4W80A

Tetrameric bap29 vded with disulfide bonds in crystal contacts
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
64
structure length
64
Chain Sequence
SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords B-cell receptor-associated protein 29
publication title A disulfide polymerized protein crystal.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4w80A00
5CCGA 4WY4C 5CCGD 1SFCD 1JTHB 1L4AA 4LGDE 2PP6A 3B5NA 3RK3C 1L4AD 4W7YA 3HD7C 1KILC 4JF7A 2XDJA 5KJ7C 3HD7B 1URQA 1KILB 4OH8B 5CCHC 1GL2A 1JTHA 2NPSC 1SFCA 3RL0C 1URQD 4WY4B 2NPSB 3RL0B 1GL2D 2WZ7A 2N1TA 1HVVA 3KYQA 3RK2C 3M0DC 3PP5A 2N1TD 3RK2B 3RK3B 2H8PD 1KILD 4WY4A 5KJ7D 4W80A 1N7SC 1N7SB 5CCGC 4WY4D 2NPSD 3HTKB 3RL0D 1L4AC 3HD7A 1KILA 2HG5D 3TSIA 3P8CE 3VOPA 1L4AB 5KJ7A 3B5NC 3RK3D 5CCHA 2KOGA 3B5NB 3HD7D 2NPSA 2M8RA 5CCHD 1N7SD 1URQC 2HFED 1GL2C 1URQB 1SFCC 1GL2B 4N78E 1T3JA 1SFCB 1NHLA 1XTGB 2N1TC 2N1TB 2YMYA 4W7ZA 3RK2D 3B5ND 1N7SA
chains in the Genus database with same CATH superfamily
1KQSO 2M5AB 4L75A 3Q1MA 4LC1A 1M8OB 4D6TJ 4AYCA 1FOSE 1FBMA 1EZVG 1BCCD 1BDCA 5KAFH 2NRGA 3CLQA 2PGDA 1X8YA 1ZOYC 5KJ7C 3CWBD 3NTNA 1URQA 4OH8B 2KI7B 3GHGA 2KLUA 2YIUC 1RF1B 1NTKD 1AVOA 3IR9A 1HTLC 3USSA 3MZWB 3PP5A 3CCVP 3KZIE 2FFDB 1NTMG 4NPFX 2K1AA 3HTKB 4R4LA 1Q81Q 3V2RA 2YMKA 1SQPK 3L36A 4D6TE 2A45G 2OGUA 1QGKB 2K37A 1EXIA 1R5SA 1SQQG 1RE3A 1HGVA 3MUDC 2C0XA 3PRJA 1S1CX 4NPDA 3SWKA 1LTGC 1LWUC 2KK7A 2J5UA 3CXHE 1R5LA 5KTBA 3AE5C 2ZYDA 1FOSF 3M9HA 2BEQD 2FXPA 3BATA 3UIAA 3TK1A 3TF5A 1JY2O 2OYIB 1Y9BA 1VQ4P 2V7QH 3KXDA 3GG2A 2P67A 3MHVA 3CXHH 4N6JA 2R32A 2IFNA 4K3AA 1KILC 2OYIA 1JCCA 4TLFA 2B9BA 1BSHA 1YJWP 4WY4B 3VMZA 2PAJA 2KSEA 1TU3F 5CHXA 1ZR2A 4WY4A 2C9NY 1GW4A 3L73D 3H1IJ 1ZRTE 3HE4A 4JBZA 4L76A 3V4WA 5AW0B 3H1KD 3V2PA 3M9BA 2E76C 2NPSA 2IDBA 2QJYB 1N7SD 1IFJA 1ZLLA 3II6A 3CL3D 2A06E 1Q2NA 4IFMA 2RMZA 3HUSC 2IBZG 1WRGA 2FXOA 2YXQB 1VQ9P 1NTZD 1UIIA 2YKQA 2QJPB 2KZJA 1NU1J 2FYUG 1SQXJ 3RK3E 2P7JA 1N73B 1KFMA 4GKGA 2W6JH 4UB6E 5CCGD 1JTHB 3TGUJ 1OW7A 4Y99B 4C7RA 2KZIA 3O6QA 1DD3A 3BCCD 3H1IE 1ZXGA 2OTKE 1IK9A 1HJ0A 1GU4A 1JTHA 4BXLA 1IJDB 5AW7B 4H13B 1RF1C 1IZNB 1DIPA 2KIKA 1HVVA 2A45H 2JWDA 3FX0A 1NTMK 1FZBA 1X22A 1A02F 3VN0A 1RHZB 1BE3D 2FFDC 2B87B 3CI9A 5AW1B 2JEEA 5B5EE 2H7HA 3L75D 5CCGC 1NU1E 2QJKB 3NFQA 2RH0A 1SQXE 2WWWA 3H1JG 1Q86Q 4U3FJ 2B87A 3H1LD 2FKWB 3V4QA 3P8CE 1S9KE 4QMAA 1YYCA 2YO2A 3TGUE 2ITAA 1SQBD 1IK7A 5CCHD 5B5EH 3C1LA 1LTIC 1SFCB 3M0DA 5KLVD 1SVFA 4M3LA 3TNUA 1Q90D 2P58A 3QH9A 2K88A 1L0NG 3CCUP 3IF4A 5AVQB 4WBAA 3HE5A 1MKMA 2OQQA 3H1HJ 3WUUA 1RH5B 4ZKUA 4A7PA 1RY3A 1P84I 5CCHC 3F5HA 4KHXA 4C7NA 1BGYD 2HLOA 4I7ZC 2Z5IA 5K5GB 3FWLA 4GOEA 1S5LE 3G3ZA 1MFZA 2N1TA 5APXA 5AVXB 4OGQD 3KYQA 2FYUE 2L5GB 2IYOA 1IC2A 2Q1KA 4C46A 2E42A 5AVVB 2DW3A 2Q5UA 1EDKA 5APSA 1PL5A 1DX7A 3L74J 2LXBA 2KSJA 1JM0A 1S5LH 1LGHB 1KV4A 3O8ZA 1KYOH 3GF7A 5KJ7A 2QJYC 4MN4C 3OAKA 2R5DA 4K35A 4B86A 4OGQC 2L91A 2BCCG 1W2BO 2FYUK 1VQKP 3EFGA 1NYHA 2QJPC 1ZP0C 2OARA 2ZT9B 2XNXA 1M7LA 1KMIZ 3M9QA 1YQ4C 1P84D 5AW8B 1N73C 1AV1A 1PGQA 1PP9J 1SQVJ 2KLVA 3JSVC 3RL0g 3L72E 1OVUA 1CW5A 1NAYA 4JYBA 1LP1A 1LWUB 1ZW0A 3PH0A 2PP6A 5CJ4A 5AVTB 3L71D 3L74E 3ABVC 3A5TA 1PFIA 3T97B 1PGJA 3MUDA 3GW6A 1KQGB 1JMMA 4I1LA 1LWUA 4H0LB 2K9JB 3BASA 1GMJA 3R4YA 5CMZA 3M91A 2Y9ZA 2HPCA 2YO3A 2AEFA 2JO1A 1OIPA 4I2LC 3WUTA 1L0LD 1M90Q 4AUWA 1KC8Q 1L0NE 1K04A 2ZYGA 3VMXA 3KPEA 4IFDK 5E79H 2KYVA 1YITP 1PP9E 1SQVE 3AE2C 1VL2A 1FE6A 3VP9A 1S2EA 1KILA 3OJAB 3CCQP 1U7MA 1BCCG 4N3YB 5KKZC 1LTTC 1VPCA 5KAIE 1T6AA 1OW6A 1SQPJ 1M56D 4N78D 3CWBG 1SFCC 5AW4B 3CXHI 1FZCB 3CCJP 3B4SA 3CC2P 1G1IA 2P2UA 5AVSB 2R5BA 4CPGA 1NTKG 3B5ND 1FDMA 2WSCJ 2AXTE 1EDLA 1L0NK 4XFJA 1LTBC 1ZN5A 3TDKA 3H32A 3HUSB 2NZ2A 4PD4E 1BDDA 2BEZF 5KLIC 3AEFC 2C9LY 1EDIA 3HD7B 2IZ1A 1CI6B 1UIXA 2AXTH 1NVOA 1QLED 2WZ7A 4D6TD 2OTLP 3OW2O 1M1JC 2CK3H 2WT7A 1SQPE 1H89A 1OX3A 2M5AA 2ZT9D 2V7QJ 1FZAA 4PD4H 3AEBC 