1SQBK

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
LTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDSRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqbK00
3G3ZA 1NU1K 1NTKK 2J59M 3CLQA 1SQBK 2FYUK 3LW5H 1SQVK 4IFDK 1SQQK 1NTMK 2WSFH 5KLVK 2O01H 2WSCH 1SQPK 2LKMA 1SQXK 2OARA 3M9QA 1L0LK 1L0NK 1NTZK 2WSEH
chains in the Genus database with same CATH superfamily
2FXOA 2Q6QA 1NAFA 1RQVA 3M06A 2K9JA 3HUSC 3RK3E 3HUSB 2FYUE 4YPCA 2DW3A 1SQBJ 2QVAA 2E5TA 3L73E 1KILC 1HJ0A 4U7JA 2FBWC 1L0NK 3RK3D 1N7LA 1KILB 2FYUD 1EZVI 1N73A 1L0NJ 3EQ2A 2Z5IA 1IFMA 3JCUE 1DEBA 1OVVA 1YJ9P 2H8PD 3C9IA 4L73A 3AE4C 1M1JA 4R4LA 1NVOA 1JB0J 1FZAA 2N9YB 4H0LC 3CI9A 3GLMA 3RK2B 4H0LB 2J5UA 2RH0A 2Q1KA 4KT0J 1VDFA 2KNCA 2V7QH 2O1JA 4WBAA 2K1AA 2ITAA 1LTTC 1N7SC 1N7SB 1NTKK 5KJ7C 3NXSA 3VTPC 4C46A 2W6JH 4IL6E 1R5LA 4QMAA 1NTKJ 1P84H 5AVSB 2KSJA 1S4XA 2QA4P 3WUTA 2WSEJ 1PIXA 3RGUA 2HYNA 2A45G 2HG5D 3CXHI 5APTA 1YBKA 3MP7B 1PV3A 4N3YB 2OYIA 1H0TB 3II6A 3H1LD 2GA1A 4DCKA 1EXJA 3L75J 1DX7A 3L74G 2C9NY 2B9BA 3KXDA 3CCJP 3IR9A 2M3BA 4UB8E 3TYYA 3PP5A 3IF4A 2PRRA 1U57A 1AJYA 2SPZA 3D6YA 1BDDA 1LT9C 2IX7C 1ZRTD 3WMM0 4OGQD 1LT9B 3L72G 1D7MA 1EDJA 1PP9G 1YI2P 2BCCJ 2I1KA 3JCUH 2IZ1A 1K05A 3KQGA 2YXQB 2H7HA 2I8DA 4IFFA 2N9BA 1Q2NA 3JSVC 1A02F 1NYHA 1AFOA 2W27A 1MFZA 3OW2O 3L74J 1LT1A 2NZ2A 5TJHA 1FZBA 1LTBC 1GD2E 1IC2A 1FZCC 3BVHA 3L73J 1NAYA 4EDFA 4WY4A 1K8AQ 1FZCB 1JTHA 3BCCG 1KFMA 1EZVD 1BGYG 2KK7A 2IFMA 1BE3D 4I2LC 2MJZA 1OFCX 1KB9E 4HJGH 5KLVD 2BEZF 2ZVOB 3L70D 2FXMA 1S72P 1NTZE 1IZNB 3WUVA 1LWUA 3VN0A 3EFFK 3AE5C 3BCCJ 1H8AA 3UIAA 5AW6B 1SQVG 2POHA 4L76A 4EIJA 1KD1Q 4UB8H 1VQ8P 2XNDH 3NMDA 3W68A 3HD7D 3QH9A 2OGUA 4BXLA 3U59A 2QEXP 5E79H 5BU8B 1SQQE 3L4FA 1Q82Q 3CXHD 2NPSC 5AW2B 2OARA 3TDKA 3G71P 2NPSB 3R4YA 1L0LG 4XE5B 2WT7A 2E75C 5EFWB 2E75B 1SQVK 2KIKA 4ZKUA 4W7YA 1SVFA 1GK4A 3B8EB 3M0DA 3TNUB 1E5WA 5AVQB 3TGUG 1PGOA 1HGZA 4D6TE 2LXBA 3GW6A 5APYA 2E76D 1IO4A 4GKGA 1KYOI 4C7NB 1RE4C 1X8YA 3H1IG 1L0LK 3VP8A 4TLFA 3L71D 2FFDC 1RF0C 2HLOA 2FFDB 3CCVP 3ZDMA 1HF9A 1BCCE 1G2CB 4YXDC 1FE6A 2N1TC 1M7LA 1FAVA 3E1IA 2Q3EA 2N1TB 2OYOA 3TGUJ 2ZT9D 1USEA 2C0WA 1JM0A 3HTKA 5DJUB 1TU3F 3C1LA 2OTKE 1U7JA 4ZKPA 1SQPE 5APWA 2A06D 2YNYA 1X0TA 2KS1B 3CXHH 3H1HD 1PPJE 4GDOA 3BRTB 4LC1A 3AE6C 4KJMA 4NPEA 5CJ4A 3TF5A 2KZIA 4H13D 1SQXE 1S9KE 1NTZK 1NTZJ 3CMAP 4C7RA 2HPCB 4H44C 2C0XA 1HWTC 3CWBD 3VP9A 2P67A 1S9KD 1JMBA 4H44B 1PL5A 1RH5B 3R2PA 3NFQA 2RN0A 2ZXXA 3G3ZA 1DIPA 1FZEA 2WPQA 3IN6A 1NU1G 2L91A 1KILA 1M90Q 1LP1B 1HUCA 1FZGA 1QVGO 1CSBA 3PH0A 3T97B 2WSFH 1NTME 3HE5B 3AE1C 4RESB 4BWNA 2PFXA 4U3FE 1SQQJ 1GZLA 4NPFX 4BRYA 1VPCA 2PGDA 1QX8A 1UIXA 2JP3A 3TK1A 2CPBA 3PTZA 1IK7A 4PV1C 1P84E 1SQBG 3P32A 3I55P 2YKQA 2W6AA 5AW4B 4Y99C 4PV1B 4OH8B 1ZP0C 3H1KG 2Z4EA 3SWFA 5BU5A 1HVVA 3AE7C 3G6EP 2AXTH 4Y99B 2OTJP 3ABVC 5CCGC 1L0NG 1NU1K 3H6PA 1KYOE 5B66E 1L4AA 2B88A 2IBZI 1NU1J 2HODB 5GTIH 2Q5UA 3V2NA 1X79B 4D6TJ 1N7SA 1OZHA 2WSFJ 1VQ7P 2YO3A 3O6QB 3VYIA 3A2AA 5KJ7A 2E74D 1VF5D 5C39A 3KDPB 3SWKA 2Q7CA 1M56D 3EFGA 2YKOA 1ZW0A 3LIDA 1SQBK 2QG4A 1L4AD 2Y9YA 4N78D 1BCCJ 3P8MC 1RY3A 3H1KJ 1URQA 4I6MC 2R3SA 3Q5PA 1FBMA 1DH3A 2WWWA 1NTKG 1NOHA 4GOFA 1GL2C 3BATA 1SS1A 3L74D 2LR2A 1GL2B 1SQPK 3RK2C 3D71A 1SQPJ 2FYNC 1URQD 3CCMP 2KB7P 2RMZA 1DD3A 2FYNB 3AEEC 3CX5D 1LT9A 2YXRB 2KZJA 1RE3C 1QGKB 4EI2A 1OXZA 2H43A 3L72D 1PP9D 1Y8AA 3L75G 3CPWO 1SQXJ 3Q2YA 3CD6P 1AA0A 2BEQD 2B87B 2FYZA 5AVRB 1UIIA 3A0BE 1FC2C 2AEMA 3BRVB 1ZV8A 4DJGA 2QJPC 4WB4A 2IDBA 2QJPB 2JKVA 1HTLC 3H1LE 2W83C 3RK3C 1JY2N 5AW3B 1LNQA 2BCCG 1KYOH 1KV4A 5B66H 4GODA 1RHZB 3LW5H 3RK3B 3H32A 4AQRD 1FDIA 3S9OA 1FS0E 