2IBZI

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 2ibzI00
3L75J 1SQPJ 1KB9I 3L71J 3H1KJ 4PD4I 1NU1J 5KLVJ 1BE3J 1SQVJ 1PP9J 2BCCJ 1SQBJ 1SQXJ 3L72J 3TGUJ 3H1LJ 3L73J 3H1IJ 1EZVI 3CX5I 3BCCJ 3L74J 1NTZJ 2IBZI 1SQQJ 3H1JJ 4U3FJ 2FYUJ 1BGYJ 1L0LJ 1P84I 3L70J 3CWBJ 3H1HJ 1NTMJ 1KYOI 4D6TJ 1L0NJ 1BCCJ 1NTKJ 3CXHI
chains in the Genus database with same CATH superfamily
3VP9A 3HTKA 3L71D 4A7PA 2HODA 1FZCC 3FWNA 2E76B 3L71J 2Y0CA 1GD2E 1NTKD 1S5LE 1KILD 2XNXA 1IFPA 1BCCE 2HLOA 1K04A 2FBWC 2PRRA 3SWKA 3CCLP 1DX7A 1AVOA 3E1IA 1RE4C 3G3ZA 3GG2A 3IF4A 4PJ0H 3CWBG 3KYQA 1KYOH 2J59M 2NRGA 3VYIA 2E76D 1FC2C 2B89A 2JEEA 3H25A 3TGUD 1ZR4A 1M8OB 3TF5A 1NTZJ 1HH0A 2E74B 3PLNA 2IBZI 3AE4C 2NZ2A 5EFWB 1T2KC 4QMAA 5AVYB 3E1RA 1MV8A 1GU5A 1MZ9A 3RK3C 3H1JD 3RGUA 1EZVD 1FU1A 2JWDA 3D71A 2QJKC 2YIUB 1N7LA 3HE4B 3MUDA 1VQNP 1LT9C 2A06G 1ZR2A 2D2CD 4NPDA 4OWFA 1LWUC 1ZN5A 2XKMA 4XFJA 1Q90D 1OZHA 1YQ3C 1RF1C 2QSIA 3M9QA 2IFMA 1M56D 1Y47A 1NAFA 1SQVE 2IYPA 2XU6A 3CWBE 3VN0A 1WMKA 2JR8A 1RE4A 1NHLA 1JO5A 5AVXB 2RKLA 3FXEA 5H2FE 5KJ7D 2ZXEB 2CPBA 1PGPA 1MKMA 2R32A 3H1LG 3PRJA 1SLQA 2FYZA 4AYCA 1DEBA 1EZVI 2QE7H 3KXDA 1EQ7A 4H13D 3D6ZA 1FZFA 1L0LG 5AVVB 4DT0A 1GK6A 3PTZA 2WPRA 4OGQD 5TISE 1LTJA 4PV1B 1L4AD 2WPQA 1PP9E 1NAYA 1J1EC 2YKPA 3U59A 4ZKUA 4D6TD 5CCHC 5AVSB 3HE5B 1JCDA 2WQYC 3MUDC 1P84I 3PP5A 1KILC 3AE7C 3B5NA 3M0AA 3PJSK 1URQC 2P2UA 2QRXA 3HUSA 3S4RA 1Q7YQ 5CHXA 1JNMA 2WSEH 1YYCA 2Y9ZA 2NPSA 2P10A 4WY4B 1URQA 3TNUB 1H88A 1SQPJ 2ZJSE 1KB9I 3CX5H 4BRYB 2K9YA 4UB6H 1LP1A 1SQVK 3H1KJ 2FYUK 2A06D 3HRNA 2WSFJ 1JMBA 1S1CX 3L75E 4JYBA 5KAFE 2LR2A 3H1IG 2QJPB 2A45H 1JEKA 3MGNA 1S4XA 3H1IJ 1BGYE 3FGAD 4YXDC 1OW6A 4N78D 2E42A 1AFOA 3R4YA 2KZJA 3H1LD 1VF5B 3M06A 4I2LC 4IFMA 3RL0C 2FFDA 1FJPA 5M1BA 2YKOA 3WUVA 3H1HD 4U3FJ 1L0LK 1GTWA 3W68A 1SQQE 2CK3H 2WSSH 3AEBC 3CMAP 1EDJA 3A3YB 3II6A 1N7SC 3L75D 3N4XA 4RJTA 2RMZA 3IAOA 4I6MC 2Y0DA 1ZXGA 3BRVB 3WUUA 4DCKA 2QJKB 2YIUC 4U3FG 3NXSA 1CI6A 4PD4D 3U1AA 1PPJG 1SQQG 3HD7C 3MZWB 5APSA 2Z5HA 5KAIE 3VOPA 2K9JA 3HD7B 5APVA 2WSCJ 4H0LC 1H0TB 1KILA 1S3JA 3CCRP 2C0XA 2IZ1A 1M1KQ 1NKNA 1M1JA 1NKZB 1SQXJ 3V2NA 3GF3A 1SQVG 4AQRD 2FYUG 3CC7P 2WITA 3OAKA 2BEQD 1PP9D 3BCCJ 2KI7B 2Z5IA 2W6JH 3KQGA 1FJKA 1Q81Q 2MJZA 1ZMEC 2B88A 2Y9YA 1URQD 3AE3C 5APTA 4C7RA 4OGQB 4PD4H 2XZRA 5AVQB 2Q9IA 3B5ND 5B66E 2B87A 3P8CE 1L0LJ 3L74E 1LT1A 4HYTB 1L2PA 4JPZB 4N6JA 5AW1B 1S5LH 1L0LD 3P7KA 5KLIC 2AXTE 1JCCA 1UIXA 3M9HA 1FZCB 2QJYC 3GHGB 1T8ZA 3T97B 3NFQA 3KDPB 2G8YA 2OYIA 2GM4A 3N7NA 1NU1J 5AVTB 1N73A 2J58A 1QEXA 1LTSC 1JTHA 1GL2B 2O01H 2YKQA 2AEMA 1W5CE 2A45G 1SQQK 2D2CB 1VQ6P 1RE3C 3CI9A 3AE2C 1X22A 2ZT9C 2OYOA 4H0LB 2NPSC 4I7ZB 3H6PA 3M91A 3V4QA 2ZYDA 3Q5RA 1KC8Q 3IN6A 3IFMA 5KJ7C 5AW5B 4UB8H 3AEEC 1FS0E 3B5NC 3TYYA 1VQ4P 1DIPA 