2IBZI

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2ibzI00
1BCCJ 3H1KJ 3H1JJ 5KLVJ 3L70J 4PD4I 1NTKJ 3CX5I 4D6TJ 2FYUJ 1L0NJ 3L72J 4U3FJ 3CWBJ 3TGUJ 1BE3J 1SQPJ 3L75J 2BCCJ 1P84I 1PP9J 1KB9I 3BCCJ 3H1LJ 3CXHI 1SQQJ 1KYOI 1NTMJ 3L74J 1L0LJ 1NTZJ 1SQVJ 1SQXJ 1EZVI 1BGYJ 1SQBJ 3H1HJ 3L73J 3L71J 3H1IJ 1NU1J 2IBZI
chains in the Genus database with same CATH superfamily
3SWFA 3S1KA 1HVVA 4K35A 3Q5PA 2FYUJ 3MTUE 4N78E 3KHUA 3N4XA 4AUWA 4WY4D 3Q1MA 1SQVJ 1N86A 2H7HA 1GW4A 3H6PA 1SQPG 1N8RQ 4C7NB 3MP7B 2NRGA 3L73G 1G1JA 5GTIH 3L72E 1EC5A 2QSIA 3B5NC 2AXCA 1LNQA 2Y0EA 1JUNA 2FFDB 2E74C 2FYUD 1FC2C 2ZT9B 1K9MQ 1OFCX 1SQVD 3U59A 3E7KA 2QEXP 4O9BA 1BSNA 2R3CA 1CSBA 2E74B 2KP8A 5APYA 1N73C 2W83C 1NKZB 4IFMA 3L35A 1MV8A 2HG5D 1NTKJ 2WQYC 1Q7YQ 3A0BE 4RESB 1KD1Q 1N73B 1HBWA 1SQQJ 1M8OB 2QJKC 1LTJB 3G71P 1VQ5P 1VQ9P 5GTHH 4PV1C 2QJKB 2FXOA 2H43A 3L36A 2A45H 3BRVB 3CWBE 1BSHA 1SVFA 1S9KE 1K05A 5AW0B 4GKGA 4XE5B 5KLVD 1MKMA 4PV1B 1FAVA 1NTKD 1L0NG 3H1JJ 4ZNCA 1FOSF 5H2FH 1PGQA 4U3FJ 2MJZA 1KV4A 2HYNA 1UIIA 1SQQD 4GIFA 2XKMA 1PP9J 1EXJA 4LGDE 3TGUE 2QM7A 1L4AD 3ABVC 3SFEC 1YJWP 2NPSA 2JWAA 3NMDA 3UIAA 2JP3A 1JNMA 3AE9C 2XNXA 2BASA 2N1TD 2ZXEB 1LTSC 2K9JA 2QE7H 3H1JD 1IFNA 1K8AQ 2MKVA 2FKWB 4U3FD 4L74A 1NVOA 3KXDA 4W7YA 3BRTB 5AVQB 2JR8A 3MGNA 1VQ7P 3H32B 2O01H 1ZRTE 1JY3N 2OYHA 3TDKA 3D6ZA 2DW3A 1LT9A 1KILC 2IBZE 3JSVC 1NTMG 4QMAA 1RF0A 4EIJA 2E42A 2KB7P 2B87A 3HE5A 1PPJD 1NTZJ 1KILB 2J59M 5CCHC 1KN7A 1PZQA 3H1KJ 2W6AA 2R44A 4BXLA 2OTKE 1Y9BA 1X22A 1GD2E 2JJLA 1BGYG 2E5YA 2D2CB 1JCCA 2ZVOB 3BCCE 1LTBC 3H1IJ 3G4SP 3IAOA 2G3AA 3P32A 3M91A 3P8CE 2A45I 1ZMEC 3GF3A 3A0BH 1NTZD 1EZVD 1QVFO 2R5DA 1IFIA 3H1KD 1KYOE 1VDFA 4WVZA 4RKUJ 1JB0J 3WUTA 5KJ7D 1S4XA 1CI6A 2CK3H 2A06G 3L37A 3H1ID 2Y0CA 5AVYB 3MZWB 1SLQA 2KXPB 2Q1KA 2Q3EA 4D6TG 2A45G 1KFMA 1NAFA 1FJPA 3T97A 3PP5A 2P7JA 3R2PA 1QL2A 1SQXG 1QGKB 2OTJP 3USSA 3LIDA 2W90A 3HD7D 3NXSA 2GM4A 4XFJA 1FE6A 4A7PA 2RH0A 1SS1A 2RKLA 3CX5I 5CHXA 3RL0D 1Q82Q 1FS0E 2E75D 3HE5B 4WBAA 5APXA 1JY3O 2QIWA 3V2PA 5AVWB 2FYUE 4R4MA 2W27A 2IYOA 1FZCA 1WMKA 2Q6QA 2KS1B 3VMAA 2R3SA 3NTNA 4OVNF 1EDKA 1SQVE 4C7RA 5CCGA 1VQOP 1LWUC 1E79H 2P1JA 1XTCC 2IZ1A 1DEEG 4DT0A 2XU6A 1U7MA 2WSCH 3IR9A 1KZUB 1BE3J 3U1AA 3EQ2A 2OYIC 1LWUB 1HWTC 1HF9A 4I7ZC 1HGZA 2E43A 5CJ0A 2BCCG 3FX0A 2XZRA 3TNUA 2WPSA 3II6A 1SFCC 3K5BA 2PRRA 1ZXGA 2XV5A 4JYBA 1GU5A 1VQNP 2WSFH 2C9LY 4OWFA 2KNCA 3RK3D 1A02F 1EQ7A 3L72G 1M56D 3ITKA 1AA0A 1BE3D 1IK7A 2WTYA 1RHZB 1SQPJ 1NTKE 4NPFX 1SQQE 2HLOA 2KLUA 3LW5H 4H0LC 3T97B 3OW2O 3HUSC 1RQVA 1RE4A 1QEXA 3RGUA 3AECC 2L5GB 1JY2P 2HR3A 3HUSB 1KYOH 2E76B 3B5ND 2K9YA 1RE3A 3KZIE 2FYUK 2E74D 3JC22 5KAIE 2IDBA 2RN0A 2BEQD 4LLHA 1SQPD 4BRYA 2YIUC 3H1JE 1S2EA 3GHGA 4PJ0E 1KB9D 1SQVK 1YTZT 4IL6E 3AEAC 3RBXA 2QJYC 