3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
2IBZG 1SQXG 1NTKG 3L74G 5KLVG 1BE3G 1P84H 3L75G 3H1IG 1SQVG 1EZVG 1SQPG 2FYUG 3CXHH 1KYOH 3H1JG 1SQBG 3BCCG 3CWBG 3CX5H 1NTMG 1KB9H 1SQQG 1BCCG 4PD4H 1NTZG 4D6TG 1BGYG 1L0LG 3H1HG 3H1KG 1PPJG 2BCCG 3L73G 1NU1G 4U3FG 2A06G 3TGUG 3L71G 3L70G 3L72G 1L0NG 3H1LG 1PP9G
chains in the Genus database with same CATH superfamily
1KTMA 1YQ3C 3E7KA 3VN0A 2H7HA 3H1KD 1RQVA 1BDCA 2OYIA 4H13B 2JO1A 4BRYA 2E74C 1JOCA 1KD1Q 1SQVD 2H89C 4H0LD 1SQVE 2NRGA 2QJKC 1EDIA 1NAYA 2ZXXA 2V7QH 4NPFX 2POHA 3L37A 2JWAA 1NU1J 1SS1A 1N7SA 1LJ2A 1L0NG 1SQPJ 1OIPA 1ZMEC 2C9NY 3M0DC 5CCGA 2WITA 1LTIC 1BSHA 2OTJP 3GHGA 1DD4A 5E79H 4JQ0D 2KUBA 4W80A 2BEQD 1P84H 4H13D 4AYCA 1ZW0A 3Q5PA 2A45H 3AEEC 3VMAA 2CPSA 5KLVD 1BE3J 1OZHA 5KLVE 4YXWH 1AV1A 5KTBA 1AQTA 5TJHA 4Y99B 2FYUJ 5APUA 1K8AQ 1LTSC 1UIIA 2LXCB 1NOHA 2HFED 4B86A 1NTZE 2XU6A 2HPCB 1IFPA 4EDFA 1HJ0A 5CBNA 2WPVB 1OX3A 1SQBK 3VMZA 2OTKE 3QWOC 3S1KA 1JMMA 2H88C 1VQNP 2Q1KA 1IFMA 4H0LC 1ZR4A 3KXDA 3L70J 3R2PA 3H1LJ 2IDBA 2PRRA 1NTKJ 5AVXB 4RESB 1S9KD 2KYVA 1S9KE 3HUSB 3VTPC 3V4WA 3H1JE 1SQQD 1Y47A 5AVTB 5KLIC 3BCCG 4JBZA 2P67A 4OWFA 1SQXK 3RK2B 3EWKA 1PP9G 1NVOA 1EC5A 2BEZF 1IFDA 1L0LK 4QMAA 3SFEC 1BGYD 3CWBG 1BGYE 2YO3A 5CCHA 3CXHE 2K9YA 2SPZA 4D6TG 4H13C 1KN7A 3L75D 2BCCG 4HKZH 3TGUG 3L75E 5APWA 1NTKG 1KQSO 1U7JA 2Q3IA 2QSIA 1NTMJ 3AE8C 1LWUA 5AW3B 3MP7B 1WRGA 2W27A 3L73J 4L76A 1FJPA 1R5LA 3L71E 1PPJG 1N2DC 3ZDMA 2K3RA 3Q1MA 3GMAA 3MHVA 3O6QB 3RK2D 1L0NK 1LNQA 1OFCX 1PGOA 2Q5UA 1AVYA 1IC2A 2RH0A 1A02F 1VF5B 3L4FA 3Q3DA 1KMIZ 3MD0A 2ZFCA 5KJ7D 4EYYQ 5KJ7A 1Q81Q 3P7KA 1NU1E 1NO4A 2BASA 1DX7A 4MN4C 2M5AB 3CCRP 1CW5A 1VPCA 3HD7B 2LKMA 4Y99C 5AW4B 5AW8B 3CCJP 1IK9A 1K05A 1Y8AA 1G2CA 1H0TB 1JCCA 3H1HD 3RGUA 1HBWA 2QIWA 1S1CX 1RQUA 5BU5A 1K04A 1QVFO 1EXIA 2NPSB 1JM0A 1JMBA 3CPWO 1M7LA 3H1KJ 2GUSA 1YJNP 4ZMDA 2FBWC 2IFNA 2Y9YA 1YHQP 1H8AA 1VF5D 1SQVJ 1M1JB 1BE3E 4LC1A 3L72G 1SLQA 1NH4A 5AW1B 1KFMA 2O1JA 2W6AA 3CXHI 2HODB 1BCCD 2JWDA 3HUSC 2XDJA 3A2AA 1RH5B 1K73Q 2M5AA 3CX5H 1KILE 2QJYB 2MKVA 4GT1A 3KDPB 1OW7A 3HD7D 1EQ7A 3CC2P 1JO5A 1GK6A 2N9YB 3RK2C 2IZ1A 2M8RA 3TF5A 5APVA 1LT9A 4U3FD 2A06D 4BWNA 1T2KD 3MGNA 4WB4A 2WZ7A 2NPSD 3V6IA 2KIKA 1PZQA 1FBMA 1JNMA 3JCUE 1EDLA 2K88A 3GW6A 2LR2A 4TLFA 3PLNA 3OJAB 3A3YB 3D70A 3P8CD 1M1KQ 3VMYA 1QL1A 1NTKK 1N73B 5AVWB 2GUVA 4XFJA 5KLVJ 1R8EA 1H88A 1X79B 1OW6A 3GG2A 3H32B 2R44A 2WSFH 5L8RJ 2K9JA 2QRXA 2AXTH 1GL2B 1WT6A 1JTHB 2ZVNB 1T8ZA 4XA4A 1MFZA 1Q7YQ 1RY3A 4JYCA 2QJPB 2A45G 4Z1MH 3VOPA 1YITP 1ZP0C 3FWNA 2N1TA 2B87B 3B8EB 1VF5C 3G9RA 4WBAA 4XE5B 4WVZA 3HTKA 1M8OB 3CMAP 3HD7C 1SQQJ 2KXPB 2QEXP 3CLQA 3EFFK 2R3SA 1VQ9P 3QH9A 2WPQA 3PP5A 1HF9A 1M57D 1NTZG 2P7JA 2OYIB 1Z56A 1EZVD 2B88A 1GL2D 4BRYB 1JY2O 1EZVE 1T2KC 2G8YA 4R4LA 