2A06G

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 21
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2a06G00
1P84H 3TGUG 1BCCG 1SQVG 1EZVG 3L70G 5KLVG 1NTKG 3H1JG 3L75G 1KB9H 2BCCG 1NU1G 1BE3G 2A06G 1SQBG 1SQXG 2FYUG 1NTZG 3H1LG 1SQPG 1L0LG 3CXHH 3H1HG 1BGYG 4U3FG 4D6TG 3H1IG 1SQQG 4PD4H 1KYOH 3CWBG 3L73G 3H1KG 3L74G 1PP9G 2IBZG 3BCCG 3L71G 3CX5H 1PPJG 1L0NG 1NTMG 3L72G
chains in the Genus database with same CATH superfamily
1RE4C 1EZVE 5AW1B 4I2LC 2A45H 1BGYD 1QX8A 2ZJSE 1RH5B 1VF5C 2Z5HA 1HJBA 1QLED 1L0ND 1BSNA 2P10A 3TGUD 5KAIH 1VQMP 5AVQB 2H8PD 4RESB 3TDKA 1E79H 1Q90D 1GK4A 3ITKA 2ZYAA 1MUUA 4GOEA 1N2DC 2FYZA 5KJ7D 1LJ2A 2N9BA 2ZVNB 1HJ0A 1HH0A 2Y0DA 4U3FJ 3RGUA 4WB4A 5GTIE 1X0TA 4ASVA 1H0TA 1JM0A 1URQA 2A45G 1ZXGA 1G2CB 1NTKJ 2GUSA 3CXHE 2BCCJ 2I8DA 5AW9B 1SQQE 1ZN5A 1OFCX 5KJ7C 3RBZA 1YIJP 2KLUA 1KYOI 4C7RA 1SQVG 2KIKA 4C46A 1SLQA 2RMZA 2W8ZA 2ZYGA 1FZBA 2HYNA 2IZ1A 2OTKE 3AEGC 3H1ID 3Q3DA 1NTZG 3WUTA 2AEFA 1L4AB 3CC4P 2OYHC 3CX5E 4DJGA 2J5UA 2Q7CA 1OZHA 1KB9H 2FYUD 2BCCG 4H44D 4RJTA 3AE7C 1L4AC 3L74D 3H1HE 3SFEC 3EFGA 2YXQB 3CCLP 1JCDA 3HTKB 3L4FA 3L72E 1BCCE 4GODA 2KYVA 1FZCA 3GW6A 3VOPA 1EQ7A 3SWYA 2ZXEB 1Q7YQ 1SQPE 4H44C 1GTWA 3I56P 1AJYA 1PFIA 1LP1A 3W68A 1IO4A 3M0DC 1PV3A 2IDBA 3HUSA 3L70J 4IL6H 3MZWB 1RF0C 4H13D 3L36A 3CWBE 3CXHI 2KXPB 5AW7B 3FWLA 2R3CA 4H13B 1NTMJ 2AXTE 2M0BA 2OARA 4H13C 1YBKA 2QM8A 2B87A 1LTBC 3CX5I 1IC2A 3RL0g 1ZOYC 2WT7B 4UB8E 2QEXP 3P8MC 3V2RA 1QL2A 4PD4H 1CSBA 4AUWA 1K04A 2OQQA 5H2FH 4B86A 1YTZI 1NTMG 2JDIH 3VP8A 1W2EA 1PP9J 2IZ0A 1FU1A 1MZ9A 2RKLA 1S4XA 2JR8A 1IFJA 1L0LE 3HD7D 5CJ4A 1SQBJ 1JO5A 2IBZE 3L71E 1CW5A 2R44A 4ZMDA 3RL0D 3U59A 1N7LA 2IX7C 2O01J 3EFFK 1SFCD 1FOSE 3RL0B 1PGPA 3H1KD 3PHLA 1YQ4C 1Y8AA 4WY4D 3GG2A 1PP9G 2QJKB 1NAFA 1PPJG 5CCGD 5KLVE 5AVRB 3NTNA 1ZLLA 1N86A 2A06E 1GMJA 3RL0C 3N4XA 1SQBG 3FGAD 2E76B 1SFCC 1IFPA 3CXHH 3CCQP 4GIFA 2LXCB 1VPCA 2FFDC 2KLVA 1L0NK 1KILE 1EDKA 1JOCA 2Y9YA 5CCGC 1NTKK 1FZGA 2JP3A 1A02J 3V2PA 3F89A 4N78E 1GU5A 2M5AB 3P8CE 2BEZF 2YIUB 4NPEA 2CK3H 3CX5H 1VQ6P 3ZDMA 2HODB 3RK2D 5AVXB 4TLFA 1Q81Q 1EDLA 5AW2B 4DOJA 1WRGA 1Y9BA 1FDMA 1JTHB 4W80A 1SQQG 2QJYB 4BRYA 2C0WA 3AEFC 1BDDA 5KTBA 2QE7H 1N7SD 1N73A 3L72J 2Z5IA 1NU1E 2KS1A 3D6YA 2OTJP 3L75J 1BGYE 2P1JA 2QJYC 1VQ4P 2CPBA 1HUCA 1L0NE 3Q1MA 1S5LX 5EFWB 2E75D 3TGUE 1X9VA 2Q3IA 3VMAA 3O6QB 4W7YA 1S5LE 1LWUB 4KHXA 3OAKA 1G1IA 2E75B 4KJMA 3H1HG 1RHZB 1BE3J 3AE6C 1JEKA 1WMKA 3MP7B 1NJIQ 3FXEA 5E79E 3H1LJ 3L72G 4KT0J 2KP8A 1BCCG 1LWUC 2E74D 2E75C 1YJ9P 1CI6A 3VTPC 3JC22 1SQPG 2QSIA 1FJKA 1W5CE 2IPPA 3AE5C 3NFQA 2E74B 1U7JA 4D6TJ 1PGQA 2AEMA 1M90Q 3H1JD 3MUDA 2M3BA 2P2UA 1NTMK 3BCCJ 3E7KA 3I55P 4DZOA 3CC7P 1BE3G 4NPDA 3CCSP 4UB8H 1GW3A 1IFIA 1VQ7P 2QRXA 1DEEG 3C1LA 1LTJA 3H1IE 2E74C 3CWBG 1KQGB 1S9KD 