2H8PD 1N7SB 4JYCA 3RL0D 3CXHD 2Z5HA 2XNDH 4IL6E 3W68A 4ASWA 3KHUA 5DJUB 2POHA 3BRTB 4HKZH 1FS0E 2KOGA 1K9MQ 1RF1A 4H0LD 1L2PA 2K3RA 2KB7P 4OVNF 3L35A 3Q5SA 2WSCH 2ZT9C 3L70J 1JY3O 1RE4C 2FFDA 4IL6H 1VF5B 3VMYA 1S3JA 3HTKA 1VQPP 5CCGA 2O1JA 3MTUE 2J58A 2XKMA 1ZR4A 1EC5A 3L73G 1AA0A 2OYHC 1IFIA 4H0LC 5APTA 4AQRD 2HODB 3H1KG 1ZRTD 1NO4A 5TJHA 3G9RA 3AE3C 1S4XA 3CMEP 1NTZG 3L70E 3G4SP 2A06D 4KT0J 2K9YA 2JJLA 2BASA 1NTMJ 4I7ZB 2XV5A 1QVFO 3FXDA 1NWQA 3P8MC 3G71P 1L4AB 2E74D 3RK3D 5CCHA 2JKVA 3HD7D 4BWNA 1KILE 1EZVE 3BCCG 1VQ6P 1FZCC 1GL2B 1OFCX 1SQQJ 1VQ8P 3KQGA 3RBZA 1NTKK 3M0AA 1E79H 3H1ID 1R8EA 4RESB 3N7NA 1BE3G 1PPJD 1IFPA 1GK6A 2O01H 1NH4A 2PRRA 3VYIA 4OGQB 1VQOP 3L75G 2JP3A 1CZQA 2QEXP 5APVA 2E74C 3RK3C 1NTME 5AW3B 2C0WA 3HD7C 3B8EB 1H88A 3H1LG 1NU1D 1SQXD 1DEBA 1VQ5P 3SWFA 1HH0A 1LTJB 2WMMA 4H44B 4L73A 5AVYB 2WSFH 1QL2A 3MIWA 1SQBG 1JNMA 4EDFA 3P8CD 3P32A 1S9KD 3TGUD 3ITKA 3RK2B 1N73A 1SQQE 1VF5D 2RKLA 1DEEG 5KLVG 1N7SC 3GHGC 4U7JA 5L8RJ 3FXEA 2Q7CA 3SSUA 2FBWC 4NPEA 3AEEC 2HG5D 5BVZA 2QVAA 3GMAA 3CPWO 1FZGA 3A0HE 3MP7B 2AXCA 2O1KA 1ZV8A 2W6BA 4HJGH 3PLNA 1BGYG 2YNYA 1XTGB 1LT9B 2ZFCA 2WPRA 1VF5C 4W7ZA 4U3FD 1SQQK 2B88A 3LIDA 2P10A 2FYUJ 5KKZB 4YTPC 5B66E 4EI2A 2YKOA 1PGOA 1IFDA 3A0HH 1J1EB 2ZXEB 4DOJA 3IN6A 3QWOC 4IFFA 1AFOA 3CCSP 1L4AD 2I8DA 1AQTA 3Q5RA 1N8RQ 1KQFB 3AE4C 1SFCA 3SWYA 1GL2D 2P1JA 3U1AA 2KS1B 1PV3A 5B66H 1PZQA 5AVWB 1NTZK 2D2CB 3H1HD 5KLIB 2E75D 2KXPB 2Q9IA 3BVHA 2IBZE 1W2EA 2NPSD 1SLQA 1IO4A 2Z4EA 1KYOE 1NAFA 1JY2N 1L4AC 1KB9E 3RBXA 2KP8A 1QEXA 1M1JB 3H1JJ 5AW2B 3C9IA 1IFMA 3L72J 3B5NB 1NKNA 1X0TA 3L71G 2ZXXA 4H44D 1GL2C 3HRNA 2Q6QA 2ZJSE 4DZOA 3TYYA 3L74D 2YMYA 3RK2D 2AEJA 1GD2E 1MFTA 1KB9H 1KTMA 3R2PA 1JO5A 1L0LG 1T8ZA 4PD4I 3NXSA 1YHQP 5TISE 3PHLA 1L0NJ 1G1JA 2XDJA 4JF7A 2UWJE 1ZMEC 1LT1A 2Q3EA 2O01N 1SQBK 4H44C 1LTJC 4XA4A 3H1JE 3E1RA 1YQ3C 1PP9D 1SQVD 3RL0B 1WMKA 2GUVA 1RE4A 3RK2C 5KLVK 5AW6B 3S4RA 2WSSH 5TISH 3U1CA 3SFEC 5E79E 2Y0EA 2OYHB 1HWTC 1W5CE 4JQ0D 2ZAEB 3T97A 1OVVA 1LTAC 2OYHA 1LNQA 4O9BA 2K9JA 3L4FA 2FXMA 1LT9C 2FY8A 3F89A 1N86A 1USDA 1AVYA 3MGNA 4RJTA 4D6TG 2BCCJ 2D2CD 3A0BE 1GDTA 2W27A 4R4MA 2OTJP 1Y8AA 1P84E 3AE6C 2E43A 4UB8E 5AW9B 1J1EC 3I5CA 3CD6P 4DJGA 1SQPD 3CCMP 1YJ9P 2WPQA 3Q5PA 4ASVA 4HH2A 3CC7P 1FZCA 3CCLP 3FGAD 3A0BH 3OA7A 3VTPC 3A7OA 1P84H 4XE5B 5GTIH 3ZDMA 4UB8H 1OW8A 2ZYAA 1AQ5A 2D2CC 1WT6A 2E74B 3RK3B 1GZLA 1OVRA 5KJ7D 2QM8A 1L0LE 2FYNB 4KJMA 2BCCE 2KNCB 3HUSA 5EFWB 4EOTA 2LXCB 2XZRA 1KN7A 3GLMA 3HD7A 1JMBA 4LLHA 2M0BA 3I55P 1CSBA 3B5NC 1CI6A 2KNCA 4YXDC 1EZVI 3GF3A 1QL1A 3V5BA 1BCCJ 1URQB 3A3YB 3GHGB 4N78E 3JCUE 2QA4P 1OZHA 1VQLP 1YI2P 3CWBJ 4WB4A 1N7SA 3PTZA 1L0LK 2RN0A 2QE7H 1NTKJ 4RKUJ 2A06G 3JCUH 3L37A 3CX5E 1H8AA 1U57A 3L70D 5M1BA 3FWNA 1T2KD 1MV8A 2YXRB 3LW5J 4EYYQ 3RL0C 2A45I 5BU8B 3EQ2A 1YJNP 3AE9C 1N2DC 1M57D 5AVRB 1BCCE 1KFNA 4RO0A 2O01J 1KILD 1EZVD 3CX5H 3H1IG 3KZIH 3CWBE 1RF0C 2GM4A 4L74A 5CJ0A 2SPZA 1NGMB 1HF9A 1HJBA 1J2JB 1NTKE 2WSFJ 1PPJG 3TSIA 3A2AA 1A02J 2WSEJ 2HODA 1T2KC 3SFDC 1S5LX 1PIXA 2QRXA 1KORA 2QG4A 1LJ2A 1NU1G 2AEMA 1NTMD 1SQXG 3IAOA 4PV1D 3Q2YA 1N7LA 2W90A 3VP8A 2E76D 1KZUB 1Q7YQ 1NJIQ 2JWAA 2VRSA 3TGUG 4ZKPA 1YBKA 3E7KA 1L4AA 1MUUA 3P7KA 2IYPA 1FJKA 1SQQD 4IOIH 1BSNA 2R3SA 2WPSA 2HYNA 3HE4B 4W7YA 3LW5H 2Y9YA 1GL2A 1NKZB 3AEGC 3L73J 2E75B 1GW3A 2YKPA 1URQD 2NPSB 2H88C 1KQLA 3I56P 2OYOA 4PV1C 3H1KJ 1IFNA 1X79B 3AEAC 1EQ7A 2FYNC 2LR2A 1K73Q 5APQA 2IBZI 4U3FG 4WWIA 1FU1A 2Y0DA 1KYOI 1NTZJ 1T3UA 1U7JA 1JUNA 2WSEH 1KB9I 1VQMP 3CC4P 4OWFA 1YTZT 1LTJA 3O6QB 4GODA 1K8AQ 3S1KA 3WUVA 1URQC 2HFED 2WITA 4TT3H 2FYZA 4GOFA 3V2NA 2IX7C 2J59M 3K5BA 3L73E 3BCCJ 2MJZA 3BRVB 5BU5A 2IFMA 3B71A 3RGUA 2G3AA 3MD0A 3H1KE 1DH3A 1H0TB 3NMDA 2MKVA 4DCKA 3H1HG 3CCRP 1PPJE 3CMAP 2QSIA 1M1KQ 1NOHA 4I6MC 4UB6H 2GA1A 1BE3J 1H0TA 5APWA 1NTZE 5APYA 3L75J 1AJYA 2IBZD 1EXJA 1QX8A 2QIWA 1RE3C 1KYOD 1LT9A 2E5TA 4GDOA 3H1LJ 2FYUD 1KB9D 1SP4A 3L72G 