3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
1EZVG 1NU1G 1BE3G 3H1HG 3CX5H 1NTKG 3H1LG 3L75G 1SQPG 3L73G 3BCCG 1L0LG 4PD4H 1P84H 4D6TG 1L0NG 3L70G 3L74G 3L72G 1KYOH 3CXHH 4U3FG 3L71G 2FYUG 3H1JG 1SQVG 1SQQG 3CWBG 2IBZG 1BGYG 1NTZG 2A06G 1KB9H 1PPJG 1SQXG 1NTMG 1BCCG 3TGUG 1SQBG 3H1KG 2BCCG 1PP9G 5KLVG 3H1IG
chains in the Genus database with same CATH superfamily
3M0DA 1MFZA 3HE4A 2K9YA 2KZIA 3V4WA 3CX5I 1L0LG 1R8EA 2WTYA 3CCEP 3CCSP 1G2CB 1VQ5P 3A5TA 1FDMA 2I8DA 2IBZI 2YO2A 3OAKA 4BRYB 1M57D 1GU4A 1G1IA 2YIUC 2E76B 1EQ7A 5AVTB 1R5LA 2C0XA 1QX8A 2B9BA 5KAIH 4C46A 1JY2N 1SVFA 1NKZB 5KLVD 1L0LK 2KSEA 2AXCA 2ZAEB 3AE7C 5H2FH 3BRVB 1G2CA 3H32A 4D6TG 1LP1B 2WSCJ 1OW7A 1ZRTE 2XKMA 4BRYA 2WSSH 2Q3IA 3S4RA 3CC4P 2WPSA 1NTMD 3MHVA 1IFPA 3VMZA 3B71A 2R3SA 3VOPA 5KJ7C 2QM8A 3GHGC 5KLVJ 3TYYA 3PRJA 3S9OA 1W2EA 2I1KA 1PPJD 1XTGB 3P7KA 5KKZB 4ASWA 1KC8Q 2C9NY 1IO4A 2QJKC 1UIIA 1LP1A 1T3JA 3FGAD 3N4XA 1EDJA 4WY4D 2D2CC 2XZRA 3IFMA 3L71D 4PV1B 1SQQD 1JMMA 1S9KD 1HF9A 1L0NJ 1ZW0A 1Q2NA 1NU1D 1NTME 2JO1A 4HJGH 3F89A 1E5WA 1P84H 1N2DC 5K5GB 1GZLA 4JYCA 2J59M 1M1JB 2OQQA 2LXCB 1W2BO 3L71J 1KILD 1PPJE 2NPSC 3M91A 3IAOA 4I7ZB 5CCHD 1P84I 2QA4P 1BE3J 4TLFA 3HD7C 4U3FD 1LTAC 3CWBG 3CCLP 1LT9B 2K3RA 4H13D 2OGUA 3KZIH 4EYYQ 3TGUD 2E75C 1SQQE 2KP8A 3B4SA 1NU1E 1EDIA 3NTNA 2PGDA 4AYCA 4ZMDA 4XA4A 1OZHA 2ZYGA 4KJMA 5AVXB 2W8ZA 2CPBA 5E79H 3TGUJ 1NTKG 3FXDA 1AVOA 1PFIA 2XNDH 1LT9A 2ZT9D 2YIUB 1BDCA 3GF7A 1KILE 2SPZA 1KYOH 4W80A 2FBWC 2FYUG 3AEDC 2AXTH 2YO3A 3G6EP 1FZBA 1K9MQ 1RF0C 1KQFB 2K9JB 4U3FE 2FYNC 2WVRA 2Y0EA 3CI9A 3TGUE 4GDOA 3USSA 5B66H 1PZQA 3RL0C 1CZQA 1H89A 2YMKA 5AW7B 1YIJP 2HYNA 4ZNCA 3V6IA 4NPDA 5C39A 1NTKK 2ZVNB 2YKQA 2E42A 1L0LD 5AVYB 2E43A 2JR8A 4OH8B 2N1TC 5KTBA 3KHUA 2OYOA 1HGVA 1BDDA 5TJHA 1VQ4P 2QJKB 3AEAC 2PRRA 2DW3A 1ZV8A 2D2CB 2A06G 1L0LJ 4KT0J 3TSIA 2WPQA 3VMYA 4WY4C 5KJ7A 2KI7B 3Q3DA 2XNXA 5KAFE 4D6TD 3CXHD 1QVFO 2XV5A 2WMMA 3TF5A 1L0LE 1LJ2A 1JOCA 3AE5C 4Z1MH 5AVSB 1U57A 1S5LH 1ZP0C 3S1KA 2NPSB 1KZUB 3L4FA 1SLQA 3HD7B 4D6TJ 2KLUA 3PLNA 2NRGA 1SQXJ 2WSCH 3OJAB 2V7QJ 4H13C 3VP8A 4H44D 3L74G 3N7NA 3V5BA 1GW3A 5AW6B 3TNUB 3SFDC 4DT0A 1BSHA 4D6TE 3CXHE 1ZXGA 5BU8B 3RK2D 2NPSA 3H1ID 3H1LG 2E5YA 1FAVA 5KLIC 3HD7A 1CW5A 1HGZA 1VQPP 1PL5A 1DEBA 4RESB 3HE5B 1WRGA 1KFNA 1Y9BA 2ZVOB 3VN0A 2ZT9C 1NTZJ 3SFEC 2FYNB 1JMBA 2AEJA 3TNUA 2RH0A 4I2LC 5CCGD 3BCCG 2IPPA 3H1IJ 1FOSE 1MUUA 2Z4EA 1GL2D 2LXBA 3CWBD 1K73Q 1HUCA 3NMDA 3D6ZA 2WQYC 3MTUE 3P32A 4H0LD 3F5HA 3K5BA 1IFJA 2Q3EA 3VTPC 3HE5A 3H1JG 3M0AA 1RF0A 3EFGA 2OARA 1YITP 1PP9G 3CWBJ 2N1TB 1FC2C 3M9QA 4C7NB 5APWA 3L75G 1NTKD 5AW4B 2AEMA 1IFMA 4JF7A 5AVZB 2OYIC 2QSIA 3O6QB 2IFMA 2FYUD 4NPFX 2P2UA 4IL6H 4BXLA 4GOFA 3CWBE 2V4HA 2WPVB 1KTMA 4WY4B 3B5ND 4YTPC 2ITAA 4W7ZA 2J5UA 3W68A 2H89C 