2IBZI

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
b'SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2ibzI00
1NTKJ 1NU1J 3H1JJ 3CWBJ 1SQVJ 1NTZJ 1KB9I 1PP9J 1L0LJ 3L71J 1BCCJ 1KYOI 3L72J 1SQBJ 4U3FJ 1SQPJ 3H1IJ 2BCCJ 1BE3J 3H1HJ 3CX5I 3H1LJ 3BCCJ 2IBZI 5KLVJ 3L74J 1EZVI 1SQQJ 1L0NJ 3L73J 3L75J 3L70J 4D6TJ 3CXHI 3H1KJ 1BGYJ 3TGUJ 4PD4I 1P84I 2FYUJ 1SQXJ 1NTMJ
chains in the Genus database with same CATH superfamily
4L73A 1ZW0A 2NPSB 3CMEP 3II6A 1LTGC 1ZN5A 3L71J 4L76A 2ZVOB 1FZAA 5AVTB 3L71E 1MZ9A 1Y9BA 1YHQP 3CXHI 1N73B 5EFWB 4N3YB 1DIPA 1G2CA 4Z1MH 4RO0A 1DD4A 1AA0A 1JM0A 3UIAA 1S2EA 3IN6A 1FJPA 3C9IA 3H1KG 2BCCJ 4MN4C 1ZV8A 1RE4C 4D6TJ 1AQ5A 2VRSA 2YKQA 2BCCE 5CJ4A 2XNXA 4PJ0E 1GK4A 2AEFA 3SFEC 4D6TE 1K05A 1VDFA 3KXDA 2NPSA 2WZ7A 4JPZB 2Y0CA 2FYUG 1ZRTD 1HGZA 1NTMK 4XFJA 2OYIC 2WSFH 1NU1J 5AW4B 1M57D 4H44D 4PV1D 3RL0B 1IO4A 1KQFB 2FBWC 1NU1E 1PL5A 1IFNA 1VQMP 4OH8B 1SP4A 4IFDK 2Y0EA 3ABVC 5AW7B 1R8EA 3L37A 1NWQA 3A0BE 1QVGO 1SQPG 3CL3D 5KAIE 3H1IJ 5APQA 1HJ0A 1LGHB 2E42A 3H1IE 4PD4I 2N1TB 2IYOA 1EDIA 2W90A 4H0LB 1CSBA 1N86A 3L74G 3D71A 2YNYA 1MUUA 1VF5D 4XE5B 2Z4EA 3HE5B 4JYCA 3L73J 3L75J 2KLVA 1MV8A 1FOSF 2V7QJ 1SFCD 3D70A 2JKVA 1M1KQ 3AEAC 3L73E 3L75E 4JQ0D 3V4QA 3H1HG 3B71A 5KLVD 2WPQA 2ZFCA 3M9HA 5KLVK 1HH0A 3FGAD 1ZXGA 4W7ZA 1H0TB 2IFMA 2O01J 2G8YA 3D6YA 3AE3C 1Q90D 4NPEA 2N1TA 1SQBJ 1K04A 1VL2A 1R5LA 2M0BA 1KV4A 1VQKP 1SQBE 1L4AD 3A0BH 1PGJA 1YJWP 3JCUH 4U3FG 5KAIH 5K5GB 2M8RA 3AE4C 3RBXA 3N7NA 3Q1MA 2DW3A 5CCGC 1KFMA 1PGQA 3AEFC 2K3RA 3VTPC 2D2CC 1CI6A 1LNQA 5B5EH 1VQPP 1OFCX 2PGDA 4HB1A 5KJ7D 1JO5A 1RE3C 3W68A 1W2EA 1D7MA 2E75B 1SQPK 1Q2NA 1XTGB 2E76C 2PP6A 2JWAA 2KIKA 1FC2C 2P67A 3VMZA 2CPBA 1K73Q 2OYIB 2V7QH 1TU3F 3PLNA 4UB6E 4NPDA 4EDFA 1MKMA 1SQQD 4D6TD 3KHUA 4O9BA 3LIDA 3AECC 4OGQD 5B66E 3H1LJ 1SQQK 1KC8Q 5GTHH 3ZDMA 3O6QB 3P32A 3H1LE 1T2KC 2WPSA 2O01H 5APTA 1RE4A 4R4LA 2A06E 3G71P 1K9MQ 2ZYDA 3TDKA 5GTIH 3BRVB 3B5NC 1IFDA 1URQC 3FWLA 2JP3A 4N78D 3WU2H 1IC2A 4HH2A 3MTUE 4U7JA 2OGUA 2OYIA 2WITA 5AVWB 1YTZT 2N9BA 3O8ZA 1PPJE 1OXZA 4LC1A 2WT7B 1KD1Q 3E1IA 3B8EB 4TT3H 2WPRA 1X8YA 2KLUA 2I1KA 3O6QA 4EI2A 1YYCA 5M1BA 5AVRB 3L70J 1R5SA 4WBAA 3B4SA 3A0HH 3PHLA 3AE8C 1AFOA 1E5WA 3D6ZA 1KB9I 3L70E 3CCLP 2YKPA 4UB8E 1KORA 2BEQD 3JC22 5B66H 1RQUA 5AVUB 4OWFA 1MFZA 1NTKG 5BU5A 3TYYA 3MIWA 2QRXA 2QM7A 1N73C 4WVZA 1NHLA 3C1LA 4L75A 4XA4A 3L72G 1A02J 1PZQA 1KB9D 3OA7A 2WT7A 1BE3D 4LLHA 2XDJA 2N9YB 4HJGH 1GMJA 1JMBA 1L0NK 1EZVG 3CWBD 1PP9G 4H13D 3M0AA 2HLOA 1JCDA 3RK3C 2D2CB 2R44A 2OTLP 4TLFA 2IZ0A 2W27A 2E5TA 1HBWA 1KFNA 3K5BA 2WSEJ 2IBZD 5APSA 3AE9C 1UIIA 2E76B 1VQ5P 1PFIA 1P84D 1BCCG 4EIJA 1S9KD 2B87B 1YITP 2HFED 3HD7D 1GZLA 4W80A 3AE7C 1VQ8P 3IR9A 1JY2N 3V2QA 5CBOA 2M3BA 2PAJA 5CCGA 1NTZK 5AW6B 4GIFA 4ZNCA 2HODB 