2IBZI

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2ibzI00
3L74J 1NU1J 1SQBJ 3CX5I 1SQPJ 1BE3J 1SQVJ 2IBZI 3CXHI 3L75J 3L70J 3H1IJ 1NTKJ 4PD4I 1KYOI 3H1KJ 1P84I 1BGYJ 1L0NJ 4U3FJ 1PP9J 3CWBJ 3L71J 2FYUJ 2BCCJ 3H1LJ 1KB9I 1L0LJ 3H1HJ 3TGUJ 5KLVJ 1EZVI 1SQQJ 1NTMJ 3H1JJ 1NTZJ 1BCCJ 3BCCJ 1SQXJ 4D6TJ 3L72J 3L73J
chains in the Genus database with same CATH superfamily
3VMAA 3V2RA 4ASWA 3Q5SA 1GL2A 2ZT9B 2R5DA 3RL0C 2FYUJ 3G6EP 1SQXD 1AQ5A 2P7JA 2IBZG 1JO5A 4UB6H 4PJ0H 1LTSC 3AEDC 3TSIA 1S3JA 3V2NA 1N86A 1JEKA 5AVQB 4IOIH 3CL3D 2PGDA 3HUSB 4JYCA 3USSA 1DD3A 1LP1A 1NOHA 3D70A 1KORA 1ZR2A 4H44C 4DCKA 4IL6E 3L74E 3H1IE 1ZMEC 2E43A 4BRYB 1L2PA 1T6AA 2E74C 2YXRB 3AE3C 4N78D 1A02F 4U7JA 3HTKA 5APQA 2UWJE 1IC2A 1W2BO 2M5AB 1FZBA 1IFIA 1LTJB 4L75A 3H1JE 2OTKE 4IFMA 1SQPG 1Q82Q 2XNXA 4NPDA 5CJ0A 2KZIA 5KAFH 1SQQK 1IO4A 4Y99C 3TF5A 2R3CA 1GK4A 5KLIC 5KJ7D 2KSEA 2NRGA 3B5NA 2RMZA 4PD4E 3PH0A 1Y9BA 3MHVA 1OW6A 3PLNA 2YKOA 2R3SA 1X9VA 2WWWA 1LTIC 1QLED 3MTUE 1K05A 2QJYC 4I6MC 4ZNCA 4JF7A 2FYUE 3W67A 2KOGA 2FFDB 3HE4B 1ZRTE 2FXPA 3H1JD 2HLOA 1J1EB 2WT7B 1K9MQ 1U57A 2V4HA 5B5EH 1EC5A 1N7LA 1G1JA 1PZQA 3OJAB 2ZVOB 1L0LK 1QGKB 2R44A 2VRSA 3P8MC 3O6QA 1KN7A 1OVRA 1VQ6P 4C7NB 3HE5A 1PPJE 5KJ7C 3NXSA 3AE1C 2NPSA 1JY2O 3RBXA 1AQTA 3EFGA 4WBAA 1GZLA 2J58A 1FOSE 4TLFA 1VQNP 2WZ7A 4Y28J 4IL6H 1SQQD 2WPSA 2JDIH 1UIIA 2CK3H 1IFPA 3Q1MA 1DH3A 1S4XA 1HGVA 1KFMA 2C9NY 1NTKJ 2Q1KA 1PPJD 1NHLA 1NYHA 1LTAC 2QVAA 2ZAEB 1BE3D 3PJSK 1NU1G 1RHZB 3RGUA 1S1CX 1URQA 4GOEA 2E75B 1VQ8P 2WSCJ 4PD4I 2YMYA 4PD4H 1LT1A 4XA4A 5DJTB 2JO1A 2GUVA 1L4AD 3M9HA 1JTHB 1BCCG 5BU5A 4R4MA 2O1JA 1NKNA 3PTZA 3KZIE 3BRVB 3NTNA 3T97B 2E5YA 1G2CA 2OGUA 2LKMA 1EXJA 1RF1B 1SQBJ 2B87A 2QG4A 2YKPA 1S5LX 4KT0J 2ZYDA 3L71J 2BCCJ 5CCHD 1RE4C 2LXBA 5BVZA 4H13D 2KP8A 1FDOA 5CBOA 2BEQD 3EQ2A 1YITP 2SPZA 3VYIA 4YTPC 1FOSF 2FYUG 2PRRA 2HG5D 2QM7A 3FWNA 3H1HJ 3L72G 1L4AC 2FFDC 1M1JA 3A0HE 1Y8AA 3ABVC 4C7RA 3IF4A 1J1EC 3CLQA 3JC22 1Z56A 1S5LE 1USEA 2CPSA 2E76B 4EDFA 2DW3A 5CCHC 4H13C 2W6BA 3UIAA 1RH5B 4RKUJ 3N7NA 1FJPA 1J1DC 2E75D 5M1BA 4YXWH 2IYOA 3JCUE 4PV1D 2OYIB 2CPBA 1SQBE 1DX7A 1AA0A 1JOCA 1X79B 3HUSA 2K9JB 4O9BA 3L71E 5KTBA 2BCCE 1Y47A 1KZUB 1FAVA 3E1IA 3KZIH 4BRYA 5KLVJ 1KYOE 1FC2C 3GHGB 2D2CC 2FYNB 1SQPJ 2M5AA 5GTHE 1LTJA 3H1HE 2OARA 4GT1A 1J2JB 1VL2A 1SLQA 1OVVA 4PV1C 3L70D 1RE4A 2W6JH 4JBZA 5C39A 1NO4A 2MJZA 1NTZK 3C8VA 3AE8C 4RESB 5AW1B 3A2AA 3GF3A 1GDTA 2FY8A 1OMIA 2KSJA 3A0HH 3CX5E 2IBZE 4IFDK 3GW6A 4LLHA 1SQVG 1KYOD 4HB1A 5GTIH 5APXA 1L4AA 2FFDA 3HE4A 1S5LH 3H1LG 1EZVD 2WSCH 1VF5D 4WB4A 1E79H 3G71P 1VQKP 3PHLA 3L37A 5TISE 1HGZA 3CCMP 1JY2N 3H32B 3WU2E 1LNQA 1NTKG 2JR8A 1BGYG 4PJ0E 4C7NA 3B5ND 3JCUH 1M1KQ 2I1KA 3TGUD 1AVOA 1YI2P 2C0XA 1T3JA 3BCCD 2IBZD 1AFOA 1GU4A 1PGPA 1SQPE 