4NPFX 3B5NA 1M1JB 1KFMA 2SPZA 2ITAA 4RKUJ 1DD3A 2WSSH 4XA4A 3ABVC 2R32A 2PGDA 2Y9ZA 1VQOP 2FYUE 1XTCC 1S3JA 3H25A 1FZAA 2Q1KA 5L8RJ 4D6TG 2KSJA 3VP9A 4Z1MH 3L74E 3PH0A 1NOHA 2DW3A 1BSHA 3BCCG 1GK6A 5AVVB 1KORA 2YKQA 3KZIE 4PV1D 2NPSA 3TSIA 5CCHD 2K37A 2WSFH 1KILB 1MKMA 3MD0A 1LT9B 2WMMA 3GHGB 3FXDA 2WSFJ 2XZRA 1RF1B 3BRVB 1QVFO 1JMBA 3JSVC 4UB6H 3HE5A 1SQXJ 3PJSK 2OYOA 2KZIA 3JCUH 3D70A 4JF7A 4U7JA 1LT9C 4PV1C 2LKMA 1L0LG 1GL2A 5CCHC 3CD6P 4OGQD 1VF5B 2G8YA 3L71G 1JNMA 1HBWA 2POHA 4GT1A 2WSCJ 1PGOA 2W6JH 2KOGA 4OH8B 4WBAA 3G6EP 4U3FD 2KZJA 1DX7A 1YI2P 4GDOA 2N1TA 1SQXG 1NTKD 3HE4A 4OGQC 2BCCD 4LGDE 1VQ9P 4HYTB 2C0XA 2V7QH 3GLMA 1EXIA 2Y0EA 2M3EA 1FZFA 1UIXA 1SQVJ 2V7QJ 1VL2A 1KD1Q 1FAVA 3AEAC 1URQD 3B71A 1NTZJ 4YXDC 1A02F 1H0TB 4XFJA 4M3LA 1U57A 1JY2P 2JKVA 1GU4A 2C9NY 1HTLC 3S9OA 1NU1J 2WSEH 2E42A 2PFXA 3HRNA 2C9LY 4ZKPA 5TISE 3R4YA 1KB9D 1VQKP 4DT0A 1URQC 2OYHB 3AEBC 1IK7A 1JY3N 1S5LH 3BATA 1NYHA 1T6AA 1G2CA 3R2PA 3Q5SA 1LTSC 2GA1A 3M0AA 1T8ZA 2Q5UA 3H1KE 2FBWC 2Q3EA 4PD4I 1NKNA 5E79H 1QGKB 3WU2E 1NGMB 1R5SA 1LT1A 1SVFA 5CBOA 1ZRTD 3MGNA 2IFNA 1NU1G 1YJNP 1EZVI 4MN4C 5CJ0A 4ZKUA 2ZAEB 2XKMA 1L4AA 1T3JA 2GUVA 1LTTC 4R4LA 4H44B 3V5BA 4Y99B 3L70D 3TGUG 2BASA 4TT3H 1FZCB 1KTMA 1EC5A 1K9MQ 1HVVA 3M9BA 3OA7A 1K05A 3U1AA 5APUA 1NTMD 4Y99C 3HTKA 1IZNB 1P84E 1FZCC 4DCKA 3L73J 5AVTB 1KYOD 2ZFCA 3CCJP 2OYIA 2V4HA 1RF0A 1KQFB 2HR3A 2J59M 5AVUB 1PIXA 4PJ0E 4IFFA 3H32B 3HUSC 3KZIH 3F5HA 1XTGB 2XV5A 2NZ2A 4BWNA 1PP9D 3E1IA 1X79B 4I7ZB 1PPJD 5B5EE 4HH2A 1VQ8P 3L73G 2B87B 4ASWA 3G4SP 1SQBD 4EIJA 5KAFE 3FWNA 4I7ZC 4L76A 3H6PA 2OTLP 4RO0A 2QM7A 3KXDA 1JMMA 3PLNA 3WUUA 3G71P 3CCEP 5B66E 3WUVA 4AYCA 1AQ5A 1HF9A 5M1BA 1BDCA 4N6JA 1ZR4A 3G9RA 2AXCA 4BXLA 3T97B 5APQA 3L35A 3H1JE 1P84I 3HD7B 1IJDB 2HPCA 3CXHD 2K3RA 1OMIA 2O1JA 3LW5H 3SWKA 1SFCB 3LW5J 1KQSO 4R4MA 3RK3D 3HD7C 2HG5D 3AE1C 1S9KE 1AVYA 1JY3P 5BU8B 1EZVG 5GTIH 4H0LD 1SQVK 2FFDB 4WY4B 3VN0A 2OGUA 3AEDC 2P58A 3RK3B 4HKZH 2PRRA 1NTZK 1J1DC 1SQQJ 4CPGA 4WY4C 1MV8A 2K9JB 1YTZT 3KHUA 3RK3C 4GOFA 3QWOC 2G3AA 4H0LC 2KI7B 5TJHA 2K88A 2KNCB 3AECC 5AVYB 2XNDH 3H1KJ 3L75D 1GD2E 4YTPC 4XE5B 3RK2B 2M5AA 2D2CD 2B9BA 1EDJA 2WZ7A 4ZNCA 3H1HJ 2HODA 2IBZI 2XU6A 1BE3D 4L75A 1JTHA 3RK2C 1JCCA 1BCCJ 3GF3A 3H1LD 1DIPA 3WMM0 4U3FE 1N7SB 1KZUB 3H1KG 3AE4C 1SQPJ 2D2CC 1YJWP 1N73C 1P84H 2FYNC 1DH3A 4QMAA 1S72P 1NTKE 2H43A 2BCCE 3V4WA 1JB0J 1PL5A 1M1KQ 4EYYQ 4D6TD 1N7SC 3BCCD 2KB7P 1AA0A 2K1AA 1IFNA 1AVOA 2RH0A 5DJTB 1LTGC 3CWBJ 4PJ0H 1M56D 1PGJA 3O6QA 1K73Q 2E5TA 2WWWA 1QVGO 3W67A 2AXTH 1R8EA 4EOTA 1KFNA 2PP6A 3M9HA 4C7NB 2R5DA 1KB9E 2ZT9D 3IAOA 3B5ND 1H8AA 1NHLA 3NXSA 3MUDC 3B5NB 1QL1A 2J58A 2LR2A 1FC2C 1GW4A 5KKZB 1OW6A 1ZMEC 2I1JA 1KMIZ 1EXJA 4L73A 4LLHA 3B8EB 4JPZB 3CMEP 5AW6B 3TF5A 4WWIA 3AE2C 2NPSD 3LIEA 3B5NC 1SQXD 