3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
b'IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
molecule tags Oxidoreductase
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
1BGYG 2BCCG 1NTZG 1L0NG 1BE3G 1EZVG 3L75G 3L72G 1SQVG 3BCCG 3L73G 1NTMG 3CXHH 1KYOH 4D6TG 1SQBG 1PPJG 3H1LG 3L70G 1SQXG 4PD4H 1NU1G 1SQQG 2A06G 1SQPG 1PP9G 2FYUG 3H1HG 3H1JG 5KLVG 3H1KG 3TGUG 4U3FG 3CWBG 2IBZG 1KB9H 1NTKG 3CX5H 3H1IG 3L71G 1BCCG 1P84H 1L0LG 3L74G
chains in the Genus database with same CATH superfamily
4IL6E 3MIWA 4GOFA 3VP8A 5TISH 2WSEJ 2E75B 3JCUE 1D7MA 5APTA 1EZVE 1YTZT 2YKPA 1IFIA 2JEEA 3WUUA 2IPPA 3G4SP 3P32A 2CPBA 4YXDC 3PLNA 2WITA 1HBWA 1M56D 1OX3A 1BSNA 2D2CB 5GTIE 1Z56A 4Z1MH 1NU1G 1NO4A 2ZYGA 3CWBD 3HUSA 3NXSA 4N78D 4ZKPA 1L0NK 1KYOI 1RH5B 4U7JA 3GLMA 1JOCA 1IFPA 2IDBA 2W6BA 5AVWB 3FXDA 1RE4A 2OQQA 1H88A 3CCEP 1HF9A 2K37A 1RHZB 1LTJA 2O1JA 2OGUA 2WSFH 5APSA 5H2FE 1YI2P 1WRGA 4PD4E 3MUDA 5CHXA 2M8RA 1GW3A 1BGYE 4LLHA 1GL2B 2WTYA 1JNMA 2KLVA 5CCHC 1FZEA 3BVHA 2FYZA 1N73C 1S5LE 3RK2D 1FZCB 3AE5C 3A7OA 4HYTB 2FXMA 3VN0A 1GU4A 2WPRA 1NTME 3I5CA 1E79H 2KSJA 1Q7YQ 1KQFB 1WMKA 3USSA 1ZMEC 1CI6A 1X22A 1QX8A 2R3SA 2ZYAA 2FFDA 3FGAD 1CW5A 3WUTA 1S3JA 3M9BA 2YMKA 1N7LA 5AVSB 3AEAC 2KIKA 1JMMA 2ZXXA 2E74C 2FFDC 1EQ7A 2NPSC 3H1KG 3HE4A 1LTJC 1FDOA 1NHLA 3IN6A 4QMAA 1HGZA 2WPQA 1P84I 3CX5H 4XA4A 5CCGC 3U1CA 2QJPB 1EXJA 1PPJD 1BCCG 3H1LD 2IZ1A 2J59M 1PZQA 3WU2E 1N73A 1GL2C 1N86A 2J5UA 2QJYB 2IZ0A 2Q3EA 3GF7A 2KYVA 3P8MC 1JY2O 1LTBC 2JDIH 3P7KA 4Y99B 3TGUD 4AUWA 2P7JA 1FZGA 1LWUB 3SWYA 4I7ZC 3FX0A 1FOSF 1T8ZA 1N2DC 2KZIA 2Q6QA 1SLQA 3TNUB 3VTPC 2L5GB 2WPVB 5KLIB 1ZN5A 2E76B 3GHGC 4N78E 3U59A 5B66H 5KTBA 3C9IA 4L73A 1JY2N 5B5EE 1VQ4P 1BCCD 3H1LG 3W67A 3RK3E 1SQXG 1W2EA 3HD7B 1OMIA 3HD7A 4GT1A 1URQC 1LJ2A 1SFCB 1U57A 2GA1A 1HUCA 1L0ND 1PGPA 3BCCJ 3CCJP 1HJBA 1VQ7P 4N6JA 2R5BA 1GZLA 3W68A 5CCHD 1LTSC 2XU6A 1NKNA 2K9JA 1QEXA 1JCDA 2B88A 1KILD 3LIDA 1VL2A 1AVYA 1OW7A 2QE7H 1YJ9P 1KZUB 1X8YA 5APXA 1EC5A 2QM7A 1EZVG 1OWAA 4ZNCA 2WSCH 1ZW0A 2Y0DA 3V2NA 2XZRA 5AW6B 2HYNA 1KQGB 1NTMK 1SQQD 1X79B 3MD0A 1OW6A 2FXOA 3H6PA 1G1JA 1MV8A 2FYUD 3AEDC 1GK4A 1QL1A 1S1CX 3FWLA 4EDFA 1KB9I 1DD3A 2M0BA 3MUDC 2KP8A 2YMYA 4Y99C 1FOSE 3D6YA 1CSBA 4H0LB 1GMJA 3A2AA 3H1LE 4IL6H 1QVGO 1LP1B 2AEJA 3CX5D 3H1JD 4NPEA 1U7MA 2FYUE 2H89C 4GIFA 4JBZA 1JMBA 4WBAA 3OJAB 1J2JB 3ZDMA 3V2QA 3Q3DA 2KOGA 2NPSA 1YJWP 2Z5HA 1S4XA 4YPCA 1ZOYC 2K3RA 1LGHB 3IFMA 5AW5B 2K88A 1VQMP 2ZVNB 1L4AD 3AEGC 1HJ0A 1Q2NA 2AEFA 2KK7A 1KQLA 2KUBA 3AE8C 5AW7B 2YKQA 4DCKA 1NU1E 3CD6P 1RQUA 1J1EC 1Q81Q 2IFMA 2KZJA 2YO3A 2MKVA 3CMAP 1ZXGA 2R32A 3EWKA 2CPSA 2RKLA 3B8EB 4OWFA 4R4MA 2Q9IA 2BCCE 1NTMG 1OXZA 1W5CE 2KSEA 3IAOA 1BSHA 4WB4A 2WPSA 3V6IA 3S9OA 4PD4H 3RL0C 4IOIH 3H1KJ 3HUSB 4PD4D 2R5DA 3EQ2A 4BRYA 1IZNB 