2R32A 4K3AA 3RK3E 1GU4A 1X79B 1RHZB 1NTMG 2J58A 1FZBA 1RE3A 3KZIE 2P1JA 3CCQP 3B5NB 1URQB 1IJDB 4H0LC 3Q5RA 1HGVA 3C8VA 2O1JA 1KYOI 3GW6A 2B87A 1IK7A 2KYVA 5AW5B 2E43A 1YJNP 4RESB 3H1KJ 1OW6A 2FFDC 1IFMA 1U7MA 3H1KE 3CCVP 1VQ6P 1KYOD 3BVHA 2KSEA 2HODA 2YO2A 2WSEH 2OYOA 4K35A 1NKZB 3P8MC 2FYUJ 3GHGC 4KHXA 5H2FE 2P58A 2OQQA 2YXRB 2FYUE 1EC5A 3B5NA 1BSNA 1VQLP 1URQA 3CC4P 1N7SC 1EDKA 1QVFO 2H88C 4ASWA 2AXTE 1T6AA 2QIWA 1SQVD 5AW0B 3PRJA 2C9LY 1MFTA 2ZXXA 1LWUC 1DH3A 2R3SA 2W6JH 4HYTB 5KLVG 1LTJC 1IK9A 3H32B 1JY3O 1ZR2A 3KQGA 1HUCA 1SQPJ 1ZMEC 3WUUA 3KZIH 1YBKA 4KT0J 2KK7A 1SQPE 4ZKPA 5C39A 3CXHD 1KMIZ 1BSHA 2E75C 3RK3B 2Q3IA 2QG4A 2OTKE 1FAVA 4WWIA 3Q5SA 2RKLA 3N4XA 1PIXA 1YTZI 3L74J 3G9RA 1L0LD 1HWTC 5CJ0A 2A45I 2W6AA 3L74E 1L0LK 3SFDC 2NPSD 1N73A 1FS0E 3V4WA 4DZOA 5L8RJ 3H1HJ 3H1JG 3HTKB 1FZGA 2Z5HA 5H2FH 3H1HE 1GTWA 3HUSB 2KUBA 1JY2P 3JCUE 1KILC 2AXTH 1EXIA 3Q3DA 3RBZA 3G6EP 4Y28J 5CCHC 1OZHA 1HVVA 1JY3P 2KXPB 2Y9ZA 1LTSC 1YIJP 1H8AA 4GKGA 2XV5A 2OTJP 3P7KA 1OW7A 3AEGC 4L74A 3AE2C 5B5EE 1SQQG 2YXQB 2FXOA 4U3FJ 1SQXD 2NRGA 1QLED 1OIPA 2B89A 5CHXA 1SQXK 4U3FE 2Y9YA 4PD4D 1ZP0C 3HTKA 2J59M 2FFDB 3V2PA 1ZOYC 1LJ2A 4IOIH 3RL0D 1KILE 2M3EA 1AJYA 2P10A 4WY4B 3P8CE 1FZCB 2Q5UA 5GTHE 2WWWA 4N6JA 3GHGB 5AVQB 3PTZA 3BCCG 3PP5A 1GW4A 5AW9B 1BGYD 3TGUD 1Q82Q 5AVYB 2AEMA 3CI9A 1N7SB 5AVZB 1QX8A 3EFGA 1GL2C 3QWOC 1FZEA 5APXA 3R2PA 3CCEP 5GTIE 2YKOA 3HE5A 1JEKA 3TSIA 2KNCB 3WU2E 1LWUB 2N1TD 2WQYC 2JR8A 3CX5E 5APWA 1VQ4P 2FYUD 1NKNA 1LTJB 4H0LD 1IFPA 3MD0A 1M90Q 2FFDA 3MHVA 5AW2B 4IL6E 3VMXA 2W8ZA 3L71D 1LTBC 3I56P 1NH4A 4EYYQ 3ITKA 2Q7CA 3U59A 4M3LA 5KLIB 1H0TA 1FZCA 3VOPA 3WUVA 3GHGA 3FXDA 5TISE 1AVYA 1LT9C 1N7SA 3RK2B 3V5BA 2BCCD 3A0HE 1BE3G 1QL1A 3TK1A 1L0NG 2B88A 2KNCA 3JSVC 2FYNB 4NPFX 3OJAB 1LWUA 1JTHB 3S4RA 3CWBG 1G1IA 5TJHA 1U7JA 1QEXA 1LTJA 3F89A 3U1AA 4HKZH 1YQ4C 2KZIA 2XKMA 2Z5IA 3F5HA 2E74C 3U1CA 1J1DC 1KILB 2O3JA 1NU1D 1DEEG 4GT1A 2IBZG 1LTIC 2FYZA 2OARA 3IF4A 1NTKJ 3CX5H 1NTKE 2POHA 3L72J 1WRGA 3GMAA 4IL6H 2E75D 1FDOA 1RQVA 3CPWO 1NTZG 3L72E 2I8DA 1EXJA 1WMKA 1SLQA 4I2LC 3NFQA 3AE6C 1JTHA 3M9BA 3H1ID 1PP9J 1VQOP 5AW3B 4I7ZB 1IFIA 3SWYA 3NMDA 5TISH 1P84H 2W6BA 1EZVE 2QJPC 2Y0DA 1PP9E 3KPEA 1Q7YQ 3LW5J 1J1EC 1PGOA 4DJGA 2RH0A 3AEBC 1KILA 2ZT9B 3T97B 1AVOA 2HYNA 1USEA 2R5BA 2LXBA 5CCHA 5KAFE 2UWJE 1BCCJ 3L73D 3L75D 1FDMA 3AEEC 1RH5B 2M5AB 4H44C 5APYA 1XTCC 1PV3A 1BCCE 2BASA 1GL2B 3FXEA 1JB0J 3AE5C 3SWFA 1FE6A 1OVRA 5CCHD 1USDA 4DT0A 3WMM0 3R4YA 3VP9A 3Q2YA 2KI7B 1VQ7P 1Q81Q 2ZVNB 2XNDH 3QH9A 1RF1B 1NTMJ 1SQBD 3CC7P 1HF9A 2K9YA 3MZWB 2J5UA 2W83C 1NTME 1ZRTE 3T97A 1RF0C 2RMZA 4GDOA 1NO4A 1SQVG 4ZKUA 1OW8A 2BEZF 2M5AA 3TF5A 1LT9B 2WMMA 3CC2P 3W67A 1LP1B 1GL2A 2I1JA 2XZRA 1SFCC 1X9VA 3HE4B 2K88A 3LW5H 3CLQA 3HUSC 1Q86Q 1NVOA 5KAFH 1S1CX 