2A06G

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 21
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2005-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2a06G00
1PPJG 1BCCG 1SQVG 3H1IG 5KLVG 1NTMG 1EZVG 3L70G 3CXHH 2BCCG 3L73G 4PD4H 4D6TG 1SQXG 3H1LG 1NTZG 3L74G 1L0LG 1SQQG 2FYUG 3L72G 1KYOH 1P84H 4U3FG 1BGYG 1NU1G 3BCCG 1PP9G 3CX5H 3L71G 3TGUG 1L0NG 1SQBG 1NTKG 3L75G 3H1KG 1KB9H 2IBZG 3H1HG 1BE3G 3CWBG 3H1JG 1SQPG 2A06G
chains in the Genus database with same CATH superfamily
3AEDC 1NTKD 4IL6H 4DOJA 3HUSB 3O8ZA 1URQC 2L5GB 1OW8A 1HVVA 3H1LJ 1YYCA 5APQA 2VRSA 4GT1A 3GF7A 2XU6A 3TGUG 3EWKA 2KSJA 2P2UA 1LTIC 1MZ9A 4H13D 1VQOP 1S5LX 5L8RJ 2XV5A 3AE3C 1VQ5P 1T2KD 3LW5H 3E1RA 1LWUC 1SQVD 5CMZA 1P84H 1VQ4P 2FY8A 2FYUD 4ASVA 2KNCB 2YMKA 3JCUH 3HUSA 3H32A 3SSUA 3L72E 1MV8A 2ZVOB 5AVTB 2WWWA 4PD4D 2N1TD 4EOTA 4R4MA 3B5ND 2WZ7A 1G2CA 3E7KA 4DJGA 3CCEP 2JWDA 1R8EA 1SQXD 3KXDA 2PGDA 1JO5A 3CX5D 3IN6A 2E43A 1HWTC 1L0ND 1KORA 1EZVG 3ABVC 3L70J 1KQGB 4D6TJ 5AW3B 3SWFA 1NH4A 1GK6A 1BGYG 1YJ9P 1EDIA 3P8MC 4WB4A 1JTHB 3L74D 1PL5A 2BCCE 3H1JG 4C7NB 1BSHA 2KP8A 2YXRB 3RK3B 1GL2B 2B88A 1MUUA 4U3FJ 1YBKA 4W7YA 2JJLA 2HODB 3V4QA 1JCDA 2OYOA 2Y0CA 1SQPG 2O3JA 1IC2A 1YQ4C 5AW0B 1JTHA 1VF5C 2KXPB 1R5SA 2CK3H 2WPSA 3B4SA 2C0XA 4BWNA 2OYIC 4UB6E 1KYOI 1N2DC 4TT3H 1M1JB 3Q5PA 2QE7H 2WSSH 3HE4B 1RE3A 4PD4H 3V2QA 2Q3EA 1AJYA 3MHVA 3NTNA 1NAYA 1FZCB 2FFDA 2L91A 1NVOA 1U7JA 1IZNB 1X8YA 1FZFA 1JM0A 4I1LA 4Y99C 1IFMA 3L73D 1W5CE 2E74C 3WMM0 2I1JA 3CX5H 1SQPK 1M8OB 4B86A 1EDKA 2WSCJ 1J1EB 1LT9C 1FS0E 2ZT9C 2Y0EA 3Q2YA 1YI2P 4C7RA 1PIXA 4H13B 5APWA 3CPWO 1J1DC 4JPZB 2R5DA 2YNYA 1YIJP 1VQ8P 2E74D 3M9HA 1A02F 2O1KA 3USSA 3CI9A 4RESB 3V2NA 2XNDH 2RMZA 2O1JA 3VTPC 3L72D 5GTIH 1PP9J 3R2PA 1FOSE 3AEGC 1NU1D 3M0AA 1L0LE 5APTA 2N1TB 1FZEA 3HUSC 3B5NB 1KB9E 3WUTA 4WY4A 2A06D 3Q5RA 5AW2B 2W6JH 1KYOD 1LTAC 1MFTA 4Y28J 4BRYA 2IBZG 1VQKP 1VQ9P 1PGOA 3H1HJ 5KKZB 2KK7A 1Q82Q 3KZIH 2W6BA 3CC7P 2UWJE 1HH0A 2CPBA 1ZW0A 3Q5SA 3L71G 1BGYJ 2WSFH 3O6QA 2K37A 1NTMK 1N7LA 3CWBG 3H1LE 1DD4A 3IFMA 1EQ7A 1NTZK 3KDPB 3HTKB 2HYNA 3W67A 3OJAB 1PPJD 4H0LC 4N3YB 2N9BA 2BCCD 2WSEJ 3SWYA 1FZBA 1NTKG 2OYHA 2C0WA 1Q81Q 1YJWP 4OGQD 1SQPJ 3FXDA 1K05A 2P7JA 3R4YA 3S9OA 4HJGH 2N9YB 2K9JB 3CC2P 2R32A 3CMAP 1WRGA 1CI6A 1L2PA 1SVFA 1FOSF 2ZXEB 3M91A 3L75G 2E76D 2P10A 1MKMA 4H0LD 1SQVG 2PAJA 2XDJA 2BEZF 4UB8H 4BXLA 1N73B 2IZ0A 1AFOA 2JKVA 1YJNP 1BCCD 2ZFCA 1YTZT 4I7ZC 3UIAA 1EC5A 4PV1B 3HD7B 3PRJA 4HH2A 1NWQA 2XZRA 3WUVA 4HB1A 1QLED 1KV4A 1Q7YQ 1H0TB 1S3JA 1GL2C 4EYYQ 1RE3C 3PHLA 1S5LE 1KYOH 1M90Q 1NTKK 5CCGA 3LIDA 4ZKUA 3L70E 1KFNA 1NAFA 2J5UA 2K9YA 2ZAEB 3L4FA 1VPCA 4D6TE 2QSIA 1ZP0C 4XFJA 3VMXA 1SQXG 2J58A 3CXHI 3HD7A 3FX0A 3OAKA 1NTZD 1L0NG 2W90A 1SQVK 4JBZA 1M1JC 5E79H 2CPSA 1H88A 2AXTH 5TJHA 