1M57D 3USSA 2N9YB 1X8YA 1L0LJ 5KKZC 2HFED 1M1JA 3KQGA 3II6A 3L70E 3L71J 1RE3C 1VQ5P 4IL6E 1JUNA 2JWAA 1R5LA 2ZVOB 1SQBK 1T2KD 5K5GB 4PV1B 3BASA 3AE9C 3C9IA 1NTME 1WT6A 3BVHA 2NPSC 1GL2D 1MFZA 2QIWA 4N78D 3TNUB 5KLVJ 1GL2B 1ZP0C 1NAYA 1KILA 1KYOE 3GHGA 1RQUA 2IBZG 3O8ZA 1SQVD 1RF1A 1T2KC 3PRJA 2QJPB 2UWJE 1RE4A 4OGQB 5CMZA 1GL2C 2N1TD 1NTZD 1VQLP 1H89A 3AE3C 5H2FE 1PP9E 1PPJE 1SQQK 3Q2YA 2WITA 5GTHE 3HE4B 2E5YA 3IR9A 2QJPC 1T3UA 1NU1D 5KLVG 1YQ3C 3GMAA 3M91A 2WPVB 1HWTC 1SQBE 2A06G 1QEXA 2N1TC 3K5BA 5KLIB 5BVZA 3UIAA 3MHVA 1OW8A 1X22A 1URQB 3IFMA 1VQPP 2M8RA 2Z4EA 5KLIC 5APSA 2I1KA 1M7LA 3CLQA 2WSEJ 1BGYJ 5KJ7A 4O9BA 3N7NA 3V2NA 2H89C 3V4QA 1L0NJ 2W6BA 3EWKA 4YPCA 3TGUJ 2L5GB 1ZR2A 1FDOA 1OIPA 2O1KA 1DEBA 1FS0E 1SQPK 5APTA 1FBMA 2OYHA 5AW5B 1L4AD 3RK3E 3TK1A 3Q5RA 1NH4A 3IN6A 3CL3D 1K8AQ 2XDJA 2R5BA 4U3FG 1BGYG 3RBXA 3L73D 2W83C 3AE8C 2B88A 1L0NG 3TYYA 3CMAP 1NTKG 1VQNP 3A5TA 3D6ZA 3A0BE 2VRSA 5APYA 1MFTA 3CI9A 1L2PA 2WQYC 3H1IJ 1LP1B 1JY2O 3L75E 3IF4A 2O01N 3HUSB 3M0DA 4JQ0D 3Q5PA 2OYIB 1Q82Q 1J1EB 4JYBA 2GM4A 2QG4A 2FYUJ 2FXMA 1AQTA 3L74J 2Y0CA 1N8RQ 1BE3E 2OYIC 1J1EC 1USEA 4PD4D 3H1LE 3P32A 3H1IG 2YNYA 1L0LK 2YMKA 1EZVD 3H32A 3M9QA 3SFDC 5AVWB 2FYUG 3P7KA 4D6TE 2Q9IA 3AEEC 1KYOH 2IYPA 3BCCE 4JYCA 3L74G 1KQLA 1LTIC 2YO3A 2QVAA 2KK7A 1SQXK 2R3SA 3L70G 3VYIA 2YMYA 5KLVK 2WT7A 2BEQD 2AEJA 4IFMA 1FOSF 1S2EA 1LTAC 1RQVA 1OVRA 2RN0A 2YKOA 2CPSA 5GTHH 4I1LA 2HPCB 1YYCA 3A0HE 2WTYA 2MKVA 3S4RA 3VMXA 2FXPA 1KN7A 1SQQD 3MIWA 1Q2NA 1OWAA 2Q6QA 2YKPA 5APXA 2O01H 1J1DB 3T97A 3V6IA 4HJGH 3VMZA 1G1JA 3HD7A 5CHXA 4AQRD 2ZXXA 2O3JA 1FDIA 1HGZA 3CX5D 2FXOA 3CPWO 4L74A 1SFCA 3C8VA 4H0LB 1ZW0A 1SQXE 1YHQP 5TISH 4IFDK 2E76D 3S1KA 4UB6E 2FFDA 3JCUE 4WY4A 3U1CA 3A3YB 3H1HD 1NU1K 5CCGA 2QJKC 2WVRA 1GDTA 3L72D 4OVNF 3CCRP 3GF7A 1BCCD 3B4SA 5AVSB 3WU2H 1FJPA 2K9JA 2E76C 2WPQA 1NKZB 1SQPD 1IK9A 4GKGA 1P84D 2KNCA 5KAIE 1OW7A 2HLOA 4BRYB 1SQVE 2P67A 1LGHB 5AW4B 2QA4P 2D2CB 1N73B 2FYNB 4W7ZA 2KS1B 3A0BH 1FZEA 2YIUC 3CCUP 1NTZE 3CWBD 2MJZA 3OJAB 1H88A 5AW3B 1JY3O 1NVOA 2IFMA 1USDA 3M06A 2YXRB 3L37A 1SS1A 3PP5A 3CCVP 1N7SA 2WPRA 1D7MA 2K9YA 1IFMA 2NRGA 1OVVA 1U7MA 1AFOA 3SSUA 2WPSA 3QH9A 4HB1A 5AW8B 3D71A 1CI6B 1OVUA 3VMYA 1LWUA 1LNQA 1JY2N 2KUBA 2FYUK 1VDFA 4WVZA 2P7JA 5CBNA 4K3AA 5B5EH 4A7PA 3KDPB 1E5WA 2W6AA 3L75G 5APWA 1AV1A 1UIIA 5KAFH 1CZQA 1L0LD 3G3ZA 2A45I 5BU5A 1HGVA 3V2QA 1LTJB 2IBZD 3L71D 2ZT9B 1OX3A 1Q86Q 2KSEA 2PAJA 3BRTB 2W90A 5DJUB 1KC8Q 2YO2A 4C7NA 4Y28J 3CC2P 4YXWH 5B66H 1ZRTE 1LTJC 2ZYDA 2ZT9C 2H88C 3H1LG 3KPEA 3E1RA 1Y47A 4EDFA 4JBZA 3PTZA 1NO4A 1PZQA 3EQ2A 3L73E 4EI2A 5KLVD 4K35A 1ZV8A 4IL6X 2A06D 1IFDA 2NPSB 2E43A 2H7HA 3A0HH 1M8OB 1EDIA 3H1JJ 5C39A 1RY3A 1RE3A 4IOIH 5AVZB 4LC1A 1M1JC 1NWQA 2JJLA 2XNXA 1KV4A 1KILD 1FE6A 3A2AA 1TU3F 3HE5B 1S1CX 2IYOA 3SWFA 5AW0B 3KYQA 4I6MC 2FKWB 1GZLA 3I5CA 1DD4A 3CCMP 3P8CD 1W2BO 2JO1A 3LIDA 4N3YB 2JWDA 1LT9A 3OW2O 3MTUE 5CCHA 3NMDA 2W27A 1SP4A 1J2JB 2JEEA 1OXZA 2FY8A 4OWFA 2L91A 2LXBA 3H1JG 1YITP 1VF5D 3TNUA 1KILC 1KB9I 5APVA 3FX0A 3GHGC 1Z56A 2B89A 4PD4E 1RF1C 3A7OA 2WSCH 2N1TB