1M8OB 3V2NA 1NAYA 2JEEA 1FBMA 4IFMA 1OX3A 2E74B 1ZR4A 1J1DB 4GOFA 1PGPA 3A5TA 1L0LG 2JDIH 5CCGD 3PH0A 1CW5A 1GD2E 4B86A 4GOEA 3H1LD 1UIXA 3KYQA 3BRTB 1L4AC 2D2CD 1JCCA 1LT9A 1DX7A 4WB4A 1LP1A 5KLVJ 2A06D 1K8AQ 3VN0A 3HE4A 5KLVE 1JOCA 3Q5PA 2E76D 1BDCA 1U57A 3GF3A 2LXCB 4ASVA 4EOTA 1AQTA 2QE7H 1NJIQ 3H25A 5KJ7C 2QJPB 1M1JC 4ZMDA 4WY4C 3VMAA 1FZCC 1J1EB 1PPJD 3TNUB 2O1KA 1KTMA 2H7HA 1S72P 1X22A 2KB7P 2LKMA 1T2KD 4YTPC 1SQXG 4H44B 4PV1B 1JY2O 1S5LH 5APVA 5AVXB 3H1JJ 4OGQC 3OW2O 3CD6P 1SQVK 2CPSA 2WSCJ 3B5ND 1URQD 3H1JE 1LTTC 2Q9IA 3L70D 3E7KA 1N2DC 1KQLA 2Q1KA 1BCCD 4DOJA 1KN7A 3PJSK 1SS1A 1T3JA 4Y99C 5KLIC 4C46A 4PD4H 1BGYG 3TGUG 3IFMA 3A7OA 3TNUA 1SQQJ 3NTNA 5CMZA 5KTBA 2MKVA 2GA1A 3RK2C 1J2JB 1Y8AA 2CK3H 1CZQA 1SQQE 2OYHC 1WT6A 1VF5B 2IZ1A 2C0XA 2FYNC 1NTMD 3RL0g 2H89C 1SFCB 2SPZA 2QJYC 3H32A 3L71G 2QM8A 2K9JB 1GU5A 4N78E 3BCCJ 2YO3A 4YXWH 5DJTB 3BCCE 2PFXA 4QMAA 1RF0A 2BCCG 3RGUA 3FWNA 2WSCH 1BDDA 1W5CE 4D6TG 1L4AB 3RK3D 3M06A 3GG2A 2O01N 1AV1A 4I1LA 3MUDC 4IL6X 4AYCA 3CCRP 1KQGB 1SFCA 2ITAA 4I7ZC 1L2PA 3I5CA 1FZFA 4H13C 2QVAA 2ZYGA 5CBNA 3CCMP 3HUSA 1FJKA 3M0DC 2G3AA 5BVZA 1NU1G 5APUA 2IPPA 2K9JA 1M1JB 2ZT9C 4PJ0H 5AW1B 4C7RA 3IAOA 4YXDC 1SVFA 2WTYA 3H1KD 1CI6B 1GK6A 3S1KA 1BE3J 3SSUA 1W2BO 1L0NJ 1KB9E 1L4AA 3HD7C 1BE3E 3VP8A 2K37A 2ZAEB 1YI2P 3CWBJ 3H1IG 4A7PA 1L0NE 2P7JA 4DCKA 4OGQB 3CMAP 3HRNA 2ZJSE 5AW8B 3CWBE 2YIUC 3NXSA 4BXLA 1FU1A 1RF1C 2FYUK 1VQ9P 1N8RQ 3WUTA 2V4HA 5KJ7A 1M1JA 3A2AA 2QEXP 4WY4A 1LT1A 1A02F 3L73G 3L75G 4Y99B 2IBZE 2Q6QA 3H1JD 1NGMB 2JJLA 3MP7B 1P84E 1FDIA 3A3YB 1S9KE 1HTLC 1HJBA 5AVSB 1H88A 1GW3A 1H89A 1SQPD 1NTZJ 4WY4D 1NOHA 2OYHB 2R3CA 1JMMA 1NTZE 5AVVB 5E79E 1KQSO 2QJYB 2L91A 1N7SD 5DJUB 2HPCB 1SQBG 5KKZC 3I55P 1YQ3C 1EDJA 3BATA 3L74D 2QSIA 2JWDA 1KB9H 1M7LA 3GLMA 4JYBA 1NU1K 2L5GB 3H1HD 3BASA 2IX7C 1DD3A 2NZ2A 2OYHA 1JNMA 1FOSE 2HR3A 1EDLA 1KYOE 3BCCD 2LR2A 2PRRA 2QJKC 2FY8A 1T3UA 3RK2D 2HPCA 4H13B 3CCSP 1OWAA 2H8PD 1QL2A 2GM4A 4C7NB 3G4SP 4U3FD 2IDBA 1OVUA 1SQVJ 3CCUP 3H1LG 1Z56A 3AEDC 2ZYAA 1X0TA 3OAKA 1SQVE 2KZJA 3L4FA 5E79H 4PV1C 3M91A 2A06G 2KP8A 1KILD 2R5DA 2NPSC 2FXMA 2ZXEB 1S5LX 4UB6H 3HD7B 4BRYB 3P8CD 1G1JA 3V6IA 1S4XA 1ZLLA 3MUDA 3USSA 2YMKA 1KZUB 4KJMA 1NAFA 3CX5I 2YIUB 3CXHE 3AE1C 1LTAC 2RN0A 1S3JA 1PPJG 3L36A 3M0DA 1L0LJ 4C7NA 1L0ND 4YPCA 4R4MA 1SQBK 4RJTA 3CX5D 2GUVA 1L0LE 2IBZI 2IFNA 1RY3A 3EWKA 1P84I 1KYOH 1NYHA 2H43A 1VF5C 2FKWB 2ZT9D 1GDTA 2WVRA 3L70G 3HD7A 4I6MC 4BRYA 2P2UA 1M56D 2C9NY 2E5YA 3RL0C 1S5LE 2HG5D 4JF7A 4JBZA 1GL2D 2QA4P 3L35A 2KS1B 3S9OA 5KKZB 4W7YA 1OVVA 1RF1A 4IFFA 2KOGA 2AEJA 2B9BA 3LIEA 1QGKB 1NTZD 1VPCA 2GUSA 1T8ZA 1YJ9P 1SQXJ 4UB8H 4OVNF 1IFJA 2WSSH 4AQRD 2YMYA 1SQXE 1JY3N 3CCJP 1IZNB 3VYIA 3FX0A 2Q3EA 3CXHH 3M9QA 4CPGA 2IYPA 3V2RA 3GF7A 4PD4E 4RKUJ 2K1AA 2N1TC 2FXPA 3E1RA 2KSJA 2A45G 2C0WA 1EQ7A 2XU6A 4BWNA 1OMIA 1N7LA 3G3ZA 4AUWA 1Y47A 1DEBA 2QJKB 2MJZA 1NTKD 5BU8B 3EFFK 2KS1A 3KDPB 3EQ2A 2WPVB 1EZVI 1G2CB 2WSFJ 1VQNP 3H6PA 1BGYJ 1NTKK 3TGUJ 1JUNA 3VMYA 4GODA 3L72D 3SWKA 2AXCA 1BGYE 3TGUE 2A45H 4LGDE 2JO1A 1EZVD 1E79H 1PP9D 3MGNA 2E74D