1KMIZ 1RF1B 2FYUK 3LW5J 4U3FE 3L74G 1M7LA 4Y99B 4OWFA 1FZCC 3T97A 1GU5A 1NKNA 2WMMA 1FJKA 1Q86Q 2K88A 3BRTB 1JY3N 1SLQA 3IF4A 2D2CD 1GMJA 2HLOA 3WUUA 1HGVA 1SQQD 2M8RA 3RBXA 2KS1A 1N7SA 2YKPA 2WPRA 3TK1A 1SQXK 3VYIA 2WTYA 1VQ6P 1J1EC 5AW4B 2LR2A 3TYYA 2KUBA 2MJZA 4TLFA 4AUWA 4H13C 3H1ID 3BVHA 3KZIE 3L36A 2OQQA 1G1IA 4L75A 3L71J 3A0HH 5APXA 4HYTB 3CWBJ 3WU2H 1LJ2A 1SQBD 2WPVB 1RY3A 2JWAA 3AEAC 3H32B 5KJ7A 2FXPA 1YHQP 3H1LD 1WMKA 3NMDA 5AVRB 3BCCJ 5AVYB 2N1TC 3AEBC 1ZRTD 3B71A 4O9BA 1KQSO 3B5NC 4LGDE 1G2CB 3C9IA 3L73G 1IFPA 3CXHD 2NPSB 1PZQA 3JSVC 5AVWB 3AECC 4OGQB 1OVRA 1CW5A 5AVZB 1Z56A 5KKZC 3L75J 1SQVJ 4I2LC 3D71A 1JB0J 2Z5IA 4AYCA 1PP9E 3FWNA 2E76B 5AW7B 4UB8E 4H0LB 2IYPA 1GDTA 1FU1A 2QVAA 2IDBA 3P8CD 2M0BA 2NPSA 1N8RQ 2YIUB 3CCMP 3TNUA 2E5YA 3V2PA 5AW6B 1NHLA 2A45I 1GU4A 4Z1MH 2WT7A 3CCVP 5KLVD 3H1HE 4L74A 4H44D 1NU1G 2PFXA 3HE5B 2WITA 2A06G 1NKZB 3C8VA 4IOIH 3K5BA 1BGYE 1KN7A 4ZKPA 5AVUB 1SQXJ 2KI7B 5KAFH 3L70D 3VMAA 2ITAA 4D6TD 3CD6P 4I7ZB 2R3CA 1L0NJ 5CCGC 1M56D 1LTTC 3A0BH 1DEEG 2H88C 5CCHA 1N73C 2HFED 1HF9A 1H89A 2AXTE 2QJKB 2Q5UA 1HGZA 1G1JA 1KILE 1SQPE 1RH5B 3HE5A 4R4LA 3CMEP 4PV1C 3HD7C 1SFCA 1ZMEC 1QL2A 4U3FD 1FDOA 2JDIH 1PPJG 2FFDB 1VQLP 3CCSP 2BCCG 1RF0A 2K1AA 5CCGD 1NU1K 3TF5A 3AE2C 2ZYDA 4L73A 3CC4P 1PV3A 2FXMA 2E75B 1FE6A 3ITKA 2IFNA 3IR9A 2D2CB 1NO4A 2LXBA 2ZYAA 4ASWA 1QX8A 4PV1D 3M0DA 3HD7D 1HJ0A 3QWOC 2J59M 2RKLA 2AEJA 2KZIA 3PTZA 3W68A 2PRRA 1BCCG 4DCKA 1OXZA 1RF1C 2NRGA 4AQRD 4PJ0H 3D6YA 5CJ0A 2M5AA 3MUDA 2KZJA 4M3LA 1HBWA 4IL6E 2WSFJ 4JQ0D 3TGUJ 2KYVA 1VL2A 1OVUA 2I1KA 3SWKA 1FZGA 3A2AA 3L73J 2P1JA 4W7ZA 3V4WA 5KJ7C 1LTJA 4WY4B 1N7SD 3H1KG 3EQ2A 2H8PD 1S2EA 1KQLA 1P84E 1YTZI 3BASA 1IFNA 3N4XA 3RK3E 1NTMG 3TSIA 4BRYB 5DJUB 5APYA 3JCUE 1NTZG 1Y47A 3MZWB 5KAIH 1JMBA 2OTJP 3CL3D 1BSNA 3II6A 2POHA 4A7PA 4ZNCA 2ZXXA 3KQGA 2FKWB 1IFDA 1PP9D 2B9BA 4JYCA 3O6QB 5KJ7D 4C46A 1T6AA 2KLUA 2C9LY 2K3RA 2E42A 4N78E 1K8AQ 1NU1J 1FAVA 1JCCA 1W2EA 3GF3A 1NGMB 4U7JA 1L4AA 2NPSC 4H44B 1RHZB 1JUNA 3H1HD 2OYHB 2R44A 1IFJA 3L71E 4K3AA 1VQMP 1SQQG 3SFEC 1PFIA 1R5LA 4OGQC 3CWBE 2LKMA 1JNMA 1LP1A 2YMYA 5TISH 1BE3G 2W83C 1URQA 1AV1A 1CI6B 3H1IG 5B66H 3H1JJ 1SS1A 2JO1A 1NYHA 3BCCE 2E76C 1AA0A 1DX7A 1D7MA 3BRVB 2NPSD 1BDDA 1SQBG 5CBNA 3M06A 1OWAA 2Z5HA 2YIUC 4IFMA 1H8AA 3JC22 1KQFB 1QGKB 3AE1C 1LWUA 3NFQA 5KLIB 4WWIA 1AQTA 4IL6X 3SFDC 1T3JA 1IK7A 3F89A 3VP8A 3L75E 3VOPA 1LTGC 1JY3P 1SQVE 1OX3A 5DJTB 2WVRA 5B5EH 1YITP 1L0LK 1KB9I 1LNQA 1SQQK 4YXDC 1IJDB 1FZAA 5APSA 2FYUG 1QVFO 4PD4E 1RF0C 1OW6A 5CBOA 1KD1Q 2XKMA 4EIJA 1A02J 2W8ZA 1USDA 5CCHD 2XNXA 1JMMA 5K5GB 1BCCJ 5AW1B 3MGNA 2QJKC 4WVZA 3V6IA 3RBZA 1RE4A 3G6EP 3U59A 2H43A 3LIEA 3M0DC 3HRNA 1SFCD 2WQYC 1SQBK 2B89A 4YPCA 3RL0D 1SQXE 3A3YB 3T97B 2FFDC 3CX5E 5KLVG 4NPEA 4EDFA 2JEEA 1Q2NA 3AE5C 2ZJSE 