1Q82Q 1J1DB 5GTHE 1JB0J 3AEDC 3S9OA 1SQBJ 1E5WA 2B89A 1X9VA 3BCCE 3L74G 1HBWA 1JY3N 5DJTB 3TNUB 2KUBA 3C8VA 4WY4D 1FDIA 5KLVJ 1KD1Q 2N9BA 1HUCA 4YXWH 2GUSA 1RQUA 4EIJA 5GTHH 3HE5B 1D7MA 1BE3E 2OYIC 2WTYA 1GK4A 2I1KA 1JY3P 1NU1K 1RQVA 1FAVA 1SQXK 2KS1A 3L75E 4C7NB 1JEKA 2JDIH 3CCEP 2V4HA 1PP9G 1SQVG 2N1TB 2LKMA 3H1LE 1SS1A 1FJPA 4U3FE 1BGYJ 2R3CA 4JPZB 3JC22 3H25A 2IPPA 3H1JD 4WY4C 1Y47A 1SQBE 3L72D 2IZ0A 1QVGO 4IL6X 1M1JA 4LGDE 5CBNA 2M3EA 1G2CB 2O3JA 4DT0A 1K05A 3B5NA 1S72P 3WU2E 1JY2P 3KDPB 5H2FE 2ZVOB 5KLVE 3PJSK 3EWKA 1XTCC 3IFMA 2E75C 2XU6A 2NPSC 1G2CA 1DD4A 1VQ7P 3M06A 1OXZA 1GU5A 2YIUB 2E5YA 4HB1A 4PJ0E 1JCDA 4Y28J 3V6IA 1L0ND 1FC2C 3WU2H 4W80A 3H1HE 5H2FH 1PGPA 3EFFK 4H13D 1BGYE 1FZFA 2I1JA 2ZVNB 4HYTB 1LTSC 1USEA 5CBOA 1MZ9A 3AE7C 2HR3A 1LP1B 4WVZA 1SQPG 3D6YA 3D70A 4PJ0H 2M8RA 4Y99C 4ZMDA 1T3JA 3L71J 1JOCA 1NHLA 1OMIA 2G8YA 3N4XA 5AW5B 2H43A 3H6PA 3W67A 2HPCB 2M3BA 4BRYB 1RF0A 1GTWA 4H13C 3AECC 4GIFA 1SFCD 4PD4D 1VDFA 2WPVB 4BRYA 3V2QA 3CX5I 3E1IA 1YTZI 3G6EP 5APUA 1L0LJ 1OWAA 2N9YB 1KILB 2BCCD 2QJKC 3WMM0 1YIJP 5GTIE 3LIEA 2R44A 4ZNCA 1J1DC 2W8ZA 2WVRA 3M0DC 3D71A 2N1TD 3AE8C 4YPCA 2WQYC 3L71E 3Q3DA 2Y0CA 2H89C 3U59A 2CPSA 1VQNP 1FDOA 1Z56A 4Z1MH 4PV1B 3VOPA 1EDJA 3VMAA 3H32B 4GT1A 2PFXA 2QM7A 2E76B 2W83C 3L70G 1HGZA 1SQVK 5KAFE 5KAIH 5AVUB 5AVZB 2W6AA 1FZEA 3CX5D 2N1TC 2JR8A 3AE1C 5C39A 3D6ZA 2Q3IA 2CPBA 2WT7B
chains in the Genus database with same CATH topology
5AW8B 1N73C 1KZUB 2KLVA 4LC1A 2VRSA 4AYCA 4ZKPA 1FOSE 1FBMA 2YKOA 1CW5A 1L4AA 4JYBA 1IFDA 1J1EB 1LWUB 2ZXEB 1MUUA 4DOJA 2PP6A 3P7KA 4IFFA 5AVTB 1FJKA 5CJ4A 1AFOA 3HE4B 2WPSA 2HYNA 1L4AD 3CLQA 4W7YA 3A5TA 3LW5H 1X8YA 1PFIA 5KJ7C 3NTNA 1URQA 3MUDA 4OH8B 3GHGA 1GL2A 1NKZB 4I1LA 1JMMA 1SFCA 1GW3A 1LWUA 3SWYA 2YKPA 3BASA 1URQD 2NPSB 1KQLA 1GL2D 2P1JA 3U1AA 1RF1B 5CMZA 3M91A 3IR9A 1HTLC 2HPCA 5AVWB 2YO3A 1NTZK 3PP5A 1IFNA 1X79B 1EQ7A 2FFDB 4I2LC 4AUWA 5APQA 2Q9IA 3BVHA 3VMXA 1W2EA 2NPSD 3KPEA 1FU1A 4IFDK 3HTKB 1SLQA 2KYVA 3V2RA 1IO4A 1T3UA 2Z4EA 1JUNA 2WSEH 1NAFA 1SQPK 3L36A 1JY2N 2A45G 1L4AC 3VP9A 2KP8A 1KILA 1M1JB 3OJAB 1YTZT 5AW2B 3C9IA 1LTJA 1IFMA 3B5NB 4N3YB 1NKNA 1RE3A 1HGVA 1URQC 1LTTC 2C0XA 2WITA 2HFED 1VPCA 2FYZA 1GL2C 3HRNA 4N78D 3V2NA 2IX7C 2J59M 1SFCC 5AW4B 1LTGC 1LWUC 1FZCB 4DZOA 3TYYA 1G1IA 2MJZA 2P2UA 3BRVB 5BU5A 5KTBA 5AVSB 2IFMA 2YMYA 3RK2D 1FOSF 3M9HA 2R5BA 1GD2E 3B5ND 1FDMA 3MD0A 1DH3A 1L0NK 3R2PA 3NMDA 3BATA 3UIAA 3TK1A 1JY2O 2OYIB 1LTBC 1JO5A 1ZN5A 1T8ZA 1NOHA 3NXSA 4I6MC 3H32A 3HUSB 2P67A 5APWA 5APYA 4N6JA 1G1JA 2R32A 2C9LY 2IFNA 1KILC 2OYIA 2XDJA 4JF7A 3HD7B 1JCCA 1SQBK 1LTJC 4XA4A 3VP8A 1CI6B 1RE3C 4WY4B 1LT9A 3RL0B 3VMZA 2WZ7A 2GUVA 1RE4A 1SP4A 1M1JC 2PAJA 1J1DB 3RK2C 2WT7A 1H89A 5KLVK 5AW6B 1FZAA 1E5WA 5CHXA 1ZR2A 1X9VA 2H8PD 4WY4A 2C9NY 3U1CA 1GW4A 1HBWA 1JY3N 3TNUB 1N7SB 4JYCA 2OYHB 4WY4D 3RL0D 1HWTC 3HE4A 2N9BA 2Z5HA 1HUCA 3T97A 2POHA 3BRTB 2GUSA 3V4WA 5AW0B 4EIJA 3V2PA 1LTAC 2OYHA 2KOGA 3HE5B 4O9BA 3M9BA 2NPSA 2OYIC 2WTYA 1RF1A 1GK4A 1N7SD 2I1KA 1IFJA 1JY3P 1NU1K 1ZLLA 2FXMA 3II6A 3L4FA 1FAVA 1SQXK 3CL3D 4IFMA 3HUSC 4C7NB 2KB7P 1LT9C 3L35A 1WRGA 1N86A 2WSCH 2YKQA 1JY3O 1RE4C 2FFDA 2N1TB 2LKMA 3MGNA 1FJPA 2R3CA 3VMYA 1GDTA 2W27A 2IPPA 2P7JA 3HTKA 5CCGA 1N73B 4WY4C 2O1JA 3MTUE 1KFMA 4GKGA 2E43A 5AW9B 5CCGD 2J58A 2XKMA 1J1EC 3I5CA 1ZR4A 1M1JA 1JTHB 4Y99B 4LGDE 4C7RA 1G2CB 3B5NA 1JY2P 3KDPB 1XTCC 2WPQA 3IFMA 1IK9A 4HH2A 2OYHC 2XU6A 1GU4A 1IFIA 1JTHA 1FZCA 5APTA 2NPSC 4AQRD 2HODB 3OA7A 3VTPC 1G2CA 3A7OA 1IJDB 5AW7B 1RF1C 4XE5B 3M06A 1OXZA 1GU5A 1HVVA 1NO4A 2A45H 1NTMK 1FZBA 1AQ5A 1A02F 3VN0A 1WT6A 1JCDA 2FFDC 3RK3B 3CI9A 1GZLA 5AW1B 2JEEA 5KJ7D 2QM8A 4W80A 2H7HA 5CCGC 3HUSA 3NFQA 2JJLA 1FZFA 2BASA 2I1JA 4HYTB 1LTSC 2XV5A 2WWWA 4EOTA 2XZRA 1NWQA 3P8MC 3HD7A 2FKWB 1MZ9A 3V4QA 3P8CE 4LLHA 1L4AB 1CSBA 3B5NC 1CI6A 3RK3D 5CCHA 1YYCA 2YO2A 1S9KE 3HD7D 1QL1A 2M8RA 5CCHD 3V5BA 1URQB 3A3YB 1FZCC 4Y99C 1LTIC 3GHGB 