chains in the Genus database with same CATH topology
1NTKJ 1NU1J 3H1JJ 3CWBJ 1SQVJ 1NTZJ 1KB9I 1PP9J 1L0LJ 3L71J 1BCCJ 1KYOI 3L72J 1SQBJ 4U3FJ 1SQPJ 3H1IJ 2BCCJ 1BE3J 3H1HJ 3CX5I 3H1LJ 3BCCJ 2IBZI 5KLVJ 3L74J 1EZVI 1SQQJ 1L0NJ 3L73J 3L75J 3L70J 4D6TJ 3CXHI 3H1KJ 1BGYJ 3TGUJ 4PD4I 1P84I 2FYUJ 1SQXJ 1NTMJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTK J;  1NU1 J;  3H1J J;  3CWB J;  1SQV J;  1NTZ J;  1KB9 I;  1PP9 J;  1L0L J;  3L71 J;  1BCC J;  1KYO I;  3L72 J;  1SQB J;  4U3F J;  1SQP J;  3H1I J;  2BCC J;  1BE3 J;  3H1H J;  3CX5 I;  3H1L J;  3BCC J;  2IBZ I;  5KLV J;  3L74 J;  1EZV I;  1SQQ J;  1L0N J;  3L73 J;  3L75 J;  3L70 J;  4D6T J;  3CXH I;  3H1K J;  1BGY J;  3TGU J;  4PD4 I;  1P84 I;  2FYU J;  1SQX J;  1NTM J; 
#chains in the Genus database with same CATH topology
 4L73 A;  1ZW0 A;  2NPS B;  3CME P;  3II6 A;  1LTG C;  1ZN5 A;  3L71 J;  4L76 A;  2ZVO B;  1FZA A;  5AVT B;  3L71 E;  1MZ9 A;  1Y9B A;  1YHQ P;  3CXH I;  1N73 B;  5EFW B;  4N3Y B;  1DIP A;  1G2C A;  4Z1M H;  4RO0 A;  1DD4 A;  1AA0 A;  1JM0 A;  3UIA A;  1S2E A;  3IN6 A;  1FJP A;  3C9I A;  3H1K G;  2BCC J;  4MN4 C;  1ZV8 A;  1RE4 C;  4D6T J;  1AQ5 A;  2VRS A;  2YKQ A;  2BCC E;  5CJ4 A;  2XNX A;  4PJ0 E;  1GK4 A;  2AEF A;  3SFE C;  4D6T E;  1K05 A;  1VDF A;  3KXD A;  2NPS A;  2WZ7 A;  4JPZ B;  2Y0C A;  2FYU G;  1ZRT D;  1HGZ A;  1NTM K;  4XFJ A;  2OYI C;  2WSF H;  1NU1 J;  5AW4 B;  1M57 D;  4H44 D;  4PV1 D;  3RL0 B;  1IO4 A;  1KQF B;  2FBW C;  1NU1 E;  1PL5 A;  1IFN A;  1VQM P;  4OH8 B;  1SP4 A;  4IFD K;  2Y0E A;  3ABV C;  5AW7 B;  1R8E A;  3L37 A;  1NWQ A;  3A0B E;  1QVG O;  1SQP G;  3CL3 D;  5KAI E;  3H1I J;  5APQ A;  1HJ0 A;  1LGH B;  2E42 A;  3H1I E;  4PD4 I;  2N1T B;  2IYO A;  1EDI A;  2W90 A;  4H0L B;  1CSB A;  1N86 A;  3L74 G;  3D71 A;  2YNY A;  1MUU A;  1VF5 D;  4XE5 B;  2Z4E A;  3HE5 B;  4JYC A;  3L73 J;  3L75 J;  2KLV A;  1MV8 A;  1FOS F;  2V7Q J;  1SFC D;  3D70 A;  2JKV A;  1M1K Q;  3AEA C;  3L73 E;  3L75 E;  4JQ0 D;  3V4Q A;  3H1H G;  3B71 A;  5KLV D;  2WPQ A;  2ZFC A;  3M9H A;  5KLV K;  1HH0 A;  3FGA D;  1ZXG A;  4W7Z A;  1H0T B;  2IFM A;  2O01 J;  2G8Y A;  3D6Y A;  3AE3 C;  1Q90 D;  4NPE A;  2N1T A;  1SQB J;  1K04 A;  1VL2 A;  1R5L A;  2M0B A;  1KV4 A;  1VQK P;  1SQB E;  1L4A D;  3A0B H;  1PGJ A;  1YJW P;  3JCU H;  4U3F G;  5KAI H;  5K5G B;  2M8R A;  3AE4 C;  3RBX A;  3N7N A;  3Q1M A;  2DW3 A;  5CCG C;  1KFM A;  1PGQ A;  3AEF C;  2K3R A;  3VTP C;  2D2C C;  1CI6 A;  