3D6ZA 1KILC 4PV1C 1J1DB 1OZHA 2PFXA 4WY4D 2KNCB 3RK3D 1URQB 3V2PA 2W27A 4AYCA 1DIPA 5B5EH 2QG4A 1JTHB 1SFCA 1NAYA 1AA0A 1KMIZ 2I1KA 1NTMD 1K73Q 3WUVA 1HGVA 1P84D 3H1KD 1QL2A 1J1EB 2WQYC 3H1LJ 3H25A 2QM8A 3L4FA 3F89A 3L75D 5KJ7C 2N1TA 1H0TA 2HODA 3AE3C 3B5NB 1RF0A 1L0NG 1SQVE 1WT6A 1YYCA 1DEEG 2HODB 2JJLA 3B5NA 3L73E 2O1KA 1SQVG 3L73G 2V7QJ 2IYOA 2B89A 2R3CA 2RN0A 5KLVE 1Y47A 1OW8A 2KI7B 3CXHD 3G9RA 1BCCJ 1FE6A 4I1LA 1S72P 1IFMA 2FXPA 2JKVA 3H1ID 3JSVC 5APVA 1PPJG 3N4XA 3CCUP 1VQKP 1SFCD 3AE7C 3H32B 3M9HA 4D6TD 2A06G 1PPJE 4L76A 1ZRTE 3CPWO 4KJMA 4HB1A 2FY8A 1J1DC 3C8VA 2UWJE 2KS1A 3Q5SA 2GM4A 2XNDH 2H7HA 3EFGA 5AW9B 1N7SB 1KILB 1Y9BA 4DOJA 2I1JA 2H8PD 3B4SA 2V4HA 3MTUE 3B5ND 1AJYA 2AXCA 2C0WA 5E79E 5TISE 1GW4A 4EOTA 1FZBA 1SQXJ 2N1TB 2QJKB 2P1JA 3EFFK 4LGDE 5C39A 1FU1A 3L71E 4K35A 2BCCG 1JB0J 2Y9ZA 1GTWA 1YJNP 1UIXA 1OVUA 4GOEA 1SQXK 3PTZA 1JTHA 4D6TJ 3CXHH 4I7ZB 1VQNP 2A06E 1DEBA 1OVRA 1JCCA 2P67A 3M9QA 3NTNA 4WY4A 1R8EA 3D70A 5AVVB 1UIIA 1Q86Q 1GL2A 2QRXA 1SQPG 4HJGH 3RL0B 1JY3P 5KLVG 1AQ5A 4PJ0E 1N7SD 1SS1A 1NH4A 2Y0CA 4H0LC 1NTKJ 3IF4A 4MN4C 3N7NA 3I55P 3L75J 4UB8E 1A02J 1K9MQ 1KB9D 2ZT9B 3RL0g 5KLIC 1DD4A 1NJIQ 3VMAA 4C7RA 1T2KC 1SQPD 1M90Q 1KORA 2P2UA 2W90A 3GF3A 4KT0J 4U3FE 2Q3IA 1LTGC 5KAFE 5KKZC 1GD2E 2LKMA 2PGDA 3AEEC 2KLUA 3NFQA 3L72J 1VQ9P 4M3LA 1LT9A 3H1HD 3L75G 2NPSD 3L72G 1USDA 1FZFA 2O01H 2A45G 2K9JB 3WMM0 1FJKA 3CC4P 1NU1D 5CCHA 3O6QA 3L70G 4HH2A 3QWOC 5M1BA 3H1HG 3CCVP 1S2EA 3GHGA 1SQPJ 2ZT9D 1G1IA 3H1HJ 3Q5RA 3Q2YA 1QVFO 2AXTH 4L75A 2N9BA 4OGQB 3TDKA 5GTIH 2WT7A 1RF1B 1RF0C 3B5NC 1NTMJ 1IFDA 1NOHA 2Q5UA 5KJ7A 1VQ5P 1ZV8A 2K1AA 4PJ0H 3UIAA 3Q5PA 2H88C 3FWNA 2ITAA 3L71D 1MZ9A 1NTKK 3K5BA 2BCCD 1HVVA 1XTGB 1L0LE 5AVUB 1L0NJ 1SQQE 2B9BA 1NVOA 2FYUK 2IFNA 3JC22 2O3JA 3H1JJ 4N3YB 1NTZG 3KYQA 3AEFC 5APUA 1Q90D 2A45I 2M5AA 4RO0A 5TJHA 3TGUE 1VQOP 5AVTB 3H1IJ 5EFWB 2P58A 1L0LD 1FBMA 1S5LH 2HPCB 1JY2P 2JWDA 2OYOA 3SFEC 4ASVA 3L37A 4H13D 1YQ4C 1FS0E 2KB7P 2RMZA 1Y8AA 1SQBD 5AW0B 3H1JG 3E1IA 1ZP0C 1E5WA 1BE3J 1XTCC 3BASA 3AECC 2D2CC 3CXHI 3L36A 4NPFX 3CXHE 4UB8H 4ZMDA 4JQ0D 2OYIA 3L71J 2E42A 3V4WA 1KFMA 1LT9C 5AVZB 1H0TB 1LWUC 3KQGA 2OTKE 2KXPB 3TF5A 4IFMA 2NRGA 1SQVD 2Y9YA 3L73D 3O8ZA 3P8CE 3A0HE 4H44D 2FYNC 1IJDB 2QEXP 3TSIA 1Q82Q 1PP9E 3GG2A 2JR8A 2JP3A 3HE5B 3M91A 3ITKA 3L74E 1K8AQ 1FDIA 4UB6H 1X0TA 2M3EA 3S4RA 1N73B 2BASA 1K05A 4TT3H 4W80A 4BRYB 5AW2B 3CCLP 1RF1C 4I2LC 4RESB 1SQXE 3MZWB 4IL6X 1IK7A 3QH9A 4ASWA 5KAFH 1LTJB 2ZFCA 3KZIE 4A7PA 1NWQA 1H8AA 1FZCC 2HG5D 2YKOA 1IO4A 2E76D 2O01J 1VPCA 3P8CD 4U3FJ 1BGYJ 2AEMA 2CK3H 4XE5B 3BATA 3SSUA 3RBZA 5B66E 4WWIA 2BCCJ 2WMMA 1LTIC 2E74D 3M0DA 3MGNA 5CJ4A 2MJZA 2G8YA 4GKGA 2XV5A 3L71G 5AVQB 3SWKA 1OIPA 3C1LA 3BCCD 1VDFA 1YBKA 1K04A 4NPDA 4JF7A 1JY3O 5KLVD 2W6AA 3CC7P 3L70J 3AE9C 1BGYG 