3L71G

Cytochrome bc1 complex from chicken with azoxystrobin bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "DISTAL" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l71G00
3CX5H 1SQVG 1EZVG 3BCCG 3L70G 2A06G 3H1JG 3H1LG 3H1KG 3CXHH 4PD4H 1SQXG 1NTMG 1BCCG 5KLVG 2IBZG 1P84H 4U3FG 1BGYG 2FYUG 1NU1G 3L73G 1PP9G 1L0LG 3CWBG 3L74G 3L75G 3L71G 3H1HG 3TGUG 1SQQG 1PPJG 1L0NG 4D6TG 1NTZG 1KB9H 3L72G 1KYOH 1SQPG 3H1IG 1SQBG 1NTKG 1BE3G 2BCCG
chains in the Genus database with same CATH superfamily
3GMAA 2IFNA 1HJBA 1KYOD 1U57A 3SWFA 1VDFA 3PHLA 1SFCA 3F89A 1VQ8P 3L75D 3H1JE 3BCCD 1PPJE 1SQQE 2B89A 2C0XA 1YJ9P 1DEEG 3CWBD 2G8YA 1FJKA 2ZVNB 3H1HJ 5BVZA 3CD6P 2XNDH 5APVA 3CMAP 4IFDK 1H0TA 4W7ZA 1ZMEC 3W68A 5B5EE 2B87A 1SQXD 3L74G 1S5LX 3SFDC 1HGVA 2PRRA 1CI6B 4OH8B 4XE5B 4GKGA 1QX8A 5KJ7C 3MTUE 2PFXA 5GTHH 4JPZB 4YTPC 3GHGB 4AQRD 2E42A 1J2JB 3UIAA 3SFEC 4Y28J 3CCLP 1VL2A 1RE3A 2QSIA 5AW6B 2WSFH 1HJ0A 5H2FE 1VQ7P 1KYOH 1RY3A 1L4AA 1YHQP 1M56D 3L74E 3CCRP 3A7OA 3CCMP 5KAIE 3PP5A 1OX3A 1NTMK 2D2CB 3B4SA 3LW5H 1VQ6P 4WVZA 1LT9C 3L72J 1LTIC 1PGQA 1CW5A 1NAYA 3B71A 1VQLP 1DD3A 3O6QB 5AVUB 2WSFJ 1LP1B 1ZP0C 2C9NY 4K3AA 4I7ZC 1KQFB 1Q81Q 1NGMB 2VRSA 3V4WA 2FYNC 1SQPJ 1FOSF 1KQLA 1ZRTE 3H1LD 3L71E 2HODB 1DEBA 2Y0DA 1EZVE 2H8PD 4NPFX 1ZLLA 5KAFE 1JOCA 2YKPA 1IFMA 3LIEA 3MHVA 3OA7A 1H0TB 4ZNCA 3Q2YA 2FYUD 2IYOA 4LC1A 3VMZA 1NTZD 1GL2D 3VP8A 3AE3C 4JF7A 1OVVA 1KQGB 3VTPC 1KILE 4KT0J 2E75B 1SQXJ 3V2RA 1QLED 1Y8AA 2G3AA 4H44C 4XFJA 2QRXA 3D71A 3D70A 3H1JD 4PV1C 1JY3P 3CX5H 1N73B 2QG4A 3B8EB 3A0BH 1NJIQ 3M0DA 2OYIC 1EQ7A 1EZVG 2LKMA 1FZCC 3CC7P 1HBWA 2A06G 2ZT9B 2K88A 2WPSA 1LP1A 2C0WA 3V4QA 1RE4C 3E1IA 5AW3B 4D6TE 1XTCC 4IL6E 2IFMA 3PH0A 2O1JA 2NPSC 1DH3A 2YKOA 5CCHC 4BRYA 1T2KC 2ZYGA 1WMKA 2LR2A 2QIWA 1KFMA 4I1LA 1SP4A 2IBZD 1G1JA 2P67A 3CX5D 2NPSA 2E74C 2KK7A 2YNYA 2V4HA 1OW6A 3I56P 3AEEC 5BU5A 3OW2O 3E1RA 1LWUA 1Q7YQ 2QVAA 3P8MC 1W2EA 4TLFA 1FZCA 2E5YA 3CWBJ 1SQVJ 1GL2B 2JR8A 3HD7D 3L72G 2M3BA 3CXHI 5AVSB 3GHGA 4HB1A 3RL0B 2WTYA 1K8AQ 1FZCB 1IJDB 1S1CX 2KZJA 1KFNA 4UB6E 2BEZF 1NU1J 1PPJD 1SQQD 5E79E 3T97B 3L70G 1R5SA 3TNUB 3CCJP 5TJHA 1AJYA 2GUVA 3BATA 1J1EC 1KILB 1SQXG 4WY4B 5CCGC 2Y9ZA 1P84H 4GOEA 3B5ND 1JY2P 3SWKA 2E76C 2N9BA 2IX7C 2WPQA 5GTHE 2HR3A 2ZXEB 3H1JJ 2Z4EA 3P8CE 4GIFA 3KZIE 1RF0A 3L75G 3L71G 5KLVJ 2E76B 1JY2N 1FE6A 1X79B 2IBZI 2M5AA 2R44A 2GUSA 2PAJA 5KLIB 1LT9A 1SQXE 4R4LA 2WVRA 2JEEA 1KILC 3ITKA 3MD0A 4XA4A 1JY3O 1BCCD 3A3YB 3KHUA 5KJ7D 3WUVA 3TGUJ 1URQD 2H89C 1S9KD 2XDJA 3L75E 3VP9A 2AEMA 2L91A 3PRJA 2HLOA 1FDMA 3U1CA 1IZNB 2A06E 1GK6A 1LTBC 1GL2A 3IR9A 4ASVA 4H0LD 1G2CA 1ZR4A 3L74D 1DD4A 2LXCB 1L0ND 1AQTA 1PGPA 3L73G 3RBZA 1RE4A 1SQBK 3BRTB 1GTWA 1BE3E 1PP9G 1FDOA 1ZV8A 1FZBA 1SQBJ 3NFQA 2WWWA 5AVYB 3RK3D 2ZJSE 2POHA 3M91A 3P8CD 1NTZK 