1LNQ A;  5B5E H;  1VQP P;  1OFC X;  2PGD A;  4HB1 A;  5KJ7 D;  1JO5 A;  1RE3 C;  3W68 A;  1W2E A;  1D7M A;  2E75 B;  1SQP K;  1Q2N A;  1XTG B;  2E76 C;  2PP6 A;  2JWA A;  2KIK A;  1FC2 C;  2P67 A;  3VMZ A;  2CPB A;  1K73 Q;  2OYI B;  2V7Q H;  1TU3 F;  3PLN A;  4UB6 E;  4NPD A;  4EDF A;  1MKM A;  1SQQ D;  4D6T D;  3KHU A;  4O9B A;  3LID A;  3AEC C;  4OGQ D;  5B66 E;  3H1L J;  1SQQ K;  1KC8 Q;  5GTH H;  3ZDM A;  3O6Q B;  3P32 A;  3H1L E;  1T2K C;  2WPS A;  2O01 H;  5APT A;  1RE4 A;  4R4L A;  2A06 E;  3G71 P;  1K9M Q;  2ZYD A;  3TDK A;  5GTI H;  3BRV B;  3B5N C;  1IFD A;  1URQ C;  3FWL A;  2JP3 A;  4N78 D;  3WU2 H;  1IC2 A;  4HH2 A;  3MTU E;  4U7J A;  2OGU A;  2OYI A;  2WIT A;  5AVW B;  1YTZ T;  2N9B A;  3O8Z A;  1PPJ E;  1OXZ A;  4LC1 A;  2WT7 B;  1KD1 Q;  3E1I A;  3B8E B;  4TT3 H;  2WPR A;  1X8Y A;  2KLU A;  2I1K A;  3O6Q A;  4EI2 A;  1YYC A;  5M1B A;  5AVR B;  3L70 J;  1R5S A;  4WBA A;  3B4S A;  3A0H H;  3PHL A;  3AE8 C;  1AFO A;  1E5W A;  3D6Z A;  1KB9 I;  3L70 E;  3CCL P;  2YKP A;  4UB8 E;  1KOR A;  2BEQ D;  3JC2 2;  5B66 H;  1RQU A;  5AVU B;  4OWF A;  1MFZ A;  1NTK G;  5BU5 A;  3TYY A;  3MIW A;  2QRX A;  2QM7 A;  1N73 C;  4WVZ A;  1NHL A;  3C1L A;  4L75 A;  4XA4 A;  3L72 G;  1A02 J;  1PZQ A;  1KB9 D;  3OA7 A;  2WT7 A;  1BE3 D;  4LLH A;  2XDJ A;  2N9Y B;  4HJG H;  1GMJ A;  1JMB A;  1L0N K;  1EZV G;  3CWB D;  1PP9 G;  4H13 D;  3M0A A;  2HLO A;  1JCD A;  3RK3 C;  2D2C B;  2R44 A;  2OTL P;  4TLF A;  2IZ0 A;  2W27 A;  2E5T A;  1HBW A;  1KFN A;  3K5B A;  2WSE J;  2IBZ D;  5APS A;  3AE9 C;  1UII A;  2E76 B;  1VQ5 P;  1PFI A;  1P84 D;  1BCC G;  4EIJ A;  1S9K D;  2B87 B;  1YIT P;  2HFE D;  3HD7 D;  1GZL A;  4W80 A;  3AE7 C;  1VQ8 P;  3IR9 A;  1JY2 N;  3V2Q A;  5CBO A;  2M3B A;  2PAJ A;  5CCG A;  1NTZ K;  5AW6 B;  4GIF A;  4ZNC A;  2HOD B;  2R32 A;  4K3A A;  3RK3 E;  1GU4 A;  1X79 B;  1RHZ B;  1NTM G;  2J58 A;  1FZB A;  1RE3 A;  3KZI E;  2P1J A;  3CCQ P;  3B5N B;  1URQ B;  1IJD B;  4H0L C;  3Q5R A;  1HGV A;  3C8V A;  2O1J A;  1KYO I;  3GW6 A;  2B87 A;  1IK7 A;  2KYV A;  5AW5 B;  2E43 A;  1YJN P;  4RES B;  3H1K J;  1OW6 A;  2FFD C;  1IFM A;  1U7M A;  3H1K E;  3CCV P;  1VQ6 P;  1KYO D;  3BVH A;  2KSE A;  2HOD A;  2YO2 A;  2WSE H;  2OYO A;  4K35 A;  1NKZ B;  3P8M C;  2FYU J;  3GHG C;  4KHX A;  5H2F E;  2P58 A;  2OQQ A;  2YXR B;  2FYU E;  1EC5 A;  3B5N A;  1BSN A;  1VQL P;  1URQ A;  3CC4 P;  1N7S C;  1EDK A;  1QVF O;  2H88 C;  4ASW A;  2AXT E;  1T6A A;  2QIW A;  1SQV D;  5AW0 B;  3PRJ A;  2C9L Y;  1MFT A;  2ZXX A;  1LWU C;  1DH3 A;  2R3S A;  2W6J H;  4HYT B;  5KLV G;  1LTJ C;  1IK9 A;  3H32 B;  1JY3 O;  1ZR2 A;  3KQG A;  1HUC A;  1SQP J;  1ZME C;  3WUU A;  3KZI H;  1YBK A;  4KT0 J;  2KK7 A;  1SQP E;  4ZKP A;  5C39 A;  3CXH D;  1KMI Z;  