1IFIA 1FDIA 4HJGH 3SFEC 2FYUD 4JQ0D 3USSA 2WT7A 3L73E 2FYUJ 1VQOP 2L91A 3O6QB 1FDOA 1PV3A 3KHUA 3WU2H 2PGDA 1H89A 2OTLP 1G2CB 2W6AA 4AUWA 2K37A 2QM7A 2R3SA 5L8RJ 3RL0D 1AA0A 3RBZA 1R5LA 1PZQA 1G1JA 1S5LX 2A06E 2V4HA 2YNYA 3R2PA 1NTKJ 1JY3P 1OFCX 3LW5H 3M0DC 2E75C 5KLVE 4YXWH 1VQKP 2O1KA 4JF7A 2FKWB 2FYNB 3MD0A 2GUVA 1PGOA 3L72D 1OXZA 1SQBK 1ZOYC 4NPFX 4W7YA 3NTNA 2E76C 4YTPC 3VTPC 2N1TB 4ASWA 1OW7A 5CBOA 1PL5A 5AW0B 2E5YA 1T3JA 2POHA 1OMIA 2OTKE 4D6TG 1NVOA 4H44C 4BWNA 2W83C 4IOIH 4Y99B 2W8ZA 2QJPC 3AEAC 1VQ5P 4XA4A 4ZMDA 1KYOE 3H32A 3H1HE 3TGUE 4OH8B 2E74C 4TLFA 2BEZF 4EI2A 2LXCB 1YJNP 1PPJE 1SFCA 1KQFB 1KYOI 3LIDA 1RH5B 1L0NJ 3WU2E 1BCCJ 4MN4C 2BCCG 1WT6A 1N7SA 4KJMA 1LTBC 1SP4A 2JP3A 5KLIB 1S9KD 1YJWP 3U1CA 3BCCG 1NTMD 1FOSF 1L4AA 5CJ0A 1RF0C 1OX3A 2FYNC 1U7MA 3QWOC 4KT0J 3MHVA 1SQBJ 5KKZB 1KORA 2QA4P 1SQBG 2PP6A 3CL3D 2IFNA 2M8RA 3JSVC 1MFZA 2C0WA 3VP8A 4C7NA 2WTYA 1Q86Q 3V4WA 1Y8AA 1OVVA 3Q1MA 3RK2B 2N9YB 3L73D 3FWLA 1PIXA 3H1IE 1QL2A 4U3FD 1BDDA 3EQ2A 3JCUH 3L70E 5AW7B 4Y28J 3L75G 1Q2NA 1RF1A 1OW8A 5B5EH 1LTIC 1KD1Q 3CWBJ 1KTMA 2AEJA 3V5BA 1SQXG 1KQSO 3EWKA 4R4MA 1GU4A 1KILE 2FXPA 1LGHB 1EZVG 3JCUE 2E5TA 4LLHA 4GT1A 4YPCA 1YI2P 1HBWA 1NTME 1QX8A 3MIWA 2GUSA 3AE5C 2HODB 2BCCJ 2OQQA 1CZQA 3CC4P 2YO2A 1KFMA 3H1LJ 2IBZD 5CCHD 3BCCD 1VQ8P 1QGKB 1VF5C 4BXLA 5TJHA 3FX0A 2WZ7A 2YMKA 3GMAA 4L73A 1ZRTE 2AEFA 4Z1MH 1QL1A 1JY3O 3A0BH 2HG5D 3TDKA 1DH3A 3CCVP 3L70D 1IC2A 3RL0B 2KSJA 4I1LA 3BCCE 1VQ7P 4HH2A 5E79E 2KNCB 1R5SA 3MP7B 2XNDH 1T2KD 3I55P 1A02J 1RHZB 5K5GB 5AVWB 3CXHI 1IFDA 1U57A 2FY8A 1LT9B 3C9IA 3H1KG 1XTGB 4DJGA 3G71P 1SQXK 1LWUB 1GL2C 3K5BA 3L72E 3RK2D 1A02F 2D2CC 3AE1C 1KMIZ 3PHLA 1MUUA 1BE3J 4H44B 3L71E 2M5AA 2HPCB 1PP9J 3Q5PA 2WPSA 5C39A 2QIWA 1USDA 5KTBA 3Q2YA 2OYHA 3CXHE 1VQ9P 1HJBA 2KUBA 4W7ZA 1IZNB 1OWAA 3PH0A 4KHXA 5CCGC 4Y99C 3M9BA 3UIAA 3L71G 1OIPA 2I1KA 4H44D 3GLMA 4L74A 2L5GB 2IBZG 2KS1B 1NTKG 2J5UA 2QVAA 3CLQA 2YMYA 3VMZA 1E79H 3A5TA 3HTKB 4OGQC 1AVYA 3H1KE 1RF0A 4N78E 1LTJB 4D6TJ 4H0LD 4WBAA 3L70G 2E75B 4EDFA 5B66H 5GTIH 1NU1D 3G9RA 3V2QA 1NGMB 5APXA 1GZLA 2KYVA 1S9KE 1SVFA 1X0TA 3O8ZA 2P7JA 1VDFA 4L75A 3A0HE 4PD4I 3HUSB 2Q3EA 4GOEA 5AW4B 1P84D 1SFCC 1M90Q 2OTJP 5KAIH 1SQPD 2NPSB 1BCCG 1SQVJ 3TNUA 2ZAEB 3H1KD 1N86A 1KZUB 3EFGA 1YJ9P 5DJUB 1LP1B 1NTZD 1GW4A 1NTZK 1D7MA 5APQA 3L74J 2KB7P 2IPPA 3H1JG 1J1EB 2WMMA 4M3LA 3WUTA 1HVVA 4ZKPA 3CCUP 1N73C 3H1JJ 3HE4A 2R5DA 2M3BA 3QH9A 1GDTA 1T3UA 2UWJE 4UB6E 2KIKA 2ITAA 5AW9B 2WSEJ 1HTLC 2N1TD 2E75D 2PAJA 3AEDC 3H1HJ 3RL0g 3S1KA 2QJYB 3GHGC 3TGUG 5AW8B 2FFDB 1NTZE 1NTKK 2LKMA 3H1HG 2H89C 4DOJA 1YTZI 1BDCA 1K73Q 1RQUA 4U7JA 1X79B 1KB9H 2WPVB 1Q82Q 3FXDA 1JMMA 2I8DA 1FE6A 2Q1KA 3BRTB 3RK3E 2W27A 4GOFA 2XDJA 2HR3A 4PJ0E 4XE5B 1VPCA 2R5BA 1PPJD 1W2BO 3Q5SA 4B86A 