4W80A

Tetrameric bap29 vded with disulfide bonds in crystal contacts
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
64
structure length
64
Chain Sequence
SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-cell receptor-associated protein 29
publication title A disulfide polymerized protein crystal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 28
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4w80A00
3HD7D 4WY4C 4OH8B 4W80A 3M0DC 1L4AC 2NPSC 3B5NC 5CCHC 1KILA 2KOGA 3PP5A 5CCGD 4JF7A 5KJ7A 4WY4B 1L4AB 3B5NB 2N1TA 1SFCC 2HG5D 2M8RA 1URQD 4WY4A 1GL2C 1XTGB 1SFCB 3RK3C 1N7SD 3HD7C 2YMYA 3HD7B 5CCGC 1KILD 5KJ7D 2NPSB 3RL0D 1T3JA 2XDJA 2N1TD 4W7YA 1URQC 1JTHB 4WY4D 1L4AA 2NPSA 3B5NA 5CCHA 1N7SC 2WZ7A 1GL2B 3RK3B 3RK2D 1JTHA 1NHLA 1HVVA 1SFCA 3TSIA 5KJ7C 3KYQA 1GL2A 3HTKB 4LGDE 3RL0C 2N1TC 2H8PD 3HD7A 4N78E 3RL0B 2N1TB 1L4AD 2NPSD 5CCGA 3B5ND 5CCHD 1URQB 4W7ZA 3RK2C 1N7SB 1KILC 3P8CE 1SFCD 2HFED 1URQA 3RK2B 2PP6A 3VOPA 1KILB 1GL2D 3RK3D 1N7SA
chains in the Genus database with same CATH superfamily
3KDPB 1FZEA 4OH8B 2FYUJ 5CCHC 1KILA 5AW8B 1OX3A 1MUUA 3HUSB 2K9JB 1HGVA 2IBZG 5H2FH 1Q2NA 3D70A 3R2PA 1L0LK 1SFCB 5M1BA 2N9YB 3CL3D 2JP3A 3CCSP 1ZN5A 3BVHA 4TT3H 2A45H 1ZLLA 1FBMA 2XDJA 1KFNA 3JSVC 3M9BA 1EDJA 3SFDC 3AE5C 3M0DA 1KB9H 1JMBA 2QJYC 3WUVA 1GL2B 1EZVG 2FFDB 1IFNA 3UIAA 5GTIE 1A02F 3O6QA 4ZNCA 1GL2A 3GF3A 1ZW0A 2N1TC 1OW6A 3FXEA 1KFMA 4OWFA 1BE3D 1W2EA 2E76C 2O1KA 1L4AD 1FZFA 1X22A 2Z5IA 3PTZA 1L0LD 1G2CB 1IJDB 4DJGA 4AYCA 2HR3A 3N7NA 3FX0A 5B5EE 1G2CA 1HH0A 3V2RA 4PD4H 2E74C 3S9OA 2QM7A 1NU1E 3H1ID 4JQ0D 5AVTB 1GW4A 1VF5D 5KAFE 1KC8Q 1S9KE 2WQYC 3A0BH 3L71E 4L75A 3PJSK 2AXCA 1PGOA 2ZT9C 3T97B 1NTZG 1NTZK 5CCGC 2E75D 3AEDC 1VQLP 1ZP0C 1K04A 1JB0J 4UB8E 1VQ6P 1LTIC 4H0LC 2QA4P 1E79H 5CBNA 1L4AA 1OIPA 1NU1K 4OGQB 3V6IA 2HPCB 2A06G 1G1JA 2LR2A 1MFTA 2H8PD 5BU8B 4XE5B 2VRSA 3RL0B 4UB6E 3JC22 1DEBA 1KYOH 1GDTA 3CCQP 2OQQA 3RK2B 2QRXA 2E75B 3R4YA 3KHUA 3CX5I 2R44A 3M0DC 2WSCH 2Q9IA 2KXPB 2ZVNB 2O01H 4IFFA 3QH9A 3G6EP 1NU1D 4PJ0H 2OYIB 1NTME 1MKMA 1GL2C 2E43A 1SQXE 1P84H 2Y9ZA 1SQQG 2OYIA 4L73A 1S9KD 4B86A 3L71D 2IDBA 1N73B 2PFXA 3C1LA 3H1KE 3L75E 1NKZB 2W90A 1T2KD 1N73A 4KHXA 2AEJA 3G3ZA 4D6TE 4PV1B 4XA4A 2O01N 3WU2H 1SQVJ 4WWIA 3Q5PA 2IYOA 1NTKG 2YIUB 1NTKK 3M9QA 4DZOA 3NFQA 3P7KA 5TISE 1ZR4A 3B5ND 4GOFA 2E42A 3KXDA 3F5HA 1SQQJ 4JBZA 1BGYG 2FXMA 3FGAD 3FWNA 3M9HA 3CCEP 2BCCE 1JY2P 3Q2YA 1GK6A 1S5LE 1L4AC 2KNCB 5APXA 4BXLA 1K9MQ 1AJYA 4H13D 3TNUB 1IO4A 4C46A 2QJPB 2KIKA 3II6A 3E1RA 2YKOA 2KB7P 3I5CA 5B66H 1NTMD 1LGHB 1DEEG 3V4WA 1RQUA 1IFPA 1RE3A 1SQXD 4N6JA 2I1JA 3M91A 3MD0A 4TLFA 2OYOA 1VF5C 2WMMA 2GUSA 5KLVG 2XKMA 1AQ5A 3H1HE 3C9IA 3CWBG 3H1KD 4C7RA 3L75D 2SPZA 4ASVA 2E5TA 3B5NA 2XV5A 1USDA 3EFFK 3HE4A 3MIWA 3HE5B 4D6TD 2H43A 2WWWA 3L73G 3EFGA 1ZRTE 1L0NK 1W2BO 3AEGC 2FKWB 2WVRA 1JMMA 1NJIQ 1KQSO 1LT1A 2OYIC 1JCDA 2QM8A 1JUNA 1ZXGA 1DD4A 3Q1MA 1NAYA 2FBWC 1PP9G 1J1EC 2POHA 1J2JB 2KK7A 3A7OA 2QSIA 1N73C 2BCCD 4MN4C 1KQLA 4U3FG 3U1CA 3CI9A 1WMKA 5GTIH 1X8YA 1CI6B 3L73J 1IFMA 1LTJC 1PZQA 1NGMB 3L74E 1YQ3C 2OTLP 1BCCG 4JPZB 5CJ0A 3QWOC 3I56P 1G1IA 2W83C 1USEA 5APUA 3N4XA 1SP4A 2V7QH 2KP8A 1U7JA 2IX7C 3VP8A 1OVUA 3IF4A 1FC2C 1SS1A 1PP9J 3B8EB 1JO5A 1Q81Q 1S5LX 3CCUP 5AW5B 2ZXXA 3H1HD 2KLUA 1LTSC 3MUDA 5APQA 1YQ4C 4WB4A 4U3FJ 1HUCA 3PH0A 2R3CA 2OTKE 2Y9YA 3V4QA 1T2KC 1FZCB 1ZRTD 1W5CE 1K05A 1HF9A 3V2NA 2Z4EA 2WSCJ 1EDKA 1J1DB 1PPJE 1SFCD 2O01J 4Y99B 2YXRB 2J5UA 2P2UA 2FY8A 1IC2A 1BSNA 3H1LJ 4IL6H 2WT7B 2R5BA 1JEKA 1IK9A 4YPCA 3B5NC 3MP7B 1EC5A 4NPDA 1T3UA 3GLMA 3JCUE 1WT6A 2C9NY 3L74D 3MTUE 1SQBE 4YTPC 2AXTE 1BE3G 4GOEA 4H13C 3RBZA 1BDDA 3TGUG 1L0LG 2YKPA 5AVUB 3HUSA 2K9JA 2LKMA 1YJWP 1SFCA 3CMAP 3TSIA 4IOIH 4KJMA 3W67A 1JY3N 1NOHA 2GA1A 3H1IG 1FZAA 3CX5H 3H1JE 1SQBK 4QMAA 2QIWA 2KLVA 1MV8A 2N9BA 4YXWH 1PFIA 2O3JA 1BE3J 2FFDA 2XZRA 1PPJD 1Q82Q 4Z1MH 4ZKUA 3GW6A 3TGUJ 2K9YA 5K5GB 2XU6A 