chains in the Genus database with same CATH topology
1P84H 3TGUG 1BCCG 1SQVG 1EZVG 3L70G 5KLVG 1NTKG 3H1JG 3L75G 1KB9H 2BCCG 1NU1G 1BE3G 2A06G 1SQBG 1SQXG 2FYUG 1NTZG 3H1LG 1SQPG 1L0LG 3CXHH 3H1HG 1BGYG 4U3FG 4D6TG 3H1IG 1SQQG 4PD4H 1KYOH 3CWBG 3L73G 3H1KG 3L74G 1PP9G 2IBZG 3BCCG 3L71G 3CX5H 1PPJG 1L0NG 1NTMG 3L72G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 H;  3TGU G;  1BCC G;  1SQV G;  1EZV G;  3L70 G;  5KLV G;  1NTK G;  3H1J G;  3L75 G;  1KB9 H;  2BCC G;  1NU1 G;  1BE3 G;  2A06 G;  1SQB G;  1SQX G;  2FYU G;  1NTZ G;  3H1L G;  1SQP G;  1L0L G;  3CXH H;  3H1H G;  1BGY G;  4U3F G;  4D6T G;  3H1I G;  1SQQ G;  4PD4 H;  1KYO H;  3CWB G;  3L73 G;  3H1K G;  3L74 G;  1PP9 G;  2IBZ G;  3BCC G;  3L71 G;  3CX5 H;  1PPJ G;  1L0N G;  1NTM G;  3L72 G; 
#chains in the Genus database with same CATH topology
 1RE4 C;  1EZV E;  5AW1 B;  4I2L C;  2A45 H;  1BGY D;  1QX8 A;  2ZJS E;  1RH5 B;  1VF5 C;  2Z5H A;  1HJB A;  1QLE D;  1L0N D;  1BSN A;  2P10 A;  3TGU D;  5KAI H;  1VQM P;  5AVQ B;  2H8P D;  4RES B;  3TDK A;  1E79 H;  1Q90 D;  1GK4 A;  3ITK A;  2ZYA A;  1MUU A;  4GOE A;  1N2D C;  2FYZ A;  5KJ7 D;  1LJ2 A;  2N9B A;  2ZVN B;  1HJ0 A;  1HH0 A;  2Y0D A;  4U3F J;  3RGU A;  4WB4 A;  5GTI E;  1X0T A;  4ASV A;  1H0T A;  1JM0 A;  1URQ A;  2A45 G;  1ZXG A;  1G2C B;  1NTK J;  2GUS A;  3CXH E;  2BCC J;  2I8D A;  5AW9 B;  1SQQ E;  1ZN5 A;  1OFC X;  5KJ7 C;  3RBZ A;  1YIJ P;  2KLU A;  1KYO I;  4C7R A;  1SQV G;  2KIK A;  4C46 A;  1SLQ A;  2RMZ A;  2W8Z A;  2ZYG A;  1FZB A;  2HYN A;  2IZ1 A;  2OTK E;  3AEG C;  3H1I D;  3Q3D A;  1NTZ G;  3WUT A;  2AEF A;  1L4A B;  3CC4 P;  2OYH C;  3CX5 E;  4DJG A;  2J5U A;  2Q7C A;  1OZH A;  1KB9 H;  2FYU D;  2BCC G;  4H44 D;  4RJT A;  3AE7 C;  1L4A C;  3L74 D;  3H1H E;  3SFE C;  3EFG A;  2YXQ B;  3CCL P;  1JCD A;  3HTK B;  3L4F A;  3L72 E;  1BCC E;  4GOD A;  2KYV A;  1FZC A;  3GW6 A;  3VOP A;  1EQ7 A;  3SWY A;  2ZXE B;  1Q7Y Q;  1SQP E;  4H44 C;  1GTW A;  3I56 P;  1AJY A;  1PFI A;  1LP1 A;  3W68 A;  1IO4 A;  3M0D C;  1PV3 A;  2IDB A;  3HUS A;  3L70 J;  4IL6 H;  3MZW B;  1RF0 C;  4H13 D;  3L36 A;  3CWB E;  3CXH I;  2KXP B;  5AW7 B;  3FWL A;  2R3C A;  4H13 B;  1NTM J;  2AXT E;  2M0B A;  2OAR A;  4H13 C;  1YBK A;  2QM8 A;  2B87 A;  1LTB C;  3CX5 I;  1IC2 A;  3RL0 g;  1ZOY C;  2WT7 B;  4UB8 E;  2QEX P;  3P8M C;  3V2R A;  1QL2 A;  4PD4 H;  1CSB A;  4AUW A;  1K04 A;  2OQQ A;  5H2F H;  4B86 A;  1YTZ I;  1NTM G;  2JDI H;  3VP8 A;  1W2E A;  1PP9 J;  2IZ0 