2V7QJ 1NTMJ 3GG2A 3CC2P 4U3FJ 1BGYD 3MIWA 3KZIH 1FOSE 1KZUB 1VQNP 1DEEG 1ZRTE 4EOTA 2NRGA 2FYUG 4GOEA 1N73C 1JMMA 1AVOA 2PP6A 1GW4A 2IBZE 1N73B 1LTJC 4HH2A 2YIUC 2JO1A 3L73G 3RL0g 3CCUP 1OMIA 1LTJB 2YIUB 1M1JC 4YXWH 1GW3A 3MD0A 1EDIA 1M1JB 5E79E 1RF1A 1KMIZ 2IBZD 5KTBA 1G1JA 4OVNF 1U7MA 2O1KA 2HFED 1EDKA 2O3JA 2JJLA 4IL6X 2D2CD 4O9BA 2XKMA 1SQVD 2JR8A 1ZOYC 1EC5A 2P7JA 2KSEA 3Q5SA 3TSIA 2FYUK 1YITP 5APUA 3CL3D 2FYUJ 1EZVE 1ZR4A 1IFJA 1KQLA 2K37A 1BE3E 1ZXGA 1HBWA 4I7ZC 5TISE 5GTHE 1W2BO 4GT1A 4I7ZB 1AQ5A 1KQGB 3OAKA 1L0LD 5KLVE 3A0BH 3F5HA 3A0HE 1K73Q 5BVZA 3L70E 2WMMA 4L74A 1Q90D 3QWOC 2R5DA 1GU5A 2K3RA 1A02J 4EYYQ 4OGQC 4WY4D 2Y0EA 2WTYA 4OGQB 1M8OB 2KLUA 1MFTA 2K9YA 1SP4A 1JOCA 4C7NA 3P8CD 1S5LE 1YYCA 2G3AA 2V4HA 3H1ID 4YTPC 2FFDA 1RF0A 1OX3A 2W90A 1G2CA 2UWJE 1QVFO 2QJYC 3AE3C 2JWDA 3GF7A 3CXHE 3M9HA 2QJYB 3H1JD 1KQSO 3H1LJ 2IPPA 2P2UA 3VMYA 3USSA 4KHXA 5B5EE 5CMZA 2I1JA 3HRNA 1SFCA 3C8VA 2CPSA 3Q3DA 1JY2O 2OYHA 1EXIA 2Q9IA 3L35A 2KS1A 4IFDK 1PZQA 2ZYAA 3CCRP 1JTHB 1WRGA 3M9QA 1MZ9A 2R44A 1KORA 1SFCD 1VQLP 5TISH 3CLQA 3BASA 5GTHH 3L71E 2JDIH 2HPCA 3D70A 2R32A 3RL0D 3Q1MA 5KAFH 3A0HH 2E43A 2M5AA 3OJAB 3RBXA 3G9RA 3FWLA 4CPGA 2IYPA 3HD7C 1VL2A 2WPSA 3HD7B 1PGPA 1LWUC 2QSIA 4TT3H 2AXTE 2A45I 1LWUB 2LKMA 3HE4B 2GM4A 5AW9B 4RJTA 1NTZG 3PJSK 3PLNA 4JQ0D 1BE3J 3I5CA 5GTIE 2A06E 1N8RQ 1S5LH 1IFIA 5CCHA 3A3YB 3H1HE 2QJKC 3B5NA 2O01H 3GHGC 2R3CA 2QJKB 3MGNA 3L70J 3GHGB 1SQBD 1PGJA 3CX5I 1N86A 3IAOA 1QL2A 4I1LA 1T2KD 2E76C 2HODA 1L0ND 2W8ZA 1SQQG 2WT7B 2KXPB 1YHQP 5CCHD 3V6IA 1OW8A 5B5EH 2E76B 4OWFA 3CWBE 4AYCA 3D6ZA 3B5ND 1T8ZA 4HYTB 3M0DC 1IFPA 1VQPP 2J58A 3VMXA 4AUWA 1L2PA 3HUSA 3CCEP 3KYQA 2WSCH 4JYBA 3MUDC 3VMZA 2XV5A 5AW5B 2QRXA 4D6TG 3AEBC 2WQYC 2ZT9C 1CW5A 1SQQK 2JWAA 2YO2A 1LTIC 2ZT9B 4LLHA 2K88A 1OVRA 4DZOA 1J1DC 1NTKD 1J1DB 2Y9ZA 1M1KQ 1GDTA 3CCQP 2Z5HA 5AW1B 1BCCG 2AXCA 1KILD 3WUUA 3SFDC 2WSCJ 1CZQA 3HTKB 1VQ4P 1T6AA 3PRJA 4H13B 5AVZB 1QL1A 5AVUB 3V4WA 3V4QA 3L75D 4ASVA 5KKZC 1JY3P 2KUBA 3L71J 2R5BA 3RK2D 4H0LD 5KKZB 2FXPA 2WPRA 4N78E 1VQ9P 3S1KA 1SQPG 2ZJSE 1USDA 3KZIE 2YMKA 1PPJG 1KC8Q 4DOJA 3GF3A 3FXEA 2VRSA 1N7SD 2BCCD 1KTMA 1SQXG 5APQA 3L74E 3GMAA 4NPDA 1H0TA 5KJ7D 3AEFC 1VQ5P 2QM7A 4W7ZA 3V2RA 1Q86Q 2GUSA 1JNMA 1E79H 3CX5E 3H1HJ 1HJBA 4RO0A 1JUNA 3I56P 4HB1A 1BSNA 3L72E 5CHXA 1PP9E 2WZ7A 1JEKA 1LTJA 1IK9A 2ZAEB 1N2DC 5KLIC 3L73D 2O01N 4BRYB 1OIPA 3AEDC 1NTMG 5KLIB 1VQ6P 1SQXK 4U3FG 4B86A 3OA7A 2ZXEB 2WSEH 3ITKA 3PHLA 2E74C 1VF5C 3CWBJ 4UB6E 5H2FE 3M9BA 2E74B 1VF5B 2KLVA 1KB9I 1SLQA 1OVUA 4JBZA 5KAIE 1L4AC 1ZN5A 5AW8B 2WPVB 4PJ0E 1L4AB 3W67A 2H89C 1LTAC 3BCCE 1KN7A 2Y0CA 1BGYE 1R5SA 1R8EA 1JCDA 5AW7B 1CI6B 4IOIH 3S4RA 1FZCA 1NTMK 1YJWP 3JC22 1NGMB 2E5YA 1JY3N 2K9JB 3BCCD 5AVWB 3IFMA 1VQOP 3VOPA 3P7KA 4GIFA 1URQC 1Z56A 4PD4I 2A45H 1YIJP 1WT6A 1URQB 3E7KA 2ZFCA 1J2JB 4Z1MH 1LTSC 3EWKA 2YMYA 2XZRA 1KFNA 3AE9C 5CBOA 1FJKA 4JYCA 1VQKP 1X22A 5AVXB 3LIEA 1SQVE 3LW5J 2XNXA 4A7PA 2C9LY 2L5GB 1H88A 2P58A 1RQUA 3VMAA 2G8YA 3CX5H 5L8RJ 2AEJA 4XFJA 3FGAD 2KNCB 2KYVA 4LGDE 2LXCB 3MHVA 2P1JA 3AE8C 2XU6A 3E1RA 1VQMP 1L0LE 1NHLA 1GK6A 4XA4A 4HKZH 1GU4A 4W80A 4UB6H 1NKZB 5H2FH 5M1BA 2NPSA 1PGQA 1DD4A 1NH4A 4ZMDA 3L36A 1K04A 5KAFE 1FJPA 5KAIH 4PJ0H 3TGUE 2MKVA 2FKWB 3H32B 2IYOA 2OYIC 3H1LG 1LTGC 3TNUA 3L72J 1YJNP 1PP9J 2OYIB 2OTLP 3P8CE 2NPSD 1MV8A 4IL6H 3TGUD 1YQ4C 3H1IE 4WVZA 5AVVB 1WMKA 1BDCA 3CC7P 2E75D 5DJTB 1Y47A 3WU2E 2D2CC 1RE4A 2D2CB 3AE2C 1IJDB 5APSA 3H1JE 5APXA 1KB9D 4WWIA 3MTUE 1NWQA 1AVYA 3HD7A 1RF1C 2IBZG 2OQQA 1RF1B 2B89A 5CBNA 1FOSF 3HE4A 2N1TA 1BGYJ 2Q3IA 1GTWA 1YQ3C 1NTZD 1LGHB 1JO5A 4PD4E 1NO4A 3M91A 3RBZA 