3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
1SQQG 3H1JG 2FYUG 3H1IG 5KLVG 1P84H 3CX5H 3L74G 3L72G 4U3FG 3CXHH 1KYOH 1EZVG 3L71G 2BCCG 3L73G 1PP9G 1BGYG 1SQXG 1BE3G 1NTZG 1SQBG 1NTKG 3H1KG 3BCCG 1BCCG 1KB9H 1L0NG 3H1HG 2A06G 3H1LG 3L70G 4D6TG 4PD4H 3TGUG 1SQVG 3L75G 2IBZG 1NU1G 1NTMG 1SQPG 3CWBG 1L0LG 1PPJG
chains in the Genus database with same CATH superfamily
3RK3E 3GLMA 3D71A 1RE4A 4IFMA 3H1HJ 3P7KA 3FX0A 2JWDA 3H1IG 3HTKB 4PV1B 5AVQB 1GTWA 2OYIC 3B5NC 5B66E 2B87B 1PGJA 1RQVA 1H8AA 4B86A 4IFDK 2P58A 2SPZA 3B8EB 2BCCE 3FXEA 4WWIA 1GZLA 2Y0CA 1EZVE 2P2UA 3FWNA 2B87A 4HKZH 1JCCA 3IF4A 3ITKA 1LTJC 2E43A 3BVHA 1SQPJ 3A3YB 3AEBC 2MJZA 1YYCA 4H0LD 1M56D 4GKGA 5AW4B 1NKNA 1OMIA 1RH5B 2B89A 3SWKA 2A06D 3G71P 3H1HG 1PP9E 1NTKJ 3L74D 3SFEC 1N73A 2I1KA 2D2CD 1ZP0C 3KZIE 2YIUB 1JNMA 1KMIZ 2IZ0A 1SFCC 3L71E 3IN6A 3CXHE 4I7ZC 3L72J 4JQ0D 1EZVI 1SQQK 1GW3A 1J2JB 3GMAA 3HTKA 3AEGC 2M0BA 2XZRA 3CCEP 2R44A 3L4FA 1H88A 4WY4A 3CMAP 1FDMA 5CCGD 2M5AB 4H44D 1JY3N 5CJ0A 2GUVA 5AVVB 1K05A 2M3EA 3V2NA 1X0TA 2NPSA 2QVAA 3P8MC 1PP9J 2YKPA 2E75B 3FXDA 4PD4D 3USSA 1BDCA 1PIXA 1VQMP 2LKMA 2R5DA 4BRYB 2KUBA 1ZR4A 1NTZG 2K3RA 2ZT9B 1T8ZA 2O01J 3BCCE 4M3LA 2WITA 2IYPA 2QEXP 1BSHA 4LGDE 2H89C 2BEQD 2FFDC 3H1LG 1JM0A 2BCCJ 2E5TA 3A7OA 5CCHD 1KV4A 2Q6QA 4R4LA 1G2CB 1NTZK 1L0LG 3AE8C 4UB6E 1G1JA 1DEBA 1PPJG 4JF7A 3KYQA 1T2KC 1A02F 1QLED 2LR2A 3RL0B 3E1RA 5BU8B 3F89A 3WUUA 2AXCA 2ZT9C 1JUNA 5KJ7D 4H13C 3CX5D 4GOFA 5CCHC 2FYNB 1IK9A 1YTZT 1L0ND 3SWFA 1J1DB 1L0LK 1LT9C 4TLFA 3AE3C 3T97B 3V2PA 1GL2B 4BRYA 2WSEH 5B5EH 4EOTA 2AXTH 2JJLA 1JY2P 1UIXA 2Y9ZA 1QVFO 1S5LX 1HF9A 3NXSA 3V6IA 3CCUP 1NTKE 1XTCC 4NPDA 1AV1A 2OTLP 1IFPA 2OGUA 4I1LA 4PV1C 3RK3C 2K1AA 1OW8A 4LLHA 3AE2C 1H89A 2IPPA 1VF5D 2KXPB 3WMM0 3AE5C 3CPWO 4NPEA 4PD4H 1EDLA 2Q3IA 3HUSB 1S9KD 3L75G 2IBZG 1BE3J 3H32A 2YKQA 1FZAA 4U3FJ 3N7NA 1SQQG 2G3AA 1NGMB 1URQA 5AW7B 1RHZB 3W68A 2W83C 4L76A 1QGKB 1HJ0A 4WBAA 4DZOA 1URQD 1OZHA 1FJPA 3CX5H 1SQPK 4OVNF 3NFQA 4A7PA 2H7HA 1L4AA 2YIUC 1VF5C 2E75D 2E76D 1MFTA 1SFCB 2WSSH 4I7ZB 1AFOA 1DIPA 3CCQP 2FXOA 5KLVJ 1SQXG 1W5CE 2H8PD 2ZAEB 3SWYA 1RF1B 2Z5HA 2LXBA 3VMXA 1M1JA 2OYIB 1BGYJ 1D7MA 2NPSD 2FYUE 3BATA 3I55P 1NTZJ 1VDFA 1K73Q 1DH3A 1HVVA 2CPSA 1RF1A 1IFMA 3L70G 2OYHA 4DOJA 1T3UA 2KIKA 3V5BA 3VMZA 2KK7A 2BCCD 1KFMA 2KS1A 1KQSO 2C9NY 1ZXGA 2BEZF 1LTSC 1DD3A 1QEXA 1AA0A 1T2KD 2P10A 2PP6A 2QSIA 2ZJSE 4O9BA 3RK3D 3M0DA 2VRSA 3CLQA 1ZN5A 4JYBA 4I6MC 4YXWH 3W67A 4HH2A 5TISH 1X22A 1L0LE 1ZOYC 2QM7A 1JY2O 1S3JA 1KYOH 1Y47A 2R3CA 3L75D 1OX3A 1SQXK 3RK2B 1YJ9P 1H0TA 1PL5A 3AEAC 2Q3EA 3CX5I 1SQXD 1CW5A 1KN7A 2ZFCA 1M57D 1HTLC 2L5GB 3P8CD 2IFNA 1FZCA 2WMMA 1LTGC 3H25A 2PGDA 1BSNA 2Q1KA 1NTZE 2O01H 4IFFA 3CWBE 3GF7A 3K5BA 4XFJA 4L74A 2E5YA 2KS1B 2XKMA 3L71J 5KJ7A 3CMEP 1MV8A 2IX7C 2KLVA 3L72E 4IOIH 2XNXA 3L73D 1GK6A 3IR9A 1CZQA 1KILE 2OQQA 4PJ0E 1SFCA 3CX5E 3T97A 3KZIH 3VN0A 1M1KQ 1IO4A 3LIDA 1JMBA 1OW6A 2FYUG 1L0NJ 2W90A 3B71A 3RL0D 3UIAA 2IYOA 3BRTB 4Z1MH 3V4WA 1R8EA 3EQ2A 3VTPC 5CBNA 3HD7A 1M7LA 4NPFX 4PJ0H 2WPRA 3RK3B 1FOSE 1RF0A 1MKMA 2PRRA 5DJTB 1FJKA 2P1JA 2QJYB 3WUTA 1U7MA 3FGAD 1EQ7A 1NH4A 4RO0A 3L71G 5AVZB 5AVXB 3SFDC 3M9BA 1J1EB 1S72P 2B9BA 5AVYB 3H1HE 4ZNCA 4H44C 2Y9YA 1IFNA 3Q3DA 2Z4EA 3U1CA 3VOPA 1NJIQ 2ZVOB 1N7SB 3L36A 3V2QA 3OAKA 2N9BA 1AQTA 1EDKA 1L0NG 2XU6A 1VQ7P 1SQVJ 1E5WA 1KILB 1OVRA 2FXPA 3CWBJ 4OH8B 5AW3B 5KLIC 3RL0g 4DT0A 2OYIA 2QJPC 2W6JH 2KP8A 3L75E 3MIWA 3M0DC 1YJWP 2KZIA 3L70J 3LW5H 2E75C 3Q5PA 1FBMA 2JKVA 1FAVA 2WPSA 3HD7D 3II6A 1M8OB 3NMDA 1AVOA 2YNYA 5H2FH 2D2CC 4RJTA 3JCUH 5CCGC 3GW6A 3H1IE 3D6ZA 1S5LE 1DEEG 3HUSA 1N7SC 4KHXA 4UB6H 2O1KA 4D6TJ 3S1KA 1KILD 1H0TB 3H1LD 4C7NB 1UIIA 3CXHD 1FZCC 5AW2B 1URQB 2WTYA 2AEJA 3B5ND 2ZT9D 1NVOA 5APWA 1YJNP 1LTTC 1PP9D 3M9QA 3D70A 1KORA 2FYUD 5GTHE 2E74C 2ZYAA 1BCCD 3GHGA 3M9HA 2FYUK 3BCCD 4YXDC 2GM4A 2IDBA 3RGUA 1QL1A 1SQXE 1GW4A 3WU2H 4AQRD 4D6TG 2W6BA 1RQUA 4D6TE 3HD7C 3H1JJ 3L35A 1FE6A 3NTNA 4N6JA 1M1JB 3S9OA 1J1EC 3RBXA 1YIJP 1MFZA 1IFDA 2JO1A 2K9JA 1S5LH 3WU2E 4EI2A 1GL2A 2PFXA 4HB1A 1PPJD 1NTKK 1BDDA 1TU3F 1USEA 2HODB 4H13D 1KTMA 3G4SP 4HYTB 1VQNP 1W2BO 1GL2D 2ZYDA 1JTHB 1SQQE 2P7JA 5GTHH 2RKLA 2WSFH 1HH0A 2OTJP 3OW2O 1NU1D 1Z56A 4D6TD 1OWAA 3KQGA 3L70E 1EZVG 5APTA 1RE3A 1K04A 1NHLA 5AVTB 3I56P 4U7JA 4ASWA 2Y0DA 1NOHA 2W6AA 3PTZA 4OGQB 3H32B 1LJ2A 5KTBA 4ASVA 3D6YA 3CCLP 2KSEA 3AE7C 1NTMJ 4WB4A 1VQ5P 1EZVD 1KFNA 2HG5D 4K35A 3EFGA 1SQVG 1N7SA 1SQPE 2N1TC 1NU1G 3TF5A 2ZXXA 1L0NE 3CWBG 3Q2YA 3S4RA 2V7QH 1XTGB 3OJAB 1ZR2A 1OVUA 2E74B 2O3JA 3B5NA 5CMZA 4YTPC 2Y0EA 4IL6E 4UB8H 5AW1B 1AVYA 3IAOA 3MGNA 1FOSF 2E42A 2R32A 1N86A 5BU5A 1FDIA 3TGUJ 3H6PA 3GHGC 4N78D 1FZEA 1HGVA 3CXHI 5L8RJ 1LTJA 3AEEC 3A0HH 1KQGB 2BCCG 2J5UA 2C0XA 4Y99C 3R4YA 2POHA 1N7LA 1NU1J 2OYOA 3AEDC 5M1BA 3TYYA 1YI2P 3P8CE 1SQBG 1NTKG 2D2CB 1LT1A 3BCCG 1BCCG 4GODA 1KB9H 2QRXA 4H13B 5E79E 5AVSB 5GTIE 1KZUB 2QIWA 1NAYA 5AVWB 4HJGH 2JR8A 2ZVNB 2L91A 2WSCJ 3TGUG 5KKZC 1N73C 1HWTC 1KB9E 5KAFH 4K3AA 1QL2A 4WVZA 5TISE 3H1JD 3H1KJ 2UWJE 1HGZA 3AE6C 1WT6A 3C8VA 1LTBC 2WSFJ 1N2DC 2Z5IA 4OGQC 1OFCX 4R4MA 1NKZB 2NPSC 1FDOA 1SP4A 3A0HE 1K8AQ 3BCCJ 3GF3A 5APUA 3TNUB 3B4SA 3L73E 3CCRP 2HFED 1KYOI 2K37A 3L72D 2CK3H 2HYNA 2YXQB 1S1CX 1JCDA 1M90Q 3QH9A 3RBZA 5AVRB 5KKZB 2W27A 4PV1D 2IBZD 3L74E 1MUUA 3H1IJ 1PP9G 1S4XA 1BE3G 2KNCA 1FS0E 3P32A 1ZV8A 2FFDA 2C9LY 1A02J 3TSIA 2K9JB 5APXA 4RESB 2O01N 2YKOA 3Q1MA 2KNCB 4BWNA 1VQPP 3U1AA 1JY3O 3ZDMA 2FBWC 2I8DA 5APSA 1WMKA 3L37A 1NTMD 4L73A 4AYCA 2HPCA 3M0AA 3TDKA 1CI6A 1NWQA 1LGHB 2B88A 4ZMDA 3AECC 1GDTA 4W7YA 2OARA 4DJGA 2NZ2A 