1RF0C 1QEXA 2IFMA 2MJZA 4NPEA 2NPSC 3RL0B 1BGYJ 2HR3A 3I5CA 2KLUA 2IBZE 2AEMA 3L75J 3LIEA 2N9BA 2LXBA 3D6YA 1N7SB 3I55P 1HGZA 3SWYA 1M1JC 4IFDK 2QE7H 1HH0A 5CJ4A 1N7LA 3H1JG 1USDA 3M06A 3B4SA 3AEFC 1KYOD 1L0LG 3GHGB 3PRJA 3A0HH 2PP6A 2QJYC 2OTLP 3TNUA 3FGAD 1KB9E 1S5LH 1VQ8P 2XNDH 2OYHA 4OGQB 4H44B 1G1JA 2KZIA 1J1EB 3VMXA 4DZOA 1A02J 3L35A 3KZIE 1HVVA 1KB9H 3H1KE 3HE4A 1YJWP 2YIUB 3H1ID 3S9OA 4PD4D 3RL0D 2R32A 4PD4E 3KZIH 3L75G 4RJTA 2Y9ZA 1FS0E 1VDFA 4AUWA 3AE6C 1N7SD 1SQVK 2WMMA 2Z5HA 3G3ZA 3L71G 1N73C 2YMYA 3U59A 1M90Q 2V4HA 5CCGD 2NZ2A 4GKGA 3F5HA 3H1HJ 4WWIA 1GL2C 1LTBC 1NAFA 3GF7A 1SFCA 2WWWA 4OGQD 4H44D 3BASA 3WMM0 4L74A 4ASVA 3FX0A 1E5WA 1FZGA 3G6EP 2QJPC 1IFNA 1S2EA 1EZVI 3RBZA 2IYPA 3CCUP 1NU1G 1FAVA 3RBXA 5APXA 2KI7B 1IFJA 2P2UA 3AE5C 1KQFB 1SQPG 3B71A 1BCCJ 3AE9C 4GDOA 2IBZI 2FYZA 4N6JA 2Q6QA 2O01N 1X9VA 2KZJA 4KT0J 4WY4B 1SQBD 1GW3A 1T6AA 2OYIC 3TYYA 1SQBE 1W2EA 2YO2A 1L4AA 3FXDA 1NTZK 3KYQA 1W2BO 1IK7A 3L36A 1RF1A 4YTPC 5B5EE 1KB9I 4U3FJ 1LWUB 3RL0C 3SWKA 1RE4A 4M3LA 1VQLP 2KSJA 2QG4A 3A5TA 3VP9A 3VYIA 2Z4EA 3Q5RA 1BE3G 5B5EH 2W8ZA 1N7SC 2FYUG 5KAIE 2FFDB 1SQQE 2I1KA 2QM8A 3II6A 4PD4I 1SQXD 1GU5A 5AVUB 1USEA 4C7NB 1JB0J 2P1JA 5CCGC 2XV5A 1OVVA 1NJIQ 1OXZA 3P32A 5KAIH 1PL5A 3GHGC 4GIFA 2Q9IA 2KLVA 5H2FE 2B9BA 3R4YA 2E75B 4OGQC 4H44C 5AVZB 1PGQA 4WY4D 4WY4A 1J1EC 5CCHD 1X8YA 2W83C 3A0BE 3L70G 3H1LG 2YIUC 5AW2B 2E43A 3CXHH 3CMEP 2QM7A 3A0BH 1KQLA 2J58A 1MKMA 3AE3C 4HYTB 1G2CB 1SP4A 1YTZT 4YXDC 3CCQP 2FFDA 1JUNA 1FOSE 4C7NA 4UB8E 1L0ND 1S4XA 1PGPA 3M9HA 1L0NE 4JF7A 2M0BA 1FOSF 4EIJA 1SVFA 1HTLC 3B5NA 2E75D 2O1KA 4ASWA 1LGHB 3BRVB 2ZJSE 2L91A 3AE2C 3MUDA 1NTMG 5BVZA 1QVGO 4I6MC 3L73G 4O9BA 4UB6E 4IL6X 4IL6E 1KV4A 3EFGA 3V5BA 1NU1K 2KNCA 3H1HE 2Y0EA 2FY8A 3L74D 1J1DB 1LT9B 3L74E 1SQPK 2FXOA 2O01J 5KAFE 1GU4A 1FZCA 4PV1B 1CZQA 1DH3A 4WY4C 5CCHC 3E1RA 1AJYA 2JJLA 1JY3N 1NKNA 1LWUC 3H1IJ 3MTUE 2GA1A 2PFXA 1OMIA 2IBZG 3NTNA 3Q5SA 1AFOA 1PGJA 2R3CA 5CJ0A 1LP1A 1BCCE 3C8VA 4OH8B 2K9JB 2AXCA 2FFDC 3WUVA 3CI9A 2FYUK 5KKZB 2VRSA 4AQRD 1N8RQ 2CPBA 3BCCD 1D7MA 3BCCE 3OA7A 1LTGC 1MFTA 1KILA 3CCLP 2E75C 1W5CE 4DT0A 1PP9D 1FDIA 4U3FE 2A06E 4N3YB 2N1TB 1ZRTD 3H1KG 4PV1D 1JY3P 3S4RA 1DEEG 3CWBD 4K35A 5KJ7C 4N78D 3CWBE 1SQVG 1YTZI 1GD2E 4N78E 2Q7CA 2ZYGA 4D6TD 1LTTC 1OVUA 2BCCD 4D6TE 3HTKB 3TGUD 2RMZA 3P8CE 3JCUH 2BCCE 1UIXA 3LW5J 3PJSK 1VQ6P 1X0TA 1EXJA 1JEKA 1BDDA 1Y9BA 1PPJD 5AVQB 3JSVC 3CL3D 2JDIH 3WU2E 2Z5IA 3OAKA 2E5TA 1EDKA 1ZV8A 1VQMP 3AECC 4LLHA 2YXRB 4PJ0E 1XTCC 1URQA 1SQBJ 3WU2H 1GW4A 3F89A 3V2NA 3PTZA 2N1TD 4W7ZA 3UIAA 2IZ0A 1J2JB 3JC22 2YKOA 1FC2C 1QGKB 3E1IA 2YMKA 4OVNF 1IFIA 3Q2YA 5KLVG 5TISE 1NTMK 3TNUB 1KC8Q 3BVHA 3U1CA 2OYHB 3H6PA 3SWFA 2XKMA 1SQXJ 4R4MA 2R5DA 3N7NA 5AVYB 1J1DC 1LT9C 3CD6P 3HE4B 1VQ7P 3ITKA 2YNYA 