5KTBA 2CPSA 3LIEA 3KZIH 4I2LC 2FXPA 3SWKA 4LC1A 3CXHE 4OGQD 1XTGB 5GTHH 3H1IJ 1T8ZA 1N7SD 4N3YB 1FOSF 3O8ZA 1SQBD 3RL0D 2Y0DA 3IFMA 4WY4D 2WZ7A 2P10A 3SSUA 3ITKA 1FJKA 3RK2D 4AUWA 2OYHB 2FYNC 4K3AA 1NKNA 2ZJSE 4WVZA 2JWAA 1RQVA 3BRTB 3T97A 1FS0E 2ZVOB 1ZR2A 1VQKP 1IFIA 1NU1G 1LP1B 1TU3F 2NPSD 2IFMA 3CCLP 2P67A 3H1JD 2PGDA 1N7SB 1YIJP 1KILC 2J58A 3L70G 2H88C 3L71G 1YBKA 1N7SA 3S4RA 2HPCA 3TK1A 3H25A 2HODB 3HUSC 1SQVE 5AW9B 1M1KQ 3V5BA 4O9BA 3OW2O 3A0HE 1GD2E 3RBXA 3PP5A 4WY4B 1JY3O 2D2CD 2HODA 1HJBA 1NTZJ 1SFCC 2HG5D 3PLNA 4PV1D 2V7QJ 2Y0CA 4L74A 3BCCG 4WY4A 2ZYGA 5E79H 5AW7B 5KKZB 3H32B 1R5SA 3CXHD 1M90Q 1SQQE 1FAVA 1NU1J 3H32A 1VQOP 3F89A 3Q3DA 4ZMDA 2NPSB 2M3EA 1QVGO 5H2FE 4GDOA 3L70J 3L71J 2NPSA 2FFDC 1SQVK 1LWUB 2WPSA 1EDLA 3AECC 4L76A 1GZLA 1GU5A 1HVVA 3G71P 1AQTA 1AVYA 3BASA 1QL1A 5AVXB 1RF1B 2D2CB 4GODA 3HRNA 1KB9E 3BCCJ 4N78E 3SFEC 4W7ZA 1RF1A 4RJTA 2Q1KA 3TF5A 3Q5SA 1NTMG 2JO1A 1NTMK 3GHGB 1SQXG 3RL0g 1IK7A 1SQXK 3IAOA 2B87B 1U7MA 1H89A 2M5AB 4DCKA 3KQGA 5APSA 3AE9C 3M0AA 4JYBA 3H1KG 3L75G 1VQPP 1SQVD 5KLIB 5KAIH 5AVZB 3AE8C 4D6TG 1AV1A 2K37A 1PGJA 4PD4E 1ZOYC 1Z56A 3HD7B 5BU5A 3AE7C 2Q6QA 1SQQD 2PAJA 2KYVA 1OW8A 2KNCA 3A0BE 2K1AA 3CC2P 1M56D 4OGQC 1NTKJ 3SWFA 4EDFA 2FXOA 3TNUA 1N7SC 3TYYA 1KMIZ 3L73E 3D6YA 1LJ2A 2BCCG 1VQ4P 3OJAB 4EIJA 3HTKB 3RL0C 1BGYJ 4RO0A 4NPEA 3FXDA 1HJ0A 1MZ9A 2RMZA 5APWA 5BVZA 1QLED 3HTKA 3D6ZA 1N86A 3MGNA 2MJZA 1AA0A 5AVYB 3GG2A 1KB9D 2KSEA 3RK2C 4N78D 1MFZA 3P8MC 1RE4A 2I1KA 3E1IA 5AVWB 1N8RQ 2E75C 3NXSA 1L0NG 1VQ7P 1YI2P 1CW5A 1EQ7A 3HE5A 1D7MA 1PP9E 2Q3IA 1M7LA 1HTLC 2WPRA 1LTTC 1KYOE 2NPSC 2P58A 1L2PA 1S4XA 2M3BA 5AVQB 1RF0A 1X79B 1HBWA 3H1HG 2K3RA 1LTGC 2BCCJ 4GIFA 2C0WA 1UIIA 4IFMA 2FYZA 3VYIA 1S2EA 5KLVJ 3L72G 3EQ2A 3CWBJ 2O1JA 1YYCA 2WTYA 1S3JA 4PD4D 1RF1C 2D2CC 2KUBA 3L36A 4PV1C 3BRVB 3H1LE 1GU4A 1P84E 1L0NJ 5C39A 1CI6A 2B89A 2GUVA 1QGKB 2W6AA 1FOSE 1KN7A 3VMYA 2YIUC 3CC7P 2QJYB 2GM4A 1LNQA 2QVAA 1YTZT 1ZMEC 1SQPE 1M8OB 3L73D 5B5EH 4YXDC 2FYUE 3CD6P 2N1TB 2RKLA 1CZQA 2ZT9D 1FZGA 3WU2E 3AEEC 3EWKA 5KLIC 1AVOA 3L72J 2E76B 2P7JA 3AE6C 3GMAA 5KAFH 2HFED 2H89C 3L74G 5AVRB 4AQRD 3CPWO 3AEFC 1DIPA 1LT9B 1PP9D 2QEXP 1FZBA 4I6MC 2QJPC 1FZCA 2E74B 2ZAEB 1LT9A 1RE3C 1BCCJ 1KYOD 2KS1B 1SQPK 2Y0EA 4UB8H 1QL2A 2FYUK 2W8ZA 1RY3A 5APTA 1RHZB 3I55P 1FDOA 3GF7A 1JY2N 2ZYAA 3CC4P 2WT7A 2ZT9B 4BRYB 1H8AA 1RE4C 1Y47A 1OWAA 2IBZE 3TGUE 3L74J 5B66E 4BRYA 4H0LB 2HLOA 1YTZI 1BSHA 4UB6H 3H1LD 3USSA 1P84D 1EDIA 1PPJG 2YO2A 1RF0C 5L8RJ 2WPVB 1KV4A 1ZV8A 2JJLA 1SQPD 1OMIA 5AW1B 3AEBC 4NPFX 2H7HA 2FYUD 1EZVE 4ZKPA 3P8CE 3RK3E 2JWDA 2JDIH 2PRRA 3WUUA 2KZIA 2PP6A 1FE6A 2I8DA 3C8VA 4DT0A 5CBOA 4I7ZB 1KQGB 3OA7A 1SQBG 1PL5A 2WITA 1Y9BA 4OVNF 4ASWA 3V2QA 5TJHA 2NZ2A 3VN0A 3WMM0 1URQD 2J59M 1S1CX 1XTCC 2RN0A 3O6QB 4EYYQ 5AVSB 3CXHI 2L5GB 1FJPA 1VL2A 1L0LJ 2M0BA 2BEQD 2WSSH 3VP9A 3MUDC 2R3SA 3AE3C 3TDKA 1JOCA 1Q7YQ 3H1JG 1GW3A 5TISH 2E5YA 5AW0B 3LW5H 2AEFA 2IBZD 3CCVP 2Q3EA 3TGUD 1S72P 1SQBJ 1NTZE 4EI2A 2JKVA 1FZCC 3MHVA 1LT9C 1QX8A 1JCCA 2WSFJ 2OARA 4HH2A 1M1JB 1JY2O 1J1DC 1S5LH 3AE1C 1URQB 2W27A 1LTAC 2B88A 3G4SP 4Y99C 1M1JA 1YJ9P 3A5TA 1T6AA 2K88A 3IR9A 1URQA 2A06E 3NMDA 3VOPA 3L70E 1EZVD 2IZ1A 3P8CD 3RK3D 2OYHA 1SLQA 3H1JJ 1IFJA 1VQMP 1IFDA 1L4AB 2XNXA 4H44D 1LP1A 2WPQA 3BCCE 4IL6E 1PGQA 1E5WA 3E7KA 1WRGA 3M06A 3VMXA 3ABVC 4CPGA 3PRJA 2QE7H 1X9VA 1JM0A 4W7YA 1VDFA 3KPEA 3L35A 1VF5B 2KI7B 2Z5HA 2C9LY 2YMKA 1NAFA 5CJ4A 3RGUA 5CHXA 2KSJA 3RK3B 2KZJA 2YNYA 1VQ9P 1GK4A 4I7ZC 2A45I 1UIXA 1NTZD 2W6BA 5AW4B 2YXQB 2WSEH 1SVFA 1SQVG 4H44B 2UWJE 2ZXEB 5DJUB 1PIXA 1KB9I 1OW7A 2B9BA 1R5LA 3V2PA 3CCMP 1LWUA 2R5DA 1KORA 1YHQP 1HGZA 5AW6B 1NTKE 3CX5E 3HD7D 1KD1Q 1OZHA 4IFDK 2A06D 2QG4A 1SQQK 1J1EB 2DW3A 3L70D 2Q7CA 2KOGA 2AEMA 5CMZA 1JNMA 3NTNA 1VQNP 2OGUA 1BGYE 2P1JA 2LXBA 4HJGH 1NH4A 1IZNB 1YJNP 2QJKB 2MKVA 1LTJB 2A45G 3GHGA 2R32A 3BCCD 2JEEA 1DX7A 1VPCA 2V4HA 2B87A 3KZIE 4PD4I 1LTJA 5AW3B 4C7NB 