3M0DC 2NPSB 1EDLA 3HE4B 1SVFA 5DJUB 2QEXP 4OGQC 3OAKA 4YPCA 3VMXA 3CX5E 1EZVI 2KP8A 2O01J 3NTNA 3L72E 2O01N 1M1KQ 1E5WA 1JM0A 2KUBA 2A45H 1NKNA 3H1ID 4PJ0E 1FZFA 1NU1E 1FJPA 1NTMJ 3L37A 1BE3G 1JY2O 1PP9E 2WMMA 3EWKA 2BCCE 3KPEA 5KTBA 1JEKA 2WITA 2WSSH 1HGZA 1G2CB 1PGOA 2Q6QA 1K04A 2QE7H 3AEGC 3IF4A 3L70E 4DZOA 1EXIA 4R4MA 3AE6C 2O3JA 1GDTA 2QA4P 4KJMA 5B66H 3WU2E 2B87B 2RH0A 1VF5D 5KLVG 2B9BA 2N1TB 2YIUC 2Z5HA 3NMDA 3TNUA 1N7SD 1JUNA 4I2LC 1NU1G 2W8ZA 2J58A 1G1IA 3MIWA 3L70J 1N7SB 3LIDA 1VQ5P 2FBWC 1N2DC 2CK3H 2E74B 3SSUA 5AVVB 3AEAC 4L75A 3TF5A 3I55P 1VQNP 2W6AA 3Q1MA 2A45G 2QJPC 2J59M 1E79H 1FAVA 1HVVA 3G9RA 3BVHA 1HWTC 1VQKP 3L74J 1L0NE 2NRGA 1WT6A 1LWUB 3F5HA 3VYIA 1OMIA 1M57D 3L71J 4LGDE 4N78D 4BWNA 2HPCB 1LTGC 5C39A 1NTKG 2NPSD 3CCQP 1KC8Q 3B5NC 1M7LA 5AW2B 5GTIE 4H13D 2FFDB 3W67A 5APYA 1MKMA 1N73C 1R5LA 2KLUA 3KQGA 1L4AB 3JCUE 5AW0B 5BU8B 2FFDA 1AFOA 2N9YB 2XU6A 3CC2P 3RK3B 4HH2A 1FS0E 4UB8E 1SQPD 3CCSP 1J1DC 1YTZI 1MUUA 2IBZG 1IK7A 1D7MA 2M3EA 3EFGA 3L73E 1NTKE 1NTMD 1S72P 3TYYA 1LGHB 3HUSB 5CCGD 2KNCB 1GD2E 1JB0J 1AVOA 5B66E 2P1JA 1X8YA 4L73A 1EDJA 4O9BA 4ZKUA 1K9MQ 4H0LB 1L0LK 1OW8A 1QL1A 1RQUA 1KB9D 1SFCC 1URQB 5KKZB 3H32A 1VQMP 1L2PA 3GG2A 2IBZE 3AE2C 4H0LC 4WY4C 1ZW0A 2JKVA 2AXTH 1BGYE 1LT9B 1SQBG 1HTLC 1IFIA 1LJ2A 2KSEA 2RN0A 2QJYB 1T8ZA 2BCCG 1Z56A 1OXZA 2BEQD 2WZ7A 2E5TA 2E76D 3A0HE 3HUSC 4K35A 4PD4E 2B88A 4KHXA 1QEXA 3CPWO 1Y47A 2P7JA 2JP3A 2L5GB 1UIXA 3WUTA 2BCCD 4ZKPA 1NU1K 1L0NK 1NTKJ 2R5BA 1IFDA 1K05A 2PP6A 2MKVA 2KZIA 4EDFA 5L8RJ 2OTKE 5KLVE 1BGYG 1UIIA 2KS1A 1KILD 1MFZA 3H6PA 5AW1B 3U1AA 5CBNA 5KKZC 1ZXGA 3BCCJ 3B5NB 1OFCX 1L0LG 2WT7B 2OYIB 1RHZB 3RK2D 1MFTA 4IL6H 2XNXA 3H1HD 2YMYA 5H2FH 1PZQA 2IZ1A 2W83C 3BRVB 3AE8C 1T3UA 3OJAB 4PJ0H 2LXBA 3CI9A 1PIXA 1QVFO 3M9BA 3C9IA 1LTJC 1L0NG 3HUSA 3L73D 1Y9BA 2Q1KA 2Q5UA 2ITAA 3RK3C 3USSA 1GW3A 4A7PA 1KQSO 2JJLA 2K9JA 1L0LE 3PTZA 3RL0D 3IN6A 3O6QA 1X22A 1YBKA 1Q86Q 5AVRB 1S5LH 2KXPB 1AV1A 1MV8A 1SQVG 5AW5B 3QH9A 3M9QA 2GA1A 1KV4A 1SQQK 2JWDA 4PV1D 4W80A 2RMZA 3A0HH 3V6IA 4PD4D 1BCCE 1MZ9A 1PP9D 1L4AC 2A45I 1NTZE 2R3CA 3M0AA 3MGNA 1JMBA 2Q7CA 4H44B 4W7YA 3G4SP 1EZVD 4DCKA 5KJ7A 1ZRTD 4H13C 1NYHA 5AVXB 3TK1A 1KN7A 3TGUD 2BCCJ 2ZT9D 1P84D 2FY8A 2IYPA 2ZFCA 2H88C 1X0TA 5DJTB 1L0LJ 1BE3D 3KZIH 1M1JC 3JCUH 1NTZG 3L75J 1SQBE 1JNMA 2E75D 1SQPK 1IC2A 2ZXXA 1HF9A 2HODA 1N7LA 5CHXA 2HG5D 1ZOYC 1IK9A 4UB8H 2O1KA 1URQA 2FYUJ 2Q3EA 4Y99B 3V5BA 3VOPA 3A5TA 2KOGA 3CLQA 4I6MC 3BCCG 2N1TA 3S1KA 2KB7P 2ZYDA 1QL2A 2R3SA 3H1KE 1LTJB 1NKZB 2KNCA 3RK2B 3MUDA 2OYOA 3AE1C 3AEBC 3HTKA 5M1BA 1SQVK 4AYCA 1FU1A 2AEJA 3L35A 2FXOA 4HJGH 4HKZH 1GU5A 2OARA 3NXSA 2WSEH 3H1IJ 3ABVC 3WMM0 3SWYA 1AQ5A 1BGYJ 3AE5C 3Q5RA 1NOHA 5CJ0A 5AW7B 4BRYB 3RBXA 3BASA 2KYVA 1NTKD 1NTME 1PP9J 1A02F 3KDPB 3G71P 5K5GB 1IFPA 1USEA 