A;  1FU1 A;  1MZ9 A;  2RKL A;  1S4X A;  2JR8 A;  1IFJ A;  1L0L E;  3HD7 D;  5CJ4 A;  1SQB J;  1JO5 A;  2IBZ E;  3L71 E;  1CW5 A;  2R44 A;  4ZMD A;  3RL0 D;  3U59 A;  1N7L A;  2IX7 C;  2O01 J;  3EFF K;  1SFC D;  1FOS E;  3RL0 B;  1PGP A;  3H1K D;  3PHL A;  1YQ4 C;  1Y8A A;  4WY4 D;  3GG2 A;  1PP9 G;  2QJK B;  1NAF A;  1PPJ G;  5CCG D;  5KLV E;  5AVR B;  3NTN A;  1ZLL A;  1N86 A;  2A06 E;  1GMJ A;  3RL0 C;  3N4X A;  1SQB G;  3FGA D;  2E76 B;  1SFC C;  1IFP A;  3CXH H;  3CCQ P;  4GIF A;  2LXC B;  1VPC A;  2FFD C;  2KLV A;  1L0N K;  1KIL E;  1EDK A;  1JOC A;  2Y9Y A;  5CCG C;  1NTK K;  1FZG A;  2JP3 A;  1A02 J;  3V2P A;  3F89 A;  4N78 E;  1GU5 A;  2M5A B;  3P8C E;  2BEZ F;  2YIU B;  4NPE A;  2CK3 H;  3CX5 H;  1VQ6 P;  3ZDM A;  2HOD B;  3RK2 D;  5AVX B;  4TLF A;  1Q81 Q;  1EDL A;  5AW2 B;  4DOJ A;  1WRG A;  1Y9B A;  1FDM A;  1JTH B;  4W80 A;  1SQQ G;  2QJY B;  4BRY A;  2C0W A;  3AEF C;  1BDD A;  5KTB A;  2QE7 H;  1N7S D;  1N73 A;  3L72 J;  2Z5I A;  1NU1 E;  2KS1 A;  3D6Y A;  2OTJ P;  3L75 J;  1BGY E;  2P1J A;  2QJY C;  1VQ4 P;  2CPB A;  1HUC A;  1L0N E;  3Q1M A;  1S5L X;  5EFW B;  2E75 D;  3TGU E;  1X9V A;  2Q3I A;  3VMA A;  3O6Q B;  4W7Y A;  1S5L E;  1LWU B;  4KHX A;  3OAK A;  1G1I A;  2E75 B;  4KJM A;  3H1H G;  1RHZ B;  1BE3 J;  3AE6 C;  1JEK A;  1WMK A;  3MP7 B;  1NJI Q;  3FXE A;  5E79 E;  3H1L J;  3L72 G;  4KT0 J;  2KP8 A;  1BCC G;  1LWU C;  2E74 D;  2E75 C;  1YJ9 P;  1CI6 A;  3VTP C;  3JC2 2;  1SQP G;  2QSI A;  1FJK A;  1W5C E;  2IPP A;  3AE5 C;  3NFQ A;  2E74 B;  1U7J A;  4D6T J;  1PGQ A;  2AEM A;  1M90 Q;  3H1J D;  3MUD A;  2M3B A;  2P2U A;  1NTM K;  3BCC J;  3E7K A;  3I55 P;  4DZO A;  3CC7 P;  1BE3 G;  4NPD A;  3CCS P;  4UB8 H;  1GW3 A;  1IFI A;  1VQ7 P;  2QRX A;  1DEE G;  3C1L A;  1LTJ A;  3H1I E;  2E74 C;  3CWB G;  1KQG B;  1S9K D;  4NPF X;  3B5N A;  1M1J B;  1KFM A;  2SPZ A;  2ITA A;  4RKU J;  1DD3 A;  2WSS H;  4XA4 A;  3ABV C;  2R32 A;  2PGD A;  2Y9Z A;  1VQO P;  2FYU E;  1XTC C;  1S3J A;  3H25 A;  1FZA A;  2Q1K A;  5L8R J;  4D6T G;  2KSJ A;  3VP9 A;  4Z1M H;  3L74 E;  3PH0 A;  1NOH A;  2DW3 A;  1BSH A;  3BCC G;  1GK6 A;  5AVV B;  1KOR A;  2YKQ A;  3KZI E;  4PV1 D;  2NPS A;  3TSI A;  5CCH D;  2K37 A;  2WSF H;  1KIL B;  1MKM A;  3MD0 A;  1LT9 B;  2WMM A;  3GHG B;  3FXD A;  2WSF J;  2XZR A;  1RF1 B;  3BRV B;  1QVF O;  1JMB A;  3JSV C;  4UB6 H;  3HE5 A;  1SQX J;  3PJS K;  2OYO A;  2KZI A;  3JCU H;  3D70 A;  4JF7 A;  4U7J A;  1LT9 C;  4PV1 C;  2LKM A;  1L0L G;  1GL2 A;  5CCH C;  3CD6 P;  4OGQ D;  1VF5 B;  2G8Y A;  3L71 G;  1JNM A;  1HBW A;  2POH A;  4GT1 A;  2WSC J;  1PGO A;  2W6J H;  2KOG A;  4OH8 B;  4WBA A;  3G6E P;  4U3F D;  2KZJ A;  1DX7 A;  1YI2 P;  4GDO A;  2N1T A;  1SQX G;  1NTK D;  3HE4 A;  4OGQ C;  2BCC D;  4LGD E;  1VQ9 