1XTCC 1FZGA 1KB9E 2WSFH 3CCEP 1L0LE 2FYUE 2K9JB 3CX5E 3HE5A 1SQXD 3Q3DA 1SQQD 1M1JB 3LIEA 5KJ7A 3A7OA 1SQQJ 1IFJA 2P67A 3B5NB 1K9MQ 3G6EP 1NTZG 2K3RA 1J2JB 1AQTA 1KB9D 1FZBA 1RE3A 1YHQP 4PV1C 2KOGA 4WY4A 1URQB 1YITP 2KSEA 3D70A 3CPWO 3P32A 5CMZA 3ZDMA 3AE6C 4GDOA 4BRYA 1BE3G 2O1JA 2M0BA 2O3JA 5BU5A 3OW2O 2JJLA 1LTJC 2IDBA 3G4SP 2B87B 5GTIE 3CC2P 2IYOA 4LC1A 1JY2O 1QVFO 2ZYAA 1JY3N 2Q3IA 2R3CA 2KXPB 3RK3D 5H2FH 1Y9BA 2KP8A 1M57D 3A0BE 1YTZT 1AJYA 1RY3A 1ZP0C 4IL6X 1FZCA 5KKZC 3GHGA 3T97A 3CCMP 1DD3A 4PD4E 3I56P 1FZAA 1L4AC 1NJIQ 3AE8C 3BASA 3L73J 5CCGA 1N73B 2ZYGA 1FZEA 1JTHB 1JY2N 1KFNA 4WWIA 1IFMA 1H8AA 2OYHC 2ZT9D 4L76A 1SQPG 3V2RA 2P58A 1LJ2A 3L36A 4WB4A 1KQGB 3CCSP 1M1JC 2ZVOB 2O01N 1BGYJ 1CI6B 1LNQA 1ZRTD 3L74G 3OJAB 1K8AQ 2YXQB 2FXOA 2YO3A 2IBZE 3OA7A 4RESB 3AECC 1DD4A 1GK4A 1YBKA 3HD7A 3KZIE 4RKUJ 1KILB 1H0TA 3B8EB 2O01J 3NMDA 5AVRB 3AEFC 2KLVA 2P1JA 1HGZA 1OVRA 2IX7C 2N1TC 2OARA 2BCCD 3ITKA 3KPEA 1BE3D 1S2EA 4DZOA 1EXJA 2HYNA 1BSHA 2A45I 3RBXA 1NWQA 1TU3F 1E5WA 1LTTC 3BATA 1OVUA 1NU1E 3CD6P 3L72J 5AW3B 3TGUJ 2Q6QA 1L0NG 2W6BA 2KZIA 2QG4A 1HGVA 3ABVC 3GF7A 3L72G 4R4LA 2QM8A 2R44A 3F5HA 3TSIA 1W2EA 2XV5A 2E43A 3P8MC 2GA1A 3SWFA 2YXRB 2JKVA 1L0NE 3GW6A 2PFXA 3SWYA 1NU1G 1AV1A 2OGUA 2Q7CA 1VQLP 1ZW0A 3A2AA 1HJ0A 3L73G 4IFFA 2K1AA 2KK7A 3A0HH 3EFFK 2OYIB 3I5CA 1SQPK 3LW5J 3V2PA 1NO4A 3E7KA 1KQLA 1JOCA 4H13B 2HFED 4JYCA 4NPEA 4GKGA 3C8VA 4UB8E 4WVZA 4WY4C 5E79H 3D6YA 1GL2A 2W90A 1EC5A 2ZVNB 1U7JA 4PV1D 1SFCB 1QVGO 1BCCD 5KLVD 1P84E 3WMM0 1NTKE 4JBZA 5DJTB 5BU8B 5KLVJ 1SQVD 2H43A 3AEGC 2ZFCA 3W67A 1FBMA 1HWTC 1KN7A 1EDLA 1JUNA 4HB1A 5APYA 1L4AB 1IK9A 1EDIA 1P84H 2IZ0A 2MKVA 1DEEG 1EZVE 2WT7B 3O6QA 1R8EA 2C9LY 1J1DB 1KV4A 5AVUB 3B71A 1G2CA 1L0NK 5APWA 1SQXE 1JY2P 3TK1A 3M0DA 4ASVA 1J1DC 2K88A 1QLED 1LTAC 3C1LA 2FFDC 4GIFA 4C7NB 5GTHE 1EXIA 4OVNF 1PGJA 3CCJP 2RN0A 3CX5D 3JC22 1X9VA 2M3EA 1NU1K 5APUA 1SQPE 1VL2A 3CXHD 4IL6H 3VMXA 4RO0A 5AW6B 5TISH 1RF1B 1BE3E 1SFCD 2BCCE 2N1TA 1JM0A 3CWBD 1T6AA 3SFDC 3L75J 4CPGA 1YQ4C 1IJDB 3KZIH 1IFNA 3CCQP 1PFIA 1JB0J 2B9BA 1FAVA 1SQBE 1AQ5A 4IFDK 4I7ZC 4LGDE 3SSUA 5CCGD 5KLVK 1FDMA 1Z56A 2LXBA 1NH4A 3S9OA 1WRGA 3HUSC 2QEXP 1SS1A 3H32B 3L74D 3MTUE 4IL6E 3CMEP 1USEA 1HF9A 1BGYG 2JDIH 1GL2D 3CX5I 3RK2C 4ZNCA 4N3YB 2E74D 1K05A 1MFTA 2WVRA 3H1ID 2I1JA 3CXHH 3L4FA 4U3FE 3V6IA 4EIJA 1VQPP 1IK7A 1S72P 4D6TE 5CCHA 1N2DC 3L37A 4GODA 4W80A 3VMAA 2KLUA 1ZV8A 1VF5D 1PGQA 2WSCH 2SPZA 1NTMG 2VRSA 5KAFH 2OYIC 1L0ND 1N7SB 1X8YA 2AXTH 5AW2B 2CPSA 1VQMP 5CJ4A 1NOHA 4EYYQ 3L70J 2DW3A 1GW3A 1LTGC 3AE9C 5GTHH 2C9NY 1EDKA 1NTMJ 1ZLLA 5AVZB 2AXCA 2KNCA 3B4SA 4HKZH 2JO1A 4C46A 1SQBD 3IR9A 5B5EE 1FOSE 4K35A 4TT3H 4WY4D 1G1IA 5BVZA 1M7LA 2G3AA 2V7QH 1LT9A 2BASA 4O9BA 3H1JE 1LWUA 2RH0A 2JWAA 1N8RQ 1HUCA 2Y0EA 2H8PD 5KLVG 1YIJP 2ZT9B 1CSBA 2Q5UA 1NYHA 2Z4EA 1CW5A 4K3AA 2M5AB 3P8CD 2HPCA 3H1LE 2H88C 3BVHA 3L35A 1GMJA 2NPSD 2ZXXA 2H7HA 1N7SD 1IO4A 2WWWA 2FXMA 3RK3B 5CBNA 2OYHB 1BGYD 1BSNA 1KYOD 2N9BA 4EOTA 4H13C 2V7QJ 1PP9G 3HD7D 3F89A 1NTMK 3VMYA 2KS1A 1UIIA 1RQVA