4AQRD 2AXTE 5DJUB 1KN7A 2XNXA 2JO1A 1QLED 4LC1A 1M57D 2E5YA 1IFJA 1SQBK 3I56P 4XFJA 3G71P 1NGMB 1AQTA 1PV3A 1SQPE 3VMXA 4U3FD 2OYIC 4YTPC 1PGOA 4PD4I 3RK3C 1FDMA 1LT9B 1KILE 1SQBE 2FKWB 2PAJA 2A45H 4D6TG 3MP7B 2XDJA 1SQBG 4UB6E 2WVRA 3M0AA 3PRJA 1YITP 1SQVK 1NTZK 1VF5C 1RY3A 1KTMA 2KS1B 2ZJSE 2LR2A 5APQA 2FBWC 3A3YB 1VQPP 2E43A 2IBZG 1SVFA 3AE2C 5KLVJ 1RE4C 3KZIH 2SPZA 5DJTB 4OGQC 1NTKG 1RE3C 2L91A 4H0LD 3VP9A 3VYIA 5K5GB 2WZ7A 4W7ZA 2E75C 5AW3B 1JEKA 5AVRB 1P84H 3A5TA 4L74A 2C9LY 1MUUA 2YIUC 4R4LA 3CX5I 3ABVC 5CMZA 3AE1C 2ZT9C 3VMYA 1ZR2A 1KC8Q 2C9NY 3M06A 2YNYA 1VF5B 3AE4C 3CI9A 3OAKA 2GUVA 4ZKUA 1EDIA 2ZYDA 5AVYB 3TYYA 1W2BO 3V2RA 1PP9D 3AEBC 5KJ7D 1SQQK 4W7YA 5KKZB 2W8ZA 2IBZI 1OVVA 2D2CD 1NTKE 1PGJA 3T97B 2FYNB 2V7QH 3PJSK 3R2PA 1U7JA 3HTKA 1DX7A 1L0NE 1SQQJ 2WSFJ 3SWFA 1KB9E 3KDPB 1JO5A 3E1RA 1NTZD 2HPCA 1VQ6P 2XKMA 2BEZF 4TLFA 1PP9G 3TGUJ 2OYHA 3CCSP 1SQXD 2QJYC 1PP9J 3CWBG 2E76C 4O9BA 3PP5A 3TNUA 1N7SA 4D6TE 2OARA 3M0DC 2QJPC 3Q1MA 1SQVJ 3L73J 2DW3A 1GL2D 4BXLA 2W83C 3GW6A 1KV4A 2YXRB 1VF5D 3PH0A 2N9YB 3RK2B 3KPEA 4OH8B 3MHVA 3PHLA 1KQSO 2OYHB 3V5BA 1GDTA 2QSIA 1PGQA 3E7KA 3G3ZA 5AW1B 3RBXA 2QVAA 3HE5A 3HTKB 4C46A 1RF1A 3CWBJ 1JM0A 1LTTC 2ZXEB 2LXBA 3B71A 2HR3A 5KAIE 3T97A 1NTZJ 5BVZA 3BCCG 1LTAC 1M8OB 3FXEA 5L8RJ 1L4AC 4EIJA 2R44A 1QGKB 3IR9A 4DZOA 2NPSB 3KHUA 3O6QB 4YXWH 5GTHE 4PV1B 1EDJA 4HKZH 2Q7CA 3L74J 3CMEP 1SQQG 3NMDA 4OVNF 1EZVI 2JWAA 3A0HH 1LP1A 5AW8B 3U1AA 2PP6A 3HRNA 4H13C 3CCQP 3TGUG 4DT0A 4C7NA 5CCGA 3CCRP 1IFNA 1M1JA 3D71A 1KB9H 2WSSH 2RH0A 3VMZA 3VOPA 1URQA 3L70D 3HD7C 4OGQD 3CCMP 3L74G 1KFNA 1SQBJ 2LXCB 3CL3D 2H43A 4JYCA 3H1HE 1BE3D 1KYOE 2WSEH 5KAIH 1LNQA 1NTKD 2Y0EA 1AVOA 5CJ0A 3A0BE 1HH0A 2N1TD 2YXQB 1FZAA 4WVZA 3L35A 1LT1A 1P84E 3S1KA 1KYOD 4EI2A 2I8DA 2WSCJ 3L75E 2HFED 4JYBA 2HLOA 5APYA 3KXDA 1NAFA 3H1JE 4H44C 4WY4B 1URQD 2B87B 1M1JB 4C7NB 2B87A 2IYPA 3L72D 4GODA 4U3FG 1KD1Q 1RE3A 2W6JH 3LW5H 5AW4B 1L0LK 5GTHH 1L2PA 3OW2O 1GU5A 2BEQD 2Z5IA 1PFIA 1EDLA 1S9KD 1YQ3C 1VQLP 1VQ8P 3HUSC 4RKUJ 2ZVOB 1IK9A 2OTLP 3RK2C 1R5SA 5BU5A 2J58A 2O01N 3AE6C 4I6MC 1DH3A 1T6AA 1FJPA 1RQVA 4H44B 4WY4C 1S5LX 1YHQP 1LWUA 3GMAA 3BCCE 3R4YA 1M7LA 2QJKC 2K9YA 1EXIA 2QIWA 1T2KD 1ZR4A 2Z4EA 1A02F 1MKMA 4GDOA 2Q1KA 2OYHC 4JPZB 3H32A 5CCGD 1BDDA 2NZ2A 5AVXB 1JY3N 2WWWA 1NKZB 3A0BH 1S9KE 2PRRA 1IC2A 2POHA 2YO2A 1ZLLA 2IBZD 4IFDK 3BRVB 3HE4B 1T3UA 3CLQA 3L70E 2VRSA 1G2CA 2A06D 3II6A 1YIJP 5CBOA 1BDCA 1USEA 1CZQA 2E5TA 1M1JC 2C0XA 1BCCE 3CWBE 5E79H 1L4AB 3H1IG 3JCUH 4BWNA 1EDKA 2IBZE 2OYIB 1NTZE 2E74B 2FFDB 3G6EP 2G3AA 1CI6B 1L0LG 2ZAEB 3F5HA 1HTLC 1N8RQ 1H89A 4CPGA 1SQPK 1L4AA 1PIXA 2FYUJ 4EYYQ 1GK6A 5KLVK 1BE3G 1BGYD 3H1KE 2KNCA 1MFTA 4RJTA 1FZCA 1NU1K 1G2CB 1BE3E 2E75D 3OA7A 3TK1A 4PV1D 1MFZA 1KILA 2M3BA 2M5AB 2N1TC 3L74D 1M1KQ 1KYOH 3RL0D 1L0LJ 3CX5E 2QA4P 1NU1J 1OFCX 4IFFA 5BU8B 3LIEA 3RGUA 4Y28J 3CC2P 3SFDC 2GUSA 2YIUB 3RK3B 3V4QA 4K3AA 3WU2H 1HWTC 2OTJP 2FYUG 1T3JA 1AV1A 3BRTB 2P10A 1SFCC 1PL5A 3H1IE 5APWA 1R5LA 5H2FH 4B86A 5CBNA 4H13B 1FC2C 4KHXA 1X9VA 1ZRTD 1SP4A 3HD7D 1N7SC 2WT7B 3L72E 1JUNA 1EZVD 1AFOA 1TU3F 4DJGA 3GHGB 3LW5J 1NYHA 1FAVA 2IX7C 1YTZI
chains in the Genus database with same CATH topology
1BGYG 2BCCG 1NTZG 1L0NG 1BE3G 1EZVG 3L75G 3L72G 1SQVG 3BCCG 3L73G 1NTMG 3CXHH 1KYOH 4D6TG 1SQBG 1PPJG 3H1LG 3L70G 1SQXG 4PD4H 1NU1G 1SQQG 2A06G 1SQPG 1PP9G 2FYUG 3H1HG 3H1JG 5KLVG 3H1KG 3TGUG 4U3FG 3CWBG 2IBZG 1KB9H 1NTKG 3CX5H 3H1IG 3L71G 1BCCG 1P84H 1L0LG 3L74G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  2BCC G;  1NTZ G;  1L0N G;  1BE3 G;  1EZV G;  3L75 G;  3L72 G;  1SQV G;  3BCC G;  3L73 G;  1NTM G;  3CXH H;  1KYO H;  4D6T G;  1SQB G;  1PPJ G;  3H1L G;  3L70 G;  1SQX G;  4PD4 H;  1NU1 G;  1SQQ G;  2A06 G;  1SQP G;  1PP9 G;  2FYU G;  3H1H G;  3H1J G;  5KLV G;  3H1K G;  3TGU G;  4U3F G;  3CWB G;  2IBZ G;  1KB9 H;  1NTK G;  3CX5 H;  3H1I G;  3L71 G;  1BCC G;  1P84 H;  1L0L G;  3L74 G; 
#chains in the Genus database with same CATH topology
 4IL6 E;  3MIW A;  4GOF A;  3VP8 A;  5TIS H;  2WSE J;  2E75 B;  3JCU E;  1D7M A;  5APT A;  1EZV E;  1YTZ T;  2YKP A;  1IFI A;  2JEE A;  3WUU A;  2IPP A;  3G4S P;  3P32 A;  2CPB A;  4YXD C;  3PLN A;  2WIT A;  1HBW A;  1M56 D;  1OX3 A;  1BSN A;  2D2C B;  5GTI E;  1Z56 A;  4Z1M H;  1NU1 G;  1NO4 A;  2ZYG A;  3CWB D;  3HUS A;  3NXS A;  4N78 D;  4ZKP A;  1L0N K;  1KYO I;  1RH5 B;  4U7J A;  3GLM A;  1JOC A;  1IFP A;  2IDB A;  2W6B A;  5AVW B;  3FXD A;  1RE4 A;  2OQQ A;  1H88 A;  3CCE P;  1HF9 A;  2K37 A;  1RHZ B;  1LTJ A;  2O1J A;  2OGU A;  2WSF H;  5APS A;  5H2F E;  1YI2 P;  1WRG A;  4PD4 E;  3MUD A;  5CHX A;  2M8R A;  1GW3 A;  1BGY E;  4LLH A;  1GL2 B;  2WTY A;  1JNM A;  2KLV A;  5CCH C;  1FZE A;  3BVH A;  2FYZ A;  1N73 C;  1S5L E;  3RK2 D;  1FZC B;  3AE5 C;  3A7O A;  4HYT B;  2FXM A;  3VN0 A;  1GU4 A;  2WPR A;  1NTM E;  3I5C A;  1E79 H;  2KSJ A;  1Q7Y Q;  1KQF B;  1WMK A;  3USS A;  1ZME C;  1CI6 A;  1X22 A;  1QX8 A;  2R3S A;  2ZYA A;  2FFD A;  3FGA D;  1CW5 A;  3WUT A;  1S3J A;  3M9B A;  2YMK A;  1N7L A;  5AVS B;  3AEA C;  2KIK A;  1JMM A;  2ZXX A;  2E74 C;  2FFD C;  1EQ7 A;  2NPS C;  3H1K G;  3HE4 A;  1LTJ C;  1FDO A;  1NHL A;  3IN6 A;  4QMA A;  1HGZ A;  2WPQ A;  1P84 I;  3CX5 H;  4XA4 A;  5CCG C;  3U1C A;  2QJP B;  1EXJ A;  1PPJ D;  1BCC G;  3H1L D;  2IZ1 A;  2J59 M;  1PZQ A;  3WU2 E;  1N73 A;  1GL2 C;  1N86 A;  2J5U A;  2QJY B;  2IZ0 A;  2Q3E A;  3GF7 A;  2KYV A;  3P8M C;  1JY2 O;  1LTB C;  2JDI H;  3P7K A;  4Y99 B;  3TGU D;  4AUW A;  2P7J A;  1FZG A;  1LWU B;  3SWY A;  4I7Z C;  3FX0 A;  1FOS F;  1T8Z A;  1N2D C;  2KZI A;  2Q6Q A;  