5KJ7D 4KT0J 2M5AA 5APVA 1M1JC 3CCRP 1URQC 5GTHE 4C7NA 3D71A 3CLQA 3B4SA 4K35A 2OYHC 1N7LA 2IFNA 2LXCB 3S1KA 1FU1A 2NRGA 3KYQA 2IZ0A 3ZDMA 1OVRA 3HD7A 1NTMJ 5KLVE 4IL6X 3CWBE 3A2AA 1QVFO 1SQXJ 5CCHD 1LTBC 2IPPA 2YO3A 3W68A 3OAKA 1EXIA 3CMEP 1X0TA 3FWLA 3H1KJ 1L0NE 3L75J 2RH0A 1M57D 3JCUH 4WY4C 4I1LA 3VMZA 4W80A 4D6TJ 3MZWB 4U7JA 1NTKD 3CX5D 3G9RA 3H6PA 2CK3H 1FDIA 5KJ7A 1H0TB 2AXTH 2IYPA 1KYOI 3B5NB 5EFWB 5KKZC 1KZUB 2M8RA 3HE4B 2W6JH 5KLVK 1H0TA 2WSFH 2Q5UA 1VQ5P 3VMAA 3AE2C 3RK3C 1NO4A 4BWNA 3VTPC 1BGYD 1K8AQ 2BEZF 1KILE 1GTWA 1JY3P 4A7PA 3L72E 5APYA 3LW5J 4U3FE 4H44C 1YITP 2N1TD 1LWUC 4RKUJ 5E79E 4H13B 1JTHB 4R4LA 2E76D 5CCHA 2CPBA 1RH5B 1FDMA 1DD3A 1PV3A 1P84I 3AE4C 4HKZH 1JTHA 1BCCE 4WBAA 3L37A 1Q86Q 1EXJA 4PJ0E 4LGDE 4Y28J 5AVVB 4LLHA 1KTMA 2E74D 4JYCA 1CSBA 5KLVD 1BDCA 3GHGC 3CWBD 2XNDH 2QJKC 4DOJA 2JR8A 3BATA 3CXHH 1HWTC 4HB1A 4HYTB 3H1HJ 2BASA 1Y8AA 1L0ND 3IN6A 5CCGD 1AFOA 4JF7A 2YKQA 1Q90D 4M3LA 2N1TA 3H1LG 1N2DC 4H0LD 4RESB 2C0XA 1QEXA 1U57A 2ZFCA 2OTJP 1PGPA 3K5BA 2ZYDA 1NVOA 1GMJA 3HD7C 2HYNA 2G8YA 2YMYA 1KILD 3LIDA 1A02J 1R8EA 3Q5RA 3PHLA 3L72D 1SQPG 1VQ8P 3SWYA 5KAIE 1T3JA 3U59A 3CCJP 4GT1A 4EOTA 4U3FD 3U1AA 4GKGA 2FYUG 3AEAC 3A3YB 5AW2B 1NYHA 2WSEJ 2KS1A 1OVVA 2IBZI 4XFJA 1NHLA 5KJ7C 1BE3E 5DJTB 1BCCD 1K73Q 2ITAA 2FYNB 4R4MA 1L0LE 2L91A 1KQFB 5CCGA 1OXZA 1NWQA 3B71A 3A0HH 2G3AA 3P32A 1H88A 1DH3A 1OFCX 3WUTA 1EZVI 1KILB 1GL2D 1SQPJ 3H1IE 3L4FA
chains in the Genus database with same CATH topology
1N73C 1H89A 1SLQA 3KDPB 1FZEA 1IFJA 4OH8B 5CCHC 3KQGA 1KILA 1KQLA 5APSA 5AW8B 1IFDA 3U1CA 3CI9A 3M0AA 4JYBA 1MUUA 3HUSB 1L4AB 1X8YA 2XNXA 1HGVA 1CI6B 1IFMA 1LTJC 5AVZB 2WPQA 3R2PA 1L0LK 1SFCB 3CL3D 1ZN5A 3BVHA 1Z56A 2A45H 3HD7B 1ZLLA 5BU5A 5CJ0A 1G1IA 5APUA 3N4XA 1E5WA 1SP4A 2PAJA 2KP8A 2KYVA 1WRGA 1FBMA 3M06A 3VMXA 2XDJA 1KFNA 2IX7C 3M9BA 3VP8A 1X9VA 4W7YA 1VDFA 3KPEA 3L35A 3M0DA 3SWFA 2Z5HA 3B8EB 2C9LY 1JO5A 3TNUA 1N7SC 1NAFA 5AW5B 5CJ4A 5CHXA 1GL2B 2KSJA 3TYYA 3RK3B 2YNYA 2FFDB 1LTSC 3MUDA 1GK4A 1IFNA 5APQA 3UIAA 4WB4A 1A02F 2A45I 1HUCA 2R3CA 3OJAB 1GL2A 4EIJA 3HTKB 3RL0C 2N1TC 3V4QA 2W6BA 5AW4B 1T2KC 1FZCB 2WSEH 1KFMA 1MZ9A 1SVFA 5APWA 5BVZA 1W2EA 2O1KA 3HTKA 1L4AD 1FZFA 2ZXEB 3V2NA 2Z4EA 1N86A 3MGNA 2MJZA 5AVYB 2Z5IA 3RK2C 4N78D 1J1DB 1MFZA 3P8MC 3V2PA 1RE4A 2I1KA 3E1IA 5AVWB 1G2CB 1LWUA 1SFCD 2R5DA 3NXSA 1HGZA 4Y99B 2P2UA 1IJDB 5AW6B 1CW5A 1EQ7A 3HE5A 4AYCA 1IC2A 3N7NA 2Q3IA 1G2CA 3HD7D 2WT7B 2R5BA 1HH0A 4IFDK 1M7LA 1IK9A 1HTLC 1SQQK 3V2RA 1J1EB 2WPRA 2Q7CA 1LTTC 2NPSC 3B5NC 2QM7A 2M3BA 2KOGA 5AVQB 5CMZA 1JNMA 1T3UA 1RF0A 5AVTB 3NTNA 1GW4A 1X79B 1HBWA 2P1JA 1LTGC 1NH4A 2C0WA 4GIFA 1WT6A 1S9KE 2C9NY 4IFMA 1LTJB 2FYZA 3VYIA 2A45G 3GHGA 2R32A 3EQ2A 3MTUE 2JEEA 2O1JA 1YYCA 2WTYA 1DX7A 1NTZK 1VPCA 5CCGC 1LTJA 5AW3B 4C7NB 5KJ7D 1RF1C 5APVA 1M1JC 3L36A 1LTIC 3BRVB 1URQC 1GU4A 2YKPA 4C7NA 5AVUB 3HUSA 3CLQA 1L4AA 1CI6A 1NU1K 2OYHC 1N7LA 2IFNA 2GUVA 2LKMA 2W6AA 1FOSE 3VMYA 1FU1A 1SFCA 2HPCB 3TSIA 2GM4A 1G1JA 3KYQA 1YTZT 1JY3N 1NOHA 2H8PD 5BU8B 3HD7A 1FZAA 4XE5B 2VRSA 3RL0B 2N1TB 3A2AA 1CZQA 1FZGA 1SQBK 5CCHD 1LTBC 1DEBA 2IPPA 2YO3A 2OYHA 2KLVA 1MV8A 2N9BA 1GDTA 2P7JA 3OAKA 2HFED 3RK2B 5AVRB 1PFIA 4AQRD 2FFDA 2XZRA 4ZKUA 4WY4C 1LT9B 4I1LA 3VMZA 4W80A 3M0DC 2WSCH 3H6PA 2XU6A 1FZBA 5KJ7A 4I6MC 5KTBA 2Q9IA 1FZCA 2CPSA 3LIEA 4I2LC 1LT9A 1RE3C 2O01H 4IFFA 3B5NB 1SQPK 1KZUB 2OYIB 4LC1A 2M8RA 3HE4B 5KLVK 2WSFH 2Q5UA 1GL2C 1QL2A 1XTGB 2E43A 2FYUK 3RK3C 1NO4A 3VTPC 1RY3A 1T8ZA 1N7SD 5APTA 1GTWA 1JY3P 2OYIA 4N3YB 1S9KD 4B86A 5APYA 1JY2N 1N73B 2WT7A 1FOSF 1H8AA 1RE4C 3O8ZA 1NKZB 3RL0D 1OWAA 2N1TD 1LWUC 1T2KD 1N73A 3IFMA 4KHXA 1JTHB 3G3ZA 4WY4D 5CCHA 2CPBA 4XA4A 2HLOA 1YTZI 2WZ7A 1FDMA 1FJKA 3RK2D 1JTHA 4WBAA 3L37A 4AUWA 2OYHB 1NKNA 2YO2A 1RF0C 4LGDE 3BRTB 1NTKK 3T97A 1ZV8A 5AVVB 4LLHA 1ZR2A 1IFIA 2JJLA 3M9QA 4DZOA 3NFQA 3P7KA 1ZR4A 4JYCA 2NPSD 3B5ND 5AW1B 2IFMA 2E42A 1CSBA 2P67A 3GHGC 2H7HA 1N7SB 1KILC 4ZKPA 