2Z5IA 1EDLA 4OGQB 1JCCA 5AVWB 2AXTE 3SWFA 1SQXK 2QEXP 4KJMA 1H88A 3M9BA 4K3AA 2H88C 1KYOH 1MKMA 1VF5C 2YIUB 3L36A 1T2KD 1OVUA 1KD1Q 3CCEP 2XDJA 3H6PA 5GTHH 2WTYA 2M3BA 2GA1A 2ZJSE 3L71G 2LXCB 4IFFA 1HH0A 1VPCA 3B5NC 5KAFE 1L0NJ 1JCDA 3Q2YA 1NTMG 2KNCA 4BXLA 2OYHB 3N4XA 4NPEA 3FGAD 2Q5UA 1HF9A 3PRJA 1N7SB 4RJTA 3H1KD 1WRGA 3VMXA 3CX5I 1NAFA 1JTHA 1OZHA 3CX5H 3U1AA 4I2LC 4C46A 3SFEC 5AVXB 1LWUC 2YMKA 1T2KC 1QL2A 3M0AA 4U3FD 5B5EE 3RK2B 3AEFC 5TISH 3CPWO 1CI6A 2Z5HA 3WU2H 3R2PA 1URQD 2NPSC 3V6IA 5APSA 2BASA 2HPCB 1VQOP 1NGMB 4WY4B 2AEJA 3A3YB 2QSIA 4D6TJ 1GD2E 3L72J 4OGQD 3CXHI 1YQ4C 2FYZA 1NH4A 1N73B 1M57D 2YO2A 1SS1A 3VP8A 1ZR4A 1DEBA 2K9YA 1K73Q 3HD7B 3CCSP 1NU1E 2AXTH 5CCGD 1VQMP 1BSHA 3W68A 1HVVA 1X22A 1IJDB 2E5TA 4B86A 5KLVG 1KFNA 4YPCA 1BCCE 2JP3A 1IFNA 1URQC 2Q7CA 1USDA 1GK6A 2FYUK 2IFMA 2JKVA 2OQQA 3GMAA 2H7HA 3L73J 1VQ7P 5APWA 3RK3B 5AVSB 3IR9A 2PAJA 1N7SD 2OYIA 2QJKB 3B8EB 2K9JA 3L74D 4I7ZB 1NU1D 3H1ID 3D6ZA 1QVFO 2H8PD 3FX0A 5CCGC 2YIUC 1RY3A 3CWBG 2KZJA 3TK1A 3EFFK 1X0TA 1PGQA 1M56D 3RK2D 2WSFJ 2IPPA 1KILE 1BCCD 4ZMDA 3L72E 4DZOA 2ZT9D 3SSUA 1LWUA 3AEGC 1KB9E 5APTA 3TYYA 3MGNA 2OYOA 5K5GB 1N7SC 3AEBC 1FJKA 2Q9IA 5AW8B 3RK3E 4PD4D 1M1JC 1PL5A 2JJLA 1S72P 3I55P 3KPEA 1M8OB 1VQPP 3CC4P 1HWTC 1JY2P 2FYUD 3GG2A 1SQVJ 1FE6A 1ZRTD 2IX7C 1PP9J 3H1LJ 2WITA 1CW5A 1ZN5A 2H43A 2ZT9C 1R5SA 1VQLP 5L8RJ 3MIWA 5APVA 3CMEP 3GLMA 1YIJP 1BGYJ 2WSEJ 2Y0DA 1HBWA 3HUSC 3G3ZA 1AVYA 2YO3A 1N73C 3CCJP 1EQ7A 3MZWB 5APYA 1L0NG 2FKWB 1YTZI 2R32A 1RE3C 2HODB 4Z1MH 1LT9B 2L91A 2N1TB 1FZGA 2HYNA 1OXZA 1LTJC 4BWNA 1IK9A 1QL1A 3R4YA 5CCGA 3FXEA 1OFCX 4AQRD 4N6JA 1KB9I 1SQVE 1KB9H 1NTMJ 2QJPB 2W27A 3RL0g 4L73A 2HR3A 1PP9E 3VP9A 4I7ZC 3H1LE 1SFCB 1S2EA 2WPRA 1N7SA 3MD0A 4D6TG 1ZOYC 3AECC 2Z4EA 1FZEA 1NTKE 5AW4B 1BGYE 2K1AA 5GTIE 2O01N 2QM8A 2O1KA 1SQBK 1SQQG 5KAIE 3V4QA 3AE5C 4QMAA 3S9OA 1NKZB 4W80A 3BRTB 5E79E 1XTGB 2HFED 3P7KA 3U59A 4WY4A 4HKZH 3S1KA 1MV8A 2FXOA 3L73G 1BE3G 2J5UA 4EYYQ 1RQUA 3H25A 1NTKD 2N1TD 5CBNA 1BGYD 1N73A 3IAOA 4KHXA 1L0LG 1NAYA 1T8ZA 2FXMA 3L35A 1KC8Q 3RBZA 1NTME 1RE3A 4JQ0D 1NVOA 1ZW0A 1DEEG 2ZYGA 2YXQB 1NTZJ 1E5WA 3WUVA 3MUDC 1S9KE 3KDPB 2XU6A 2E75C 2K3RA 5AVTB 1SFCD 5TJHA 4JYBA 3WMM0 1IFJA 1SQBD 1MFZA 5KKZB 1P84E 2ZXEB 2M8RA 2IFNA 2N1TC 3L71D 2BCCD 3L75J 3VTPC 4UB8H 2W8ZA 3O6QB 1FZFA 3CWBJ 1GTWA 3OW2O 2IDBA 2WQYC 2YKQA 3EWKA 4ZKUA 1RF1C 1OX3A 1Q7YQ 2POHA 1T3UA 2E76D 2WSEH 3RL0B 1PIXA 3P8CE 1S9KD 2PFXA 1PP9G 1ZXGA 2ZVNB 3H1HD 5KAIH 4EI2A 2WT7A 1SQPK 3BVHA 2G8YA 1A02J 3KYQA 1SFCC 2JEEA 4DJGA 5AW5B 3K5BA 5E79H 1SQXJ 4RO0A 1YJWP 2O01J 2I1JA 4L76A 2P10A 1VQ4P 2OTJP 4XFJA 5H2FE 5KLVE 2C9LY 1IFDA 2E74B 3CX5D 2H89C 1IFMA 3CXHE 3CI9A 3E1RA 3O8ZA 1JMBA 1H8AA 2E76C 3BASA 1FZCB 1QX8A 2ZXXA 1KQGB 2G3AA 3NFQA 5DJUB 4GODA 1PFIA 2P1JA 