1HGVA 2E42A 4PV1C 3NXSA 4W7YA 3M0DA 4KJMA 3RK3B 2ITAA 2FXMA 2DW3A 3HE5A 3CCMP 5GTHE 3T97A 2WT7A 3L72D 1NKZB 3L72E 1SQQG 5EFWB 2RN0A 5GTHH 1NWQA 1KYOE 2PAJA 4RKUJ 1SFCB 3PHLA 4I7ZB 1KQGB 5KKZC 3BATA 3W68A 5C39A 1FE6A 1KYOH 4KHXA 3CC4P 1ZN5A 1L2PA 1L0NJ 2O01H 3HRNA 1BGYG 1FJKA 5APYA 3K5BA 2N1TC 2O3JA 3H1IE 3TDKA 3AEDC 3CCVP 5AVRB 1LTJB 3RK3D 2KP8A 2WSCJ 2WPSA 3IR9A 1IO4A 3RK3E 4PD4H 3GF3A 2OYOA 2WSEJ 2FXPA 2ZT9B 1FZFA 2YXQB 3N4XA 2W90A 3VP8A 1VQKP 3FXEA 2KS1A 5CHXA 1L4AB 1M56D 5K5GB 2I8DA 1SFCD 5E79E 3L74J 1RF1B 1GMJA 4JYBA 3V4QA 2HLOA 4U7JA 5AW9B 1H89A 1S72P 2M3BA 1P84D 1P84E 2C0XA 3D71A 1QX8A 3M0AA 1VQ5P 2H8PD 1NGMB 1PIXA 2WTYA 2JKVA 1LTJA 4HJGH 4YPCA 5AW7B 3LW5H 2AEJA 5KLVK 1KZUB 4IOIH 2OYHC 3H1HG 3KQGA 2ZT9D 2J5UA 2ZXEB 3EQ2A 3L74G 2KSEA 3BCCJ 1S3JA 2Y0DA 1KFNA 3RL0g 1L4AD 1NTZD 1KYOI 2IPPA 3G71P 2P10A 1PP9J 1XTGB 2IX7C 3O8ZA 1HWTC 3RK3C 3AEGC 3CWBJ 4I1LA 2KB7P 1VQ4P 3M91A 4D6TJ 1FDMA 2BCCJ 3PH0A 3TGUJ 1BCCG 4L75A 1SQXE 4EI2A 3SFDC 2KOGA 3H1JD 1ZXGA 2RKLA 1QL2A 1VQPP 3NFQA 1SQQK 3B5NB 1SFCC 2WSFJ 1L0LD 5AW0B 4I7ZC 2L5GB 1L0LE 2ZVOB 4GOFA 1FZAA 5H2FH 2B89A 3P8MC 3AE1C 4U3FG 2A06G 2OQQA 2I1JA 2Q3EA 2UWJE 2ZYDA 1MZ9A 2M3EA 2HPCA 1AA0A 1U57A 3D6ZA 3CXHD 1LTJC 5AVVB 1YIJP 4C46A 2KNCB 3LIDA 2C0WA 3OW2O 3M9BA 1P84I 1ZOYC 2D2CB 1Q90D 2A45I 2OARA 2ZT9C 4DJGA 2JEEA 1FZCB 1DD3A 3L71D 4RO0A 3HUSA 1WMKA 2KK7A 1L4AC 1CI6B 1YBKA 1IJDB 3U1AA 2K1AA 3B5ND 4GOEA 1RF1C 4UB8H 1RE4C 5M1BA 1Q2NA 1FU1A 2CK3H 1LP1B 1YYCA 2XNXA 2WSCH 5APQA 4A7PA 1CSBA 4IFFA 1TU3F 1NU1D 2Y0CA 4UB6H 3L72J 3WUUA 3CCSP 2WSEH 1KILB 4IL6H 1PFIA 1YJ9P 2D2CD 1SQPD 1DEBA 1SQPE 1GTWA 3H25A 5APSA 1EZVG 1NHLA 1IZNB 1CI6A 2XZRA 4CPGA 5KAFH 2FYNB 4TT3H 2H43A 1HUCA 3TK1A 3O6QA 2W6JH 3A7OA 3NMDA 1AVOA 1ZLLA 2V7QJ 2WSSH 2WQYC 1N86A 1T3UA 1FDOA 3AE7C 1BE3D 3CX5D 1RE3A 3CX5E 5AW5B 2FYUD 2ZYAA 1Q86Q 3MIWA 2FYUE 1E79H 1HJBA 4Y28J 1FZEA 3IFMA 2GM4A 2WVRA 1JY2N 2E76B 1KILD 1URQB 2E5YA 3B5NC 3SSUA 3HD7A 1KORA 1PP9E 5AW6B 1ZRTE 1H0TA 4BXLA 3G4SP 3MUDC 3USSA 4HH2A 4DOJA 2JR8A 3H1IG 3ABVC 3V2RA 2E74B 2JP3A 3WUTA 3L70D 1RF0A 3H1LD 3L70E 3TGUE 2QJKB 2NPSA 3H1LE 1NTKD 2ZAEB 1NTKE 3AE4C 1DIPA 1PV3A 3CCEP 1T3JA 2OGUA 5AVSB 2G3AA 2D2CC 1M1JA 1JY2P 1PPJE 2AXTE 1QLED 2YKQA 1ZR2A 1VL2A 1FZCC 3W67A 3C1LA 3I56P 4LGDE 2HODA 2E76D 3CC7P 1URQD 4ZKUA 1BSNA 2IYOA 4ZNCA 2HYNA 1YQ4C 1NTZJ 3HE5B 3BRTB 1RHZB 3GLMA 1JCDA 4PJ0H 5B66E 3V2PA 3T97B 5CBOA 3IN6A 3C9IA 4I2LC 4JPZB 2WT7B 1AQ5A 5GTIE 1X22A 3FWLA 2E74D 1YI2P 5DJTB 1NTMD 5B66H 4K3AA 3KPEA 3IAOA 1NTME 1JY3O 4L73A 4ZKPA 4DCKA 1RE3C 3MZWB 5APTA 3L73D 1OW8A 5GTIH 1U7MA 3L73E 5TISH 1R5SA 3AEBC 3TSIA 2J59M 2W6BA 3IF4A 1KILC 3H1JJ 2YKPA 4IFMA 1EDJA 1N73A 1Q82Q 5BU8B 1MV8A 1K9MQ 1SQBG 1L0LJ 3CX5I 3H32A 2K37A 2AEFA 1VQOP 2R5BA 3M9QA 1NYHA 4HB1A 1G1IA 1LT1A 1GL2A 1JTHA 4GODA 2FYNC 4H0LB 3KHUA 2PGDA 4C7RA 1GDTA 1MUUA 1FZBA 4EOTA 1LTAC 1OWAA 3V2QA 2IBZD 2KS1B 4NPDA 2FKWB 2B87A 2WPRA 1SQXG 1GK4A 2C9LY 5KLIB 3A0HE 3AEAC 1S5LX 2QA4P 2QVAA 2P58A 1S5LE 3L71J 2E76C 1URQC 5CMZA 2HG5D 1KB9D 5DJUB 1GZLA 1OVRA