chains in the Genus database with same CATH topology
3L75J 1SQPJ 1KB9I 3L71J 3H1KJ 4PD4I 1NU1J 5KLVJ 1BE3J 1SQVJ 1PP9J 2BCCJ 1SQBJ 1SQXJ 3L72J 3TGUJ 3H1LJ 3L73J 3H1IJ 1EZVI 3CX5I 3BCCJ 3L74J 1NTZJ 2IBZI 1SQQJ 3H1JJ 4U3FJ 2FYUJ 1BGYJ 1L0LJ 1P84I 3L70J 3CWBJ 3H1HJ 1NTMJ 1KYOI 4D6TJ 1L0NJ 1BCCJ 1NTKJ 3CXHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L75 J;  1SQP J;  1KB9 I;  3L71 J;  3H1K J;  4PD4 I;  1NU1 J;  5KLV J;  1BE3 J;  1SQV J;  1PP9 J;  2BCC J;  1SQB J;  1SQX J;  3L72 J;  3TGU J;  3H1L J;  3L73 J;  3H1I J;  1EZV I;  3CX5 I;  3BCC J;  3L74 J;  1NTZ J;  2IBZ I;  1SQQ J;  3H1J J;  4U3F J;  2FYU J;  1BGY J;  1L0L J;  1P84 I;  3L70 J;  3CWB J;  3H1H J;  1NTM J;  1KYO I;  4D6T J;  1L0N J;  1BCC J;  1NTK J;  3CXH I; 
#chains in the Genus database with same CATH topology
 3VP9 A;  3HTK A;  3L71 D;  4A7P A;  2HOD A;  1FZC C;  3FWN A;  2E76 B;  3L71 J;  2Y0C A;  1GD2 E;  1NTK D;  1S5L E;  1KIL D;  2XNX A;  1IFP A;  1BCC E;  2HLO A;  1K04 A;  2FBW C;  2PRR A;  3SWK A;  3CCL P;  1DX7 A;  1AVO A;  3E1I A;  1RE4 C;  3G3Z A;  3GG2 A;  3IF4 A;  4PJ0 H;  3CWB G;  3KYQ A;  1KYO H;  2J59 M;  2NRG A;  3VYI A;  2E76 D;  1FC2 C;  2B89 A;  2JEE A;  3H25 A;  3TGU D;  1ZR4 A;  1M8O B;  3TF5 A;  1NTZ J;  1HH0 A;  2E74 B;  3PLN A;  2IBZ I;  3AE4 C;  2NZ2 A;  5EFW B;  1T2K C;  4QMA A;  5AVY B;  3E1R A;  1MV8 A;  1GU5 A;  1MZ9 A;  3RK3 C;  3H1J D;  3RGU A;  1EZV D;  1FU1 A;  2JWD A;  3D71 A;  2QJK C;  2YIU B;  1N7L A;  3HE4 B;  3MUD A;  1VQN P;  1LT9 C;  2A06 G;  1ZR2 A;  2D2C D;  4NPD A;  4OWF A;  1LWU C;  1ZN5 A;  2XKM A;  4XFJ A;  1Q90 D;  1OZH A;  1YQ3 C;  1RF1 C;  2QSI A;  3M9Q A;  2IFM A;  1M56 D;  1Y47 A;  1NAF A;  1SQV E;  2IYP A;  2XU6 A;  3CWB E;  3VN0 A;  1WMK A;  2JR8 A;  1RE4 A;  1NHL A;  1JO5 A;  5AVX B;  2RKL A;  3FXE A;  5H2F E;  5KJ7 D;  2ZXE B;  2CPB A;  1PGP A;  1MKM A;  2R32 A;  3H1L G;  3PRJ A;  1SLQ A;  2FYZ A;  4AYC A;  1DEB A;  1EZV I;  2QE7 H;  3KXD A;  1EQ7 A;  4H13 D;  3D6Z A;  1FZF A;  1L0L G;  5AVV B;  4DT0 A;  1GK6 A;  3PTZ A;  2WPR A;  4OGQ D;  5TIS E;  1LTJ A;  4PV1 B;  1L4A D;  2WPQ A;  1PP9 E;  1NAY A;  1J1E C;  2YKP A;  3U59 A;  4ZKU A;  4D6T D;  5CCH C;  5AVS B;  3HE5 B;  1JCD A;  2WQY C;  3MUD C;  1P84 I;  3PP5 A;  1KIL C;  3AE7 C;  3B5N A;  3M0A A;  3PJS K;  1URQ C;  2P2U A;  2QRX A;  3HUS A;  3S4R A;  1Q7Y Q;  5CHX A;  1JNM A;  2WSE H;  1YYC A;  2Y9Z A;  2NPS A;  2P10 A;  4WY4 B;  1URQ A;  3TNU B;  1H88 A;  1SQP J;  2ZJS E;  1KB9 I;  3CX5 H;  4BRY B;  