2IBZG 2KSJA 1NVOA 2O1KA 1RQVA 4A7PA 1NJIQ 4Y99B 2W6BA 3AEFC 3AE3C 1X0TA 3H1HG 2LKMA 3O6QA 1L4AD 1NKNA 4PD4I 1LT9C 1NTKE 5AW2B 1KQLA 1AA0A 2O3JA 3V2NA 2E74D 4WY4A 1OVUA 1GK6A 2R44A 2RMZA 1JY3O 2OTLP 5TISE 2FYUE 3M9HA 3OW2O 3G71P 3L36A 1ZRTD 1AJYA 3KYQA 2Y0DA 4H13B 2A45H 2OTJP 2YXQB 2Z5IA 3H32B 3FXEA 2A06D 1H0TB 2K1AA 1VPCA 2K88A 4YXWH 3SWKA 3RK3C 1GTWA 3G9RA 4L76A 5APUA 2N9YB 3E1IA 5KLIB 1LTGC 2UWJE 1QGKB 1M56D 4EI2A 2O01J 1BCCG 2H8PD 3H1KG 2B88A 3CCMP 5CCHA 1CI6B 5KAFH 1CSBA 1TU3F 1RE3C 4PJ0E 2ZT9B 1OIPA 4XFJA 1DEEG 3AECC 1KN7A 1H0TA 1JUNA 1FJKA 4DZOA 1Y47A 1YJWP 1ZMEC 5CCGC 2VRSA 2WT7B 1DD3A 3L35A 3QH9A 2A06E 5B5EH 1GL2C 5AW0B 2HPCB 3E1RA 5AVVB 4HKZH 5APYA 4HB1A 1CI6A 1LT1A 2WPRA 1YQ4C 3AE2C 3AE9C 4GT1A 3PHLA 3A0HE 2Q9IA 1YTZI 1NTMJ 4GKGA 4L73A 3U1CA 3H1LD 1KD1Q 2Y9YA 2YNYA 4XE5B 1T6AA 3CXHH 2OYIB 1KB9D 2XU6A 2WT7A 2QJYC 1T8ZA 2HPCA 3OA7A 1VF5C 2V7QH 1EZVG 3WU2E 1ZOYC 2C9LY 3M9BA 3FWLA 2W27A 3BCCD 2OYHC 1FZFA 3H1LJ 1Q81Q 2PP6A 3B5NC 3CC7P 5AW9B 2R5BA 5CBOA 2G3AA 3L74E 1N7SD 1SQQJ 3MZWB 3V4QA 2OYIA 3C1LA 2RKLA 4ZKPA 1S1CX 1M1KQ 2YXRB 1NU1J 4ZKUA 1K8AQ 3H1JD 3L37A 1NH4A 3H1LE 3BCCJ 1YQ3C 3WUTA 1PP9D 2P1JA 1IC2A 1T3UA 5APTA 1L4AC 3Q1MA 1KB9E 1RE4A 1X22A 4M3LA 2I1JA 3L75D 1K05A 1EZVI 4WB4A 2B89A 2LR2A 1W5CE 2ZFCA 1FJPA 3H25A 3NFQA 1DIPA 1SQBG 3BCCE 2CPSA 2JWDA 4U3FJ 1GMJA 1VQOP 1ZLLA 3CX5D 3PTZA 1PP9J 1IFNA 1EXJA 1HVVA 1SS1A 3RK3B 3A0BE 5APXA 1HH0A 4RKUJ 2W6AA 3RBZA 2IBZD 4C7RA 3RK2B 1UIXA 2WSFJ 3H1JE 1FS0E 1JNMA 4KHXA 3H1HD 2C0WA 1DD4A 3AE6C 4GODA 1PP9E 3CCUP 3Q5RA 2Q5UA 1N73C 1SQBK 1U7JA 2L91A 1KYOI 3L75E 2RN0A 4WBAA 2AEFA 4N3YB 4W7YA 2IZ1A 2O1JA 1PIXA 1JCDA 2KZJA 1JY3N 1AVYA 2BEZF 3QWOC 4R4MA 1GL2B 2FYUK 3U59A 3ZDMA 1RH5B 2WITA 3H1HJ 1MV8A 3CX5E 1KV4A 1YBKA 1RE3A 3GLMA 1MFTA 2IBZE 4N78D 5GTHE 3L73G 3AE8C 1YTZT 3W67A 3H1HE 2O01N 1VQMP 2QJPC 5CCGA 1BCCD 3H1KD 3KPEA 2QJYB 1FDIA 1GL2A 2QIWA 3I56P 1VF5B 1VQ6P 2WWWA 3Q5PA 3U1AA 3Q5SA 4IOIH 2KLVA 2OYHB 1JEKA 2IX7C 4PJ0H 1RQUA 1PGJA 4Y99C 3CLQA 3WMM0 2KB7P 3B5NB 3LIEA 1QL1A 1BCCJ 3H1KJ 2BCCE 5DJUB 5KAIE 2ZYAA 2O01H 1Q86Q 2J58A 1OVRA 4N78E 1N7SC 3LIDA 1EDLA 1BGYG 2M8RA 1KILC 1NAYA 2ZXXA 1JCCA 4RO0A 5KLVG 1G1JA 5DJTB 5CCHC 1M7LA 3SSUA 3VP9A 2OTKE 1L4AB 1BCCE 2OYHA 2FKWB 3H1KE 3HUSA 4OGQD 1P84D 1A02F 4JQ0D 2NZ2A 3B5NA 2ZYDA 4AQRD 1S3JA 2R3CA 4RJTA 4L74A 3R2PA 1J2JB 1GDTA 1L0NG 1MZ9A 1OW6A 2IFNA 1T2KD 2KYVA 3M06A 2QE7H 3WU2H 2E5TA 4WWIA 1L4AA 2Y9ZA 4EDFA 5BU5A 1VQKP 1IZNB 3P8CD 1RY3A 3C8VA 3L71G 1N73B 5AVRB 1P84E 2KIKA 4DCKA 3LW5J 2KNCB 4AUWA 1YHQP 3ABVC 2WSEH 1BE3G 1L0NK 2Y0CA 3Q2YA 3JCUE 1IFIA 4IFMA 3CD6P 2G8YA 1EZVE 1LNQA 3PP5A 1KB9H 4OWFA 1IK7A 1SQBD 4NPEA 1RF1C 5CJ4A 3KZIE 1QVGO 1NOHA 1X79B 1YJ9P 1SP4A 1JY2P 2M0BA 1M8OB 1JTHB 1N73A 3EWKA 4ASVA 2KNCA 1SFCD 3GG2A 3P8CE 2D2CD 2QJPB 3A0BH 