1U7JA 3CX5I 1SFCD 2YXQB 1W5CE 1JTHA 1DIPA 2D2CC 1NAFA 3AECC 3CXHE 2K3RA 4U3FJ 3MZWB 5APWA 1FZGA 3HD7C 2SPZA 2XZRA 5APTA 1X9VA 1SQVE 1DX7A 1KYOE 2Q3IA 1CZQA 4NPDA 3L70D 1Q2NA 3AE4C 2OTJP 3CXHD 1RE3C 1NTMG 2AEFA 1BE3J 1BCCG 1XTGB 1ZN5A 4IFFA 4Z1MH 4AUWA 3M06A 1SQQJ 2V7QJ 1KB9I 4WY4A 3ZDMA 1FDIA 2OQQA 3FWLA 1NVOA 3FXEA 4JYBA 2WPVB 1NTZJ 1RF1A 3D6ZA 4M3LA 3L71D 1BDDA 1GL2C 2C9LY 3B5NA 4HYTB 2MJZA 2H43A 2I8DA 2WQYC 2ZYAA 2KS1B 1SFCB 4ZMDA 5KLIC 2FXPA 2M5AB 3N4XA 4H13B 5EFWB 1A02J 1S3JA 2HYNA 4WWIA 1VQ4P 3H25A 2R32A 5APSA 2JO1A 4OWFA 4EI2A 1GZLA 2YIUB 3R2PA 3FX0A 1FC2C 3BCCE 5CCHA 2A06D 1JY3N 2E43A 1RF1B 2R5DA 2K1AA 3H1LG 3H1KG 2KI7B 3HE5B 5B5EH 5GTIH 1OIPA 4EOTA 1OWAA 4RO0A 2E74D 1L0LD 4LLHA 1ZR2A 1JO5A 3M9HA 1M1JA 1FZAA 2YKQA 2YO3A 1U7MA 4U3FD 4ASWA 3TGUE 2E75C 1W2BO 1FBMA 3VMAA 1VF5B 3EFFK 5CCGA 1JCCA 1LTSC 2M0BA 3H1LE 5AVTB 3AEDC 3FWNA 3Q5PA 1YYCA 2N1TC 1J1DB 1OVUA 4GODA 1T6AA 1SQXK 5KAIH 1T2KD 4L74A 4WB4A 3FXDA 2ZT9C 1LT1A 4QMAA 2XV5A 4D6TG 2Q9IA 1N7SC 2K37A 4MN4C 4I7ZB 2ZAEB 1OVRA 1WRGA 3WU2H 4PD4I 4DJGA 3H1KD 3HRNA 3KXDA 4DOJA 2HPCA 2CPSA 5AVQB 2WT7A 2AXTE 1KD1Q 3VMYA 3KYQA 3LW5J 4H44D 3WUUA 1LTAC 5KLVK 4PD4H 2OYHA 1BSNA 2J5UA 2WSCH 4JQ0D 4UB6H 3CC4P 1YQ4C 2V7QH 1KYOI 4N78E 4GOFA 5CJ4A 1IFNA 2IDBA 1TU3F 5E79H 4PV1B 1YI2P 2FYUE 4TT3H 1N73A 1P84I 5KAFH 1LTJA 3L72D 4IOIH 1AA0A 4IFMA 4D6TJ 1GK4A 1VF5C 3A2AA 4RESB 1KORA 3II6A 2W27A 4B86A 5CBOA 3N7NA 5AVZB 1P84E 2PGDA 1BCCJ 1HH0A 1KB9E 2ZVOB 3H1HE 1N7SA 3HD7A 2WSEJ 3C8VA 2I1KA 2OGUA 3IAOA 4OGQB 1KMIZ 4YXDC 1H89A 1EXJA 1BDCA 4RJTA 4GDOA 1Q90D 2JWAA 2KLVA 2WSCJ 3GW6A 3RGUA 3D6YA 1SS1A 3A0BE 1EDKA 2FYNB 3H1LJ 1IFJA 3H32B 5CMZA 3U59A 3P7KA 5AVWB 1YIJP 2HFED 1KZUB 3CWBE 2FKWB 5TISE 3CCVP 1PFIA 2YMKA 1L0NJ 1NTKK 3E7KA 3MP7B 3V2QA 1M8OB 1VQPP 3I5CA 1NH4A 2FXMA 1JTHB 1NHLA 1SQBD 3GF3A 1NWQA 3G3ZA 2IPPA 3G6EP 1JCDA 3HE4A 4OVNF 1K73Q 5CCHD 4YXWH 2QJYC 2Y0CA 2YXRB 3CWBG 4DT0A 1EDIA 2W6BA 1JMMA 3H1KJ 3V2NA 3RL0g 4JYCA 1QVGO 2W90A 3JSVC 1N8RQ 1RQVA 4BXLA 1YTZT 3GLMA 1CI6A 2CPBA 1URQC 3GHGC 2Y9YA 4C46A 3Q3DA 2K9JB 4GT1A 3CCEP 2W6JH 1J1EB 3JC22 4NPEA 1KB9H 3TDKA 1SQPE 3PJSK 5APUA 1S2EA 1CSBA 3EQ2A 2BASA 3HD7B 3L4FA 4N6JA 4Y99C 4EIJA 2XKMA 2Y0EA 2AXCA 1PGJA 3AEFC 1SQVD 4WY4D 2FFDC 3RK2C 1IO4A 4OGQD 3C1LA 3H1JG 3RL0C 1S9KE 1YQ3C 1YJNP 1EC5A 1PL5A 4C7NA 1VQOP 1YJWP 1KTMA 1OW7A 2OTLP 1NU1D 2FYUG 1BGYD 3H1IE 1R8EA 4U7JA 2QM8A 2FYUK 2KIKA 2OYIA 2UWJE 3IFMA 1L4AD 2JDIH 3VN0A 1LWUC 3H1HG 1Q82Q 3CL3D 1KILA 1S4XA 5APQA 3TGUG 2OYHB 3GF7A 3FGAD 4L76A 3RK3E 3CMEP 4CPGA 1QGKB 3T97A 1GMJA 4N3YB 3S9OA 1USDA 1S5LE 3TSIA 3CCUP 2OYHC 2P2UA 1VQ9P 1BSHA 2H7HA 2RKLA 3H1IG 5KLVD 3QWOC 4C7RA 1SLQA 2QJKC 4IL6X 4JBZA 4D6TD 3AE7C 1GW4A 2YO2A 1H8AA 2QJKB 3L73J 2QM7A 5AW9B 1M90Q 1FZEA 4RKUJ 1LTTC 3CXHH 1M1JB 3K5BA 3Q5SA 1GU4A 1AVYA 3AE9C 3P32A 2N1TD 1RH5B 2FYZA 2Z5IA 4U3FG 4WBAA 4EYYQ 2QJPB 3HE5A 1OZHA 1PV3A 5AW8B 3S4RA 1RF0C 1N86A 2P10A 2GM4A 1VPCA 1HUCA 2P58A 1H88A 2I1JA 2WPRA 5APXA 1PPJG 1SQQG 5AW4B 2D2CD 1FOSE 1NO4A 2K9YA 3PLNA 3L36A 3O8ZA 4U3FE 3V2PA 5TISH 1YITP 3R4YA 1LNQA 1SQPG 2IZ0A 2KSJA 2M8RA 2O01H 1T3JA 3MUDC 1RF1C 4C7NB 2DW3A 3HTKB 2NZ2A