4U3FE 4ZKPA 5B66E 3Q5SA 1GK6A 1PP9E 4H44C 3SFDC 3D71A 5DJUB 1OW6A 4TT3H 3CWBG 1USDA 2QJYB 1OXZA 1ZW0A 2QJPC 3VN0A 4YPCA 4I1LA 3GLMA 2IFNA 2Z5HA 3V2NA 3B5NA 4OGQC 5DJTB 2ZVNB 2WSEH 2C9NY 1VQ4P 2QJPB 1S5LE 4N6JA 1PPJE 2G8YA 3TNUB 3L70J 3NFQA 4PV1D 1RF1A 1L0NJ 1W2EA 5APVA 4GOEA 3CXHD 1JEKA 3WU2E 1D7MA 2LXBA 5KLVK 3KQGA 1HGVA 1NTKK 3W68A 2IBZI 1HJ0A 4RO0A 1GL2A 3M0AA 1OZHA 1SQQK 3M9HA 2L91A 3A7OA 3V5BA 1BDCA 3CX5E 2M8RA 2Q7CA 1LTIC 3FWLA 3AE4C 3L75E 3TYYA 1LT1A 4W7ZA 1NTZE 3L70D 1EZVE 1BCCJ 3M0DC 1L0ND 1VQLP 3H1KE 2K37A 1IFMA 2FFDC 1M1KQ 2ZT9C 1WRGA 1H89A 3M9BA 1K04A 1URQC 3KYQA 3MUDA 3GHGB 5AW5B 2VRSA 2J58A 4WB4A 4WY4A 1LGHB 1NU1K 1KTMA 1KYOI 2AXTE 3TSIA 1URQB 3IF4A 1BCCD 1T8ZA 4PD4D 1FDOA 1YJNP 1KILD 5KLVJ 1LTJC 2V7QJ 3CI9A 3GG2A 3CCUP 2ZXXA 2LXCB 2YMKA 1BGYJ 5CCHD 2M5AA 3HTKB 3KZIH 1N7SB 5KAIH 2R5BA 1RF1B 2Q9IA 1JY3P 4IFDK 3CCRP 3A5TA 4PJ0H 2K3RA 4IL6H 5B66H 1AVOA 1DEBA 1NAYA 4GOFA 1GL2B 2OARA 5TISE 1X8YA 2V4HA 1JMBA 2AEMA 1M57D 1NTZK 2KSJA 5CCHA 1BGYD 3M9QA 5APSA 4JBZA 3L4FA 3CL3D 1LP1A 3CCVP 1NU1J 4Y28J 1S5LH 3VMZA 3KPEA 2YXQB 3RK3E 4YXDC 4D6TJ 2POHA 2M0BA 2YKPA 3WU2H 3FXDA 1ZN5A 1BE3E 3CMEP 4H13B 2RMZA 1SQXJ 2J5UA 2PP6A 2C0XA 3L71E 4L73A 1Q81Q 4WY4B 1HJBA 1L4AA 3CX5H 1PGJA 2A06D 3R4YA 1J1EB 1NU1D 1U7JA 3VYIA 1KFNA 1NJIQ 1L2PA 1Y8AA 4D6TD 1PIXA 3IN6A 2N1TA 3I55P 1SQXD 1ZLLA 4L75A 2E5TA 1SQPE 2O3JA 2KI7B 2WPVB 3D70A 1IJDB 3GMAA 4BWNA 3P8MC 2P2UA 2WZ7A 2D2CC 2QVAA 4ASWA 1PV3A 2UWJE 1M90Q 1L0LK 1GU4A 5AVZB 2O01J 2BCCJ 2KYVA 1KQLA 1OIPA 3EFGA 2AXTH 3CPWO 4UB8E 4KHXA 3OAKA 3CCSP 1YITP 2NPSC 1N2DC 1OX3A 2WVRA 4C46A 1SFCD 2KOGA 2FXMA 4JF7A 2NPSB 1IC2A 3L74E 4K3AA 3JCUE 3C9IA 2JKVA 2WWWA 1M1JA 1X0TA 2P67A 2BCCD 3CLQA 3A2AA 1VQ6P 4ZKUA 1SQBK 3SWKA 1KQFB 2K9JB 1CZQA 1UIXA 3I56P 2Y0DA 1W5CE 3AEDC 1N7LA 1R5SA 4H0LD 5TISH 1DX7A 4W80A 3RK2C 4U3FG 2OYHC 3OJAB 1PP9G 1LT9C 3B4SA 3L70E 3VMYA 1L0NE 1Q86Q 3RK2B 1L0LJ 3AEEC 1RF0C 2OYHB 1VQPP 1X79B 3H1HJ 2Z5IA 1LT9B 5KJ7A 3AEFC 1SQPK 3WMM0 3Q3DA 3RBZA 2YNYA 1OWAA 3WUUA 2B87B 1PPJG 2CPSA 1BDDA 3FXEA 1DD3A 3G3ZA 1S1CX 1YTZI 1EZVI 5TJHA 3ZDMA 1RY3A 4H44D 3HRNA 2YXRB 1FOSE 5EFWB 1BCCE 3O6QA 1NOHA 1IK9A 2W8ZA 4M3LA 2SPZA 4PD4E 1EDJA 1AQ5A 1L0LD 4HB1A 3H1LJ 4OGQD 3H1HD 3Q2YA 3HD7A 2OQQA 1SQBJ 2N9BA 1Y47A 2YMYA 1ZR2A 1FZBA 3CWBD 3L75G 3QWOC 2FYNB 2WITA 4KJMA 1JTHA 1G2CA 3H1KG 2GA1A 2WSCJ 2WT7A 4EI2A 2YKOA 1CI6B 5AW2B 4IOIH 5KLVE 3H1LD 2IPPA 1MZ9A 1AFOA 2ZAEB 5C39A 1SQBD 1PL5A 4UB8H 3L73J 1ZR4A 3Q5RA 5BVZA 1U57A 2ZFCA 1L0NK 5AW7B 2E76C 5AVSB 1IFJA 3AEBC 4AQRD 2ZT9D 5AW1B 4N3YB 1FZCC 2B88A 2IYPA 5AVVB 3CCEP 3VMXA 1URQD 2ZYDA 5CCGC 3D6YA 1ZRTD 2KZJA 1P84D 2M3BA 3EWKA 1ZOYC 3MD0A 4C7NA 1FZCB 3L73D 4YTPC 1S72P 5AW8B 3HE4A 1QVGO 4HH2A 1LTTC 1MFTA 1NU1E 1JM0A 1J1DC 2QA4P 2KK7A 4D6TE 3FGAD 1LTAC 2YO2A 