1BSH A;  2E75 C;  3RK3 B;  2Q3I A;  2QG4 A;  2OTK E;  1FAV A;  4WWI A;  3Q5S A;  2RKL A;  3N4X A;  1PIX A;  1YTZ I;  3L74 J;  3G9R A;  1L0L D;  1HWT C;  5CJ0 A;  2A45 I;  2W6A A;  3L74 E;  1L0L K;  3SFD C;  2NPS D;  1N73 A;  1FS0 E;  3V4W A;  4DZO A;  5L8R J;  3H1H J;  3H1J G;  3HTK B;  1FZG A;  2Z5H A;  5H2F H;  3H1H E;  1GTW A;  3HUS B;  2KUB A;  1JY2 P;  3JCU E;  1KIL C;  2AXT H;  1EXI A;  3Q3D A;  3RBZ A;  3G6E P;  4Y28 J;  5CCH C;  1OZH A;  1HVV A;  1JY3 P;  2KXP B;  2Y9Z A;  1LTS C;  1YIJ P;  1H8A A;  4GKG A;  2XV5 A;  2OTJ P;  3P7K A;  1OW7 A;  3AEG C;  4L74 A;  3AE2 C;  5B5E E;  1SQQ G;  2YXQ B;  2FXO A;  4U3F J;  1SQX D;  2NRG A;  1QLE D;  1OIP A;  2B89 A;  5CHX A;  1SQX K;  4U3F E;  2Y9Y A;  4PD4 D;  1ZP0 C;  3HTK A;  2J59 M;  2FFD B;  3V2P A;  1ZOY C;  1LJ2 A;  4IOI H;  3RL0 D;  1KIL E;  2M3E A;  1AJY A;  2P10 A;  4WY4 B;  3P8C E;  1FZC B;  2Q5U A;  5GTH E;  2WWW A;  4N6J A;  3GHG B;  5AVQ B;  3PTZ A;  3BCC G;  3PP5 A;  1GW4 A;  5AW9 B;  1BGY D;  3TGU D;  1Q82 Q;  5AVY B;  2AEM A;  3CI9 A;  1N7S B;  5AVZ B;  1QX8 A;  3EFG A;  1GL2 C;  3QWO C;  1FZE A;  5APX A;  3R2P A;  3CCE P;  5GTI E;  2YKO A;  3HE5 A;  1JEK A;  3TSI A;  2KNC B;  3WU2 E;  1LWU B;  2N1T D;  2WQY C;  2JR8 A;  3CX5 E;  5APW A;  1VQ4 P;  2FYU D;  1NKN A;  1LTJ B;  4H0L D;  1IFP A;  3MD0 A;  1M90 Q;  2FFD A;  3MHV A;  5AW2 B;  4IL6 E;  3VMX A;  2W8Z A;  3L71 D;  1LTB C;  3I56 P;  1NH4 A;  4EYY Q;  3ITK A;  2Q7C A;  3U59 A;  4M3L A;  5KLI B;  1H0T A;  1FZC A;  3VOP A;  3WUV A;  3GHG A;  3FXD A;  5TIS E;  1AVY A;  1LT9 C;  1N7S A;  3RK2 B;  3V5B A;  2BCC D;  3A0H E;  1BE3 G;  1QL1 A;  3TK1 A;  1L0N G;  2B88 A;  2KNC A;  3JSV C;  2FYN B;  4NPF X;  3OJA B;  1LWU A;  1JTH B;  3S4R A;  3CWB G;  1G1I A;  5TJH A;  1U7J A;  1QEX A;  1LTJ A;  3F89 A;  3U1A A;  4HKZ H;  1YQ4 C;  2KZI A;  2XKM A;  2Z5I A;  3F5H A;  2E74 C;  3U1C A;  1J1D C;  1KIL B;  2O3J A;  1NU1 D;  1DEE G;  4GT1 A;  2IBZ G;  1LTI C;  2FYZ A;  2OAR A;  3IF4 A;  1NTK J;  3CX5 H;  1NTK E;  2POH A;  3L72 J;  1WRG A;  3GMA A;  4IL6 H;  2E75 D;  1FDO A;  1RQV A;  3CPW O;  1NTZ G;  3L72 E;  2I8D A;  1EXJ A;  1WMK A;  1SLQ A;  4I2L C;  3NFQ A;  3AE6 C;  1JTH A;  3M9B A;  3H1I D;  1PP9 J;  1VQO P;  5AW3 B;  4I7Z B;  1IFI A;  3SWY A;  3NMD A;  5TIS H;  1P84 H;  2W6B A;  1EZV E;  2QJP C;  2Y0D A;  1PP9 E;  3KPE A;  1Q7Y Q;  3LW5 J;  1J1E C;  1PGO A;  4DJG A;  2RH0 A;  3AEB C;  1KIL A;  2ZT9 B;  3T97 B;  1AVO A;  2HYN A;  1USE A;  2R5B A;  2LXB A;  5CCH A;  5KAF E;  2UWJ E;  1BCC J;  3L73 D;  3L75 D;  1FDM A;  3AEE C;  1RH5 B;  2M5A B;  4H44 C;  5APY A;  1XTC C;  1PV3 A;  1BCC E;  2BAS A;  1GL2 B;  3FXE A;  1JB0 J;  3AE5 C;  3SWF A;  1FE6 A;  1OVR A;  5CCH D;  1USD A;  4DT0 A;  3WMM 0;  3R4Y A;  3VP9 A;  3Q2Y