4Y99B 2KXPB 4LC1A 4N3YB 1Q90D 5KLIB 4OWFA 1GW3A 2OYIC 3CWBE 2A06G 3MUDA 3VN0A 2Y9YA 5KLVD 3I56P 1P84I 3KQGA 5AW6B 2QJYB 2KK7A 3F5HA 1VQ9P 1P84H 3CXHD 1SQPD 3L70G 3M91A 4MN4C 2ZFCA 1YYCA 2HODA 3SWKA 1LT9A 1SVFA 4I1LA 2N1TA 1JUNA 3CC7P 3GHGC 1IZNB 2K88A 2FYNC 2AEMA 3T97A 3AEEC 3H1JJ 1RF1A 1U7JA 2C0WA 1BSNA 2W83C 2W90A 1D7MA 2KS1B 4H0LB 1EZVG 1NU1K 1N8RQ 2R5BA 2BEZF 4IL6X 4W7ZA 4ZKPA 3LIDA 1OWAA 4TT3H 1SFCA 5H2FH 1FZAA 4N78E 1AJYA 4GOFA 5EFWB 3TGUG 2L5GB 2KB7P 3CXHH 1VDFA 3BCCG 1RF0A 3U1CA 1SQQJ 2M3EA 1W2EA 2MKVA 1L0NE 4OVNF 1KILB 2JWAA 2Q6QA 1QEXA 2K37A 3FWLA 3M0DC 1GMJA 4GKGA 1NTZG 2QA4P 1GW4A 2KI7B 2I8DA 3F89A 3AE2C 1Q86Q 2GM4A 2AXCA 1BE3J 2IZ1A 4OGQC 1HTLC 4ASVA 4M3LA 1L0LJ 1G1IA 1BDDA 1FZCC 3L75G 3H1KG 3LW5J 1L0ND 2LR2A 1WMKA 2XKMA 5APUA 1HJ0A 1LTTC 2O01H 4H0LD 4D6TE 2ZYAA 1HUCA 3GHGA 3QH9A 4U3FG 3QWOC 1L4AB 2OYHC 4WY4D 3M06A 1SQQE 1SQXG 1SP4A 5AW0B 3L4FA 2WPVB 2Y0EA 3TNUB 3Q3DA 1H0TB 1KQFB 3HD7D 1K04A 1EXIA 2PP6A 4H13B 3WUUA 1X8YA 4DT0A 5CJ4A 1KILD 4D6TD 3RK2C 3L72D 1J1DB 4H0LC 3L73E 1BE3E 2B9BA 2KLUA 4LGDE 1LTGC 1JMMA 1Q2NA 4L74A 1OW8A 1KB9D 1PGJA 3IN6A 1NJIQ 3MP7B 2IZ0A 1L0LE 1TU3F 3B4SA 4WY4C 1K8AQ 3A5TA 5AVRB 3RK3D 3H32A 5AVYB 1JY3N 1VQ5P 3M0DA 3CCVP 4K35A 1MFTA 1LGHB 2Y0CA 1MUUA 3HD7C 1KMIZ 1SQVK 4GIFA 3G4SP 3M9QA 2D2CB 3L73D 1KILC 3L74G 2KNCB 4W7YA 3H1IG 1R5LA 2WVRA 1FZCA 5CHXA 4PV1B 1MZ9A 1L0LD 3ITKA 3S4RA 1CZQA 3C1LA 1FU1A 3FXDA 3H1JG 1NTKK 2NZ2A 3RK3C 2XV5A 3CD6P 4HYTB 2QJKC 3L70J 2P67A 3OA7A 2V7QJ 2OYHA 1CI6B 4OH8B 2N9BA 4HH2A 4UB8E 1GL2B 1JM0A 5AW7B 2B89A 4AUWA 5AW3B 2O3JA 4EOTA 2Q3EA 3G9RA 3AE4C 3JSVC 1LP1B 4JPZB 3Q5RA 3A7OA 5AVUB 1SQVD 3D6YA 5KJ7A 3IFMA 2KS1A 5AVZB 1PP9D 2WSSH 3H1LD 1NTMK 3LW5H 1FBMA 1PPJG 3KHUA 3HTKB 2WMMA 1HJBA 2HPCA 3AE6C 3CC2P 1YBKA 3TGUJ 1KTMA 3SWYA 2WSFH 2D2CD 3ZDMA 1QVGO 3BCCJ 1Q81Q 2AEFA 1VF5B 3B71A 2A06E 1EDKA 1YQ3C 1UIXA 3GF7A 3HD7A 3C9IA 1GU5A 4A7PA 5AW2B 2KLVA 3B5NB 3L70E 2RH0A 2B88A 3CCRP 4XE5B 1YHQP 1KILA 2OTLP 2Y9ZA 1EDIA 1JB0J 3II6A 1DD4A 1ZP0C 1ZLLA 4DOJA 4WWIA 3AEAC 1LTBC 3V5BA 1OW7A 1DIPA 2W6AA 2RKLA 2QRXA 1GL2D 1LT9C 1YJNP 3HRNA 2A06D 1LJ2A 1LWUB 1EZVE 3H1KJ 3A0BE 3KXDA 1NTMD 3HE5B 3AE7C 5BU8B 2NPSB 4HJGH 5KLVK 3CMAP 3TGUE 1YJ9P 5B66E 1BDCA 2KYVA 2N9YB 4U3FJ 2QJPC 3V2PA 3BCCE 5AW9B 3CCLP 3V4WA 1P84D 3AE9C 5CMZA 1ZV8A 2A45I 1OIPA 1CSBA 4H44B 2E42A 2A45H 1GL2C 1IK7A 2FBWC 3WUTA 1RF0C 1XTCC 1H89A 1FDIA 3VMYA 4YXDC 1NTZE 2QE7H 1W5CE 1KQLA 2M0BA 1FDMA 3TNUA 4EIJA 1JY3O 1H0TA 1RQVA 3V2QA 3P8CD 1JY3P 1KQSO 5CCHA 4UB6E 1M7LA 1URQB 3E7KA 3VOPA 1PV3A 2WPQA 2KIKA 2A45G 3OAKA 2V7QH 4CPGA 3BATA 3L75E 2XZRA 3H1KE 4NPFX 3SFDC 2P2UA 2RN0A 1U7MA 1G2CB 1AV1A 1KYOI 2B87B 1NTZD 1KV4A 2YNYA 1SQBG 1EZVI 3TDKA 2ITAA 2QIWA 4U3FE 3A0BH 2P58A 3I5CA 3L74J 1NU1J 3CCQP 2BCCG 2XNDH 3H1IJ 1WT6A 3RL0D 2NPSD 3CCUP 3LIEA 3P32A 1EDJA 2IYPA 2JWDA 1FS0E 1R8EA 1SQXE 3Q5PA 1N2DC 5AVVB 3L75D 3PP5A 1PGOA 2Q3IA 1BCCJ 4AYCA 4GDOA 1M1JB 2J59M 1NWQA 3VMZA 3CWBD 3D71A 5B66H 2IBZI 3H1HG 4H44D 5KKZC 2KUBA 2GUSA 4WVZA 1JNMA 3NMDA 1L0NK 1YTZT 4R4LA 2E74D 1M90Q