1KORA 4YXDC 1SQBJ 1K04A 2YKPA 1RE4C 1OXZA 1U7MA 3BATA 2H88C 1NTKJ 1VL2A 1KYOE 5CJ0A 2AXTE 2FYUJ 1JTHA 2IYPA 2Q7CA 1LWUC 1SQBE 1OX3A 4R4LA 5AVQB 2A45G 4HYTB 2GA1A 2Q6QA 2WSFH 2YKOA 1N7SB 2B87B 3H6PA 1KILB 2JEEA 2QRXA 3FWNA 3CX5H 2W6JH 2E75D 5AVWB 1AV1A 4IFFA 3L73D 3JC22 1NGMB 3L72G 1Y8AA 2IYOA 1KMIZ 3BRTB 1FZCC 1Q90D 1FBMA 2BCCG 1MKMA 3CMAP 4H44C 1IFDA 4K3AA 3AE4C 3CCRP 3KXDA 3VMXA 3VYIA 1N7SA 2HFED 2B87A 3UIAA 3KDPB 2M3EA 1JO5A 3ITKA 1KILA 1SQVG 3L73J 3RK2C 2A45I 2Z5HA 1URQD 2H43A 3V2QA 2KUBA 1NO4A 3AEBC 1T2KC 2KXPB 1OVVA 3IN6A 2Q1KA 3L73E 1BGYD 3RL0D 1VQ9P 1YI2P 1EXIA 4LC1A 1R5SA 1HWTC 2FYZA 2GUVA 3HTKB 5AVUB 5EFWB 3MIWA 3GMAA 2ZXEB 1SQVK 3L70G 2H7HA 3L74D 1S5LE 1SQXG 4EIJA 3AEEC 4H0LC 1EDKA 1BGYJ 3MUDA 2FFDB 1RF1B 2N1TD 3SWFA 1LGHB 2IDBA 1YYCA 1L0ND 2HR3A 5GTIE 2FY8A 1JB0J 3HTKA 3IF4A 1HJ0A 3L74J 1BGYE 2KOGA 1SQPG 1SFCC 1JY3P 5KLVE 2WSEJ 3HUSC 1SQXK 5AW1B 2WZ7A 1XTCC 2QEXP 2GUSA 3CXHI 1LTSC 1NTZG 4L75A 4UB6E 2FFDA 1RF1A 3H1IG 3A7OA 3MP7B 1BE3D 4BWNA 1IJDB 1AQTA 3I55P 1LWUB 2M5AB 3JCUH 1L0NE 1OMIA 3AE1C 1SQPK 1L2PA 1USEA 3P8MC 3GF3A 4PD4D 1NTZK 1LTJC 2E74C 1HBWA 3LW5H 2QM7A 1N86A 1FZCB 1GD2E 3H1JJ 3L71E 1GU5A 2CK3H 1LWUA 4OGQB 4WVZA 1LTBC 1S9KE 3II6A 2IZ0A 1VQNP 2P58A 2FXOA 2BASA 4H44B 4EOTA 2M5AA 3WUUA 2YMYA 1PGQA 3D71A 1M1JA 4UB8E 2E76D 4IFDK 1OWAA 1BE3E 2PAJA 3L75J 1DX7A 1EC5A 1HTLC 1PV3A 2JKVA 3CPWO 1LTIC 3WUVA 1FZEA 4IL6E 2MJZA 2MKVA 2BEQD 3V2RA 1KQSO 1URQC 1FZCA 2P7JA 1S72P 2L5GB 1E79H 1GK4A 4PD4E 5AW5B 2KK7A 1VDFA 2ZJSE 2M3BA 1S4XA 2HODB 1S2EA 1Z56A 3A2AA 1QL2A 3CMEP 3L72D 1LTTC 1KFMA 1D7MA 5TISH 2W90A 1ZR4A 2JWAA 2BCCD 2KS1B 3CL3D 4H0LB 1AQ5A 1QLED 2FXMA 3GHGB 2K9JA 1SQVD 4GIFA 4N6JA 1N8RQ 3AEGC 3L72J 4PV1D 2HODA 3BASA 4LGDE 2BCCJ 4TT3H 3MD0A 5CHXA 1NAFA 3G3ZA 1FOSF 1SFCB 3RL0g 4MN4C 1H88A 1HJBA 3HUSB 2KS1A 1ZR2A 3BVHA 1FZAA 4CPGA 3L72E 1SQVJ 4I1LA 4HH2A 3GHGA 3O8ZA 1FU1A 3M0DC 1OFCX 3VMAA 4O9BA 3L70D 5H2FE 1J1EC 1JY2O 1SQXD 1FDOA 2K37A 3IR9A 1J1DC 3GW6A 1SQVE 3CCVP 2QG4A 1SFCA 1VQLP 5CBNA 3T97B 5B5EE 3PJSK 1LTJB 3KQGA 2E74B 4LLHA 4DJGA 1RHZB 3A0HH 1NTMG 3L70J 2QVAA 1PGOA 3D70A 2E75B 2JDIH 5APQA 5GTIH 2JP3A 1EZVD 1S5LX 4K35A 1SQPD 3R4YA 1H8AA 1PGPA 3RK3D 3I5CA 2GM4A 1FZGA 3CC2P 4JBZA 1PPJG 1NTZD 3FX0A 5CMZA 5KLVK 4DOJA 1ZN5A 1NHLA 1WMKA 3L70E 2E76C 3T97A 1SQXE 2HG5D 3MUDC 3NXSA 1LTJA 4UB6H 5L8RJ 1NTMK 3JSVC 1SQPJ 1SQQG 1NWQA 1URQB 3D6YA 2R5DA 4U7JA 1OW8A 1NU1G 5BVZA 1Q82Q 3C9IA 1KYOD 3RL0B 5KJ7D 1SQPE 3B8EB 1NYHA 1KQGB 3EQ2A 1BSNA 4Y28J 3RK3E 1USDA 2FFDC 2HLOA 1M90Q 1NTZE 1IK9A 1A02J 2R32A 1SQQK 4GOEA 3HRNA 1URQA 3RGUA 4U3FG 3H1IE 2P67A 3G4SP 3CCJP 1YJNP 1VQ8P 3TGUG 5KKZC 1KB9I 1NU1K 1X9VA 4I6MC 4JPZB 4UB8H 4JYBA 3TDKA 2JJLA 2P10A 1VF5D 1AFOA 5AW8B 1FE6A 4PV1C 5E79E 3V2PA 2N9BA 5M1BA 2PFXA 1DH3A 1GW4A 3RBXA 3EFFK 2POHA 1JM0A 5APVA 2XDJA 1X8YA 4PD4H 3PH0A 3MGNA 3HE4B 5AW3B 1M1JC 2NPSD 2N1TA 2W83C 4C7NA 2FXPA 3E7KA 4OVNF 4B86A 5B66E 4IL6X 1J1EB 1WT6A 4YPCA 4QMAA 3HD7D 1QEXA 1J1DB 4I7ZC 3SWYA 5APSA 3A3YB 1VQ7P 3TK1A 1N7LA 3CCQP 5GTHH 1Q7YQ 4OGQC