P;  4HYT B;  2C0X A;  2V7Q H;  3GLM A;  1EXI A;  2Y0E A;  2M3E A;  1FZF A;  1UIX A;  1SQV J;  2V7Q J;  1VL2 A;  1KD1 Q;  1FAV A;  3AEA C;  1URQ D;  3B71 A;  1NTZ J;  4YXD C;  1A02 F;  1H0T B;  4XFJ A;  4M3L A;  1U57 A;  1JY2 P;  2JKV A;  1GU4 A;  2C9N Y;  1HTL C;  3S9O A;  1NU1 J;  2WSE H;  2E42 A;  2PFX A;  3HRN A;  2C9L Y;  4ZKP A;  5TIS E;  3R4Y A;  1KB9 D;  1VQK P;  4DT0 A;  1URQ C;  2OYH B;  3AEB C;  1IK7 A;  1JY3 N;  1S5L H;  3BAT A;  1NYH A;  1T6A A;  1G2C A;  3R2P A;  3Q5S A;  1LTS C;  2GA1 A;  3M0A A;  1T8Z A;  2Q5U A;  3H1K E;  2FBW C;  2Q3E A;  4PD4 I;  1NKN A;  5E79 H;  1QGK B;  3WU2 E;  1NGM B;  1R5S A;  1LT1 A;  1SVF A;  5CBO A;  1ZRT D;  3MGN A;  2IFN A;  1NU1 G;  1YJN P;  1EZV I;  4MN4 C;  5CJ0 A;  4ZKU A;  2ZAE B;  2XKM A;  1L4A A;  1T3J A;  2GUV A;  1LTT C;  4R4L A;  4H44 B;  3V5B A;  4Y99 B;  3L70 D;  3TGU G;  2BAS A;  4TT3 H;  1FZC B;  1KTM A;  1EC5 A;  1K9M Q;  1HVV A;  3M9B A;  3OA7 A;  1K05 A;  3U1A A;  5APU A;  1NTM D;  4Y99 C;  3HTK A;  1IZN B;  1P84 E;  1FZC C;  4DCK A;  3L73 J;  5AVT B;  1KYO D;  2ZFC A;  3CCJ P;  2OYI A;  2V4H A;  1RF0 A;  1KQF B;  2HR3 A;  2J59 M;  5AVU B;  1PIX A;  4PJ0 E;  4IFF A;  3H32 B;  3HUS C;  3KZI H;  3F5H A;  1XTG B;  2XV5 A;  2NZ2 A;  4BWN A;  1PP9 D;  3E1I A;  1X79 B;  4I7Z B;  1PPJ D;  5B5E E;  4HH2 A;  1VQ8 P;  3L73 G;  2B87 B;  4ASW A;  3G4S P;  1SQB D;  4EIJ A;  5KAF E;  3FWN A;  4I7Z C;  4L76 A;  3H6P A;  2OTL P;  4RO0 A;  2QM7 A;  3KXD A;  1JMM A;  3PLN A;  3WUU A;  3G71 P;  3CCE P;  5B66 E;  3WUV A;  4AYC A;  1AQ5 A;  1HF9 A;  5M1B A;  1BDC A;  4N6J A;  1ZR4 A;  3G9R A;  2AXC A;  4BXL A;  3T97 B;  5APQ A;  3L35 A;  3H1J E;  1P84 I;  3HD7 B;  1IJD B;  2HPC A;  3CXH D;  2K3R A;  1OMI A;  2O1J A;  3LW5 H;  3SWK A;  1SFC B;  3LW5 J;  1KQS O;  4R4M A;  3RK3 D;  3HD7 C;  2HG5 D;  3AE1 C;  1S9K E;  1AVY A;  1JY3 P;  5BU8 B;  1EZV G;  5GTI H;  4H0L D;  1SQV K;  2FFD B;  4WY4 B;  3VN0 A;  2OGU A;  3AED C;  2P58 A;  3RK3 B;  4HKZ H;  2PRR A;  1NTZ K;  1J1D C;  1SQQ J;  4CPG A;  4WY4 C;  1MV8 A;  2K9J B;  1YTZ T;  3KHU A;  3RK3 C;  4GOF A;  3QWO C;  2G3A A;  4H0L C;  2KI7 B;  5TJH A;  2K88 A;  2KNC B;  3AEC C;  5AVY B;  2XND H;  3H1K J;  3L75 D;  1GD2 E;  4YTP C;  4XE5 B;  3RK2 B;  2M5A A;  2D2C D;  2B9B A;  1EDJ A;  2WZ7 A;  4ZNC A;  3H1H J;  2HOD A;  2IBZ I;  2XU6 A;  1BE3 D;  4L75 A;  1JTH A;  3RK2 C;  1JCC A;  1BCC J;  3GF3 A;  3H1L D;  1DIP A;  3WMM 0;  4U3F E;  1N7S B;  1KZU B;  3H1K G;  3AE4 C;  1SQP J;  2D2C C;  1YJW P;  1N73 C;  1P84 H;  2FYN C;  1DH3 A;  4QMA A;  1S72 P;  1NTK E;  2H43 A;  2BCC E;  3V4W A;  1JB0 J;  1PL5 A;  1M1K Q;  4EYY Q;  4D6T D;  1N7S C;  3BCC D;  2KB7 P;  1AA0 A;  2K1A A;  1IFN A;  1AVO A;  2RH0 A;  5DJT B;  1LTG C;  3CWB J;  4PJ0 H;  1M56 D;  1PGJ A;  