2K9Y A;  4UB6 H;  1LP1 A;  1SQV K;  3H1K J;  2FYU K;  2A06 D;  3HRN A;  2WSF J;  1JMB A;  1S1C X;  3L75 E;  4JYB A;  5KAF E;  2LR2 A;  3H1I G;  2QJP B;  2A45 H;  1JEK A;  3MGN A;  1S4X A;  3H1I J;  1BGY E;  3FGA D;  4YXD C;  1OW6 A;  4N78 D;  2E42 A;  1AFO A;  3R4Y A;  2KZJ A;  3H1L D;  1VF5 B;  3M06 A;  4I2L C;  4IFM A;  3RL0 C;  2FFD A;  1FJP A;  5M1B A;  2YKO A;  3WUV A;  3H1H D;  4U3F J;  1L0L K;  1GTW A;  3W68 A;  1SQQ E;  2CK3 H;  2WSS H;  3AEB C;  3CMA P;  1EDJ A;  3A3Y B;  3II6 A;  1N7S C;  3L75 D;  3N4X A;  4RJT A;  2RMZ A;  3IAO A;  4I6M C;  2Y0D A;  1ZXG A;  3BRV B;  3WUU A;  4DCK A;  2QJK B;  2YIU C;  4U3F G;  3NXS A;  1CI6 A;  4PD4 D;  3U1A A;  1PPJ G;  1SQQ G;  3HD7 C;  3MZW B;  5APS A;  2Z5H A;  5KAI E;  3VOP A;  2K9J A;  3HD7 B;  5APV A;  2WSC J;  4H0L C;  1H0T B;  1KIL A;  1S3J A;  3CCR P;  2C0X A;  2IZ1 A;  1M1K Q;  1NKN A;  1M1J A;  1NKZ B;  1SQX J;  3V2N A;  3GF3 A;  1SQV G;  4AQR D;  2FYU G;  3CC7 P;  2WIT A;  3OAK A;  2BEQ D;  1PP9 D;  3BCC J;  2KI7 B;  2Z5I A;  2W6J H;  3KQG A;  1FJK A;  1Q81 Q;  2MJZ A;  1ZME C;  2B88 A;  2Y9Y A;  1URQ D;  3AE3 C;  5APT A;  4C7R A;  4OGQ B;  4PD4 H;  2XZR A;  5AVQ B;  2Q9I A;  3B5N D;  5B66 E;  2B87 A;  3P8C E;  1L0L J;  3L74 E;  1LT1 A;  4HYT B;  1L2P A;  4JPZ B;  4N6J A;  5AW1 B;  1S5L H;  1L0L D;  3P7K A;  5KLI C;  2AXT E;  1JCC A;  1UIX A;  3M9H A;  1FZC B;  2QJY C;  3GHG B;  1T8Z A;  3T97 B;  3NFQ A;  3KDP B;  2G8Y A;  2OYI A;  2GM4 A;  3N7N A;  1NU1 J;  5AVT B;  1N73 A;  2J58 A;  1QEX A;  1LTS C;  1JTH A;  1GL2 B;  2O01 H;  2YKQ A;  2AEM A;  1W5C E;  2A45 G;  1SQQ K;  2D2C B;  1VQ6 P;  1RE3 C;  3CI9 A;  3AE2 C;  1X22 A;  2ZT9 C;  2OYO A;  4H0L B;  2NPS C;  4I7Z B;  3H6P A;  3M91 A;  3V4Q A;  2ZYD A;  3Q5R A;  1KC8 Q;  3IN6 A;  3IFM A;  5KJ7 C;  5AW5 B;  4UB8 H;  3AEE C;  1FS0 E;  3B5N C;  3TYY A;  1VQ4 P;  1DIP A;  1IFI A;  1FDI A;  4HJG H;  3SFE C;  2FYU D;  4JQ0 D;  3USS A;  2WT7 A;  3L73 E;  2FYU J;  1VQO P;  2L91 A;  3O6Q B;  1FDO A;  1PV3 A;  3KHU A;  3WU2 H;  2PGD A;  1H89 A;  2OTL P;  1G2C B;  2W6A A;  4AUW A;  2K37 A;  2QM7 A;  2R3S A;  5L8R J;  3RL0 D;  1AA0 A;  3RBZ A;  1R5L A;  1PZQ A;  1G1J A;  1S5L X;  2A06 E;  2V4H A;  2YNY A;  3R2P A;  1NTK J;  1JY3 P;  1OFC X;  3LW5 H;  3M0D C;  2E75 C;  5KLV E;  4YXW H;  1VQK P;  2O1K A;  4JF7 A;  2FKW B;  2FYN B;  3MD0 A;  2GUV A;  1PGO A;  3L72 D;  1OXZ A;  1SQB K;  1ZOY C;  4NPF X;  4W7Y A;  3NTN A;  2E76 C;  4YTP C;  3VTP C;  2N1T B;  4ASW A;  1OW7 A;  5CBO A;  1PL5 A;  5AW0 B;  2E5Y A;  1T3J A;  2POH A;  1OMI A;  2OTK E;  4D6T G;  1NVO A;  4H44 C;  4BWN A;  2W83 C;  4IOI H;  4Y99 B;  2W8Z A;  2QJP C;  3AEA C;  1VQ5 P;  4XA4 A;  4ZMD A;  1KYO E;  3H32 A;  3H1H E;  3TGU E;  4OH8 B;  2E74 C;  4TLF A;  2BEZ F;  4EI2 A;  2LXC B;  1YJN P;  1PPJ E;  1SFC A;  1KQF B;  1KYO I;  3LID A;  1RH5 B;  1L0N J;  3WU2 E;  1BCC J;  4MN4 C;  2BCC G;  1WT6 A;  1N7S A;  4KJM A;  1LTB C;  1SP4 A;  2JP3 A;  5KLI B;  1S9K D;  1YJW P;  3U1C A;  3BCC G;  1NTM D;  1FOS F;  1L4A A;  5CJ0 A;  1RF0 C;  1OX3 A;  2FYN C;  1U7M A;  3QWO C;  4KT0 J;  3MHV A;  1SQB J;  5KKZ B;  1KOR A;  2QA4 P;  1SQB G;  2PP6 A;  3CL3 D;  2IFN A;  2M8R A;  3JSV C;  1MFZ A;  2C0W A;  3VP8 A;  4C7N A;  2WTY A;  1Q86 Q;  3V4W A;  1Y8A A;  1OVV A;  3Q1M A;  3RK2 B;  2N9Y B;  3L73 D;  3FWL A;  1PIX A;  3H1I E;  1QL2 A;  4U3F D;  1BDD A;  3EQ2 A;  3JCU H;  3L70 E;  5AW7 B;  4Y28 J;  3L75 G;  1Q2N A;  1RF1 A;  1OW8 A;  5B5E H;  1LTI C;  1KD1 Q;  3CWB J;  1KTM A;  2AEJ A;  3V5B A;  1SQX G;  1KQS O;  3EWK A;  4R4M A;  1GU4 A;  1KIL E;  2FXP A;  1LGH B;  1EZV G;  3JCU E;  2E5T A;  4LLH A;  4GT1 A;  4YPC A;  1YI2 P;  1HBW A;  1NTM E;  1QX8 A;  3MIW A;  2GUS A;  3AE5 C;  2HOD B;  2BCC J;  2OQQ A;  1CZQ A;  3CC4 P;  2YO2 A;  1KFM A;  3H1L J;  2IBZ D;  5CCH D;  3BCC D;  1VQ8 P;  1QGK B;  1VF5 C;  4BXL A;  5TJH A;  3FX0 A;  2WZ7 A;  2YMK A;  3GMA A;  4L73 A;  1ZRT E;  2AEF A;  4Z1M H;  1QL1 A;  1JY3 O;  3A0B H;  2HG5 D;  3TDK A;  1DH3 A;  3CCV P;  3L70 D;  1IC2 A;  3RL0 B;  2KSJ A;  4I1L A;  3BCC E;  1VQ7 P;  4HH2 A;  5E79 E;  2KNC B;  1R5S A;  3MP7 B;  2XND H;  1T2K D;  3I55 P;  1A02 J;  1RHZ B;  5K5G B;  5AVW B;  3CXH I;  1IFD A;  1U57 A;  2FY8 A;  1LT9 B;  3C9I A;  3H1K G;  1XTG B;  4DJG A;  3G71 P;  1SQX K;  1LWU B;  1GL2 C;  3K5B A;  3L72 E;  3RK2 D;  1A02 F;  2D2C C;  3AE1 C;  1KMI Z;  3PHL A;  1MUU A;  1BE3 J;  4H44 B;  3L71 E;  2M5A A;  2HPC B;  1PP9 J;  3Q5P A;  2WPS A;  5C39 A;  2QIW A;  1USD A;  5KTB A;  3Q2Y A;  2OYH A;  3CXH E;  1VQ9 P;  1HJB A;  2KUB A;  4W7Z A;  1IZN B;  1OWA A;  3PH0 A;  4KHX A;  5CCG C;  4Y99 C;  3M9B A;  3UIA A;  3L71 G;  1OIP A;  2I1K A;  4H44 D;  3GLM A;  4L74 A;  2L5G B;  2IBZ G;  2KS1 B;  1NTK G;  2J5U A;  2QVA A;  3CLQ A;  2YMY A;  3VMZ A;  1E79 H;  3A5T A;  3HTK B;  4OGQ C;  1AVY A;  3H1K E;  1RF0 A;  4N78 E;  1LTJ B;  4D6T J;  4H0L D;  4WBA A;  3L70 G;  2E75 B;  4EDF A;  5B66 H;  5GTI H;  1NU1 D;  3G9R A;  3V2Q A;  1NGM B;  5APX A;  1GZL A;  2KYV A;  1S9K E;  1SVF A;  1X0T A;  3O8Z A;  2P7J A;  1VDF A;  4L75 A;  3A0H E;  4PD4 I;  3HUS B;  2Q3E A;  4GOE A;  5AW4 B;  1P84 D;  1SFC C;  1M90 Q;  2OTJ P;  5KAI H;  1SQP D;  2NPS B;  1BCC G;  1SQV J;  3TNU A;  2ZAE B;  3H1K D;  1N86 A;  1KZU B;  3EFG A;  1YJ9 P;  5DJU B;  1LP1 B;  1NTZ D;  1GW4 A;  1NTZ K;  1D7M A;  5APQ A;  3L74 J;  2KB7 P;  2IPP A;  3H1J G;  1J1E B;  2WMM A;  4M3L A;  3WUT A;  1HVV A;  4ZKP A;  3CCU P;  1N73 C;  3H1J J;  3HE4 A;  2R5D A;  2M3B A;  3QH9 A;  1GDT A;  1T3U A;  2UWJ E;  