1L0NE 2Q9IA 3ZDMA 3I56P 2M3EA 1Y8AA 2E75C 1JY2N 5APUA 2D2CC 3H1KJ 3L74E 4D6TG 1XTCC 2Y9YA 1NTMJ 2KS1B 1N7SB 1NTZJ 3U1AA 2IFMA 2OGUA 4GOEA 4GOFA 4N6JA 2YKOA 5GTIE 2E75D 3F5HA 2M3BA 2V7QH 4OH8B 3OW2O 2YXQB 2AEFA 1OIPA 4U3FG 1L0LD 1UIIA 2O01H 1QEXA 5KLVK 1KB9D 3G3ZA 1QL1A 1U57A 3CCJP 2Q7CA 3PLNA 1X0TA 2Q6QA 3V2RA 1LGHB 1SQQJ 4WY4C 3P32A 2H89C 3H6PA 1ZLLA 3M9BA 1BE3J 1UIXA 2OTKE 5TISE 3C1LA 2P67A 2QJPB 3H1IJ 1VQ7P 5CHXA 4W80A 1LTSC 3TGUE 2OTLP 2G8YA 2QRXA 2A45G 3RK2C 3L73E 1SQBJ 3CCLP 1NTKJ 3KYQA 1LT9A 2HR3A 3BCCD 3A5TA 2QJYB 4WY4D 1MFZA 1LT1A 2H7HA 3AEFC 1JY3O 3KHUA 3TNUB 1W2BO 2SPZA 1AVOA 4ZMDA 2WT7B 4JF7A 1L4AD 3MP7B 1KILB 1GTWA 3E1IA 1USEA 4H44C 1DH3A 1FBMA 1YQ3C 3L75D 2OYHC 2KB7P 5AVXB 1GK4A 3RK2D 2QEXP 1EDLA 5B5EE 1OMIA 3G4SP 2FYUJ 2RN0A 1EDJA 2FYNB 3PH0A 1T8ZA 1S72P 1URQD 5CJ4A 5KTBA 2NZ2A 1FJPA 1FC2C 1NU1E 1KTMA 5EFWB 1OW7A 3L72G 4KJMA 1KILA 3VN0A 2A06E 1PP9G 4KT0J 1EZVE 1X9VA 1KB9H 1IO4A 1KYOE 5KLIC 1SFCB 5KLVJ 5AW9B 3RL0B 2KNCA 4K35A 1RE4C 3H1JE 3G9RA 2ZYGA 2GM4A 5GTHH 3H1HG 1X79B 1U7MA 5AVSB 1AVYA 3RL0g 4CPGA 2O01N 5E79E 4RO0A 3L74J 1PGQA 2PP6A 1PPJE 4GIFA 5AVVB 3Q3DA 2MKVA 1OFCX 1S9KE 3CXHH 1PGJA 2KIKA 4YTPC 1TU3F 1K73Q 2LXCB 2YO3A 2QM7A 2B87B 3AEEC 2M5AB 1Y9BA 2FYZA 5M1BA 3U1CA 3AE4C 1ZR4A 1N86A 4IFDK 2Y9ZA 3VP9A 4C7NA 1BCCE 1EZVI 2IPPA 3AE7C 3D70A 2Y0DA 1S4XA 5AW5B 3FXEA 1LTJB 5BVZA 1GL2A 4RKUJ 4GKGA 2HG5D 4GDOA 1N7SC 3A0HE 4GODA 1FDMA 3GHGB 4OVNF 2B87A 2HODA 3WU2E 1ZN5A 1T3UA 1JEKA 4WBAA 3VMYA 1VF5D 3TGUD 2Q1KA 1S5LH 1K04A 2KLVA 3AE9C 1E5WA 3H1KE 2FBWC 2JP3A 1RQUA 1M1JA 3P7KA 2E5TA 1NTME 1SP4A 3HE4A 1NTZE 2QIWA 3BATA 3CCQP 2IZ1A 3GHGA 1FZCA 2BEQD 1L4AB 3FGAD 1GZLA 1KFMA 1PGPA 3EFGA 3V5BA 1CSBA 5AW8B 3RK2B 3FWLA 2AEMA 2QJPC 1LP1B 1S1CX 1GW3A 2I8DA 3EFFK 2QM8A 1URQB 5H2FH 2JR8A 2IBZE 1X22A 1Q90D 1ZOYC 1ZV8A 3L72J 1WT6A 3OA7A 2BASA 3H25A 2ZT9D 2QJYC 4LC1A 3TDKA 1SQQE 3MIWA 2P58A 1L0LG 3D6ZA 1QVGO 1BE3E 1EZVD 1LWUB 1NOHA 3AE6C 3S4RA 3H1IE 1KILC 5KAFE 2KSEA 1OVVA 3M9QA 2HPCB 3B8EB 3IAOA 2A45H 3A7OA 1BGYD 4MN4C 5GTHE 4I6MC 2FXOA 1JY2P 3H1JD 3A0BE 1SQBE 3CLQA 1NTKE 2FYNC 2QG4A 2N1TA 3QH9A 3B5NA 3KPEA 2R3SA 3Q1MA 4HKZH 1P84I 1GD2E 1ZRTE 3H1LG 2WSCH 2YO2A 1KILD 1SQPD 2BCCJ 5CCHC 3CCRP 3CXHE 2HPCA 2GA1A 3MD0A 3G71P 3BCCG 1S9KD 1VQPP 2IX7C 1E79H 1K9MQ 1KC8Q 1BDCA 1SFCC 2FYUE 1HTLC 3I5CA 1ZR2A 2V7QJ 4KHXA 3RL0C 2IBZI 1GW4A 2Q3IA 1IFIA 2IYOA 1M1KQ 2GUVA 2O01J 5BU8B 1HUCA 3HTKA 3PP5A 1M57D 4DZOA 3P8CE 1J2JB 1NJIQ 3L35A 4RJTA 1HJBA 3GLMA 2GUSA 4LLHA 4PJ0E 2R5BA 5KLVE 3I55P 1DIPA 2K9JA 4L76A 2Z4EA 1VDFA 4DT0A 5C39A 5AVQB 3RK3C 1EXIA 2RH0A 2DW3A 3VMZA 3GG2A 1VF5B 3L37A 3MUDC 1DEBA 3GMAA 2WPQA 3S1KA 1N73A 1KZUB 3NXSA 2OYIB 3PJSK 3GW6A 2G3AA 3H1KD 2ZVNB 3L70G 1JOCA 3N7NA 1NTMD 1OZHA 1XTGB 1P84D 2W6AA 5KAIE 2WSEH 3RK3D 1H0TA 1GL2D 5BU5A 1LTJC 4IFFA 4XA4A 4QMAA 2QA4P 2YKQA 3CCUP 1DD3A 3GHGC 1VQNP 2OARA 2AXCA 3RGUA 1ZXGA 4PD4I 2C9NY 2OYIA 2E74B 4JYBA 5H2FE 2KOGA 5APVA 1FDIA 1EXJA 4NPFX 4EI2A 2IBZD 4N78D 1RQVA 3AE8C 1LT9B 1CZQA 1L0LJ 2ZT9B 4UB6H 1IK9A 1RF1A 1JY2O 4XE5B 1J1DB 4YXWH 3CX5I 3L71D 4NPDA 1BE3D 3CWBD 1L4AC 2W27A 1L0NK 5B66E 2V4HA 1AQ5A 1T2KC 1LTBC 3MTUE
chains in the Genus database with same CATH topology
1PPJG 1BCCG 1SQVG 3H1IG 5KLVG 1NTMG 1EZVG 3L70G 3CXHH 2BCCG 3L73G 4PD4H 4D6TG 1SQXG 3H1LG 1NTZG 3L74G 1L0LG 1SQQG 2FYUG 3L72G 1KYOH 1P84H 4U3FG 1BGYG 1NU1G 3BCCG 1PP9G 3CX5H 3L71G 3TGUG 1L0NG 1SQBG 1NTKG 3L75G 3H1KG 1KB9H 2IBZG 3H1HG 1BE3G 3CWBG 3H1JG 1SQPG 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PPJ G;  1BCC G;  1SQV G;  3H1I G;  5KLV G;  1NTM G;  1EZV G;  3L70 G;  3CXH H;  2BCC G;  3L73 G;  4PD4 H;  4D6T G;  1SQX G;  3H1L G;  1NTZ G;  3L74 G;  1L0L G;  1SQQ G;  2FYU G;  3L72 G;  1KYO H;  1P84 H;  4U3F G;  1BGY G;  1NU1 G;  3BCC G;  1PP9 G;  3CX5 H;  3L71 G;  3TGU G;  1L0N G;  1SQB G;  1NTK G;  3L75 G;  3H1K G;  1KB9 H;  2IBZ G;  3H1H G;  1BE3 G;  3CWB G;  3H1J G;  1SQP G;  2A06 G; 
#chains in the Genus database with same CATH topology
 3AED C;  1NTK D;  4IL6 H;  4DOJ A;  3HUS B;  3O8Z A;  1URQ C;  2L5G B;  1OW8 A;  1HVV A;  3H1L J;  1YYC A;  5APQ A;  2VRS A;  4GT1 A;  3GF7 A;  2XU6 A;  3TGU G;  3EWK A;  2KSJ A;  2P2U A;  1LTI C;  1MZ9 A;  4H13 D;  1VQO P;  1S5L X;  5L8R J;  2XV5 A;  3AE3 C;  1VQ5 P;  1T2K D;  3LW5 H;  3E1R A;  1LWU C;  1SQV D;  5CMZ A;  1P84 H;  1VQ4 P;  2FY8 A;  2FYU D;  4ASV A;  2KNC B;  2YMK A;  3JCU H;  3HUS A;  3H32 A;  3SSU A;  3L72 E;  1MV8 A;  2ZVO B;  5AVT B;  2WWW A;  4PD4 D;  2N1T D;  4EOT A;  4R4M A;  3B5N D;  2WZ7 A;  1G2C A;  3E7K A;  4DJG A;  3CCE P;  2JWD A;  1R8E A;  1SQX D;  3KXD A;  2PGD A;  1JO5 A;  3CX5 D;  3IN6 A;  2E43 A;  1HWT C;  1L0N D;  1KOR A;  1EZV G;  3ABV C;  3L70 J;  1KQG B;  4D6T J;  5AW3 B;  3SWF A;  1NH4 A;  1GK6 A;  1BGY G;  1YJ9 P;  1EDI A;  3P8M C;  4WB4 A;  1JTH B;  3L74 D;  1PL5 A;  2BCC E;  3H1J G;  4C7N B;  1BSH A;  2KP8 A;  2YXR B;  3RK3 B;  1GL2 B;  2B88 A;  1MUU A;  4U3F J;  1YBK A;  4W7Y A;  2JJL A;  2HOD B;  3V4Q A;  1JCD A;  2OYO A;  2Y0C A;  1SQP G;  2O3J A;  1IC2 A;  1YQ4 C;  5AW0 B;  1JTH A;  1VF5 C;  2KXP B;  1R5S A;  2CK3 H;  2WPS A;  3B4S A;  2C0X A;  4BWN A;  2OYI C;  4UB6 E;  1KYO I;  1N2D C;  4TT3 H;  1M1J B;  3Q5P A;  2QE7 H;  2WSS H;  3HE4 B;  1RE3 A;  4PD4 H;  3V2Q A;  2Q3E A;  1AJY A;  3MHV A;  3NTN A;  1NAY A;  1FZC B;  2FFD A;  2L91 A;  1NVO A;  1U7J A;  1IZN B;  1X8Y A;  1FZF A;  1JM0 A;  4I1L A;  4Y99 C;  1IFM A;  3L73 D;  1W5C E;  2E74 C;  3WMM 0;  2I1J A;  3CX5 H;  1SQP K;  1M8O B;  4B86 A;  1EDK A;  2WSC J;  1J1E B;  1LT9 C;  1FS0 E;  2ZT9 C;  2Y0E A;  3Q2Y A;  1YI2 P;  4C7R A;  