5H2FE 1YTZI 5KLVG 3H1KD 2KYVA 4JBZA 2W8ZA 5AW9B 4L75A 2KB7P 3Q5SA 1ZRTE 2YMYA 2M8RA 3L72G 3MTUE 3MUDC 1KILC 1NTME 2QM8A 2G8YA 4JPZB 5K5GB 5KLIB 2HPCB 3TK1A 3KPEA 1SLQA 1VQLP 2HODA 5B66H 1PGOA 2J58A 3AE4C 1VPCA 1L2PA 2C0WA 3A2AA 1YHQP 1JTHA 2KSJA 1VQKP 4IL6X 1R5LA 2V7QJ 2RMZA 2JEEA 2K9YA 3SSUA 1IC2A 3ABVC 2IBZE 2JWAA 3V4QA 4W7ZA 1U57A 1BCCJ 1JY3P 1OVVA 1W2EA 2OTKE 1CI6B 2ZYGA 4QMAA 1LWUA 3HE4B 2DW3A 2IZ1A 1SQQJ 4PD4I 2AEFA 1URQC 2HR3A 2E76B 4KT0J 3WUVA 4CPGA 1RF0C 1X9VA 2A45H 2P67A 3H1LE 4W80A 3CD6P 2GA1A 1NAFA 1SQBD 3L75J 1YQ3C 1G1IA 1L4AD 2QG4A 1N7SD 2IFMA 3PLNA 3HE5A 1VQ9P 2ZXEB 3QWOC 2FFDB 3CC2P 1DD4A 2RN0A 3H1JE 1Q86Q 3A5TA 2QE7H 2WSCH 1NU1K 1KB9D 3OA7A 2QJPB 1L0LJ 1MZ9A 1ZLLA 1KYOD 1K9MQ 1SQXJ 5B5EE 2QJKB 1U7JA 1Q90D 1T6AA 1L4AC 1USDA 2E76C 5AVUB 2YO3A 1BGYG 3RL0C 3TNUA 1ZMEC 1RE3C 2WQYC 2LXCB 3JC22 1YBKA 3FWLA 3H1HD 2BASA 2OYHC 1QX8A 2YO2A 4N78E 1OXZA 2FYNC 3C9IA 2WT7B 1LT9B 3N4XA 4ZKUA 3PHLA 5AW0B 2H88C 2HLOA 1SQVK 1AJYA 2QJYC 4KJMA 1KQLA 2O1JA 3AE9C 2QJKC 1JY2N 2A45G 1NYHA 3V2RA 1WRGA 3CL3D 5KLVD 1Q2NA 1GD2E 1AQ5A 1EDIA 1T3JA 4H44B 3AE1C 1OIPA 3KHUA 1IFJA 4GDOA 5KLVE 2WT7A 1LTAC 2OYHB 2YXRB 2WSEJ 2Q5UA 1SVFA 3RK2D 4H0LC 4N3YB 1QVGO 4U3FG 2ITAA 3HD7B 3L71D 1PZQA 1EDJA 1YQ4C 1Y8AA 1LWUB 3HE4A 3CWBD 1DX7A 1GU5A 1VQ8P 4EIJA 3JCUE 1NO4A 3MD0A 5CCHA 1SQBK 1G2CA 1CSBA 1LT9A 5KAIE 1KC8Q 2K88A 5KJ7C 3LW5J 2QA4P 2A06G 3B5NB 2A45I 1BE3E 3EWKA 3HE5B 3PH0A 5AW8B 3LIEA 3CCMP 1Q7YQ 1EXIA 3I5CA 1J1DC 2WPVB 1FZGA 1PFIA 1FZCB 1LP1B 1L4AB 1ZRTD 2WPQA 2R3SA 4Y28J 3CCSP 3G6EP 1SQQD 3GG2A 1Q81Q 3KDPB 5E79H 4WY4C 1LTJB 2XNDH 4OGQD 5C39A 3M91A 1RY3A 3PP5A 1PPJE 3E7KA 2FY8A 2RH0A 2I1JA 2FYUJ 2IBZI 2WWWA 3F5HA 1JOCA 1N8RQ 3CC7P 1SFCD 3BASA 4RKUJ 1SS1A 1FZBA 3TGUD 2N1TB 3VP9A 5DJUB 5APYA 1N73B 2KI7B 5GTIH 4GIFA 3G9RA 2A06E 1IJDB 2Q9IA 1EC5A 1BGYD 2N1TA 1VQOP 1VQ4P 2FKWB 2M3BA 1BCCE 5TJHA 1JB0J 2YMKA 1VL2A 3BRVB 3GHGB 1LTIC 4H0LB 1HBWA 3CCVP 2XV5A 5CBOA 1Q82Q 1NTMK 2WVRA 1YITP 3VMAA 2JDIH 3A0BE 4TT3H 1S9KE 1VF5B 1E79H 4U3FE 1FC2C 5CCGA 2KOGA 4C46A 2V4HA 1ZW0A 2WZ7A 3H1KE 3H1ID 3PRJA 3CCJP 1IK7A 1RF1C 3CC4P 3MHVA 5KLVK 2PAJA 5KAIH 1P84H 2XDJA 1OW7A 4DCKA 1S2EA 3AEFC 3O6QB 5CJ4A 1HUCA 1SQVD 3HUSC 4EDFA 1PV3A 3U59A 2AXTE 1RE4C 3IFMA 4OWFA 5AW5B 2CPBA 3MUDA 1BE3D 4WY4B 2J59M 4C7NA 4ZKPA 1Y9BA 4XE5B 1JO5A 3M06A 1NTKD 3L74J 5EFWB 5AW6B 2JP3A 2N1TD 2NPSB 1R5SA 3E1IA 5KAFE 1L0NK 3VYIA 1X79B 4C7RA 1PGPA 3L73J 3O8ZA 1KYOE 1PGQA 1IFIA 1GL2C 2KLUA 4BXLA 1LWUC 3CI9A 1P84E 3H1JG 1KB9I 2M5AA 4JYCA 4YPCA 3JSVC 4AUWA 2FXMA 4XA4A 4IL6H 4UB8E 1LP1A 3G3ZA 1LNQA 1SQBE 5APQA 1P84D 1SQBJ 2R5BA 3EFFK 5APVA 1KD1Q 3L74G 5BVZA 3VP8A 4U3FD 3KXDA 1FU1A 1SQPD 3R2PA 1KQFB 2NRGA 3CXHH 3A0BH 1JMMA 2FYZA 1EXJA 1FZFA 1IZNB 3Q5RA 3C1LA 3L73G 2Q7CA 1M1JC 3MZWB 1NTZD 4I2LC 1P84I 1JEKA 4LC1A 3HRNA 1HJBA 2N9YB 3H1LJ 3H1KG 1VQ6P 1BGYE 1GK4A 4GOEA 1GU4A 2H43A 2GUSA 3PJSK 2AEMA 3VMYA 1X8YA 4PD4E 4MN4C 3L70D 4WY4D 3RK2C 1L0LD 1NU1E 3O6QA 3TGUE 4GT1A 1SQPG 1NTMG 1SQVE 2KZJA 4Y99B 3MP7B 2MKVA 5CHXA 4EYYQ 1GMJA 2E74D 1KILA