1SLQ A;  3TNU B;  3VTP C;  2L5G B;  2WPV B;  5KLI B;  1ZN5 A;  2E76 B;  3GHG C;  4N78 E;  3U59 A;  5B66 H;  5KTB A;  3C9I A;  4L73 A;  1JY2 N;  5B5E E;  1VQ4 P;  1BCC D;  3H1L G;  3W67 A;  3RK3 E;  1SQX G;  1W2E A;  3HD7 B;  1OMI A;  3HD7 A;  4GT1 A;  1URQ C;  1LJ2 A;  1SFC B;  1U57 A;  2GA1 A;  1HUC A;  1L0N D;  1PGP A;  3BCC J;  3CCJ P;  1HJB A;  1VQ7 P;  4N6J A;  2R5B A;  1GZL A;  3W68 A;  5CCH D;  1LTS C;  2XU6 A;  1NKN A;  2K9J A;  1QEX A;  1JCD A;  2B88 A;  1KIL D;  3LID A;  1VL2 A;  1AVY A;  1OW7 A;  2QE7 H;  1YJ9 P;  1KZU B;  1X8Y A;  5APX A;  1EC5 A;  2QM7 A;  1EZV G;  1OWA A;  4ZNC A;  2WSC H;  1ZW0 A;  2Y0D A;  3V2N A;  2XZR A;  5AW6 B;  2HYN A;  1KQG B;  1NTM K;  1SQQ D;  1X79 B;  3MD0 A;  1OW6 A;  2FXO A;  3H6P A;  1G1J A;  1MV8 A;  2FYU D;  3AED C;  1GK4 A;  1QL1 A;  1S1C X;  3FWL A;  4EDF A;  1KB9 I;  1DD3 A;  2M0B A;  3MUD C;  2KP8 A;  2YMY A;  4Y99 C;  1FOS E;  3D6Y A;  1CSB A;  4H0L B;  1GMJ A;  3A2A A;  3H1L E;  4IL6 H;  1QVG O;  1LP1 B;  2AEJ A;  3CX5 D;  3H1J D;  4NPE A;  1U7M A;  2FYU E;  2H89 C;  4GIF A;  4JBZ A;  1JMB A;  4WBA A;  3OJA B;  1J2J B;  3ZDM A;  3V2Q A;  3Q3D A;  2KOG A;  2NPS A;  1YJW P;  2Z5H A;  1S4X A;  4YPC A;  1ZOY C;  2K3R A;  1LGH B;  3IFM A;  5AW5 B;  2K88 A;  1VQM P;  2ZVN B;  1L4A D;  3AEG C;  1HJ0 A;  1Q2N A;  2AEF A;  2KK7 A;  1KQL A;  2KUB A;  3AE8 C;  5AW7 B;  2YKQ A;  4DCK A;  1NU1 E;  3CD6 P;  1RQU A;  1J1E C;  1Q81 Q;  2IFM A;  2KZJ A;  2YO3 A;  2MKV A;  3CMA P;  1ZXG A;  2R32 A;  3EWK A;  2CPS A;  2RKL A;  3B8E B;  4OWF A;  4R4M A;  2Q9I A;  2BCC E;  1NTM G;  1OXZ A;  1W5C E;  2KSE A;  3IAO A;  1BSH A;  4WB4 A;  2WPS A;  3V6I A;  3S9O A;  4PD4 H;  3RL0 C;  4IOI H;  3H1K J;  3HUS B;  4PD4 D;  2R5D A;  3EQ2 A;  4BRY A;  1IZN B;  3D6Z A;  1KIL C;  4PV1 C;  1J1D B;  1OZH A;  2PFX A;  4WY4 D;  2KNC B;  3RK3 D;  1URQ B;  3V2P A;  2W27 A;  4AYC A;  1DIP A;  5B5E H;  2QG4 A;  1JTH B;  1SFC A;  1NAY A;  1AA0 A;  1KMI Z;  2I1K A;  1NTM D;  1K73 Q;  3WUV A;  1HGV A;  1P84 D;  3H1K D;  1QL2 A;  1J1E B;  2WQY C;  3H1L J;  3H25 A;  2QM8 A;  3L4F A;  3F89 A;  3L75 D;  5KJ7 C;  2N1T A;  1H0T A;  2HOD A;  3AE3 C;  3B5N B;  1RF0 A;  1L0N G;  1SQV E;  1WT6 A;  1YYC A;  1DEE G;  2HOD B;  2JJL A;  3B5N A;  3L73 E;  2O1K A;  1SQV G;  3L73 G;  2V7Q J;  2IYO A;  2B89 A;  2R3C A;  2RN0 A;  5KLV E;  1Y47 A;  1OW8 A;  2KI7 B;  3CXH D;  3G9R A;  1BCC J;  1FE6 A;  4I1L A;  1S72 P;  1IFM A;  2FXP A;  2JKV A;  3H1I D;  3JSV C;  5APV A;  1PPJ G;  3N4X A;  3CCU P;  1VQK P;  1SFC D;  3AE7 C;  3H32 B;  3M9H A;  4D6T D;  2A06 G;  1PPJ E;  4L76 A;  1ZRT E;  3CPW O;  4KJM A;  4HB1 A;  2FY8 A;  1J1D C;  3C8V A;  2UWJ E;  2KS1 A;  3Q5S A;  2GM4 A;  2XND H;  2H7H A;  3EFG A;  5AW9 B;  1N7S B;  1KIL B;  1Y9B A;  4DOJ A;  2I1J A;  