2FXMA 3P8CE 2J58A 4DOJA 3M9HA 2PP6A 1JY2P 3BATA 1HWTC 1N7SA 1GK6A 2HPCA 3TK1A 4HYTB 2BASA 3OA7A 2HODB 3HUSC 1L4AC 5AW9B 3V5BA 2WITA 4O9BA 1GD2E 5APXA 3PP5A 5CCGD 1AFOA 4JF7A 4WY4B 1JY3O 2YKQA 3V2QA 4M3LA 2HODA 2N1TA 3TNUB 1HJBA 1IO4A 4C46A 1SFCC 2HG5D 1N2DC 4RESB 2C0XA 3VN0A 3WMM0 3II6A 1URQD 2J59M 4WY4A 2ZFCA 2YKOA 5AW7B 2KB7P 3H32B 1XTCC 3I5CA 3HD7C 1LGHB 5AVSB 2HYNA 2L5GB 1FJPA 3V4WA 1RE3A 2YMYA 4N6JA 1FAVA 1KILD 3H32A 3LIDA 1A02J 2I1JA 3M91A 3MD0A 2NPSB 3VP9A 3SWYA 2GUSA 1T3JA 3U59A 4GT1A 4EOTA 1JOCA 2XKMA 1AQ5A 3U1AA 3C9IA 4GKGA 3A3YB 4C7RA 5AW2B 2NPSA 3B5NA 1SQVK 2FFDC 1LWUB 2WPSA 1GW3A 2XV5A 5AW0B 3LW5H 3HE4A 1GZLA 3HE5B 3MIWA 2H43A 1NHLA 2WWWA 1GU5A 1HVVA 3EFGA 3BASA 5KJ7C 1FZCC 1QL1A 5AVXB 1LT9C 1L0NK 2FKWB 1JCCA 2OARA 1RF1B 1JMMA 4HH2A 1M1JB 3HRNA 1JY2O 4N78E 1J1DC 5CCGA 1URQB 2W27A 1OXZA 1LTAC 1NWQA 4W7ZA 4Y99C 1RF1A 2OYIC 1JCDA 1M1JA 2QM8A 3P32A 1JUNA 3A5TA 1H88A 3IR9A 1DH3A 1NTMK 1URQA 3GHGB 3NMDA 3VOPA 1KILB 1J1EC 1GL2D 2POHA 1SQXK 1J2JB 3P8CD 3RK3D 3L4FA 3A7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 D;  4WY4 C;  4OH8 B;  4W80 A;  3M0D C;  1L4A C;  2NPS C;  3B5N C;  5CCH C;  1KIL A;  2KOG A;  3PP5 A;  5CCG D;  4JF7 A;  5KJ7 A;  4WY4 B;  1L4A B;  3B5N B;  2N1T A;  1SFC C;  2HG5 D;  2M8R A;  1URQ D;  4WY4 A;  1GL2 C;  1XTG B;  1SFC B;  3RK3 C;  1N7S D;  3HD7 C;  2YMY A;  3HD7 B;  5CCG C;  1KIL D;  5KJ7 D;  2NPS B;  3RL0 D;  1T3J A;  2XDJ A;  2N1T D;  4W7Y A;  1URQ C;  1JTH B;  4WY4 D;  1L4A A;  2NPS A;  3B5N A;  5CCH A;  1N7S C;  2WZ7 A;  1GL2 B;  3RK3 B;  3RK2 D;  1JTH A;  1NHL A;  1HVV A;  1SFC A;  3TSI A;  5KJ7 C;  3KYQ A;  1GL2 A;  3HTK B;  4LGD E;  3RL0 C;  2N1T C;  2H8P D;  3HD7 A;  4N78 E;  3RL0 B;  2N1T B;  1L4A D;  2NPS D;  5CCG A;  3B5N D;  5CCH D;  1URQ B;  4W7Z A;  3RK2 C;  1N7S B;  1KIL C;  3P8C E;  1SFC D;  2HFE D;  1URQ A;  3RK2 B;  2PP6 A;  3VOP A;  1KIL B;  1GL2 D;  3RK3 D;  1N7S A; 
#chains in the Genus database with same CATH topology
 3KDP B;  1FZE A;  4OH8 B;  2FYU J;  5CCH C;  1KIL A;  5AW8 B;  1OX3 A;  1MUU A;  3HUS B;  2K9J B;  1HGV A;  2IBZ G;  5H2F H;  1Q2N A;  3D70 A;  3R2P A;  1L0L K;  1SFC B;  5M1B A;  2N9Y B;  3CL3 D;  2JP3 A;  3CCS P;  1ZN5 A;  3BVH A;  4TT3 H;  2A45 H;  1ZLL A;  1FBM A;  2XDJ A;  1KFN A;  3JSV C;  3M9B A;  1EDJ A;  3SFD C;  3AE5 C;  3M0D A;  1KB9 H;  1JMB A;  2QJY C;  3WUV A;  1GL2 B;  1EZV G;  2FFD B;  1IFN A;  3UIA A;  5GTI E;  1A02 F;  3O6Q A;  4ZNC A;  1GL2 A;  3GF3 A;  1ZW0 A;  2N1T C;  1OW6 A;  3FXE A;  1KFM A;  4OWF A;  1BE3 D;  1W2E A;  2E76 C;  2O1K A;  1L4A D;  1FZF A;  1X22 A;  2Z5I A;  3PTZ A;  1L0L D;  1G2C B;  1IJD B;  4DJG A;  4AYC A;  2HR3 A;  3N7N A;  3FX0 A;  5B5E E;  1G2C A;  1HH0 A;  3V2R A;  4PD4 H;  2E74 C;  3S9O A;  2QM7 A;  1NU1 E;  3H1I D;  4JQ0 D;  5AVT B;  1GW4 A;  1VF5 D;  5KAF E;  1KC8 Q;  1S9K E;  2WQY C;  3A0B H;  3L71 E;  4L75 A;  3PJS K;  2AXC A;  1PGO A;  2ZT9 C;  3T97 B;  1NTZ G;  1NTZ K;  5CCG C;  2E75 D;  3AED C;  1VQL P;  1ZP0 C;  1K04 A;  1JB0 J;  4UB8 E;  1VQ6 P;  1LTI C;  4H0L C;  2QA4 P;  1E79 H;  5CBN A;  1L4A A;  1OIP A;  1NU1 K;  4OGQ B;  3V6I A;  2HPC B;  2A06 G;  1G1J A;  2LR2 A;  1MFT A;  2H8P D;  5BU8 B;  4XE5 B;  2VRS A;  3RL0 B;  4UB6 E;  3JC2 2;  1DEB A;  1KYO H;  1GDT A;  3CCQ P;  2OQQ A;  3RK2 B;  2QRX A;  2E75 B;  3R4Y A;  3KHU A;  3CX5 I;  2R44 A;  3M0D C;  2WSC H;  2Q9I A;  2KXP B;  2ZVN B;  2O01 H;  4IFF A;  3QH9 A;  3G6E P;  1NU1 D;  4PJ0 H;  2OYI B;  1NTM E;  1MKM A;  1GL2 C;  2E43 A;  1SQX E;  1P84 H;  2Y9Z A;  1SQQ G;  2OYI A;  4L73 A;  1S9K D;  4B86 A;  3L71 D;  2IDB A;  1N73 B;  2PFX A;  3C1L A;  3H1K E;  3L75 E;  1NKZ B;  2W90 A;  1T2K D;  1N73 A;  4KHX A;  2AEJ A;  3G3Z A;  4D6T E;  4PV1 B;  4XA4 A;  2O01 N;  3WU2 H;  1SQV J;  4WWI A;  3Q5P A;  2IYO A;  1NTK G;  2YIU B;  1NTK K;  3M9Q A;  4DZO A;  3NFQ A;  3P7K A;  5TIS E;  1ZR4 A;  3B5N D;  4GOF A;  2E42 