chains in the Genus database with same CATH topology
1EZVG 1NU1G 1BE3G 3H1HG 3CX5H 1NTKG 3H1LG 3L75G 1SQPG 3L73G 3BCCG 1L0LG 4PD4H 1P84H 4D6TG 1L0NG 3L70G 3L74G 3L72G 1KYOH 3CXHH 4U3FG 3L71G 2FYUG 3H1JG 1SQVG 1SQQG 3CWBG 2IBZG 1BGYG 1NTZG 2A06G 1KB9H 1PPJG 1SQXG 1NTMG 1BCCG 3TGUG 1SQBG 3H1KG 2BCCG 1PP9G 5KLVG 3H1IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV G;  1NU1 G;  1BE3 G;  3H1H G;  3CX5 H;  1NTK G;  3H1L G;  3L75 G;  1SQP G;  3L73 G;  3BCC G;  1L0L G;  4PD4 H;  1P84 H;  4D6T G;  1L0N G;  3L70 G;  3L74 G;  3L72 G;  1KYO H;  3CXH H;  4U3F G;  3L71 G;  2FYU G;  3H1J G;  1SQV G;  1SQQ G;  3CWB G;  2IBZ G;  1BGY G;  1NTZ G;  2A06 G;  1KB9 H;  1PPJ G;  1SQX G;  1NTM G;  1BCC G;  3TGU G;  1SQB G;  3H1K G;  2BCC G;  1PP9 G;  5KLV G;  3H1I G; 
#chains in the Genus database with same CATH topology
 3M0D A;  1MFZ A;  3HE4 A;  2K9Y A;  2KZI A;  3V4W A;  3CX5 I;  1L0L G;  1R8E A;  2WTY A;  3CCE P;  3CCS P;  1G2C B;  1VQ5 P;  3A5T A;  1FDM A;  2I8D A;  2IBZ I;  2YO2 A;  3OAK A;  4BRY B;  1M57 D;  1GU4 A;  1G1I A;  2YIU C;  2E76 B;  1EQ7 A;  5AVT B;  1R5L A;  2C0X A;  1QX8 A;  2B9B A;  5KAI H;  4C46 A;  1JY2 N;  1SVF A;  1NKZ B;  5KLV D;  1L0L K;  2KSE A;  2AXC A;  2ZAE B;  3AE7 C;  5H2F H;  3BRV B;  1G2C A;  3H32 A;  4D6T G;  1LP1 B;  2WSC J;  1OW7 A;  1ZRT E;  2XKM A;  4BRY A;  2WSS H;  2Q3I A;  3S4R A;  3CC4 P;  2WPS A;  1NTM D;  3MHV A;  1IFP A;  3VMZ A;  3B71 A;  2R3S A;  3VOP A;  5KJ7 C;  2QM8 A;  3GHG C;  5KLV J;  3TYY A;  3PRJ A;  3S9O A;  1W2E A;  2I1K A;  1PPJ D;  1XTG B;  3P7K A;  5KKZ B;  4ASW A;  1KC8 Q;  2C9N Y;  1IO4 A;  2QJK C;  1UII A;  1LP1 A;  1T3J A;  3FGA D;  3N4X A;  1EDJ A;  4WY4 D;  2D2C C;  2XZR A;  3IFM A;  3L71 D;  4PV1 B;  1SQQ D;  1JMM A;  1S9K D;  1HF9 A;  1L0N J;  1ZW0 A;  1Q2N A;  1NU1 D;  1NTM E;  2JO1 A;  4HJG H;  3F89 A;  1E5W A;  1P84 H;  1N2D C;  5K5G B;  1GZL A;  4JYC A;  2J59 M;  1M1J B;  2OQQ A;  2LXC B;  1W2B O;  3L71 J;  1KIL D;  1PPJ E;  2NPS C;  3M91 A;  3IAO A;  4I7Z B;  5CCH D;  1P84 I;  2QA4 P;  1BE3 J;  4TLF A;  3HD7 C;  4U3F D;  1LTA C;  3CWB G;  3CCL P;  1LT9 B;  2K3R A;  4H13 D;  2OGU A;  3KZI H;  4EYY Q;  3TGU D;  2E75 C;  1SQQ E;  2KP8 A;  3B4S A;  1NU1 E;  1EDI A;  3NTN A;  2PGD A;  4AYC A;  4ZMD A;  4XA4 A;  1OZH A;  2ZYG A;  4KJM A;  5AVX B;  2W8Z A;  2CPB A;  5E79 H;  3TGU J;  1NTK G;  3FXD A;  1AVO A;  1PFI A;  2XND H;  1LT9 A;  2ZT9 D;  2YIU B;  1BDC A;  3GF7 A;  1KIL E;  2SPZ A;  1KYO H;  4W80 A;  2FBW C;  2FYU G;  3AED C;  2AXT H;  2YO3 