1N86A 1LWUB 2Y0DA 1AA0A 1E79H 1SVFA 3G6EP 4PD4H 5AVXB 2E75D 2M8RA 4OGQB 1AFOA 2KZJA 1HWTC 1KYOD 1Y47A 1MFZA 1H0TA 4K3AA 1FDIA 2AXTE 2OTKE 2K9JA 3GW6A 4H44D 1KILC 2YMYA 3TYYA 2FYUK 1WT6A 3C8VA 1LGHB 1DEEG 2C0WA 1BCCJ 1X79B 1KN7A 1L0LK 2XZRA 5GTIH 2LKMA 1PGQA 1VF5C 3AE8C 1LTAC 2FYNB 3H1IE 1QLED 1HGVA 4XA4A 4PD4E 2YXQB 4RJTA 1PV3A 3VP9A 2H89C 5KLIC 1OMIA 5C39A 2JDIH 3CCJP 1L0NK 1QVFO 5AVVB 3VN0A 5AW2B 1K05A 1LT9B 3RL0D 2DW3A 1S5LH 2O1KA 2M3BA 3Q2YA 4H0LD 4W7YA 3ZDMA 2FXPA 2ZAEB 5GTIE 1FU1A 1PIXA 5TJHA 1DH3A 2A06E 2IYPA 3CMAP 3SSUA 2QA4P 1NTZD 1SFCB 2JKVA 5AW6B 3KDPB
chains in the Genus database with same CATH topology
5CMZA 1YTZI 3VMZA 3VOPA 1NU1K 1IK9A 3U1AA 4M3LA 3A2AA 3HUSB 1RE3A 1RE4C 1LTJB 1SP4A 3VP8A 1IO4A 1CZQA 3UIAA 1ZN5A 4LC1A 2VRSA 1N7SD 5AW0B 1RE4A 2R5BA 1N2DC 3RK2C 1J1DC 2Q7CA 1A02F 1IFNA 2Z5IA 5AW4B 1RF0C 3RK3B 1JUNA 5AVQB 2FKWB 3H32A 1FZEA 4C7NB 2W27A 1VDFA 2H8PD 2HPCA 2KP8A 3NXSA 1MZ9A 2H7HA 1RF0A 2WPQA 2YKQA 2KYVA 2WZ7A 2H43A 3T97A 2L5GB 1GW3A 1EQ7A 2NPSB 1JY3P 5KTBA 2XU6A 1LTBC 5CCGC 1JY3N 1LTGC 1KFNA 1ZR4A 1IFDA 1JCDA 2A45G 3HD7C 1J1EC 3P8MC 1GW4A 1M1JB 3BRVB 2KOGA 5CCGA 1G2CA 1LTIC 5APWA 1SQBK 2POHA 1J2JB 1JOCA 4Y99B 2FFDC 1HGZA 3HD7A 5AVTB 1S9KE 1GU4A 1LT9C 3M06A 2WWWA 5CHXA 2ZFCA 2E43A 5APVA 1RY3A 3MD0A 4WY4C 2FXMA 2FFDA 1GK4A 1FZCC 2IPPA 1NAFA 1LT9A 3OA7A 4AQRD 4WBAA 3B5NC 1JNMA 1FZAA 4I2LC 4AYCA 1KFMA 3TNUA 3RK2D 4WY4A 2QM8A 1FZCA 2Q9IA 3P32A 2YO3A 2W6AA 3CL3D 3B5NA 1L4AC 3L4FA 1MUUA 4XE5B 1FOSE 2J59M 3GHGC 1DEBA 3LW5H 1SFCC 3LIEA 3P8CD 1H88A 1L4AA 4JYBA 3G3ZA 2Z4EA 4OH8B 3HUSC 3GHGA 5CCGD 3VTPC 1LTJC 1SFCA 2HG5D 4IFMA 1NO4A 2YKOA 5BVZA 2OYHB 1T3JA 3HD7D 1SLQA 3U1CA 3HUSA 4I1LA 1LWUC 1LTJA 4C7RA 1JY2O 2R3CA 5KLVK 3V5BA 1FZFA 2XDJA 1IFJA 1ZLLA 3RK3C 1NTZK 1LTSC 1LWUA 5AW9B 1T2KC 1IC2A 1IFMA 1QL2A 1JO5A 4WY4D 2WT7B 5AW5B 2PP6A 2WITA 2IFMA 5BU8B 5AW1B 1NKNA 1M7LA 5KJ7C 3B5ND 2J58A 2NPSC 2OARA 4C7NA 2KLVA 3U59A 1IFIA 3MTUE 1HUCA 1XTGB 3PP5A 4I6MC 3NTNA 4N6JA 5KJ7A 1FBMA 2NPSA 1L4AD 5CCHC 1M1JC 4IFDK 3NMDA 1GU5A 2IFNA 2HYNA 1SFCD 4Y99C 5CCHA 1M1JA 2MJZA 1FJKA 2Q5UA 3L35A 1N7LA 3L36A 3M0DC 5AW3B 2WTYA 2ZXEB 2HODB 2P67A 2A45I 2CPSA 2R32A 3KPEA 1GL2B 5AVSB 2P7JA 1OWAA 1OXZA 2N1TB 1JY2N 3M0DA 4JYCA 2QM7A 3V2RA 5AVYB 3MIWA 3C9IA 1CI6B 3A7OA 1T8ZA 3RK3D 2JJLA 1NTKK 3CI9A 1NOHA 3M9HA 2YNYA 1H8AA 1T2KD 3HE4B 3H6PA 3N7NA 4EIJA 1H89A 1SQQK 2JEEA 3A3YB 5KJ7D 3IR9A 1X9VA 2NPSD 1S9KD 3HE5B 1ZR2A 4HH2A 1NKZB 2KSJA 2OYIB 1URQB 3V2NA 5CJ0A 5BU5A 2OYHC 1HH0A 4GT1A 1FZBA 5CCHD 3M0AA 1X8YA 1E5WA 2C0XA 4DOJA 1JTHB 5AVRB 2CPBA 1N73B 2OYHA 4KHXA 3V4QA 2I1KA 1MV8A 1JMMA 1RF1B 4ZKUA 3EQ2A 3V4WA 3BRTB 1HBWA 1GD2E 3OAKA 4N78E 1LTTC 2Q3IA 4LLHA 2GM4A 1AQ5A 1VPCA 1G1IA 2R5DA 4JF7A 1GTWA 1T3UA 