1GL2B 4N78E 1T3JA 3KQGA 1SFCB 3M0DA 1JOCA 1NTKK 1NHLA 3M0AA 3N4XA 1SVFA 4M3LA 5AW5B 2H43A 3H6PA 4WB4A 2HPCB 2M3BA 3TNUA 1N7SA 1RF0A 1GTWA 4RESB 1L0LK 3N7NA 4GIFA 1GK6A 2O01H 1NH4A 1SFCD 5AVQB 1VDFA 3VYIA 4WBAA 3V2QA 3HE5A 1CZQA 3E1IA 3L37A 5APVA 1YTZI 3RK3C 5APUA 5AW3B 1H8AA 2C0WA 3HD7C 4ZKUA 3B8EB 1OWAA 1H88A 1RY3A 1KILB 5CCHC 1T2KD 4KHXA 4C7NA 1MV8A 3WMM0 2HLOA 1DEBA 2Z5IA 1HH0A 1LTJB 3SWFA 3RL0C 2A45I 5AVYB 5BU8B 2WSFH 1QL2A 3G3ZA 3EQ2A 3LIEA 3MIWA 1MFZA 1N2DC 2N1TA 5APXA 5AVXB 1J1DC 1JNMA 3KYQA 3P8CD 3P32A 2L5GB 3M0DC 5AVRB 1KFNA 1S9KD 2N1TD 3RK2B 1N73A 1IC2A 1KILD 4C46A 1N7SC 2E42A 1RF0C 5AVVB 2Q5UA 3GHGC 5APSA 2Q7CA 1DX7A 2GM4A 5CJ0A 3U59A 2CPSA 2KSJA 1Z56A 1LGHB 1HJBA 1J2JB 3O8ZA 2HG5D 5BVZA 3TSIA 3VOPA 3A2AA 5KJ7A 1A02J 3H32B 4GT1A 2HODA 1T2KC 2QM7A 3OAKA 1FZGA 2R5DA 4B86A 1HGZA 1SQVK 2O1KA 1ZV8A 5AVUB 2W6BA 5AVZB 2W6AA 2FYUK 1FZEA 2YNYA 3EFGA 1XTGB 2N1TC 1LT9B 2ZFCA 2WPRA 4W7ZA 1N7LA 2OARA 2XNXA 1SQQK 1M7LA 3LIDA 2Q3IA 3M9QA 2CPBA 2WT7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCG A;  4WY4 C;  5CCG D;  1SFC D;  1JTH B;  1L4A A;  4LGD E;  2PP6 A;  3B5N A;  3RK3 C;  1L4A D;  4W7Y A;  3HD7 C;  1KIL C;  4JF7 A;  2XDJ A;  5KJ7 C;  3HD7 B;  1URQ A;  1KIL B;  4OH8 B;  5CCH C;  1GL2 A;  1JTH A;  2NPS C;  1SFC A;  3RL0 C;  1URQ D;  4WY4 B;  2NPS B;  3RL0 B;  1GL2 D;  2WZ7 A;  2N1T A;  1HVV A;  3KYQ A;  3RK2 C;  3M0D C;  3PP5 A;  2N1T D;  3RK2 B;  3RK3 B;  2H8P D;  1KIL D;  4WY4 A;  5KJ7 D;  4W80 A;  1N7S C;  1N7S B;  5CCG C;  4WY4 D;  2NPS D;  3HTK B;  3RL0 D;  1L4A C;  3HD7 A;  1KIL A;  2HG5 D;  3TSI A;  3P8C E;  3VOP A;  1L4A B;  5KJ7 A;  3B5N C;  3RK3 D;  5CCH A;  2KOG A;  3B5N B;  3HD7 D;  2NPS A;  2M8R A;  5CCH D;  1N7S D;  1URQ C;  2HFE D;  1GL2 C;  1URQ B;  1SFC C;  1GL2 B;  4N78 E;  1T3J A;  1SFC B;  1NHL A;  1XTG B;  2N1T C;  2N1T B;  2YMY A;  4W7Z A;  3RK2 D;  3B5N D;  1N7S A; 
#chains in the Genus database with same CATH topology
 1KQS O;  2M5A B;  4L75 A;  3Q1M A;  4LC1 A;  1M8O B;  4D6T J;  4AYC A;  1FOS E;  1FBM A;  1EZV G;  1BCC D;  1BDC A;  5KAF H;  2NRG A;  3CLQ A;  2PGD A;  1X8Y A;  1ZOY C;  5KJ7 C;  3CWB D;  3NTN A;  1URQ A;  4OH8 B;  2KI7 B;  3GHG A;  2KLU A;  2YIU C;  1RF1 B;  1NTK D;  1AVO A;  3IR9 A;  1HTL C;  3USS A;  3MZW B;  3PP5 A;  3CCV P;  3KZI E;  2FFD B;  1NTM G;  4NPF X;  2K1A A;  3HTK B;  4R4L A;  1Q81 Q;  3V2R A;  2YMK A;  1SQP K;  3L36 A;  4D6T E;  2A45 G;  2OGU A;  1QGK B;  2K37 A;  1EXI A;  1R5S A;  1SQQ G;  1RE3 A;  1HGV A;  3MUD C;  2C0X A;  3PRJ A;  1S1C X;  4NPD A;  3SWK A;  1LTG C;  1LWU C;  2KK7 A;  2J5U A;  3CXH E;  1R5L A;  5KTB A;  3AE5 C;  2ZYD A;  1FOS F;  3M9H A;  2BEQ D;  2FXP A;  3BAT A;  3UIA A;  3TK1 A;  3TF5 A;  1JY2 O;  2OYI B;  1Y9B A;  1VQ4 P;  2V7Q H;  3KXD A;  3GG2 A;  2P67 A;  3MHV A;  3CXH H;  4N6J A;  2R32 A;  2IFN A;  4K3A A;  1KIL C;  2OYI A;  1JCC A;  4TLF A;  2B9B A;  1BSH A;  1YJW P;  4WY4 B;  3VMZ A;  2PAJ A;  2KSE A;  1TU3 F;  5CHX A;  1ZR2 A;  4WY4 A;  2C9N Y;  1GW4 A;  3L73 D;  3H1I J;  1ZRT E;  3HE4 A;  4JBZ A;  4L76 A;  3V4W A;  5AW0 B;  3H1K D;  3V2P A;  3M9B A;  2E76 C;  2NPS A;  2IDB A;  2QJY B;  1N7S D;  1IFJ A;  1ZLL A;  3II6 A;  3CL3 D;  2A06 E;  1Q2N A;  4IFM A;  2RMZ A;  3HUS C;  2IBZ G;  1WRG A;  2FXO A;  2YXQ B;  1VQ9 P;  1NTZ D;  1UII A;  2YKQ A;  2QJP B;  2KZJ A;  1NU1 J;  2FYU G;  1SQX J;  3RK3 E;  2P7J A;  1N73 B;  1KFM A;  4GKG A;  2W6J H;  4UB6 E;  5CCG D;  1JTH B;  3TGU J;  1OW7 A;  4Y99 B;  4C7R A;  2KZI A;  3O6Q A;  1DD3 A;  3BCC D;  3H1I E;  1ZXG A;  2OTK E;  1IK9 A;  1HJ0 A;  1GU4 A;  1JTH A;  4BXL A;  1IJD B;  5AW7 B;  4H13 B;  1RF1 C;  1IZN B;  1DIP A;  2KIK A;  1HVV A;  2A45 H;  2JWD A;  3FX0 A;  1NTM K;  1FZB A;  1X22 A;  1A02 F;  3VN0 A;  1RHZ B;  1BE3 D;  2FFD C;  2B87 B;  3CI9 A;  5AW1 B;  2JEE A;  5B5E E;  2H7H A;  3L75 D;  5CCG C;  1NU1 E;  2QJK B;  3NFQ A;  2RH0 A;  1SQX E;  2WWW