A;  3G6E P;  1FZB A;  1K9M Q;  1RF0 C;  1KQF B;  2K9J B;  4U3F E;  2FYN C;  2WVR A;  2Y0E A;  3CI9 A;  3TGU E;  4GDO A;  3USS A;  5B66 H;  1PZQ A;  3RL0 C;  1CZQ A;  1H89 A;  2YMK A;  5AW7 B;  1YIJ P;  2HYN A;  4ZNC A;  3V6I A;  4NPD A;  5C39 A;  1NTK K;  2ZVN B;  2YKQ A;  2E42 A;  1L0L D;  5AVY B;  2E43 A;  2JR8 A;  4OH8 B;  2N1T C;  5KTB A;  3KHU A;  2OYO A;  1HGV A;  1BDD A;  5TJH A;  1VQ4 P;  2QJK B;  3AEA C;  2PRR A;  2DW3 A;  1ZV8 A;  2D2C B;  2A06 G;  1L0L J;  4KT0 J;  3TSI A;  2WPQ A;  3VMY A;  4WY4 C;  5KJ7 A;  2KI7 B;  3Q3D A;  2XNX A;  5KAF E;  4D6T D;  3CXH D;  1QVF O;  2XV5 A;  2WMM A;  3TF5 A;  1L0L E;  1LJ2 A;  1JOC A;  3AE5 C;  4Z1M H;  5AVS B;  1U57 A;  1S5L H;  1ZP0 C;  3S1K A;  2NPS B;  1KZU B;  3L4F A;  1SLQ A;  3HD7 B;  4D6T J;  2KLU A;  3PLN A;  2NRG A;  1SQX J;  2WSC H;  3OJA B;  2V7Q J;  4H13 C;  3VP8 A;  4H44 D;  3L74 G;  3N7N A;  3V5B A;  1GW3 A;  5AW6 B;  3TNU B;  3SFD C;  4DT0 A;  1BSH A;  4D6T E;  3CXH E;  1ZXG A;  5BU8 B;  3RK2 D;  2NPS A;  3H1I D;  3H1L G;  2E5Y A;  1FAV A;  5KLI C;  3HD7 A;  1CW5 A;  1HGZ A;  1VQP P;  1PL5 A;  1DEB A;  4RES B;  3HE5 B;  1WRG A;  1KFN A;  1Y9B A;  2ZVO B;  3VN0 A;  2ZT9 C;  1NTZ J;  3SFE C;  2FYN B;  1JMB A;  2AEJ A;  3TNU A;  2RH0 A;  4I2L C;  5CCG D;  3BCC G;  2IPP A;  3H1I J;  1FOS E;  1MUU A;  2Z4E A;  1GL2 D;  2LXB A;  3CWB D;  1K73 Q;  1HUC A;  3NMD A;  3D6Z A;  2WQY C;  3MTU E;  3P32 A;  4H0L D;  3F5H A;  3K5B A;  1IFJ A;  2Q3E A;  3VTP C;  3HE5 A;  3H1J G;  3M0A A;  1RF0 A;  3EFG A;  2OAR A;  1YIT P;  1PP9 G;  3CWB J;  2N1T B;  1FC2 C;  3M9Q A;  4C7N B;  5APW A;  3L75 G;  1NTK D;  5AW4 B;  2AEM A;  1IFM A;  4JF7 A;  5AVZ B;  2OYI C;  2QSI A;  3O6Q B;  2IFM A;  2FYU D;  4NPF X;  2P2U A;  4IL6 H;  4BXL A;  4GOF A;  3CWB E;  2V4H A;  2WPV B;  1KTM A;  4WY4 B;  3B5N D;  4YTP C;  2ITA A;  4W7Z A;  2J5U A;  3W68 A;  2H89 C;  2IBZ G;  2KSJ A;  1NVO A;  2O1K A;  1RQV A;  4A7P A;  1NJI Q;  4Y99 B;  2W6B A;  3AEF C;  3AE3 C;  1X0T A;  3H1H G;  2LKM A;  3O6Q A;  1L4A D;  1NKN A;  4PD4 I;  1LT9 C;  1NTK E;  5AW2 B;  1KQL A;  1AA0 A;  2O3J A;  3V2N A;  2E74 D;  4WY4 A;  1OVU A;  1GK6 A;  2R44 A;  2RMZ A;  1JY3 O;  2OTL P;  5TIS E;  2FYU E;  3M9H A;  3OW2 O;  3G71 P;  3L36 A;  1ZRT D;  1AJY A;  3KYQ A;  2Y0D A;  4H13 B;  2A45 H;  2OTJ P;  2YXQ B;  2Z5I A;  3H32 B;  3FXE A;  2A06 D;  1H0T B;  2K1A A;  1VPC A;  2K88 A;  4YXW H;  3SWK A;  3RK3 C;  1GTW A;  3G9R A;  4L76 A;  5APU A;  2N9Y B;  3E1I A;  5KLI B;  1LTG C;  2UWJ E;  1QGK B;  1M56 D;  4EI2 A;  2O01 J;  1BCC G;  2H8P D;  3H1K G;  2B88 A;  3CCM P;  5CCH A;  1CI6 B;  5KAF H;  1CSB A;  1TU3 F;  1RE3 C;  4PJ0 E;  2ZT9 B;  1OIP A;  4XFJ A;  1DEE G;  3AEC C;  1KN7 A;  1H0T A;  1JUN A;  1FJK A;  4DZO A;  1Y47 A;  1YJW