3CC4P 3GHGA 1Q7YQ 1KQFB 4IFMA 3V2QA 4WY4C 4PD4D 5AW0B 1JY3O 2N1TD 1MKMA 4K35A 1EZVG 4Y28J 2M8RA 3FX0A 2YKPA 4WY4B 2H88C 1W5CE 1BE3G 4K3AA 1SQQD 1FZFA 2AEFA 1EQ7A 5CJ0A 2QIWA 1SQVJ 4RKUJ 1S5LX 5KLVG 3N7NA 1XTGB 1X9VA 3KHUA 3L70G 1P84I 1NU1E 1MUUA 1AQTA 3MUDA 3SWYA 1FDMA 2CK3H 2JEEA 3V2PA 4M3LA 1FU1A 4N6JA 3AEGC 1LP1A 1NU1D 3T97A 3F89A 4D6TD 3HE5A 1AV1A 1KB9H 1K9MQ 1L0LJ 2ZYDA 1ZMEC 3WU2H 4H44D 4JF7A 1SQBE 1M57D 1PFIA 3B71A 2RKLA 3H1JG 3N4XA 1OW7A 3H1KE 5KLVK 1T3UA 2PAJA 2W6BA 1IFDA 5KLVJ 3O8ZA 1HH0A 1L0NE 2HR3A 2BASA 1BCCD 3MZWB 5AVYB 3G4SP 1SFCC 1JCCA 3H1KD 2ZYGA 3M0AA 3V5BA 2OYHC 1SFCB 1S2EA 5CCGA 2OYHB 5APVA 1XTCC 1IFNA 2ZVNB 1T3JA 1H89A 3RL0C 3K5BA 3H1IJ 2M3EA 1ZR2A 3O6QA 1NKNA 4PD4H 3RL0B 3CMEP 3H25A 3FXDA 4PV1D 2XDJA 5K5GB 1NJIQ 1ZLLA 1SQPD 2IFNA 3B4SA 1YTZI 2E42A 3H1JJ 2KI7B 2WVRA 2O01J 4DT0A 5CCGD 4JPZB 1PPJD 1YTZT 2FY8A 1OW6A 2QM8A 1HGVA 3A5TA 1J1EC 2KP8A 1NTKE 1J1EB 3CCSP 2WSSH 1SQXD 3KPEA 3L71G 2M5AB 2P10A 5AVTB 1KILE 1GL2A 1LJ2A 2M0BA 3CCLP 1G1IA 2KOGA 1EDLA 2J59M 3NTNA 1GMJA 1S1CX 1T2KC 1S3JA 3SFEC 3L75E 5CCHC 4H13C 1RE3A 3L37A 1FDOA 3B5NC 1NTMD 1GL2D 2A06G 4ASWA 3B5NB 4U3FD 1QEXA 1QLED 1W2EA 3SSUA 2QE7H 2B87A 3H1HG 4MN4C 1Y9BA 3AEAC 1JY2P 3U1CA 4ZNCA 3FWNA 3A7OA 2IZ0A 4L75A 4R4MA 1P84D 3U1AA 2BCCE 3Q5RA 2GUVA 3AECC 1BSHA 1OWAA 2Y0DA 1CI6A 2WITA 1Q81Q 1KYOD 3CWBG
chains in the Genus database with same CATH topology
1FJKA 1NAFA 3M9HA 3M06A 3HUSC 4JYCA 3BRTB 5AVXB 3HUSB 2IPPA 2P2UA 4LC1A 3VMYA 3LIEA 2XNXA 5CJ4A 2C9LY 4KHXA 2L5GB 5CMZA 1H88A 2I1JA 3HRNA 1SFCA 1KILC 2CPSA 1S9KE 1L0NK 1NTZK 3RK3D 1JY2O 2OYHA 1N7LA 1KILB 1N73A 2Q9IA 3EQ2A 2Z5IA 1IFMA 4C7RA 2HPCB 1DEBA 3L35A 2H8PD 2KYVA 3C9IA 4LGDE 4IFDK 2C0XA 1HWTC 3VP9A 2P67A 1S9KD 1M1JA 2P1JA 2XU6A 1FZAA 3R2PA 1JTHB 1WRGA 3M9QA 1MZ9A 3NFQA 1NHLA 1GK6A 1SFCD 3CI9A 3G3ZA 4XA4A 1FZEA 2WPQA 3RK2B 1GU4A 4W80A 1NKZB 3CLQA 2NPSA 3BASA 1KILA 1NH4A 1HUCA 1FZGA 1CSBA 2HPCA 1VDFA 2WSFH 2R32A 3HE5B 3L36A 3RL0D 2O1JA 4RESB 1FJPA 1GZLA 4WBAA 1LTTC 1VPCA 2E43A 1N7SC 2FKWB 3OJAB 3H32B 2OYIC 1LTGC 3TNUA 1N7SB 1NTKK 3HD7C 3TK1A 5KJ7C 3NXSA 3VTPC 2WPSA 2CPBA 2OYIB 4C46A 3P32A 3HD7B 3P8CE 2NPSD 1MV8A 2YKQA 5AVSB 2W6AA 1LWUC 5AW4B 4Y99C 4OH8B 2Z4EA 2KSJA 3SWFA 5AVVB 5BU5A 1HVVA 1LWUB 2A45I 2LKMA 3HE4B 4Y99B 2GM4A 5AW9B 5CCGC 1NU1K 3H6PA 2HYNA 3I5CA 1L4AA 2HODB 1RE4A 2Q5UA 2A45G 3V2NA 1IFIA 1X79B 1IJDB 5APSA 2HG5D 5APTA 5APXA 3A3YB 1N7SA 5CCHA 4N3YB 2YO3A 3MTUE 1NWQA 2OYIA 3II6A 3B5NA 2O01H 3HD7A 3VYIA 1RF1C 3A2AA 3GHGC 5KJ7A 2R3CA 3MGNA 3KDPB 1RF1B 3GHGB 1DX7A 1FOSF 3HE4A 2Q7CA 2C9NY 3EFGA 2YKOA 1N86A 3LIDA 1SQBK 1QL2A 4I1LA 3IR9A 2M3BA 2N1TA 1L4AD 2Q3IA 3TYYA 3PP5A 4N78D 1GTWA 1T2KD 2HODA 3P8MC 2WT7B 1RY3A 5CCHD 1LGHB 1LT9C 1URQA 1JO5A 2IX7C 4AYCA 1NO4A 3M91A 3B5ND 1T8ZA 4I6MC 3WMM0 4HYTB 1LT9B 3M0DC 2J58A 1FBMA 3GHGA 1DH3A 3VMXA 2WWWA 2I1KA 1NOHA 4IFMA 1GL2C 3V2QA 4AUWA 3KQGA 3BATA 4WY4C 2H7HA 5AW0B 1JY3O 2N1TD 3HUSA 1GL2B 4IFFA 3KYQA 2M8RA 1SQPK 2N9BA 2WSCH 4JYBA 2YKPA 4WY4B 3VMZA 1A02F 1AFOA 2XV5A 3RK2C 2W27A 1URQD 5AW5B 2KB7P 1MFZA 1FZFA 1LT9A 1EQ7A 1CW5A 5CJ0A 1RE3C 1SQQK 2YO2A 1LTIC 1OXZA 3N7NA 1XTGB 2H43A 1X9VA 1FZBA 1LTBC 4LLHA 4DZOA 1J1DC 1GD2E 1IC2A 1FZCC 3BVHA 4WY4A 1J1DB 1MUUA 2FYZA 1FZCB 1JTHA 5AVRB 1KFMA 3MUDA 3SWYA 1GDTA 1FDMA 2JEEA 3V2PA 2Z5HA 5AW1B 4M3LA 1FU1A 4N6JA 2IFMA 1KILD 4I2LC 2MJZA 3BRVB 1ZV8A 3T97A 4WB4A 3HE5A 1CZQA 3HTKB 1HTLC 3RK3C 1JY2N 5AVZB 5AW3B 1QL1A 4JF7A 5AVUB 3V4WA 3LW5H 3RK3B 1PFIA 3V4QA 3H32A 4AQRD 3N4XA 1JY3P 5KLVK 1T3UA 2FXMA 2PAJA 2R5BA 2W6BA 3RK2D 1IFDA 2WPRA 4N78E 3O8ZA 1HH0A 2BASA 1LWUA 5AVYB 3MIWA 3VN0A 1SFCC 1JCCA 1KZUB 1FOSE 3V5BA 3M0AA 