3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
3L72G 1SQPG 1P84H 1SQXG 4D6TG 3CX5H 1BE3G 3BCCG 1SQBG 1BGYG 1SQQG 3L71G 3H1KG 2IBZG 1KYOH 1NTZG 3L70G 3H1LG 5KLVG 1BCCG 2FYUG 3L73G 1PPJG 3H1HG 3H1JG 1SQVG 4PD4H 1KB9H 1NTMG 3TGUG 3L75G 1L0LG 4U3FG 3L74G 3CWBG 3CXHH 2BCCG 1L0NG 1PP9G 1NU1G 1EZVG 3H1IG 1NTKG 2A06G
chains in the Genus database with same CATH superfamily
4IL6X 1S5LE 1K05A 2KLUA 3L72G 4UB8H 1SQPE 2N1TA 5CJ0A 4ZKPA 3L74D 1FJPA 1KV4A 2OYIA 3AEFC 1H0TA 2YKQA 5AW1B 1S2EA 1NKZB 1KILE 1BE3D 1NTZD 1KILA 2IZ0A 2LR2A 2WSCJ 3AE7C 1JY3O 1FZCC 3M9QA 1BGYD 4BRYA 5AW6B 3HD7A 3S4RA 1URQB 3FWNA 4RESB 3L4FA 1JMMA 2HR3A 2KSJA 3L36A 1RF1A 4O9BA 3RGUA 1AV1A 1KB9I 1LTTC 2KZIA 3MUDA 1VF5B 1K9MQ 2YKOA 3OAKA 3A0BE 2KIKA 5K5GB 2HODB 4Y99B 2R5BA 1YTZT 1J1EB 2ZAEB 1SQPK 1L0NG 1T2KD 3CCUP 2ZFCA 2JEEA 1KB9D 1NU1K 4D6TD 2NRGA 2A45I 1G2CA 1ZOYC 3CWBE 1M1KQ 3AEAC 3QH9A 2FYUJ 5H2FE 2FYNC 1Q81Q 1QX8A 1SVFA 1QVGO 3RK2B 3CWBJ 3L37A 4DZOA 1BDDA 2OYIC 3H1IE 1J1DC 1NTKE 2P1JA 1TU3F 1EDJA 2FFDC 3KZIH 4IFFA 1LTIC 4OH8B 1YITP 2K3RA 1FZEA 3A0HH 3EWKA 1JEKA 3M9BA 4GIFA 1QEXA 3WU2E 2G8YA 1Y9BA 1PP9J 3HUSC 3L74E 1ZR4A 1ZR2A 1EC5A 2JR8A 1FDMA 1LWUC 1NTZK 1ZV8A 2AEFA 2FBWC 1KB9H 2V7QJ 1OXZA 1OVRA 4PV1C 4EIJA 2O01H 4YTPC 1SQVD 1KILD 3AECC 3CXHI 3GLMA 3CXHD 4MN4C 3L73E 2YO2A 2BCCG 2O01N 2E42A 1MKMA 4OGQC 3AEEC 1SP4A 1H8AA 5B5EE 3L73J 1OW6A 1FOSE 2B87B 1WRGA 1GL2C 1PGJA 2FYNB 1Q90D 2BASA 3L70J 1DH3A 3N7NA 2O3JA 3KZIE 1OVVA 1SQBD 1JY3N 1DD3A 2A45G 3A0HE 3BASA 1BE3G 3OW2O 2JDIH 2WSFH 3WU2H 3MD0A 2HG5D 3PLNA 3V2QA 2O01J 2N9YB 3M91A 1N73A 1LP1B 2Q6QA 3B71A 1E79H 2RMZA 3VTPC 1IK9A 2XV5A 2ZT9C 1FOSF 2XZRA 2QEXP 2DW3A 2KYVA 1FZCA 2IBZE 4PV1B 2P67A 4BRYB 3VP9A 2YXRB 3H1JE 5DJTB 3MGNA 4EDFA 1K8AQ 3IFMA 3TGUG 1EDKA 4Y99C 3OA7A 3P32A 4D6TJ 1BSNA 1LT9B 2CK3H 2K9YA 1U7JA 1L4AB 4RKUJ 5B5EH 1X22A 3TSIA 1M56D 2FFDA 1LTJC 2J58A 5APVA 1SQQJ 3VMYA 1X79B 3HE4B 4NPFX 1EZVG 2M5AA 4WY4C 3U1CA 3A7OA 1N8RQ 4ASVA 2E75D 1S1CX 3HD7D 4EYYQ 1SQXG 5AVUB 3H1HJ 2C9NY 2E74C 3H25A 5CBNA 2I1KA 2OQQA 5CCHA 3TGUJ 3ITKA 4UB8E 1IJDB 2WTYA 3CD6P 4PD4E 5KLVK 1LTBC 2FYUK 4OGQB 2O1KA 1SQPJ 3S1KA 1Z56A 2FYUG 2XNDH 5AW2B 1NWQA 3PHLA 1GL2A 2ZJSE 1LT9C 3QWOC 5KLVD 1R8EA 5BVZA 2Q9IA 2PP6A 3FWLA 3GW6A 1SQXJ 3IR9A 4C7RA 2FYUE 2E76D 3Q5RA 2B89A 2Q1KA 2A06E 4GT1A 2PFXA 4KJMA 3W68A 5B66E 2V4HA 1GD2E 1M1JB 4AUWA 3CCEP 2QE7H 2IPPA 4JPZB 2Y0DA 1G2CB 3H1JJ 1LWUA 3H1KE 2LXBA 1ZP0C 1GMJA 3MHVA 2PGDA 4U3FJ 1MFZA 3L74J 1GK4A 1NH4A 3H1HD 3H32B 3MTUE 1X0TA 1AVOA 2QRXA 4H13B 2WQYC 2J5UA 3HTKA 2NPSC 5AVXB 3SFEC 5L8RJ 1QGKB 3TDKA 3PJSK 5AW5B 3AE4C 2FXOA 1JOCA 1S5LX 2HLOA 3KPEA 1KORA 4JBZA 1AVYA 3C9IA 4L73A 3TYYA 1KMIZ 4WY4D 1BCCG 3KQGA 1NAYA 5B66H 1PPJG 1JY2O 3RL0C 1BE3J 4C7NA 3SWFA 1JCCA 1N7LA 4N3YB 4HH2A 3KXDA 2FFDB 2KUBA 