P;  1ZME C;  5CCG C;  2VRS A;  2WT7 B;  1DD3 A;  3L35 A;  3QH9 A;  2A06 E;  5B5E H;  1GL2 C;  5AW0 B;  2HPC B;  3E1R A;  5AVV B;  4HKZ H;  5APY A;  4HB1 A;  1CI6 A;  1LT1 A;  2WPR A;  1YQ4 C;  3AE2 C;  3AE9 C;  4GT1 A;  3PHL A;  3A0H E;  2Q9I A;  1YTZ I;  1NTM J;  4GKG A;  4L73 A;  3U1C A;  3H1L D;  1KD1 Q;  2Y9Y A;  2YNY A;  4XE5 B;  1T6A A;  3CXH H;  2OYI B;  1KB9 D;  2XU6 A;  2WT7 A;  2QJY C;  1T8Z A;  2HPC A;  3OA7 A;  1VF5 C;  2V7Q H;  1EZV G;  3WU2 E;  1ZOY C;  2C9L Y;  3M9B A;  3FWL A;  2W27 A;  3BCC D;  2OYH C;  1FZF A;  3H1L J;  1Q81 Q;  2PP6 A;  3B5N C;  3CC7 P;  5AW9 B;  2R5B A;  5CBO A;  2G3A A;  3L74 E;  1N7S D;  1SQQ J;  3MZW B;  3V4Q A;  2OYI A;  3C1L A;  2RKL A;  4ZKP A;  1S1C X;  1M1K Q;  2YXR B;  1NU1 J;  4ZKU A;  1K8A Q;  3H1J D;  3L37 A;  1NH4 A;  3H1L E;  3BCC J;  1YQ3 C;  3WUT A;  1PP9 D;  2P1J A;  1IC2 A;  1T3U A;  5APT A;  1L4A C;  3Q1M A;  1KB9 E;  1RE4 A;  1X22 A;  4M3L A;  2I1J A;  3L75 D;  1K05 A;  1EZV I;  4WB4 A;  2B89 A;  2LR2 A;  1W5C E;  2ZFC A;  1FJP A;  3H25 A;  3NFQ A;  1DIP A;  1SQB G;  3BCC E;  2CPS A;  2JWD A;  4U3F J;  1GMJ A;  1VQO P;  1ZLL A;  3CX5 D;  3PTZ A;  1PP9 J;  1IFN A;  1EXJ A;  1HVV A;  1SS1 A;  3RK3 B;  3A0B E;  5APX A;  1HH0 A;  4RKU J;  2W6A A;  3RBZ A;  2IBZ D;  4C7R A;  3RK2 B;  1UIX A;  2WSF J;  3H1J E;  1FS0 E;  1JNM A;  4KHX A;  3H1H D;  2C0W A;  1DD4 A;  3AE6 C;  4GOD A;  1PP9 E;  3CCU P;  3Q5R A;  2Q5U A;  1N73 C;  1SQB K;  1U7J A;  2L91 A;  1KYO I;  3L75 E;  2RN0 A;  4WBA A;  2AEF A;  4N3Y B;  4W7Y A;  2IZ1 A;  2O1J A;  1PIX A;  1JCD A;  2KZJ A;  1JY3 N;  1AVY A;  2BEZ F;  3QWO C;  4R4M A;  1GL2 B;  2FYU K;  3U59 A;  3ZDM A;  1RH5 B;  2WIT A;  3H1H J;  1MV8 A;  3CX5 E;  1KV4 A;  1YBK A;  1RE3 A;  3GLM A;  1MFT A;  2IBZ E;  4N78 D;  5GTH E;  3L73 G;  3AE8 C;  1YTZ T;  3W67 A;  3H1H E;  2O01 N;  1VQM P;  2QJP C;  5CCG A;  1BCC D;  3H1K D;  3KPE A;  2QJY B;  1FDI A;  1GL2 A;  2QIW A;  3I56 P;  1VF5 B;  1VQ6 P;  2WWW A;  3Q5P A;  3U1A A;  3Q5S A;  4IOI H;  2KLV A;  2OYH B;  1JEK A;  2IX7 C;  4PJ0 H;  1RQU A;  1PGJ A;  4Y99 C;  3CLQ A;  3WMM 0;  2KB7 P;  3B5N B;  3LIE A;  1QL1 A;  1BCC J;  3H1K J;  2BCC E;  5DJU B;  5KAI E;  2ZYA A;  2O01 H;  1Q86 Q;  2J58 A;  1OVR A;  4N78 E;  1N7S C;  3LID A;  1EDL A;  1BGY G;  2M8R A;  1KIL C;  1NAY A;  2ZXX A;  1JCC A;  4RO0 A;  5KLV G;  1G1J A;  5DJT B;  5CCH C;  1M7L A;  3SSU A;  3VP9 A;  2OTK E;  1L4A B;  1BCC E;  2OYH A;  2FKW B;  3H1K E;  3HUS A;  4OGQ D;  1P84 D;  1A02 F;  4JQ0 D;  2NZ2 A;  3B5N A;  2ZYD A;  4AQR D;  1S3J A;  2R3C A;  4RJT A;  4L74 A;  3R2P A;  1J2J B;  1GDT A;  1L0N G;  1MZ9 A;  1OW6 A;  2IFN A;  1T2K D;  2KYV A;  3M06 A;  2QE7 H;  3WU2 H;  2E5T A;  4WWI A;  1L4A A;  2Y9Z A;  4EDF A;  5BU5 A;  1VQK P;  1IZN