3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
1NU1G 3L71G 3TGUG 1KB9H 1NTMG 1PPJG 1BGYG 2FYUG 4D6TG 3L73G 3L75G 1NTZG 4PD4H 3H1HG 3H1IG 1SQPG 3CX5H 1L0NG 1BCCG 3L70G 4U3FG 1L0LG 2BCCG 1BE3G 1SQVG 2A06G 3H1JG 1SQBG 1EZVG 3CXHH 1NTKG 3CWBG 1KYOH 1SQQG 3H1KG 2IBZG 3L74G 1SQXG 3BCCG 3H1LG 1PP9G 5KLVG 3L72G 1P84H
chains in the Genus database with same CATH superfamily
1K05A 3CCEP 3AE9C 5CMZA 4WY4B 2AXTE 1SQXK 3C9IA 1NU1K 3FWLA 3MHVA 3U1AA 3TYYA 1NTKD 1MUUA 4NPEA 3LW5J 3L74J 1L0LK 1KB9H 2WSCH 5CCHA 2K1AA 3RK3D 3WUUA 1NGMB 2IBZG 1NKZB 1KILB 1FZGA 5APXA 4Y28J 3G9RA 2M3EA 3A7OA 3B5NA 1Q82Q 1NO4A 2YNYA 1FE6A 2P7JA 2P10A 3V4WA 3QWOC 2E74B 1DD3A 2C9LY 2B89A 3V4QA 5CBNA 2JEEA 1L2PA 1JMBA 2JP3A 3RL0C 1GMJA 3AECC 2OYOA 2B88A 4DZOA 2A45G 1OWAA 2LKMA 3O8ZA 3GF7A 3M9BA 3SWKA 2ZT9B 2SPZA 2KS1A 3V5BA 1QEXA 1JUNA 3HE5A 2KLUA 3H1HG 3AE3C 2PP6A 2HODA 4GIFA 4WWIA 3EFGA 3A0BE 5AVZB 1EXIA 4DT0A 3H1KD 1DX7A 1YJ9P 1EDKA 3PTZA 5AW0B 1RQUA 2D2CD 1IFDA 1N7SC 4N6JA 3OA7A 5KLVE 1QX8A 4C7NB 4I6MC 3BCCG 2Y9YA 1LTSC 2ZXEB 1SFCA 3H32B 1CI6B 1M1KQ 1FZBA 1NTMD 4RKUJ 2YMKA 1VL2A 1JEKA 2PRRA 2JO1A 1URQC 2W6BA 4O9BA 3MP7B 3MD0A 1DIPA 2L5GB 1T2KD 2QSIA 3RK3B 2JJLA 1PGJA 3IN6A 1MFTA 5AVVB 1RF0C 3SWFA 1GTWA 3NTNA 2O01J 3MUDC 5KJ7D 1Q2NA 1BGYE 3RL0D 1IK9A 2HPCA 2YIUB 3NFQA 5K5GB 2QJYC 3ZDMA 2KSJA 4PJ0E 1W2EA 1J1EC 2PFXA 3GMAA 4L76A 1MV8A 5H2FH 3A3YB 3CCMP 5TISE 1VQ6P 3FGAD 1KMIZ 2OYIC 1GU4A 4DCKA 5AVQB 3M0DA 3JC22 2BEZF 3H1JG 3VMYA 2BASA 3BVHA 3M9HA 1LWUC 4HJGH 2ZFCA 1P84H 1D7MA 2WVRA 5KLVD 2QIWA 1SQPE 2ZAEB 2ZYAA 1FDOA 1FZAA 4YXWH 3WUTA 3H25A 2I1KA 1RY3A 1YJWP 2V4HA 1NH4A 2BCCG 3G3ZA 1S9KE 1OX3A 1SQQG 4EIJA 4K3AA 3TGUE 1M1JA 3AE2C 5KTBA 3USSA 1PPJG 2P67A 1A02F 2Q5UA 2D2CB 1URQD 3AE7C 1JNMA 2YKQA 1LJ2A 2QM7A 4A7PA 2AXCA 2Q3EA 3AE8C 2N9YB 4GOEA 3L4FA 3P7KA 5GTIH 3KYQA 2WT7A 1FJPA 1BGYD 1BSNA 3M9QA 3HTKB 1HGVA 4ASWA 2B87B 2KZIA 4BRYB 1BDCA 1N2DC 1PP9E 1N73A 2W6JH 3H1JJ 5TJHA 2FYZA 1PV3A 3O6QA 2V7QJ 3CWBE 1VPCA 1K73Q 4UB6E 2BCCJ 2O3JA 5B5EE 2OYHA 1IFMA 1H0TB 3RL0B 2IFMA 5CCHC 2KNCA 3H6PA 2VRSA 1PGPA 1SQPD 2E76D 4EOTA 4EYYQ 3GHGC 1HWTC 4R4MA 3Q5PA 3F5HA 1AVOA 1S9KD 1KD1Q 2AEJA 5APYA 1HTLC 2Y0DA 1GK6A 4JYCA 3TGUD 1M8OB 5AVTB 3RK2C 1LT9A 1WRGA 1SQXE 1NTZJ 1SQBG 1GK4A 5AVWB 3CCLP 1NU1E 2WITA 1LTIC 3P32A 3M0AA 2YXQB 1JCDA 2GA1A 3L75E 1AJYA 3KQGA 1S72P 1N7SB 5BU8B 4U3FE 1L0LE 1HUCA 1WMKA 3A2AA 1IFNA 1BE3G 1FZCB 2C9NY 2YO3A 1YBKA 3L72G 2XKMA 2WSCJ 4AUWA 3L73E 1PP9D 2OQQA 2W6AA 2J5UA 3V2PA 1KYOE 1PFIA 3CMAP 1HBWA 3L71D 3CC4P 1J1DC 1PZQA 1URQB 1MZ9A 2KSEA 1VQLP 3OJAB 2GM4A 1L0ND 2JDIH 1YI2P 1EZVG 1GU5A 4WB4A 3CWBD 3RL0g 3D6ZA 3AEBC 3RBXA 1NTZK 1QLED 3AE1C 2M5AA 2E43A 4B86A 1EDIA 1OW6A 2OTJP 1GL2A 3PH0A 5KKZC 2QG4A 3L74E 5CCHD 1PL5A 1NTKG 1RE3C 5GTHH 2QJYB 4TT3H 1Q86Q 1CW5A 