2H8P D;  3B4S A;  2V4H A;  3MTU E;  3B5N D;  1AJY A;  2AXC A;  2C0W A;  5E79 E;  5TIS E;  1GW4 A;  4EOT A;  1FZB A;  1SQX J;  2N1T B;  2QJK B;  2P1J A;  3EFF K;  4LGD E;  5C39 A;  1FU1 A;  3L71 E;  4K35 A;  2BCC G;  1JB0 J;  2Y9Z A;  1GTW A;  1YJN P;  1UIX A;  1OVU A;  4GOE A;  1SQX K;  3PTZ A;  1JTH A;  4D6T J;  3CXH H;  4I7Z B;  1VQN P;  2A06 E;  1DEB A;  1OVR A;  1JCC A;  2P67 A;  3M9Q A;  3NTN A;  4WY4 A;  1R8E A;  3D70 A;  5AVV B;  1UII A;  1Q86 Q;  1GL2 A;  2QRX A;  1SQP G;  4HJG H;  3RL0 B;  1JY3 P;  5KLV G;  1AQ5 A;  4PJ0 E;  1N7S D;  1SS1 A;  1NH4 A;  2Y0C A;  4H0L C;  1NTK J;  3IF4 A;  4MN4 C;  3N7N A;  3I55 P;  3L75 J;  4UB8 E;  1A02 J;  1K9M Q;  1KB9 D;  2ZT9 B;  3RL0 g;  5KLI C;  1DD4 A;  1NJI Q;  3VMA A;  4C7R A;  1T2K C;  1SQP D;  1M90 Q;  1KOR A;  2P2U A;  2W90 A;  3GF3 A;  4KT0 J;  4U3F E;  2Q3I A;  1LTG C;  5KAF E;  5KKZ C;  1GD2 E;  2LKM A;  2PGD A;  3AEE C;  2KLU A;  3NFQ A;  3L72 J;  1VQ9 P;  4M3L A;  1LT9 A;  3H1H D;  3L75 G;  2NPS D;  3L72 G;  1USD A;  1FZF A;  2O01 H;  2A45 G;  2K9J B;  3WMM 0;  1FJK A;  3CC4 P;  1NU1 D;  5CCH A;  3O6Q A;  3L70 G;  4HH2 A;  3QWO C;  5M1B A;  3H1H G;  3CCV P;  1S2E A;  3GHG A;  1SQP J;  2ZT9 D;  1G1I A;  3H1H J;  3Q5R A;  3Q2Y A;  1QVF O;  2AXT H;  4L75 A;  2N9B A;  4OGQ B;  3TDK A;  5GTI H;  2WT7 A;  1RF1 B;  1RF0 C;  3B5N C;  1NTM J;  1IFD A;  1NOH A;  2Q5U A;  5KJ7 A;  1VQ5 P;  1ZV8 A;  2K1A A;  4PJ0 H;  3UIA A;  3Q5P A;  2H88 C;  3FWN A;  2ITA A;  3L71 D;  1MZ9 A;  1NTK K;  3K5B A;  2BCC D;  1HVV A;  1XTG B;  1L0L E;  5AVU B;  1L0N J;  1SQQ E;  2B9B A;  1NVO A;  2FYU K;  2IFN A;  3JC2 2;  2O3J A;  3H1J J;  4N3Y B;  1NTZ G;  3KYQ A;  3AEF C;  5APU A;  1Q90 D;  2A45 I;  2M5A A;  4RO0 A;  5TJH A;  3TGU E;  1VQO P;  5AVT B;  3H1I J;  5EFW B;  2P58 A;  1L0L D;  1FBM A;  1S5L H;  2HPC B;  1JY2 P;  2JWD A;  2OYO A;  3SFE C;  4ASV A;  3L37 A;  4H13 D;  1YQ4 C;  1FS0 E;  2KB7 P;  2RMZ A;  1Y8A A;  1SQB D;  5AW0 B;  3H1J G;  3E1I A;  1ZP0 C;  1E5W A;  1BE3 J;  1XTC C;  3BAS A;  3AEC C;  2D2C C;  3CXH I;  3L36 A;  4NPF X;  3CXH E;  4UB8 H;  4ZMD A;  4JQ0 D;  2OYI A;  3L71 J;  2E42 A;  3V4W A;  1KFM A;  1LT9 C;  5AVZ B;  1H0T B;  1LWU C;  3KQG A;  2OTK E;  2KXP B;  3TF5 A;  4IFM A;  2NRG A;  1SQV D;  2Y9Y A;  3L73 D;  3O8Z A;  3P8C E;  3A0H E;  4H44 D;  2FYN C;  1IJD B;  2QEX P;  3TSI A;  1Q82 Q;  1PP9 E;  3GG2 A;  2JR8 A;  2JP3 A;  3HE5 B;  3M91 A;  3ITK A;  3L74 E;  1K8A Q;  1FDI A;  4UB6 H;  1X0T A;  2M3E A;  3S4R A;  1N73 B;  2BAS A;  1K05 A;  4TT3 H;  4W80 A;  4BRY B;  5AW2 B;  3CCL P;  1RF1 C;  4I2L C;  4RES B;  1SQX E;  3MZW B;  4IL6 X;  1IK7 A;  3QH9 A;  4ASW A;  5KAF H;  1LTJ B;  2ZFC A;  3KZI E;  4A7P A;  1NWQ A;  1H8A A;  1FZC C;  2HG5 D;  2YKO A;  1IO4 A;  2E76 D;  2O01 J;  1VPC A;  