1FZGA 1Z56A 2WT7A 3BASA 2XNXA 2WSFH 1HTLC 3RL0B 2W6BA 2BASA 3IFMA 4O9BA 1SQVK 1JCCA 1KILB 1SQPK 1XTCC 2GUSA 2N9BA 3N4XA 2P2UA 2Z5HA 5APXA 1CW5A 4C46A 4W7ZA 1KZUB 3CLQA 1NHLA 1HJBA 2YKPA 4AUWA 2A45H 3MUDA 1GL2C 2FYZA 1G1JA 1GDTA 2N1TC 3I5CA 5APTA 2HODA 5AVUB 2WPSA 3SWFA 1GL2A 1JY3O 2N1TA 5APQA 1PFIA 1CI6A 1W2EA 3E1IA 2WSEH 3B8EB 4W80A 4IFFA 3HE4A 1N7SB 3HTKB 2OYIC 3VMXA 3A5TA 5APYA 1URQC 1GZLA 1ZV8A 3HE5A 2E42A 2OYIA 4ZKPA 1JY2P 3TK1A 1URQA 1N73C 3OJAB 1N86A 1RF1C 1LWUB 1FAVA 3HRNA 1JTHA 3R2PA 3MGNA 1N73A 1SVFA 2P1JA 4WB4A 3M9QA 5AVXB 1RF1A 1HVVA 4GIFA 1GL2D 3NFQA 2M8RA 1AFOA 2N1TD 3VMYA 1NH4A 2O1JA 1HWTC 2C9NY 2GUVA 1MFZA 1NWQA 5APSA 1SQXK 3RL0C 4EOTA 4N3YB 1KILC 2YMYA 3L37A 2FYUK 3TYYA 1WT6A 4GKGA 1DX7A 3H32B 1LGHB 2C0WA 1FDMA 4N78D 1X79B 3RK2B 2XKMA 1J1DB 1KILA 1KQLA 1URQD 2HPCB 5CJ4A 5AW8B 3WMM0 1L0LK 2XZRA 2HLOA 2IX7C 2LKMA 1IJDB 1WRGA 1LTAC 1HGVA 3SWYA 4XA4A 1A02J 3EFGA 3VYIA 4DZOA 3O8ZA 2WSCH 1YYCA 2KB7P 3II6A 1G2CB 3VP9A 2I1JA 1YTZT 2O01H 3M9BA 1CSBA 3HD7B 5APUA 3KYQA 1J1EB 1N7SC 2WPRA 1L0NK 5AVVB 5AW7B 3KQGA 3M91A 3VN0A 3P8CE 5AW2B 1QL1A 1FOSF 1FJPA 3LIDA 2FFDB 4RESB 3TSIA 5AVZB 1N7SA 1LT9B 1NTMK 3V2PA 3RL0D 2C9LY 3HTKA 2PAJA 3P7KA 2O1KA 2M3BA 4HYTB 3TNUB 4WY4B 1KILD 4W7YA 2YO2A 1FZCB 3B5NB 1FU1A 2XV5A 3BATA 1GK6A 4B86A 1DH3A 5AVWB 3V2QA 1L4AB 4LGDE 3GHGB 1RE3C 3BVHA 2HFED 1SFCB 5AW6B 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZV8 A;  3SWY A;  1G2C A;  3KPE A;  3EFG A;  4N6J A;  1SVF A;  2FYZ A;  4EIJ A; 
#chains in the Genus database with same CATH topology
 1BGY D;  1YTZ I;  1NU1 K;  3HUS B;  4DCK A;  1IO4 A;  5AW0 B;  4EYY Q;  3CCU P;  3F5H A;  1S5L E;  3RK2 C;  3AEE C;  1IFN A;  1EZV G;  1RF0 C;  5AVQ B;  3AE2 C;  1FZE A;  3SFE C;  2YKQ A;  3Q3D A;  2WZ7 A;  1PGJ A;  2H43 A;  2L5G B;  1GW3 A;  3H25 A;  3IF4 A;  2ZT9 B;  5CCG C;  1JY3 N;  1LTG C;  1ZR4 A;  3S4R A;  2A45 G;  2RKL A;  3HD7 C;  3P8M C;  2OQQ A;  1PP9 D;  1GW4 A;  4OGQ D;  1LJ2 A;  2W83 C;  3AEA C;  2FFD C;  5AVT B;  1GU4 A;  1BSH A;  2E43 A;  3L74 E;  3H1J D;  2Y9Z A;  3AE1 C;  2IPP A;  1NAF A;  1VL2 A;  1LT9 A;  4WBA A;  1QVG O;  1FZA A;  4AYC A;  2OTL P;  3E7K A;  2BCC E;  3GLM A;  4I7Z B;  3AE9 C;  3L4F A;  1MUU A;  1M57 D;  3H1H E;  4U3F G;  1SQB G;  3G3Z A;  2Z4E A;  1L0L E;  1SFC A;  3CPW O;  5DJT B;  2OYH B;  2IBZ D;  1T6A A;  2ZYD A;  3HUS A;  1LWU C;  1OZH A;  1JY2 O;  2XDJ A;  2V7Q H;  3BCC E;  1IFJ A;  2B9B A;  1NTZ K;  2QVA A;  1LTS C;  1L0N E;  4JQ0 D;  3CCR P;  2IFM A;  5AW1 B;  2QSI A;  5KJ7 C;  2FXO A;  2KLV A;  3PJS K;  1IFI A;  4GDO A;  3NTN A;  1ZRT D;  1OVU A;  5CCH C;  1KYO H;  3CC7 P;  1EXI A;  2HYN A;  1YI2 P;  1SFC D;  4U3F J;  3WUV A;  1SQB J;  1FJK A;  2Q5U A;  3L35 A;  2RN0 