A;  3KXD A;  3F5H A;  1SQQ J;  4JBZ A;  1BGY G;  2FXM A;  3FGA D;  3FWN A;  3M9H A;  3CCE P;  2BCC E;  1JY2 P;  3Q2Y A;  1GK6 A;  1S5L E;  1L4A C;  2KNC B;  5APX A;  4BXL A;  1K9M Q;  1AJY A;  4H13 D;  3TNU B;  1IO4 A;  4C46 A;  2QJP B;  2KIK A;  3II6 A;  3E1R A;  2YKO A;  2KB7 P;  3I5C A;  5B66 H;  1NTM D;  1LGH B;  1DEE G;  3V4W A;  1RQU A;  1IFP A;  1RE3 A;  1SQX D;  4N6J A;  2I1J A;  3M91 A;  3MD0 A;  4TLF A;  2OYO A;  1VF5 C;  2WMM A;  2GUS A;  5KLV G;  2XKM A;  1AQ5 A;  3H1H E;  3C9I A;  3CWB G;  3H1K D;  4C7R A;  3L75 D;  2SPZ A;  4ASV A;  2E5T A;  3B5N A;  2XV5 A;  1USD A;  3EFF K;  3HE4 A;  3MIW A;  3HE5 B;  4D6T D;  2H43 A;  2WWW A;  3L73 G;  3EFG A;  1ZRT E;  1L0N K;  1W2B O;  3AEG C;  2FKW B;  2WVR A;  1JMM A;  1NJI Q;  1KQS O;  1LT1 A;  2OYI C;  1JCD A;  2QM8 A;  1JUN A;  1ZXG A;  1DD4 A;  3Q1M A;  1NAY A;  2FBW C;  1PP9 G;  1J1E C;  2POH A;  1J2J B;  2KK7 A;  3A7O A;  2QSI A;  1N73 C;  2BCC D;  4MN4 C;  1KQL A;  4U3F G;  3U1C A;  3CI9 A;  1WMK A;  5GTI H;  1X8Y A;  1CI6 B;  3L73 J;  1IFM A;  1LTJ C;  1PZQ A;  1NGM B;  3L74 E;  1YQ3 C;  2OTL P;  1BCC G;  4JPZ B;  5CJ0 A;  3QWO C;  3I56 P;  1G1I A;  2W83 C;  1USE A;  5APU A;  3N4X A;  1SP4 A;  2V7Q H;  2KP8 A;  1U7J A;  2IX7 C;  3VP8 A;  1OVU A;  3IF4 A;  1FC2 C;  1SS1 A;  1PP9 J;  3B8E B;  1JO5 A;  1Q81 Q;  1S5L X;  3CCU P;  5AW5 B;  2ZXX A;  3H1H D;  2KLU A;  1LTS C;  3MUD A;  5APQ A;  1YQ4 C;  4WB4 A;  4U3F J;  1HUC A;  3PH0 A;  2R3C A;  2OTK E;  2Y9Y A;  3V4Q A;  1T2K C;  1FZC B;  1ZRT D;  1W5C E;  1K05 A;  1HF9 A;  3V2N A;  2Z4E A;  2WSC J;  1EDK A;  1J1D B;  1PPJ E;  1SFC D;  2O01 J;  4Y99 B;  2YXR B;  2J5U A;  2P2U A;  2FY8 A;  1IC2 A;  1BSN A;  3H1L J;  4IL6 H;  2WT7 B;  2R5B A;  1JEK A;  1IK9 A;  4YPC A;  3B5N C;  3MP7 B;  1EC5 A;  4NPD A;  1T3U A;  3GLM A;  3JCU E;  1WT6 A;  2C9N Y;  3L74 D;  3MTU E;  1SQB E;  4YTP C;  2AXT E;  1BE3 G;  4GOE A;  4H13 C;  3RBZ A;  1BDD A;  3TGU G;  1L0L G;  2YKP A;  5AVU B;  3HUS A;  2K9J A;  2LKM A;  1YJW P;  1SFC A;  3CMA P;  3TSI A;  4IOI H;  4KJM A;  3W67 A;  1JY3 N;  1NOH A;  2GA1 A;  3H1I G;  1FZA A;  3CX5 H;  3H1J E;  1SQB K;  4QMA A;  2QIW A;  2KLV A;  1MV8 A;  2N9B A;  4YXW H;  1PFI A;  2O3J A;  1BE3 J;  2FFD A;  2XZR A;  1PPJ D;  1Q82 Q;  4Z1M H;  4ZKU A;  3GW6 A;  3TGU J;  2K9Y A;  5K5G B;  2XU6 A;  5KTB A;  2CPS A;  3LIE A;  3KZI H;  4I2L C;  2FXP A;  3SWK A;  4LC1 A;  3CXH E;  4OGQ D;  1XTG B;  5GTH H;  3H1I J;  1T8Z A;  1N7S D;  4N3Y B;  1FOS F;  3O8Z A;  1SQB D;  3RL0 D;  2Y0D A;  3IFM A;  4WY4 D;  2WZ7 A;  2P10 A;  3SSU A;  3ITK A;  1FJK A;  3RK2 D;  4AUW A;  2OYH B;  2FYN C;  4K3A A;  1NKN A;  2ZJS E;  4WVZ A;  2JWA A;  1RQV A;  3BRT B;  3T97 A;  1FS0 E;  2ZVO B;  1ZR2 A;  1VQK P;  1IFI A;  1NU1 G;  1LP1 B;  1TU3 F;  2NPS D;  2IFM A;  3CCL P;  2P67 A;  3H1J D;  2PGD A;  1N7S B;  1YIJ P;  1KIL C;  2J58 A;  3L70 G;  2H88 C;  3L71 G;  1YBK A;  1N7S A;  3S4R A;  2HPC A;  3TK1 A;  3H25 A;  2HOD B;  3HUS C;  1SQV E;  5AW9 B;  1M1K Q;  3V5B A;  4O9B A;  3OW2 O;  3A0H E;  1GD2 E;  3RBX A;  3PP5 A;  4WY4 B;  1JY3 O;  2D2C D;  2HOD A;  1HJB A;  1NTZ J;  1SFC C;  2HG5 D;  3PLN A;  4PV1 D;  2V7Q J;  2Y0C A;  4L74 A;  3BCC G;  4WY4 A;  2ZYG A;  5E79 H;  5AW7 B;  5KKZ B;  3H32 B;  1R5S A;  3CXH D;  1M90 Q;  1SQQ E;  1FAV A;  1NU1 J;  3H32 A;  1VQO P;  3F89 A;  3Q3D A;  4ZMD A;  2NPS B;  2M3E A;  1QVG O;  5H2F E;  4GDO A;  3L70 J;  3L71 J;  2NPS A;  2FFD C;  1SQV K;  1LWU B;  2WPS A;  1EDL A;  3AEC C;  4L76 A;  1GZL A;  1GU5 A;  1HVV A;  3G71 P;  1AQT A;  1AVY A;  3BAS A;  1QL1 A;  5AVX B;  1RF1 B;  2D2C B;  4GOD A;  3HRN A;  1KB9 E;  3BCC J;  4N78 E;  3SFE C;  4W7Z A;  1RF1 A;  4RJT A;  2Q1K A;  3TF5 A;  3Q5S A;  1NTM G;  2JO1 A;  1NTM K;  3GHG B;  1SQX G;  3RL0 g;  1IK7 A;  1SQX K;  3IAO A;  2B87 B;  1U7M A;  1H89 A;  2M5A B;  4DCK A;  3KQG A;  5APS A;  3AE9 C;  3M0A A;  4JYB A;  3H1K G;  