3P8C D;  4U3F J;  1BGY J;  2AEM A;  2CK3 H;  4XE5 B;  3BAT A;  3SSU A;  3RBZ A;  5B66 E;  4WWI A;  2BCC J;  2WMM A;  1LTI C;  2E74 D;  3M0D A;  3MGN A;  5CJ4 A;  2MJZ A;  2G8Y A;  4GKG A;  2XV5 A;  3L71 G;  5AVQ B;  3SWK A;  1OIP A;  3C1L A;  3BCC D;  1VDF A;  1YBK A;  1K04 A;  4NPD A;  4JF7 A;  1JY3 O;  5KLV D;  2W6A A;  3CC7 P;  3L70 J;  3AE9 C;  1BGY G;  4AQR D;  2AXT E;  5DJU B;  1KN7 A;  2XNX A;  2JO1 A;  1QLE D;  4LC1 A;  1M57 D;  2E5Y A;  1IFJ A;  1SQB K;  3I56 P;  4XFJ A;  3G71 P;  1NGM B;  1AQT A;  1PV3 A;  1SQP E;  3VMX A;  4U3F D;  2OYI C;  4YTP C;  1PGO A;  4PD4 I;  3RK3 C;  1FDM A;  1LT9 B;  1KIL E;  1SQB E;  2FKW B;  2PAJ A;  2A45 H;  4D6T G;  3MP7 B;  2XDJ A;  1SQB G;  4UB6 E;  2WVR A;  3M0A A;  3PRJ A;  1YIT P;  1SQV K;  1NTZ K;  1VF5 C;  1RY3 A;  1KTM A;  2KS1 B;  2ZJS E;  2LR2 A;  5APQ A;  2FBW C;  3A3Y B;  1VQP P;  2E43 A;  2IBZ G;  1SVF A;  3AE2 C;  5KLV J;  1RE4 C;  3KZI H;  2SPZ A;  5DJT B;  4OGQ C;  1NTK G;  1RE3 C;  2L91 A;  4H0L D;  3VP9 A;  3VYI A;  5K5G B;  2WZ7 A;  4W7Z A;  2E75 C;  5AW3 B;  1JEK A;  5AVR B;  1P84 H;  3A5T A;  4L74 A;  2C9L Y;  1MUU A;  2YIU C;  4R4L A;  3CX5 I;  3ABV C;  5CMZ A;  3AE1 C;  2ZT9 C;  3VMY A;  1ZR2 A;  1KC8 Q;  2C9N Y;  3M06 A;  2YNY A;  1VF5 B;  3AE4 C;  3CI9 A;  3OAK A;  2GUV A;  4ZKU A;  1EDI A;  2ZYD A;  5AVY B;  3TYY A;  1W2B O;  3V2R A;  1PP9 D;  3AEB C;  5KJ7 D;  1SQQ K;  4W7Y A;  5KKZ B;  2W8Z A;  2IBZ I;  1OVV A;  2D2C D;  1NTK E;  1PGJ A;  3T97 B;  2FYN B;  2V7Q H;  3PJS K;  3R2P A;  1U7J A;  3HTK A;  1DX7 A;  1L0N E;  1SQQ J;  2WSF J;  3SWF A;  1KB9 E;  3KDP B;  1JO5 A;  3E1R A;  1NTZ D;  2HPC A;  1VQ6 P;  2XKM A;  2BEZ F;  4TLF A;  1PP9 G;  3TGU J;  2OYH A;  3CCS P;  1SQX D;  2QJY C;  1PP9 J;  3CWB G;  2E76 C;  4O9B A;  3PP5 A;  3TNU A;  1N7S A;  4D6T E;  2OAR A;  3M0D C;  2QJP C;  3Q1M A;  1SQV J;  3L73 J;  2DW3 A;  1GL2 D;  4BXL A;  2W83 C;  3GW6 A;  1KV4 A;  2YXR B;  1VF5 D;  3PH0 A;  2N9Y B;  3RK2 B;  3KPE A;  4OH8 B;  3MHV A;  3PHL A;  1KQS O;  2OYH B;  3V5B A;  1GDT A;  2QSI A;  1PGQ A;  3E7K A;  3G3Z A;  5AW1 B;  3RBX A;  2QVA A;  3HE5 A;  3HTK B;  4C46 A;  1RF1 A;  3CWB J;  1JM0 A;  1LTT C;  2ZXE B;  2LXB A;  3B71 A;  2HR3 A;  5KAI E;  3T97 A;  1NTZ J;  5BVZ A;  3BCC G;  1LTA C;  1M8O B;  3FXE A;  5L8R J;  1L4A C;  4EIJ A;  2R44 A;  1QGK B;  3IR9 A;  4DZO A;  2NPS B;  3KHU A;  3O6Q B;  4YXW H;  5GTH E;  4PV1 B;  1EDJ A;  4HKZ H;  2Q7C A;  3L74 J;  3CME P;  1SQQ G;  3NMD A;  4OVN F;  1EZV I;  2JWA A;  3A0H H;  1LP1 A;  5AW8 B;  3U1A A;  2PP6 A;  3HRN A;  4H13 C;  3CCQ P;  3TGU G;  4DT0 A;  4C7N A;  5CCG A;  3CCR P;  1IFN A;  1M1J A;  3D71 A;  1KB9 H;  2WSS H;  2RH0 A;  3VMZ A;  3VOP A;  1URQ A;  3L70 D;  3HD7 C;  4OGQ D;  3CCM P;  3L74 G;  1KFN A;  1SQB J;  2LXC B;  