1H8AA 4DOJA 3UIAA 4EOTA 2OYHC 1SFCB 5AW6B 2POHA 4EIJA 1N73C 1JMMA 5CCGA 2OYHB 2PP6A 1GW4A 5APVA 1XTCC 2VRSA 1N73B 1LTJC 1IFNA 3NMDA 1N7SD 1T3JA 4HH2A 1H89A 3RL0C 5APQA 1ZR2A 1LTJB 3HD7D 1NKNA 5KJ7D 1M1JC 3RL0B 1GW3A 3MD0A 2QM7A 1M1JB 2XDJA 3U59A 1RF1A 4W7ZA 3V2RA 5BU8B 2GUSA 1G1JA 5KTBA 1ZLLA 2IFNA 3L4FA 1YTZI 1JNMA 2E42A 2O1KA 2HFED 2NPSC 1HJBA 5AW2B 2JJLA 5CCGD 2OARA 1YTZT 4O9BA 2NPSB 1JUNA 4XE5B 2XKMA 2QM8A 2WT7A 1HGVA 3A5TA 5CHXA 1J1EC 2KP8A 2P7JA 2WZ7A 1LTJA 3TSIA 1IK9A 2FYUK 1J1EB 1N2DC 1SQVK 3KPEA 4ZKUA 4W7YA 5APUA 1SVFA 1GK4A 3B8EB 3CL3D 3M0DA 1ZR4A 1IFJA 1SQXK 4B86A 1KQLA 3OA7A 3TNUB 2ZXEB 5AVTB 1E5WA 2WSEH 5AVQB 1GL2A 1HBWA 1G1IA 1HGZA 2KOGA 4GT1A 2J59M 3M9BA 2KLVA 1AQ5A 1SLQA 5APYA 1IO4A 3NTNA 3OAKA 4GKGA 1L4AC 1ZN5A 5AW8B 4C7NB 1T2KC 5BVZA 1RE4C 1X8YA 1L4AB 1L0LK 3VP8A 2R5DA 5CCHC 1GU5A 2FFDC 1RF0C 1RE3A 3L37A 1LTAC 2HLOA 1A02J 3B5NC 1GL2D 2FFDB 3B5NB 4WY4D 1JCDA 1W2EA 2WTYA 5AW7B 1CI6B 1G2CB 1FZCA 1NTMK 1JY3N 2N1TC 1JY2P 3U1CA 1SP4A 1JOCA 1M7LA 1FAVA 5AVWB 3E1IA 4C7NA 3A7OA 2N1TB 3IFMA 3U1AA 3P8CD 3VOPA 1YYCA 2GUVA 3P7KA 4GIFA 1URQC 2C0WA 1Z56A 1OWAA 3HTKA 2A45H 1WT6A 1URQB 2ZFCA 2FFDA 1RF0A 4ZKPA 1J2JB 1CI6A 1G2CA 2WITA 1LTSC 2YMYA 5APWA 2XZRA 2YNYA 1KFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3Z A;  1NU1 K;  1NTK K;  2J59 M;  3CLQ A;  1SQB K;  2FYU K;  3LW5 H;  1SQV K;  4IFD K;  1SQQ K;  1NTM K;  2WSF H;  5KLV K;  2O01 H;  2WSC H;  1SQP K;  2LKM A;  1SQX K;  2OAR A;  3M9Q A;  1L0L K;  1L0N K;  1NTZ K;  2WSE H; 
#chains in the Genus database with same CATH topology
 2FXO A;  2Q6Q A;  1NAF A;  1RQV A;  3M06 A;  2K9J A;  3HUS C;  3RK3 E;  3HUS B;  2FYU E;  4YPC A;  2DW3 A;  1SQB J;  2QVA A;  2E5T A;  3L73 E;  1KIL C;  1HJ0 A;  4U7J A;  2FBW C;  1L0N K;  3RK3 D;  1N7L A;  1KIL B;  2FYU D;  1EZV I;  1N73 A;  1L0N J;  3EQ2 A;  2Z5I A;  1IFM A;  3JCU E;  1DEB A;  1OVV A;  1YJ9 P;  2H8P D;  3C9I A;  4L73 A;  3AE4 C;  1M1J A;  4R4L A;  1NVO A;  1JB0 J;  1FZA A;  2N9Y B;  4H0L C;  3CI9 A;  3GLM A;  3RK2 B;  4H0L B;  2J5U A;  2RH0 A;  2Q1K A;  4KT0 J;  1VDF A;  2KNC A;  2V7Q H;  2O1J A;  4WBA A;  2K1A A;  2ITA A;  1LTT C;  1N7S C;  1N7S B;  1NTK K;  5KJ7 C;  3NXS A;  3VTP C;  4C46 A;  2W6J H;  4IL6 E;  1R5L A;  4QMA A;  1NTK J;  1P84 H;  5AVS B;  2KSJ A;  1S4X A;  2QA4 P;  3WUT A;  2WSE J;  1PIX A;  3RGU A;  2HYN A;  2A45 G;  2HG5 D;  3CXH I;  5APT A;  1YBK A;  3MP7 B;  1PV3 A;  4N3Y B;  2OYI A;  1H0T B;  3II6 A;  3H1L D;  2GA1 A;  4DCK A;  1EXJ A;  3L75 J;  1DX7 A;  3L74 G;  2C9N Y;  2B9B A;  3KXD A;  3CCJ P;  3IR9 A;  2M3B A;  4UB8 E;  3TYY A;  3PP5 A;  3IF4 A;  2PRR A;  1U57 A;  1AJY A;  2SPZ A;  3D6Y A;  1BDD A;  1LT9 C;  2IX7 C;  1ZRT D;  3WMM 0;  4OGQ D;  1LT9 B;  3L72 G;  1D7M A;  1EDJ A;  1PP9 G;  1YI2 P;  2BCC J;  2I1K A;  3JCU H;  2IZ1 A;  1K05 A;  3KQG A;  2YXQ B;  2H7H A;  2I8D A;  4IFF A;  2N9B A;  1Q2N A;  3JSV C;  1A02 F;  1NYH A;  1AFO A;  2W27 A;  1MFZ A;  3OW2 O;  3L74 J;  1LT1 A;  2NZ2 A;  5TJH A;  1FZB A;  1LTB C;  1GD2 E;  1IC2 A;  1FZC C;  3BVH A;  3L73 J;  1NAY A;  4EDF A;  4WY4 A;  1K8A Q;  1FZC B;  1JTH A;  3BCC G;  1KFM A;  1EZV D;  1BGY G;  2KK7 A;  2IFM A;  1BE3 D;  4I2L C;  2MJZ A;  1OFC X;  1KB9 E;  4HJG H;  5KLV D;  2BEZ F;  2ZVO B;  3L70 D;  2FXM A;  1S72 P;  1NTZ E;  1IZN B;  3WUV A;  1LWU A;  3VN0 A;  3EFF K;  3AE5 C;  3BCC J;  1H8A A;  3UIA A;  5AW6 B;  1SQV G;  2POH A;  4L76 A;  4EIJ A;  1KD1 Q;  4UB8 H;  1VQ8 P;  2XND H;  3NMD A;  3W68 A;  3HD7 D;  3QH9 A;  2OGU A;  4BXL A;  3U59 A;  2QEX P;  5E79 H;  5BU8 B;  1SQQ E;  3L4F A;  1Q82 Q;  3CXH D;  2NPS C;  5AW2 B;  2OAR