chains in the Genus database with same CATH topology
3CX5H 1SQVG 1EZVG 3BCCG 3L70G 2A06G 3H1JG 3H1LG 3H1KG 3CXHH 4PD4H 1SQXG 1NTMG 1BCCG 5KLVG 2IBZG 1P84H 4U3FG 1BGYG 2FYUG 1NU1G 3L73G 1PP9G 1L0LG 3CWBG 3L74G 3L75G 3L71G 3H1HG 3TGUG 1SQQG 1PPJG 1L0NG 4D6TG 1NTZG 1KB9H 3L72G 1KYOH 1SQPG 3H1IG 1SQBG 1NTKG 1BE3G 2BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 H;  1SQV G;  1EZV G;  3BCC G;  3L70 G;  2A06 G;  3H1J G;  3H1L G;  3H1K G;  3CXH H;  4PD4 H;  1SQX G;  1NTM G;  1BCC G;  5KLV G;  2IBZ G;  1P84 H;  4U3F G;  1BGY G;  2FYU G;  1NU1 G;  3L73 G;  1PP9 G;  1L0L G;  3CWB G;  3L74 G;  3L75 G;  3L71 G;  3H1H G;  3TGU G;  1SQQ G;  1PPJ G;  1L0N G;  4D6T G;  1NTZ G;  1KB9 H;  3L72 G;  1KYO H;  1SQP G;  3H1I G;  1SQB G;  1NTK G;  1BE3 G;  2BCC G; 
#chains in the Genus database with same CATH topology
 3GMA A;  2IFN A;  1HJB A;  1KYO D;  1U57 A;  3SWF A;  1VDF A;  3PHL A;  1SFC A;  3F89 A;  1VQ8 P;  3L75 D;  3H1J E;  3BCC D;  1PPJ E;  1SQQ E;  2B89 A;  2C0X A;  1YJ9 P;  1DEE G;  3CWB D;  2G8Y A;  1FJK A;  2ZVN B;  3H1H J;  5BVZ A;  3CD6 P;  2XND H;  5APV A;  3CMA P;  4IFD K;  1H0T A;  4W7Z A;  1ZME C;  3W68 A;  5B5E E;  2B87 A;  1SQX D;  3L74 G;  1S5L X;  3SFD C;  1HGV A;  2PRR A;  1CI6 B;  4OH8 B;  4XE5 B;  4GKG A;  1QX8 A;  5KJ7 C;  3MTU E;  2PFX A;  5GTH H;  4JPZ B;  4YTP C;  3GHG B;  4AQR D;  2E42 A;  1J2J B;  3UIA A;  3SFE C;  4Y28 J;  3CCL P;  1VL2 A;  1RE3 A;  2QSI A;  5AW6 B;  2WSF H;  1HJ0 A;  5H2F E;  1VQ7 P;  1KYO H;  1RY3 A;  1L4A A;  1YHQ P;  1M56 D;  3L74 E;  3CCR P;  3A7O A;  3CCM P;  5KAI E;  3PP5 A;  1OX3 A;  1NTM K;  2D2C B;  3B4S A;  3LW5 H;  1VQ6 P;  4WVZ A;  1LT9 C;  3L72 J;  1LTI C;  1PGQ A;  1CW5 A;  1NAY A;  3B71 A;  1VQL P;  1DD3 A;  3O6Q B;  5AVU B;  2WSF J;  1LP1 B;  1ZP0 C;  2C9N Y;  4K3A A;  4I7Z C;  1KQF B;  1Q81 Q;  1NGM B;  2VRS A;  3V4W A;  2FYN C;  1SQP J;  1FOS F;  1KQL A;  1ZRT E;  3H1L D;  3L71 E;  2HOD B;  1DEB A;  2Y0D A;  1EZV E;  2H8P D;  4NPF X;  1ZLL A;  5KAF E;  1JOC A;  2YKP A;  1IFM A;  3LIE A;  3MHV A;  3OA7 A;  1H0T B;  4ZNC A;  3Q2Y A;  2FYU D;  2IYO A;  4LC1 A;  3VMZ A;  1NTZ D;  1GL2 D;  3VP8 A;  3AE3 C;  4JF7 A;  1OVV A;  1KQG B;  3VTP C;  1KIL E;  4KT0 J;  2E75 B;  1SQX J;  3V2R A;  1QLE D;  1Y8A A;  2G3A A;  4H44 C;  4XFJ A;  2QRX A;  3D71 A;  3D70 A;  3H1J D;  4PV1 C;  1JY3 P;  3CX5 H;  1N73 B;  2QG4 A;  3B8E B;  3A0B H;  1NJI Q;  3M0D A;  2OYI C;  1EQ7 A;  1EZV G;  2LKM A;  1FZC