4AYCA 5KLIB 2IX7C 1FZGA 1J1DB 1SQXE 3TGUG 4GODA 1KQGB 1NTMK 3V2RA 4ASVA 4YXWH 1HH0A 2KNCB 1N73A 4UB6E 5K5GB 3S4RA 1LTJA 1IO4A 3PHLA 4NPDA 1BE3G 3M06A 4DZOA 3VOPA 1RQUA 4IL6X 3BASA 1Q90D 4PD4H 1RE4C 5APUA 1JO5A 2XNDH 1KB9I 1VQKP 3L71G 4MN4C 2KIKA 3PJSK 2NZ2A 1OVRA 5AVTB 5CMZA 1VQMP 1RE3C 2JDIH 3S9OA 1GMJA 1JY2N 3OA7A 2I8DA 3RK3B 3AE6C 3GHGC 1NHLA 2BCCE 2YKQA 2IBZG 3VP9A 1T2KC 1S5LX 2I1JA 1VQ8P 1VF5C 4B86A 4HKZH 4BRYB 2OTLP 3H1IE 1W2BO 1JOCA 2V7QH 1VF5B 1GW3A 3CXHI 1NH4A 1NTMJ 3HE4B 2B89A 2Q5UA 2HODA 1SP4A 5AVXB 1J2JB 1GTWA 4JQ0D 1FDMA 3BCCG 1N7SC 1NKNA 3N7NA 1SQXK 1EDIA 1RF1C 2JO1A 3MIWA 3B5NB 1QX8A 2IFMA 1PFIA 4LC1A 5L8RJ 1K73Q 3H32A 1KORA 1IFDA 2D2CD 2M3EA 1KQSO 1GL2C 3L74G 1NTMD 2OYOA 1YI2P 1QL1A 2H8PD 1L0LE 1KILA 3AE5C 2K1AA 2NPSD 3H1HE 5APTA 1JCDA 2ZYGA 3SSUA 2QG4A 3V4QA 4DJGA 3L70G 4DCKA 1QLED 1OVUA 4NPEA 2Y9ZA 4H13C 4PD4I 2HPCA 5AW9B 1M7LA 3B8EB 1OMIA 3MUDC 3F89A 2QRXA 1H0TA 1YIJP 4JYCA 2BEZF 4WY4C 3U1CA 4UB6H 3H1LE 1NWQA 3RK2D 1JY2O 3BVHA 3CC2P 1SQBE 1YQ3C 2FYUG 1J1EC 1GK4A 1EDLA 5E79E 2W6BA 1DD4A 1EXIA 5AW3B 1SQVG 1JMMA 1FU1A 1NO4A 1BCCG 2XDJA 2WMMA 2HODB 3PLNA 2FY8A 2PFXA 5CBOA 3TK1A 5BU5A 3CCMP 1XTGB 3VP8A 3E1RA 1PP9D 2C0WA 4TLFA 1T6AA 2P58A 5B5EE 2LR2A 1DIPA 3A3YB 1AV1A 3W67A 3E1IA 2M5AB 1P84E 1KB9E 2KSEA 3PRJA 5M1BA 3L73E 4I6MC 1G1IA 4GDOA 1H8AA 5KTBA 2PGDA 3VTPC 3L75J 1YYCA 1OVVA 1VPCA 2YO3A 5KLVG 2KS1A 1NTKG 3CD6P 2ITAA 4HJGH 5KAFE 1USEA 3KDPB 3BATA 1FZEA 2O1JA 1YHQP 3L72J 1SQQG 1ZV8A 2H89C 3O8ZA 3AE8C 1RH5B 1LP1B 2LKMA 1LWUA 2FXPA 3CXHE 4N78D 3A0HE 2HPCB 3GF7A 3CX5D 1PGPA 1MFZA 1H0TB 1VL2A 3L75D 3V6IA 2KLVA 2OYIA 1AJYA 2FYZA 1X9VA 1KMIZ 1L4AC 2W6JH 3QH9A 4HYTB 1A02J 3H1JG 1CW5A 3AE7C 2GUVA 4R4LA 2Y9YA 4GT1A 2WPQA 2E76D 2KUBA 3L72D 3CC7P 1SFCA 3V4WA 1L4AB 3C1LA 2AEJA 5BU8B 1NU1G 1T3UA 2N1TC 4L76A 3RL0g 1YBKA 4I2LC 3B71A 2ZYAA 3WUVA 3G6EP 1NGMB 5CJ4A 2KZIA 5CCGD 1AQTA 5AVRB 4CPGA 2N1TB 3CWBJ 1Q2NA 5KKZC 3C8VA 5AVUB 3HUSA 4RJTA 1FZAA 1FZFA 2H88C 3FWNA 2B9BA 2O1KA 4IFFA 1YJ9P 5E79H 3F5HA 4WWIA 5KKZB 3IFMA 3TGUJ 3CMAP 1KILE 4OH8B 1MUUA 3AEGC 2FYNC 3EFFK 1PGOA 1GZLA 2Z4EA 4EDFA 3AE3C 3PH0A 4Y99C 1R8EA 1H88A 1YQ4C 1HUCA 5CBNA 1S9KD 2O01N 5B5EH 1NTZG 2JWDA 1M1JC 1T3JA 3AE2C 1EZVG 1GDTA 4U7JA 1P84H 4Y99B 3V2QA 1KB9H 3L71J 1NTME 2FBWC 5AW6B 1IZNB 4ZMDA 2PAJA 2R32A 1M1JB 3TGUD 3CCJP 2OYIB 4I7ZB 5GTIE 3H1IG 2WSSH 3P7KA 1S3JA 4DOJA 1E5WA 1BGYE 1SFCB 5KAFH 5KJ7C 3AE1C 1KC8Q 2WSFJ 3CCQP 1LTGC 2AEFA 3L71D 1T2KD 1VF5D 2P10A 3CXHH 3A0HH 3GW6A 3JCUH 3SWYA 1TU3F 2I1KA 4H0LB 1WT6A 3BCCJ 1OW7A 2HFED 1Z56A 2QM8A 3LW5J 1ZP0C 3M0DA 2IBZD 3TF5A 3HD7C 3O6QB 2A06E 5GTHE 1AVYA 1N7SD 5KLIC 1NYHA 2CPBA 2FFDA 1L0LG 3CCLP 3RL0C 3MHVA 2E75C 3H1HG 3HD7B 1LJ2A 1FJKA 3PTZA 1HTLC 3L74J 2GUSA 2YIUB 4Z1MH 5APWA 1URQA 5AW4B 3RL0B 3CC4P 1OW8A 2E75B 2JEEA 1DH3A 2ZJSE 1GL2D 1R5LA 5H2FE 1JTHB 3BCCD 5APQA 1G2CB 2IZ0A 4H44B 3P8CD 4JPZB 4KT0J 2WT7B 3HTKA 1N7SA 4EOTA 3LIEA 2Q3IA 2WPRA 4EYYQ 3G9RA 2OGUA 3H1LG 4OGQB 1FBMA 3L74D 1KYOD 1SQBG 1P84I 2WSEJ 1FDIA 4XA4A 3H25A 2N9YB 3RK3C 1IFPA 3I5CA 4H13D 2K88A