3PRJA 1HH0A 3LW5H 3CI9A 1M1JC 1SFCB 1IO4A 4TT3H 1VQOP 3HE5B 1VQ8P 1VQ9P 1N73C 2H43A 1KB9E 1FDIA 1FZBA 3T97B 5CJ4A 1JMBA 2ZT9D 5AVZB 2OGUA 5APXA 1BCCJ 2WPVB 3HE4A 4H13C 1AFOA 2M3EA 4ASWA 1AQTA 3CL3D 1OMIA 1XTCC 1P84I 3L71G 5KAIE 3H1KG 3AE1C 1SQVK 3IAOA 4R4LA 4K3AA 1PP9E 1SQXK 5DJUB 1IFIA 5AVVB 1CI6B 3PH0A 1PFIA 3L72D 2K37A 3EFGA 1SQQE 3JCUE 2QA4P 3AEGC 1LJ2A 1AJYA 1PV3A 3S9OA 3KHUA 1KQFB 1SFCC 3USSA 1PIXA 1NTMG 2BEQD 2C0XA 2QJKB 3M9HA 1USDA 1H89A 3W67A 2E74D 1MZ9A 3A3YB 1HTLC 3MP7B 2OTKE 3D71A 1PL5A 2HFED 2FXMA 4XA4A 2KK7A 2WVRA 5GTHE 5CCGA 5KJ7A 1S9KE 2KNCA 1RY3A 3FXEA 3H1IG 3RK2D 2ZVNB 3B5ND 1EQ7A 3CCLP 5KAIH 2H88C 1E5WA 1SQVE 3WUVA 1HGVA 3VYIA 2D2CC 2YMYA 1M90Q 2W8ZA 1PGOA 1NTMJ 1BGYG 3BRVB 1J1EC 1PGPA 2FY8A 1PPJE 2VRSA 3JC22 3B5NB 4H0LC 4PD4I 5AVSB 5KJ7D 5CCGD 3GHGC 3V4WA 1EZVE 1JY3P 4XE5B 1VF5C 1KZUB 3CCMP 2YIUC 3CCRP 1G1JA 5CMZA 2LXCB 2WSEH 3Q1MA 3D70A 3SSUA 1KTMA 2P10A 5C39A 1S3JA 3L70D 3V2PA 4PD4H 4W7YA 4M3LA 2W27A 1NAFA 1Y47A 2J59M 2W6JH 1M7LA 3R2PA 1KILC 3CXHH 3CX5I 5AW0B 1KQSO 1SQQD 2PAJA 1KYOI 2IBZD 4ZNCA 3RK2C 2E75C 1L0ND 5AW4B 3P8CE 2MJZA 4GKGA 3EFFK 4GODA 3M06A 4LC1A 4ZKUA 5APQA 3CMEP 4DJGA 1K73Q 1DEEG 5E79E 1L4AA 4BXLA 1BE3E 3NTNA 3WUTA 1L4AC 1JO5A 4C46A 2QJKC 1LT1A 2I8DA 3KYQA 1VQ5P 4IFDK 3D6ZA 1IFDA 3RL0g 4L76A 1NTKJ 2QJPB 1ZN5A 3CCSP 1JCDA 1YJWP 1EDLA 5KLVG 1OVUA 1SQBE 1T8ZA 2AEJA 1SQXE 3L73G 3CMAP 1L4AD 2HPCA 3TK1A 1CZQA 1DX7A 1PGQA 1SQBJ 2CPSA 2R5DA 4JF7A 4H0LD 1YHQP 2D2CB 2KS1A 2I1JA 3G3ZA 1ZW0A 2Q7CA 1D7MA 3Q5PA 3CLQA 4HYTB 3V6IA 1NTMK 1RF1B 3K5BA 1KC8Q 1BGYE 4HKZH 1DIPA 4XFJA 2M5AB 1URQA 3FGAD 4W7ZA 5KLVJ 3RBZA 1LP1A 2KS1B 2FYUD 3ZDMA 1N73B 1GU5A 2B88A 4DCKA 1SQBG 3L75J 1PP9D 1L0NJ 2FKWB 2O1JA 1SQBK 2IBZG 4WBAA 1RQVA 2W90A 2ZYAA 3MIWA 3NFQA 4IL6H 2Q5UA 5CCGC 1L0NE 5KJ7C 1FZAA 1FDOA 2IZ1A 4I1LA 5BU5A 3T97A 4AQRD 1DD4A 3PP5A 2M0BA 4H44C 4I7ZC 2QJYC 1M57D 1GTWA 1IFPA 1RE4A 1WT6A 1XTGB 3CCJP 3AEDC 3F89A 2XKMA 2QVAA 1KQLA 3HE5A 3JCUH 1SFCA 3RBXA 3RL0B 1YJ9P 2Z4EA 4I2LC 2E76C 5TISE 4A7PA 5KLIB 1Q7YQ 3P7KA 3RK3D 1FU1A 4OGQD 1PP9G 1X9VA 1YQ3C 1ZRTE 1OW7A 5AW7B 1EZVI 2KOGA 1FC2C 2BCCE 5AVYB 3M0DA 4KT0J 1L0LD 1NTKK 1Q82Q 5GTHH 4YXDC 1R5SA 5AW9B 1HF9A 2P58A 1T3UA 4LGDE 1KYOD 3HRNA 1S72P 5KTBA 1OX3A 2OYHB 1EXJA 3L72E 2Q3IA 1GW3A 3Q5SA 1JY2N 3I56P 1NO4A 2RH0A 3KDPB 1AA0A 1Q2NA 3CCQP 3H1KD 5APUA 4WWIA 5EFWB 4EOTA 3PTZA 4QMAA 3H1JG 5BU8B 2WWWA 2WITA 2R32A 1T6AA 3B5NA 5KAFE 2JJLA 3HUSB 1M1JA 4H13D 3L75E 2K1AA 4WVZA 4Z1MH 1VQ7P 1RF0A 3CC7P 1ZXGA 4R4MA 1VF5D 3CWBG 4CPGA 2N1TB 1MV8A 3RK3C 4YXWH 1IFJA 1ZLLA 1T2KC 4WY4A 2OYHC 2POHA 1GW4A 3C1LA 3E1RA 2E75B 5APWA 3AE8C 5AVQB 3BCCE 1SQVJ 1M8OB 3WMM0 3VMAA 3CXHE 4U3FD 2QSIA 4N6JA 1NTME 4D6TE 1U57A 4H44D 4K35A 3V2RA 1KILB 4W80A 3H1JD 1QVFO 3O6QB 1S4XA 2R3CA 1UIXA 1SQQG 1UIIA 