C;  3CC7 P;  1HBW A;  2A06 G;  2ZT9 B;  2K88 A;  2WPS A;  1LP1 A;  2C0W A;  3V4Q A;  1RE4 C;  3E1I A;  5AW3 B;  4D6T E;  1XTC C;  4IL6 E;  2IFM A;  3PH0 A;  2O1J A;  2NPS C;  1DH3 A;  2YKO A;  5CCH C;  4BRY A;  1T2K C;  2ZYG A;  1WMK A;  2LR2 A;  2QIW A;  1KFM A;  4I1L A;  1SP4 A;  2IBZ D;  1G1J A;  2P67 A;  3CX5 D;  2NPS A;  2E74 C;  2KK7 A;  2YNY A;  2V4H A;  1OW6 A;  3I56 P;  3AEE C;  5BU5 A;  3OW2 O;  3E1R A;  1LWU A;  1Q7Y Q;  2QVA A;  3P8M C;  1W2E A;  4TLF A;  1FZC A;  2E5Y A;  3CWB J;  1SQV J;  1GL2 B;  2JR8 A;  3HD7 D;  3L72 G;  2M3B A;  3CXH I;  5AVS B;  3GHG A;  4HB1 A;  3RL0 B;  2WTY A;  1K8A Q;  1FZC B;  1IJD B;  1S1C X;  2KZJ A;  1KFN A;  4UB6 E;  2BEZ F;  1NU1 J;  1PPJ D;  1SQQ D;  5E79 E;  3T97 B;  3L70 G;  1R5S A;  3TNU B;  3CCJ P;  5TJH A;  1AJY A;  2GUV A;  3BAT A;  1J1E C;  1KIL B;  1SQX G;  4WY4 B;  5CCG C;  2Y9Z A;  1P84 H;  4GOE A;  3B5N D;  1JY2 P;  3SWK A;  2E76 C;  2N9B A;  2IX7 C;  2WPQ A;  5GTH E;  2HR3 A;  2ZXE B;  3H1J J;  2Z4E A;  3P8C E;  4GIF A;  3KZI E;  1RF0 A;  3L75 G;  3L71 G;  5KLV J;  2E76 B;  1JY2 N;  1FE6 A;  1X79 B;  2IBZ I;  2M5A A;  2R44 A;  2GUS A;  2PAJ A;  5KLI B;  1LT9 A;  1SQX E;  4R4L A;  2WVR A;  2JEE A;  1KIL C;  3ITK A;  3MD0 A;  4XA4 A;  1JY3 O;  1BCC D;  3A3Y B;  3KHU A;  5KJ7 D;  3WUV A;  3TGU J;  1URQ D;  2H89 C;  1S9K D;  2XDJ A;  3L75 E;  3VP9 A;  2AEM A;  2L91 A;  3PRJ A;  2HLO A;  1FDM A;  3U1C A;  1IZN B;  2A06 E;  1GK6 A;  1LTB C;  1GL2 A;  3IR9 A;  4ASV A;  4H0L D;  1G2C A;  1ZR4 A;  3L74 D;  1DD4 A;  2LXC B;  1L0N D;  1AQT A;  1PGP A;  3L73 G;  3RBZ A;  1RE4 A;  1SQB K;  3BRT B;  1GTW A;  1BE3 E;  1PP9 G;  1FDO A;  1ZV8 A;  1FZB A;  1SQB J;  3NFQ A;  2WWW A;  5AVY B;  3RK3 D;  2ZJS E;  2POH A;  3M91 A;  3P8C D;  1NTZ K;  3M0D C;  2NPS B;  1EDL A;  3HE4 B;  1SVF A;  5DJU B;  2QEX P;  4OGQ C;  3OAK A;  4YPC A;  3VMX A;  3CX5 E;  1EZV I;  2KP8 A;  2O01 J;  3NTN A;  3L72 E;  2O01 N;  1M1K Q;  1E5W A;  1JM0 A;  2KUB A;  2A45 H;  1NKN A;  3H1I D;  4PJ0 E;  1FZF A;  1NU1 E;  1FJP A;  1NTM J;  3L37 A;  1BE3 G;  1JY2 O;  1PP9 E;  2WMM A;  3EWK A;  2BCC E;  3KPE A;  5KTB A;  1JEK A;  2WIT A;  2WSS H;  1HGZ A;  1G2C B;  1PGO A;  2Q6Q A;  1K04 A;  2QE7 H;  3AEG C;  3IF4 A;  3L70 E;  4DZO A;  1EXI A;  4R4M A;  3AE6 C;  2O3J A;  1GDT A;  2QA4 P;  4KJM A;  5B66 H;  3WU2 E;  2B87 B;  2RH0 A;  1VF5 D;  5KLV G;  2B9B A;  2N1T B;  2YIU C;  2Z5H A;  3NMD A;  3TNU A;  1N7S D;  1JUN A;  4I2L C;  1NU1 G;  2W8Z A;  2J58 A;  1G1I A;  3MIW A;  3L70 J;  1N7S B;  3LID A;  1VQ5 P;  2FBW C;  1N2D C;  2CK3 H;  2E74 B;  3SSU A;  5AVV B;  3AEA C;  4L75 A;  3TF5 A;  3I55 P;  1VQN P;  2W6A A;  3Q1M A;  2A45 G;  2QJP C;  2J59 M;  1E79 H;  1FAV A;  1HVV A;  3G9R A;  3BVH A;  1HWT C;  1VQK P;  3L74 J;  1L0N E;  