A;  2WTY A;  1YJW P;  2ZXE B;  2HOD B;  2A45 I;  2CPS A;  2D2C B;  2V4H A;  5AVS B;  1JY2 N;  1NU1 E;  2LXB A;  1YIT P;  4YPC A;  1CI6 B;  2JJL A;  4L75 A;  3L75 D;  1OW6 A;  3HE4 B;  3H6P A;  2FY8 A;  2WPV B;  3N7N A;  1H89 A;  1PPJ G;  1SQQ K;  2JEE A;  1S9K D;  2ZT9 D;  3O6Q B;  1KYO E;  3S1K A;  1URQ B;  3MP7 B;  5CJ0 A;  2WSS H;  1FDO A;  3RBX A;  4U7J A;  1JTH B;  3CCL P;  1M56 D;  2ZXX A;  2OYH A;  2E5Y A;  2E74 C;  1KV4 A;  4ZKU A;  4IL6 E;  2KLU A;  2WSC J;  1HBW A;  1OVV A;  1OX3 A;  5K5G B;  1LTT C;  1NTK G;  1BE3 J;  3TGU J;  3L71 E;  1ZXG A;  4LLH A;  2O01 J;  3AEB C;  3H1L G;  4JBZ A;  1X22 A;  1JEK A;  1HTL C;  3WUT A;  1DIP A;  2W6B A;  3GF7 A;  2B87 B;  1JCC A;  1KIL B;  3ABV C;  2N9B A;  3MUD C;  3RGU A;  1USD A;  4H13 C;  1SQP D;  1DD3 A;  4C46 A;  3G9R A;  1NHL A;  3CWB D;  1GL2 C;  1G1J A;  1GMJ A;  1VF5 B;  2N1T C;  2HOD A;  1P84 D;  1NTK J;  4IOI H;  5KLI B;  1CI6 A;  1W2E A;  3E1I A;  3B8E B;  3H1L J;  3CXH D;  1EZV D;  3HE4 A;  1NTZ E;  3L70 G;  2OYI C;  3A5T A;  5APY A;  1BGY E;  1GZL A;  3CX5 D;  3O6Q A;  2L91 A;  1URQ A;  3MHV A;  3AEG C;  1JTH A;  2P1J A;  4WB4 A;  3W67 A;  2D2C D;  1HVV A;  3VMY A;  5KAI H;  1MKM A;  3WU2 H;  1VQ4 P;  1JMB A;  1PP9 E;  1DX7 A;  3H32 B;  2B87 A;  3L70 J;  3RK2 B;  1KIL A;  1URQ D;  2FYU D;  5CJ4 A;  5AW8 B;  3K5B A;  1SQB D;  1NTM J;  2HLO A;  2E76 C;  3SWK A;  1KTM A;  3H1J E;  5H2F H;  1USE A;  4EI2 A;  3EFG A;  3AE5 C;  3GG2 A;  1YYC A;  5E79 H;  2KB7 P;  1SQX G;  1G2C B;  2I1J A;  2OTJ P;  5KAI E;  2PFX A;  5M1B A;  3HD7 B;  2K3R A;  3WU2 E;  5AW7 B;  3KQG A;  1YJN P;  4HKZ H;  1QL1 A;  2WQY C;  1FOS F;  3LID A;  2FFD B;  4RES B;  1ZW0 A;  2QEX P;  1X0T A;  1UII A;  1PZQ A;  4JPZ B;  1KIL D;  4D6T J;  1U7M A;  2IZ0 A;  2XV5 A;  3GMA A;  5H2F E;  2KIK A;  5AVW B;  3SFD C;  3V2Q A;  4KJM A;  1VF5 D;  1S72 P;  3BVH A;  2Q6Q A;  1R5S A;  5E79 E;  1BCC G;  3L72 D;  2JR8 A;  1YQ4 C;  3VMZ A;  1M90 Q;  2Q1K A;  1RE4 C;  2QE7 H;  3PHL A;  1SQX J;  1CZQ A;  1ZRT E;  1LP1 B;  2R5B A;  1N2D C;  2Q7C A;  1AJY A;  3L73 D;  5AW4 B;  3H1K D;  1PPJ D;  2WVR A;  1VQ7 P;  3H32 A;  1Q81 Q;  2FBW C;  2W27 A;  2JO1 A;  3NXS A;  2H7H A;  1RF0 A;  1EQ7 A;  1JY3 P;  4Z1M H;  1KFN A;  3CC4 P;  3L75 E;  1M1K Q;  1IZN B;  2CK3 H;  3BRV B;  2KOG A;  5CCG A;  2G8Y A;  1G2C A;  1SQB K;  2POH A;  1JOC A;  1HGZ A;  3HD7 A;  1S9K E;  3H1L D;  3M06 A;  2WWW A;  1RY3 A;  4WY4 C;  2FXM A;  4ASW A;  2FFD A;  2IDB A;  3OA7 A;  4AQR D;  4I2L C;  4HJG H;  5KLV J;  3RK2 D;  2QIW A;  2AEJ A;  2H88 C;  3P32 A;  2YO3 A;  1L4A C;  1P84 H;  4XE5 B;  2J59 M;  3LW5 H;  1H88 A;  2K37 A;  5TIS H;  3E1R A;  5CCG D;  3CXH H;  1T3J A;  3HD7 D;  1SLQ A;  2JP3 A;  4C7R