2OYIB 1KFNA 1H0TB 4NPDA 3NMDA 2K9JB 1NTKD 5E79H 3V4QA 1RF0C 2AXTH 3U1AA 2BCCJ 2Y0CA 2YO3A 4L74A 2BCCD 1YJNP 1SQXD 3L71E 1WMKA 3N4XA 3SWYA 3VMXA 2OTJP 2E43A 1USEA 4GDOA 4OWFA 3GHGB 3HD7B 3JSVC 2E5TA 4JYCA 3I55P 1HJBA 1L0NK 1HGZA 2A06D 2NZ2A 2QG4A 4JYBA 3G4SP 1SQPD 1W2EA 1VQPP 1HWTC 1HBWA 1HVVA 1LT9A 1NKNA 2G3AA 2PRRA 4IFMA 4EI2A 2Z5IA 1OWAA 1N7SB 3MZWB 2YIUB 3AE6C 1P84D 3L73D 2ZXXA 3GHGA 2V7QH 1LGHB 1LTSC 2QM8A 1IZNB 3AE3C 1G1IA 3M0DC 4N78D 2AXTE 2GA1A 1BCCE 5AW3B 3VN0A 1RHZB 1NYHA 2Z5HA 3AE9C 3LW5J 3O6QA 4I6MC 2QIWA 4L75A 4LLHA 2WT7A 3IF4A 2ITAA 2KB7P 3BRTB 3G6EP 3R4YA 2B87A 2W6BA 4DOJA 1JNMA 2W6AA 1LTJA 1NTMD 3FX0A 2QJYB 4JQ0D 4PJ0E 2WSFJ 1FZCB 1EXIA 1VPCA 2NPSA 3IN6A 1OIPA 4IL6E 2CPBA 4RJTA 3CWBD 4H0LB 1VQMP 3F5HA 1DEBA 1NJIQ 1VQKP 2H89C 2QJPC 1KN7A 3H32A 2UWJE 3U59A 2K88A 1T3JA 1BGYJ 3H1ID 4WB4A 1CW5A 2R3SA 1GK6A 3L71D 4ZMDA 2A45H 4H44B 1MFTA 1PZQA 4I7ZB 4U7JA 1GL2D 2A06G 2BEZF 3B5NC 1JTHA 1URQC 4IOIH 1SQPG 2QM7A 5TISH 1W2BO 4NPEA 1FS0E 5AW8B 1CSBA 2ZXEB 1BSHA 1MUUA 2E76B 2WPSA 5KLIC 3V2NA 3CCVP 3HTKB 4KHXA 1RF1C 2YKPA 1NU1D 2JWDA 2AEMA 1GL2B 1EZVD 1NU1J 2Y0EA 1YYCA 1NTZE 1L2PA 1IFNA 3L70G 3H1LG 3P8CD 2OARA 2M8RA 3AE2C 2ZYDA 2JO1A 2XDJA 3AEBC 4N78E 2D2CD 3C8VA 5APSA 5AVWB 1YI2P 5CCHD 1IK7A 4OVNF 2H7HA 4U3FG 3L74G 1FBMA 1VQLP 3E7KA 1S9KD 5KAFH 2IBZI 1N2DC 3TNUB 3H1LE 2AXCA 1NU1G 3H6PA 3A5TA 1L0LE 2OTLP 5KKZC 1NTKG 3SFDC 3WUUA 5CBOA 1VDFA 3H1LJ 2E5YA 1P84H 1Q86Q 4PV1D 1L0LJ 2WSEJ 5CHXA 3NXSA 4D6TG 3TGUE 1GDTA 1VQ6P 1SFCD 1FZFA 1PPJD 1FE6A 1VL2A 2HODA 2R44A 2XU6A 1EDIA 2WPRA 3BCCG 3GF7A 1YIJP 2KP8A 3LIEA 1SQQK 2GUVA 3H1HE 5GTIH 3FXDA 1HUCA 2E74B 1JUNA 2Y9YA 1FJKA 1YQ4C 2GUSA 2IFNA 2N9BA 2YNYA 3H1IJ 2HPCB 1RE3A 2RKLA 2ZVOB 4Y28J 4AYCA 2YMKA 1SS1A 3A0BH 3H1HG 4WY4B 1GU4A 1JY2P 3UIAA 1QL2A 2K9JA 1R5LA 1L0LG 1QLED 1GZLA 1IFMA 1N7SA 1NU1E 2FXPA 2KZJA 1L0LK 3AE5C 1VQNP 5AVTB 2P7JA 3BCCJ 1P84E 4GOFA 3BCCD 3L71J 1JTHB 5H2FH 1J1DB 1IC2A 1U7MA 2B9BA 2P2UA 3H1KJ 3HD7C 4U3FE 1VQ4P 2KXPB 3CC4P 1JB0J 2FYZA 2Q3EA 2ZT9B 3VOPA 5GTIE 1N7SD 1AQ5A 3V5BA 5CCHC 2YXQB 3L70E 3RL0D 2JP3A 2H8PD 3RK3E 5KLVE 2N1TC 2WPQA 3RK3B 1JM0A 1Y8AA 2ZYGA 5APTA 3HUSA 4C7NB 2W83C 2XNXA 4B86A 1NTZG 3CX5D 2L5GB 1YBKA 1SLQA 1J2JB 3TGUD 5KKZB 1LWUB 2WSSH 4HJGH 2L91A 1OZHA 2Y9ZA 5AVRB 1KYOE 3D6YA 3L35A 2IYPA 1URQD 2IYOA 2HYNA 2LKMA 2N1TD 1K04A 3GF3A 3OJAB 3TNUA 2KLVA 2OYHA 2WMMA 4TLFA 4PJ0H 3M0AA 1W5CE 3VMZA 2KSEA 2NPSB 2SPZA 1QL1A 4BWNA 5APYA 1KQGB 3B8EB 4PD4D 1YTZI 4RO0A 1NTZJ 1X8YA 2IX7C 4UB6H 2KNCB 2M3BA 3L75D 2WT7B 1KD1Q 1BCCD 1N7SC 3CX5H 2IFMA 1RH5B 3P8MC 1LTAC 2NPSD 3MUDC 4GOEA 2MKVA 5TJHA 1H88A 1RQUA 1HJ0A 2IDBA 1S5LH 1NGMB 1A02F 3SWKA 2RN0A 2C0WA 2WZ7A 3O8ZA 1LNQA 3A2AA 2KI7B 1KYOH 1OW8A 1RE3C 1LTGC 1NVOA 3LIDA 3B4SA 1KFMA 3L72J 3VP8A 3TF5A 1LTJB 1ZMEC 2JWAA 3I5CA 1N86A 1SQVG 5M1BA 3Q3DA 1CI6A 1NOHA 1FAVA 3BATA 3GG2A 4HB1A 3BVHA 3L75G 2WSCH 3GMAA 2OYOA 3ABVC 3CC2P 1BDCA 3E1IA 2JKVA 4YPCA 3G71P 4UB6E 1ZRTD 3H1LD 3CPWO 4DT0A 3EQ2A 3Q2YA 1FZGA 1A02J 3G9RA 3II6A 2C9LY 3CX5E 1NHLA 2GM4A 1RE4C 1OFCX