A;  3TDK A;  3G71 P;  2NPS B;  3R4Y A;  1L0L G;  4XE5 B;  2WT7 A;  2E75 C;  5EFW B;  2E75 B;  1SQV K;  2KIK A;  4ZKU A;  4W7Y A;  1SVF A;  1GK4 A;  3B8E B;  3M0D A;  3TNU B;  1E5W A;  5AVQ B;  3TGU G;  1PGO A;  1HGZ A;  4D6T E;  2LXB A;  3GW6 A;  5APY A;  2E76 D;  1IO4 A;  4GKG A;  1KYO I;  4C7N B;  1RE4 C;  1X8Y A;  3H1I G;  1L0L K;  3VP8 A;  4TLF A;  3L71 D;  2FFD C;  1RF0 C;  2HLO A;  2FFD B;  3CCV P;  3ZDM A;  1HF9 A;  1BCC E;  1G2C B;  4YXD C;  1FE6 A;  2N1T C;  1M7L A;  1FAV A;  3E1I A;  2Q3E A;  2N1T B;  2OYO A;  3TGU J;  2ZT9 D;  1USE A;  2C0W A;  1JM0 A;  3HTK A;  5DJU B;  1TU3 F;  3C1L A;  2OTK E;  1U7J A;  4ZKP A;  1SQP E;  5APW A;  2A06 D;  2YNY A;  1X0T A;  2KS1 B;  3CXH H;  3H1H D;  1PPJ E;  4GDO A;  3BRT B;  4LC1 A;  3AE6 C;  4KJM A;  4NPE A;  5CJ4 A;  3TF5 A;  2KZI A;  4H13 D;  1SQX E;  1S9K E;  1NTZ K;  1NTZ J;  3CMA P;  4C7R A;  2HPC B;  4H44 C;  2C0X A;  1HWT C;  3CWB D;  3VP9 A;  2P67 A;  1S9K D;  1JMB A;  4H44 B;  1PL5 A;  1RH5 B;  3R2P A;  3NFQ A;  2RN0 A;  2ZXX A;  3G3Z A;  1DIP A;  1FZE A;  2WPQ A;  3IN6 A;  1NU1 G;  2L91 A;  1KIL A;  1M90 Q;  1LP1 B;  1HUC A;  1FZG A;  1QVG O;  1CSB A;  3PH0 A;  3T97 B;  2WSF H;  1NTM E;  3HE5 B;  3AE1 C;  4RES B;  4BWN A;  2PFX A;  4U3F E;  1SQQ J;  1GZL A;  4NPF X;  4BRY A;  1VPC A;  2PGD A;  1QX8 A;  1UIX A;  2JP3 A;  3TK1 A;  2CPB A;  3PTZ A;  1IK7 A;  4PV1 C;  1P84 E;  1SQB G;  3P32 A;  3I55 P;  2YKQ A;  2W6A A;  5AW4 B;  4Y99 C;  4PV1 B;  4OH8 B;  1ZP0 C;  3H1K G;  2Z4E A;  3SWF A;  5BU5 A;  1HVV A;  3AE7 C;  3G6E P;  2AXT H;  4Y99 B;  2OTJ P;  3ABV C;  5CCG C;  1L0N G;  1NU1 K;  3H6P A;  1KYO E;  5B66 E;  1L4A A;  2B88 A;  2IBZ I;  1NU1 J;  2HOD B;  5GTI H;  2Q5U A;  3V2N A;  1X79 B;  4D6T J;  1N7S A;  1OZH A;  2WSF J;  1VQ7 P;  2YO3 A;  3O6Q B;  3VYI A;  3A2A A;  5KJ7 A;  2E74 D;  1VF5 D;  5C39 A;  3KDP B;  3SWK A;  2Q7C A;  1M56 D;  3EFG A;  2YKO A;  1ZW0 A;  3LID A;  1SQB K;  2QG4 A;  1L4A D;  2Y9Y A;  4N78 D;  1BCC J;  3P8M C;  1RY3 A;  3H1K J;  1URQ A;  4I6M C;  2R3S A;  3Q5P A;  1FBM A;  1DH3 A;  2WWW A;  1NTK G;  1NOH A;  4GOF A;  1GL2 C;  3BAT A;  1SS1 A;  3L74 D;  2LR2 A;  1GL2 B;  1SQP K;  3RK2 C;  3D71 A;  1SQP J;  2FYN C;  1URQ D;  3CCM P;  2KB7 P;  2RMZ A;  1DD3 A;  2FYN B;  3AEE C;  3CX5 D;  1LT9 A;  2YXR B;  2KZJ A;  1RE3 C;  1QGK B;  4EI2 A;  1OXZ A;  2H43 A;  3L72 D;  1PP9 D;  1Y8A A;  3L75 G;  3CPW O;  1SQX J;  3Q2Y A;  3CD6 P;  1AA0 A;  2BEQ D;  2B87 B;  2FYZ A;  5AVR B;  1UII A;  3A0B E;  1FC2 C;  2AEM A;  3BRV B;  1ZV8 A;  4DJG A;  2QJP C;  4WB4 A;  2IDB A;  2QJP B;  2JKV A;  1HTL C;  3H1L E;  2W83 C;  3RK3 C;  1JY2 N;  5AW3 B;  1LNQ A;  2BCC G;  1KYO H;  1KV4 A;  5B66 H;  4GOD A;  1RHZ B;  3LW5 H;  3RK3 B;  3H32 A;  4AQR D;  1FDI A;  3S9O A;  1FS0 E;  2V7Q J;  1NTM J;  3GG2 A;  3CC2 P;  4U3F J;  1BGY D;  3MIW A;  3KZI H;  1FOS E;  1KZU B;  1VQN P;  1DEE G;  1ZRT E;  4EOT A;  2NRG A;  2FYU G;  4GOE A;  1N73 C;  1JMM A;  1AVO A;  2PP6 A;  1GW4 A;  2IBZ E;  1N73 B;  1LTJ C;  4HH2 A;  2YIU C;  2JO1 A;  3L73 G;  3RL0 g;  3CCU P;  1OMI A;  1LTJ B;  2YIU B;  1M1J C;  4YXW H;  1GW3 A;  3MD0 A;  1EDI A;  1M1J B;  5E79 E;  1RF1 A;  1KMI Z;  2IBZ D;  5KTB A;  1G1J A;  4OVN F;  1U7M A;  2O1K A;  2HFE D;  1EDK A;  2O3J A;  2JJL A;  4IL6 X;  2D2C D;  4O9B A;  2XKM A;  1SQV D;  2JR8 A;  1ZOY C;  1EC5 A;  2P7J A;  2KSE A;  3Q5S A;  3TSI A;  2FYU K;  1YIT P;  5APU A;  3CL3 D;  2FYU J;  1EZV E;  1ZR4 A;  1IFJ A;  1KQL A;  2K37 A;  1BE3 E;  1ZXG A;  1HBW A;  4I7Z C;  5TIS E;  5GTH E;  1W2B O;  4GT1 A;  4I7Z B;  1AQ5 A;  1KQG B;  3OAK A;  1L0L D;  5KLV