3AEDC 1M7LA 3L37A 1J1EB 1SQVE 1H89A 1LTAC 2KYVA 5APWA 1K9MQ 1GD2E 1SLQA 4CPGA 4YTPC 2UWJE 2OYIB 1BE3J 2E75C 3TNUB 1YTZI 3FWNA 4WY4A 1Q81Q 1FZFA 4IL6E 1NWQA 3RK2D 2Z5IA 1S3JA 1NU1D 2FYUG 1LWUB 5EFWB 3HRNA 1JM0A 1LTJA 4H13C 3L75D 1ZV8A 1VQMP 2O1JA 3IF4A 4U3FD 1L0LD 1YQ4C 1KN7A 2Y9ZA 3OAKA 2QVAA 1G2CB 2W27A 2WSEH 2N1TA 1JY2P 4AQRD 1KV4A 1JY2N 1KILA 1KYOD 1K04A 3CI9A 1X8YA 1DEEG 1U7JA 3VMAA 3L36A 2D2CC 3CMEP 2Z5HA 3H1LD 2WPVB 4PD4D 1EC5A 4NPDA 3PHLA 2OTLP 1HGZA 2ZVOB 1LP1A 3CCJP 2Q1KA 1R5LA 2IBZE 2WZ7A 3HE4B 3V2QA 4GOFA 3H1KG 1RQVA 1E79H 1KQGB 2JKVA 3K5BA 3L74D 3QH9A 3AE5C 1L4AC 2QJPC 5APSA 1A02J 3I5CA 3L70E 2K3RA 4UB6H 4L74A 2HYNA 1IJDB 2FYUJ 5CJ0A 2NZ2A 1T2KC 3IAOA 2KB7P 4L73A 1SQVD 2NPSC 2IBZI 2KXPB 1NTMG 2WSFJ 3FXDA 2R3SA 2ZJSE 5KJ7C 3Q1MA 2E75D 4IFFA 1VDFA 2XZRA 2KK7A 2IFNA 4H13D 4N3YB 2H89C 1FDMA 3GHGB 3H1IE 5AW2B 2JR8A 3FXEA 4N78E 5AVSB 1N73C 1EXJA 3AEGC 3CCRP 1CI6A 2E5TA 3RGUA 3CCQP 4DJGA 2FYUK 1ZRTE 3CLQA 3CCVP 3N7NA 3RK2B 3H1KJ 4OGQC 5KAFH 2A45I 3FX0A 3BASA 2MKVA 3AEAC 2G8YA 3JCUE 1QGKB 3BRTB 2XV5A 2OYHC 1KYOH 5L8RJ 2MJZA 4TLFA 3KXDA 1KTMA 3HUSC 1JY3P 1JTHB 1FZCC 1GW4A 1JY3N 4ZMDA 4PD4H 2R32A 3W68A 3B71A 1NTMJ 1ZOYC 2KS1B 1PGQA 5AW5B 3HE5B 2K88A 3L70D 1L4AD 3CXHI 1VQPP 5DJTB 4ASVA 2Y0EA 2JWAA 2ZVNB 3G6EP 3KPEA 1BSHA 1J1DB 3Q5RA 5CJ4A 1ZW0A 2XNXA 3ITKA 3UIAA 3L35A 4OVNF 1BCCG 3PJSK 1FOSF 3H1HJ 2NPSD 1RF1A 4UB8E 4MN4C 2FFDA 3F89A 4D6TE 5KKZB 1N86A 2IX7C 1LTGC 1PGOA 4W7ZA 1S2EA 2M8RA 1NOHA 3H1ID 2XDJA 4IL6H 1YHQP 4N78D 1NTMK 1S5LH 3CD6P 2FYNC 3BATA 4KT0J 1UIIA 3BCCJ 4Y99C 1BGYG 2GUSA 5B66E 2E75B 4XFJA 3II6A 4OGQD 2KOGA 4NPFX 4H13B 2E76C 2AXTH 1Q90D 5AW3B 2BCCE 2C0XA 1ZXGA 1HVVA 2QE7H 2HPCB 1J2JB 1NAYA 1BCCJ 5CCGA 2J59M 1VF5C 3A5TA 3OW2O 1AFOA 3PP5A 2IZ1A 2WPSA 4EI2A 3W67A 3G4SP 2B87A 1AV1A 1CZQA 2YKPA 2YMYA 1U57A 2CK3H 1DH3A 3HD7A 1SQPG 2FXPA 3MTUE 5CHXA 4QMAA 3BRVB 1DEBA 3MZWB 1IC2A 1VQNP 2ZXXA 3TGUG 1NTZE 2RKLA 1LTJC 4BWNA 2LR2A 4H44D 1VQKP 4D6TD 3P8CE 1L4AB 1NJIQ 2QJPB 3NMDA 1OFCX 2N1TC 2QEXP 3U59A 4I7ZC 2J58A 3CC2P 1AQ5A 2A06E 4K35A 3E1RA 1M1JB 2NPSB 1KILE 3V2NA 2LXCB 3VN0A 3AEFC 1PP9G 5KAIE 1SQQJ 3L71G 2H88C 1HJ0A 3A0BH 4IFMA 2HR3A 1KFNA 1L0NG 2I8DA 3Q3DA 1RE4A 2W83C 2HFED 3B8EB 3CWBG 1N7SA 2Q6QA 2YKOA 1N8RQ 1N73B 1KB9I 3SSUA 5AW8B 2R44A 3B5NC 1LNQA 1X79B 1VF5D 1USDA 2FY8A 4OGQB 1DD4A 3VMXA 1H88A 1RH5B 2K9JA 3O6QB 5AW4B 2POHA 4HB1A 2WSEJ 5AW6B 2AEFA 2RMZA 2OYHB 4H0LC 4WY4D 3G71P 2R5DA 1SQQK 2KNCB 1NTZD 2O01N 3HUSB 1RF0A 1JOCA 2Y0CA 1KC8Q 4OH8B 3P8CD 1EDJA 4U7JA 5KLIC 4HYTB 1NU1G 1PP9J 5E79E 1Y9BA 3L75G 3L71J 4UB8H 2G3AA 4U3FG 1EZVE 1L0LG 3TF5A 1QL1A 2N1TD 1L0NJ 2A06D 1OXZA 2IDBA 1QVGO 3EFFK 4JYBA 4KHXA 1YITP 3EQ2A 1Z56A 1OW7A 4PJ0H 1IFIA 3TNUA 2H7HA 1OVVA 2B9BA 5TISH 5AVYB 1LTBC 1LWUA 3H1LG 3EWKA 1IK7A 2WMMA 1SQBJ 