chains in the Genus database with same CATH topology
3L72G 1SQPG 1P84H 1SQXG 4D6TG 3CX5H 1BE3G 3BCCG 1SQBG 1BGYG 1SQQG 3L71G 3H1KG 2IBZG 1KYOH 1NTZG 3L70G 3H1LG 5KLVG 1BCCG 2FYUG 3L73G 1PPJG 3H1HG 3H1JG 1SQVG 4PD4H 1KB9H 1NTMG 3TGUG 3L75G 1L0LG 4U3FG 3L74G 3CWBG 3CXHH 2BCCG 1L0NG 1PP9G 1NU1G 1EZVG 3H1IG 1NTKG 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  1SQP G;  1P84 H;  1SQX G;  4D6T G;  3CX5 H;  1BE3 G;  3BCC G;  1SQB G;  1BGY G;  1SQQ G;  3L71 G;  3H1K G;  2IBZ G;  1KYO H;  1NTZ G;  3L70 G;  3H1L G;  5KLV G;  1BCC G;  2FYU G;  3L73 G;  1PPJ G;  3H1H G;  3H1J G;  1SQV G;  4PD4 H;  1KB9 H;  1NTM G;  3TGU G;  3L75 G;  1L0L G;  4U3F G;  3L74 G;  3CWB G;  3CXH H;  2BCC G;  1L0N G;  1PP9 G;  1NU1 G;  1EZV G;  3H1I G;  1NTK G;  2A06 G; 
#chains in the Genus database with same CATH topology
 4IL6 X;  1S5L E;  1K05 A;  2KLU A;  3L72 G;  4UB8 H;  1SQP E;  2N1T A;  5CJ0 A;  4ZKP A;  3L74 D;  1FJP A;  1KV4 A;  2OYI A;  3AEF C;  1H0T A;  2YKQ A;  5AW1 B;  1S2E A;  1NKZ B;  1KIL E;  1BE3 D;  1NTZ D;  1KIL A;  2IZ0 A;  2LR2 A;  2WSC J;  3AE7 C;  1JY3 O;  1FZC C;  3M9Q A;  1BGY D;  4BRY A;  5AW6 B;  3HD7 A;  3S4R A;  1URQ B;  3FWN A;  4RES B;  3L4F A;  1JMM A;  2HR3 A;  2KSJ A;  3L36 A;  1RF1 A;  4O9B A;  3RGU A;  1AV1 A;  1KB9 I;  1LTT C;  2KZI A;  3MUD A;  1VF5 B;  1K9M Q;  2YKO A;  3OAK A;  3A0B E;  2KIK A;  5K5G B;  2HOD B;  4Y99 B;  2R5B A;  1YTZ T;  1J1E B;  2ZAE B;  1SQP K;  1L0N G;  1T2K D;  3CCU P;  2ZFC A;  2JEE A;  1KB9 D;  1NU1 K;  4D6T D;  2NRG A;  2A45 I;  1G2C A;  1ZOY C;  3CWB E;  1M1K Q;  3AEA C;  3QH9 A;  2FYU J;  5H2F E;  2FYN C;  1Q81 Q;  1QX8 A;  1SVF A;  1QVG O;  3RK2 B;  3CWB J;  3L37 A;  4DZO A;  1BDD A;  2OYI C;  3H1I E;  1J1D C;  1NTK E;  2P1J A;  1TU3 F;  1EDJ A;  2FFD C;  3KZI H;  4IFF A;  1LTI C;  4OH8 B;  1YIT P;  2K3R A;  1FZE A;  3A0H H;  3EWK A;  1JEK A;  3M9B A;  4GIF A;  1QEX A;  3WU2 E;  2G8Y A;  1Y9B A;  1PP9 J;  3HUS C;  3L74 E;  1ZR4 A;  1ZR2 A;  1EC5 A;  2JR8 A;  1FDM A;  1LWU C;  1NTZ K;  1ZV8 A;  2AEF A;  2FBW C;  1KB9 H;  2V7Q J;  1OXZ A;  1OVR A;  4PV1 C;  4EIJ A;  2O01 H;  4YTP C;  1SQV D;  1KIL D;  3AEC C;  3CXH I;  3GLM A;  3CXH D;  4MN4 C;  3L73 E;  2YO2 A;  2BCC G;  2O01 N;  2E42 A;  1MKM A;  4OGQ C;  3AEE C;  1SP4 A;  1H8A A;  5B5E E;  3L73 J;  1OW6 A;  1FOS E;  2B87 B;  1WRG A;  1GL2 C;  1PGJ A;  2FYN B;  1Q90 D;  2BAS A;  3L70 J;  1DH3 A;  3N7N A;  2O3J A;  3KZI E;  1OVV A;  1SQB D;  1JY3 N;  1DD3 A;  2A45 G;  3A0H E;  3BAS A;  1BE3 G;  3OW2 O;  2JDI H;  2WSF H;  3WU2 H;  3MD0 A;  2HG5 D;  3PLN A;  3V2Q A;  2O01 J;  2N9Y B;  3M91 A;  1N73 A;  1LP1 B;  2Q6Q A;  3B71 A;  1E79 H;  2RMZ A;  3VTP C;  1IK9 A;  2XV5 A;  2ZT9 C;  1FOS F;  2XZR A;  2QEX P;  2DW3 A;  2KYV A;  1FZC A;  2IBZ E;  4PV1 B;  2P67 A;  4BRY B;  3VP9 A;  2YXR B;  3H1J E;  5DJT B;  3MGN A;  4EDF A;  1K8A Q;  3IFM A;  3TGU G;  1EDK A;  4Y99 C;  3OA7 A;  3P32 A;  4D6T J;  1BSN A;  1LT9 B;  2CK3 H;  2K9Y A;  1U7J A;  1L4A B;  4RKU J;  5B5E H;  1X22 A;  3TSI A;  1M56 D;  2FFD A;  1LTJ C;  2J58 A;  5APV A;  1SQQ J;  3VMY A;  1X79 B;  3HE4 B;  4NPF X;  1EZV G;  2M5A A;  4WY4 C;  3U1C A;  3A7O A;  1N8R Q;  4ASV A;  2E75 D;  1S1C X;  3HD7 D;  4EYY Q;  1SQX G;  5AVU B;  3H1H J;  2C9N Y;  2E74 C;  3H25 A;  5CBN A;  2I1K A;  2OQQ A;  5CCH A;  3TGU J;  3ITK A;  4UB8 E;  1IJD B;  2WTY A;  3CD6 P;  4PD4 E;  5KLV K;  1LTB C;  2FYU K;  4OGQ B;  2O1K A;  1SQP J;  3S1K A;  1Z56 A;  2FYU G;  2XND H;  5AW2 B;  1NWQ A;  3PHL A;  1GL2 A;  2ZJS E;  1LT9 C;  3QWO C;  5KLV D;  1R8E A;  5BVZ A;  2Q9I A;  2PP6 A;  3FWL A;  3GW6 A;  1SQX J;  3IR9 A;  4C7R A;  2FYU E;  2E76 D;  3Q5R A;  2B89 A;  2Q1K A;  2A06 E;  4GT1 A;  2PFX A;  4KJM A;  3W68 A;  5B66 E;  2V4H A;  1GD2 E;  1M1J B;  4AUW A;  3CCE P;  2QE7 H;  2IPP A;  4JPZ B;  2Y0D A;  1G2C B;  3H1J J;  1LWU A;  3H1K E;  2LXB A;  1ZP0 C;  1GMJ A;  3MHV A;  2PGD A;  4U3F J;  1MFZ A;  3L74 J;  1GK4 A;  1NH4 A;  3H1H D;  3H32 B;  3MTU E;  1X0T A;  1AVO A;  2QRX A;  4H13 B;  2WQY C;  2J5U A;  3HTK A;  2NPS C;  5AVX B;  3SFE C;  5L8R J;  1QGK B;  3TDK A;  3PJS K;  5AW5 B;  3AE4 C;  2FXO A;  1JOC A;  1S5L X;  2HLO A;  3KPE A;  1KOR A;  4JBZ A;  1AVY A;  3C9I A;  4L73 A;  3TYY A;  1KMI Z;  4WY4 D;  1BCC G;  3KQG A;  1NAY A;  5B66 H;  1PPJ G;  1JY2 O;  3RL0 C;  1BE3 J;  4C7N A;  3SWF A;  1JCC A;  1N7L A;  4N3Y B;  4HH2 A;  3KXD A;  2FFD B;  2KUB A;  3PRJ A;  1HH0 A;  3LW5 H;  3CI9 A;  1M1J C;  1SFC B;  1IO4 A;  4TT3 H;  1VQO P;  3HE5 B;  1VQ8 P;  1VQ9 P;  1N73 C;  2H43 A;  1KB9 E;  1FDI A;  1FZB A;  3T97 B;  5CJ4 A;  1JMB A;  2ZT9 D;  5AVZ B;  2OGU A;  5APX A;  1BCC J;  2WPV B;  3HE4 A;  4H13 C;  1AFO A;  2M3E A;  4ASW A;  1AQT A;  3CL3 D;  1OMI A;  1XTC C;  1P84 I;  3L71 G;  5KAI E;  3H1K G;  3AE1 C;  1SQV K;  3IAO A;  4R4L A;  4K3A A;  1PP9 E;  1SQX K;  5DJU B;  1IFI A;  5AVV B;  1CI6 B;  3PH0 A;  1PFI A;  3L72 D;  2K37 A;  3EFG A;  1SQQ E;  3JCU E;  2QA4 P;  3AEG C;  1LJ2 A;  1AJY A;  1PV3 A;  3S9O A;  3KHU A;  1KQF B;  1SFC C;  3USS A;  1PIX A;  1NTM G;  2BEQ D;  2C0X A;  2QJK B;  3M9H A;  1USD A;  1H89 A;  3W67 A;  2E74 D;  1MZ9 A;  3A3Y B;  1HTL C;  3MP7 B;  2OTK E;  3D71 A;  1PL5 A;  2HFE D;  2FXM A;  4XA4 A;  2KK7 A;  2WVR A;  5GTH E;  5CCG A;  5KJ7 A;  1S9K E;  2KNC A;  1RY3 