B;  3P8C D;  1RY3 A;  3C8V A;  3L71 G;  1N73 B;  5AVR B;  1P84 E;  2KIK A;  4DCK A;  3LW5 J;  2KNC B;  4AUW A;  1YHQ P;  3ABV C;  2WSE H;  1BE3 G;  1L0N K;  2Y0C A;  3Q2Y A;  3JCU E;  1IFI A;  4IFM A;  3CD6 P;  2G8Y A;  1EZV E;  1LNQ A;  3PP5 A;  1KB9 H;  4OWF A;  1IK7 A;  1SQB D;  4NPE A;  1RF1 C;  5CJ4 A;  3KZI E;  1QVG O;  1NOH A;  1X79 B;  1YJ9 P;  1SP4 A;  1JY2 P;  2M0B A;  1M8O B;  1JTH B;  1N73 A;  3EWK A;  4ASV A;  2KNC A;  1SFC D;  3GG2 A;  3P8C E;  2D2C D;  2QJP B;  3A0B H;  1KOR A;  4YXD C;  1SQB J;  1K04 A;  2YKP A;  1RE4 C;  1OXZ A;  1U7M A;  3BAT A;  2H88 C;  1NTK J;  1VL2 A;  1KYO E;  5CJ0 A;  2AXT E;  2FYU J;  1JTH A;  2IYP A;  2Q7C A;  1LWU C;  1SQB E;  1OX3 A;  4R4L A;  5AVQ B;  2A45 G;  4HYT B;  2GA1 A;  2Q6Q A;  2WSF H;  2YKO A;  1N7S B;  2B87 B;  3H6P A;  1KIL B;  2JEE A;  2QRX A;  3FWN A;  3CX5 H;  2W6J H;  2E75 D;  5AVW B;  1AV1 A;  4IFF A;  3L73 D;  3JC2 2;  1NGM B;  3L72 G;  1Y8A A;  2IYO A;  1KMI Z;  3BRT B;  1FZC C;  1Q90 D;  1FBM A;  2BCC G;  1MKM A;  3CMA P;  4H44 C;  1IFD A;  4K3A A;  3AE4 C;  3CCR P;  3KXD A;  3VMX A;  3VYI A;  1N7S A;  2HFE D;  2B87 A;  3UIA A;  3KDP B;  2M3E A;  1JO5 A;  3ITK A;  1KIL A;  1SQV G;  3L73 J;  3RK2 C;  2A45 I;  2Z5H A;  1URQ D;  2H43 A;  3V2Q A;  2KUB A;  1NO4 A;  3AEB C;  1T2K C;  2KXP B;  1OVV A;  3IN6 A;  2Q1K A;  3L73 E;  1BGY D;  3RL0 D;  1VQ9 P;  1YI2 P;  1EXI A;  4LC1 A;  1R5S A;  1HWT C;  2FYZ A;  2GUV A;  3HTK B;  5AVU B;  5EFW B;  3MIW A;  3GMA A;  2ZXE B;  1SQV K;  3L70 G;  2H7H A;  3L74 D;  1S5L E;  1SQX G;  4EIJ A;  3AEE C;  4H0L C;  1EDK A;  1BGY J;  3MUD A;  2FFD B;  1RF1 B;  2N1T D;  3SWF A;  1LGH B;  2IDB A;  1YYC A;  1L0N D;  2HR3 A;  5GTI E;  2FY8 A;  1JB0 J;  3HTK A;  3IF4 A;  1HJ0 A;  3L74 J;  1BGY E;  2KOG A;  1SQP G;  1SFC C;  1JY3 P;  5KLV E;  2WSE J;  3HUS C;  1SQX K;  5AW1 B;  2WZ7 A;  1XTC C;  2QEX P;  2GUS A;  3CXH I;  1LTS C;  1NTZ G;  4L75 A;  4UB6 E;  2FFD A;  1RF1 A;  3H1I G;  3A7O A;  3MP7 B;  1BE3 D;  4BWN A;  1IJD B;  1AQT A;  3I55 P;  1LWU B;  2M5A B;  3JCU H;  1L0N E;  1OMI A;  3AE1 C;  1SQP K;  1L2P A;  1USE A;  3P8M C;  3GF3 A;  4PD4 D;  1NTZ K;  1LTJ C;  2E74 C;  1HBW A;  3LW5 H;  2QM7 A;  1N86 A;  1FZC B;  1GD2 E;  3H1J J;  3L71 E;  1GU5 A;  2CK3 H;  1LWU A;  4OGQ B;  4WVZ A;  1LTB C;  1S9K E;  3II6 A;  2IZ0 A;  1VQN P;  2P58 A;  2FXO A;  2BAS A;  4H44 B;  4EOT A;  2M5A A;  3WUU A;  2YMY A;  1PGQ A;  3D71 A;  1M1J A;  4UB8 E;  2E76 D;  4IFD K;  1OWA A;  1BE3 E;  2PAJ A;  3L75 J;  1DX7 A;  1EC5 A;  1HTL C;  1PV3 A;  2JKV A;  3CPW O;  1LTI C;  3WUV A;  1FZE A;  4IL6 E;  2MJZ A;  2MKV A;  2BEQ D;  3V2R A;  1KQS O;  1URQ C;  1FZC A;  2P7J A;  1S72 P;  2L5G B;  1E79 H;  1GK4 A;  4PD4 E;  5AW5 B;  2KK7 A;  1VDF A;  2ZJS E;  2M3B