A;  3CX5 H;  1ZP0 C;  2E74 B;  3RK3 C;  1LP1 A;  1LWU A;  1SQV D;  1IC2 A;  1SQP E;  1QL2 A;  1JO5 A;  2MKV A;  3L70 D;  5AW5 B;  1MFT A;  5BU8 B;  3CWB E;  4WVZ A;  1NKN A;  1M7L A;  2J58 A;  1YHQ P;  3MTU E;  1XTG B;  5KJ7 A;  1FBM A;  4IFD K;  5TIS E;  1W5C E;  4Y99 C;  3CXH E;  1EZV E;  5CCH A;  1TU3 F;  3H1I J;  3L36 A;  5AW3 B;  4K35 A;  4H13 B;  1M8O B;  1NGM B;  3CX5 E;  2R32 A;  1GL2 B;  1EC5 A;  2N1T B;  1YQ3 C;  3V2R A;  1S2E A;  3C9I A;  1T8Z A;  1NTK K;  3CI9 A;  3M9H A;  1ZOY C;  1H8A A;  4IL6 X;  1NVO A;  5KJ7 D;  1X9V A;  3Q1M A;  3HE5 B;  2OYI B;  1SQQ D;  5BU5 A;  5CCH D;  4HB1 A;  4DOJ A;  2CPB A;  2ZVN B;  3V4Q A;  2I1K A;  3V4W A;  2OGU A;  1NJI Q;  1GD2 E;  3OAK A;  1KQG B;  3G4S P;  2FYU E;  2Q3I A;  4PD4 I;  1Y8A A;  3I56 P;  1VPC A;  1SQB E;  1T3U A;  1R8E A;  1Z56 A;  1Q86 Q;  2JWA A;  2XNX A;  2WSF H;  4TT3 H;  2G3A A;  2W90 A;  1QEX A;  2O3J A;  2BCC G;  2BAS A;  2ZYG A;  1SQV K;  3AE3 C;  2GUS A;  2P2U A;  2QJK C;  4W7Z A;  5B66 H;  1L0L G;  3PH0 A;  1BCC D;  4AUW A;  3MUD A;  2FYZ A;  2E76 B;  1FC2 C;  3I5C A;  1KIL E;  2QJY C;  4OVN F;  3EWK A;  2E74 D;  1GL2 A;  2N1T A;  5KAF H;  3GF3 A;  5APQ A;  1PFI A;  2WSE H;  3L74 J;  4BRY B;  1L0N G;  3L72 E;  1BE3 G;  3TGU G;  1QGK B;  1ZV8 A;  3HE5 A;  2OYI A;  2BCC J;  3KHU A;  3TK1 A;  1N73 C;  3OJA B;  3AE7 C;  1RF1 C;  3USS A;  5B66 E;  1VQO P;  3HRN A;  3R2P A;  3H1H J;  3L73 E;  4H13 D;  3H1K E;  1PPJ E;  1L0L J;  1GL2 D;  2N1T D;  5KAF E;  2O1J A;  3JC2 2;  5APS A;  1SQX K;  3BCC J;  4GKG A;  2AEF A;  1FDM A;  1L0N J;  3G71 P;  1KQL A;  3WMM 0;  1RQV A;  2IX7 C;  1IJD B;  1FS0 E;  1JB0 J;  3MZW B;  3Q5S A;  1Q2N A;  3A0B H;  4DZO A;  1K73 Q;  3O8Z A;  3M9B A;  3L71 G;  4A7P A;  3KYQ A;  1N7S C;  2XND H;  2WPR A;  3M91 A;  1BSN A;  2V7Q J;  1PL5 A;  3TSI A;  1S4X A;  1NU1 J;  4BRY A;  2KZI A;  4UB8 H;  2C9L Y;  4DT0 A;  3AED C;  4WY4 B;  3TDK A;  2YO2 A;  2AEM A;  4B86 A;  4PJ0 H;  1SQV E;  1Y9B A;  1L4A B;  2E76 D;  3OW2 O;  3L70 E;  1RE3 C;  3Q5R A;  1HF9 A;  5CMZ A;  1Q7Y Q;  1IK9 A;  3A2A A;  1NTM G;  1SP4 A;  1VQK P;  3L71 J;  3AEF C;  2GA1 A;  1RE4 A;  1J1D C;  2Z5I A;  3RK3 B;  3I55 P;  2FKW B;  4C7N B;  1VDF A;  2KP8 A;  1MZ9 A;  2J5U A;  4PJ0 E;  3TF5 A;  1KB9 D;  2XU6 A;  1IFD A;  4KT0 J;  4YXD C;  1J1E C;  3CCQ P;  4D6T G;  1KYO I;  3CCE P;  1OVR A;  1NYH A;  1LTI C;  5APW A;  1J2J B;  2M5A B;  4Y99 B;  1SQQ E;  2ZFC A;  4U3F D;  2JWD A;  2PGD A;  3MD0 A;  2AXC A;  1GK4 A;  1FZC C;  3B4S A;  1PGO A;  2N9Y B;  3B5N C;  1JNM A;  1QX8 A;  2QM8 A;  4WY4 A;  4YTP C;  3IAO A;  4BXL A;  2W6A A;  1NTZ J;  3CL3 D;  2NRG A;  1BGY J;  3GHG C;  2QG4 A;  4R4M A;  1D7M A;  1EDI A;  1OIP A;  2LXC B;  2B89 