A;  3FXE A;  3H1I G;  3RK2 D;  2ZVN B;  3B5N D;  1EQ7 A;  3CCL P;  5KAI H;  2H88 C;  1E5W A;  1SQV E;  3WUV A;  1HGV A;  3VYI A;  2D2C C;  2YMY A;  1M90 Q;  2W8Z A;  1PGO A;  1NTM J;  1BGY G;  3BRV B;  1J1E C;  1PGP A;  2FY8 A;  1PPJ E;  2VRS A;  3JC2 2;  3B5N B;  4H0L C;  4PD4 I;  5AVS B;  5KJ7 D;  5CCG D;  3GHG C;  3V4W A;  1EZV E;  1JY3 P;  4XE5 B;  1VF5 C;  1KZU B;  3CCM P;  2YIU C;  3CCR P;  1G1J A;  5CMZ A;  2LXC B;  2WSE H;  3Q1M A;  3D70 A;  3SSU A;  1KTM A;  2P10 A;  5C39 A;  1S3J A;  3L70 D;  3V2P A;  4PD4 H;  4W7Y A;  4M3L A;  2W27 A;  1NAF A;  1Y47 A;  2J59 M;  2W6J H;  1M7L A;  3R2P A;  1KIL C;  3CXH H;  3CX5 I;  5AW0 B;  1KQS O;  1SQQ D;  2PAJ A;  1KYO I;  2IBZ D;  4ZNC A;  3RK2 C;  2E75 C;  1L0N D;  5AW4 B;  3P8C E;  2MJZ A;  4GKG A;  3EFF K;  4GOD A;  3M06 A;  4LC1 A;  4ZKU A;  5APQ A;  3CME P;  4DJG A;  1K73 Q;  1DEE G;  5E79 E;  1L4A A;  4BXL A;  1BE3 E;  3NTN A;  3WUT A;  1L4A C;  1JO5 A;  4C46 A;  2QJK C;  1LT1 A;  2I8D A;  3KYQ A;  1VQ5 P;  4IFD K;  3D6Z A;  1IFD A;  3RL0 g;  4L76 A;  1NTK J;  2QJP B;  1ZN5 A;  3CCS P;  1JCD A;  1YJW P;  1EDL A;  5KLV G;  1OVU A;  1SQB E;  1T8Z A;  2AEJ A;  1SQX E;  3L73 G;  3CMA P;  1L4A D;  2HPC A;  3TK1 A;  1CZQ A;  1DX7 A;  1PGQ A;  1SQB J;  2CPS A;  2R5D A;  4JF7 A;  4H0L D;  1YHQ P;  2D2C B;  2KS1 A;  2I1J A;  3G3Z A;  1ZW0 A;  2Q7C A;  1D7M A;  3Q5P A;  3CLQ A;  4HYT B;  3V6I A;  1NTM K;  1RF1 B;  3K5B A;  1KC8 Q;  1BGY E;  4HKZ H;  1DIP A;  4XFJ A;  2M5A B;  1URQ A;  3FGA D;  4W7Z A;  5KLV J;  3RBZ A;  1LP1 A;  2KS1 B;  2FYU D;  3ZDM A;  1N73 B;  1GU5 A;  2B88 A;  4DCK A;  1SQB G;  3L75 J;  1PP9 D;  1L0N J;  2FKW B;  2O1J A;  1SQB K;  2IBZ G;  4WBA A;  1RQV A;  2W90 A;  2ZYA A;  3MIW A;  3NFQ A;  4IL6 H;  2Q5U A;  5CCG C;  1L0N E;  5KJ7 C;  1FZA A;  1FDO A;  2IZ1 A;  4I1L A;  5BU5 A;  3T97 A;  4AQR D;  1DD4 A;  3PP5 A;  2M0B A;  4H44 C;  4I7Z C;  2QJY C;  1M57 D;  1GTW A;  1IFP A;  1RE4 A;  1WT6 A;  1XTG B;  3CCJ P;  3AED C;  3F89 A;  2XKM A;  2QVA A;  1KQL A;  3HE5 A;  3JCU H;  1SFC A;  3RBX A;  3RL0 B;  1YJ9 P;  2Z4E A;  4I2L C;  2E76 C;  5TIS E;  4A7P A;  5KLI B;  1Q7Y Q;  3P7K A;  3RK3 D;  1FU1 A;  4OGQ D;  1PP9 G;  1X9V A;  1YQ3 C;  1ZRT E;  1OW7 A;  5AW7 B;  1EZV I;  2KOG A;  1FC2 C;  2BCC E;  5AVY B;  3M0D A;  4KT0 J;  1L0L D;  1NTK K;  1Q82 Q;  5GTH H;  4YXD C;  1R5S A;  5AW9 B;  1HF9 A;  2P58 A;  1T3U A;  4LGD E;  1KYO D;  3HRN A;  1S72 P;  5KTB A;  1OX3 A;  2OYH B;  1EXJ A;  3L72 E;  2Q3I A;  1GW3 A;  3Q5S A;  1JY2 N;  3I56 P;  1NO4 A;  2RH0 A;  3KDP B;  1AA0 A;  1Q2N A;  3CCQ P;  3H1K D;  5APU A;  4WWI A;  5EFW B;  4EOT A;  3PTZ A;  4QMA A;  3H1J G;  5BU8 B;  2WWW A;  2WIT A;  2R32 A;  1T6A A;  3B5N A;  5KAF E;  2JJL A;  3HUS B;  1M1J A;  4H13 D;  3L75 