3RK3E 1SFCC 1EZVI 2E5YA 1KQFB 3IFMA 5M1BA 2FYNB 1S4XA 3C1LA 4C7RA 1G2CA 2YO2A 3T97B 4Y99B 5APTA 1VQ8P 3L74G 1QVFO 2C0WA 1AVYA 4GT1A 1XTCC 2NRGA 1SQXD 3B5ND 2FYUE 1L0NK 2IZ0A 3L72J 2FBWC 1H8AA 2KZJA 3KHUA 2E76B 3L75J 1CSBA 3Q5SA 2PAJA 4EDFA 2M5AB 1SQVG 1LTTC 1RF1C 4U3FJ 3TDKA 1L0LJ 1FDIA 5APVA 4ZKPA 2FFDC 4H0LD 1YQ3C 1YIJP 3WU2E 3CCUP 1GZLA 1S5LX 5H2FE 1VF5B 1SQBK 3L73D 3U1CA 1UIXA 2L91A 1K8AQ 1EZVD 1NTKJ 3P8MC 1VQ9P 3D70A 3H1LJ 2YXRB 1NVOA 4I1LA 1VQOP 1FS0E 3LIEA 1OMIA 1P84E 2JWDA 3R4YA 3M0DC 4JQ0D 2E42A 3A0HE 4RO0A 3H1KE 4W80A 4ZNCA 1ZLLA 1LTJB 3KZIE 4DOJA 4I2LC 2Q9IA 4LC1A 4KJMA 5B5EH 1T6AA 2OARA 2LXBA 2N1TB 5CCGC 5BVZA 1NHLA 5KAIH 1SFCD 1GW3A 2WPRA 4I7ZB 3GHGA 3LIDA 1SQVJ 3AE4C 1NTME 1P84I 4WVZA 1M1JC 3HD7C 2FYUD 4R4LA 1NTKK 3L70G 5GTIE 2PGDA 1LP1B 1JMMA 4L75A 2K37A 4XA4A 3GF3A 3H1HE 4JPZB 2FXOA 4C7NA 1HF9A 3M06A 1G1JA 5AW7B 1KQSO 2WQYC 1JTHA 1SVFA 4Z1MH 3H32A 1SS1A 2IPPA 3B5NB 2KUBA 4YPCA 1ZR2A 2QRXA 3CXHE 2N9BA 1MKMA 1SQVK 2DW3A 3R2PA 3H1IG 1SP4A 3BCCE 3PLNA 1P84D 1OVUA 5E79H 4H0LB 1OIPA 2I1JA 2IBZD 3ABVC 2O1KA 1NAFA 4LLHA 2HLOA 1Y47A 2Q3IA 3KDPB 3CC7P 1RE4C 1JCCA 5KLIB 1USEA 4XE5B 1R5SA 3L70J 4BXLA 2ZYDA 1VQ4P 1RE3A 2W8ZA 2HODB 5KLVG 1QL2A 2Q7CA 5CCGD 3LW5H 1BCCE 1Y8AA 1BDDA 1X22A 1LT9C 2KI7B 1FU1A 4H44C 1MFZA 3HD7D 1FAVA 2ITAA 3S4RA 1YTZT 3CL3D 2IYPA 2QM8A 4PV1C 5BU5A 1VQ5P 1EDLA 2P1JA 3N4XA 1KZUB 1JY2O 3H1HD 1SFCB 1IFJA 3H1IJ 4W7YA 5APUA 1JB0J 1PIXA 4GODA 3NXSA 4D6TG 1ZRTD 2WSFH 1AA0A 3H1JE 1ZR4A 3CXHD 3B4SA 4HH2A 3WU2H 4WBAA 5AW1B 1HJBA 1TU3F 3BCCD 3MGNA 1ZMEC 1HH0A 2RH0A 4IFDK 5KLVJ 1RF1B 1ZN5A 1LT1A 4OWFA 5GTHE 2FFDB 1YJNP 1GL2C 3VP9A 1VQ7P 2KP8A 1SQQE 2H43A 3SFEC 3C8VA 3CX5E 2R3CA 3VTPC 2QJKC 1PPJE 3V6IA 3A0HH 1Q7YQ 3GW6A 1L4AA 1FC2C 4AYCA 3HTKA 1N7SD 4BRYA 3KZIH 2W90A 1BCCD 2K9YA 5DJUB 3S9OA 2KIKA 4WY4C 1FBMA 1WT6A 3S1KA 1IO4A 1U7MA 5APQA 4RESB 2NPSA 3GLMA 1ZP0C 5AVUB 3CX5I 5KJ7A 4D6TJ 1E5WA 1BGYJ 5KLVK 1H0TA 4M3LA 3WMM0 2WSSH 4PV1D 3AEEC 1AQTA 4ZKUA 1M56D 5AW9B 2XNDH 2A45H 1FZEA 1KILC 1NTZG 4RJTA 3Q2YA 3MIWA 1KB9E 3HD7B 1W5CE 3H1JD 3E1IA 3L71E 2RN0A 1M90Q 1NKNA 1W2BO 2O01H 3VOPA 1KQLA 1L0NE 1JY3O 3TSIA 2QA4P 4YXDC 2E74C 2A06G 2BCCD 1SQPJ 2WT7B 3CXHH 1SQQD 2KLVA 2HG5D 1KFMA 2OTKE 3JCUH 3JSVC 1T8ZA 1GL2D 3HUSA 3CX5D 2P2UA 1X0TA 1FZCA 1PPJD 3TGUJ 1T3UA 1RHZB 1SQBE 2ZT9C 3E7KA 3RBZA 2AEMA 2ZYGA 3D6YA 2IYOA 2XU6A 3D71A 1URQA 3VMZA 1FOSE 1FJKA 1BE3E 2CPBA 2FXMA 1OZHA 2GUVA 1NYHA 4C46A 3L72E 1SQXG 2Z4EA 2FKWB 1OVRA 1EQ7A 3MUDA 1SQPK 1S1CX 2BEQD 1IFPA 1T3JA 5KAFE 1R8EA 3I55P 3IR9A 1KB9D 1KILD 1LT9B 3CWBJ 2K9JB 1OW8A 2R5BA 3PRJA 3CCSP 2OGUA 4H44B 3L73G 3T97A 2WWWA 4JF7A 2OYIA 4GKGA 5C39A 5AVXB 4JBZA 1NTKE 5AVRB 3SFDC 3H1LE 4PV1B 4PD4E 3RK3C 4HKZH 2M3BA 4IOIH 5B66H 2E74D 1X9VA 1G1IA 3V2RA 3WUVA 3VYIA 2P58A 4GDOA 2V7QH 4LGDE 3I56P 1KYOI 2YIUC 1SQBD 2WPQA 1SQXJ 2ZT9D 3VP8A 5CBOA 3TK1A 4PD4I 1IZNB 3M91A 1NU1J 3CX5H 1BE3D 2H8PD 2CPSA 1GL2B 1KORA 2M0BA 4IL6X 3L72D 2WTYA 1LGHB 1S5LE 1XTGB 3HE4A 1JO5A 3CPWO 1M57D 2QJKB 3L73J 3SWYA 3GG2A 1GDTA 1YYCA 1N7LA 3AE6C