E;  3A0B H;  3F5H A;  3A0H E;  1K73 Q;  5BVZ A;  3L70 E;  2WMM A;  4L74 A;  1Q90 D;  3QWO C;  2R5D A;  1GU5 A;  2K3R A;  1A02 J;  4EYY Q;  4OGQ C;  4WY4 D;  2Y0E A;  2WTY A;  4OGQ B;  1M8O B;  2KLU A;  1MFT A;  2K9Y A;  1SP4 A;  1JOC A;  4C7N A;  3P8C D;  1S5L E;  1YYC A;  2G3A A;  2V4H A;  3H1I D;  4YTP C;  2FFD A;  1RF0 A;  1OX3 A;  2W90 A;  1G2C A;  2UWJ E;  1QVF O;  2QJY C;  3AE3 C;  2JWD A;  3GF7 A;  3CXH E;  3M9H A;  2QJY B;  3H1J D;  1KQS O;  3H1L J;  2IPP A;  2P2U A;  3VMY A;  3USS A;  4KHX A;  5B5E E;  5CMZ A;  2I1J A;  3HRN A;  1SFC A;  3C8V A;  2CPS A;  3Q3D A;  1JY2 O;  2OYH A;  1EXI A;  2Q9I A;  3L35 A;  2KS1 A;  4IFD K;  1PZQ A;  2ZYA A;  3CCR P;  1JTH B;  1WRG A;  3M9Q A;  1MZ9 A;  2R44 A;  1KOR A;  1SFC D;  1VQL P;  5TIS H;  3CLQ A;  3BAS A;  5GTH H;  3L71 E;  2JDI H;  2HPC A;  3D70 A;  2R32 A;  3RL0 D;  3Q1M A;  5KAF H;  3A0H H;  2E43 A;  2M5A A;  3OJA B;  3RBX A;  3G9R A;  3FWL A;  4CPG A;  2IYP A;  3HD7 C;  1VL2 A;  2WPS A;  3HD7 B;  1PGP A;  1LWU C;  2QSI A;  4TT3 H;  2AXT E;  2A45 I;  1LWU B;  2LKM A;  3HE4 B;  2GM4 A;  5AW9 B;  4RJT A;  1NTZ G;  3PJS K;  3PLN A;  4JQ0 D;  1BE3 J;  3I5C A;  5GTI E;  2A06 E;  1N8R Q;  1S5L H;  1IFI A;  5CCH A;  3A3Y B;  3H1H E;  2QJK C;  3B5N A;  2O01 H;  3GHG C;  2R3C A;  2QJK B;  3MGN A;  3L70 J;  3GHG B;  1SQB D;  1PGJ A;  3CX5 I;  1N86 A;  3IAO A;  1QL2 A;  4I1L A;  1T2K D;  2E76 C;  2HOD A;  1L0N D;  2W8Z A;  1SQQ G;  2WT7 B;  2KXP B;  1YHQ P;  5CCH D;  3V6I A;  1OW8 A;  5B5E H;  2E76 B;  4OWF A;  3CWB E;  4AYC A;  3D6Z A;  3B5N D;  1T8Z A;  4HYT B;  3M0D C;  1IFP A;  1VQP P;  2J58 A;  3VMX A;  4AUW A;  1L2P A;  3HUS A;  3CCE P;  3KYQ A;  2WSC H;  4JYB A;  3MUD C;  3VMZ A;  2XV5 A;  5AW5 B;  2QRX A;  4D6T G;  3AEB C;  2WQY C;  2ZT9 C;  1CW5 A;  1SQQ K;  2JWA A;  2YO2 A;  1LTI C;  2ZT9 B;  4LLH A;  2K88 A;  1OVR A;  4DZO A;  1J1D C;  1NTK D;  1J1D B;  2Y9Z A;  1M1K Q;  1GDT A;  3CCQ P;  2Z5H A;  5AW1 B;  1BCC G;  2AXC A;  1KIL D;  3WUU A;  3SFD C;  2WSC J;  1CZQ A;  3HTK B;  1VQ4 P;  1T6A A;  3PRJ A;  4H13 B;  5AVZ B;  1QL1 A;  5AVU B;  3V4W A;  3V4Q A;  3L75 D;  4ASV A;  5KKZ C;  1JY3 P;  2KUB A;  3L71 J;  2R5B A;  3RK2 D;  4H0L D;  5KKZ B;  2FXP A;  2WPR A;  4N78 E;  1VQ9 P;  3S1K A;  1SQP G;  2ZJS E;  1USD A;  3KZI E;  2YMK A;  1PPJ G;  1KC8 Q;  4DOJ A;  3GF3 A;  3FXE A;  2VRS A;  1N7S D;  2BCC D;  1KTM A;  1SQX G;  5APQ A;  3L74 E;  3GMA A;  4NPD A;  1H0T A;  5KJ7 D;  3AEF C;  1VQ5 P;  2QM7 A;  4W7Z A;  3V2R A;  1Q86 Q;  2GUS A;  1JNM A;  1E79 H;  3CX5 E;  3H1H J;  1HJB A;  4RO0 A;  1JUN A;  3I56 P;  4HB1 A;  1BSN A;  3L72 E;  5CHX A;  1PP9 E;  2WZ7 A;  1JEK A;  1LTJ A;  1IK9 A;  2ZAE B;  1N2D C;  5KLI C;  3L73 D;  2O01 N;  4BRY B;  1OIP A;  3AED C;  1NTM G;  5KLI B;  1VQ6 P;  1SQX K;  4U3F G;  4B86 A;  3OA7 A;  2ZXE B;  2WSE H;  3ITK A;  3PHL A;  2E74 C;  1VF5 C;  3CWB J;  4UB6 E;  5H2F E;  3M9B A;  2E74 B;  1VF5 B;  2KLV A;  1KB9 I;  1SLQ A;  1OVU A;  4JBZ A;  5KAI E;  1L4A C;  1ZN5 A;  5AW8 B;  2WPV B;  4PJ0 E;  1L4A B;  3W67 A;  2H89 C;  1LTA C;  3BCC E;  1KN7 A;  2Y0C A;  1BGY E;  1R5S A;  1R8E A;  1JCD A;  5AW7 B;  1CI6 B;  4IOI H;  3S4R A;  1FZC A;  1NTM K;  1YJW P;  3JC2 2;  1NGM B;  2E5Y A;  1JY3 N;  2K9J B;  3BCC D;  5AVW B;  3IFM A;  1VQO P;  3VOP A;  3P7K A;  4GIF A;  1URQ C;  1Z56 A;  4PD4 I;  2A45 H;  1YIJ P;  1WT6 A;  1URQ B;  3E7K A;  2ZFC A;  1J2J B;  4Z1M H;  1LTS C;  3EWK A;  2YMY A;  2XZR A;  1KFN A;  3AE9 C;  5CBO A;  1FJK A;  4JYC A;  1VQK P;  1X22 A;  5AVX B;  3LIE A;  1SQV E;  3LW5 J;  2XNX A;  4A7P A;  2C9L Y;  2L5G B;  1H88 A;  2P58 