A;  2KI7 B;  1VQ7 P;  1Q81 Q;  2ZVN B;  2XND H;  3QH9 A;  1RF1 B;  1NTM J;  1SQB D;  3CC7 P;  1HF9 A;  2K9Y A;  3MZW B;  2J5U A;  2W83 C;  1NTM E;  1ZRT E;  3T97 A;  1RF0 C;  2RMZ A;  4GDO A;  1NO4 A;  1SQV G;  4ZKU A;  1OW8 A;  2BEZ F;  2M5A A;  3TF5 A;  1LT9 B;  2WMM A;  3CC2 P;  3W67 A;  1LP1 B;  1GL2 A;  2I1J A;  2XZR A;  1SFC C;  1X9V A;  3HE4 B;  2K88 A;  3LW5 H;  3CLQ A;  3HUS C;  1Q86 Q;  1NVO A;  5KAF H;  1S1C X;  1M8O B;  3V2N A;  1NAY A;  2JEE A;  1FBM A;  4IFM A;  1OX3 A;  2E74 B;  1ZR4 A;  1J1D B;  4GOF A;  1PGP A;  3A5T A;  1L0L G;  2JDI H;  5CCG D;  3PH0 A;  1CW5 A;  1GD2 E;  4B86 A;  4GOE A;  3H1L D;  1UIX A;  3KYQ A;  3BRT B;  1L4A C;  2D2C D;  1JCC A;  1LT9 A;  1DX7 A;  4WB4 A;  1LP1 A;  5KLV J;  2A06 D;  1K8A Q;  3VN0 A;  3HE4 A;  5KLV E;  1JOC A;  3Q5P A;  2E76 D;  1BDC A;  1U57 A;  3GF3 A;  2LXC B;  4ASV A;  4EOT A;  1AQT A;  2QE7 H;  1NJI Q;  3H25 A;  5KJ7 C;  2QJP B;  1M1J C;  4ZMD A;  4WY4 C;  3VMA A;  1FZC C;  1J1E B;  1PPJ D;  3TNU B;  2O1K A;  1KTM A;  2H7H A;  1S72 P;  1X22 A;  2KB7 P;  2LKM A;  1T2K D;  4YTP C;  1SQX G;  4H44 B;  4PV1 B;  1JY2 O;  1S5L H;  5APV A;  5AVX B;  3H1J J;  4OGQ C;  3OW2 O;  3CD6 P;  1SQV K;  2CPS A;  2WSC J;  3B5N D;  1URQ D;  3H1J E;  1LTT C;  2Q9I A;  3L70 D;  3E7K A;  1N2D C;  1KQL A;  2Q1K A;  1BCC D;  4DOJ A;  1KN7 A;  3PJS K;  1SS1 A;  1T3J A;  4Y99 C;  5KLI C;  4C46 A;  4PD4 H;  1BGY G;  3TGU G;  3IFM A;  3A7O A;  3TNU A;  1SQQ J;  3NTN A;  5CMZ A;  5KTB A;  2MKV A;  2GA1 A;  3RK2 C;  1J2J B;  1Y8A A;  2CK3 H;  1CZQ A;  1SQQ E;  2OYH C;  1WT6 A;  1VF5 B;  2IZ1 A;  2C0X A;  2FYN C;  1NTM D;  3RL0 g;  2H89 C;  1SFC B;  2SPZ A;  2QJY C;  3H32 A;  3L71 G;  2QM8 A;  2K9J B;  1GU5 A;  4N78 E;  3BCC J;  2YO3 A;  4YXW H;  5DJT B;  3BCC E;  2PFX A;  4QMA A;  1RF0 A;  2BCC G;  3RGU A;  3FWN A;  2WSC H;  1BDD A;  1W5C E;  4D6T G;  1L4A B;  3RK3 D;  3M06 A;  3GG2 A;  2O01 N;  1AV1 A;  4I1L A;  3MUD C;  4IL6 X;  4AYC A;  3CCR P;  1KQG B;  1SFC A;  2ITA A;  4I7Z C;  1L2P A;  3I5C A;  1FZF A;  4H13 C;  2QVA A;  2ZYG A;  5CBN A;  3CCM P;  3HUS A;  1FJK A;  3M0D C;  2G3A A;  5BVZ A;  1NU1 G;  5APU A;  2IPP A;  2K9J A;  1M1J B;  2ZT9 C;  4PJ0 H;  5AW1 B;  4C7R A;  3IAO A;  4YXD C;  1SVF A;  2WTY A;  3H1K D;  1CI6 B;  1GK6 A;  3S1K A;  1BE3 J;  3SSU A;  1W2B O;  1L0N J;  1KB9 E;  1L4A A;  3HD7 C;  1BE3 E;  3VP8 A;  2K37 A;  2ZAE B;  1YI2 P;  3CWB J;  3H1I G;  4A7P A;  1L0N E;  2P7J A;  4DCK A;  4OGQ B;  3CMA P;  3HRN A;  2ZJS E;  5AW8 B;  3CWB E;  2YIU C;  3NXS A;  4BXL A;  1FU1 A;  1RF1 C;  2FYU K;  1VQ9 P;  1N8R Q;  3WUT A;  2V4H A;  5KJ7 A;  1M1J A;  3A2A A;  2QEX P;  4WY4 A;  1LT1 A;  1A02 F;  3L73 G;  3L75 G;  4Y99 B;  2IBZ E;  2Q6Q A;  3H1J D;  1NGM B;  2JJL A;  3MP7 B;  1P84 