chains in the Genus database with same CATH topology
1NU1G 3L71G 3TGUG 1KB9H 1NTMG 1PPJG 1BGYG 2FYUG 4D6TG 3L73G 3L75G 1NTZG 4PD4H 3H1HG 3H1IG 1SQPG 3CX5H 1L0NG 1BCCG 3L70G 4U3FG 1L0LG 2BCCG 1BE3G 1SQVG 2A06G 3H1JG 1SQBG 1EZVG 3CXHH 1NTKG 3CWBG 1KYOH 1SQQG 3H1KG 2IBZG 3L74G 1SQXG 3BCCG 3H1LG 1PP9G 5KLVG 3L72G 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 G;  3L71 G;  3TGU G;  1KB9 H;  1NTM G;  1PPJ G;  1BGY G;  2FYU G;  4D6T G;  3L73 G;  3L75 G;  1NTZ G;  4PD4 H;  3H1H G;  3H1I G;  1SQP G;  3CX5 H;  1L0N G;  1BCC G;  3L70 G;  4U3F G;  1L0L G;  2BCC G;  1BE3 G;  1SQV G;  2A06 G;  3H1J G;  1SQB G;  1EZV G;  3CXH H;  1NTK G;  3CWB G;  1KYO H;  1SQQ G;  3H1K G;  2IBZ G;  3L74 G;  1SQX G;  3BCC G;  3H1L G;  1PP9 G;  5KLV G;  3L72 G;  1P84 H; 
#chains in the Genus database with same CATH topology
 1K05 A;  3CCE P;  3AE9 C;  5CMZ A;  4WY4 B;  2AXT E;  1SQX K;  3C9I A;  1NU1 K;  3FWL A;  3MHV A;  3U1A A;  3TYY A;  1NTK D;  1MUU A;  4NPE A;  3LW5 J;  3L74 J;  1L0L K;  1KB9 H;  2WSC H;  5CCH A;  2K1A A;  3RK3 D;  3WUU A;  1NGM B;  2IBZ G;  1NKZ B;  1KIL B;  1FZG A;  5APX A;  4Y28 J;  3G9R A;  2M3E A;  3A7O A;  3B5N A;  1Q82 Q;  1NO4 A;  2YNY A;  1FE6 A;  2P7J A;  2P10 A;  3V4W A;  3QWO C;  2E74 B;  1DD3 A;  2C9L Y;  2B89 A;  3V4Q A;  5CBN A;  2JEE A;  1L2P A;  1JMB A;  2JP3 A;  3RL0 C;  1GMJ A;  3AEC C;  2OYO A;  2B88 A;  4DZO A;  2A45 G;  1OWA A;  2LKM A;  3O8Z A;  3GF7 A;  3M9B A;  3SWK A;  2ZT9 B;  2SPZ A;  2KS1 A;  3V5B A;  1QEX A;  1JUN A;  3HE5 A;  2KLU A;  3H1H G;  3AE3 C;  2PP6 A;  2HOD A;  4GIF A;  4WWI A;  3EFG A;  3A0B E;  5AVZ B;  1EXI A;  4DT0 A;  3H1K D;  1DX7 A;  1YJ9 P;  1EDK A;  3PTZ A;  5AW0 B;  1RQU A;  2D2C D;  1IFD A;  1N7S C;  4N6J A;  3OA7 A;  5KLV E;  1QX8 A;  4C7N B;  4I6M C;  3BCC G;  2Y9Y A;  1LTS C;  2ZXE B;  1SFC A;  3H32 B;  1CI6 B;  1M1K Q;  1FZB A;  1NTM D;  4RKU J;  2YMK A;  1VL2 A;  1JEK A;  2PRR A;  2JO1 A;  1URQ C;  2W6B A;  4O9B A;  3MP7 B;  3MD0 A;  1DIP A;  2L5G B;  1T2K D;  2QSI A;  3RK3 B;  2JJL A;  1PGJ A;  3IN6 A;  1MFT A;  5AVV B;  1RF0 C;  3SWF A;  1GTW A;  3NTN A;  2O01 J;  3MUD C;  5KJ7 D;  1Q2N A;  1BGY E;  3RL0 D;  1IK9 A;  2HPC A;  2YIU B;  3NFQ A;  5K5G B;  2QJY C;  3ZDM A;  2KSJ A;  4PJ0 E;  1W2E A;  1J1E C;  2PFX A;  3GMA A;  4L76 A;  1MV8 A;  5H2F H;  3A3Y B;  3CCM P;  5TIS E;  1VQ6 P;  3FGA D;  1KMI Z;  2OYI C;  1GU4 A;  4DCK A;  5AVQ B;  3M0D A;  3JC2 2;  2BEZ F;  3H1J G;  3VMY A;  2BAS A;  3BVH A;  3M9H A;  1LWU C;  4HJG H;  2ZFC A;  1P84 