chains in the Genus database with same CATH topology
3L74J 1NU1J 1SQBJ 3CX5I 1SQPJ 1BE3J 1SQVJ 2IBZI 3CXHI 3L75J 3L70J 3H1IJ 1NTKJ 4PD4I 1KYOI 3H1KJ 1P84I 1BGYJ 1L0NJ 4U3FJ 1PP9J 3CWBJ 3L71J 2FYUJ 2BCCJ 3H1LJ 1KB9I 1L0LJ 3H1HJ 3TGUJ 5KLVJ 1EZVI 1SQQJ 1NTMJ 3H1JJ 1NTZJ 1BCCJ 3BCCJ 1SQXJ 4D6TJ 3L72J 3L73J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 J;  1NU1 J;  1SQB J;  3CX5 I;  1SQP J;  1BE3 J;  1SQV J;  2IBZ I;  3CXH I;  3L75 J;  3L70 J;  3H1I J;  1NTK J;  4PD4 I;  1KYO I;  3H1K J;  1P84 I;  1BGY J;  1L0N J;  4U3F J;  1PP9 J;  3CWB J;  3L71 J;  2FYU J;  2BCC J;  3H1L J;  1KB9 I;  1L0L J;  3H1H J;  3TGU J;  5KLV J;  1EZV I;  1SQQ J;  1NTM J;  3H1J J;  1NTZ J;  1BCC J;  3BCC J;  1SQX J;  4D6T J;  3L72 J;  3L73 J; 
#chains in the Genus database with same CATH topology
 3VMA A;  3V2R A;  4ASW A;  3Q5S A;  1GL2 A;  2ZT9 B;  2R5D A;  3RL0 C;  2FYU J;  3G6E P;  1SQX D;  1AQ5 A;  2P7J A;  2IBZ G;  1JO5 A;  4UB6 H;  4PJ0 H;  1LTS C;  3AED C;  3TSI A;  1S3J A;  3V2N A;  1N86 A;  1JEK A;  5AVQ B;  4IOI H;  3CL3 D;  2PGD A;  3HUS B;  4JYC A;  3USS A;  1DD3 A;  1LP1 A;  1NOH A;  3D70 A;  1KOR A;  1ZR2 A;  4H44 C;  4DCK A;  4IL6 E;  3L74 E;  3H1I E;  1ZME C;  2E43 A;  4BRY B;  1L2P A;  1T6A A;  2E74 C;  2YXR B;  3AE3 C;  4N78 D;  1A02 F;  4U7J A;  3HTK A;  5APQ A;  2UWJ E;  1IC2 A;  1W2B O;  2M5A B;  1FZB A;  1IFI A;  1LTJ B;  4L75 A;  3H1J E;  2OTK E;  4IFM A;  1SQP G;  1Q82 Q;  2XNX A;  4NPD A;  5CJ0 A;  2KZI A;  5KAF H;  1SQQ K;  1IO4 A;  4Y99 C;  3TF5 A;  2R3C A;  1GK4 A;  5KLI C;  5KJ7 D;  2KSE A;  2NRG A;  3B5N A;  2RMZ A;  4PD4 E;  3PH0 A;  1Y9B A;  3MHV A;  1OW6 A;  3PLN A;  2YKO A;  2R3S A;  1X9V A;  2WWW A;  1LTI C;  1QLE D;  3MTU E;  1K05 A;  2QJY C;  4I6M C;  4ZNC A;  4JF7 A;  2FYU E;  3W67 A;  2KOG A;  2FFD B;  3HE4 B;  1ZRT E;  2FXP A;  3H1J D;  2HLO A;  1J1E B;  2WT7 B;  1K9M Q;  1U57 A;  2V4H A;  5B5E H;  1EC5 A;  1N7L A;  1G1J A;  1PZQ A;  3OJA B;  2ZVO B;  1L0L K;  1QGK B;  2R44 A;  2VRS A;  3P8M C;  3O6Q A;  1KN7 A;  1OVR A;  1VQ6 P;  4C7N B;  3HE5 A;  1PPJ E;  5KJ7 C;  3NXS A;  3AE1 C;  2NPS A;  1JY2 O;  3RBX A;  1AQT A;  3EFG A;  4WBA A;  1GZL A;  2J58 A;  1FOS E;  4TLF A;  1VQN P;  2WZ7 A;  4Y28 J;  4IL6 H;  1SQQ D;  2WPS A;  2JDI H;  1UII A;  2CK3 H;  1IFP A;  3Q1M A;  1DH3 A;  1S4X A;  1HGV A;  1KFM A;  2C9N Y;  1NTK J;  2Q1K A;  1PPJ D;  1NHL A;  1NYH A;  1LTA C;  2QVA A;  2ZAE B;  1BE3 D;  3PJS K;  1NU1 G;  1RHZ B;  3RGU A;  1S1C X;  1URQ A;  4GOE A;  