4UB6 E;  2KIK A;  2ITA A;  5AW9 B;  2WSE J;  1HTL C;  2N1T D;  2E75 D;  2PAJ A;  3AED C;  3H1H J;  3RL0 g;  3S1K A;  2QJY B;  3GHG C;  3TGU G;  5AW8 B;  2FFD B;  1NTZ E;  1NTK K;  2LKM A;  3H1H G;  2H89 C;  4DOJ A;  1YTZ I;  1BDC A;  1K73 Q;  1RQU A;  4U7J A;  1X79 B;  1KB9 H;  2WPV B;  1Q82 Q;  3FXD A;  1JMM A;  2I8D A;  1FE6 A;  2Q1K A;  3BRT B;  3RK3 E;  2W27 A;  4GOF A;  2XDJ A;  2HR3 A;  4PJ0 E;  4XE5 B;  1VPC A;  2R5B A;  1PPJ D;  1W2B O;  3Q5S A;  4B86 A;  1XTC C;  1FZG A;  1KB9 E;  2WSF H;  3CCE P;  1L0L E;  2FYU E;  2K9J B;  3CX5 E;  3HE5 A;  1SQX D;  3Q3D A;  1SQQ D;  1M1J B;  3LIE A;  5KJ7 A;  3A7O A;  1SQQ J;  1IFJ A;  2P67 A;  3B5N B;  1K9M Q;  3G6E P;  1NTZ G;  2K3R A;  1J2J B;  1AQT A;  1KB9 D;  1FZB A;  1RE3 A;  1YHQ P;  4PV1 C;  2KOG A;  4WY4 A;  1URQ B;  1YIT P;  2KSE A;  3D70 A;  3CPW O;  3P32 A;  5CMZ A;  3ZDM A;  3AE6 C;  4GDO A;  4BRY A;  1BE3 G;  2O1J A;  2M0B A;  2O3J A;  5BU5 A;  3OW2 O;  2JJL A;  1LTJ C;  2IDB A;  3G4S P;  2B87 B;  5GTI E;  3CC2 P;  2IYO A;  4LC1 A;  1JY2 O;  1QVF O;  2ZYA A;  1JY3 N;  2Q3I A;  2R3C A;  2KXP B;  3RK3 D;  5H2F H;  1Y9B A;  2KP8 A;  1M57 D;  3A0B E;  1YTZ T;  1AJY A;  1RY3 A;  1ZP0 C;  4IL6 X;  1FZC A;  5KKZ C;  3GHG A;  3T97 A;  3CCM P;  1DD3 A;  4PD4 E;  3I56 P;  1FZA A;  1L4A C;  1NJI Q;  3AE8 C;  3BAS A;  3L73 J;  5CCG A;  1N73 B;  2ZYG A;  1FZE A;  1JTH B;  1JY2 N;  1KFN A;  4WWI A;  1IFM A;  1H8A A;  2OYH C;  2ZT9 D;  4L76 A;  1SQP G;  3V2R A;  2P58 A;  1LJ2 A;  3L36 A;  4WB4 A;  1KQG B;  3CCS P;  1M1J C;  2ZVO B;  2O01 N;  1BGY J;  1CI6 B;  1LNQ A;  1ZRT D;  3L74 G;  3OJA B;  1K8A Q;  2YXQ B;  2FXO A;  2YO3 A;  2IBZ E;  3OA7 A;  4RES B;  3AEC C;  1DD4 A;  1GK4 A;  1YBK A;  3HD7 A;  3KZI E;  4RKU J;  1KIL B;  1H0T A;  3B8E B;  2O01 J;  3NMD A;  5AVR B;  3AEF C;  2KLV A;  2P1J A;  1HGZ A;  1OVR A;  2IX7 C;  2N1T C;  2OAR A;  2BCC D;  3ITK A;  3KPE A;  1BE3 D;  1S2E A;  4DZO A;  1EXJ A;  2HYN A;  1BSH A;  2A45 I;  3RBX A;  1NWQ A;  1TU3 F;  1E5W A;  1LTT C;  3BAT A;  1OVU A;  1NU1 E;  3CD6 P;  3L72 J;  5AW3 B;  3TGU J;  2Q6Q A;  1L0N G;  2W6B A;  2KZI A;  2QG4 A;  1HGV A;  3ABV C;  3GF7 A;  3L72 G;  4R4L A;  2QM8 A;  2R44 A;  3F5H A;  3TSI A;  1W2E A;  2XV5 A;  2E43 A;  3P8M C;  2GA1 A;  3SWF A;  2YXR B;  2JKV A;  1L0N E;  3GW6 A;  2PFX A;  3SWY A;  1NU1 G;  1AV1 A;  2OGU A;  2Q7C A;  1VQL P;  1ZW0 A;  3A2A A;  1HJ0 A;  3L73 G;  4IFF A;  2K1A A;  2KK7 A;  3A0H H;  3EFF K;  2OYI B;  3I5C A;  1SQP K;  3LW5 J;  3V2P A;  1NO4 A;  3E7K A;  1KQL A;  1JOC A;  4H13 B;  2HFE D;  4JYC A;  4NPE A;  4GKG A;  3C8V A;  4UB8 E;  4WVZ A;  4WY4 C;  5E79 H;  3D6Y A;  1GL2 A;  2W90 A;  1EC5 A;  2ZVN B;  1U7J A;  4PV1 D;  1SFC B;  1QVG O;  1BCC D;  5KLV D;  1P84 E;  3WMM 0;  1NTK