H;  1D7M A;  2WVR A;  5KLV D;  2QIW A;  1SQP E;  2ZAE B;  2ZYA A;  1FDO A;  1FZA A;  4YXW H;  3WUT A;  3H25 A;  2I1K A;  1RY3 A;  1YJW P;  2V4H A;  1NH4 A;  2BCC G;  3G3Z A;  1S9K E;  1OX3 A;  1SQQ G;  4EIJ A;  4K3A A;  3TGU E;  1M1J A;  3AE2 C;  5KTB A;  3USS A;  1PPJ G;  2P67 A;  1A02 F;  2Q5U A;  2D2C B;  1URQ D;  3AE7 C;  1JNM A;  2YKQ A;  1LJ2 A;  2QM7 A;  4A7P A;  2AXC A;  2Q3E A;  3AE8 C;  2N9Y B;  4GOE A;  3L4F A;  3P7K A;  5GTI H;  3KYQ A;  2WT7 A;  1FJP A;  1BGY D;  1BSN A;  3M9Q A;  3HTK B;  1HGV A;  4ASW A;  2B87 B;  2KZI A;  4BRY B;  1BDC A;  1N2D C;  1PP9 E;  1N73 A;  2W6J H;  3H1J J;  5TJH A;  2FYZ A;  1PV3 A;  3O6Q A;  2V7Q J;  3CWB E;  1VPC A;  1K73 Q;  4UB6 E;  2BCC J;  2O3J A;  5B5E E;  2OYH A;  1IFM A;  1H0T B;  3RL0 B;  2IFM A;  5CCH C;  2KNC A;  3H6P A;  2VRS A;  1PGP A;  1SQP D;  2E76 D;  4EOT A;  4EYY Q;  3GHG C;  1HWT C;  4R4M A;  3Q5P A;  3F5H A;  1AVO A;  1S9K D;  1KD1 Q;  2AEJ A;  5APY A;  1HTL C;  2Y0D A;  1GK6 A;  4JYC A;  3TGU D;  1M8O B;  5AVT B;  3RK2 C;  1LT9 A;  1WRG A;  1SQX E;  1NTZ J;  1SQB G;  1GK4 A;  5AVW B;  3CCL P;  1NU1 E;  2WIT A;  1LTI C;  3P32 A;  3M0A A;  2YXQ B;  1JCD A;  2GA1 A;  3L75 E;  1AJY A;  3KQG A;  1S72 P;  1N7S B;  5BU8 B;  4U3F E;  1L0L E;  1HUC A;  1WMK A;  3A2A A;  1IFN A;  1BE3 G;  1FZC B;  2C9N Y;  2YO3 A;  1YBK A;  3L72 G;  2XKM A;  2WSC J;  4AUW A;  3L73 E;  1PP9 D;  2OQQ A;  2W6A A;  2J5U A;  3V2P A;  1KYO E;  1PFI A;  3CMA P;  1HBW A;  3L71 D;  3CC4 P;  1J1D C;  1PZQ A;  1URQ B;  1MZ9 A;  2KSE A;  1VQL P;  3OJA B;  2GM4 A;  1L0N D;  2JDI H;  1YI2 P;  1EZV G;  1GU5 A;  4WB4 A;  3CWB D;  3RL0 g;  3D6Z A;  3AEB C;  3RBX A;  1NTZ K;  1QLE D;  3AE1 C;  2M5A A;  2E43 A;  4B86 A;  1EDI A;  1OW6 A;  2OTJ P;  1GL2 A;  3PH0 A;  5KKZ C;  2QG4 A;  3L74 E;  5CCH D;  1PL5 A;  1NTK G;  1RE3 C;  5GTH H;  2QJY B;  4TT3 H;  1Q86 Q;  1CW5 A;  3AED C;  1M7L A;  3L37 A;  1J1E B;  1SQV E;  1H89 A;  1LTA C;  2KYV A;  5APW A;  1K9M Q;  1GD2 E;  1SLQ A;  4CPG A;  4YTP C;  2UWJ E;  2OYI B;  1BE3 J;  2E75 C;  3TNU B;  1YTZ I;  3FWN A;  4WY4 A;  1Q81 Q;  1FZF A;  4IL6 E;  1NWQ A;  3RK2 D;  2Z5I A;  1S3J A;  1NU1 D;  2FYU G;  1LWU B;  5EFW B;  3HRN A;  1JM0 A;  1LTJ A;  4H13 C;  3L75 D;  1ZV8 A;  1VQM P;  2O1J A;  3IF4 A;  4U3F D;  1L0L D;  1YQ4 C;  1KN7 A;  2Y9Z A;  3OAK A;  2QVA A;  1G2C B;  2W27 A;  2WSE H;  2N1T A;  1JY2 P;  4AQR D;  1KV4 A;  1JY2 N;  1KIL A;  1KYO D;  1K04 A;  3CI9 A;  1X8Y A;  1DEE G;  1U7J A;  3VMA A;  3L36 A;  2D2C C;  3CME P;  2Z5H A;  3H1L D;  2WPV B;  4PD4 D;  1EC5 A;  4NPD A;  3PHL A;  2OTL P;  1HGZ A;  2ZVO B;  1LP1 A;  3CCJ P;  2Q1K A;  1R5L A;  2IBZ E;  2WZ7 A;  3HE4 B;  3V2Q A;  4GOF A;  3H1K G;  1RQV A;  1E79 H;  1KQG B;  2JKV A;  3K5B A;  3L74 D;  3QH9 