A;  1S4X A;  2HOD B;  1S2E A;  1Z56 A;  3A2A A;  1QL2 A;  3CME P;  3L72 D;  1LTT C;  1KFM A;  1D7M A;  5TIS H;  2W90 A;  1ZR4 A;  2JWA A;  2BCC D;  2KS1 B;  3CL3 D;  4H0L B;  1AQ5 A;  1QLE D;  2FXM A;  3GHG B;  2K9J A;  1SQV D;  4GIF A;  4N6J A;  1N8R Q;  3AEG C;  3L72 J;  4PV1 D;  2HOD A;  3BAS A;  4LGD E;  2BCC J;  4TT3 H;  3MD0 A;  5CHX A;  1NAF A;  3G3Z A;  1FOS F;  1SFC B;  3RL0 g;  4MN4 C;  1H88 A;  1HJB A;  3HUS B;  2KS1 A;  1ZR2 A;  3BVH A;  1FZA A;  4CPG A;  3L72 E;  1SQV J;  4I1L A;  4HH2 A;  3GHG A;  3O8Z A;  1FU1 A;  3M0D C;  1OFC X;  3VMA A;  4O9B A;  3L70 D;  5H2F E;  1J1E C;  1JY2 O;  1SQX D;  1FDO A;  2K37 A;  3IR9 A;  1J1D C;  3GW6 A;  1SQV E;  3CCV P;  2QG4 A;  1SFC A;  1VQL P;  5CBN A;  3T97 B;  5B5E E;  3PJS K;  1LTJ B;  3KQG A;  2E74 B;  4LLH A;  4DJG A;  1RHZ B;  3A0H H;  1NTM G;  3L70 J;  2QVA A;  1PGO A;  3D70 A;  2E75 B;  2JDI H;  5APQ A;  5GTI H;  2JP3 A;  1EZV D;  1S5L X;  4K35 A;  1SQP D;  3R4Y A;  1H8A A;  1PGP A;  3RK3 D;  3I5C A;  2GM4 A;  1FZG A;  3CC2 P;  4JBZ A;  1PPJ G;  1NTZ D;  3FX0 A;  5CMZ A;  5KLV K;  4DOJ A;  1ZN5 A;  1NHL A;  1WMK A;  3L70 E;  2E76 C;  3T97 A;  1SQX E;  2HG5 D;  3MUD C;  3NXS A;  1LTJ A;  4UB6 H;  5L8R J;  1NTM K;  3JSV C;  1SQP J;  1SQQ G;  1NWQ A;  1URQ B;  3D6Y A;  2R5D A;  4U7J A;  1OW8 A;  1NU1 G;  5BVZ A;  1Q82 Q;  3C9I A;  1KYO D;  3RL0 B;  5KJ7 D;  1SQP E;  3B8E B;  1NYH A;  1KQG B;  3EQ2 A;  1BSN A;  4Y28 J;  3RK3 E;  1USD A;  2FFD C;  2HLO A;  1M90 Q;  1NTZ E;  1IK9 A;  1A02 J;  2R32 A;  1SQQ K;  4GOE A;  3HRN A;  1URQ A;  3RGU A;  4U3F G;  3H1I E;  2P67 A;  3G4S P;  3CCJ P;  1YJN P;  1VQ8 P;  3TGU G;  5KKZ C;  1KB9 I;  1NU1 K;  1X9V A;  4I6M C;  4JPZ B;  4UB8 H;  4JYB A;  3TDK A;  2JJL A;  2P10 A;  1VF5 D;  1AFO A;  5AW8 B;  1FE6 A;  4PV1 C;  5E79 E;  3V2P A;  2N9B A;  5M1B A;  2PFX A;  1DH3 A;  1GW4 A;  3RBX A;  3EFF K;  2POH A;  1JM0 A;  5APV A;  2XDJ A;  1X8Y A;  4PD4 H;  3PH0 A;  3MGN A;  3HE4 B;  5AW3 B;  1M1J C;  2NPS D;  2N1T A;  2W83 C;  4C7N A;  2FXP A;  3E7K A;  4OVN F;  4B86 A;  5B66 E;  4IL6 X;  1J1E B;  1WT6 A;  4YPC A;  4QMA A;  3HD7 D;  1QEX A;  1J1D B;  4I7Z C;  3SWY A;  5APS A;  3A3Y B;  1VQ7 P;  3TK1 A;  1N7L A;  3CCQ P;  5GTH H;  1Q7Y Q;  4OGQ C; 
#chains in the Genus database with same CATH homology
 1EZV G;  1NU1 G;  1BE3 G;  3H1H G;  3CX5 H;  1NTK G;  3H1L G;  3L75 G;  1SQP G;  3L73 G;  3BCC G;  1L0L G;  4PD4 H;  1P84 H;  4D6T G;  1L0N G;  3L70 G;  3L74 G;  3L72 G;  1KYO H;  3CXH H;  4U3F G;  3L71 G;  2FYU G;  3H1J G;  1SQV G;  1SQQ G;  3CWB G;  2IBZ G;  1BGY G;  1NTZ G;  2A06 G;  1KB9 H;  1PPJ G;  1SQX G;  1NTM G;  1BCC G;  3TGU G;  1SQB G;  3H1K G;  2BCC G;  1PP9 G;  5KLV G;  3H1I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...