A;  3P8C D;  3H1J G;  1L4A A;  3FXE A;  1VQ9 P;  4JYB A;  4OH8 B;  3RBZ A;  1LTJ C;  2HG5 D;  5BVZ A;  2Y0C A;  1R5L A;  3CCM P;  1EDK A;  2IBZ E;  1YIJ P;  2R3C A;  2R3S A;  2SPZ A;  1ZLL A;  1N8R Q;  4DJG A;  2ZVO B;  1T2K C;  3VMA A;  1IFM A;  4WY4 D;  1S5L X;  2K1A A;  2M3E A;  1VQ5 P;  1BCC E;  2PP6 A;  2WIT A;  1BE3 D;  3TGU D;  2LR2 A;  2NPS C;  4C7N A;  5CBO A;  2NZ2 A;  3U59 A;  1PP9 J;  1YJ9 P;  3FWL A;  3PP5 A;  4N6J A;  1KQF B;  1L4A D;  1M1J C;  3NMD A;  2IFN A;  2KSE A;  2KS1 B;  5KLV G;  4L76 A;  3H1J J;  2MJZ A;  3QWO C;  2ITA A;  2E5T A;  1N7L A;  1RH5 B;  2KUB A;  3M0D C;  2QJK B;  2M5A A;  3CCS P;  4UB6 H;  3KPE A;  4GOD A;  3S9O A;  2KXP B;  2YMK A;  1OWA A;  1OXZ A;  2QM7 A;  2QJY B;  5AVY B;  1NAY A;  3RK3 D;  3A7O A;  1NOH A;  1K8A Q;  1NTK D;  1S3J A;  1EDJ A;  1OFC X;  4GOE A;  3AEC C;  2YIU C;  1ZR2 A;  1NKZ B;  3A0H H;  3PLN A;  1HH0 A;  4NPE A;  3M0A A;  1X8Y A;  1E5W A;  2C0X A;  3L75 G;  1W2B O;  1N73 B;  1SS1 A;  4QMA A;  4KHX A;  1MV8 A;  1RF1 B;  2I8D A;  3BRT B;  4UB6 E;  3EFF K;  3L71 D;  4PV1 C;  1AV1 A;  3FX0 A;  2QJP C;  2QRX A;  2R5D A;  4JF7 A;  1GTW A;  1PGP A;  3H1I G;  3R4Y A;  3A0H E;  1XTC C;  2HR3 A;  2Z5H A;  2KS1 A;  3FGA D;  2IBZ I;  1K04 A;  2R44 A;  1HJB A;  3CLQ A;  2E75 C;  2YKP A;  2A45 H;  3KXD A;  3WUU A;  3CME P;  3L75 J;  1NTM D;  1P84 E;  3SWF A;  1JY3 O;  4H44 C;  1AVY A;  1KB9 H;  2A06 G;  3AE4 C;  4W80 A;  1Q82 Q;  1SQP G;  1Q90 D;  1N7S B;  1K9M Q;  5KKZ C;  3HTK B;  3VMX A;  3CWB G;  3AE6 C;  1KOR A;  3FXD A;  3D6Z A;  1JY2 P;  2KI7 B;  1FAV A;  2RH0 A;  1BDD A;  4D6T D;  3MGN A;  1JM0 A;  1N73 A;  2W6J H;  3M9Q A;  1RF1 A;  2Y9Y A;  4GIF A;  1KMI Z;  3NFQ A;  2YXR B;  3JCU H;  1NH4 A;  2C9N Y;  2M0B A;  2GUV A;  1KB9 E;  3D71 A;  1NWQ A;  3RL0 C;  4EOT A;  1WMK A;  4N3Y B;  2Q3E A;  3L37 A;  4H0L C;  2IZ1 A;  1SQP J;  1OW7 A;  1SQX D;  1VQP P;  4N78 D;  1BDC A;  2XKM A;  3CWB J;  1J1D B;  2HPC B;  1EDL A;  2BEZ F;  1EXJ A;  3T97 B;  4U3F E;  1WRG A;  1HJ0 A;  3LW5 J;  3V6I A;  3L74 G;  4BWN A;  1VQ6 P;  2UWJ E;  3PTZ A;  3SWY A;  1A02 J;  2WMM A;  3VYI A;  2WSC H;  3II6 A;  3JCU E;  1YTZ T;  2O01 H;  1CSB A;  5APU A;  2FYU G;  1J1E B;  2ZYA A;  3P8C E;  3H1H G;  1FJP A;  5AVZ B;  1N7S A;  5L8R J;  1NTM K;  3V2P A;  3HTK A;  2PAJ A;  3P7K A;  3PRJ A;  4HYT B;  3TNU B;  1KQS O;  1FZC B;  1VQ8 P;  3B5N B;  1VQN P;  3BAT A;  1GK6 A;  3B71 A;  3BCC G;  5KLV D;  3Q5P A;  1AQT A;  1P84 I;  4OGQ C;  4LGD E;  3CD6 P;  3IN6 A;  3GHG B;  2HFE D;  1BE3 E;  3TGU E;  3W68 A;  3VOP A;  4YXW H;  3U1A A;  4M3L A;  2P10 A;  1RE3 A;  1LTJ B;  3VP8 A;  3CXH I;  1EZV I;  3UIA A;  1ZN5 A;  4LC1 A;  2VRS A;  2FYU J;  1N7S D;  1U7J A;  3CX5 I;  1A02 F;  1JUN A;  3L72 G;  2ZJS E;  4OWF A;  4IL6 H;  2H8P D;  2HPC A;  2FYN C;  2W8Z A;  2WPQ A;  2KYV A;  4L74 A;  3KZI H;  3T97 A;  2NPS B;  5KTB A;  1LTB C;  1NU1 G;  2OYO A;  2K9Y A;  2O01 N;  3RK3 E;  1JCD A;  3L73 G;  1M1J B;  5CBN A;  1KB9 I;  3H1K G;  1NTK E;  1IFP A;  1KD1 Q;  1DD4 A;  1VQM P;  1LT9 C;  3H1L E;  5CHX A;  4Y28 J;  4NPF X;  5APV A;  3H1I D;  1UIX A;  4PD4 D;  1KFM A;  3TNU A;  2WSF J;  1FZC A;  2Q9I A;  3B5N A;  3KZI E;  3L72 J;  3QH9 A;  4EDF A;  1FOS E;  1DEB A;  1SFC C;  3LIE A;  3C1L A;  1S1C X;  3HUS C;  3GHG A;  2YIU B;  4GOF A;  3VTP C;  4IFM A;  1NO4 A;  2YKO A;  1ZME C;  3U1C A;  4I1L A;  3L73 J;  3H1K J;  1LTJ A;  5KLV K;  3V5B A;  1FZF A;  1L2P A;  2A06 D;  1LT1 A;  4PV1 B;  5AW9 B;  1RQU A;  4NPD A;  3A0B E;  2WT7 B;  2QJP B;  2WSE J;  5GTH H;  3B5N D;  2OAR A;  2ZT9 C;  1NTM E;  1HUC A;  1FE6 A;  4I6M C;  2NPS A;  1GU5 A;  1SQV G;  4CPG A;  4UB8 E;  3CC2 P;  1M1J A;  1U57 A;  1NTZ G;  2Y0E A;  5EFW B;  1AVO A;  1BGY G;  2P67 A;  2E75 B;  4MN4 C;  2P7J A;  3M0D A;  4JYC A;  2RMZ A;  3JSV C;  5B5E H;  2KNC B;  3MIW A;  2IYO A;  4I7Z C;  4ASV A;  2YNY A;  4WWI A;  4D6T E;  4XFJ A;  5GTH E;  1T2K D;  4EIJ A;  4H44 B;  4RKU J;  2PRR A;  3A3Y B;  3IR9 A;  2NPS D;  5KKZ B;  4HH2 A;  2KSJ A;  4R4L A;  3L74 D;  3V2N A;  2KK7 A;  2OYH C;  4GT1 A;  1FZB A;  5AVR B;  1SQV J;  1JMM A;  3RL0 g;  1PP9 G;  1SQX E;  3EQ2 A;  2BCC D;  4N78 E;  3CCV P;  2GM4 A;  1AQ5 A;  3ITK A;  5B5E E;  1G1I A;  1SQQ G;  3H1H D;  1H0T B;  1FZG A;  4RO0 A;  1L0L D;  2K9J B;  2WT7 A;  3BAS A;  4L73 A;  1YBK A;  1OW8 A;  1IK7 A;  2B88 A;  3D6Y A;  3RL0 B;  3IFM A;  4O9B A;  1SQP K;  4H0L B;  3BCC D;  3N4X A;  5APX A;  1CW5 A;  3F89 A;  1KC8 Q;  1KZU B;  1L0N D;  2D2C C;  2P58 A;  1LNQ A;  1GDT A;  1VQL P;  5APT A;  2IBZ G;  5AVU B;  2WPS A;  4PV1 D;  5DJU B;  3FWN A;  2KNC A;  5KLV E;  2AXT H;  1SQQ J;  4IFF A;  4ZNC A;  1RHZ B;  2K88 A;  1URQ C;  2BEQ D;  3D70 A;  4TLF A;  2E42 A;  4ZKP A;  1NU1 D;  4ZMD A;  1N86 A;  1LWU B;  2Y0D A;  1AA0 A;  1E79 H;  1SVF A;  3G6E P;  4PD4 H;  5AVX B;  2E75 D;  2M8R A;  4OGQ B;  1AFO A;  2KZJ A;  1HWT C;  1KYO D;  1Y47 A;  1MFZ A;  1H0T A;  4K3A A;  1FDI A;  2AXT E;  2OTK E;  2K9J A;  3GW6 A;  4H44 D;  1KIL C;  2YMY A;  3TYY A;  2FYU K;  1WT6 A;  3C8V A;  1LGH B;  1DEE G;  2C0W A;  1BCC J;  1X79 B;  1KN7 A;  1L0L K;  2XZR A;  5GTI H;  2LKM A;  1PGQ A;  1VF5 C;  3AE8 C;  1LTA C;  2FYN B;  3H1I E;  1QLE D;  1HGV A;  4XA4 A;  4PD4 E;  2YXQ B;  4RJT A;  1PV3 A;  3VP9 A;  2H89 C;  5KLI C;  1OMI A;  5C39 A;  2JDI H;  3CCJ P;  1L0N K;  1QVF O;  5AVV B;  3VN0 A;  5AW2 B;  1K05 A;  1LT9 B;  3RL0 D;  2DW3 A;  1S5L H;  2O1K A;  2M3B A;  3Q2Y A;  4H0L D;  4W7Y A;  3ZDM A;  2FXP A;  2ZAE B;  5GTI E;  1FU1 A;  1PIX A;  5TJH A;  1DH3 A;  2A06 E;  2IYP A;  3CMA P;  3SSU A;  2QA4 P;  1NTZ D;  1SFC B;  2JKV A;  5AW6 B;  3KDP B; 