A;  3AE5 C;  1L4A C;  2QJP C;  5APS A;  1A02 J;  3I5C A;  3L70 E;  2K3R A;  4UB6 H;  4L74 A;  2HYN A;  1IJD B;  2FYU J;  5CJ0 A;  2NZ2 A;  1T2K C;  3IAO A;  2KB7 P;  4L73 A;  1SQV D;  2NPS C;  2IBZ I;  2KXP B;  1NTM G;  2WSF J;  3FXD A;  2R3S A;  2ZJS E;  5KJ7 C;  3Q1M A;  2E75 D;  4IFF A;  1VDF A;  2XZR A;  2KK7 A;  2IFN A;  4H13 D;  4N3Y B;  2H89 C;  1FDM A;  3GHG B;  3H1I E;  5AW2 B;  2JR8 A;  3FXE A;  4N78 E;  5AVS B;  1N73 C;  1EXJ A;  3AEG C;  3CCR P;  1CI6 A;  2E5T A;  3RGU A;  3CCQ P;  4DJG A;  2FYU K;  1ZRT E;  3CLQ A;  3CCV P;  3N7N A;  3RK2 B;  3H1K J;  4OGQ C;  5KAF H;  2A45 I;  3FX0 A;  3BAS A;  2MKV A;  3AEA C;  2G8Y A;  3JCU E;  1QGK B;  3BRT B;  2XV5 A;  2OYH C;  1KYO H;  5L8R J;  2MJZ A;  4TLF A;  3KXD A;  1KTM A;  3HUS C;  1JY3 P;  1JTH B;  1FZC C;  1GW4 A;  1JY3 N;  4ZMD A;  4PD4 H;  2R32 A;  3W68 A;  3B71 A;  1NTM J;  1ZOY C;  2KS1 B;  1PGQ A;  5AW5 B;  3HE5 B;  2K88 A;  3L70 D;  1L4A D;  3CXH I;  1VQP P;  5DJT B;  4ASV A;  2Y0E A;  2JWA A;  2ZVN B;  3G6E P;  3KPE A;  1BSH A;  1J1D B;  3Q5R A;  5CJ4 A;  1ZW0 A;  2XNX A;  3ITK A;  3UIA A;  3L35 A;  4OVN F;  1BCC G;  3PJS K;  1FOS F;  3H1H J;  2NPS D;  1RF1 A;  4UB8 E;  4MN4 C;  2FFD A;  3F89 A;  4D6T E;  5KKZ B;  1N86 A;  2IX7 C;  1LTG C;  1PGO A;  4W7Z A;  1S2E A;  2M8R A;  1NOH A;  3H1I D;  2XDJ A;  4IL6 H;  1YHQ P;  4N78 D;  1NTM K;  1S5L H;  3CD6 P;  2FYN C;  3BAT A;  4KT0 J;  1UII A;  3BCC J;  4Y99 C;  1BGY G;  2GUS A;  5B66 E;  2E75 B;  4XFJ A;  3II6 A;  4OGQ D;  2KOG A;  4NPF X;  4H13 B;  2E76 C;  2AXT H;  1Q90 D;  5AW3 B;  2BCC E;  2C0X A;  1ZXG A;  1HVV A;  2QE7 H;  2HPC B;  1J2J B;  1NAY A;  1BCC J;  5CCG A;  2J59 M;  1VF5 C;  3A5T A;  3OW2 O;  1AFO A;  3PP5 A;  2IZ1 A;  2WPS A;  4EI2 A;  3W67 A;  3G4S P;  2B87 A;  1AV1 A;  1CZQ A;  2YKP A;  2YMY A;  1U57 A;  2CK3 H;  1DH3 A;  3HD7 A;  1SQP G;  2FXP A;  3MTU E;  5CHX A;  4QMA A;  3BRV B;  1DEB A;  3MZW B;  1IC2 A;  1VQN P;  2ZXX A;  3TGU G;  1NTZ E;  2RKL A;  1LTJ C;  4BWN A;  2LR2 A;  4H44 D;  1VQK P;  4D6T D;  3P8C E;  1L4A B;  1NJI Q;  2QJP B;  3NMD A;  1OFC X;  2N1T C;  2QEX P;  3U59 A;  4I7Z C;  2J58 A;  3CC2 P;  1AQ5 A;  2A06 E;  4K35 A;  3E1R A;  1M1J B;  2NPS B;  1KIL E;  3V2N A;  2LXC B;  3VN0 A;  3AEF C;  1PP9 G;  5KAI E;  1SQQ J;  3L71 G;  2H88 C;  1HJ0 A;  3A0B H;  4IFM A;  2HR3 A;  1KFN A;  1L0N G;  2I8D A;  3Q3D A;  1RE4 A;  2W83 C;  2HFE D;  3B8E B;  3CWB G;  1N7S A;  2Q6Q A;  2YKO A;  1N8R Q;  1N73 B;  1KB9 I;  3SSU A;  5AW8 B;  2R44 A;  3B5N C;  1LNQ A;  1X79 B;  1VF5 D;  1USD A;  2FY8 A;  4OGQ B;  1DD4 A;  3VMX A;  1H88 A;  1RH5 B;  2K9J A;  3O6Q B;  5AW4 B;  2POH A;  4HB1 A;  2WSE J;  5AW6 B;  2AEF A;  2RMZ A;  2OYH B;  4H0L C;  4WY4 D;  3G71 P;  2R5D A;  1SQQ K;  2KNC B;  1NTZ D;  2O01 N;  3HUS B;  1RF0 A;  1JOC A;  2Y0C A;  1KC8 Q;  4OH8 B;  3P8C D;  1EDJ A;  4U7J A;  5KLI C;  4HYT B;  1NU1 G;  1PP9 J;  5E79 E;  1Y9B A;  3L75 G;  3L71 J;  4UB8 H;  2G3A A;  4U3F G;  1EZV E;  1L0L G;  3TF5 A;  1QL1 A;  2N1T D;  1L0N J;  2A06 D;  1OXZ A;  2IDB A;  1QVG O;  3EFF K;  4JYB A;  4KHX A;  1YIT P;  3EQ2 A;  1Z56 A;  1OW7 A;  4PJ0 H;  1IFI A;  3TNU A;  2H7H A;  1OVV A;  2B9B A;  5TIS H;  5AVY B;  1LTB C;  1LWU A;  3H1L G;  3EWK A;  1IK7 A;  2WMM A;  1SQB J;  3RK3 E;  1SFC C;  1EZV I;  2E5Y A;  1KQF B;  3IFM A;  5M1B A;  2FYN B;  1S4X A;  3C1L A;  4C7R A;  1G2C A;  2YO2 A;  3T97 B;  4Y99 B;  5APT A;  1VQ8 P;  3L74 G;  1QVF O;  2C0W A;  1AVY A;  4GT1 A;  1XTC C;  2NRG A;  1SQX D;  3B5N D;  2FYU E;  1L0N K;  2IZ0 A;  3L72 J;  2FBW C;  1H8A A;  2KZJ A;  3KHU A;  2E76 B;  3L75 J;  1CSB A;  3Q5S A;  2PAJ A;  4EDF A;  2M5A B;  1SQV G;  1LTT C;  1RF1 C;  4U3F J;  3TDK A;  1L0L J;  1FDI A;  5APV A;  4ZKP A;  2FFD C;  4H0L D;  1YQ3 C;  1YIJ P;  3WU2 E;  3CCU P;  1GZL A;  1S5L X;  5H2F E;  1VF5 B;  1SQB K;  3L73 D;  3U1C A;  1UIX A;  2L91 A;  1K8A Q;  1EZV D;  1NTK J;  3P8M C;  1VQ9 P;  3D70 A;  3H1L J;  2YXR B;  1NVO A;  4I1L A;  1VQO P;  1FS0 E;  3LIE A;  1OMI A;  1P84 E;  2JWD A;  3R4Y A;  3M0D C;  4JQ0 D;  2E42 A;  3A0H E;  4RO0 A;  3H1K E;  4W80 A;  4ZNC A;  1ZLL A;  1LTJ B;  3KZI E;  4DOJ A;  4I2L C;  2Q9I A;  4LC1 A;  4KJM A;  5B5E H;  1T6A A;  2OAR A;  2LXB A;  2N1T B;  5CCG C;  5BVZ A;  1NHL A;  5KAI H;  1SFC D;  1GW3 A;  2WPR A;  4I7Z B;  3GHG A;  3LID A;  1SQV J;  3AE4 C;  1NTM E;  1P84 I;  4WVZ A;  1M1J C;  3HD7 C;  2FYU D;  4R4L A;  1NTK K;  3L70 G;  5GTI E;  2PGD A;  1LP1 B;  1JMM A;  4L75 A;  2K37 A;  4XA4 A;  3GF3 A;  3H1H E;  4JPZ B;  2FXO A;  4C7N A;  1HF9 A;  3M06 A;  1G1J A;  5AW7 B;  1KQS O;  2WQY C;  1JTH A;  1SVF A;  4Z1M H;  3H32 A;  1SS1 A;  2IPP A;  3B5N B;  2KUB A;  4YPC A;  1ZR2 A;  2QRX A;  3CXH E;  2N9B A;  1MKM A;  1SQV K;  2DW3 A;  3R2P A;  3H1I G;  1SP4 A;  3BCC E;  3PLN A;  1P84 D;  1OVU A;  5E79 H;  4H0L B;  1OIP A;  2I1J A;  2IBZ D;  3ABV C;  2O1K A;  1NAF A;  4LLH A;  2HLO A;  1Y47 A;  2Q3I A;  3KDP B;  3CC7 P;  1RE4 C;  1JCC A;  5KLI B;  1USE A;  4XE5 B;  1R5S A;  3L70 J;  4BXL A;  2ZYD A;  1VQ4 P;  1RE3 A;  2W8Z A;  2HOD B;  5KLV G;  1QL2 A;  2Q7C A;  5CCG D;  3LW5 H;  1BCC E;  1Y8A A;  1BDD A;  1X22 A;  1LT9 C;  2KI7 B;  1FU1 A;  4H44 C;  1MFZ A;  3HD7 D;  1FAV A;  2ITA A;  3S4R A;  1YTZ T;  3CL3 D;  2IYP A;  2QM8 A;  4PV1 C;  5BU5 A;  1VQ5 P;  1EDL A;  2P1J A;  3N4X A;  1KZU B;  1JY2 O;  3H1H D;  1SFC B;  1IFJ A;  3H1I J;  4W7Y A;  5APU A;  1JB0 J;  1PIX A;  4GOD A;  3NXS A;  4D6T G;  1ZRT D;  2WSF H;  1AA0 A;  3H1J E;  1ZR4 A;  3CXH D;  3B4S A;  4HH2 A;  3WU2 H;  4WBA A;  