A;  1RQU A;  3VMA A;  2G8Y A;  3CX5 H;  5L8R J;  2AEJ A;  4XFJ A;  3FGA D;  2KNC B;  2KYV A;  4LGD E;  2LXC B;  3MHV A;  2P1J A;  3AE8 C;  2XU6 A;  3E1R A;  1VQM P;  1L0L E;  1NHL A;  1GK6 A;  4XA4 A;  4HKZ H;  1GU4 A;  4W80 A;  4UB6 H;  1NKZ B;  5H2F H;  5M1B A;  2NPS A;  1PGQ A;  1DD4 A;  1NH4 A;  4ZMD A;  3L36 A;  1K04 A;  5KAF E;  1FJP A;  5KAI H;  4PJ0 H;  3TGU E;  2MKV A;  2FKW B;  3H32 B;  2IYO A;  2OYI C;  3H1L G;  1LTG C;  3TNU A;  3L72 J;  1YJN P;  1PP9 J;  2OYI B;  2OTL P;  3P8C E;  2NPS D;  1MV8 A;  4IL6 H;  3TGU D;  1YQ4 C;  3H1I E;  4WVZ A;  5AVV B;  1WMK A;  1BDC A;  3CC7 P;  2E75 D;  5DJT B;  1Y47 A;  3WU2 E;  2D2C C;  1RE4 A;  2D2C B;  3AE2 C;  1IJD B;  5APS A;  3H1J E;  5APX A;  1KB9 D;  4WWI A;  3MTU E;  1NWQ A;  1AVY A;  3HD7 A;  1RF1 C;  2IBZ G;  2OQQ A;  1RF1 B;  2B89 A;  5CBN A;  1FOS F;  3HE4 A;  2N1T A;  1BGY J;  2Q3I A;  1GTW A;  1YQ3 C;  1NTZ D;  1LGH B;  1JO5 A;  4PD4 E;  1NO4 A;  3M91 A;  3RBZ A;  3CC4 P;  3GHG A;  1Q7Y Q;  1KQF B;  4IFM A;  3V2Q A;  4WY4 C;  4PD4 D;  5AW0 B;  1JY3 O;  2N1T D;  1MKM A;  4K35 A;  1EZV G;  4Y28 J;  2M8R A;  3FX0 A;  2YKP A;  4WY4 B;  2H88 C;  1W5C E;  1BE3 G;  4K3A A;  1SQQ D;  1FZF A;  2AEF A;  1EQ7 A;  5CJ0 A;  2QIW A;  1SQV J;  4RKU J;  1S5L X;  5KLV G;  3N7N A;  1XTG B;  1X9V A;  3KHU A;  3L70 G;  1P84 I;  1NU1 E;  1MUU A;  1AQT A;  3MUD A;  3SWY A;  1FDM A;  2CK3 H;  2JEE A;  3V2P A;  4M3L A;  1FU1 A;  4N6J A;  3AEG C;  1LP1 A;  1NU1 D;  3T97 A;  3F89 A;  4D6T D;  3HE5 A;  1AV1 A;  1KB9 H;  1K9M Q;  1L0L J;  2ZYD A;  1ZME C;  3WU2 H;  4H44 D;  4JF7 A;  1SQB E;  1M57 D;  1PFI A;  3B71 A;  2RKL A;  3H1J G;  3N4X A;  1OW7 A;  3H1K E;  5KLV K;  1T3U A;  2PAJ A;  2W6B A;  1IFD A;  5KLV J;  3O8Z A;  1HH0 A;  1L0N E;  2HR3 A;  2BAS A;  1BCC D;  3MZW B;  5AVY B;  3G4S P;  1SFC C;  1JCC A;  3H1K D;  2ZYG A;  3M0A A;  3V5B A;  2OYH C;  1SFC B;  1S2E A;  5CCG A;  2OYH B;  5APV A;  1XTC C;  1IFN A;  2ZVN B;  1T3J A;  1H89 A;  3RL0 C;  3K5B A;  3H1I J;  2M3E A;  1ZR2 A;  3O6Q A;  1NKN A;  4PD4 H;  3RL0 B;  3CME P;  3H25 A;  3FXD A;  4PV1 D;  2XDJ A;  5K5G B;  1NJI Q;  1ZLL A;  1SQP D;  2IFN A;  3B4S A;  1YTZ I;  2E42 A;  3H1J J;  2KI7 B;  2WVR A;  2O01 J;  4DT0 A;  5CCG D;  4JPZ B;  1PPJ D;  1YTZ T;  2FY8 A;  1OW6 A;  2QM8 A;  1HGV A;  3A5T A;  1J1E C;  2KP8 A;  1NTK E;  1J1E B;  3CCS P;  2WSS H;  1SQX D;  3KPE A;  3L71 G;  2M5A B;  2P10 A;  5AVT B;  1KIL E;  1GL2 A;  1LJ2 A;  2M0B A;  3CCL P;  1G1I A;  2KOG A;  1EDL A;  2J59 M;  3NTN A;  1GMJ A;  1S1C X;  1T2K C;  1S3J A;  3SFE C;  3L75 E;  5CCH C;  4H13 C;  1RE3 A;  3L37 A;  1FDO A;  3B5N C;  1NTM D;  1GL2 D;  2A06 G;  4ASW A;  3B5N B;  4U3F D;  1QEX A;  1QLE D;  1W2E A;  3SSU A;  2QE7 H;  2B87 A;  3H1H G;  4MN4 C;  1Y9B A;  3AEA C;  1JY2 P;  3U1C A;  4ZNC A;  3FWN A;  3A7O A;  2IZ0 A;  4L75 A;  4R4M A;  1P84 D;  3U1A A;  2BCC E;  3Q5R A;  2GUV A;  3AEC C;  1BSH A;  1OWA A;  2Y0D A;  1CI6 A;  2WIT A;  1Q81 Q;  1KYO D;  3CWB G; 
#chains in the Genus database with same CATH homology
 1FJK A;  1NAF A;  3M9H A;  3M06 A;  3HUS C;  4JYC A;  3BRT B;  5AVX B;  3HUS B;  2IPP A;  2P2U A;  4LC1 A;  3VMY A;  3LIE A;  2XNX A;  5CJ4 A;  2C9L Y;  4KHX A;  2L5G B;  5CMZ A;  1H88 A;  2I1J A;  3HRN A;  1SFC A;  1KIL C;  2CPS A;  1S9K E;  1L0N K;  1NTZ K;  3RK3 D;  1JY2 O;  2OYH A;  1N7L A;  1KIL B;  1N73 A;  2Q9I A;  3EQ2 A;  2Z5I A;  1IFM A;  4C7R A;  2HPC B;  1DEB A;  3L35 A;  2H8P D;  2KYV A;  3C9I A;  4LGD E;  4IFD K;  2C0X A;  1HWT C;  3VP9 A;  2P67 A;  1S9K D;  1M1J A;  2P1J A;  2XU6 A;  1FZA A;  3R2P A;  1JTH B;  1WRG A;  3M9Q