chains in the Genus database with same CATH topology
2IBZG 1SQXG 1NTKG 3L74G 5KLVG 1BE3G 1P84H 3L75G 3H1IG 1SQVG 1EZVG 1SQPG 2FYUG 3CXHH 1KYOH 3H1JG 1SQBG 3BCCG 3CWBG 3CX5H 1NTMG 1KB9H 1SQQG 1BCCG 4PD4H 1NTZG 4D6TG 1BGYG 1L0LG 3H1HG 3H1KG 1PPJG 2BCCG 3L73G 1NU1G 4U3FG 2A06G 3TGUG 3L71G 3L70G 3L72G 1L0NG 3H1LG 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBZ G;  1SQX G;  1NTK G;  3L74 G;  5KLV G;  1BE3 G;  1P84 H;  3L75 G;  3H1I G;  1SQV G;  1EZV G;  1SQP G;  2FYU G;  3CXH H;  1KYO H;  3H1J G;  1SQB G;  3BCC G;  3CWB G;  3CX5 H;  1NTM G;  1KB9 H;  1SQQ G;  1BCC G;  4PD4 H;  1NTZ G;  4D6T G;  1BGY G;  1L0L G;  3H1H G;  3H1K G;  1PPJ G;  2BCC G;  3L73 G;  1NU1 G;  4U3F G;  2A06 G;  3TGU G;  3L71 G;  3L70 G;  3L72 G;  1L0N G;  3H1L G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1KTM A;  1YQ3 C;  3E7K A;  3VN0 A;  2H7H A;  3H1K D;  1RQV A;  1BDC A;  2OYI A;  4H13 B;  2JO1 A;  4BRY A;  2E74 C;  1JOC A;  1KD1 Q;  1SQV D;  2H89 C;  4H0L D;  1SQV E;  2NRG A;  2QJK C;  1EDI A;  1NAY A;  2ZXX A;  2V7Q H;  4NPF X;  2POH A;  3L37 A;  2JWA A;  1NU1 J;  1SS1 A;  1N7S A;  1LJ2 A;  1L0N G;  1SQP J;  1OIP A;  1ZME C;  2C9N Y;  3M0D C;  5CCG A;  2WIT A;  1LTI C;  1BSH A;  2OTJ P;  3GHG A;  1DD4 A;  5E79 H;  4JQ0 D;  2KUB A;  4W80 A;  2BEQ D;  1P84 H;  4H13 D;  4AYC A;  1ZW0 A;  3Q5P A;  2A45 H;  3AEE C;  3VMA A;  2CPS A;  5KLV D;  1BE3 J;  1OZH A;  5KLV E;  4YXW H;  1AV1 A;  5KTB A;  1AQT A;  5TJH A;  4Y99 B;  2FYU J;  5APU A;  1K8A Q;  1LTS C;  1UII A;  2LXC B;  1NOH A;  2HFE D;  4B86 A;  1NTZ E;  2XU6 A;  2HPC B;  1IFP A;  4EDF A;  1HJ0 A;  5CBN A;  2WPV B;  1OX3 A;  1SQB K;  3VMZ A;  2OTK E;  3QWO C;  3S1K A;  1JMM A;  2H88 C;  1VQN P;  2Q1K A;  1IFM A;  4H0L C;  1ZR4 A;  3KXD A;  3L70 J;  3R2P A;  3H1L J;  2IDB A;  2PRR A;  1NTK J;  5AVX B;  4RES B;  1S9K D;  2KYV A;  1S9K E;  3HUS B;  3VTP C;  3V4W A;  3H1J E;  1SQQ D;  1Y47 A;  5AVT B;  5KLI C;  3BCC G;  4JBZ A;  2P67 A;  4OWF A;  1SQX K;  3RK2 B;  3EWK A;  1PP9 G;  1NVO A;  1EC5 A;  2BEZ F;  1IFD A;  1L0L K;  4QMA A;  3SFE C;  1BGY D;  3CWB G;  1BGY E;  2YO3 A;  5CCH A;  3CXH E;  2K9Y A;  2SPZ A;  4D6T G;  4H13 C;  1KN7 A;  3L75 D;  2BCC G;  4HKZ H;  3TGU G;  3L75 E;  5APW A;  1NTK G;  1KQS O;  1U7J A;  2Q3I A;  2QSI A;  1NTM J;  3AE8 C;  1LWU A;  5AW3 B;  3MP7 B;  1WRG A;  2W27 A;  3L73 J;  4L76 A;  1FJP A;  1R5L A;  3L71 E;  1PPJ G;  1N2D C;  3ZDM A;  2K3R A;  3Q1M A;  3GMA A;  3MHV A;  3O6Q B;  3RK2 D;  1L0N K;  1LNQ A;  1OFC X;  