#chains in the Genus database with same CATH homology
 5CMZ A;  1YTZ I;  3VMZ A;  3VOP A;  1NU1 K;  1IK9 A;  3U1A A;  4M3L A;  3A2A A;  3HUS B;  1RE3 A;  1RE4 C;  1LTJ B;  1SP4 A;  3VP8 A;  1IO4 A;  1CZQ A;  3UIA A;  1ZN5 A;  4LC1 A;  2VRS A;  1N7S D;  5AW0 B;  1RE4 A;  2R5B A;  1N2D C;  3RK2 C;  1J1D C;  2Q7C A;  1A02 F;  1IFN A;  2Z5I A;  5AW4 B;  1RF0 C;  3RK3 B;  1JUN A;  5AVQ B;  2FKW B;  3H32 A;  1FZE A;  4C7N B;  2W27 A;  1VDF A;  2H8P D;  2HPC A;  2KP8 A;  3NXS A;  1MZ9 A;  2H7H A;  1RF0 A;  2WPQ A;  2YKQ A;  2KYV A;  2WZ7 A;  2H43 A;  3T97 A;  2L5G B;  1GW3 A;  1EQ7 A;  2NPS B;  1JY3 P;  5KTB A;  2XU6 A;  1LTB C;  5CCG C;  1JY3 N;  1LTG C;  1KFN A;  1ZR4 A;  1IFD A;  1JCD A;  2A45 G;  3HD7 C;  1J1E C;  3P8M C;  1GW4 A;  1M1J B;  3BRV B;  2KOG A;  5CCG A;  1G2C A;  1LTI C;  5APW A;  1SQB K;  2POH A;  1J2J B;  1JOC A;  4Y99 B;  2FFD C;  1HGZ A;  3HD7 A;  5AVT B;  1S9K E;  1GU4 A;  1LT9 C;  3M06 A;  2WWW A;  5CHX A;  2ZFC A;  2E43 A;  5APV A;  1RY3 A;  3MD0 A;  4WY4 C;  2FXM A;  2FFD A;  1GK4 A;  1FZC C;  2IPP A;  1NAF A;  1LT9 A;  3OA7 A;  4AQR D;  4WBA A;  3B5N C;  1JNM A;  1FZA A;  4I2L C;  4AYC A;  1KFM A;  3TNU A;  3RK2 D;  4WY4 A;  2QM8 A;  1FZC A;  2Q9I A;  3P32 A;  2YO3 A;  2W6A A;  3CL3 D;  3B5N A;  1L4A C;  3L4F A;  1MUU A;  4XE5 B;  1FOS E;  2J59 M;  3GHG C;  1DEB A;  3LW5 H;  1SFC C;  3LIE A;  3P8C D;  1H88 A;  1L4A A;  4JYB A;  3G3Z A;  2Z4E A;  4OH8 B;  3HUS C;  3GHG A;  5CCG D;  3VTP C;  1LTJ C;  1SFC A;  2HG5 D;  4IFM A;  1NO4 A;  2YKO A;  5BVZ A;  2OYH B;  1T3J A;  3HD7 D;  1SLQ A;  3U1C A;  3HUS A;  4I1L A;  1LWU C;  1LTJ A;  4C7R A;  1JY2 O;  2R3C A;  5KLV K;  3V5B A;  1FZF A;  2XDJ A;  1IFJ A;  1ZLL A;  3RK3 C;  1NTZ K;  1LTS C;  1LWU A;  5AW9 B;  1T2K C;  1IC2 A;  1IFM A;  1QL2 A;  1JO5 A;  4WY4 D;  2WT7 B;  5AW5 B;  2PP6 A;  2WIT A;  2IFM A;  5BU8 B;  5AW1 B;  1NKN A;  1M7L A;  5KJ7 C;  3B5N D;  2J58 A;  2NPS C;  2OAR A;  4C7N A;  2KLV A;  3U59 A;  1IFI A;  3MTU E;  1HUC A;  1XTG B;  3PP5 A;  4I6M C;  3NTN A;  4N6J A;  5KJ7 A;  1FBM A;  2NPS A;  1L4A D;  5CCH C;  1M1J C;  4IFD K;  3NMD A;  1GU5 A;  2IFN A;  2HYN A;  1SFC D;  4Y99 C;  5CCH A;  1M1J A;  2MJZ A;  1FJK A;  2Q5U A;  3L35 A;  1N7L A;  3L36 A;  3M0D C;  5AW3 B;  2WTY A;  2ZXE B;  2HOD B;  2P67 A;  2A45 I;  2CPS A;  2R32 A;  3KPE A;  1GL2 B;  5AVS B;  2P7J A;  1OWA A;  1OXZ A;  2N1T B;  1JY2 N;  3M0D A;  4JYC A;  2QM7 A;  3V2R A;  5AVY B;  3MIW A;  3C9I A;  1CI6 B;  3A7O A;  1T8Z A;  3RK3 D;  2JJL A;  1NTK K;  3CI9 A;  1NOH A;  