chains in the Genus database with same CATH topology
1SQQG 3H1JG 2FYUG 3H1IG 5KLVG 1P84H 3CX5H 3L74G 3L72G 4U3FG 3CXHH 1KYOH 1EZVG 3L71G 2BCCG 3L73G 1PP9G 1BGYG 1SQXG 1BE3G 1NTZG 1SQBG 1NTKG 3H1KG 3BCCG 1BCCG 1KB9H 1L0NG 3H1HG 2A06G 3H1LG 3L70G 4D6TG 4PD4H 3TGUG 1SQVG 3L75G 2IBZG 1NU1G 1NTMG 1SQPG 3CWBG 1L0LG 1PPJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  3H1J G;  2FYU G;  3H1I G;  5KLV G;  1P84 H;  3CX5 H;  3L74 G;  3L72 G;  4U3F G;  3CXH H;  1KYO H;  1EZV G;  3L71 G;  2BCC G;  3L73 G;  1PP9 G;  1BGY G;  1SQX G;  1BE3 G;  1NTZ G;  1SQB G;  1NTK G;  3H1K G;  3BCC G;  1BCC G;  1KB9 H;  1L0N G;  3H1H G;  2A06 G;  3H1L G;  3L70 G;  4D6T G;  4PD4 H;  3TGU G;  1SQV G;  3L75 G;  2IBZ G;  1NU1 G;  1NTM G;  1SQP G;  3CWB G;  1L0L G;  1PPJ G; 
#chains in the Genus database with same CATH topology
 3RK3 E;  3GLM A;  3D71 A;  1RE4 A;  4IFM A;  3H1H J;  3P7K A;  3FX0 A;  2JWD A;  3H1I G;  3HTK B;  4PV1 B;  5AVQ B;  1GTW A;  2OYI C;  3B5N C;  5B66 E;  2B87 B;  1PGJ A;  1RQV A;  1H8A A;  4B86 A;  4IFD K;  2P58 A;  2SPZ A;  3B8E B;  2BCC E;  3FXE A;  4WWI A;  1GZL A;  2Y0C A;  1EZV E;  2P2U A;  3FWN A;  2B87 A;  4HKZ H;  1JCC A;  3IF4 A;  3ITK A;  1LTJ C;  2E43 A;  3BVH A;  1SQP J;  3A3Y B;  3AEB C;  2MJZ A;  1YYC A;  4H0L D;  1M56 D;  4GKG A;  5AW4 B;  1NKN A;  1OMI A;  1RH5 B;  2B89 A;  3SWK A;  2A06 D;  3G71 P;  3H1H G;  1PP9 E;  1NTK J;  3L74 D;  3SFE C;  1N73 A;  2I1K A;  2D2C D;  1ZP0 C;  3KZI E;  2YIU B;  1JNM A;  1KMI Z;  2IZ0 A;  1SFC C;  3L71 E;  3IN6 A;  3CXH E;  4I7Z C;  3L72 J;  4JQ0 D;  1EZV I;  1SQQ K;  1GW3 A;  1J2J B;  3GMA A;  3HTK A;  3AEG C;  2M0B A;  2XZR A;  3CCE P;  2R44 A;  3L4F A;  1H88 A;  4WY4 A;  3CMA P;  1FDM A;  5CCG D;  2M5A B;  4H44 D;  1JY3 N;  5CJ0 A;  2GUV A;  5AVV B;  1K05 A;  2M3E A;  3V2N A;  1X0T A;  2NPS A;  2QVA A;  3P8M C;  1PP9 J;  2YKP A;  2E75 B;  3FXD A;  4PD4 D;  3USS A;  1BDC A;  1PIX A;  1VQM P;  2LKM A;  2R5D A;  4BRY B;  2KUB A;  1ZR4 A;  1NTZ G;  2K3R A;  2ZT9 B;  1T8Z A;  2O01 J;  3BCC E;  4M3L A;  2WIT A;  2IYP A;  2QEX P;  1BSH A;  4LGD E;  2H89 C;  2BEQ D;  2FFD C;  3H1L G;  1JM0 A;  2BCC J;  2E5T A;  3A7O A;  5CCH D;  1KV4 A;  2Q6Q A;  4R4L A;  1G2C B;  1NTZ K;  1L0L G;  3AE8 C;  4UB6 E;  1G1J A;  1DEB A;  1PPJ G;  4JF7 A;  3KYQ A;  1T2K C;  1A02 F;  1QLE D;  2LR2 A;  3RL0 B;  3E1R A;  5BU8 B;  3F89 A;  3WUU A;  2AXC A;  2ZT9 C;  1JUN A;  5KJ7 D;  4H13 C;  3CX5 D;  4GOF A;  5CCH C;  2FYN B;  1IK9 A;  1YTZ T;  1L0N D;  3SWF A;  1J1D B;  1L0L