A;  3H1J G;  1Q86 Q;  4U3F J;  2B87 A;  3H1L D;  2FKW B;  3V4Q A;  3P8C E;  1S9K E;  4QMA A;  1YYC A;  2YO2 A;  3TGU E;  2ITA A;  1SQB D;  1IK7 A;  5CCH D;  5B5E H;  3C1L A;  1LTI C;  1SFC B;  3M0D A;  5KLV D;  1SVF A;  4M3L A;  3TNU A;  1Q90 D;  2P58 A;  3QH9 A;  2K88 A;  1L0N G;  3CCU P;  3IF4 A;  5AVQ B;  4WBA A;  3HE5 A;  1MKM A;  2OQQ A;  3H1H J;  3WUU A;  1RH5 B;  4ZKU A;  4A7P A;  1RY3 A;  1P84 I;  5CCH C;  3F5H A;  4KHX A;  4C7N A;  1BGY D;  2HLO A;  4I7Z C;  2Z5I A;  5K5G B;  3FWL A;  4GOE A;  1S5L E;  3G3Z A;  1MFZ A;  2N1T A;  5APX A;  5AVX B;  4OGQ D;  3KYQ A;  2FYU E;  2L5G B;  2IYO A;  1IC2 A;  2Q1K A;  4C46 A;  2E42 A;  5AVV B;  2DW3 A;  2Q5U A;  1EDK A;  5APS A;  1PL5 A;  1DX7 A;  3L74 J;  2LXB A;  2KSJ A;  1JM0 A;  1S5L H;  1LGH B;  1KV4 A;  3O8Z A;  1KYO H;  3GF7 A;  5KJ7 A;  2QJY C;  4MN4 C;  3OAK A;  2R5D A;  4K35 A;  4B86 A;  4OGQ C;  2L91 A;  2BCC G;  1W2B O;  2FYU K;  1VQK P;  3EFG A;  1NYH A;  2QJP C;  1ZP0 C;  2OAR A;  2ZT9 B;  2XNX A;  1M7L A;  1KMI Z;  3M9Q A;  1YQ4 C;  1P84 D;  5AW8 B;  1N73 C;  1AV1 A;  1PGQ A;  1PP9 J;  1SQV J;  2KLV A;  3JSV C;  3RL0 g;  3L72 E;  1OVU A;  1CW5 A;  1NAY A;  4JYB A;  1LP1 A;  1LWU B;  1ZW0 A;  3PH0 A;  2PP6 A;  5CJ4 A;  5AVT B;  3L71 D;  3L74 E;  3ABV C;  3A5T A;  1PFI A;  3T97 B;  1PGJ A;  3MUD A;  3GW6 A;  1KQG B;  1JMM A;  4I1L A;  1LWU A;  4H0L B;  2K9J B;  3BAS A;  1GMJ A;  3R4Y A;  5CMZ A;  3M91 A;  2Y9Z A;  2HPC A;  2YO3 A;  2AEF A;  2JO1 A;  1OIP A;  4I2L C;  3WUT A;  1L0L D;  1M90 Q;  4AUW A;  1KC8 Q;  1L0N E;  1K04 A;  2ZYG A;  3VMX A;  3KPE A;  4IFD K;  5E79 H;  2KYV A;  1YIT P;  1PP9 E;  1SQV E;  3AE2 C;  1VL2 A;  1FE6 A;  3VP9 A;  1S2E A;  1KIL A;  3OJA B;  3CCQ P;  1U7M A;  1BCC G;  4N3Y B;  5KKZ C;  1LTT C;  1VPC A;  5KAI E;  1T6A A;  1OW6 A;  1SQP J;  1M56 D;  4N78 D;  3CWB G;  1SFC C;  5AW4 B;  3CXH I;  1FZC B;  3CCJ P;  3B4S A;  3CC2 P;  1G1I A;  2P2U A;  5AVS B;  2R5B A;  4CPG A;  1NTK G;  3B5N D;  1FDM A;  2WSC J;  2AXT E;  1EDL A;  1L0N K;  4XFJ A;  1LTB C;  1ZN5 A;  3TDK A;  3H32 A;  3HUS B;  2NZ2 A;  4PD4 E;  1BDD A;  2BEZ F;  5KLI C;  3AEF C;  2C9L Y;  1EDI A;  3HD7 B;  2IZ1 A;  1CI6 B;  1UIX A;  2AXT H;  1NVO A;  1QLE D;  2WZ7 A;  4D6T D;  2OTL P;  3OW2 O;  1M1J C;  2CK3 H;  2WT7 A;  1SQP E;  1H89 A;  1OX3 A;  2M5A A;  2ZT9 D;  2V7Q J;  1FZA A;  4PD4 H;  3AEB C;  2H8P D;  1N7S B;  4JYC A;  3RL0 D;  3CXH D;  2Z5H A;  2XND H;  4IL6 E;  3W68 A;  4ASW A;  3KHU A;  5DJU B;  2POH A;  3BRT B;  4HKZ H;  1FS0 E;  2KOG A;  1K9M Q;  1RF1 A;  4H0L D;  1L2P A;  2K3R A;  2KB7 P;  4OVN F;  3L35 A;  3Q5S A;  2WSC H;  2ZT9 C;  3L70 J;  1JY3 O;  1RE4 C;  2FFD A;  4IL6 H;  1VF5 B;  3VMY A;  1S3J A;  3HTK A;  1VQP P;  5CCG A;  2O1J A;  3MTU E;  2J58 A;  2XKM A;  1ZR4 A;  1EC5 A;  3L73 G;  1AA0 A;  2OYH C;  1IFI A;  4H0L C;  5APT A;  4AQR D;  2HOD B;  3H1K G;  1ZRT D;  1NO4 A;  5TJH A;  3G9R A;  3AE3 C;  1S4X A;  3CME P;  1NTZ G;  3L70 E;  3G4S P;  2A06 D;  4KT0 J;  2K9Y A;  2JJL A;  2BAS A;  1NTM J;  4I7Z B;  2XV5 A;  1QVF O;  3FXD A;  1NWQ A;  3P8M C;  3G71 P;  1L4A B;  2E74 D;  3RK3 D;  5CCH A;  2JKV A;  3HD7 D;  4BWN A;  1KIL E;  1EZV E;  3BCC G;  1VQ6 P;  1FZC C;  1GL2 B;  1OFC X;  1SQQ J;  1VQ8 P;  3KQG A;  3RBZ A;  1NTK K;  3M0A A;  1E79 H;  3H1I D;  1R8E A;  4RES B;  3N7N A;  1BE3 G;  1PPJ D;  1IFP A;  1GK6 A;  2O01 H;  1NH4 A;  2PRR A;  3VYI A;  4OGQ B;  1VQO P;  3L75 G;  2JP3 A;  1CZQ A;  2QEX P;  5APV A;  2E74 C;  3RK3 C;  1NTM E;  5AW3 B;  2C0W A;  3HD7 C;  3B8E B;  1H88 A;  3H1L G;  1NU1 D;  1SQX D;  1DEB A;  1VQ5 P;  3SWF A;  1HH0 A;  1LTJ B;  2WMM A;  4H44 B;  4L73 A;  5AVY B;  2WSF H;  1QL2 A;  3MIW A;  1SQB G;  1JNM A;  4EDF A;  3P8C D;  3P32 A;  1S9K D;  3TGU D;  3ITK A;  3RK2 B;  1N73 A;  1SQQ E;  1VF5 D;  2RKL A;  1DEE G;  5KLV G;  1N7S C;  3GHG C;  4U7J A;  5L8R J;  3FXE A;  2Q7C A;  3SSU A;  2FBW C;  