E;  2K1A A;  4WVZ A;  4Z1M H;  1VQ7 P;  1RF0 A;  3CC7 P;  1ZXG A;  4R4M A;  1VF5 D;  3CWB G;  4CPG A;  2N1T B;  1MV8 A;  3RK3 C;  4YXW H;  1IFJ A;  1ZLL A;  1T2K C;  4WY4 A;  2OYH C;  2POH A;  1GW4 A;  3C1L A;  3E1R A;  2E75 B;  5APW A;  3AE8 C;  5AVQ B;  3BCC E;  1SQV J;  1M8O B;  3WMM 0;  3VMA A;  3CXH E;  4U3F D;  2QSI A;  4N6J A;  1NTM E;  4D6T E;  1U57 A;  4H44 D;  4K35 A;  3V2R A;  1KIL B;  4W80 A;  3H1J D;  1QVF O;  3O6Q B;  1S4X A;  2R3C A;  1UIX A;  1SQQ G;  1UII A;  2OYI B;  1KFN A;  1H0T B;  4NPD A;  3NMD A;  2K9J B;  1NTK D;  5E79 H;  3V4Q A;  1RF0 C;  2AXT H;  3U1A A;  2BCC J;  2Y0C A;  2YO3 A;  4L74 A;  2BCC D;  1YJN P;  1SQX D;  3L71 E;  1WMK A;  3N4X A;  3SWY A;  3VMX A;  2OTJ P;  2E43 A;  1USE A;  4GDO A;  4OWF A;  3GHG B;  3HD7 B;  3JSV C;  2E5T A;  4JYC A;  3I55 P;  1HJB A;  1L0N K;  1HGZ A;  2A06 D;  2NZ2 A;  2QG4 A;  4JYB A;  3G4S P;  1SQP D;  1W2E A;  1VQP P;  1HWT C;  1HBW A;  1HVV A;  1LT9 A;  1NKN A;  2G3A A;  2PRR A;  4IFM A;  4EI2 A;  2Z5I A;  1OWA A;  1N7S B;  3MZW B;  2YIU B;  3AE6 C;  1P84 D;  3L73 D;  2ZXX A;  3GHG A;  2V7Q H;  1LGH B;  1LTS C;  2QM8 A;  1IZN B;  3AE3 C;  1G1I A;  3M0D C;  4N78 D;  2AXT E;  2GA1 A;  1BCC E;  5AW3 B;  3VN0 A;  1RHZ B;  1NYH A;  2Z5H A;  3AE9 C;  3LW5 J;  3O6Q A;  4I6M C;  2QIW A;  4L75 A;  4LLH A;  2WT7 A;  3IF4 A;  2ITA A;  2KB7 P;  3BRT B;  3G6E P;  3R4Y A;  2B87 A;  2W6B A;  4DOJ A;  1JNM A;  2W6A A;  1LTJ A;  1NTM D;  3FX0 A;  2QJY B;  4JQ0 D;  4PJ0 E;  2WSF J;  1FZC B;  1EXI A;  1VPC A;  2NPS A;  3IN6 A;  1OIP A;  4IL6 E;  2CPB A;  4RJT A;  3CWB D;  4H0L B;  1VQM P;  3F5H A;  1DEB A;  1NJI Q;  1VQK P;  2H89 C;  2QJP C;  1KN7 A;  3H32 A;  2UWJ E;  3U59 A;  2K88 A;  1T3J A;  1BGY J;  3H1I D;  4WB4 A;  1CW5 A;  2R3S A;  1GK6 A;  3L71 D;  4ZMD A;  2A45 H;  4H44 B;  1MFT A;  1PZQ A;  4I7Z B;  4U7J A;  1GL2 D;  2A06 G;  2BEZ F;  3B5N C;  1JTH A;  1URQ C;  4IOI H;  1SQP G;  2QM7 A;  5TIS H;  1W2B O;  4NPE A;  1FS0 E;  5AW8 B;  1CSB A;  2ZXE B;  1BSH A;  1MUU A;  2E76 B;  2WPS A;  5KLI C;  3V2N A;  3CCV P;  3HTK B;  4KHX A;  1RF1 C;  2YKP A;  1NU1 D;  2JWD A;  2AEM A;  1GL2 B;  1EZV D;  1NU1 J;  2Y0E A;  1YYC A;  1NTZ E;  1L2P A;  1IFN A;  3L70 G;  3H1L G;  3P8C D;  2OAR A;  2M8R A;  3AE2 C;  2ZYD A;  2JO1 A;  2XDJ A;  3AEB C;  4N78 E;  2D2C D;  3C8V A;  5APS A;  5AVW B;  1YI2 P;  5CCH D;  1IK7 A;  4OVN F;  2H7H A;  4U3F G;  3L74 G;  1FBM A;  1VQL P;  3E7K A;  1S9K D;  5KAF H;  2IBZ I;  1N2D C;  3TNU B;  3H1L E;  2AXC A;  1NU1 G;  3H6P A;  3A5T A;  1L0L E;  2OTL P;  5KKZ C;  1NTK G;  3SFD C;  3WUU A;  5CBO A;  1VDF A;  3H1L J;  2E5Y A;  1P84 H;  1Q86 Q;  4PV1 D;  1L0L J;  2WSE J;  5CHX A;  3NXS A;  4D6T G;  3TGU E;  1GDT A;  1VQ6 P;  1SFC D;  1FZF A;  1PPJ D;  