1PIX A;  4H13 B;  5APW A;  3CPW O;  1J1D C;  4JPZ B;  2R5D A;  2YNY A;  1YIJ P;  1VQ8 P;  2E74 D;  3M9H A;  1A02 F;  2O1K A;  3USS A;  3CI9 A;  4RES B;  3V2N A;  2XND H;  2RMZ A;  2O1J A;  3VTP C;  3L72 D;  5GTI H;  1PP9 J;  3R2P A;  1FOS E;  3AEG C;  1NU1 D;  3M0A A;  1L0L E;  5APT A;  2N1T B;  1FZE A;  3HUS C;  3B5N B;  1KB9 E;  3WUT A;  4WY4 A;  2A06 D;  3Q5R A;  5AW2 B;  2W6J H;  1KYO D;  1LTA C;  1MFT A;  4Y28 J;  4BRY A;  2IBZ G;  1VQK P;  1VQ9 P;  1PGO A;  3H1H J;  5KKZ B;  2KK7 A;  1Q82 Q;  3KZI H;  2W6B A;  3CC7 P;  2UWJ E;  1HH0 A;  2CPB A;  1ZW0 A;  3Q5S A;  3L71 G;  1BGY J;  2WSF H;  3O6Q A;  2K37 A;  1NTM K;  1N7L A;  3CWB G;  3H1L E;  1DD4 A;  3IFM A;  1EQ7 A;  1NTZ K;  3KDP B;  3HTK B;  2HYN A;  3W67 A;  3OJA B;  1PPJ D;  4H0L C;  4N3Y B;  2N9B A;  2BCC D;  2WSE J;  3SWY A;  1FZB A;  1NTK G;  2OYH A;  2C0W A;  1Q81 Q;  1YJW P;  4OGQ D;  1SQP J;  3FXD A;  1K05 A;  2P7J A;  3R4Y A;  3S9O A;  4HJG H;  2N9Y B;  2K9J B;  3CC2 P;  2R32 A;  3CMA P;  1WRG A;  1CI6 A;  1L2P A;  1SVF A;  1FOS F;  2ZXE B;  3M91 A;  3L75 G;  2E76 D;  2P10 A;  1MKM A;  4H0L D;  1SQV G;  2PAJ A;  2XDJ A;  2BEZ F;  4UB8 H;  4BXL A;  1N73 B;  2IZ0 A;  1AFO A;  2JKV A;  1YJN P;  1BCC D;  2ZFC A;  1YTZ T;  4I7Z C;  3UIA A;  1EC5 A;  4PV1 B;  3HD7 B;  3PRJ A;  4HH2 A;  1NWQ A;  2XZR A;  3WUV A;  4HB1 A;  1QLE D;  1KV4 A;  1Q7Y Q;  1H0T B;  1S3J A;  1GL2 C;  4EYY Q;  1RE3 C;  3PHL A;  1S5L E;  1KYO H;  1M90 Q;  1NTK K;  5CCG A;  3LID A;  4ZKU A;  3L70 E;  1KFN A;  1NAF A;  2J5U A;  2K9Y A;  2ZAE B;  3L4F A;  1VPC A;  4D6T E;  2QSI A;  1ZP0 C;  4XFJ A;  3VMX A;  1SQX G;  2J58 A;  3CXH I;  3HD7 A;  3FX0 A;  3OAK A;  1NTZ D;  1L0N G;  2W90 A;  1SQV K;  4JBZ A;  1M1J C;  5E79 H;  2CPS A;  1H88 A;  2AXT H;  5TJH A;  1KMI Z;  1RF1 B;  2FYU K;  3LW5 J;  4U3F E;  3L74 G;  1M7L A;  4Y99 B;  4OWF A;  1FZC C;  3T97 A;  1GU5 A;  1NKN A;  2WMM A;  1FJK A;  1Q86 Q;  2K88 A;  3BRT B;  1JY3 N;  1SLQ A;  3IF4 A;  2D2C D;  1GMJ A;  2HLO A;  3WUU A;  1HGV A;  1SQQ D;  2M8R A;  3RBX A;  2KS1 A;  1N7S A;  2YKP A;  2WPR A;  3TK1 A;  1SQX K;  3VYI A;  2WTY A;  1VQ6 P;  1J1E C;  5AW4 B;  2LR2 A;  3TYY A;  2KUB A;  2MJZ A;  4TLF A;  4AUW A;  4H13 C;  3H1I D;  3BVH A;  3KZI E;  3L36 A;  2OQQ A;  1G1I A;  4L75 A;  3L71 J;  3A0H H;  5APX A;  4HYT B;  3CWB J;  3WU2 H;  1LJ2 A;  1SQB D;  2WPV B;  1RY3 A;  2JWA A;  3AEA C;  3H32 B;  5KJ7 A;  2FXP A;  1YHQ P;  3H1L D;  1WMK A;  3NMD A;  5AVR B;  3BCC J;  5AVY B;  2N1T C;  3AEB C;  1ZRT D;  3B71 A;  4O9B A;  1KQS O;  3B5N C;  4LGD E;  1G2C B;  3C9I A;  3L73 G;  1IFP A;  3CXH D;  2NPS B;  1PZQ A;  3JSV C;  5AVW B;  3AEC C;  4OGQ B;  1OVR A;  1CW5 A;  5AVZ B;  1Z56 A;  5KKZ C;  3L75 J;  1SQV J;  4I2L C;  3D71 A;  1JB0 J;  2Z5I A;  4AYC A;  1PP9 E;  