3L75 G;  1VQP P;  1SQV D;  5KLI B;  5KAI H;  5AVZ B;  3AE8 C;  4D6T G;  1AV1 A;  2K37 A;  1PGJ A;  4PD4 E;  1ZOY C;  1Z56 A;  3HD7 B;  5BU5 A;  3AE7 C;  2Q6Q A;  1SQQ D;  2PAJ A;  2KYV A;  1OW8 A;  2KNC A;  3A0B E;  2K1A A;  3CC2 P;  1M56 D;  4OGQ C;  1NTK J;  3SWF A;  4EDF A;  2FXO A;  3TNU A;  1N7S C;  3TYY A;  1KMI Z;  3L73 E;  3D6Y A;  1LJ2 A;  2BCC G;  1VQ4 P;  3OJA B;  4EIJ A;  3HTK B;  3RL0 C;  1BGY J;  4RO0 A;  4NPE A;  3FXD A;  1HJ0 A;  1MZ9 A;  2RMZ A;  5APW A;  5BVZ A;  1QLE D;  3HTK A;  3D6Z A;  1N86 A;  3MGN A;  2MJZ A;  1AA0 A;  5AVY B;  3GG2 A;  1KB9 D;  2KSE A;  3RK2 C;  4N78 D;  1MFZ A;  3P8M C;  1RE4 A;  2I1K A;  3E1I A;  5AVW B;  1N8R Q;  2E75 C;  3NXS A;  1L0N G;  1VQ7 P;  1YI2 P;  1CW5 A;  1EQ7 A;  3HE5 A;  1D7M A;  1PP9 E;  2Q3I A;  1M7L A;  1HTL C;  2WPR A;  1LTT C;  1KYO E;  2NPS C;  2P58 A;  1L2P A;  1S4X A;  2M3B A;  5AVQ B;  1RF0 A;  1X79 B;  1HBW A;  3H1H G;  2K3R A;  1LTG C;  2BCC J;  4GIF A;  2C0W A;  1UII A;  4IFM A;  2FYZ A;  3VYI A;  1S2E A;  5KLV J;  3L72 G;  3EQ2 A;  3CWB J;  2O1J A;  1YYC A;  2WTY A;  1S3J A;  4PD4 D;  1RF1 C;  2D2C C;  2KUB A;  3L36 A;  4PV1 C;  3BRV B;  3H1L E;  1GU4 A;  1P84 E;  1L0N J;  5C39 A;  1CI6 A;  2B89 A;  2GUV A;  1QGK B;  2W6A A;  1FOS E;  1KN7 A;  3VMY A;  2YIU C;  3CC7 P;  2QJY B;  2GM4 A;  1LNQ A;  2QVA A;  1YTZ T;  1ZME C;  1SQP E;  1M8O B;  3L73 D;  5B5E H;  4YXD C;  2FYU E;  3CD6 P;  2N1T B;  2RKL A;  1CZQ A;  2ZT9 D;  1FZG A;  3WU2 E;  3AEE C;  3EWK A;  5KLI C;  1AVO A;  3L72 J;  2E76 B;  2P7J A;  3AE6 C;  3GMA A;  5KAF H;  2HFE D;  2H89 C;  3L74 G;  5AVR B;  4AQR D;  3CPW O;  3AEF C;  1DIP A;  1LT9 B;  1PP9 D;  2QEX P;  1FZB A;  4I6M C;  2QJP C;  1FZC A;  2E74 B;  2ZAE B;  1LT9 A;  1RE3 C;  1BCC J;  1KYO D;  2KS1 B;  1SQP K;  2Y0E A;  4UB8 H;  1QL2 A;  2FYU K;  2W8Z A;  1RY3 A;  5APT A;  1RHZ B;  3I55 P;  1FDO A;  3GF7 A;  1JY2 N;  2ZYA A;  3CC4 P;  2WT7 A;  2ZT9 B;  4BRY B;  1H8A A;  1RE4 C;  1Y47 A;  1OWA A;  2IBZ E;  3TGU E;  3L74 J;  5B66 E;  4BRY A;  4H0L B;  2HLO A;  1YTZ I;  1BSH A;  4UB6 H;  3H1L D;  3USS A;  1P84 D;  1EDI A;  1PPJ G;  2YO2 A;  1RF0 C;  5L8R J;  2WPV B;  1KV4 A;  1ZV8 A;  2JJL A;  1SQP D;  1OMI A;  5AW1 B;  3AEB C;  4NPF X;  2H7H A;  2FYU D;  1EZV E;  4ZKP A;  3P8C E;  3RK3 E;  2JWD A;  2JDI H;  2PRR A;  3WUU A;  2KZI A;  2PP6 A;  1FE6 A;  2I8D A;  3C8V A;  4DT0 A;  5CBO A;  4I7Z B;  1KQG B;  3OA7 A;  1SQB G;  1PL5 A;  2WIT A;  1Y9B A;  4OVN F;  4ASW A;  3V2Q A;  5TJH A;  2NZ2 A;  3VN0 A;  3WMM 0;  1URQ D;  2J59 M;  1S1C X;  1XTC C;  2RN0 A;  3O6Q B;  4EYY Q;  5AVS B;  3CXH I;  2L5G B;  1FJP A;  1VL2 A;  1L0L J;  2M0B A;  2BEQ D;  2WSS H;  3VP9 A;  3MUD C;  2R3S A;  3AE3 C;  3TDK A;  1JOC A;  1Q7Y Q;  3H1J G;  1GW3 A;  5TIS H;  2E5Y A;  5AW0 B;  3LW5 H;  2AEF A;  2IBZ D;  3CCV P;  2Q3E A;  3TGU D;  1S72 P;  1SQB J;  1NTZ E;  4EI2 A;  2JKV A;  1FZC C;  3MHV A;  1LT9 C;  1QX8 A;  1JCC A;  2WSF J;  2OAR A;  4HH2 A;  1M1J B;  1JY2 O;  1J1D C;  1S5L H;  3AE1 C;  1URQ B;  2W27 A;  1LTA C;  2B88 A;  3G4S P;  4Y99 C;  1M1J A;  1YJ9 P;  3A5T A;  1T6A A;  2K88 A;  3IR9 A;  1URQ A;  2A06 E;  3NMD A;  3VOP A;  3L70 E;  1EZV D;  2IZ1 A;  3P8C D;  3RK3 D;  2OYH A;  1SLQ A;  3H1J J;  1IFJ A;  1VQM P;  1IFD A;  1L4A B;  2XNX A;  4H44 D;  1LP1 A;  2WPQ A;  3BCC E;  4IL6 E;  1PGQ A;  1E5W A;  3E7K A;  1WRG A;  3M06 A;  3VMX A;  3ABV C;  4CPG A;  3PRJ A;  2QE7 H;  1X9V A;  1JM0 A;  4W7Y A;  1VDF A;  3KPE A;  3L35 A;  1VF5 B;  2KI7 B;  2Z5H A;  2C9L Y;  2YMK A;  1NAF A;  5CJ4 A;  3RGU A;  5CHX A;  2KSJ A;  3RK3 B;  2KZJ A;  2YNY A;  1VQ9 P;  1GK4 A;  4I7Z C;  2A45 I;  1UIX A;  1NTZ D;  2W6B A;  5AW4 B;  2YXQ B;  2WSE H;  1SVF A;  1SQV G;  4H44 B;  2UWJ E;  2ZXE B;  5DJU B;  1PIX A;  1KB9 I;  1OW7 A;  2B9B A;  1R5L A;  3V2P A;  3CCM P;  1LWU A;  2R5D A;  1KOR A;  1YHQ P;  1HGZ A;  5AW6 B;  1NTK E;  3CX5 E;  3HD7 D;  