5AW1 B;  1HJB A;  1TU3 F;  3BCC D;  3MGN A;  1ZME C;  1HH0 A;  2RH0 A;  4IFD K;  5KLV J;  1RF1 B;  1ZN5 A;  1LT1 A;  4OWF A;  5GTH E;  2FFD B;  1YJN P;  1GL2 C;  3VP9 A;  1VQ7 P;  2KP8 A;  1SQQ E;  2H43 A;  3SFE C;  3C8V A;  3CX5 E;  2R3C A;  3VTP C;  2QJK C;  1PPJ E;  3V6I A;  3A0H H;  1Q7Y Q;  3GW6 A;  1L4A A;  1FC2 C;  4AYC A;  3HTK A;  1N7S D;  4BRY A;  3KZI H;  2W90 A;  1BCC D;  2K9Y A;  5DJU B;  3S9O A;  2KIK A;  4WY4 C;  1FBM A;  1WT6 A;  3S1K A;  1IO4 A;  1U7M A;  5APQ A;  4RES B;  2NPS A;  3GLM A;  1ZP0 C;  5AVU B;  3CX5 I;  5KJ7 A;  4D6T J;  1E5W A;  1BGY J;  5KLV K;  1H0T A;  4M3L A;  3WMM 0;  2WSS H;  4PV1 D;  3AEE C;  1AQT A;  4ZKU A;  1M56 D;  5AW9 B;  2XND H;  2A45 H;  1FZE A;  1KIL C;  1NTZ G;  4RJT A;  3Q2Y A;  3MIW A;  1KB9 E;  3HD7 B;  1W5C E;  3H1J D;  3E1I A;  3L71 E;  2RN0 A;  1M90 Q;  1NKN A;  1W2B O;  2O01 H;  3VOP A;  1KQL A;  1L0N E;  1JY3 O;  3TSI A;  2QA4 P;  4YXD C;  2E74 C;  2A06 G;  2BCC D;  1SQP J;  2WT7 B;  3CXH H;  1SQQ D;  2KLV A;  2HG5 D;  1KFM A;  2OTK E;  3JCU H;  3JSV C;  1T8Z A;  1GL2 D;  3HUS A;  3CX5 D;  2P2U A;  1X0T A;  1FZC A;  1PPJ D;  3TGU J;  1T3U A;  1RHZ B;  1SQB E;  2ZT9 C;  3E7K A;  3RBZ A;  2AEM A;  2ZYG A;  3D6Y A;  2IYO A;  2XU6 A;  3D71 A;  1URQ A;  3VMZ A;  1FOS E;  1FJK A;  1BE3 E;  2CPB A;  2FXM A;  1OZH A;  2GUV A;  1NYH A;  4C46 A;  3L72 E;  1SQX G;  2Z4E A;  2FKW B;  1OVR A;  1EQ7 A;  3MUD A;  1SQP K;  1S1C X;  2BEQ D;  1IFP A;  1T3J A;  5KAF E;  1R8E A;  3I55 P;  3IR9 A;  1KB9 D;  1KIL D;  1LT9 B;  3CWB J;  2K9J B;  1OW8 A;  2R5B A;  3PRJ A;  3CCS P;  2OGU A;  4H44 B;  3L73 G;  3T97 A;  2WWW A;  4JF7 A;  2OYI A;  4GKG A;  5C39 A;  5AVX B;  4JBZ A;  1NTK E;  5AVR B;  3SFD C;  3H1L E;  4PV1 B;  4PD4 E;  3RK3 C;  4HKZ H;  2M3B A;  4IOI H;  5B66 H;  2E74 D;  1X9V A;  1G1I A;  3V2R A;  3WUV A;  3VYI A;  2P58 A;  4GDO A;  2V7Q H;  4LGD E;  3I56 P;  1KYO I;  2YIU C;  1SQB D;  2WPQ A;  1SQX J;  2ZT9 D;  3VP8 A;  5CBO A;  3TK1 A;  4PD4 I;  1IZN B;  3M91 A;  1NU1 J;  3CX5 H;  1BE3 D;  2H8P D;  2CPS A;  1GL2 B;  1KOR A;  2M0B A;  4IL6 X;  3L72 D;  2WTY A;  1LGH B;  1S5L E;  1XTG B;  3HE4 A;  1JO5 A;  3CPW O;  1M57 D;  2QJK B;  3L73 J;  3SWY A;  3GG2 A;  1GDT A;  1YYC A;  1N7L A;  3AE6 C; 
#chains in the Genus database with same CATH homology
 1NU1 G;  3L71 G;  3TGU G;  1KB9 H;  1NTM G;  1PPJ G;  1BGY G;  2FYU G;  4D6T G;  3L73 G;  3L75 G;  1NTZ G;  4PD4 H;  3H1H G;  3H1I G;  1SQP G;  3CX5 H;  1L0N G;  1BCC G;  3L70 G;  4U3F G;  1L0L G;  2BCC G;  1BE3 G;  1SQV G;  2A06 G;  3H1J G;  1SQB G;  1EZV G;  3CXH H;  1NTK G;  3CWB G;  1KYO H;  1SQQ G;  3H1K G;  2IBZ G;  3L74 G;  1SQX G;  3BCC G;  3H1L G;  1PP9 G;  5KLV G;  3L72 G;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...