3FWN A;  2E76 B;  5AW7 B;  4UB8 E;  4H0L B;  2IYP A;  1GDT A;  1FU1 A;  2QVA A;  2IDB A;  3P8C D;  2M0B A;  2NPS A;  1N8R Q;  2YIU B;  3CCM P;  3TNU A;  2E5Y A;  3V2P A;  5AW6 B;  1NHL A;  2A45 I;  1GU4 A;  4Z1M H;  2WT7 A;  3CCV P;  5KLV D;  3H1H E;  4L74 A;  4H44 D;  1NU1 G;  2PFX A;  3HE5 B;  2WIT A;  2A06 G;  1NKZ B;  3C8V A;  4IOI H;  3K5B A;  1BGY E;  1KN7 A;  4ZKP A;  5AVU B;  1SQX J;  2KI7 B;  5KAF H;  3L70 D;  3VMA A;  2ITA A;  4D6T D;  3CD6 P;  4I7Z B;  2R3C A;  1L0N J;  5CCG C;  1M56 D;  1LTT C;  3A0B H;  1DEE G;  2H88 C;  5CCH A;  1N73 C;  2HFE D;  1HF9 A;  1H89 A;  2AXT E;  2QJK B;  2Q5U A;  1HGZ A;  1G1J A;  1KIL E;  1SQP E;  1RH5 B;  3HE5 A;  4R4L A;  3CME P;  4PV1 C;  3HD7 C;  1SFC A;  1ZME C;  1QL2 A;  4U3F D;  1FDO A;  2JDI H;  1PPJ G;  2FFD B;  1VQL P;  3CCS P;  2BCC G;  1RF0 A;  2K1A A;  5CCG D;  1NU1 K;  3TF5 A;  3AE2 C;  2ZYD A;  4L73 A;  3CC4 P;  1PV3 A;  2FXM A;  2E75 B;  1FE6 A;  3ITK A;  2IFN A;  3IR9 A;  2D2C B;  1NO4 A;  2LXB A;  2ZYA A;  4ASW A;  1QX8 A;  4PV1 D;  3M0D A;  3HD7 D;  1HJ0 A;  3QWO C;  2J59 M;  2RKL A;  2AEJ A;  2KZI A;  3PTZ A;  3W68 A;  2PRR A;  1BCC G;  4DCK A;  1OXZ A;  1RF1 C;  2NRG A;  4AQR D;  4PJ0 H;  3D6Y A;  5CJ0 A;  2M5A A;  3MUD A;  2KZJ A;  4M3L A;  1HBW A;  4IL6 E;  2WSF J;  4JQ0 D;  3TGU J;  2KYV A;  1VL2 A;  1OVU A;  2I1K A;  3SWK A;  1FZG A;  3A2A A;  3L73 J;  2P1J A;  4W7Z A;  3V4W A;  5KJ7 C;  1LTJ A;  4WY4 B;  1N7S D;  3H1K G;  3EQ2 A;  2H8P D;  1S2E A;  1KQL A;  1P84 E;  1YTZ I;  3BAS A;  1IFN A;  3N4X A;  3RK3 E;  1NTM G;  3TSI A;  4BRY B;  5DJU B;  5APY A;  3JCU E;  1NTZ G;  1Y47 A;  3MZW B;  5KAI H;  1JMB A;  2OTJ P;  3CL3 D;  1BSN A;  3II6 A;  2POH A;  4A7P A;  4ZNC A;  2ZXX A;  3KQG A;  2FKW B;  1IFD A;  1PP9 D;  2B9B A;  4JYC A;  3O6Q B;  5KJ7 D;  4C46 A;  1T6A A;  2KLU A;  2C9L Y;  2K3R A;  2E42 A;  4N78 E;  1K8A Q;  1NU1 J;  1FAV A;  1JCC A;  1W2E A;  3GF3 A;  1NGM B;  4U7J A;  1L4A A;  2NPS C;  4H44 B;  1RHZ B;  1JUN A;  3H1H D;  2OYH B;  2R44 A;  1IFJ A;  3L71 E;  4K3A A;  1VQM P;  1SQQ G;  3SFE C;  1PFI A;  1R5L A;  4OGQ C;  3CWB E;  2LKM A;  1JNM A;  1LP1 A;  2YMY A;  5TIS H;  1BE3 G;  2W83 C;  1URQ A;  1AV1 A;  1CI6 B;  3H1I G;  5B66 H;  3H1J J;  1SS1 A;  2JO1 A;  1NYH A;  3BCC E;  2E76 C;  1AA0 A;  1DX7 A;  1D7M A;  3BRV B;  2NPS D;  1BDD A;  1SQB G;  5CBN A;  3M06 A;  1OWA A;  2Z5H A;  2YIU C;  4IFM A;  1H8A A;  3JC2 2;  1KQF B;  1QGK B;  3AE1 C;  1LWU A;  3NFQ A;  5KLI B;  4WWI A;  1AQT A;  4IL6 X;  3SFD C;  1T3J A;  1IK7 A;  3F89 A;  3VP8 A;  3L75 E;  3VOP A;  1LTG C;  1JY3 P;  1SQV E;  1OX3 A;  5DJT B;  2WVR A;  5B5E H;  1YIT P;  1L0L K;  1KB9 I;  1LNQ A;  1SQQ K;  4YXD C;  1IJD B;  1FZA A;  5APS A;  2FYU G;  1QVF O;  4PD4 E;  1RF0 C;  1OW6 A;  5CBO A;  1KD1 