chains in the Genus database with same CATH topology
1BCCJ 3H1KJ 3H1JJ 5KLVJ 3L70J 4PD4I 1NTKJ 3CX5I 4D6TJ 2FYUJ 1L0NJ 3L72J 4U3FJ 3CWBJ 3TGUJ 1BE3J 1SQPJ 3L75J 2BCCJ 1P84I 1PP9J 1KB9I 3BCCJ 3H1LJ 3CXHI 1SQQJ 1KYOI 1NTMJ 3L74J 1L0LJ 1NTZJ 1SQVJ 1SQXJ 1EZVI 1BGYJ 1SQBJ 3H1HJ 3L73J 3L71J 3H1IJ 1NU1J 2IBZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  3H1K J;  3H1J J;  5KLV J;  3L70 J;  4PD4 I;  1NTK J;  3CX5 I;  4D6T J;  2FYU J;  1L0N J;  3L72 J;  4U3F J;  3CWB J;  3TGU J;  1BE3 J;  1SQP J;  3L75 J;  2BCC J;  1P84 I;  1PP9 J;  1KB9 I;  3BCC J;  3H1L J;  3CXH I;  1SQQ J;  1KYO I;  1NTM J;  3L74 J;  1L0L J;  1NTZ J;  1SQV J;  1SQX J;  1EZV I;  1BGY J;  1SQB J;  3H1H J;  3L73 J;  3L71 J;  3H1I J;  1NU1 J;  2IBZ I; 
#chains in the Genus database with same CATH topology
 3SWF A;  3S1K A;  1HVV A;  4K35 A;  3Q5P A;  2FYU J;  3MTU E;  4N78 E;  3KHU A;  3N4X A;  4AUW A;  4WY4 D;  3Q1M A;  1SQV J;  1N86 A;  2H7H A;  1GW4 A;  3H6P A;  1SQP G;  1N8R Q;  4C7N B;  3MP7 B;  2NRG A;  3L73 G;  1G1J A;  5GTI H;  3L72 E;  1EC5 A;  2QSI A;  3B5N C;  2AXC A;  1LNQ A;  2Y0E A;  1JUN A;  2FFD B;  2E74 C;  2FYU D;  1FC2 C;  2ZT9 B;  1K9M Q;  1OFC X;  1SQV D;  3U59 A;  3E7K A;  2QEX P;  4O9B A;  1BSN A;  2R3C A;  1CSB A;  2E74 B;  2KP8 A;  5APY A;  1N73 C;  2W83 C;  1NKZ B;  4IFM A;  3L35 A;  1MV8 A;  2HG5 D;  1NTK J;  2WQY C;  1Q7Y Q;  3A0B E;  4RES B;  1KD1 Q;  1N73 B;  1HBW A;  1SQQ J;  1M8O B;  2QJK C;  1LTJ B;  3G71 P;  1VQ5 P;  1VQ9 P;  5GTH H;  4PV1 C;  2QJK B;  2FXO A;  2H43 A;  3L36 A;  2A45 H;  3BRV B;  3CWB E;  1BSH A;  1SVF A;  1S9K E;  1K05 A;  5AW0 B;  4GKG A;  4XE5 B;  5KLV D;  1MKM A;  4PV1 B;  1FAV A;  1NTK D;  1L0N G;  3H1J J;  4ZNC A;  1FOS F;  5H2F H;  1PGQ A;  4U3F J;  2MJZ A;  1KV4 A;  2HYN A;  1UII A;  1SQQ D;  4GIF A;  2XKM A;  1PP9 J;  1EXJ A;  4LGD E;  3TGU E;  2QM7 A;  1L4A D;  3ABV C;  3SFE C;  1YJW P;  2NPS A;  2JWA A;  3NMD A;  3UIA A;  2JP3 A;  1JNM A;  3AE9 C;  2XNX A;  2BAS A;  2N1T D;  2ZXE B;  1LTS C;  2K9J A;  2QE7 H;  3H1J D;  1IFN A;  1K8A Q;  2MKV A;  2FKW B;  4U3F D;  4L74 A;  1NVO A;  3KXD A;  4W7Y A;  3BRT B;  5AVQ B;  2JR8 A;  3MGN A;  1VQ7 P;  3H32 B;  2O01 H;  1ZRT E;  1JY3 N;  2OYH A;  3TDK A;  3D6Z A;  2DW3 A;  1LT9 A;  1KIL C;  2IBZ E;  3JSV C;  1NTM G;  4QMA A;  1RF0 A;  4EIJ A;  2E42 A;  2KB7 P;  2B87 A;  3HE5 A;  1PPJ D;  1NTZ J;  1KIL B;  2J59 M;  5CCH C;  1KN7 A;  1PZQ A;  3H1K J;  2W6A A;  2R44 A;  4BXL A;  2OTK E;  1Y9B A;  1X22 A;  1GD2 E;  2JJL A;  1BGY G;  2E5Y A;  2D2C B;  1JCC A;  2ZVO B;  3BCC E;  1LTB C;  3H1I J;  3G4S P;  3IAO A;  2G3A A;  3P32 A;  3M91 A;  3P8C E;  2A45 I;  1ZME C;  3GF3 A;  3A0B H;  1NTZ D;  1EZV D;  1QVF O;  2R5D A;  1IFI A;  3H1K D;  1KYO E;  1VDF A;  4WVZ A;  4RKU J;  1JB0 J;  3WUT A;  5KJ7 D;  1S4X A;  1CI6 A;  2CK3 H;  2A06 G;  3L37 A;  3H1I D;  2Y0C A;  5AVY B;  3MZW B;  1SLQ A;  2KXP B;  2Q1K A;  2Q3E A;  4D6T G;  2A45 G;  1KFM A;  1NAF A;  1FJP A;  3T97 A;  3PP5 A;  2P7J A;  3R2P A;  1QL2 A;  1SQX G;  1QGK B;  2OTJ P;  3USS A;  3LID A;  2W90 A;  3HD7 D;  3NXS A;  2GM4 A;  4XFJ A;  1FE6 A;  4A7P A;  2RH0 A;  1SS1 A;  2RKL A;  3CX5 I;  5CHX A;  3RL0 D;  1Q82 Q;  1FS0 E;  2E75 D;  3HE5 B;  4WBA A;  5APX A;  1JY3 O;  2QIW A;  3V2P A;  5AVW B;  2FYU E;  4R4M A;  2W27 A;  2IYO A;  1FZC A;  1WMK A;  2Q6Q A;  2KS1 B;  3VMA A;  2R3S A;  3NTN A;  4OVN F;  1EDK A;  1SQV E;  4C7R A;  5CCG A;  1VQO P;  1LWU C;  1E79 H;  2P1J A;  1XTC C;  2IZ1 A;  1DEE G;  4DT0 A;  2XU6 A;  1U7M A;  2WSC H;  3IR9 A;  1KZU B;  1BE3 J;  3U1A A;  3EQ2 A;  2OYI C;  1LWU B;  1HWT C;  1HF9 A;  4I7Z C;  1HGZ A;  2E43 A;  5CJ0 A;  2BCC G;  3FX0 A;  2XZR A;  3TNU A;  2WPS A;  3II6 A;  1SFC C;  3K5B A;  2PRR A;  1ZXG A;  2XV5 A;  4JYB A;  1GU5 A;  1VQN P;  2WSF H;  2C9L Y;  4OWF A;  2KNC A;  3RK3 D;  1A02 F;  1EQ7 A;  3L72 G;  1M56 D;  3ITK A;  1AA0 A;  1BE3 D;  1IK7 A;  2WTY A;  1RHZ B;  1SQP J;  1NTK E;  4NPF X;  1SQQ E;  2HLO A;  2KLU A;  3LW5 H;  4H0L C;  3T97 B;  3OW2 O;  3HUS C;  1RQV A;  1RE4 A;  1QEX A;  3RGU A;  3AEC C;  2L5G B;  1JY2 P;  2HR3 A;  3HUS B;  1KYO H;  2E76 B;  3B5N D;  2K9Y A;  1RE3 A;  3KZI E;  2FYU K;  2E74 D;  3JC2 2;  5KAI E;  2IDB A;  2RN0 A;  2BEQ D;  4LLH A;  1SQP D;  4BRY A;  2YIU C;  3H1J E;  1S2E A;  3GHG A;  4PJ0 E;  1KB9 D;  1SQV K;  1YTZ T;  4IL6 E;  3AEA C;  3RBX A;  2QJY C;  4U3F E;  4ZKP A;  5B66 E;  3Q5S A;  1GK6 A;  1PP9 E;  4H44 C;  3SFD C;  3D71 A;  5DJU B;  1OW6 A;  4TT3 H;  3CWB G;  1USD A;  2QJY B;  1OXZ A;  1ZW0 A;  2QJP C;  3VN0 A;  4YPC A;  4I1L A;  3GLM A;  2IFN A;  2Z5H A;  3V2N A;  3B5N A;  4OGQ C;  5DJT B;  2ZVN B;  2WSE H;  2C9N Y;  1VQ4 P;  2QJP B;  1S5L E;  4N6J A;  1PPJ E;  2G8Y A;  3TNU B;  3L70 J;  3NFQ A;  4PV1 D;  1RF1 A;  1L0N J;  1W2E A;  5APV A;  4GOE A;  3CXH D;  1JEK A;  3WU2 E;  1D7M A;  2LXB A;  5KLV K;  3KQG A;  1HGV A;  1NTK K;  3W68 A;  2IBZ I;  1HJ0 A;  4RO0 A;  1GL2 A;  3M0A A;  1OZH A;  1SQQ K;  3M9H A;  2L91 A;  3A7O A;  3V5B A;  1BDC A;  3CX5 E;  2M8R A;  2Q7C A;  1LTI C;  3FWL A;  3AE4 C;  3L75 E;  3TYY A;  1LT1 A;  4W7Z A;  1NTZ E;  3L70 D;  1EZV E;  1BCC J;  3M0D C;  1L0N D;  1VQL P;  3H1K E;  2K37 A;  1IFM A;  2FFD C;  1M1K Q;  2ZT9 C;  1WRG A;  1H89 A;  3M9B A;  1K04 A;  1URQ C;  3KYQ A;  3MUD A;  3GHG B;  5AW5 B;  2VRS A;  2J58 A;  4WB4 A;  4WY4 A;  1LGH B;  1NU1 K;  1KTM A;  1KYO I;  2AXT E;  3TSI A;  1URQ B;  3IF4 A;  1BCC D;  1T8Z A;  4PD4 D;  1FDO A;  1YJN P;  1KIL D;  5KLV J;  1LTJ C;  2V7Q J;  3CI9 A;  3GG2 A;  3CCU P;  2ZXX A;  2LXC B;  2YMK A;  1BGY J;  5CCH D;  2M5A A;  3HTK B;  3KZI H;  1N7S B;  5KAI H;  2R5B A;  1RF1 B;  2Q9I A;  1JY3 P;  4IFD K;  3CCR P;  3A5T A;  4PJ0 H;  2K3R A;  4IL6 H;  5B66 H;  1AVO A;  1DEB A;  1NAY A;  4GOF A;  1GL2 B;  2OAR A;  5TIS E;  1X8Y A;  2V4H A;  1JMB A;  2AEM A;  1M57 D;  1NTZ K;  2KSJ A;  5CCH A;  1BGY D;  3M9Q A;  5APS A;  4JBZ A;  3L4F A;  3CL3 D;  1LP1 A;  3CCV P;  1NU1 J;  4Y28 J;  1S5L H;  3VMZ A;  3KPE A;  2YXQ B;  3RK3 E;  4YXD C;  4D6T J;  2POH A;  2M0B A;  2YKP A;  3WU2 H;  3FXD A;  1ZN5 A;  1BE3 E;  3CME P;  4H13 B;  2RMZ A;  1SQX J;  2J5U A;  2PP6 A;  2C0X A;  3L71 E;  4L73 A;  1Q81 Q;  4WY4 B;  1HJB A;  1L4A A;  3CX5 H;  1PGJ A;  2A06 D;  3R4Y A;  1J1E B;  1NU1 D;  1U7J A;  3VYI A;  1KFN A;  1NJI Q;  1L2P A;  1Y8A A;  4D6T D;  1PIX A;  3IN6 A;  2N1T A;  3I55 P;  1SQX D;  1ZLL A;  4L75 A;  2E5T A;  1SQP E;  2O3J A;  2KI7 B;  2WPV B;  3D70 A;  1IJD B;  3GMA A;  4BWN A;  3P8M C;  2P2U A;  2WZ7 A;  2D2C C;  2QVA A;  4ASW A;  1PV3 A;  2UWJ E;  1M90 Q;  1L0L K;  1GU4 A;  5AVZ B;  2O01 J;  2BCC J;  2KYV A;  1KQL A;  1OIP A;  3EFG A;  2AXT H;  3CPW O;  4UB8 E;  4KHX A;  3OAK A;  3CCS P;  1YIT P;  2NPS C;  1N2D C;  1OX3 A;  2WVR A;  4C46 A;  1SFC D;  2KOG A;  2FXM A;  4JF7 A;  2NPS B;  1IC2 A;  3L74 E;  4K3A A;  3JCU E;  3C9I A;  2JKV A;  2WWW A;  1M1J A;  1X0T A;  2P67 A;  2BCC D;  3CLQ A;  3A2A A;  1VQ6 P;  4ZKU A;  1SQB K;  3SWK A;  1KQF B;  2K9J B;  1CZQ A;  1UIX A;  3I56 P;  2Y0D A;  1W5C E;  3AED C;  1N7L A;  1R5S A;  4H0L D;  5TIS H;  1DX7 A;  4W80 A;  3RK2 C;  4U3F G;  2OYH C;  3OJA B;  1PP9 G;  1LT9 C;  3B4S A;  3L70 E;  3VMY A;  1L0N E;  1Q86 Q;  3RK2 B;  1L0L J;  3AEE C;  1RF0 C;  2OYH B;  1VQP P;  1X79 B;  3H1H J;  2Z5I A;  1LT9 B;  5KJ7 A;  3AEF C;  1SQP K;  3WMM 0;  3Q3D A;  3RBZ A;  2YNY A;  1OWA A;  3WUU A;  2B87 B;  1PPJ G;  2CPS A;  1BDD A;  3FXE A;  1DD3 A;  3G3Z A;  1S1C X;  1YTZ I;  1EZV I;  5TJH A;  3ZDM A;  1RY3 A;  4H44 D;  3HRN A;  2YXR B;  1FOS E;  5EFW B;  1BCC E;  3O6Q A;  1NOH A;  1IK9 A;  2W8Z A;  4M3L A;  2SPZ A;  4PD4 E;  1EDJ A;  1AQ5 A;  1L0L D;  4HB1 A;  3H1L J;  4OGQ D;  3H1H D;  3Q2Y A;  3HD7 A;  2OQQ A;  1SQB J;  2N9B A;  1Y47 A;  2YMY A;  1ZR2 A;  1FZB A;  3CWB D;  3L75 G;  3QWO C;  2FYN B;  2WIT A;  4KJM A;  1JTH A;  1G2C A;  3H1K G;  2GA1 A;  2WSC J;  2WT7 A;  4EI2 A;  2YKO A;  1CI6 B;  5AW2 B;  4IOI H;  5KLV E;  3H1L D;  2IPP A;  1MZ9 A;  1AFO A;  2ZAE B;  5C39 A;  1SQB D;  1PL5 A;  4UB8 H;  3L73 J;  