2NRG A;  1WT6 A;  1LWU B;  3F5H A;  3VYI A;  1OMI A;  1M57 D;  3L71 J;  4LGD E;  4N78 D;  4BWN A;  2HPC B;  1LTG C;  5C39 A;  1NTK G;  2NPS D;  3CCQ P;  1KC8 Q;  3B5N C;  1M7L A;  5AW2 B;  5GTI E;  4H13 D;  2FFD B;  3W67 A;  5APY A;  1MKM A;  1N73 C;  1R5L A;  2KLU A;  3KQG A;  1L4A B;  3JCU E;  5AW0 B;  5BU8 B;  2FFD A;  1AFO A;  2N9Y B;  2XU6 A;  3CC2 P;  3RK3 B;  4HH2 A;  1FS0 E;  4UB8 E;  1SQP D;  3CCS P;  1J1D C;  1YTZ I;  1MUU A;  2IBZ G;  1IK7 A;  1D7M A;  2M3E A;  3EFG A;  3L73 E;  1NTK E;  1NTM D;  1S72 P;  3TYY A;  1LGH B;  3HUS B;  5CCG D;  2KNC B;  1GD2 E;  1JB0 J;  1AVO A;  5B66 E;  2P1J A;  1X8Y A;  4L73 A;  1EDJ A;  4O9B A;  4ZKU A;  1K9M Q;  4H0L B;  1L0L K;  1OW8 A;  1QL1 A;  1RQU A;  1KB9 D;  1SFC C;  1URQ B;  5KKZ B;  3H32 A;  1VQM P;  1L2P A;  3GG2 A;  2IBZ E;  3AE2 C;  4H0L C;  4WY4 C;  1ZW0 A;  2JKV A;  2AXT H;  1BGY E;  1LT9 B;  1SQB G;  1HTL C;  1IFI A;  1LJ2 A;  2KSE A;  2RN0 A;  2QJY B;  1T8Z A;  2BCC G;  1Z56 A;  1OXZ A;  2BEQ D;  2WZ7 A;  2E5T A;  2E76 D;  3A0H E;  3HUS C;  4K35 A;  4PD4 E;  2B88 A;  4KHX A;  1QEX A;  3CPW O;  1Y47 A;  2P7J A;  2JP3 A;  2L5G B;  1UIX A;  3WUT A;  2BCC D;  4ZKP A;  1NU1 K;  1L0N K;  1NTK J;  2R5B A;  1IFD A;  1K05 A;  2PP6 A;  2MKV A;  2KZI A;  4EDF A;  5L8R J;  2OTK E;  5KLV E;  1BGY G;  1UII A;  2KS1 A;  1KIL D;  1MFZ A;  3H6P A;  5AW1 B;  3U1A A;  5CBN A;  5KKZ C;  1ZXG A;  3BCC J;  3B5N B;  1OFC X;  1L0L G;  2WT7 B;  2OYI B;  1RHZ B;  3RK2 D;  1MFT A;  4IL6 H;  2XNX A;  3H1H D;  2YMY A;  5H2F H;  1PZQ A;  2IZ1 A;  2W83 C;  3BRV B;  3AE8 C;  1T3U A;  3OJA B;  4PJ0 H;  2LXB A;  3CI9 A;  1PIX A;  1QVF O;  3M9B A;  3C9I A;  1LTJ C;  1L0N G;  3HUS A;  3L73 D;  1Y9B A;  2Q1K A;  2Q5U A;  2ITA A;  3RK3 C;  3USS A;  1GW3 A;  4A7P A;  1KQS O;  2JJL A;  2K9J A;  1L0L E;  3PTZ A;  3RL0 D;  3IN6 A;  3O6Q A;  1X22 A;  1YBK A;  1Q86 Q;  5AVR B;  1S5L H;  2KXP B;  1AV1 A;  1MV8 A;  1SQV G;  5AW5 B;  3QH9 A;  3M9Q A;  2GA1 A;  1KV4 A;  1SQQ K;  2JWD A;  4PV1 D;  4W80 A;  2RMZ A;  3A0H H;  3V6I A;  4PD4 D;  1BCC E;  1MZ9 A;  1PP9 D;  1L4A C;  2A45 I;  1NTZ E;  2R3C A;  3M0A A;  3MGN A;  1JMB A;  2Q7C A;  4H44 B;  4W7Y A;  3G4S P;  1EZV D;  4DCK A;  5KJ7 A;  1ZRT D;  4H13 C;  1NYH A;  5AVX B;  3TK1 A;  1KN7 A;  3TGU D;  2BCC J;  2ZT9 D;  1P84 D;  2FY8 A;  2IYP A;  2ZFC A;  2H88 C;  1X0T A;  5DJT B;  1L0L J;  1BE3 D;  3KZI H;  1M1J C;  3JCU H;  1NTZ G;  3L75 J;  1SQB E;  1JNM A;  2E75 D;  1SQP K;  1IC2 A;  2ZXX A;  1HF9 A;  2HOD A;  1N7L A;  5CHX A;  2HG5 D;  1ZOY C;  1IK9 A;  4UB8 H;  2O1K A;  1URQ A;  2FYU J;  2Q3E A;  4Y99 B;  3V5B A;  3VOP A;  3A5T A;  2KOG A;  3CLQ A;  4I6M C;  3BCC G;  2N1T A;  3S1K A;  2KB7 P;  2ZYD A;  1QL2 A;  2R3S A;  3H1K E;  1LTJ B;  1NKZ B;  2KNC A;  3RK2 B;  3MUD A;  