4NPE A;  3AEE C;  2HG5 D;  5BVZ A;  2QVA A;  3GMA A;  3CPW O;  1FZG A;  3A0H E;  3MP7 B;  2AXC A;  2O1K A;  1ZV8 A;  2W6B A;  4HJG H;  3PLN A;  1BGY G;  2YNY A;  1XTG B;  1LT9 B;  2ZFC A;  2WPR A;  1VF5 C;  4W7Z A;  4U3F D;  1SQQ K;  2B88 A;  3LID A;  2P10 A;  2FYU J;  5KKZ B;  4YTP C;  5B66 E;  4EI2 A;  2YKO A;  1PGO A;  1IFD A;  3A0H H;  1J1E B;  2ZXE B;  4DOJ A;  3IN6 A;  3QWO C;  4IFF A;  1AFO A;  3CCS P;  1L4A D;  2I8D A;  1AQT A;  3Q5R A;  1N8R Q;  1KQF B;  3AE4 C;  1SFC A;  3SWY A;  1GL2 D;  2P1J A;  3U1A A;  2KS1 B;  1PV3 A;  5B66 H;  1PZQ A;  5AVW B;  1NTZ K;  2D2C B;  3H1H D;  5KLI B;  2E75 D;  2KXP B;  2Q9I A;  3BVH A;  2IBZ E;  1W2E A;  2NPS D;  1SLQ A;  1IO4 A;  2Z4E A;  1KYO E;  1NAF A;  1JY2 N;  1L4A C;  1KB9 E;  3RBX A;  2KP8 A;  1QEX A;  1M1J B;  3H1J J;  5AW2 B;  3C9I A;  1IFM A;  3L72 J;  3B5N B;  1NKN A;  1X0T A;  3L71 G;  2ZXX A;  4H44 D;  1GL2 C;  3HRN A;  2Q6Q A;  2ZJS E;  4DZO A;  3TYY A;  3L74 D;  2YMY A;  3RK2 D;  2AEJ A;  1GD2 E;  1MFT A;  1KB9 H;  1KTM A;  3R2P A;  1JO5 A;  1L0L G;  1T8Z A;  4PD4 I;  3NXS A;  1YHQ P;  5TIS E;  3PHL A;  1L0N J;  1G1J A;  2XDJ A;  4JF7 A;  2UWJ E;  1ZME C;  1LT1 A;  2Q3E A;  2O01 N;  1SQB K;  4H44 C;  1LTJ C;  4XA4 A;  3H1J E;  3E1R A;  1YQ3 C;  1PP9 D;  1SQV D;  3RL0 B;  1WMK A;  2GUV A;  1RE4 A;  3RK2 C;  5KLV K;  5AW6 B;  3S4R A;  2WSS H;  5TIS H;  3U1C A;  3SFE C;  5E79 E;  2Y0E A;  2OYH B;  1HWT C;  1W5C E;  4JQ0 D;  2ZAE B;  3T97 A;  1OVV A;  1LTA C;  2OYH A;  1LNQ A;  4O9B A;  2K9J A;  3L4F A;  2FXM A;  1LT9 C;  2FY8 A;  3F89 A;  1N86 A;  1USD A;  1AVY A;  3MGN A;  4RJT A;  4D6T G;  2BCC J;  2D2C D;  3A0B E;  1GDT A;  2W27 A;  4R4M A;  2OTJ P;  1Y8A A;  1P84 E;  3AE6 C;  2E43 A;  4UB8 E;  5AW9 B;  1J1E C;  3I5C A;  3CD6 P;  4DJG A;  1SQP D;  3CCM P;  1YJ9 P;  2WPQ A;  3Q5P A;  4ASV A;  4HH2 A;  3CC7 P;  1FZC A;  3CCL P;  3FGA D;  3A0B H;  3OA7 A;  3VTP C;  3A7O A;  1P84 H;  4XE5 B;  5GTI H;  3ZDM A;  4UB8 H;  1OW8 A;  2ZYA A;  1AQ5 A;  2D2C C;  1WT6 A;  2E74 B;  3RK3 B;  1GZL A;  1OVR A;  5KJ7 D;  2QM8 A;  1L0L E;  2FYN B;  4KJM A;  2BCC E;  2KNC B;  3HUS A;  5EFW B;  4EOT A;  2LXC B;  2XZR A;  1KN7 A;  3GLM A;  3HD7 A;  1JMB A;  4LLH A;  2M0B A;  3I55 P;  1CSB A;  3B5N C;  1CI6 A;  2KNC A;  4YXD C;  1EZV I;  3GF3 A;  1QL1 A;  3V5B A;  1BCC J;  1URQ B;  3A3Y B;  3GHG B;  4N78 E;  3JCU E;  2QA4 P;  1OZH A;  1VQL P;  1YI2 P;  3CWB J;  4WB4 A;  1N7S A;  3PTZ A;  1L0L K;  2RN0 A;  2QE7 H;  1NTK J;  4RKU J;  2A06 G;  3JCU H;  3L37 A;  3CX5 E;  1H8A A;  1U57 A;  3L70 D;  5M1B A;  3FWN A;  1T2K D;  1MV8 A;  2YXR B;  3LW5 J;  4EYY Q;  3RL0 C;  2A45 I;  5BU8 B;  3EQ2 A;  1YJN P;  3AE9 C;  1N2D C;  1M57 D;  5AVR B;  1BCC E;  1KFN A;  4RO0 A;  2O01 J;  1KIL D;  1EZV D;  3CX5 H;  3H1I G;  3KZI H;  3CWB E;  1RF0 C;  2GM4 A;  4L74 A;  5CJ0 A;  2SPZ A;  1NGM B;  1HF9 A;  1HJB A;  1J2J B;  1NTK E;  2WSF J;  1PPJ G;  3TSI A;  3A2A A;  1A02 J;  2WSE J;  2HOD A;  1T2K C;  3SFD C;  1S5L X;  1PIX A;  2QRX A;  1KOR A;  2QG4 A;  1LJ2 A;  1NU1 G;  2AEM A;  1NTM D;  1SQX G;  3IAO A;  4PV1 D;  3Q2Y A;  1N7L A;  2W90 A;  3VP8 A;  2E76 D;  1KZU B;  1Q7Y Q;  1NJI Q;  2JWA A;  2VRS A;  3TGU G;  4ZKP A;  1YBK A;  3E7K A;  1L4A A;  1MUU A;  3P7K A;  2IYP A;  1FJK A;  1SQQ D;  4IOI H;  1BSN A;  2R3S A;  2WPS A;  2HYN A;  3HE4 B;  4W7Y A;  3LW5 H;  2Y9Y A;  1GL2 A;  1NKZ B;  3AEG C;  3L73 J;  2E75 B;  1GW3 A;  2YKP A;  1URQ D;  2NPS B;  2H88 C;  1KQL A;  3I56 P;  2OYO A;  4PV1 C;  3H1K J;  1IFN A;  1X79 B;  3AEA C;  1EQ7 A;  2FYN C;  2LR2 A;  1K73 Q;  5APQ A;  2IBZ I;  4U3F G;  4WWI A;  1FU1 A;  2Y0D A;  1KYO I;  1NTZ J;  1T3U A;  1U7J A;  1JUN A;  2WSE H;  1KB9 I;  1VQM P;  3CC4 P;  4OWF A;  1YTZ T;  1LTJ A;  3O6Q B;  4GOD A;  1K8A Q;  3S1K A;  3WUV A;  1URQ C;  2HFE D;  2WIT A;  4TT3 H;  2FYZ A;  4GOF A;  3V2N A;  2IX7 C;  2J59 M;  3K5B A;  3L73 E;  3BCC