3O6Q A;  1K73 Q;  2E5T A;  2WWW A;  1QVG O;  3W67 A;  2AXT H;  1R8E A;  4EOT A;  1KFN A;  2PP6 A;  3M9H A;  4C7N B;  2R5D A;  1KB9 E;  2ZT9 D;  3IAO A;  3B5N D;  1H8A A;  1NHL A;  3NXS A;  3MUD C;  3B5N B;  1QL1 A;  2J58 A;  2LR2 A;  1FC2 C;  1GW4 A;  5KKZ B;  1OW6 A;  1ZME C;  2I1J A;  1KMI Z;  1EXJ A;  4L73 A;  4LLH A;  3B8E B;  4JPZ B;  3CME P;  5AW6 B;  3TF5 A;  4WWI A;  3AE2 C;  2NPS D;  3LIE A;  3B5N C;  1SQX D;  1M57 D;  3USS A;  2N9Y B;  1X8Y A;  1L0L J;  5KKZ C;  2HFE D;  1M1J A;  3KQG A;  3II6 A;  3L70 E;  3L71 J;  1RE3 C;  1VQ5 P;  4IL6 E;  1JUN A;  2JWA A;  1R5L A;  2ZVO B;  1SQB K;  1T2K D;  5K5G B;  4PV1 B;  3BAS A;  3AE9 C;  3C9I A;  1NTM E;  1WT6 A;  3BVH A;  2NPS C;  1GL2 D;  1MFZ A;  2QIW A;  4N78 D;  3TNU B;  5KLV J;  1GL2 B;  1ZP0 C;  1NAY A;  1KIL A;  1KYO E;  3GHG A;  1RQU A;  2IBZ G;  3O8Z A;  1SQV D;  1RF1 A;  1T2K C;  3PRJ A;  2QJP B;  2UWJ E;  1RE4 A;  4OGQ B;  5CMZ A;  1GL2 C;  2N1T D;  1NTZ D;  1VQL P;  1H89 A;  3AE3 C;  5H2F E;  1PP9 E;  1PPJ E;  1SQQ K;  3Q2Y A;  2WIT A;  5GTH E;  3HE4 B;  2E5Y A;  3IR9 A;  2QJP C;  1T3U A;  1NU1 D;  5KLV G;  1YQ3 C;  3GMA A;  3M91 A;  2WPV B;  1HWT C;  1SQB E;  2A06 G;  1QEX A;  2N1T C;  3K5B A;  5KLI B;  5BVZ A;  3UIA A;  3MHV A;  1OW8 A;  1X22 A;  1URQ B;  3IFM A;  1VQP P;  2M8R A;  2Z4E A;  5KLI C;  5APS A;  2I1K A;  1M7L A;  3CLQ A;  2WSE J;  1BGY J;  5KJ7 A;  4O9B A;  3N7N A;  3V2N A;  2H89 C;  3V4Q A;  1L0N J;  2W6B A;  3EWK A;  4YPC A;  3TGU J;  2L5G B;  1ZR2 A;  1FDO A;  1OIP A;  2O1K A;  1DEB A;  1FS0 E;  1SQP K;  5APT A;  1FBM A;  2OYH A;  5AW5 B;  1L4A D;  3RK3 E;  3TK1 A;  3Q5R A;  1NH4 A;  3IN6 A;  3CL3 D;  1K8A Q;  2XDJ A;  2R5B A;  4U3F G;  1BGY G;  3RBX A;  3L73 D;  2W83 C;  3AE8 C;  2B88 A;  1L0N G;  3TYY A;  3CMA P;  1NTK G;  1VQN P;  3A5T A;  3D6Z A;  3A0B E;  2VRS A;  5APY A;  1MFT A;  3CI9 A;  1L2P A;  2WQY C;  3H1I J;  1LP1 B;  1JY2 O;  3L75 E;  3IF4 A;  2O01 N;  3HUS B;  3M0D A;  4JQ0 D;  3Q5P A;  2OYI B;  1Q82 Q;  1J1E B;  4JYB A;  2GM4 A;  2QG4 A;  2FYU J;  2FXM A;  1AQT A;  3L74 J;  2Y0C A;  1N8R Q;  1BE3 E;  2OYI C;  1J1E C;  1USE A;  4PD4 D;  3H1L E;  3P32 A;  3H1I G;  2YNY A;  1L0L K;  2YMK A;  1EZV D;  3H32 A;  3M9Q A;  3SFD C;  5AVW B;  2FYU G;  3P7K A;  4D6T E;  2Q9I A;  3AEE C;  1KYO H;  2IYP A;  3BCC E;  4JYC A;  3L74 G;  1KQL A;  1LTI C;  2YO3 A;  2QVA A;  2KK7 A;  1SQX K;  2R3S A;  3L70 G;  3VYI A;  2YMY A;  5KLV K;  2WT7 A;  2BEQ D;  2AEJ A;  4IFM A;  1FOS F;  1S2E A;  1LTA C;  1RQV A;  1OVR A;  2RN0 A;  2YKO A;  2CPS A;  5GTH H;  4I1L A;  2HPC B;  1YYC A;  3A0H E;  2WTY A;  2MKV A;  3S4R A;  3VMX A;  2FXP A;  1KN7 A;  1SQQ D;  3MIW A;  1Q2N A;  1OWA A;  2Q6Q A;  2YKP A;  5APX A;  2O01 H;  1J1D B;  3T97 A;  3V6I A;  4HJG H;  3VMZ A;  