1PGO A;  2Q5U A;  1AVY A;  1IC2 A;  2RH0 A;  1A02 F;  1VF5 B;  3L4F A;  3Q3D A;  1KMI Z;  3MD0 A;  2ZFC A;  5KJ7 D;  4EYY Q;  5KJ7 A;  1Q81 Q;  3P7K A;  1NU1 E;  1NO4 A;  2BAS A;  1DX7 A;  4MN4 C;  2M5A B;  3CCR P;  1CW5 A;  1VPC A;  3HD7 B;  2LKM A;  4Y99 C;  5AW4 B;  5AW8 B;  3CCJ P;  1IK9 A;  1K05 A;  1Y8A A;  1G2C A;  1H0T B;  1JCC A;  3H1H D;  3RGU A;  1HBW A;  2QIW A;  1S1C X;  1RQU A;  5BU5 A;  1K04 A;  1QVF O;  1EXI A;  2NPS B;  1JM0 A;  1JMB A;  3CPW O;  1M7L A;  3H1K J;  2GUS A;  1YJN P;  4ZMD A;  2FBW C;  2IFN A;  2Y9Y A;  1YHQ P;  1H8A A;  1VF5 D;  1SQV J;  1M1J B;  1BE3 E;  4LC1 A;  3L72 G;  1SLQ A;  1NH4 A;  5AW1 B;  1KFM A;  2O1J A;  2W6A A;  3CXH I;  2HOD B;  1BCC D;  2JWD A;  3HUS C;  2XDJ A;  3A2A A;  1RH5 B;  1K73 Q;  2M5A A;  3CX5 H;  1KIL E;  2QJY B;  2MKV A;  4GT1 A;  3KDP B;  1OW7 A;  3HD7 D;  1EQ7 A;  3CC2 P;  1JO5 A;  1GK6 A;  2N9Y B;  3RK2 C;  2IZ1 A;  2M8R A;  3TF5 A;  5APV A;  1LT9 A;  4U3F D;  2A06 D;  4BWN A;  1T2K D;  3MGN A;  4WB4 A;  2WZ7 A;  2NPS D;  3V6I A;  2KIK A;  1PZQ A;  1FBM A;  1JNM A;  3JCU E;  1EDL A;  2K88 A;  3GW6 A;  2LR2 A;  4TLF A;  3PLN A;  3OJA B;  3A3Y B;  3D70 A;  3P8C D;  1M1K Q;  3VMY A;  1QL1 A;  1NTK K;  1N73 B;  5AVW B;  2GUV A;  4XFJ A;  5KLV J;  1R8E A;  1H88 A;  1X79 B;  1OW6 A;  3GG2 A;  3H32 B;  2R44 A;  2WSF H;  5L8R J;  2K9J A;  2QRX A;  2AXT H;  1GL2 B;  1WT6 A;  1JTH B;  2ZVN B;  1T8Z A;  4XA4 A;  1MFZ A;  1Q7Y Q;  1RY3 A;  4JYC A;  2QJP B;  2A45 G;  4Z1M H;  3VOP A;  1YIT P;  1ZP0 C;  3FWN A;  2N1T A;  2B87 B;  3B8E B;  1VF5 C;  3G9R A;  4WBA A;  4XE5 B;  4WVZ A;  3HTK A;  1M8O B;  3CMA P;  3HD7 C;  1SQQ J;  2KXP B;  2QEX P;  3CLQ A;  3EFF K;  2R3S A;  1VQ9 P;  3QH9 A;  2WPQ A;  3PP5 A;  1HF9 A;  1M57 D;  1NTZ G;  2P7J A;  2OYI B;  1Z56 A;  1EZV D;  2B88 A;  1GL2 D;  4BRY B;  1JY2 O;  1EZV E;  1T2K C;  2G8Y A;  4R4L A;  1RF0 C;  1QEX A;  2IFM A;  2MJZ A;  4NPE A;  2NPS C;  3RL0 B;  1BGY J;  2HR3 A;  3I5C A;  2KLU A;  2IBZ E;  2AEM A;  3L75 J;  3LIE A;  2N9B A;  2LXB A;  3D6Y A;  1N7S B;  3I55 P;  1HGZ A;  3SWY A;  1M1J C;  4IFD K;  2QE7 H;  1HH0 A;  5CJ4 A;  1N7L A;  3H1J G;  1USD A;  3M06 A;  3B4S A;  3AEF C;  1KYO D;  1L0L G;  3GHG B;  3PRJ A;  3A0H H;  2PP6 A;  2QJY C;  2OTL P;  3TNU A;  3FGA D;  1KB9 E;  1S5L H;  1VQ8 P;  2XND H;  2OYH A;  4OGQ B;  4H44 B;  1G1J A;  2KZI A;  1J1E B;  3VMX A;  4DZO A;  1A02 J;  3L35 A;  3KZI E;  1HVV A;  1KB9 H;  3H1K E;  3HE4 A;  1YJW P;  2YIU B;  3H1I D;  3S9O A;  4PD4 D;  3RL0 D;  2R32 A;  4PD4 E;  3KZI H;  3L75 G;  4RJT A;  2Y9Z A;  1FS0 E;  1VDF A;  4AUW A;  3AE6 C;  1N7S D;  1SQV K;  2WMM A;  2Z5H A;  3G3Z A;  3L71 G;  1N73 C;  2YMY A;  3U59 A;  1M90 Q;  2V4H A;  5CCG D;  2NZ2 A;  4GKG A;  3F5H A;  3H1H J;  4WWI A;  