K;  1LT9 C;  4TLF A;  3AE3 C;  3T97 B;  3V2P A;  1GL2 B;  4BRY A;  2WSE H;  5B5E H;  4EOT A;  2AXT H;  2JJL A;  1JY2 P;  1UIX A;  2Y9Z A;  1QVF O;  1S5L X;  1HF9 A;  3NXS A;  3V6I A;  3CCU P;  1NTK E;  1XTC C;  4NPD A;  1AV1 A;  2OTL P;  1IFP A;  2OGU A;  4I1L A;  4PV1 C;  3RK3 C;  2K1A A;  1OW8 A;  4LLH A;  3AE2 C;  1H89 A;  2IPP A;  1VF5 D;  2KXP B;  3WMM 0;  3AE5 C;  3CPW O;  4NPE A;  4PD4 H;  1EDL A;  2Q3I A;  3HUS B;  1S9K D;  3L75 G;  2IBZ G;  1BE3 J;  3H32 A;  2YKQ A;  1FZA A;  4U3F J;  3N7N A;  1SQQ G;  2G3A A;  1NGM B;  1URQ A;  5AW7 B;  1RHZ B;  3W68 A;  2W83 C;  4L76 A;  1QGK B;  1HJ0 A;  4WBA A;  4DZO A;  1URQ D;  1OZH A;  1FJP A;  3CX5 H;  1SQP K;  4OVN F;  3NFQ A;  4A7P A;  2H7H A;  1L4A A;  2YIU C;  1VF5 C;  2E75 D;  2E76 D;  1MFT A;  1SFC B;  2WSS H;  4I7Z B;  1AFO A;  1DIP A;  3CCQ P;  2FXO A;  5KLV J;  1SQX G;  1W5C E;  2H8P D;  2ZAE B;  3SWY A;  1RF1 B;  2Z5H A;  2LXB A;  3VMX A;  1M1J A;  2OYI B;  1BGY J;  1D7M A;  2NPS D;  2FYU E;  3BAT A;  3I55 P;  1NTZ J;  1VDF A;  1K73 Q;  1DH3 A;  1HVV A;  2CPS A;  1RF1 A;  1IFM A;  3L70 G;  2OYH A;  4DOJ A;  1T3U A;  2KIK A;  3V5B A;  3VMZ A;  2KK7 A;  2BCC D;  1KFM A;  2KS1 A;  1KQS O;  2C9N Y;  1ZXG A;  2BEZ F;  1LTS C;  1DD3 A;  1QEX A;  1AA0 A;  1T2K D;  2P10 A;  2PP6 A;  2QSI A;  2ZJS E;  4O9B A;  3RK3 D;  3M0D A;  2VRS A;  3CLQ A;  1ZN5 A;  4JYB A;  4I6M C;  4YXW H;  3W67 A;  4HH2 A;  5TIS H;  1X22 A;  1L0L E;  1ZOY C;  2QM7 A;  1JY2 O;  1S3J A;  1KYO H;  1Y47 A;  2R3C A;  3L75 D;  1OX3 A;  1SQX K;  3RK2 B;  1YJ9 P;  1H0T A;  1PL5 A;  3AEA C;  2Q3E A;  3CX5 I;  1SQX D;  1CW5 A;  1KN7 A;  2ZFC A;  1M57 D;  1HTL C;  2L5G B;  3P8C D;  2IFN A;  1FZC A;  2WMM A;  1LTG C;  3H25 A;  2PGD A;  1BSN A;  2Q1K A;  1NTZ E;  2O01 H;  4IFF A;  3CWB E;  3GF7 A;  3K5B A;  4XFJ A;  4L74 A;  2E5Y A;  2KS1 B;  2XKM A;  3L71 J;  5KJ7 A;  3CME P;  1MV8 A;  2IX7 C;  2KLV A;  3L72 E;  4IOI H;  2XNX A;  3L73 D;  1GK6 A;  3IR9 A;  1CZQ A;  1KIL E;  2OQQ A;  4PJ0 E;  1SFC A;  3CX5 E;  3T97 A;  3KZI H;  3VN0 A;  1M1K Q;  1IO4 A;  3LID A;  1JMB A;  1OW6 A;  2FYU G;  1L0N J;  2W90 A;  3B71 A;  3RL0 D;  3UIA A;  2IYO A;  3BRT B;  4Z1M H;  3V4W A;  1R8E A;  3EQ2 A;  3VTP C;  5CBN A;  3HD7 A;  1M7L A;  4NPF X;  4PJ0 H;  2WPR A;  3RK3 B;  1FOS E;  1RF0 A;  1MKM A;  2PRR A;  5DJT B;  1FJK A;  2P1J A;  2QJY B;  3WUT A;  1U7M A;  3FGA D;  1EQ7 A;  1NH4 A;  4RO0 A;  3L71 G;  5AVZ B;  5AVX B;  3SFD C;  3M9B A;  1J1E B;  1S72 P;  2B9B A;  5AVY B;  3H1H E;  4ZNC A;  4H44 C;  2Y9Y A;  1IFN A;  3Q3D A;  2Z4E A;  3U1C A;  3VOP A;  1NJI Q;  2ZVO B;  1N7S B;  3L36 A;  3V2Q A;  3OAK A;  2N9B A;  1AQT A;  1EDK A;  1L0N G;  2XU6 A;  1VQ7 P;  1SQV J;  1E5W A;  1KIL B;  1OVR A;  2FXP A;  3CWB J;  4OH8 B;  5AW3 