E;  4JBZ A;  5DJT B;  5BU8 B;  5KLV J;  1SQV D;  2H43 A;  3AEG C;  2ZFC A;  3W67 A;  1FBM A;  1HWT C;  1KN7 A;  1EDL A;  1JUN A;  4HB1 A;  5APY A;  1L4A B;  1IK9 A;  1EDI A;  1P84 H;  2IZ0 A;  2MKV A;  1DEE G;  1EZV E;  2WT7 B;  3O6Q A;  1R8E A;  2C9L Y;  1J1D B;  1KV4 A;  5AVU B;  3B71 A;  1G2C A;  1L0N K;  5APW A;  1SQX E;  1JY2 P;  3TK1 A;  3M0D A;  4ASV A;  1J1D C;  2K88 A;  1QLE D;  1LTA C;  3C1L A;  2FFD C;  4GIF A;  4C7N B;  5GTH E;  1EXI A;  4OVN F;  1PGJ A;  3CCJ P;  2RN0 A;  3CX5 D;  3JC2 2;  1X9V A;  2M3E A;  1NU1 K;  5APU A;  1SQP E;  1VL2 A;  3CXH D;  4IL6 H;  3VMX A;  4RO0 A;  5AW6 B;  5TIS H;  1RF1 B;  1BE3 E;  1SFC D;  2BCC E;  2N1T A;  1JM0 A;  3CWB D;  1T6A A;  3SFD C;  3L75 J;  4CPG A;  1YQ4 C;  1IJD B;  3KZI H;  1IFN A;  3CCQ P;  1PFI A;  1JB0 J;  2B9B A;  1FAV A;  1SQB E;  1AQ5 A;  4IFD K;  4I7Z C;  4LGD E;  3SSU A;  5CCG D;  5KLV K;  1FDM A;  1Z56 A;  2LXB A;  1NH4 A;  3S9O A;  1WRG A;  3HUS C;  2QEX P;  1SS1 A;  3H32 B;  3L74 D;  3MTU E;  4IL6 E;  3CME P;  1USE A;  1HF9 A;  1BGY G;  2JDI H;  1GL2 D;  3CX5 I;  3RK2 C;  4ZNC A;  4N3Y B;  2E74 D;  1K05 A;  1MFT A;  2WVR A;  3H1I D;  2I1J A;  3CXH H;  3L4F A;  4U3F E;  3V6I A;  4EIJ A;  1VQP P;  1IK7 A;  1S72 P;  4D6T E;  5CCH A;  1N2D C;  3L37 A;  4GOD A;  4W80 A;  3VMA A;  2KLU A;  1ZV8 A;  1VF5 D;  1PGQ A;  2WSC H;  2SPZ A;  1NTM G;  2VRS A;  5KAF H;  2OYI C;  1L0N D;  1N7S B;  1X8Y A;  2AXT H;  5AW2 B;  2CPS A;  1VQM P;  5CJ4 A;  1NOH A;  4EYY Q;  3L70 J;  2DW3 A;  1GW3 A;  1LTG C;  3AE9 C;  5GTH H;  2C9N Y;  1EDK A;  1NTM J;  1ZLL A;  5AVZ B;  2AXC A;  2KNC A;  3B4S A;  4HKZ H;  2JO1 A;  4C46 A;  1SQB D;  3IR9 A;  5B5E E;  1FOS E;  4K35 A;  4TT3 H;  4WY4 D;  1G1I A;  5BVZ A;  1M7L A;  2G3A A;  2V7Q H;  1LT9 A;  2BAS A;  4O9B A;  3H1J E;  1LWU A;  2RH0 A;  2JWA A;  1N8R Q;  1HUC A;  2Y0E A;  2H8P D;  5KLV G;  1YIJ P;  2ZT9 B;  1CSB A;  2Q5U A;  1NYH A;  2Z4E A;  1CW5 A;  4K3A A;  2M5A B;  3P8C D;  2HPC A;  3H1L E;  2H88 C;  3BVH A;  3L35 A;  1GMJ A;  2NPS D;  2ZXX A;  2H7H A;  1N7S D;  1IO4 A;  2WWW A;  2FXM A;  3RK3 B;  5CBN A;  2OYH B;  1BGY D;  1BSN A;  1KYO D;  2N9B A;  4EOT A;  4H13 C;  2V7Q J;  1PP9 G;  3HD7 D;  3F89 A;  1NTM K;  3VMY A;  2KS1 A;  1UII A;  1RQV A; 
#chains in the Genus database with same CATH homology
 3L75 J;  1SQP J;  1KB9 I;  3L71 J;  3H1K J;  4PD4 I;  1NU1 J;  5KLV J;  1BE3 J;  1SQV J;  1PP9 J;  2BCC J;  1SQB J;  1SQX J;  3L72 J;  3TGU J;  3H1L J;  3L73 J;  3H1I J;  1EZV I;  3CX5 I;  3BCC J;  3L74 J;  1NTZ J;  2IBZ I;  1SQQ J;  3H1J J;  4U3F J;  2FYU J;  1BGY J;  1L0L J;  1P84 I;  3L70 J;  3CWB J;  3H1H J;  1NTM J;  1KYO I;  4D6T J;  1L0N J;  1BCC J;  1NTK J;  3CXH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...