1ZR4 A;  3Q5R A;  5BVZ A;  1U57 A;  2ZFC A;  1L0N K;  5AW7 B;  2E76 C;  5AVS B;  1IFJ A;  3AEB C;  4AQR D;  2ZT9 D;  5AW1 B;  4N3Y B;  1FZC C;  2B88 A;  2IYP A;  5AVV B;  3CCE P;  3VMX A;  1URQ D;  2ZYD A;  5CCG C;  3D6Y A;  1ZRT D;  2KZJ A;  1P84 D;  2M3B A;  3EWK A;  1ZOY C;  3MD0 A;  4C7N A;  1FZC B;  3L73 D;  4YTP C;  1S72 P;  5AW8 B;  3HE4 A;  1QVG O;  4HH2 A;  1LTT C;  1MFT A;  1NU1 E;  1JM0 A;  1J1D C;  2QA4 P;  2KK7 A;  4D6T E;  3FGA D;  1LTA C;  2YO2 A;  4AYC A;  5KLI B;  2IX7 C;  1FZG A;  1J1D B;  1SQX E;  3TGU G;  4GOD A;  1KQG B;  1NTM K;  3V2R A;  4ASV A;  4YXW H;  1HH0 A;  2KNC B;  1N73 A;  4UB6 E;  5K5G B;  3S4R A;  1LTJ A;  1IO4 A;  3PHL A;  4NPD A;  1BE3 G;  3M06 A;  4DZO A;  3VOP A;  1RQU A;  4IL6 X;  3BAS A;  1Q90 D;  4PD4 H;  1RE4 C;  5APU A;  1JO5 A;  2XND H;  1KB9 I;  1VQK P;  3L71 G;  4MN4 C;  2KIK A;  3PJS K;  2NZ2 A;  1OVR A;  5AVT B;  5CMZ A;  1VQM P;  1RE3 C;  2JDI H;  3S9O A;  1GMJ A;  1JY2 N;  3OA7 A;  2I8D A;  3RK3 B;  3AE6 C;  3GHG C;  1NHL A;  2BCC E;  2YKQ A;  2IBZ G;  3VP9 A;  1T2K C;  1S5L X;  2I1J A;  1VQ8 P;  1VF5 C;  4B86 A;  4HKZ H;  4BRY B;  2OTL P;  3H1I E;  1W2B O;  1JOC A;  2V7Q H;  1VF5 B;  1GW3 A;  3CXH I;  1NH4 A;  1NTM J;  3HE4 B;  2B89 A;  2Q5U A;  2HOD A;  1SP4 A;  5AVX B;  1J2J B;  1GTW A;  4JQ0 D;  1FDM A;  3BCC G;  1N7S C;  1NKN A;  3N7N A;  1SQX K;  1EDI A;  1RF1 C;  2JO1 A;  3MIW A;  3B5N B;  1QX8 A;  2IFM A;  1PFI A;  4LC1 A;  5L8R J;  1K73 Q;  3H32 A;  1KOR A;  1IFD A;  2D2C D;  2M3E A;  1KQS O;  1GL2 C;  3L74 G;  1NTM D;  2OYO A;  1YI2 P;  1QL1 A;  2H8P D;  1L0L E;  1KIL A;  3AE5 C;  2K1A A;  2NPS D;  3H1H E;  5APT A;  1JCD A;  2ZYG A;  3SSU A;  2QG4 A;  3V4Q A;  4DJG A;  3L70 G;  4DCK A;  1QLE D;  1OVU A;  4NPE A;  2Y9Z A;  4H13 C;  4PD4 I;  2HPC A;  5AW9 B;  1M7L A;  3B8E B;  1OMI A;  3MUD C;  3F89 A;  2QRX A;  1H0T A;  1YIJ P;  4JYC A;  2BEZ F;  4WY4 C;  3U1C A;  4UB6 H;  3H1L E;  1NWQ A;  3RK2 D;  1JY2 O;  3BVH A;  3CC2 P;  1SQB E;  1YQ3 C;  2FYU G;  1J1E C;  1GK4 A;  1EDL A;  5E79 E;  2W6B A;  1DD4 A;  1EXI A;  5AW3 B;  1SQV G;  1JMM A;  1FU1 A;  1NO4 A;  1BCC G;  2XDJ A;  2WMM A;  2HOD B;  3PLN A;  2FY8 A;  2PFX A;  5CBO A;  3TK1 A;  5BU5 A;  3CCM P;  1XTG B;  3VP8 A;  3E1R A;  1PP9 D;  2C0W A;  4TLF A;  1T6A A;  2P58 A;  5B5E E;  2LR2 A;  1DIP A;  3A3Y B;  1AV1 A;  3W67 A;  3E1I A;  2M5A B;  1P84 E;  1KB9 E;  2KSE A;  3PRJ A;  5M1B A;  3L73 E;  4I6M C;  1G1I A;  4GDO A;  1H8A A;  5KTB A;  2PGD A;  3VTP C;  3L75 J;  1YYC A;  1OVV A;  1VPC A;  2YO3 A;  5KLV G;  2KS1 A;  1NTK G;  3CD6 P;  2ITA A;  4HJG H;  5KAF E;  1USE A;  3KDP B;  3BAT A;  1FZE A;  2O1J A;  1YHQ P;  3L72 J;  1SQQ G;  1ZV8 A;  2H89 C;  3O8Z A;  3AE8 C;  1RH5 B;  1LP1 B;  2LKM A;  1LWU A;  2FXP