B;  5KLI C;  3RL0 g;  4DT0 A;  2OYI A;  2QJP C;  2W6J H;  2KP8 A;  3L75 E;  3MIW A;  3M0D C;  1YJW P;  2KZI A;  3L70 J;  3LW5 H;  2E75 C;  3Q5P A;  1FBM A;  2JKV A;  1FAV A;  2WPS A;  3HD7 D;  3II6 A;  1M8O B;  3NMD A;  1AVO A;  2YNY A;  5H2F H;  2D2C C;  4RJT A;  3JCU H;  5CCG C;  3GW6 A;  3H1I E;  3D6Z A;  1S5L E;  1DEE G;  3HUS A;  1N7S C;  4KHX A;  4UB6 H;  2O1K A;  4D6T J;  3S1K A;  1KIL D;  1H0T B;  3H1L D;  4C7N B;  1UII A;  3CXH D;  1FZC C;  5AW2 B;  1URQ B;  2WTY A;  2AEJ A;  3B5N D;  2ZT9 D;  1NVO A;  5APW A;  1YJN P;  1LTT C;  1PP9 D;  3M9Q A;  3D70 A;  1KOR A;  2FYU D;  5GTH E;  2E74 C;  2ZYA A;  1BCC D;  3GHG A;  3M9H A;  2FYU K;  3BCC D;  4YXD C;  2GM4 A;  2IDB A;  3RGU A;  1QL1 A;  1SQX E;  1GW4 A;  3WU2 H;  4AQR D;  4D6T G;  2W6B A;  1RQU A;  4D6T E;  3HD7 C;  3H1J J;  3L35 A;  1FE6 A;  3NTN A;  4N6J A;  1M1J B;  3S9O A;  1J1E C;  3RBX A;  1YIJ P;  1MFZ A;  1IFD A;  2JO1 A;  2K9J A;  1S5L H;  3WU2 E;  4EI2 A;  1GL2 A;  2PFX A;  4HB1 A;  1PPJ D;  1NTK K;  1BDD A;  1TU3 F;  1USE A;  2HOD B;  4H13 D;  1KTM A;  3G4S P;  4HYT B;  1VQN P;  1W2B O;  1GL2 D;  2ZYD A;  1JTH B;  1SQQ E;  2P7J A;  5GTH H;  2RKL A;  2WSF H;  1HH0 A;  2OTJ P;  3OW2 O;  1NU1 D;  1Z56 A;  4D6T D;  1OWA A;  3KQG A;  3L70 E;  1EZV G;  5APT A;  1RE3 A;  1K04 A;  1NHL A;  5AVT B;  3I56 P;  4U7J A;  4ASW A;  2Y0D A;  1NOH A;  2W6A A;  3PTZ A;  4OGQ B;  3H32 B;  1LJ2 A;  5KTB A;  4ASV A;  3D6Y A;  3CCL P;  2KSE A;  3AE7 C;  1NTM J;  4WB4 A;  1VQ5 P;  1EZV D;  1KFN A;  2HG5 D;  4K35 A;  3EFG A;  1SQV G;  1N7S A;  1SQP E;  2N1T C;  1NU1 G;  3TF5 A;  2ZXX A;  1L0N E;  3CWB G;  3Q2Y A;  3S4R A;  2V7Q H;  1XTG B;  3OJA B;  1ZR2 A;  1OVU A;  2E74 B;  2O3J A;  3B5N A;  5CMZ A;  4YTP C;  2Y0E A;  4IL6 E;  4UB8 H;  5AW1 B;  1AVY A;  3IAO A;  3MGN A;  1FOS F;  2E42 A;  2R32 A;  1N86 A;  5BU5 A;  1FDI A;  3TGU J;  3H6P A;  3GHG C;  4N78 D;  1FZE A;  1HGV A;  3CXH I;  5L8R J;  1LTJ A;  3AEE C;  3A0H H;  1KQG B;  2BCC G;  2J5U A;  2C0X A;  4Y99 C;  3R4Y A;  2POH A;  1N7L A;  1NU1 J;  2OYO A;  3AED C;  5M1B A;  3TYY A;  1YI2 P;  3P8C E;  1SQB G;  1NTK G;  2D2C B;  1LT1 A;  3BCC G;  1BCC G;  4GOD A;  1KB9 H;  2QRX A;  4H13 B;  5E79 E;  5AVS B;  5GTI E;  1KZU B;  2QIW A;  1NAY A;  5AVW B;  4HJG H;  2JR8 A;  2ZVN B;  2L91 A;  2WSC J;  3TGU G;  5KKZ C;  1N73 C;  1HWT C;  1KB9 E;  5KAF H;  4K3A A;  1QL2 A;  4WVZ A;  5TIS E;  3H1J D;  3H1K J;  2UWJ E;  1HGZ A;  3AE6 C;  1WT6 A;  3C8V A;  1LTB C;  2WSF J;  1N2D C;  2Z5I A;  4OGQ C;  1OFC X;  4R4M A;  1NKZ B;  2NPS C;  1FDO A;  1SP4 A;  3A0H E;  1K8A Q;  3BCC J;  3GF3 A;  5APU A;  3TNU B;  3B4S A;  3L73 E;  3CCR P;  2HFE D;  1KYO I;  2K37 A;  3L72 D;  2CK3 H;  2HYN A;  2YXQ B;  1S1C X;  1JCD A;  1M90 Q;  3QH9 A;  3RBZ A;  5AVR B;  5KKZ B;  2W27 A;  4PV1 D;  2IBZ D;  3L74 E;  1MUU A;  3H1I J;  1PP9 G;  1S4X A;  1BE3 G;  2KNC A;  1FS0 E;  3P32 A;  1ZV8 A;  2FFD A;  2C9L Y;  1A02 J;  3TSI A;  2K9J B;  5APX A;  4RES B;  2O01 N;  2YKO A;  3Q1M A;  2KNC B;  4BWN A;  1VQP P;  3U1A A;  1JY3 O;  3ZDM A;  2FBW C;  2I8D A;  5APS A;  1WMK A;  3L37 A;  1NTM D;  4L73 A;  4AYC A;  2HPC A;  3M0A A;  3TDK A;  1CI6 A;  1NWQ A;  1LGH B;  2B88 A;  4ZMD A;  3AEC C;  1GDT A;  4W7Y A;  2OAR A;  4DJG A;  2NZ2 A;  5H2F E;  1YTZ I;  5KLV G;  3H1K D;  2KYV A;  4JBZ A;  2W8Z A;  5AW9 B;  4L75 A;  2KB7 P;  3Q5S A;  1ZRT E;  2YMY A;  2M8R A;  3L72 G;  3MTU E;  3MUD C;  1KIL C;  1NTM E;  2QM8 A;  2G8Y A;  4JPZ B;  5K5G B;  5KLI B;  2HPC B;  3TK1 A;  3KPE A;  1SLQ A;  1VQL P;  2HOD A;  5B66 H;  1PGO A;  2J58 A;  3AE4 C;  1VPC A;  1L2P A;  2C0W A;  3A2A A;  1YHQ P;  1JTH A;  2KSJ A;  1VQK P;  4IL6 X;  1R5L A;  2V7Q J;  2RMZ A;  2JEE A;  2K9Y A;  3SSU A;  1IC2 A;  3ABV C;  2IBZ E;  2JWA A;  3V4Q A;  4W7Z A;  1U57 A;  1BCC J;  1JY3 P;  1OVV A;  1W2E A;  2OTK E;  1CI6 B;  2ZYG A;  4QMA A;  1LWU A;  3HE4 B;  2DW3 A;  2IZ1 A;  1SQQ J;  4PD4 I;  2AEF A;  1URQ C;  2HR3 A;  2E76 B;  4KT0 J;  3WUV A;  4CPG A;  1RF0 C;  1X9V A;  2A45 H;  2P67 A;  3H1L E;  4W80 A;  3CD6 P;  2GA1 A;  1NAF A;  1SQB D;  3L75 J;  1YQ3 C;  1G1I A;  1L4A D;  2QG4 A;  1N7S D;  2IFM A;  3PLN A;  3HE5 A;  1VQ9 P;  2ZXE B;  3QWO C;  2FFD B;  3CC2 P;  1DD4 A;  2RN0 A;  3H1J E;  1Q86 Q;  3A5T A;  2QE7 H;  2WSC H;  1NU1 K;  1KB9 D;  3OA7 A;  2QJP B;  1L0L J;  1MZ9 A;  1ZLL A;  1KYO D;  1K9M Q;  1SQX J;  5B5E E;  2QJK B;  1U7J A;  1Q90 D;  1T6A A;  1L4A C;  1USD A;  2E76 C;  5AVU B;  2YO3 A;  1BGY G;  3RL0 C;  3TNU A;  1ZME C;  1RE3 C;  2WQY C;  2LXC B;  3JC2 2;  1YBK A;  3FWL A;  3H1H D;  2BAS A;  2OYH C;  1QX8 A;  2YO2 A;  4N78 E;  1OXZ A;  2FYN C;  3C9I A;  2WT7 B;  1LT9 B;  3N4X A;  4ZKU A;  3PHL A;  5AW0 B;  2H88 C;  2HLO A;  1SQV K;  1AJY A;  2QJY C;  4KJM A;  1KQL A;  2O1J A;  3AE9 C;  2QJK C;  1JY2 N;  2A45 G;  1NYH A;  3V2R A;  1WRG A;  3CL3 D;  5KLV D;  1Q2N A;  1GD2 E;  1AQ5 A;  1EDI A;  1T3J A;  4H44 B;  3AE1 C;  1OIP A;  3KHU A;  1IFJ A;  4GDO A;  5KLV E;  2WT7 A;  1LTA C;  2OYH B;  2YXR B;  2WSE J;  2Q5U A;  1SVF A;  3RK2 D;  4H0L C;  4N3Y B;  1QVG O;  4U3F G;  2ITA A;  3HD7 B;  3L71 D;  1PZQ A;  1EDJ A;  1YQ4 C;  1Y8A A;  1LWU B;  3HE4 A;  3CWB D;  1DX7 A;  1GU5 A;  1VQ8 P;  4EIJ A;  3JCU E;  1NO4 A;  3MD0 A;  5CCH A;  1SQB K;  1G2C A;  1CSB A;  1LT9 A;  5KAI E;  1KC8 Q;  2K88 A;  5KJ7 C;  3LW5 J;  2QA4 P;  2A06 G;  3B5N B;  2A45 I;  1BE3 E;  3EWK A;  3HE5 B;  3PH0 A;  5AW8 B;  3LIE A;  3CCM P;  1Q7Y Q;  1EXI A;  3I5C A;  1J1D C;  2WPV B;  1FZG A;  1PFI A;  1FZC B;  1LP1 B;  1L4A B;  1ZRT D;  2WPQ A;  2R3S A;  4Y28 J;  3CCS P;  3G6E P;  1SQQ D;  3GG2 A;  1Q81 Q;  3KDP B;  5E79 H;  4WY4 C;  1LTJ B;  2XND H;  4OGQ D;  5C39 A;  3M91 A;  1RY3 A;  3PP5 A;  1PPJ E;  3E7K A;  2FY8 A;  2RH0 A;  2I1J A;  2FYU J;  2IBZ I;  2WWW A;  3F5H A;  1JOC A;  1N8R Q;  3CC7 P;  1SFC D;  3BAS A;  4RKU J;  1SS1 A;  1FZB A;  3TGU D;  2N1T B;  3VP9 A;  5DJU B;  5APY A;  1N73 B;  2KI7 B;  5GTI H;  4GIF A;  3G9R A;  2A06 E;  1IJD B;  2Q9I A;  1EC5 A;  1BGY D;  2N1T A;  1VQO P;  1VQ4 P;  2FKW B;  2M3B A;  1BCC E;  5TJH A;  1JB0 J;  2YMK A;  1VL2 A;  3BRV B;  3GHG B;  1LTI C;  4H0L B;  1HBW A;  3CCV P;  2XV5 A;  5CBO A;  1Q82 Q;  1NTM K;  2WVR A;  1YIT P;  3VMA A;  2JDI H;  3A0B E;  4TT3 H;  1S9K E;  1VF5 B;  1E79 H;  4U3F E;  1FC2 C;  5CCG A;  2KOG A;  4C46 A;  2V4H A;  1ZW0 A;  2WZ7 A;  3H1K E;  3H1I D;  3PRJ A;  3CCJ P;  1IK7 A;  1RF1 C;  3CC4 P;  3MHV A;  5KLV K;  2PAJ A;  5KAI H;  1P84 H;  2XDJ A;  1OW7 A;  4DCK A;  1S2E A;  3AEF C;  3O6Q B;  5CJ4 A;  1HUC A;  1SQV D;  3HUS C;  4EDF A;  1PV3 A;  3U59 A;  2AXT E;  1RE4 C;  3IFM A;  4OWF A;  5AW5 B;  2CPB A;  3MUD A;  1BE3 D;  4WY4 B;  2J59 M;  4C7N A;  4ZKP A;  1Y9B A;  4XE5 B;  1JO5 A;  3M06 A;  1NTK D;  3L74 J;  5EFW B;  5AW6 B;  2JP3 A;  2N1T D;  2NPS B;  1R5S A;  3E1I A;  5KAF E;  1L0N K;  3VYI A;  1X79 B;  4C7R A;  1PGP A;  3L73 J;  3O8Z A;  1KYO E;  1PGQ A;  1IFI A;  1GL2 C;  2KLU A;  4BXL A;  1LWU C;  3CI9 A;  1P84 E;  3H1J G;  1KB9 I;  2M5A A;  4JYC A;  4YPC A;  3JSV C;  4AUW A;  2FXM A;  4XA4 A;  4IL6 H;  4UB8 E;  1LP1 A;  3G3Z A;  1LNQ A;  1SQB E;  5APQ A;  1P84 D;  1SQB J;  2R5B A;  3EFF K;  5APV A;  1KD1 Q;  3L74 G;  5BVZ A;  3VP8 A;  4U3F D;  3KXD A;  1FU1 A;  1SQP D;  3R2P A;  1KQF B;  2NRG A;  3CXH H;  3A0B H;  1JMM A;  2FYZ A;  1EXJ A;  1FZF A;  1IZN B;  3Q5R A;  3C1L A;  3L73 G;  2Q7C A;  1M1J C;  3MZW B;  1NTZ D;  4I2L C;  1P84 I;  1JEK A;  4LC1 A;  3HRN A;  1HJB A;  2N9Y B;  3H1L J;  3H1K G;  1VQ6 P;  1BGY E;  1GK4 A;  4GOE A;  1GU4 A;  2H43 A;  2GUS A;  3PJS K;  2AEM A;  3VMY A;  1X8Y A;  4PD4 E;  4MN4 C;  3L70 D;  4WY4 D;  3RK2 C;  1L0L D;  1NU1 E;  3O6Q A;  3TGU E;  4GT1 A;  1SQP G;  1NTM G;  1SQV E;  2KZJ A;  4Y99 B;  3MP7 B;  2MKV A;  5CHX A;  4EYY Q;  1GMJ A;  2E74 D;  1KIL A; 
#chains in the Genus database with same CATH homology
 1SQQ G;  3H1J G;  2FYU G;  3H1I G;  5KLV G;  1P84 H;  3CX5 H;  3L74 G;  3L72 G;  4U3F G;  3CXH H;  1KYO H;  1EZV G;  3L71 G;  2BCC G;  3L73 G;  1PP9 G;  1BGY G;  1SQX G;  1BE3 G;  1NTZ G;  1SQB G;  1NTK G;  3H1K G;  3BCC G;  1BCC G;  1KB9 H;  1L0N G;  3H1H G;  2A06 G;  3H1L G;  3L70 G;  4D6T G;  4PD4 H;  3TGU G;  1SQV G;  3L75 G;  2IBZ G;  1NU1 G;  1NTM G;  1SQP G;  3CWB G;  1L0L G;  1PPJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...