1KD1 Q;  1OZH A;  4IFD K;  2A06 D;  2QG4 A;  1SQQ K;  1J1E B;  2DW3 A;  3L70 D;  2Q7C A;  2KOG A;  2AEM A;  5CMZ A;  1JNM A;  3NTN A;  1VQN P;  2OGU A;  1BGY E;  2P1J A;  2LXB A;  4HJG H;  1NH4 A;  1IZN B;  1YJN P;  2QJK B;  2MKV A;  1LTJ B;  2A45 G;  3GHG A;  2R32 A;  3BCC D;  2JEE A;  1DX7 A;  1VPC A;  2V4H A;  2B87 A;  3KZI E;  4PD4 I;  1LTJ A;  5AW3 B;  4C7N B;  5KJ7 D;  4KT0 J;  2M5A A;  5APV A;  1M1J C;  3CCR P;  1URQ C;  5GTH E;  4C7N A;  3D71 A;  3CLQ A;  3B4S A;  4K35 A;  2OYH C;  1N7L A;  2IFN A;  2LXC B;  3S1K A;  1FU1 A;  2NRG A;  3KYQ A;  2IZ0 A;  3ZDM A;  1OVR A;  3HD7 A;  1NTM J;  5KLV E;  4IL6 X;  3CWB E;  3A2A A;  1QVF O;  1SQX J;  5CCH D;  1LTB C;  2IPP A;  2YO3 A;  3W68 A;  3OAK A;  1EXI A;  3CME P;  1X0T A;  3FWL A;  3H1K J;  1L0N E;  3L75 J;  2RH0 A;  1M57 D;  3JCU H;  4WY4 C;  4I1L A;  3VMZ A;  4W80 A;  4D6T J;  3MZW B;  4U7J A;  1NTK D;  3CX5 D;  3G9R A;  3H6P A;  2CK3 H;  1FDI A;  5KJ7 A;  1H0T B;  2AXT H;  2IYP A;  1KYO I;  3B5N B;  5EFW B;  5KKZ C;  1KZU B;  2M8R A;  3HE4 B;  2W6J H;  5KLV K;  1H0T A;  2WSF H;  2Q5U A;  1VQ5 P;  3VMA A;  3AE2 C;  3RK3 C;  1NO4 A;  4BWN A;  3VTP C;  1BGY D;  1K8A Q;  2BEZ F;  1KIL E;  1GTW A;  1JY3 P;  4A7P A;  3L72 E;  5APY A;  3LW5 J;  4U3F E;  4H44 C;  1YIT P;  2N1T D;  1LWU C;  4RKU J;  5E79 E;  4H13 B;  1JTH B;  4R4L A;  2E76 D;  5CCH A;  2CPB A;  1RH5 B;  1FDM A;  1DD3 A;  1PV3 A;  1P84 I;  3AE4 C;  4HKZ H;  1JTH A;  1BCC E;  4WBA A;  3L37 A;  1Q86 Q;  1EXJ A;  4PJ0 E;  4LGD E;  4Y28 J;  5AVV B;  4LLH A;  1KTM A;  2E74 D;  4JYC A;  1CSB A;  5KLV D;  1BDC A;  3GHG C;  3CWB D;  2XND H;  2QJK C;  4DOJ A;  2JR8 A;  3BAT A;  3CXH H;  1HWT C;  4HB1 A;  4HYT B;  3H1H J;  2BAS A;  1Y8A A;  1L0N D;  3IN6 A;  5CCG D;  1AFO A;  4JF7 A;  2YKQ A;  1Q90 D;  4M3L A;  2N1T A;  3H1L G;  1N2D C;  4H0L D;  4RES B;  2C0X A;  1QEX A;  1U57 A;  2ZFC A;  2OTJ P;  1PGP A;  3K5B A;  2ZYD A;  1NVO A;  1GMJ A;  3HD7 C;  2HYN A;  2G8Y A;  2YMY A;  1KIL D;  3LID A;  1A02 J;  1R8E A;  3Q5R A;  3PHL A;  3L72 D;  1SQP G;  1VQ8 P;  3SWY A;  5KAI E;  1T3J A;  3U59 A;  3CCJ P;  4GT1 A;  4EOT A;  4U3F D;  3U1A A;  4GKG A;  2FYU G;  3AEA C;  3A3Y B;  5AW2 B;  1NYH A;  2WSE J;  2KS1 A;  1OVV A;  2IBZ I;  4XFJ A;  1NHL A;  5KJ7 C;  1BE3 E;  5DJT B;  1BCC D;  1K73 Q;  2ITA A;  2FYN B;  4R4M A;  1L0L E;  2L91 A;  1KQF B;  5CCG A;  1OXZ A;  1NWQ A;  3B71 A;  3A0H H;  2G3A A;  3P32 A;  1H88 A;  1DH3 A;  1OFC X;  3WUT A;  1EZV I;  1KIL B;  1GL2 D;  1SQP J;  3H1I E;  3L4F A; 
#chains in the Genus database with same CATH homology
 1N73 C;  1H89 A;  1SLQ A;  3KDP B;  1FZE A;  1IFJ A;  4OH8 B;  5CCH C;  3KQG A;  1KIL A;  1KQL A;  5APS A;  5AW8 B;  1IFD A;  3U1C A;  3CI9 A;  3M0A A;  4JYB A;  1MUU A;  3HUS B;  1L4A B;  1X8Y A;  2XNX A;  1HGV A;  1CI6 B;  1IFM A;  1LTJ C;  5AVZ B;  2WPQ A;  3R2P A;  1L0L K;  1SFC B;  3CL3 D;  1ZN5 A;  3BVH A;  1Z56 A;  2A45 H;  3HD7 B;  1ZLL A;  5BU5 A;  5CJ0 A;  1G1I A;  5APU A;  3N4X A;  1E5W A;  1SP4 A;  2PAJ A;  2KP8 A;  2KYV A;  1WRG A;  1FBM A;  3M06 A;  3VMX A;  2XDJ A;  1KFN A;  2IX7 C;  3M9B A;  3VP8 A;  1X9V A;  4W7Y A;  1VDF A;  3KPE A;  3L35 A;  3M0D A;  3SWF A;  2Z5H A;  3B8E B;  2C9L Y;  1JO5 A;  3TNU A;  1N7S C;  1NAF A;  5AW5 B;  5CJ4 A;  5CHX A;  1GL2 B;  2KSJ A;  3TYY A;  3RK3 B;  2YNY A;  2FFD B;  1LTS C;  3MUD A;  1GK4 A;  1IFN A;  5APQ A;  3UIA A;  4WB4 A;  1A02 F;  2A45 I;  1HUC A;  2R3C A;  3OJA B;  1GL2 A;  4EIJ A;  3HTK B;  3RL0 C;  2N1T C;  3V4Q A;  2W6B A;  5AW4 B;  1T2K C;  1FZC B;  2WSE H;  1KFM A;  1MZ9 A;  1SVF A;  5APW A;  5BVZ A;  1W2E A;  2O1K A;  3HTK A;  1L4A D;  1FZF A;  2ZXE B;  3V2N A;  2Z4E A;  1N86 A;  3MGN A;  2MJZ A;  5AVY B;  2Z5I A;  3RK2 C;  4N78 D;  1J1D B;  1MFZ A;  3P8M C;  3V2P A;  1RE4 A;  2I1K A;  3E1I A;  5AVW B;  1G2C B;  1LWU A;  1SFC D;  2R5D A;  3NXS A;  1HGZ A;  4Y99 B;  2P2U A;  1IJD B;  5AW6 