Q;  2XKM A;  4EIJ A;  1A02 J;  2W8Z A;  1USD A;  5CCH D;  2XNX A;  1JMM A;  5K5G B;  1BCC J;  5AW1 B;  3MGN A;  2QJK C;  4WVZ A;  3V6I A;  3RBZ A;  1RE4 A;  3G6E P;  3U59 A;  2H43 A;  3LIE A;  3M0D C;  3HRN A;  1SFC D;  2WQY C;  1SQB K;  2B89 A;  4YPC A;  3RL0 D;  1SQX E;  3A3Y B;  3T97 B;  2FFD C;  3CX5 E;  5KLV G;  4NPE A;  4EDF A;  2JEE A;  1Q2N A;  3AE5 C;  2ZJS E;  1L0N E;  2Q9I A;  3ZDM A;  3I56 P;  2M3E A;  1Y8A A;  2E75 C;  1JY2 N;  5APU A;  2D2C C;  3H1K J;  3L74 E;  4D6T G;  1XTC C;  2Y9Y A;  1NTM J;  2KS1 B;  1N7S B;  1NTZ J;  3U1A A;  2IFM A;  2OGU A;  4GOE A;  4GOF A;  4N6J A;  2YKO A;  5GTI E;  2E75 D;  3F5H A;  2M3B A;  2V7Q H;  4OH8 B;  3OW2 O;  2YXQ B;  2AEF A;  1OIP A;  4U3F G;  1L0L D;  1UII A;  2O01 H;  1QEX A;  5KLV K;  1KB9 D;  3G3Z A;  1QL1 A;  1U57 A;  3CCJ P;  2Q7C A;  3PLN A;  1X0T A;  2Q6Q A;  3V2R A;  1LGH B;  1SQQ J;  4WY4 C;  3P32 A;  2H89 C;  3H6P A;  1ZLL A;  3M9B A;  1BE3 J;  1UIX A;  2OTK E;  5TIS E;  3C1L A;  2P67 A;  2QJP B;  3H1I J;  1VQ7 P;  5CHX A;  4W80 A;  1LTS C;  3TGU E;  2OTL P;  2G8Y A;  2QRX A;  2A45 G;  3RK2 C;  3L73 E;  1SQB J;  3CCL P;  1NTK J;  3KYQ A;  1LT9 A;  2HR3 A;  3BCC D;  3A5T A;  2QJY B;  4WY4 D;  1MFZ A;  1LT1 A;  2H7H A;  3AEF C;  1JY3 O;  3KHU A;  3TNU B;  1W2B O;  2SPZ A;  1AVO A;  4ZMD A;  2WT7 B;  4JF7 A;  1L4A D;  3MP7 B;  1KIL B;  1GTW A;  3E1I A;  1USE A;  4H44 C;  1DH3 A;  1FBM A;  1YQ3 C;  3L75 D;  2OYH C;  2KB7 P;  5AVX B;  1GK4 A;  3RK2 D;  2QEX P;  1EDL A;  5B5E E;  1OMI A;  3G4S P;  2FYU J;  2RN0 A;  1EDJ A;  2FYN B;  3PH0 A;  1T8Z A;  1S72 P;  1URQ D;  5CJ4 A;  5KTB A;  2NZ2 A;  1FJP A;  1FC2 C;  1NU1 E;  1KTM A;  5EFW B;  1OW7 A;  3L72 G;  4KJM A;  1KIL A;  3VN0 A;  2A06 E;  1PP9 G;  4KT0 J;  1EZV E;  1X9V A;  1KB9 H;  1IO4 A;  1KYO E;  5KLI C;  1SFC B;  5KLV J;  5AW9 B;  3RL0 B;  2KNC A;  4K35 A;  1RE4 C;  3H1J E;  3G9R A;  2ZYG A;  2GM4 A;  5GTH H;  3H1H G;  1X79 B;  1U7M A;  5AVS B;  1AVY A;  3RL0 g;  4CPG A;  2O01 N;  5E79 E;  4RO0 A;  3L74 J;  1PGQ A;  2PP6 A;  1PPJ E;  4GIF A;  5AVV B;  3Q3D A;  2MKV A;  1OFC X;  1S9K E;  3CXH H;  1PGJ A;  2KIK A;  4YTP C;  1TU3 F;  1K73 Q;  2LXC B;  2YO3 A;  2QM7 A;  2B87 B;  3AEE C;  2M5A B;  1Y9B A;  2FYZ A;  5M1B A;  3U1C A;  3AE4 C;  1ZR4 A;  1N86 A;  4IFD K;  2Y9Z A;  3VP9 A;  4C7N A;  1BCC E;  1EZV I;  2IPP A;  3AE7 C;  3D70 A;  2Y0D A;  1S4X A;  5AW5 B;  3FXE A;  1LTJ B;  5BVZ A;  1GL2 A;  4RKU J;  4GKG A;  2HG5 D;  4GDO A;  1N7S C;  3A0H E;  4GOD A;  1FDM A;  3GHG B;  4OVN F;  2B87 A;  2HOD A;  3WU2 E;  1ZN5 A;  1T3U A;  1JEK A;  4WBA A;  3VMY A;  1VF5 D;  3TGU D;  2Q1K A;  1S5L H;  1K04 A;  2KLV A;  3AE9 C;  1E5W A;  3H1K E;  2FBW C;  2JP3 A;  1RQU A;  1M1J A;  3P7K A;  2E5T A;  1NTM E;  1SP4 A;  3HE4 A;  1NTZ E;  2QIW