1GL2 C;  1LTB C;  1NAF A;  3GF7 A;  1SFC A;  2WWW A;  4OGQ D;  4H44 D;  3BAS A;  3WMM 0;  4L74 A;  4ASV A;  3FX0 A;  1E5W A;  1FZG A;  3G6E P;  2QJP C;  1IFN A;  1S2E A;  1EZV I;  3RBZ A;  2IYP A;  3CCU P;  1NU1 G;  1FAV A;  3RBX A;  5APX A;  2KI7 B;  1IFJ A;  2P2U A;  3AE5 C;  1KQF B;  1SQP G;  3B71 A;  1BCC J;  3AE9 C;  4GDO A;  2IBZ I;  2FYZ A;  4N6J A;  2Q6Q A;  2O01 N;  1X9V A;  2KZJ A;  4KT0 J;  4WY4 B;  1SQB D;  1GW3 A;  1T6A A;  2OYI C;  3TYY A;  1SQB E;  1W2E A;  2YO2 A;  1L4A A;  3FXD A;  1NTZ K;  3KYQ A;  1W2B O;  1IK7 A;  3L36 A;  1RF1 A;  4YTP C;  5B5E E;  1KB9 I;  4U3F J;  1LWU B;  3RL0 C;  3SWK A;  1RE4 A;  4M3L A;  1VQL P;  2KSJ A;  2QG4 A;  3A5T A;  3VP9 A;  3VYI A;  2Z4E A;  3Q5R A;  1BE3 G;  5B5E H;  2W8Z A;  1N7S C;  2FYU G;  5KAI E;  2FFD B;  1SQQ E;  2I1K A;  2QM8 A;  3II6 A;  4PD4 I;  1SQX D;  1GU5 A;  5AVU B;  1USE A;  4C7N B;  1JB0 J;  2P1J A;  5CCG C;  2XV5 A;  1OVV A;  1NJI Q;  1OXZ A;  3P32 A;  5KAI H;  1PL5 A;  3GHG C;  4GIF A;  2Q9I A;  2KLV A;  5H2F E;  2B9B A;  3R4Y A;  2E75 B;  4OGQ C;  4H44 C;  5AVZ B;  1PGQ A;  4WY4 D;  4WY4 A;  1J1E C;  5CCH D;  1X8Y A;  2W83 C;  3A0B E;  3L70 G;  3H1L G;  2YIU C;  5AW2 B;  2E43 A;  3CXH H;  3CME P;  2QM7 A;  3A0B H;  1KQL A;  2J58 A;  1MKM A;  3AE3 C;  4HYT B;  1G2C B;  1SP4 A;  1YTZ T;  4YXD C;  3CCQ P;  2FFD A;  1JUN A;  1FOS E;  4C7N A;  4UB8 E;  1L0N D;  1S4X A;  1PGP A;  3M9H A;  1L0N E;  4JF7 A;  2M0B A;  1FOS F;  4EIJ A;  1SVF A;  1HTL C;  3B5N A;  2E75 D;  2O1K A;  4ASW A;  1LGH B;  3BRV B;  2ZJS E;  2L91 A;  3AE2 C;  3MUD A;  1NTM G;  5BVZ A;  1QVG O;  4I6M C;  3L73 G;  4O9B A;  4UB6 E;  4IL6 X;  4IL6 E;  1KV4 A;  3EFG A;  3V5B A;  1NU1 K;  2KNC A;  3H1H E;  2Y0E A;  2FY8 A;  3L74 D;  1J1D B;  1LT9 B;  3L74 E;  1SQP K;  2FXO A;  2O01 J;  5KAF E;  1GU4 A;  1FZC A;  4PV1 B;  1CZQ A;  1DH3 A;  4WY4 C;  5CCH C;  3E1R A;  1AJY A;  2JJL A;  1JY3 N;  1NKN A;  1LWU C;  3H1I J;  3MTU E;  2GA1 A;  2PFX A;  1OMI A;  2IBZ G;  3NTN A;  3Q5S A;  1AFO A;  1PGJ A;  2R3C A;  5CJ0 A;  1LP1 A;  1BCC E;  3C8V A;  4OH8 B;  2K9J B;  2AXC A;  2FFD C;  3WUV A;  3CI9 A;  2FYU K;  5KKZ B;  2VRS A;  4AQR D;  1N8R Q;  2CPB A;  3BCC D;  1D7M A;  3BCC E;  3OA7 A;  1LTG C;  1MFT A;  1KIL A;  3CCL P;  2E75 C;  1W5C E;  4DT0 A;  1PP9 D;  1FDI A;  4U3F E;  2A06 E;  4N3Y B;  2N1T B;  1ZRT D;  3H1K G;  4PV1 D;  1JY3 P;  3S4R A;  1DEE G;  3CWB D;  4K35 A;  5KJ7 C;  4N78 D;  3CWB E;  1SQV G;  1YTZ I;  1GD2 E;  4N78 E;  2Q7C A;  2ZYG A;  4D6T D;  1LTT C;  1OVU A;  2BCC D;  4D6T E;  3HTK B;  3TGU D;  2RMZ A;  3P8C E;  3JCU H;  2BCC E;  1UIX A;  3LW5 J;  3PJS K;  1VQ6 P;  1X0T A;  1EXJ A;  1JEK A;  1BDD A;  1Y9B A;  1PPJ D;  5AVQ B;  3JSV C;  3CL3 D;  2JDI H;  3WU2 E;  2Z5I A;  3OAK