2OYO A;  3AE1 C;  3AEB C;  3HTK A;  5M1B A;  1SQV K;  4AYC A;  1FU1 A;  2AEJ A;  3L35 A;  2FXO A;  4HJG H;  4HKZ H;  1GU5 A;  2OAR A;  3NXS A;  2WSE H;  3H1I J;  3ABV C;  3WMM 0;  3SWY A;  1AQ5 A;  1BGY J;  3AE5 C;  3Q5R A;  1NOH A;  5CJ0 A;  5AW7 B;  4BRY B;  3RBX A;  3BAS A;  2KYV A;  1NTK D;  1NTM E;  1PP9 J;  1A02 F;  3KDP B;  3G71 P;  5K5G B;  1IFP A;  1USE A;  1U7J A;  3CX5 I;  1SFC D;  2YXQ B;  1W5C E;  1JTH A;  1DIP A;  2D2C C;  1NAF A;  3AEC C;  3CXH E;  2K3R A;  4U3F J;  3MZW B;  5APW A;  1FZG A;  3HD7 C;  2SPZ A;  2XZR A;  5APT A;  1X9V A;  1SQV E;  1DX7 A;  1KYO E;  2Q3I A;  1CZQ A;  4NPD A;  3L70 D;  1Q2N A;  3AE4 C;  2OTJ P;  3CXH D;  1RE3 C;  1NTM G;  2AEF A;  1BE3 J;  1BCC G;  1XTG B;  1ZN5 A;  4IFF A;  4Z1M H;  4AUW A;  3M06 A;  1SQQ J;  2V7Q J;  1KB9 I;  4WY4 A;  3ZDM A;  1FDI A;  2OQQ A;  3FWL A;  1NVO A;  3FXE A;  4JYB A;  2WPV B;  1NTZ J;  1RF1 A;  3D6Z A;  4M3L A;  3L71 D;  1BDD A;  1GL2 C;  2C9L Y;  3B5N A;  4HYT B;  2MJZ A;  2H43 A;  2I8D A;  2WQY C;  2ZYA A;  2KS1 B;  1SFC B;  4ZMD A;  5KLI C;  2FXP A;  2M5A B;  3N4X A;  4H13 B;  5EFW B;  1A02 J;  1S3J A;  2HYN A;  4WWI A;  1VQ4 P;  3H25 A;  2R32 A;  5APS A;  2JO1 A;  4OWF A;  4EI2 A;  1GZL A;  2YIU B;  3R2P A;  3FX0 A;  1FC2 C;  3BCC E;  5CCH A;  2A06 D;  1JY3 N;  2E43 A;  1RF1 B;  2R5D A;  2K1A A;  3H1L G;  3H1K G;  2KI7 B;  3HE5 B;  5B5E H;  5GTI H;  1OIP A;  4EOT A;  1OWA A;  4RO0 A;  2E74 D;  1L0L D;  4LLH A;  1ZR2 A;  1JO5 A;  3M9H A;  1M1J A;  1FZA A;  2YKQ A;  2YO3 A;  1U7M A;  4U3F D;  4ASW A;  3TGU E;  2E75 C;  1W2B O;  1FBM A;  3VMA A;  1VF5 B;  3EFF K;  5CCG A;  1JCC A;  1LTS C;  2M0B A;  3H1L E;  5AVT B;  3AED C;  3FWN A;  3Q5P A;  1YYC A;  2N1T C;  1J1D B;  1OVU A;  4GOD A;  1T6A A;  1SQX K;  5KAI H;  1T2K D;  4L74 A;  4WB4 A;  3FXD A;  2ZT9 C;  1LT1 A;  4QMA A;  2XV5 A;  4D6T G;  2Q9I A;  1N7S C;  2K37 A;  4MN4 C;  4I7Z B;  2ZAE B;  1OVR A;  1WRG A;  3WU2 H;  4PD4 I;  4DJG A;  3H1K D;  3HRN A;  3KXD A;  4DOJ A;  2HPC A;  2CPS A;  5AVQ B;  2WT7 A;  2AXT E;  1KD1 Q;  3VMY A;  3KYQ A;  3LW5 J;  4H44 D;  3WUU A;  1LTA C;  5KLV K;  4PD4 H;  2OYH A;  1BSN A;  2J5U A;  2WSC H;  4JQ0 D;  4UB6 H;  3CC4 P;  1YQ4 C;  2V7Q H;  1KYO I;  4N78 E;  4GOF A;  5CJ4 A;  1IFN A;  2IDB A;  1TU3 F;  5E79 H;  4PV1 B;  1YI2 P;  2FYU E;  4TT3 H;  1N73 A;  1P84 I;  5KAF H;  1LTJ A;  3L72 D;  4IOI H;  1AA0 A;  4IFM A;  4D6T J;  1GK4 A;  1VF5 C;  3A2A A;  4RES B;  1KOR A;  3II6 A;  2W27 A;  4B86 A;  5CBO A;  3N7N A;  5AVZ B;  1P84 E;  2PGD A;  1BCC J;  1HH0 A;  1KB9 E;  2ZVO B;  3H1H E;  1N7S A;  3HD7 A;  2WSE J;  3C8V A;  2I1K A;  2OGU A;  3IAO A;  4OGQ B;  1KMI Z;  4YXD C;  1H89 A;  1EXJ A;  1BDC A;  4RJT A;  4GDO A;  1Q90 D;  2JWA A;  2KLV A;  2WSC J;  3GW6 A;  3RGU A;  3D6Y A;  