2E75 B;  1VQ8 P;  2WSC J;  4PD4 I;  2YMY A;  4PD4 H;  1LT1 A;  4XA4 A;  5DJT B;  2JO1 A;  2GUV A;  1L4A D;  3M9H A;  1JTH B;  1BCC G;  5BU5 A;  4R4M A;  2O1J A;  1NKN A;  3PTZ A;  3KZI E;  3BRV B;  3NTN A;  3T97 B;  2E5Y A;  1G2C A;  2OGU A;  2LKM A;  1EXJ A;  1RF1 B;  1SQB J;  2B87 A;  2QG4 A;  2YKP A;  1S5L X;  4KT0 J;  2ZYD A;  3L71 J;  2BCC J;  5CCH D;  1RE4 C;  2LXB A;  5BVZ A;  4H13 D;  2KP8 A;  1FDO A;  5CBO A;  2BEQ D;  3EQ2 A;  1YIT P;  2SPZ A;  3VYI A;  4YTP C;  1FOS F;  2FYU G;  2PRR A;  2HG5 D;  2QM7 A;  3FWN A;  3H1H J;  3L72 G;  1L4A C;  2FFD C;  1M1J A;  3A0H E;  1Y8A A;  3ABV C;  4C7R A;  3IF4 A;  1J1E C;  3CLQ A;  3JC2 2;  1Z56 A;  1S5L E;  1USE A;  2CPS A;  2E76 B;  4EDF A;  2DW3 A;  5CCH C;  4H13 C;  2W6B A;  3UIA A;  1RH5 B;  4RKU J;  3N7N A;  1FJP A;  1J1D C;  2E75 D;  5M1B A;  4YXW H;  2IYO A;  3JCU E;  4PV1 D;  2OYI B;  2CPB A;  1SQB E;  1DX7 A;  1AA0 A;  1JOC A;  1X79 B;  3HUS A;  2K9J B;  4O9B A;  3L71 E;  5KTB A;  2BCC E;  1Y47 A;  1KZU B;  1FAV A;  3E1I A;  3KZI H;  4BRY A;  5KLV J;  1KYO E;  1FC2 C;  3GHG B;  2D2C C;  2FYN B;  1SQP J;  2M5A A;  5GTH E;  1LTJ A;  3H1H E;  2OAR A;  4GT1 A;  1J2J B;  1VL2 A;  1SLQ A;  1OVV A;  4PV1 C;  3L70 D;  1RE4 A;  2W6J H;  4JBZ A;  5C39 A;  1NO4 A;  2MJZ A;  1NTZ K;  3C8V A;  3AE8 C;  4RES B;  5AW1 B;  3A2A A;  3GF3 A;  1GDT A;  2FY8 A;  1OMI A;  2KSJ A;  3A0H H;  3CX5 E;  2IBZ E;  4IFD K;  3GW6 A;  4LLH A;  1SQV G;  1KYO D;  4HB1 A;  5GTI H;  5APX A;  1L4A A;  2FFD A;  3HE4 A;  1S5L H;  3H1L G;  1EZV D;  2WSC H;  1VF5 D;  4WB4 A;  1E79 H;  3G71 P;  1VQK P;  3PHL A;  3L37 A;  5TIS E;  1HGZ A;  3CCM P;  1JY2 N;  3H32 B;  3WU2 E;  1LNQ A;  1NTK G;  2JR8 A;  1BGY G;  4PJ0 E;  4C7N A;  3B5N D;  3JCU H;  1M1K Q;  2I1K A;  3TGU D;  1AVO A;  1YI2 P;  2C0X A;  1T3J A;  3BCC D;  2IBZ D;  1AFO A;  1GU4 A;  1PGP A;  1SQP E;  2Z5I A;  1EDL A;  4OGQ B;  1JCC A;  5AVW B;  2AXT E;  3SWF A;  1SQX K;  2QEX P;  4KJM A;  1H88 A;  3M9B A;  4K3A A;  2H88 C;  1KYO H;  1MKM A;  1VF5 C;  2YIU B;  3L36 A;  1T2K D;  1OVU A;  1KD1 Q;  3CCE P;  2XDJ A;  3H6P A;  5GTH H;  2WTY A;  2M3B A;  2GA1 A;  2ZJS E;  3L71 G;  2LXC B;  4IFF A;  1HH0 A;  1VPC A;  3B5N C;  5KAF E;  1L0N J;  1JCD A;  3Q2Y A;  1NTM G;  2KNC A;  4BXL A;  2OYH B;  3N4X A;  4NPE A;  3FGA D;  2Q5U A;  1HF9 A;  3PRJ A;  1N7S B;  4RJT A;  3H1K D;  1WRG A;  3VMX A;  3CX5 I;  1NAF A;  1JTH A;  1OZH A;  3CX5 H;  3U1A A;  4I2L C;  4C46 A;  3SFE C;  5AVX B;  1LWU C;  2YMK A;  1T2K C;  1QL2 A;  3M0A A;  4U3F D;  5B5E E;  3RK2 B;  3AEF C;  5TIS H;  3CPW O;  1CI6 A;  2Z5H A;  3WU2 H;  3R2P A;  1URQ D;  2NPS C;  3V6I A;  5APS A;  2BAS A;  2HPC B;  1VQO P;  1NGM B;  4WY4 B;  2AEJ A;  3A3Y B;  2QSI A;  4D6T J;  1GD2 E;  3L72 J;  4OGQ D;  3CXH I;  1YQ4 C;  2FYZ A;  1NH4 A;  1N73 B;  1M57 D;  2YO2 A;  1SS1 A;  3VP8 A;  1ZR4 A;  1DEB A;  2K9Y A;  1K73 Q;  3HD7 B;  3CCS P;  1NU1 E;  2AXT H;  5CCG D;  1VQM P;  1BSH A;  3W68 A;  1HVV A;  1X22 A;  1IJD B;  2E5T A;  4B86 A;  5KLV G;  1KFN A;  4YPC A;  1BCC E;  2JP3 A;  1IFN A;  1URQ C;  2Q7C A;  1USD A;  1GK6 A;  2FYU K;  2IFM A;  2JKV A;  2OQQ A;  3GMA A;  2H7H A;  3L73 J;  1VQ7 P;  5APW A;  3RK3 B;  5AVS B;  3IR9 A;  2PAJ A;  1N7S D;  2OYI A;  2QJK B;  3B8E B;  2K9J A;  3L74 D;  4I7Z B;  1NU1 D;  3H1I D;  3D6Z A;  1QVF O;  2H8P D;  3FX0 A;  5CCG C;  2YIU C;  1RY3 A;  3CWB G;  2KZJ A;  3TK1 A;  3EFF K;  1X0T A;  1PGQ A;  1M56 D;  3RK2 D;  2WSF J;  2IPP A;  1KIL E;  1BCC D;  4ZMD A;  3L72 E;  4DZO A;  2ZT9 D;  3SSU A;  1LWU A;  3AEG C;  1KB9 E;  5APT A;  3TYY A;  3MGN A;  2OYO A;  5K5G B;  1N7S C;  3AEB C;  1FJK A;  2Q9I A;  5AW8 B;  3RK3 E;  4PD4 D;  1M1J C;  1PL5 A;  2JJL A;  1S72 P;  3I55 P;  3KPE A;  1M8O B;  1VQP P;  3CC4 P;  1HWT C;  1JY2 P;  2FYU D;  3GG2 A;  1SQV J;  1FE6 A;  1ZRT D;  2IX7 C;  1PP9 J;  3H1L J;  2WIT A;  1CW5 A;  1ZN5 A;  2H43 A;  2ZT9 C;  1R5S A;  1VQL P;  5L8R J;  3MIW A;  5APV A;  3CME P;  3GLM A;  1YIJ P;  1BGY J;  2WSE J;  2Y0D A;  1HBW A;  3HUS C;  3G3Z A;  1AVY A;  2YO3 A;  1N73 C;  3CCJ P;  1EQ7 A;  3MZW B;  5APY A;  1L0N G;  2FKW B;  1YTZ I;  2R32 A;  1RE3 C;  2HOD B;  4Z1M H;  1LT9 B;  2L91 A;  2N1T B;  1FZG A;  2HYN A;  1OXZ A;  1LTJ C;  4BWN A;  1IK9 A;  1QL1 A;  3R4Y A;  5CCG A;  3FXE A;  1OFC X;  4AQR D;  4N6J A;  1KB9 I;  1SQV E;  1KB9 H;  1NTM J;  2QJP B;  2W27 A;  3RL0 g;  4L73 A;  2HR3 A;  1PP9 E;  3VP9 A;  4I7Z C;  3H1L E;  1SFC B;  1S2E A;  2WPR A;  1N7S A;  3MD0 A;  4D6T G;  1ZOY C;  3AEC C;  2Z4E A;  1FZE A;  1NTK E;  5AW4 B;  1BGY E;  2K1A A;  5GTI E;  2O01 N;  2QM8 A;  2O1K A;  1SQB K;  1SQQ G;  5KAI E;  3V4Q A;  3AE5 C;  4QMA A;  3S9O A;  1NKZ B;  4W80 A;  3BRT B;  5E79 E;  1XTG B;  2HFE D;  3P7K A;  3U59 A;  4WY4 A;  4HKZ H;  3S1K A;  1MV8 A;  2FXO A;  3L73 G;  1BE3 G;  2J5U A;  4EYY Q;  1RQU A;  3H25 A;  1NTK D;  2N1T D;  5CBN A;  1BGY D;  1N73 A;  3IAO A;  4KHX A;  1L0L G;  1NAY A;  1T8Z A;  2FXM A;  3L35 A;  1KC8 Q;  3RBZ A;  1NTM E;  1RE3 A;  4JQ0 D;  1NVO A;  1ZW0 A;  1DEE G;  2ZYG A;  2YXQ B;  1NTZ J;  1E5W A;  3WUV A;  3MUD C;  1S9K E;  3KDP B;  2XU6 A;  2E75 C;  2K3R A;  5AVT B;  1SFC D;  5TJH A;  4JYB A;  3WMM 0;  1IFJ A;  1SQB D;  1MFZ A;  5KKZ B;  1P84 E;  2ZXE B;  2M8R A;  2IFN A;  2N1T C;  3L71 D;  2BCC D;  3L75 J;  3VTP C;  4UB8 H;  2W8Z A;  3O6Q B;  1FZF A;  3CWB J;  1GTW A;  3OW2 O;  2IDB A;  2WQY C;  2YKQ A;  3EWK A;  4ZKU A;  1RF1 C;  1OX3 A;  1Q7Y Q;  2POH A;  1T3U A;  2E76 D;  2WSE H;  3RL0 B;  1PIX A;  3P8C E;  1S9K D;  2PFX A;  1PP9 G;  