J;  2MJZ A;  3BRV B;  5BU5 A;  2IFM A;  3B71 A;  3RGU A;  2G3A A;  3MD0 A;  3H1K E;  1DH3 A;  1H0T B;  3NMD A;  2MKV A;  4DCK A;  3H1H G;  3CCR P;  1PPJ E;  3CMA P;  2QSI A;  1M1K Q;  1NOH A;  4I6M C;  4UB6 H;  2GA1 A;  1BE3 J;  1H0T A;  5APW A;  1NTZ E;  5APY A;  3L75 J;  1AJY A;  2IBZ D;  1EXJ A;  1QX8 A;  2QIW A;  1RE3 C;  1KYO D;  1LT9 A;  2E5T A;  4GDO A;  3H1L J;  2FYU D;  1KB9 D;  1SP4 A;  3L72 G;  1Q82 Q;  1J1D B;  5GTH E;  1JB0 J;  3AED C;  3S9O A;  1SQB J;  1E5W A;  2B89 A;  1X9V A;  3BCC E;  3L74 G;  1HBW A;  1JY3 N;  5DJT B;  3TNU B;  2KUB A;  3C8V A;  4WY4 D;  1FDI A;  5KLV J;  1KD1 Q;  2N9B A;  1HUC A;  4YXW H;  2GUS A;  1RQU A;  4EIJ A;  5GTH H;  3HE5 B;  1D7M A;  1BE3 E;  2OYI C;  2WTY A;  1GK4 A;  2I1K A;  1JY3 P;  1NU1 K;  1RQV A;  1FAV A;  1SQX K;  2KS1 A;  3L75 E;  4C7N B;  1JEK A;  2JDI H;  3CCE P;  2V4H A;  1PP9 G;  1SQV G;  2N1T B;  2LKM A;  3H1L E;  1SS1 A;  1FJP A;  4U3F E;  1BGY J;  2R3C A;  4JPZ B;  3JC2 2;  3H25 A;  2IPP A;  3H1J D;  4WY4 C;  1Y47 A;  1SQB E;  3L72 D;  2IZ0 A;  1QVG O;  4IL6 X;  1M1J A;  4LGD E;  5CBN A;  2M3E A;  1G2C B;  2O3J A;  4DT0 A;  1K05 A;  3B5N A;  1S72 P;  3WU2 E;  1JY2 P;  3KDP B;  5H2F E;  2ZVO B;  5KLV E;  3PJS K;  3EWK A;  1XTC C;  3IFM A;  2E75 C;  2XU6 A;  2NPS C;  1G2C A;  1DD4 A;  1VQ7 P;  3M06 A;  1OXZ A;  1GU5 A;  2YIU B;  2E5Y A;  4HB1 A;  4PJ0 E;  1JCD A;  4Y28 J;  3V6I A;  1L0N D;  1FC2 C;  3WU2 H;  4W80 A;  3H1H E;  5H2F H;  1PGP A;  3EFF K;  4H13 D;  1BGY E;  1FZF A;  2I1J A;  2ZVN B;  4HYT B;  1LTS C;  1USE A;  5CBO A;  1MZ9 A;  3AE7 C;  2HR3 A;  1LP1 B;  4WVZ A;  1SQP G;  3D6Y A;  3D70 A;  4PJ0 H;  2M8R A;  4Y99 C;  4ZMD A;  1T3J A;  3L71 J;  1JOC A;  1NHL A;  1OMI A;  2G8Y A;  3N4X A;  5AW5 B;  2H43 A;  3H6P A;  3W67 A;  2HPC B;  2M3B A;  4BRY B;  1RF0 A;  1GTW A;  4H13 C;  3AEC C;  4GIF A;  1SFC D;  4PD4 D;  1VDF A;  2WPV B;  4BRY A;  3V2Q A;  3CX5 I;  3E1I A;  1YTZ I;  3G6E P;  5APU A;  1L0L J;  1OWA A;  2N9Y B;  1KIL B;  2BCC D;  2QJK C;  3WMM 0;  1YIJ P;  5GTI E;  3LIE A;  2R44 A;  4ZNC A;  1J1D C;  2W8Z A;  2WVR A;  3M0D C;  3D71 A;  2N1T D;  3AE8 C;  4YPC A;  2WQY C;  3L71 E;  3Q3D A;  2Y0C A;  2H89 C;  3U59 A;  2CPS A;  1VQN P;  1FDO A;  1Z56 A;  4Z1M H;  4PV1 B;  3VOP A;  1EDJ A;  3VMA A;  3H32 B;  4GT1 A;  2PFX A;  2QM7 A;  2E76 B;  2W83 C;  3L70 G;  1HGZ A;  1SQV K;  5KAF E;  5KAI H;  5AVU B;  5AVZ B;  2W6A A;  1FZE A;  3CX5 D;  2N1T C;  2JR8 A;  3AE1 C;  5C39 A;  3D6Z A;  2Q3I A;  2CPB A;  2WT7 B; 
#chains in the Genus database with same CATH homology
 5AW8 B;  1N73 C;  1KZU B;  2KLV A;  4LC1 A;  2VRS A;  4AYC A;  4ZKP A;  1FOS E;  1FBM A;  2YKO A;  1CW5 A;  1L4A A;  4JYB A;  1IFD A;  1J1E B;  1LWU B;  2ZXE B;  1MUU A;  4DOJ A;  2PP6 A;  3P7K A;  4IFF A;  5AVT B;  1FJK A;  5CJ4 A;  1AFO A;  3HE4 B;  2WPS A;  2HYN A;  1L4A D;  3CLQ A;  4W7Y A;  3A5T A;  3LW5 H;  1X8Y A;  1PFI A;  5KJ7 C;  3NTN A;  1URQ A;  3MUD A;  4OH8 B;  3GHG A;  1GL2 A;  1NKZ B;  4I1L A;  1JMM A;  1SFC A;  1GW3 A;  1LWU A;  3SWY A;  2YKP A;  3BAS A;  1URQ D;  2NPS B;  1KQL A;  1GL2 D;  2P1J A;  3U1A A;  1RF1 B;  5CMZ A;  3M91 A;  3IR9 A;  1HTL C;  2HPC A;  5AVW B;  2YO3 A;  1NTZ K;  3PP5 A;  1IFN A;  1X79 B;  1EQ7 A;  2FFD B;  4I2L C;  4AUW A;  5APQ A;  2Q9I A;  3BVH A;  3VMX A;  1W2E A;  2NPS D;  3KPE A;  1FU1 A;  4IFD K;  3HTK B;  1SLQ A;  2KYV A;  3V2R A;  1IO4 A;  1T3U A;  2Z4E A;  1JUN A;  2WSE H;  1NAF A;  1SQP K;  3L36 A;  1JY2 N;  2A45 G;  1L4A C;  3VP9 A;  2KP8 A;  1KIL A;  1M1J B;  3OJA B;  1YTZ T;  5AW2 B;  3C9I A;  1LTJ A;  1IFM A;  3B5N B;  4N3Y B;  1NKN A;  1RE3 A;  1HGV A;  1URQ C;  1LTT C;  2C0X A;  2WIT A;  2HFE D;  1VPC A;  2FYZ A;  1GL2 C;  3HRN A;  4N78 D;  3V2N A;  2IX7 C;  2J59 M;  1SFC C;  5AW4 B;  1LTG C;  1LWU C;  1FZC B;  4DZO A;  3TYY A;  1G1I A;  2MJZ A;  2P2U A;  3BRV B;  5BU5 A;  5KTB A;  5AVS B;  2IFM A;  