1G1J A;  3HD7 A;  5CHX A;  4AQR D;  2ZXX A;  2O3J A;  1FDI A;  1HGZ A;  3CX5 D;  2FXO A;  3CPW O;  4L74 A;  1SFC A;  3C8V A;  4H0L B;  1ZW0 A;  1SQX E;  1YHQ P;  5TIS H;  4IFD K;  2E76 D;  3S1K A;  4UB6 E;  2FFD A;  3JCU E;  4WY4 A;  3U1C A;  3A3Y B;  3H1H D;  1NU1 K;  5CCG A;  2QJK C;  2WVR A;  1GDT A;  3L72 D;  4OVN F;  3CCR P;  3GF7 A;  1BCC D;  3B4S A;  5AVS B;  3WU2 H;  1FJP A;  2K9J A;  2E76 C;  2WPQ A;  1NKZ B;  1SQP D;  1IK9 A;  4GKG A;  1P84 D;  2KNC A;  5KAI E;  1OW7 A;  2HLO A;  4BRY B;  1SQV E;  2P67 A;  1LGH B;  5AW4 B;  2QA4 P;  2D2C B;  1N73 B;  2FYN B;  4W7Z A;  2KS1 B;  3A0B H;  1FZE A;  2YIU C;  3CCU P;  1NTZ E;  3CWB D;  2MJZ A;  3OJA B;  1H88 A;  5AW3 B;  1JY3 O;  1NVO A;  2IFM A;  1USD A;  3M06 A;  2YXR B;  3L37 A;  1SS1 A;  3PP5 A;  3CCV P;  1N7S A;  2WPR A;  1D7M A;  2K9Y A;  1IFM A;  2NRG A;  1OVV A;  1U7M A;  1AFO A;  3SSU A;  2WPS A;  3QH9 A;  4HB1 A;  5AW8 B;  3D71 A;  1CI6 B;  1OVU A;  3VMY A;  1LWU A;  1LNQ A;  1JY2 N;  2KUB A;  2FYU K;  1VDF A;  4WVZ A;  2P7J A;  5CBN A;  4K3A A;  5B5E H;  4A7P A;  3KDP B;  1E5W A;  2W6A A;  3L75 G;  5APW A;  1AV1 A;  1UII A;  5KAF H;  1CZQ A;  1L0L D;  3G3Z A;  2A45 I;  5BU5 A;  1HGV A;  3V2Q A;  1LTJ B;  2IBZ D;  3L71 D;  2ZT9 B;  1OX3 A;  1Q86 Q;  2KSE A;  2PAJ A;  3BRT B;  2W90 A;  5DJU B;  1KC8 Q;  2YO2 A;  4C7N A;  4Y28 J;  3CC2 P;  4YXW H;  5B66 H;  1ZRT E;  1LTJ C;  2ZYD A;  2ZT9 C;  2H88 C;  3H1L G;  3KPE A;  3E1R A;  1Y47 A;  4EDF A;  4JBZ A;  3PTZ A;  1NO4 A;  1PZQ A;  3EQ2 A;  3L73 E;  4EI2 A;  5KLV D;  4K35 A;  1ZV8 A;  4IL6 X;  2A06 D;  1IFD A;  2NPS B;  2E43 A;  2H7H A;  3A0H H;  1M8O B;  1EDI A;  3H1J J;  5C39 A;  1RY3 A;  1RE3 A;  4IOI H;  5AVZ B;  4LC1 A;  1M1J C;  1NWQ A;  2JJL A;  2XNX A;  1KV4 A;  1KIL D;  1FE6 A;  3A2A A;  1TU3 F;  3HE5 B;  1S1C X;  2IYO A;  3SWF A;  5AW0 B;  3KYQ A;  4I6M C;  2FKW B;  1GZL A;  3I5C A;  1DD4 A;  3CCM P;  3P8C D;  1W2B O;  2JO1 A;  3LID A;  4N3Y B;  2JWD A;  1LT9 A;  3OW2 O;  3MTU E;  5CCH A;  3NMD A;  2W27 A;  1SP4 A;  1J2J B;  2JEE A;  1OXZ A;  2FY8 A;  4OWF A;  2L91 A;  2LXB A;  3H1J G;  1YIT P;  1VF5 D;  3TNU A;  1KIL C;  1KB9 I;  5APV A;  3FX0 A;  3GHG C;  1Z56 A;  2B89 A;  4PD4 E;  1RF1 C;  3A7O A;  2WSC H;  2N1T B; 
#chains in the Genus database with same CATH homology
 1P84 H;  3TGU G;  1BCC G;  1SQV G;  1EZV G;  3L70 G;  5KLV G;  1NTK G;  3H1J G;  3L75 G;  1KB9 H;  2BCC G;  1NU1 G;  1BE3 G;  2A06 G;  1SQB G;  1SQX G;  2FYU G;  1NTZ G;  3H1L G;  1SQP G;  1L0L G;  3CXH H;  3H1H G;  1BGY G;  4U3F G;  4D6T G;  3H1I G;  1SQQ G;  4PD4 H;  1KYO H;  3CWB G;  3L73 G;  3H1K G;  3L74 G;  1PP9 G;  2IBZ G;  3BCC G;  3L71 G;  3CX5 H;  1PPJ G;  1L0N G;  1NTM G;  3L72 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...