B;  1CW5 A;  1EQ7 A;  3HE5 A;  4AYC A;  1IC2 A;  3N7N A;  2Q3I A;  1G2C A;  3HD7 D;  2WT7 B;  2R5B A;  1HH0 A;  4IFD K;  1M7L A;  1IK9 A;  1HTL C;  1SQQ K;  3V2R A;  1J1E B;  2WPR A;  2Q7C A;  1LTT C;  2NPS C;  3B5N C;  2QM7 A;  2M3B A;  2KOG A;  5AVQ B;  5CMZ A;  1JNM A;  1T3U A;  1RF0 A;  5AVT B;  3NTN A;  1GW4 A;  1X79 B;  1HBW A;  2P1J A;  1LTG C;  1NH4 A;  2C0W A;  4GIF A;  1WT6 A;  1S9K E;  2C9N Y;  4IFM A;  1LTJ B;  2FYZ A;  3VYI A;  2A45 G;  3GHG A;  2R32 A;  3EQ2 A;  3MTU E;  2JEE A;  2O1J A;  1YYC A;  2WTY A;  1DX7 A;  1NTZ K;  1VPC A;  5CCG C;  1LTJ A;  5AW3 B;  4C7N B;  5KJ7 D;  1RF1 C;  5APV A;  1M1J C;  3L36 A;  1LTI C;  3BRV B;  1URQ C;  1GU4 A;  2YKP A;  4C7N A;  5AVU B;  3HUS A;  3CLQ A;  1L4A A;  1CI6 A;  1NU1 K;  2OYH C;  1N7L A;  2IFN A;  2GUV A;  2LKM A;  2W6A A;  1FOS E;  3VMY A;  1FU1 A;  1SFC A;  2HPC B;  3TSI A;  2GM4 A;  1G1J A;  3KYQ A;  1YTZ T;  1JY3 N;  1NOH A;  2H8P D;  5BU8 B;  3HD7 A;  1FZA A;  4XE5 B;  2VRS A;  3RL0 B;  2N1T B;  3A2A A;  1CZQ A;  1FZG A;  1SQB K;  5CCH D;  1LTB C;  1DEB A;  2IPP A;  2YO3 A;  2OYH A;  2KLV A;  1MV8 A;  2N9B A;  1GDT A;  2P7J A;  3OAK A;  2HFE D;  3RK2 B;  5AVR B;  1PFI A;  4AQR D;  2FFD A;  2XZR A;  4ZKU A;  4WY4 C;  1LT9 B;  4I1L A;  3VMZ A;  4W80 A;  3M0D C;  2WSC H;  3H6P A;  2XU6 A;  1FZB A;  5KJ7 A;  4I6M C;  5KTB A;  2Q9I A;  1FZC A;  2CPS A;  3LIE A;  4I2L C;  1LT9 A;  1RE3 C;  2O01 H;  4IFF A;  3B5N B;  1SQP K;  1KZU B;  2OYI B;  4LC1 A;  2M8R A;  3HE4 B;  5KLV K;  2WSF H;  2Q5U A;  1GL2 C;  1QL2 A;  1XTG B;  2E43 A;  2FYU K;  3RK3 C;  1NO4 A;  3VTP C;  1RY3 A;  1T8Z A;  1N7S D;  5APT A;  1GTW A;  1JY3 P;  2OYI A;  4N3Y B;  1S9K D;  4B86 A;  5APY A;  1JY2 N;  1N73 B;  2WT7 A;  1FOS F;  1H8A A;  1RE4 C;  3O8Z A;  1NKZ B;  3RL0 D;  1OWA A;  2N1T D;  1LWU C;  1T2K D;  1N73 A;  3IFM A;  4KHX A;  1JTH B;  3G3Z A;  4WY4 D;  5CCH A;  2CPB A;  4XA4 A;  2HLO A;  1YTZ I;  2WZ7 A;  1FDM A;  1FJK A;  3RK2 D;  1JTH A;  4WBA A;  3L37 A;  4AUW A;  2OYH B;  1NKN A;  2YO2 A;  1RF0 C;  4LGD E;  3BRT B;  1NTK K;  3T97 A;  1ZV8 A;  5AVV B;  4LLH A;  1ZR2 A;  1IFI A;  2JJL A;  3M9Q A;  4DZO A;  3NFQ A;  3P7K A;  1ZR4 A;  4JYC A;  2NPS D;  3B5N D;  5AW1 B;  2IFM A;  2E42 A;  1CSB A;  2P67 A;  3GHG C;  2H7H A;  1N7S B;  1KIL C;  4ZKP A;  2FXM A;  3P8C E;  2J58 A;  4DOJ A;  3M9H A;  2PP6 A;  1JY2 P;  3BAT A;  1HWT C;  1N7S A;  1GK6 A;  2HPC A;  3TK1 A;  4HYT B;  2BAS A;  3OA7 A;  2HOD B;  3HUS C;  1L4A C;  5AW9 B;  3V5B A;  2WIT A;  4O9B A;  1GD2 E;  5APX A;  3PP5 A;  5CCG D;  1AFO A;  4JF7 A;  4WY4 B;  1JY3 O;  2YKQ A;  3V2Q A;  4M3L A;  2HOD A;  2N1T A;  3TNU B;  1HJB A;  1IO4 A;  4C46 A;  1SFC C;  2HG5 D;  1N2D C;  4RES B;  2C0X A;  3VN0 A;  3WMM 0;  3II6 A;  1URQ D;  2J59 M;  4WY4 A;  2ZFC A;  2YKO A;  5AW7 B;  2KB7 P;  3H32 B;  1XTC C;  3I5C A;  3HD7 C;  1LGH B;  5AVS B;  2HYN A;  2L5G B;  1FJP A;  3V4W A;  1RE3 A;  2YMY A;  4N6J A;  1FAV A;  1KIL D;  3H32 A;  3LID A;  1A02 J;  2I1J A;  3M91 A;  3MD0 A;  2NPS B;  3VP9 A;  3SWY A;  2GUS A;  1T3J A;  3U59 A;  4GT1 A;  4EOT A;  1JOC A;  2XKM A;  1AQ5 A;  3U1A A;  3C9I A;  4GKG A;  3A3Y B;  4C7R A;  5AW2 B;  2NPS A;  3B5N A;  1SQV K;  2FFD C;  1LWU B;  2WPS A;  1GW3 A;  2XV5 A;  5AW0 B;  3LW5 H;  3HE4 A;  1GZL A;  3HE5 B;  3MIW A;  2H43 A;  1NHL A;  2WWW A;  1GU5 A;  1HVV A;  3EFG A;  3BAS A;  5KJ7 C;  1FZC C;  1QL1 A;  5AVX B;  1LT9 C;  1L0N K;  2FKW B;  1JCC A;  2OAR A;  1RF1 B;  1JMM A;  4HH2 A;  1M1J B;  3HRN A;  1JY2 O;  4N78 E;  1J1D C;  5CCG A;  1URQ B;  2W27 A;  1OXZ A;  1LTA C;  1NWQ A;  4W7Z A;  4Y99 C;  1RF1 A;  2OYI C;  1JCD A;  1M1J A;  2QM8 A;  3P32 A;  1JUN A;  3A5T A;  1H88 A;  3IR9 A;  1DH3 A;  1NTM K;  1URQ A;  3GHG B;  3NMD A;  3VOP A;  1KIL B;  1J1E C;  1GL2 D;  2POH A;  1SQX K;  1J2J B;  3P8C D;  3RK3 D;  3L4F A;  3A7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...