2YMY A;  3RK2 D;  1FOS F;  3M9H A;  2R5B A;  1GD2 E;  3B5N D;  1FDM A;  3MD0 A;  1DH3 A;  1L0N K;  3R2P A;  3NMD A;  3BAT A;  3UIA A;  3TK1 A;  1JY2 O;  2OYI B;  1LTB C;  1JO5 A;  1ZN5 A;  1T8Z A;  1NOH A;  3NXS A;  4I6M C;  3H32 A;  3HUS B;  2P67 A;  5APW A;  5APY A;  4N6J A;  1G1J A;  2R32 A;  2C9L Y;  2IFN A;  1KIL C;  2OYI A;  2XDJ A;  4JF7 A;  3HD7 B;  1JCC A;  1SQB K;  1LTJ C;  4XA4 A;  3VP8 A;  1CI6 B;  1RE3 C;  4WY4 B;  1LT9 A;  3RL0 B;  3VMZ A;  2WZ7 A;  2GUV A;  1RE4 A;  1SP4 A;  1M1J C;  2PAJ A;  1J1D B;  3RK2 C;  2WT7 A;  1H89 A;  5KLV K;  5AW6 B;  1FZA A;  1E5W A;  5CHX A;  1ZR2 A;  1X9V A;  2H8P D;  4WY4 A;  2C9N Y;  3U1C A;  1GW4 A;  1HBW A;  1JY3 N;  3TNU B;  1N7S B;  4JYC A;  2OYH B;  4WY4 D;  3RL0 D;  1HWT C;  3HE4 A;  2N9B A;  2Z5H A;  1HUC A;  3T97 A;  2POH A;  3BRT B;  2GUS A;  3V4W A;  5AW0 B;  4EIJ A;  3V2P A;  1LTA C;  2OYH A;  2KOG A;  3HE5 B;  4O9B A;  3M9B A;  2NPS A;  2OYI C;  2WTY A;  1RF1 A;  1GK4 A;  1N7S D;  2I1K A;  1IFJ A;  1JY3 P;  1NU1 K;  1ZLL A;  2FXM A;  3II6 A;  3L4F A;  1FAV A;  1SQX K;  3CL3 D;  4IFM A;  3HUS C;  4C7N B;  2KB7 P;  1LT9 C;  3L35 A;  1WRG A;  1N86 A;  2WSC H;  2YKQ A;  1JY3 O;  1RE4 C;  2FFD A;  2N1T B;  2LKM A;  3MGN A;  1FJP A;  2R3C A;  3VMY A;  1GDT A;  2W27 A;  2IPP A;  2P7J A;  3HTK A;  5CCG A;  1N73 B;  4WY4 C;  2O1J A;  3MTU E;  1KFM A;  4GKG A;  2E43 A;  5AW9 B;  5CCG D;  2J58 A;  2XKM A;  1J1E C;  3I5C A;  1ZR4 A;  1M1J A;  1JTH B;  4Y99 B;  4LGD E;  4C7R A;  1G2C B;  3B5N A;  1JY2 P;  3KDP B;  1XTC C;  2WPQ A;  3IFM A;  1IK9 A;  4HH2 A;  2OYH C;  2XU6 A;  1GU4 A;  1IFI A;  1JTH A;  1FZC A;  5APT A;  2NPS C;  4AQR D;  2HOD B;  3OA7 A;  3VTP C;  1G2C A;  3A7O A;  1IJD B;  5AW7 B;  1RF1 C;  4XE5 B;  3M06 A;  1OXZ A;  1GU5 A;  1HVV A;  1NO4 A;  2A45 H;  1NTM K;  1FZB A;  1AQ5 A;  1A02 F;  3VN0 A;  1WT6 A;  1JCD A;  2FFD C;  3RK3 B;  3CI9 A;  1GZL A;  5AW1 B;  2JEE A;  5KJ7 D;  2QM8 A;  4W80 A;  2H7H A;  5CCG C;  3HUS A;  3NFQ A;  2JJL A;  1FZF A;  2BAS A;  2I1J A;  4HYT B;  1LTS C;  2XV5 A;  2WWW A;  4EOT A;  2XZR A;  1NWQ A;  3P8M C;  3HD7 A;  2FKW B;  1MZ9 A;  3V4Q A;  3P8C E;  4LLH A;  1L4A B;  1CSB A;  3B5N C;  1CI6 A;  3RK3 D;  5CCH A;  1YYC A;  2YO2 A;  1S9K E;  3HD7 D;  1QL1 A;  2M8R A;  5CCH D;  3V5B A;  1URQ B;  3A3Y B;  1FZC C;  4Y99 C;  1LTI C;  3GHG B;  1GL2 B;  4N78 E;  1T3J A;  3KQG A;  1SFC B;  3M0D A;  1JOC A;  1NTK K;  1NHL A;  3M0A A;  3N4X A;  1SVF A;  4M3L A;  5AW5 B;  2H43 A;  3H6P A;  4WB4 A;  2HPC B;  2M3B A;  3TNU A;  1N7S A;  1RF0 A;  1GTW A;  4RES B;  1L0L K;  3N7N A;  4GIF A;  1GK6 A;  2O01 H;  1NH4 A;  1SFC D;  5AVQ B;  1VDF A;  3VYI A;  4WBA A;  3V2Q A;  3HE5 A;  1CZQ A;  3E1I A;  3L37 A;  5APV A;  1YTZ I;  3RK3 C;  5APU A;  5AW3 B;  1H8A A;  2C0W A;  3HD7 C;  4ZKU A;  3B8E B;  1OWA A;  1H88 A;  1RY3 A;  1KIL B;  5CCH C;  1T2K D;  4KHX A;  4C7N A;  1MV8 A;  3WMM 0;  2HLO A;  1DEB A;  2Z5I A;  1HH0 A;  1LTJ B;  3SWF A;  3RL0 C;  2A45 I;  5AVY B;  5BU8 B;  2WSF H;  1QL2 A;  3G3Z A;  3EQ2 A;  3LIE A;  3MIW A;  1MFZ A;  1N2D C;  2N1T A;  5APX A;  5AVX B;  1J1D C;  1JNM A;  3KYQ A;  3P8C D;  3P32 A;  2L5G B;  3M0D C;  5AVR B;  1KFN A;  1S9K D;  2N1T D;  3RK2 B;  1N73 A;  1IC2 A;  1KIL D;  4C46 A;  1N7S C;  2E42 A;  1RF0 C;  5AVV B;  2Q5U A;  3GHG C;  5APS A;  2Q7C A;  1DX7 A;  2GM4 A;  5CJ0 A;  3U59 A;  2CPS A;  2KSJ A;  1Z56 A;  1LGH B;  1HJB A;  1J2J B;  3O8Z A;  2HG5 D;  5BVZ A;  3TSI A;  3VOP A;  3A2A A;  5KJ7 A;  1A02 J;  3H32 B;  4GT1 A;  2HOD A;  1T2K C;  2QM7 A;  3OAK A;  1FZG A;  2R5D A;  4B86 A;  1HGZ A;  1SQV K;  2O1K A;  1ZV8 A;  5AVU B;  2W6B A;  5AVZ B;  2W6A A;  2FYU K;  1FZE A;  2YNY A;  3EFG A;  1XTG B;  2N1T C;  1LT9 B;  2ZFC A;  2WPR A;  4W7Z A;  1N7L A;  2OAR A;  2XNX A;  1SQQ K;  1M7L A;  3LID A;  2Q3I A;  3M9Q A;  2CPB A;  2WT7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...