1FE6 A;  1VL2 A;  2HOD A;  2R44 A;  2XU6 A;  1EDI A;  2WPR A;  3BCC G;  3GF7 A;  1YIJ P;  2KP8 A;  3LIE A;  1SQQ K;  2GUV A;  3H1H E;  5GTI H;  3FXD A;  1HUC A;  2E74 B;  1JUN A;  2Y9Y A;  1FJK A;  1YQ4 C;  2GUS A;  2IFN A;  2N9B A;  2YNY A;  3H1I J;  2HPC B;  1RE3 A;  2RKL A;  2ZVO B;  4Y28 J;  4AYC A;  2YMK A;  1SS1 A;  3A0B H;  3H1H G;  4WY4 B;  1GU4 A;  1JY2 P;  3UIA A;  1QL2 A;  2K9J A;  1R5L A;  1L0L G;  1QLE D;  1GZL A;  1IFM A;  1N7S A;  1NU1 E;  2FXP A;  2KZJ A;  1L0L K;  3AE5 C;  1VQN P;  5AVT B;  2P7J A;  3BCC J;  1P84 E;  4GOF A;  3BCC D;  3L71 J;  1JTH B;  5H2F H;  1J1D B;  1IC2 A;  1U7M A;  2B9B A;  2P2U A;  3H1K J;  3HD7 C;  4U3F E;  1VQ4 P;  2KXP B;  3CC4 P;  1JB0 J;  2FYZ A;  2Q3E A;  2ZT9 B;  3VOP A;  5GTI E;  1N7S D;  1AQ5 A;  3V5B A;  5CCH C;  2YXQ B;  3L70 E;  3RL0 D;  2JP3 A;  2H8P D;  3RK3 E;  5KLV E;  2N1T C;  2WPQ A;  3RK3 B;  1JM0 A;  1Y8A A;  2ZYG A;  5APT A;  3HUS A;  4C7N B;  2W83 C;  2XNX A;  4B86 A;  1NTZ G;  3CX5 D;  2L5G B;  1YBK A;  1SLQ A;  1J2J B;  3TGU D;  5KKZ B;  1LWU B;  2WSS H;  4HJG H;  2L91 A;  1OZH A;  2Y9Z A;  5AVR B;  1KYO E;  3D6Y A;  3L35 A;  2IYP A;  1URQ D;  2IYO A;  2HYN A;  2LKM A;  2N1T D;  1K04 A;  3GF3 A;  3OJA B;  3TNU A;  2KLV A;  2OYH A;  2WMM A;  4TLF A;  4PJ0 H;  3M0A A;  1W5C E;  3VMZ A;  2KSE A;  2NPS B;  2SPZ A;  1QL1 A;  4BWN A;  5APY A;  1KQG B;  3B8E B;  4PD4 D;  1YTZ I;  4RO0 A;  1NTZ J;  1X8Y A;  2IX7 C;  4UB6 H;  2KNC B;  2M3B A;  3L75 D;  2WT7 B;  1KD1 Q;  1BCC D;  1N7S C;  3CX5 H;  2IFM A;  1RH5 B;  3P8M C;  1LTA C;  2NPS D;  3MUD C;  4GOE A;  2MKV A;  5TJH A;  1H88 A;  1RQU A;  1HJ0 A;  2IDB A;  1S5L H;  1NGM B;  1A02 F;  3SWK A;  2RN0 A;  2C0W A;  2WZ7 A;  3O8Z A;  1LNQ A;  3A2A A;  2KI7 B;  1KYO H;  1OW8 A;  1RE3 C;  1LTG C;  1NVO A;  3LID A;  3B4S A;  1KFM A;  3L72 J;  3VP8 A;  3TF5 A;  1LTJ B;  1ZME C;  2JWA A;  3I5C A;  1N86 A;  1SQV G;  5M1B A;  3Q3D A;  1CI6 A;  1NOH A;  1FAV A;  3BAT A;  3GG2 A;  4HB1 A;  3BVH A;  3L75 G;  2WSC H;  3GMA A;  2OYO A;  3ABV C;  3CC2 P;  1BDC A;  3E1I A;  2JKV A;  4YPC A;  3G71 P;  4UB6 E;  1ZRT D;  3H1L D;  3CPW O;  4DT0 A;  3EQ2 A;  3Q2Y A;  1FZG A;  1A02 J;  3G9R A;  3II6 A;  2C9L Y;  3CX5 E;  1NHL A;  2GM4 A;  1RE4 C;  1OFC X; 
#chains in the Genus database with same CATH homology
 3L72 G;  1SQP G;  1P84 H;  1SQX G;  4D6T G;  3CX5 H;  1BE3 G;  3BCC G;  1SQB G;  1BGY G;  1SQQ G;  3L71 G;  3H1K G;  2IBZ G;  1KYO H;  1NTZ G;  3L70 G;  3H1L G;  5KLV G;  1BCC G;  2FYU G;  3L73 G;  1PPJ G;  3H1H G;  3H1J G;  1SQV G;  4PD4 H;  1KB9 H;  1NTM G;  3TGU G;  3L75 G;  1L0L G;  4U3F G;  3L74 G;  3CWB G;  3CXH H;  2BCC G;  1L0N G;  1PP9 G;  1NU1 G;  1EZV G;  3H1I G;  1NTK G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...