A;  3CXH E;  4N78 D;  3A0H E;  2HPC B;  3GF7 A;  3CX5 D;  1PGP A;  1MFZ A;  1H0T B;  1VL2 A;  3L75 D;  3V6I A;  2KLV A;  2OYI A;  1AJY A;  2FYZ A;  1X9V A;  1KMI Z;  1L4A C;  2W6J H;  3QH9 A;  4HYT B;  1A02 J;  3H1J G;  1CW5 A;  3AE7 C;  2GUV A;  4R4L A;  2Y9Y A;  4GT1 A;  2WPQ A;  2E76 D;  2KUB A;  3L72 D;  3CC7 P;  1SFC A;  3V4W A;  1L4A B;  3C1L A;  2AEJ A;  5BU8 B;  1NU1 G;  1T3U A;  2N1T C;  4L76 A;  3RL0 g;  1YBK A;  4I2L C;  3B71 A;  2ZYA A;  3WUV A;  3G6E P;  1NGM B;  5CJ4 A;  2KZI A;  5CCG D;  1AQT A;  5AVR B;  4CPG A;  2N1T B;  3CWB J;  1Q2N A;  5KKZ C;  3C8V A;  5AVU B;  3HUS A;  4RJT A;  1FZA A;  1FZF A;  2H88 C;  3FWN A;  2B9B A;  2O1K A;  4IFF A;  1YJ9 P;  5E79 H;  3F5H A;  4WWI A;  5KKZ B;  3IFM A;  3TGU J;  3CMA P;  1KIL E;  4OH8 B;  1MUU A;  3AEG C;  2FYN C;  3EFF K;  1PGO A;  1GZL A;  2Z4E A;  4EDF A;  3AE3 C;  3PH0 A;  4Y99 C;  1R8E A;  1H88 A;  1YQ4 C;  1HUC A;  5CBN A;  1S9K D;  2O01 N;  5B5E H;  1NTZ G;  2JWD A;  1M1J C;  1T3J A;  3AE2 C;  1EZV G;  1GDT A;  4U7J A;  1P84 H;  4Y99 B;  3V2Q A;  1KB9 H;  3L71 J;  1NTM E;  2FBW C;  5AW6 B;  1IZN B;  4ZMD A;  2PAJ A;  2R32 A;  1M1J B;  3TGU D;  3CCJ P;  2OYI B;  4I7Z B;  5GTI E;  3H1I G;  2WSS H;  3P7K A;  1S3J A;  4DOJ A;  1E5W A;  1BGY E;  1SFC B;  5KAF H;  5KJ7 C;  3AE1 C;  1KC8 Q;  2WSF J;  3CCQ P;  1LTG C;  2AEF A;  3L71 D;  1T2K D;  1VF5 D;  2P10 A;  3CXH H;  3A0H H;  3GW6 A;  3JCU H;  3SWY A;  1TU3 F;  2I1K A;  4H0L B;  1WT6 A;  3BCC J;  1OW7 A;  2HFE D;  1Z56 A;  2QM8 A;  3LW5 J;  1ZP0 C;  3M0D A;  2IBZ D;  3TF5 A;  3HD7 C;  3O6Q B;  2A06 E;  5GTH E;  1AVY A;  1N7S D;  5KLI C;  1NYH A;  2CPB A;  2FFD A;  1L0L G;  3CCL P;  3RL0 C;  3MHV A;  2E75 C;  3H1H G;  3HD7 B;  1LJ2 A;  1FJK A;  3PTZ A;  1HTL C;  3L74 J;  2GUS A;  2YIU B;  4Z1M H;  5APW A;  1URQ A;  5AW4 B;  3RL0 B;  3CC4 P;  1OW8 A;  2E75 B;  2JEE A;  1DH3 A;  2ZJS E;  1GL2 D;  1R5L A;  5H2F E;  1JTH B;  3BCC D;  5APQ A;  1G2C B;  2IZ0 A;  4H44 B;  3P8C D;  4JPZ B;  4KT0 J;  2WT7 B;  3HTK A;  1N7S A;  4EOT A;  3LIE A;  2Q3I A;  2WPR A;  4EYY Q;  3G9R A;  2OGU A;  3H1L G;  4OGQ B;  1FBM A;  3L74 D;  1KYO D;  1SQB G;  1P84 I;  2WSE J;  1FDI A;  4XA4 A;  3H25 A;  2N9Y B;  3RK3 C;  1IFP A;  3I5C A;  4H13 D;  2K88 A; 
#chains in the Genus database with same CATH homology
 1BCC J;  3H1K J;  3H1J J;  5KLV J;  3L70 J;  4PD4 I;  1NTK J;  3CX5 I;  4D6T J;  2FYU J;  1L0N J;  3L72 J;  4U3F J;  3CWB J;  3TGU J;  1BE3 J;  1SQP J;  3L75 J;  2BCC J;  1P84 I;  1PP9 J;  1KB9 I;  3BCC J;  3H1L J;  3CXH I;  1SQQ J;  1KYO I;  1NTM J;  3L74 J;  1L0L J;  1NTZ J;  1SQV J;  1SQX J;  1EZV I;  1BGY J;  1SQB J;  3H1H J;  3L73 J;  3L71 J;  3H1I J;  1NU1 J;  2IBZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...