1ZXG A;  2ZVN B;  3H1H D;  5KAI H;  4EI2 A;  2WT7 A;  1SQP K;  3BVH A;  2G8Y A;  1A02 J;  3KYQ A;  1SFC C;  2JEE A;  4DJG A;  5AW5 B;  3K5B A;  5E79 H;  1SQX J;  4RO0 A;  1YJW P;  2O01 J;  2I1J A;  4L76 A;  2P10 A;  1VQ4 P;  2OTJ P;  4XFJ A;  5H2F E;  5KLV E;  2C9L Y;  1IFD A;  2E74 B;  3CX5 D;  2H89 C;  1IFM A;  3CXH E;  3CI9 A;  3E1R A;  3O8Z A;  1JMB A;  1H8A A;  2E76 C;  3BAS A;  1FZC B;  1QX8 A;  2ZXX A;  1KQG B;  2G3A A;  3NFQ A;  5DJU B;  4GOD A;  1PFI A;  2P1J A;  4Y99 B;  2KXP B;  4LC1 A;  4N3Y B;  1Q90 D;  5KLI B;  4OWF A;  1GW3 A;  2OYI C;  3CWB E;  2A06 G;  3MUD A;  3VN0 A;  2Y9Y A;  5KLV D;  3I56 P;  1P84 I;  3KQG A;  5AW6 B;  2QJY B;  2KK7 A;  3F5H A;  1VQ9 P;  1P84 H;  3CXH D;  1SQP D;  3L70 G;  3M91 A;  4MN4 C;  2ZFC A;  1YYC A;  2HOD A;  3SWK A;  1LT9 A;  1SVF A;  4I1L A;  2N1T A;  1JUN A;  3CC7 P;  3GHG C;  1IZN B;  2K88 A;  2FYN C;  2AEM A;  3T97 A;  3AEE C;  3H1J J;  1RF1 A;  1U7J A;  2C0W A;  1BSN A;  2W83 C;  2W90 A;  1D7M A;  2KS1 B;  4H0L B;  1EZV G;  1NU1 K;  1N8R Q;  2R5B A;  2BEZ F;  4IL6 X;  4W7Z A;  4ZKP A;  3LID A;  1OWA A;  4TT3 H;  1SFC A;  5H2F H;  1FZA A;  4N78 E;  1AJY A;  4GOF A;  5EFW B;  3TGU G;  2L5G B;  2KB7 P;  3CXH H;  1VDF A;  3BCC G;  1RF0 A;  3U1C A;  1SQQ J;  2M3E A;  1W2E A;  2MKV A;  1L0N E;  4OVN F;  1KIL B;  2JWA A;  2Q6Q A;  1QEX A;  2K37 A;  3FWL A;  3M0D C;  1GMJ A;  4GKG A;  1NTZ G;  2QA4 P;  1GW4 A;  2KI7 B;  2I8D A;  3F89 A;  3AE2 C;  1Q86 Q;  2GM4 A;  2AXC A;  1BE3 J;  2IZ1 A;  4OGQ C;  1HTL C;  4ASV A;  4M3L A;  1L0L J;  1G1I A;  1BDD A;  1FZC C;  3L75 G;  3H1K G;  3LW5 J;  1L0N D;  2LR2 A;  1WMK A;  2XKM A;  5APU A;  1HJ0 A;  1LTT C;  2O01 H;  4H0L D;  4D6T E;  2ZYA A;  1HUC A;  3GHG A;  3QH9 A;  4U3F G;  3QWO C;  1L4A B;  2OYH C;  4WY4 D;  3M06 A;  1SQQ E;  1SQX G;  1SP4 A;  5AW0 B;  3L4F A;  2WPV B;  2Y0E A;  3TNU B;  3Q3D A;  1H0T B;  1KQF B;  3HD7 D;  1K04 A;  1EXI A;  2PP6 A;  4H13 B;  3WUU A;  1X8Y A;  4DT0 A;  5CJ4 A;  1KIL D;  4D6T D;  3RK2 C;  3L72 D;  1J1D B;  4H0L C;  3L73 E;  1BE3 E;  2B9B A;  2KLU A;  4LGD E;  1LTG C;  1JMM A;  1Q2N A;  4L74 A;  1OW8 A;  1KB9 D;  1PGJ A;  3IN6 A;  1NJI Q;  3MP7 B;  2IZ0 A;  1L0L E;  1TU3 F;  3B4S A;  4WY4 C;  1K8A Q;  3A5T A;  5AVR B;  3RK3 D;  3H32 A;  5AVY B;  1JY3 N;  1VQ5 P;  3M0D A;  3CCV P;  4K35 A;  1MFT A;  1LGH B;  2Y0C A;  1MUU A;  3HD7 C;  1KMI Z;  1SQV K;  4GIF A;  3G4S P;  3M9Q A;  2D2C B;  3L73 D;  1KIL C;  3L74 G;  2KNC B;  4W7Y A;  3H1I G;  1R5L A;  2WVR A;  1FZC A;  5CHX A;  4PV1 B;  1MZ9 A;  1L0L D;  3ITK A;  3S4R A;  1CZQ A;  3C1L A;  1FU1 A;  3FXD A;  3H1J G;  1NTK K;  2NZ2 A;  3RK3 C;  2XV5 A;  3CD6 P;  4HYT B;  2QJK C;  3L70 J;  2P67 A;  3OA7 A;  2V7Q J;  2OYH A;  1CI6 B;  4OH8 B;  2N9B A;  4HH2 