1SS1 A;  3A0B E;  1EDK A;  2FYN B;  3H1L J;  1IFJ A;  3H32 B;  5CMZ A;  3U59 A;  3P7K A;  5AVW B;  1YIJ P;  2HFE D;  1KZU B;  3CWB E;  2FKW B;  5TIS E;  3CCV P;  1PFI A;  2YMK A;  1L0N J;  1NTK K;  3E7K A;  3MP7 B;  3V2Q A;  1M8O B;  1VQP P;  3I5C A;  1NH4 A;  2FXM A;  1JTH B;  1NHL A;  1SQB D;  3GF3 A;  1NWQ A;  3G3Z A;  2IPP A;  3G6E P;  1JCD A;  3HE4 A;  4OVN F;  1K73 Q;  5CCH D;  4YXW H;  2QJY C;  2Y0C A;  2YXR B;  3CWB G;  4DT0 A;  1EDI A;  2W6B A;  1JMM A;  3H1K J;  3V2N A;  3RL0 g;  4JYC A;  1QVG O;  2W90 A;  3JSV C;  1N8R Q;  1RQV A;  4BXL A;  1YTZ T;  3GLM A;  1CI6 A;  2CPB A;  1URQ C;  3GHG C;  2Y9Y A;  4C46 A;  3Q3D A;  2K9J B;  4GT1 A;  3CCE P;  2W6J H;  1J1E B;  3JC2 2;  4NPE A;  1KB9 H;  3TDK A;  1SQP E;  3PJS K;  5APU A;  1S2E A;  1CSB A;  3EQ2 A;  2BAS A;  3HD7 B;  3L4F A;  4N6J A;  4Y99 C;  4EIJ A;  2XKM A;  2Y0E A;  2AXC A;  1PGJ A;  3AEF C;  1SQV D;  4WY4 D;  2FFD C;  3RK2 C;  1IO4 A;  4OGQ D;  3C1L A;  3H1J G;  3RL0 C;  1S9K E;  1YQ3 C;  1YJN P;  1EC5 A;  1PL5 A;  4C7N A;  1VQO P;  1YJW P;  1KTM A;  1OW7 A;  2OTL P;  1NU1 D;  2FYU G;  1BGY D;  3H1I E;  1R8E A;  4U7J A;  2QM8 A;  2FYU K;  2KIK A;  2OYI A;  2UWJ E;  3IFM A;  1L4A D;  2JDI H;  3VN0 A;  1LWU C;  3H1H G;  1Q82 Q;  3CL3 D;  1KIL A;  1S4X A;  5APQ A;  3TGU G;  2OYH B;  3GF7 A;  3FGA D;  4L76 A;  3RK3 E;  3CME P;  4CPG A;  1QGK B;  3T97 A;  1GMJ A;  4N3Y B;  3S9O A;  1USD A;  1S5L E;  3TSI A;  3CCU P;  2OYH C;  2P2U A;  1VQ9 P;  1BSH A;  2H7H A;  2RKL A;  3H1I G;  5KLV D;  3QWO C;  4C7R A;  1SLQ A;  2QJK C;  4IL6 X;  4JBZ A;  4D6T D;  3AE7 C;  1GW4 A;  2YO2 A;  1H8A A;  2QJK B;  3L73 J;  2QM7 A;  5AW9 B;  1M90 Q;  1FZE A;  4RKU J;  1LTT C;  3CXH H;  1M1J B;  3K5B A;  3Q5S A;  1GU4 A;  1AVY A;  3AE9 C;  3P32 A;  2N1T D;  1RH5 B;  2FYZ A;  2Z5I A;  4U3F G;  4WBA A;  4EYY Q;  2QJP B;  3HE5 A;  1OZH A;  1PV3 A;  5AW8 B;  3S4R A;  1RF0 C;  1N86 A;  2P10 A;  2GM4 A;  1VPC A;  1HUC A;  2P58 A;  1H88 A;  2I1J A;  2WPR A;  5APX A;  1PPJ G;  1SQQ G;  5AW4 B;  2D2C D;  1FOS E;  1NO4 A;  2K9Y A;  3PLN A;  3L36 A;  3O8Z A;  4U3F E;  3V2P A;  5TIS H;  1YIT P;  3R4Y A;  1LNQ A;  1SQP G;  2IZ0 A;  2KSJ A;  2M8R A;  2O01 H;  1T3J A;  3MUD C;  1RF1 C;  4C7N B;  2DW3 A;  3HTK B;  2NZ2 A; 
#chains in the Genus database with same CATH homology
 3CX5 H;  1SQV G;  1EZV G;  3BCC G;  3L70 G;  2A06 G;  3H1J G;  3H1L G;  3H1K G;  3CXH H;  4PD4 H;  1SQX G;  1NTM G;  1BCC G;  5KLV G;  2IBZ G;  1P84 H;  4U3F G;  1BGY G;  2FYU G;  1NU1 G;  3L73 G;  1PP9 G;  1L0L G;  3CWB G;  3L74 G;  3L75 G;  3L71 G;  3H1H G;  3TGU G;  1SQQ G;  1PPJ G;  1L0N G;  4D6T G;  1NTZ G;  1KB9 H;  3L72 G;  1KYO H;  1SQP G;  3H1I G;  1SQB G;  1NTK G;  1BE3 G;  2BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...