E;  1FDI A;  3A3Y B;  1S9K E;  1HTL C;  1HJB A;  5AVS B;  1H88 A;  1GW3 A;  1H89 A;  1SQP D;  1NTZ J;  4WY4 D;  1NOH A;  2OYH B;  2R3C A;  1JMM A;  1NTZ E;  5AVV B;  5E79 E;  1KQS O;  2QJY B;  2L91 A;  1N7S D;  5DJU B;  2HPC B;  1SQB G;  5KKZ C;  3I55 P;  1YQ3 C;  1EDJ A;  3BAT A;  3L74 D;  2QSI A;  2JWD A;  1KB9 H;  1M7L A;  3GLM A;  4JYB A;  1NU1 K;  2L5G B;  3H1H D;  3BAS A;  2IX7 C;  1DD3 A;  2NZ2 A;  2OYH A;  1JNM A;  1FOS E;  2HR3 A;  1EDL A;  1KYO E;  3BCC D;  2LR2 A;  2PRR A;  2QJK C;  2FY8 A;  1T3U A;  3RK2 D;  2HPC A;  4H13 B;  3CCS P;  1OWA A;  2H8P D;  1QL2 A;  2GM4 A;  4C7N B;  3G4S P;  4U3F D;  2IDB A;  1OVU A;  1SQV J;  3CCU P;  3H1L G;  1Z56 A;  3AED C;  2ZYA A;  1X0T A;  3OAK A;  1SQV E;  2KZJ A;  3L4F A;  5E79 H;  4PV1 C;  3M91 A;  2A06 G;  2KP8 A;  1KIL D;  2R5D A;  2NPS C;  2FXM A;  2ZXE B;  1S5L X;  4UB6 H;  3HD7 B;  4BRY B;  3P8C D;  1G1J A;  3V6I A;  1S4X A;  1ZLL A;  3MUD A;  3USS A;  2YMK A;  1KZU B;  4KJM A;  1NAF A;  3CX5 I;  2YIU B;  3CXH E;  3AE1 C;  1LTA C;  2RN0 A;  1S3J A;  1PPJ G;  3L36 A;  3M0D A;  1L0L J;  4C7N A;  1L0N D;  4YPC A;  4R4M A;  1SQB K;  4RJT A;  3CX5 D;  2GUV A;  1L0L E;  2IBZ I;  2IFN A;  1RY3 A;  3EWK A;  1P84 I;  1KYO H;  1NYH A;  2H43 A;  1VF5 C;  2FKW B;  2ZT9 D;  1GDT A;  2WVR A;  3L70 G;  3HD7 A;  4I6M C;  4BRY A;  2P2U A;  1M56 D;  2C9N Y;  2E5Y A;  3RL0 C;  1S5L E;  2HG5 D;  4JF7 A;  4JBZ A;  1GL2 D;  2QA4 P;  3L35 A;  2KS1 B;  3S9O A;  5KKZ B;  4W7Y A;  1OVV A;  1RF1 A;  4IFF A;  2KOG A;  2AEJ A;  2B9B A;  3LIE A;  1QGK B;  1NTZ D;  1VPC A;  2GUS A;  1T8Z A;  1YJ9 P;  1SQX J;  4UB8 H;  4OVN F;  1IFJ A;  2WSS H;  4AQR D;  2YMY A;  1SQX E;  1JY3 N;  3CCJ P;  1IZN B;  3VYI A;  3FX0 A;  2Q3E A;  3CXH H;  3M9Q A;  4CPG A;  2IYP A;  3V2R A;  3GF7 A;  4PD4 E;  4RKU J;  2K1A A;  2N1T C;  2FXP A;  3E1R A;  2KSJ A;  2A45 G;  2C0W A;  1EQ7 A;  2XU6 A;  4BWN A;  1OMI A;  1N7L A;  3G3Z A;  4AUW A;  1Y47 A;  1DEB A;  2QJK B;  2MJZ A;  1NTK D;  5BU8 B;  3EFF K;  2KS1 A;  3KDP B;  3EQ2 A;  2WPV B;  1EZV I;  1G2C B;  2WSF J;  1VQN P;  3H6P A;  1BGY J;  1NTK K;  3TGU J;  1JUN A;  3VMY A;  4GOD A;  3L72 D;  3SWK A;  2AXC A;  1BGY E;  3TGU E;  2A45 H;  4LGD E;  2JO1 A;  1EZV D;  1E79 H;  1PP9 D;  3MGN A;  2E74 D; 
#chains in the Genus database with same CATH homology
 1NTK J;  1NU1 J;  3H1J J;  3CWB J;  1SQV J;  1NTZ J;  1KB9 I;  1PP9 J;  1L0L J;  3L71 J;  1BCC J;  1KYO I;  3L72 J;  1SQB J;  4U3F J;  1SQP J;  3H1I J;  2BCC J;  1BE3 J;  3H1H J;  3CX5 I;  3H1L J;  3BCC J;  2IBZ I;  5KLV J;  3L74 J;  1EZV I;  1SQQ J;  1L0N J;  3L73 J;  3L75 J;  3L70 J;  4D6T J;  3CXH I;  3H1K J;  1BGY J;  3TGU J;  4PD4 I;  1P84 I;  2FYU J;  1SQX J;  1NTM J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...