3M9H A;  2YNY A;  1H8A A;  1T2K D;  3HE4 B;  3H6P A;  3N7N A;  4EIJ A;  1H89 A;  1SQQ K;  2JEE A;  3A3Y B;  5KJ7 D;  3IR9 A;  1X9V A;  2NPS D;  1S9K D;  3HE5 B;  1ZR2 A;  4HH2 A;  1NKZ B;  2KSJ A;  2OYI B;  1URQ B;  3V2N A;  5CJ0 A;  5BU5 A;  2OYH C;  1HH0 A;  4GT1 A;  1FZB A;  5CCH D;  3M0A A;  1X8Y A;  1E5W A;  2C0X A;  4DOJ A;  1JTH B;  5AVR B;  2CPB A;  1N73 B;  2OYH A;  4KHX A;  3V4Q A;  2I1K A;  1MV8 A;  1JMM A;  1RF1 B;  4ZKU A;  3EQ2 A;  3V4W A;  3BRT B;  1HBW A;  1GD2 E;  3OAK A;  4N78 E;  1LTT C;  2Q3I A;  4LLH A;  2GM4 A;  1AQ5 A;  1VPC A;  1G1I A;  2R5D A;  4JF7 A;  1GTW A;  1T3U A;  1FZG A;  1Z56 A;  2WT7 A;  3BAS A;  2XNX A;  2WSF H;  1HTL C;  3RL0 B;  2W6B A;  2BAS A;  3IFM A;  4O9B A;  1SQV K;  1JCC A;  1KIL B;  1SQP K;  1XTC C;  2GUS A;  2N9B A;  3N4X A;  2P2U A;  2Z5H A;  5APX A;  1CW5 A;  4C46 A;  4W7Z A;  1KZU B;  3CLQ A;  1NHL A;  1HJB A;  2YKP A;  4AUW A;  2A45 H;  3MUD A;  1GL2 C;  2FYZ A;  1G1J A;  1GDT A;  2N1T C;  3I5C A;  5APT A;  2HOD A;  5AVU B;  2WPS A;  3SWF A;  1GL2 A;  1JY3 O;  2N1T A;  5APQ A;  1PFI A;  1CI6 A;  1W2E A;  3E1I A;  2WSE H;  3B8E B;  4W80 A;  4IFF A;  3HE4 A;  1N7S B;  3HTK B;  2OYI C;  3VMX A;  3A5T A;  5APY A;  1URQ C;  1GZL A;  1ZV8 A;  3HE5 A;  2E42 A;  2OYI A;  4ZKP A;  1JY2 P;  3TK1 A;  1URQ A;  1N73 C;  3OJA B;  1N86 A;  1RF1 C;  1LWU B;  1FAV A;  3HRN A;  1JTH A;  3R2P A;  3MGN A;  1N73 A;  1SVF A;  2P1J A;  4WB4 A;  3M9Q A;  5AVX B;  1RF1 A;  1HVV A;  4GIF A;  1GL2 D;  3NFQ A;  2M8R A;  1AFO A;  2N1T D;  3VMY A;  1NH4 A;  2O1J A;  1HWT C;  2C9N Y;  2GUV A;  1MFZ A;  1NWQ A;  5APS A;  1SQX K;  3RL0 C;  4EOT A;  4N3Y B;  1KIL C;  2YMY A;  3L37 A;  2FYU K;  3TYY A;  1WT6 A;  4GKG A;  1DX7 A;  3H32 B;  1LGH B;  2C0W A;  1FDM A;  4N78 D;  1X79 B;  3RK2 B;  2XKM A;  1J1D B;  1KIL A;  1KQL A;  1URQ D;  2HPC B;  5CJ4 A;  5AW8 B;  3WMM 0;  1L0L K;  2XZR A;  2HLO A;  2IX7 C;  2LKM A;  1IJD B;  1WRG A;  1LTA C;  1HGV A;  3SWY A;  4XA4 A;  1A02 J;  3EFG A;  3VYI A;  4DZO A;  3O8Z A;  2WSC H;  1YYC A;  2KB7 P;  3II6 A;  1G2C B;  3VP9 A;  2I1J A;  1YTZ T;  2O01 H;  3M9B A;  1CSB A;  3HD7 B;  5APU A;  3KYQ A;  1J1E B;  1N7S C;  2WPR A;  1L0N K;  5AVV B;  5AW7 B;  3KQG A;  3M91 A;  3VN0 A;  3P8C E;  5AW2 B;  1QL1 A;  1FOS F;  1FJP A;  3LID A;  2FFD B;  4RES B;  3TSI A;  5AVZ B;  1N7S A;  1LT9 B;  1NTM K;  3V2P A;  3RL0 D;  2C9L Y;  3HTK A;  2PAJ A;  3P7K A;  2O1K A;  2M3B A;  4HYT B;  3TNU B;  4WY4 B;  1KIL D;  4W7Y A;  2YO2 A;  1FZC B;  3B5N B;  1FU1 A;  2XV5 A;  3BAT A;  1GK6 A;  4B86 A;  1DH3 A;  5AVW B;  3V2Q A;  1L4A B;  4LGD E;  3GHG B;  1RE3 C;  3BVH A;  2HFE D;  1SFC B;  5AW6 B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...