A;  3BAT A;  3CCQ P;  2IZ1 A;  3GHG A;  1FZC A;  2BEQ D;  1L4A B;  3FGA D;  1GZL A;  1KFM A;  1PGP A;  3EFG A;  3V5B A;  1CSB A;  5AW8 B;  3RK2 B;  3FWL A;  2AEM A;  2QJP C;  1LP1 B;  1S1C X;  1GW3 A;  2I8D A;  3EFF K;  2QM8 A;  1URQ B;  5H2F H;  2JR8 A;  2IBZ E;  1X22 A;  1Q90 D;  1ZOY C;  1ZV8 A;  3L72 J;  1WT6 A;  3OA7 A;  2BAS A;  3H25 A;  2ZT9 D;  2QJY C;  4LC1 A;  3TDK A;  1SQQ E;  3MIW A;  2P58 A;  1L0L G;  3D6Z A;  1QVG O;  1BE3 E;  1EZV D;  1LWU B;  1NOH A;  3AE6 C;  3S4R A;  3H1I E;  1KIL C;  5KAF E;  2KSE A;  1OVV A;  3M9Q A;  2HPC B;  3B8E B;  3IAO A;  2A45 H;  3A7O A;  1BGY D;  4MN4 C;  5GTH E;  4I6M C;  2FXO A;  1JY2 P;  3H1J D;  3A0B E;  1SQB E;  3CLQ A;  1NTK E;  2FYN C;  2QG4 A;  2N1T A;  3QH9 A;  3B5N A;  3KPE A;  2R3S A;  3Q1M A;  4HKZ H;  1P84 I;  1GD2 E;  1ZRT E;  3H1L G;  2WSC H;  2YO2 A;  1KIL D;  1SQP D;  2BCC J;  5CCH C;  3CCR P;  3CXH E;  2HPC A;  2GA1 A;  3MD0 A;  3G71 P;  3BCC G;  1S9K D;  1VQP P;  2IX7 C;  1E79 H;  1K9M Q;  1KC8 Q;  1BDC A;  1SFC C;  2FYU E;  1HTL C;  3I5C A;  1ZR2 A;  2V7Q J;  4KHX A;  3RL0 C;  2IBZ I;  1GW4 A;  2Q3I A;  1IFI A;  2IYO A;  1M1K Q;  2GUV A;  2O01 J;  5BU8 B;  1HUC A;  3HTK A;  3PP5 A;  1M57 D;  4DZO A;  3P8C E;  1J2J B;  1NJI Q;  3L35 A;  4RJT A;  1HJB A;  3GLM A;  2GUS A;  4LLH A;  4PJ0 E;  2R5B A;  5KLV E;  3I55 P;  1DIP A;  2K9J A;  4L76 A;  2Z4E A;  1VDF A;  4DT0 A;  5C39 A;  5AVQ B;  3RK3 C;  1EXI A;  2RH0 A;  2DW3 A;  3VMZ A;  3GG2 A;  1VF5 B;  3L37 A;  3MUD C;  1DEB A;  3GMA A;  2WPQ A;  3S1K A;  1N73 A;  1KZU B;  3NXS A;  2OYI B;  3PJS K;  3GW6 A;  2G3A A;  3H1K D;  2ZVN B;  3L70 G;  1JOC A;  3N7N A;  1NTM D;  1OZH A;  1XTG B;  1P84 D;  2W6A A;  5KAI E;  2WSE H;  3RK3 D;  1H0T A;  1GL2 D;  5BU5 A;  1LTJ C;  4IFF A;  4XA4 A;  4QMA A;  2QA4 P;  2YKQ A;  3CCU P;  1DD3 A;  3GHG C;  1VQN P;  2OAR A;  2AXC A;  3RGU A;  1ZXG A;  4PD4 I;  2C9N Y;  2OYI A;  2E74 B;  4JYB A;  5H2F E;  2KOG A;  5APV A;  1FDI A;  1EXJ A;  4NPF X;  4EI2 A;  2IBZ D;  4N78 D;  1RQV A;  3AE8 C;  1LT9 B;  1CZQ A;  1L0L J;  2ZT9 B;  4UB6 H;  1IK9 A;  1RF1 A;  1JY2 O;  4XE5 B;  1J1D B;  4YXW H;  3CX5 I;  3L71 D;  4NPD A;  1BE3 D;  3CWB D;  1L4A C;  2W27 A;  1L0N K;  5B66 E;  2V4H A;  1AQ5 A;  1T2K C;  1LTB C;  3MTU E; 
#chains in the Genus database with same CATH homology
 1PPJ G;  1BCC G;  1SQV G;  3H1I G;  5KLV G;  1NTM G;  1EZV G;  3L70 G;  3CXH H;  2BCC G;  3L73 G;  4PD4 H;  4D6T G;  1SQX G;  3H1L G;  1NTZ G;  3L74 G;  1L0L G;  1SQQ G;  2FYU G;  3L72 G;  1KYO H;  1P84 H;  4U3F G;  1BGY G;  1NU1 G;  3BCC G;  1PP9 G;  3CX5 H;  3L71 G;  3TGU G;  1L0N G;  1SQB G;  1NTK G;  3L75 G;  3H1K G;  1KB9 H;  2IBZ G;  3H1H G;  1BE3 G;  3CWB G;  3H1J G;  1SQP G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...