3CL3 D;  2H43 A;  4JYC A;  3H1H E;  1BE3 D;  1KYO E;  2WSE H;  5KAI H;  1LNQ A;  1NTK D;  2Y0E A;  1AVO A;  5CJ0 A;  3A0B E;  1HH0 A;  2N1T D;  2YXQ B;  1FZA A;  4WVZ A;  3L35 A;  1LT1 A;  1P84 E;  3S1K A;  1KYO D;  4EI2 A;  2I8D A;  2WSC J;  3L75 E;  2HFE D;  4JYB A;  2HLO A;  5APY A;  3KXD A;  1NAF A;  3H1J E;  4H44 C;  4WY4 B;  1URQ D;  2B87 B;  1M1J B;  4C7N B;  2B87 A;  2IYP A;  3L72 D;  4GOD A;  4U3F G;  1KD1 Q;  1RE3 A;  2W6J H;  3LW5 H;  5AW4 B;  1L0L K;  5GTH H;  1L2P A;  3OW2 O;  1GU5 A;  2BEQ D;  2Z5I A;  1PFI A;  1EDL A;  1S9K D;  1YQ3 C;  1VQL P;  1VQ8 P;  3HUS C;  4RKU J;  2ZVO B;  1IK9 A;  2OTL P;  3RK2 C;  1R5S A;  5BU5 A;  2J58 A;  2O01 N;  3AE6 C;  4I6M C;  1DH3 A;  1T6A A;  1FJP A;  1RQV A;  4H44 B;  4WY4 C;  1S5L X;  1YHQ P;  1LWU A;  3GMA A;  3BCC E;  3R4Y A;  1M7L A;  2QJK C;  2K9Y A;  1EXI A;  2QIW A;  1T2K D;  1ZR4 A;  2Z4E A;  1A02 F;  1MKM A;  4GDO A;  2Q1K A;  2OYH C;  4JPZ B;  3H32 A;  5CCG D;  1BDD A;  2NZ2 A;  5AVX B;  1JY3 N;  2WWW A;  1NKZ B;  3A0B H;  1S9K E;  2PRR A;  1IC2 A;  2POH A;  2YO2 A;  1ZLL A;  2IBZ D;  4IFD K;  3BRV B;  3HE4 B;  1T3U A;  3CLQ A;  3L70 E;  2VRS A;  1G2C A;  2A06 D;  3II6 A;  1YIJ P;  5CBO A;  1BDC A;  1USE A;  1CZQ A;  2E5T A;  1M1J C;  2C0X A;  1BCC E;  3CWB E;  5E79 H;  1L4A B;  3H1I G;  3JCU H;  4BWN A;  1EDK A;  2IBZ E;  2OYI B;  1NTZ E;  2E74 B;  2FFD B;  3G6E P;  2G3A A;  1CI6 B;  1L0L G;  2ZAE B;  3F5H A;  1HTL C;  1N8R Q;  1H89 A;  4CPG A;  1SQP K;  1L4A A;  1PIX A;  2FYU J;  4EYY Q;  1GK6 A;  5KLV K;  1BE3 G;  1BGY D;  3H1K E;  2KNC A;  1MFT A;  4RJT A;  1FZC A;  1NU1 K;  1G2C B;  1BE3 E;  2E75 D;  3OA7 A;  3TK1 A;  4PV1 D;  1MFZ A;  1KIL A;  2M3B A;  2M5A B;  2N1T C;  3L74 D;  1M1K Q;  1KYO H;  3RL0 D;  1L0L J;  3CX5 E;  2QA4 P;  1NU1 J;  1OFC X;  4IFF A;  5BU8 B;  3LIE A;  3RGU A;  4Y28 J;  3CC2 P;  3SFD C;  2GUS A;  2YIU B;  3RK3 B;  3V4Q A;  4K3A A;  3WU2 H;  1HWT C;  2OTJ P;  2FYU G;  1T3J A;  1AV1 A;  3BRT B;  2P10 A;  1SFC C;  1PL5 A;  3H1I E;  5APW A;  1R5L A;  5H2F H;  4B86 A;  5CBN A;  4H13 B;  1FC2 C;  4KHX A;  1X9V A;  1ZRT D;  1SP4 A;  3HD7 D;  1N7S C;  2WT7 B;  3L72 E;  1JUN A;  1EZV D;  1AFO A;  1TU3 F;  4DJG A;  3GHG B;  3LW5 J;  1NYH A;  1FAV A;  2IX7 C;  1YTZ I; 
#chains in the Genus database with same CATH homology
 1BGY G;  2BCC G;  1NTZ G;  1L0N G;  1BE3 G;  1EZV G;  3L75 G;  3L72 G;  1SQV G;  3BCC G;  3L73 G;  1NTM G;  3CXH H;  1KYO H;  4D6T G;  1SQB G;  1PPJ G;  3H1L G;  3L70 G;  1SQX G;  4PD4 H;  1NU1 G;  1SQQ G;  2A06 G;  1SQP G;  1PP9 G;  2FYU G;  3H1H G;  3H1J G;  5KLV G;  3H1K G;  3TGU G;  4U3F G;  3CWB G;  2IBZ G;  1KB9 H;  1NTK G;  3CX5 H;  3H1I G;  3L71 G;  1BCC G;  1P84 H;  1L0L G;  3L74 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...