A;  2E5T A;  1EDK A;  1ZV8 A;  1VQM P;  3AEC C;  4LLH A;  2YXR B;  4PJ0 E;  1XTC C;  1URQ A;  1SQB J;  3WU2 H;  1GW4 A;  3F89 A;  3V2N A;  3PTZ A;  2N1T D;  4W7Z A;  3UIA A;  2IZ0 A;  1J2J B;  3JC2 2;  2YKO A;  1FC2 C;  1QGK B;  3E1I A;  2YMK A;  4OVN F;  1IFI A;  3Q2Y A;  5KLV G;  5TIS E;  1NTM K;  3TNU B;  1KC8 Q;  3BVH A;  3U1C A;  2OYH B;  3H6P A;  3SWF A;  2XKM A;  1SQX J;  4R4M A;  2R5D A;  3N7N A;  5AVY B;  1J1D C;  1LT9 C;  3CD6 P;  3HE4 B;  1VQ7 P;  3ITK A;  2YNY A;  1HGV A;  2E42 A;  4PV1 C;  3NXS A;  4W7Y A;  3M0D A;  4KJM A;  3RK3 B;  2ITA A;  2FXM A;  2DW3 A;  3HE5 A;  3CCM P;  5GTH E;  3T97 A;  2WT7 A;  3L72 D;  1NKZ B;  3L72 E;  1SQQ G;  5EFW B;  2RN0 A;  5GTH H;  1NWQ A;  1KYO E;  2PAJ A;  4RKU J;  1SFC B;  3PHL A;  4I7Z B;  1KQG B;  5KKZ C;  3BAT A;  3W68 A;  5C39 A;  1FE6 A;  1KYO H;  4KHX A;  3CC4 P;  1ZN5 A;  1L2P A;  1L0N J;  2O01 H;  3HRN A;  1BGY G;  1FJK A;  5APY A;  3K5B A;  2N1T C;  2O3J A;  3H1I E;  3TDK A;  3AED C;  3CCV P;  5AVR B;  1LTJ B;  3RK3 D;  2KP8 A;  2WSC J;  2WPS A;  3IR9 A;  1IO4 A;  3RK3 E;  4PD4 H;  3GF3 A;  2OYO A;  2WSE J;  2FXP A;  2ZT9 B;  1FZF A;  2YXQ B;  3N4X A;  2W90 A;  3VP8 A;  1VQK P;  3FXE A;  2KS1 A;  5CHX A;  1L4A B;  1M56 D;  5K5G B;  2I8D A;  1SFC D;  5E79 E;  3L74 J;  1RF1 B;  1GMJ A;  4JYB A;  3V4Q A;  2HLO A;  4U7J A;  5AW9 B;  1H89 A;  1S72 P;  2M3B A;  1P84 D;  1P84 E;  2C0X A;  3D71 A;  1QX8 A;  3M0A A;  1VQ5 P;  2H8P D;  1NGM B;  1PIX A;  2WTY A;  2JKV A;  1LTJ A;  4HJG H;  4YPC A;  5AW7 B;  3LW5 H;  2AEJ A;  5KLV K;  1KZU B;  4IOI H;  2OYH C;  3H1H G;  3KQG A;  2ZT9 D;  2J5U A;  2ZXE B;  3EQ2 A;  3L74 G;  2KSE A;  3BCC J;  1S3J A;  2Y0D A;  1KFN A;  3RL0 g;  1L4A D;  1NTZ D;  1KYO I;  2IPP A;  3G71 P;  2P10 A;  1PP9 J;  1XTG B;  2IX7 C;  3O8Z A;  1HWT C;  3RK3 C;  3AEG C;  3CWB J;  4I1L A;  2KB7 P;  1VQ4 P;  3M91 A;  4D6T J;  1FDM A;  2BCC J;  3PH0 A;  3TGU J;  1BCC G;  4L75 A;  1SQX E;  4EI2 A;  3SFD C;  2KOG A;  3H1J D;  1ZXG A;  2RKL A;  1QL2 A;  1VQP P;  3NFQ A;  1SQQ K;  3B5N B;  1SFC C;  2WSF J;  1L0L D;  5AW0 B;  4I7Z C;  2L5G B;  1L0L E;  2ZVO B;  4GOF A;  1FZA A;  5H2F H;  2B89 A;  3P8M C;  3AE1 C;  4U3F G;  2A06 G;  2OQQ A;  2I1J A;  2Q3E A;  2UWJ E;  2ZYD A;  1MZ9 A;  2M3E A;  2HPC A;  1AA0 A;  1U57 A;  3D6Z A;  3CXH D;  1LTJ C;  5AVV B;  1YIJ P;  4C46 A;  2KNC B;  3LID A;  2C0W A;  3OW2 O;  3M9B A;  1P84 I;  1ZOY C;  2D2C B;  1Q90 D;  2A45 I;  2OAR A;  2ZT9 C;  4DJG A;  2JEE A;  1FZC B;  1DD3 A;  3L71 D;  4RO0 A;  3HUS A;  1WMK A;  2KK7 A;  1L4A C;  1CI6 B;  1YBK A;  1IJD B;  3U1A A;  2K1A A;  3B5N D;  4GOE A;  1RF1 C;  4UB8 H;  1RE4 C;  5M1B A;  1Q2N A;  1FU1 A;  2CK3 H;  1LP1 B;  1YYC A;  2XNX A;  2WSC H;  5APQ A;  4A7P A;  1CSB A;  4IFF A;  