A;  4UB8 E;  1GL2 B;  1JM0 A;  5AW7 B;  2B89 A;  4AUW A;  5AW3 B;  2O3J A;  4EOT A;  2Q3E A;  3G9R A;  3AE4 C;  3JSV C;  1LP1 B;  4JPZ B;  3Q5R A;  3A7O A;  5AVU B;  1SQV D;  3D6Y A;  5KJ7 A;  3IFM A;  2KS1 A;  5AVZ B;  1PP9 D;  2WSS H;  3H1L D;  1NTM K;  3LW5 H;  1FBM A;  1PPJ G;  3KHU A;  3HTK B;  2WMM A;  1HJB A;  2HPC A;  3AE6 C;  3CC2 P;  1YBK A;  3TGU J;  1KTM A;  3SWY A;  2WSF H;  2D2C D;  3ZDM A;  1QVG O;  3BCC J;  1Q81 Q;  2AEF A;  1VF5 B;  3B71 A;  2A06 E;  1EDK A;  1YQ3 C;  1UIX A;  3GF7 A;  3HD7 A;  3C9I A;  1GU5 A;  4A7P A;  5AW2 B;  2KLV A;  3B5N B;  3L70 E;  2RH0 A;  2B88 A;  3CCR P;  4XE5 B;  1YHQ P;  1KIL A;  2OTL P;  2Y9Z A;  1EDI A;  1JB0 J;  3II6 A;  1DD4 A;  1ZP0 C;  1ZLL A;  4DOJ A;  4WWI A;  3AEA C;  1LTB C;  3V5B A;  1OW7 A;  1DIP A;  2W6A A;  2RKL A;  2QRX A;  1GL2 D;  1LT9 C;  1YJN P;  3HRN A;  2A06 D;  1LJ2 A;  1LWU B;  1EZV E;  3H1K J;  3A0B E;  3KXD A;  1NTM D;  3HE5 B;  3AE7 C;  5BU8 B;  2NPS B;  4HJG H;  5KLV K;  3CMA P;  3TGU E;  1YJ9 P;  5B66 E;  1BDC A;  2KYV A;  2N9Y B;  4U3F J;  2QJP C;  3V2P A;  3BCC E;  5AW9 B;  3CCL P;  3V4W A;  1P84 D;  3AE9 C;  5CMZ A;  1ZV8 A;  2A45 I;  1OIP A;  1CSB A;  4H44 B;  2E42 A;  2A45 H;  1GL2 C;  1IK7 A;  2FBW C;  3WUT A;  1RF0 C;  1XTC C;  1H89 A;  1FDI A;  3VMY A;  4YXD C;  1NTZ E;  2QE7 H;  1W5C E;  1KQL A;  2M0B A;  1FDM A;  3TNU A;  4EIJ A;  1JY3 O;  1H0T A;  1RQV A;  3V2Q A;  3P8C D;  1JY3 P;  1KQS O;  5CCH A;  4UB6 E;  1M7L A;  1URQ B;  3E7K A;  3VOP A;  1PV3 A;  2WPQ A;  2KIK A;  2A45 G;  3OAK A;  2V7Q H;  4CPG A;  3BAT A;  3L75 E;  2XZR A;  3H1K E;  4NPF X;  3SFD C;  2P2U A;  2RN0 A;  1U7M A;  1G2C B;  1AV1 A;  1KYO I;  2B87 B;  1NTZ D;  1KV4 A;  2YNY A;  1SQB G;  1EZV I;  3TDK A;  2ITA A;  2QIW A;  4U3F E;  3A0B H;  2P58 A;  3I5C A;  3L74 J;  1NU1 J;  3CCQ P;  2BCC G;  2XND H;  3H1I J;  1WT6 A;  3RL0 D;  2NPS D;  3CCU P;  3LIE A;  3P32 A;  1EDJ A;  2IYP A;  2JWD A;  1FS0 E;  1R8E A;  1SQX E;  3Q5P A;  1N2D C;  5AVV B;  3L75 D;  3PP5 A;  1PGO A;  2Q3I A;  1BCC J;  4AYC A;  4GDO A;  1M1J B;  2J59 M;  1NWQ A;  3VMZ A;  3CWB D;  3D71 A;  5B66 H;  2IBZ I;  3H1H G;  4H44 D;  5KKZ C;  2KUB A;  2GUS A;  4WVZ A;  1JNM A;  3NMD A;  1L0N K;  1YTZ T;  4R4L A;  2E74 D;  1M90 Q; 
#chains in the Genus database with same CATH homology
 3L74 J;  1NU1 J;  1SQB J;  3CX5 I;  1SQP J;  1BE3 J;  1SQV J;  2IBZ I;  3CXH I;  3L75 J;  3L70 J;  3H1I J;  1NTK J;  4PD4 I;  1KYO I;  3H1K J;  1P84 I;  1BGY J;  1L0N J;  4U3F J;  1PP9 J;  3CWB J;  3L71 J;  2FYU J;  2BCC J;  3H1L J;  1KB9 I;  1L0L J;  3H1H J;  3TGU J;  5KLV J;  1EZV I;  1SQQ J;  1NTM J;  3H1J J;  1NTZ J;  1BCC J;  3BCC J;  1SQX J;  4D6T J;  3L72 J;  3L73 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...