1TU3 F;  1NU1 D;  2Y0C A;  4UB6 H;  3L72 J;  3WUU A;  3CCS P;  2WSE H;  1KIL B;  4IL6 H;  1PFI A;  1YJ9 P;  2D2C D;  1SQP D;  1DEB A;  1SQP E;  1GTW A;  3H25 A;  5APS A;  1EZV G;  1NHL A;  1IZN B;  1CI6 A;  2XZR A;  4CPG A;  5KAF H;  2FYN B;  4TT3 H;  2H43 A;  1HUC A;  3TK1 A;  3O6Q A;  2W6J H;  3A7O A;  3NMD A;  1AVO A;  1ZLL A;  2V7Q J;  2WSS H;  2WQY C;  1N86 A;  1T3U A;  1FDO A;  3AE7 C;  1BE3 D;  3CX5 D;  1RE3 A;  3CX5 E;  5AW5 B;  2FYU D;  2ZYA A;  1Q86 Q;  3MIW A;  2FYU E;  1E79 H;  1HJB A;  4Y28 J;  1FZE A;  3IFM A;  2GM4 A;  2WVR A;  1JY2 N;  2E76 B;  1KIL D;  1URQ B;  2E5Y A;  3B5N C;  3SSU A;  3HD7 A;  1KOR A;  1PP9 E;  5AW6 B;  1ZRT E;  1H0T A;  4BXL A;  3G4S P;  3MUD C;  3USS A;  4HH2 A;  4DOJ A;  2JR8 A;  3H1I G;  3ABV C;  3V2R A;  2E74 B;  2JP3 A;  3WUT A;  3L70 D;  1RF0 A;  3H1L D;  3L70 E;  3TGU E;  2QJK B;  2NPS A;  3H1L E;  1NTK D;  2ZAE B;  1NTK E;  3AE4 C;  1DIP A;  1PV3 A;  3CCE P;  1T3J A;  2OGU A;  5AVS B;  2G3A A;  2D2C C;  1M1J A;  1JY2 P;  1PPJ E;  2AXT E;  1QLE D;  2YKQ A;  1ZR2 A;  1VL2 A;  1FZC C;  3W67 A;  3C1L A;  3I56 P;  4LGD E;  2HOD A;  2E76 D;  3CC7 P;  1URQ D;  4ZKU A;  1BSN A;  2IYO A;  4ZNC A;  2HYN A;  1YQ4 C;  1NTZ J;  3HE5 B;  3BRT B;  1RHZ B;  3GLM A;  1JCD A;  4PJ0 H;  5B66 E;  3V2P A;  3T97 B;  5CBO A;  3IN6 A;  3C9I A;  4I2L C;  4JPZ B;  2WT7 B;  1AQ5 A;  5GTI E;  1X22 A;  3FWL A;  2E74 D;  1YI2 P;  5DJT B;  1NTM D;  5B66 H;  4K3A A;  3KPE A;  3IAO A;  1NTM E;  1JY3 O;  4L73 A;  4ZKP A;  4DCK A;  1RE3 C;  3MZW B;  5APT A;  3L73 D;  1OW8 A;  5GTI H;  1U7M A;  3L73 E;  5TIS H;  1R5S A;  3AEB C;  3TSI A;  2J59 M;  2W6B A;  3IF4 A;  1KIL C;  3H1J J;  2YKP A;  4IFM A;  1EDJ A;  1N73 A;  1Q82 Q;  5BU8 B;  1MV8 A;  1K9M Q;  1SQB G;  1L0L J;  3CX5 I;  3H32 A;  2K37 A;  2AEF A;  1VQO P;  2R5B A;  3M9Q A;  1NYH A;  4HB1 A;  1G1I A;  1LT1 A;  1GL2 A;  1JTH A;  4GOD A;  2FYN C;  4H0L B;  3KHU A;  2PGD A;  4C7R A;  1GDT A;  1MUU A;  1FZB A;  4EOT A;  1LTA C;  1OWA A;  3V2Q A;  2IBZ D;  2KS1 B;  4NPD A;  2FKW B;  2B87 A;  2WPR A;  1SQX G;  1GK4 A;  2C9L Y;  5KLI B;  3A0H E;  3AEA C;  1S5L X;  2QA4 P;  2QVA A;  2P58 A;  1S5L E;  3L71 J;  2E76 C;  1URQ C;  5CMZ A;  2HG5 D;  1KB9 D;  5DJU B;  1GZL A;  1OVR A; 
#chains in the Genus database with same CATH homology
 2IBZ G;  1SQX G;  1NTK G;  3L74 G;  5KLV G;  1BE3 G;  1P84 H;  3L75 G;  3H1I G;  1SQV G;  1EZV G;  1SQP G;  2FYU G;  3CXH H;  1KYO H;  3H1J G;  1SQB G;  3BCC G;  3CWB G;  3CX5 H;  1NTM G;  1KB9 H;  1SQQ G;  1BCC G;  4PD4 H;  1NTZ G;  4D6T G;  1BGY G;  1L0L G;  3H1H G;  3H1K G;  1PPJ G;  2BCC G;  3L73 G;  1NU1 G;  4U3F G;  2A06 G;  3TGU G;  3L71 G;  3L70 G;  3L72 G;  1L0N G;  3H1L G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...