A;  1MZ9 A;  3NFQ A;  1NHL A;  1GK6 A;  1SFC D;  3CI9 A;  3G3Z A;  4XA4 A;  1FZE A;  2WPQ A;  3RK2 B;  1GU4 A;  4W80 A;  1NKZ B;  3CLQ A;  2NPS A;  3BAS A;  1KIL A;  1NH4 A;  1HUC A;  1FZG A;  1CSB A;  2HPC A;  1VDF A;  2WSF H;  2R32 A;  3HE5 B;  3L36 A;  3RL0 D;  2O1J A;  4RES B;  1FJP A;  1GZL A;  4WBA A;  1LTT C;  1VPC A;  2E43 A;  1N7S C;  2FKW B;  3OJA B;  3H32 B;  2OYI C;  1LTG C;  3TNU A;  1N7S B;  1NTK K;  3HD7 C;  3TK1 A;  5KJ7 C;  3NXS A;  3VTP C;  2WPS A;  2CPB A;  2OYI B;  4C46 A;  3P32 A;  3HD7 B;  3P8C E;  2NPS D;  1MV8 A;  2YKQ A;  5AVS B;  2W6A A;  1LWU C;  5AW4 B;  4Y99 C;  4OH8 B;  2Z4E A;  2KSJ A;  3SWF A;  5AVV B;  5BU5 A;  1HVV A;  1LWU B;  2A45 I;  2LKM A;  3HE4 B;  4Y99 B;  2GM4 A;  5AW9 B;  5CCG C;  1NU1 K;  3H6P A;  2HYN A;  3I5C A;  1L4A A;  2HOD B;  1RE4 A;  2Q5U A;  2A45 G;  3V2N A;  1IFI A;  1X79 B;  1IJD B;  5APS A;  2HG5 D;  5APT A;  5APX A;  3A3Y B;  1N7S A;  5CCH A;  4N3Y B;  2YO3 A;  3MTU E;  1NWQ A;  2OYI A;  3II6 A;  3B5N A;  2O01 H;  3HD7 A;  3VYI A;  1RF1 C;  3A2A A;  3GHG C;  5KJ7 A;  2R3C A;  3MGN A;  3KDP B;  1RF1 B;  3GHG B;  1DX7 A;  1FOS F;  3HE4 A;  2Q7C A;  2C9N Y;  3EFG A;  2YKO A;  1N86 A;  3LID A;  1SQB K;  1QL2 A;  4I1L A;  3IR9 A;  2M3B A;  2N1T A;  1L4A D;  2Q3I A;  3TYY A;  3PP5 A;  4N78 D;  1GTW A;  1T2K D;  2HOD A;  3P8M C;  2WT7 B;  1RY3 A;  5CCH D;  1LGH B;  1LT9 C;  1URQ A;  1JO5 A;  2IX7 C;  4AYC A;  1NO4 A;  3M91 A;  3B5N D;  1T8Z A;  4I6M C;  3WMM 0;  4HYT B;  1LT9 B;  3M0D C;  2J58 A;  1FBM A;  3GHG A;  1DH3 A;  3VMX A;  2WWW A;  2I1K A;  1NOH A;  4IFM A;  1GL2 C;  3V2Q A;  4AUW A;  3KQG A;  3BAT A;  4WY4 C;  2H7H A;  5AW0 B;  1JY3 O;  2N1T D;  3HUS A;  1GL2 B;  4IFF A;  3KYQ A;  2M8R A;  1SQP K;  2N9B A;  2WSC H;  4JYB A;  2YKP A;  4WY4 B;  3VMZ A;  1A02 F;  1AFO A;  2XV5 A;  3RK2 C;  2W27 A;  1URQ D;  5AW5 B;  2KB7 P;  1MFZ A;  1FZF A;  1LT9 A;  1EQ7 A;  1CW5 A;  5CJ0 A;  1RE3 C;  1SQQ K;  2YO2 A;  1LTI C;  1OXZ A;  3N7N A;  1XTG B;  2H43 A;  1X9V A;  1FZB A;  1LTB C;  4LLH A;  4DZO A;  1J1D C;  1GD2 E;  1IC2 A;  1FZC C;  3BVH A;  4WY4 A;  1J1D B;  1MUU A;  2FYZ A;  1FZC B;  1JTH A;  5AVR B;  1KFM A;  3MUD A;  3SWY A;  1GDT A;  1FDM A;  2JEE A;  3V2P A;  2Z5H A;  5AW1 B;  4M3L A;  1FU1 A;  4N6J A;  2IFM A;  1KIL D;  4I2L C;  2MJZ A;  3BRV B;  1ZV8 A;  3T97 A;  4WB4 A;  3HE5 A;  1CZQ A;  3HTK B;  1HTL C;  3RK3 C;  1JY2 N;  5AVZ B;  5AW3 B;  1QL1 A;  4JF7 A;  5AVU B;  3V4W A;  3LW5 H;  3RK3 B;  1PFI A;  3V4Q A;  3H32 A;  4AQR D;  3N4X A;  1JY3 P;  5KLV K;  1T3U A;  2FXM A;  2PAJ A;  2R5B A;  2W6B A;  3RK2 D;  1IFD A;  2WPR A;  4N78 E;  3O8Z A;  1HH0 A;  2BAS A;  1LWU A;  5AVY B;  3MIW A;  3VN0 A;  1SFC C;  1JCC A;  1KZU B;  1FOS E;  3V5B A;  3M0A A;  1H8A A;  4DOJ A;  3UIA A;  4EOT A;  2OYH C;  1SFC B;  5AW6 B;  2POH A;  4EIJ A;  1N73 C;  1JMM A;  5CCG A;  2OYH B;  2PP6 A;  1GW4 A;  5APV A;  1XTC C;  2VRS A;  1N73 B;  1LTJ C;  1IFN A;  3NMD A;  1N7S D;  1T3J A;  4HH2 A;  1H89 A;  3RL0 C;  5APQ A;  1ZR2 A;  1LTJ B;  3HD7 D;  1NKN A;  5KJ7 D;  1M1J C;  3RL0 B;  1GW3 A;  3MD0 A;  2QM7 A;  1M1J B;  2XDJ A;  3U59 A;  1RF1 A;  4W7Z A;  3V2R A;  5BU8 B;  2GUS A;  1G1J A;  5KTB A;  1ZLL A;  2IFN A;  3L4F A;  1YTZ I;  1JNM A;  2E42 A;  2O1K A;  2HFE D;  2NPS C;  1HJB A;  5AW2 B;  2JJL A;  5CCG D;  2OAR A;  1YTZ T;  4O9B A;  2NPS B;  1JUN A;  4XE5 B;  2XKM A;  2QM8 A;  2WT7 A;  1HGV A;  3A5T A;  5CHX A;  1J1E C;  2KP8 A;  2P7J A;  2WZ7 A;  1LTJ A;  3TSI A;  1IK9 A;  2FYU K;  1J1E B;  1N2D C;  1SQV K;  3KPE A;  4ZKU A;  4W7Y A;  5APU A;  1SVF A;  1GK4 A;  3B8E B;  3CL3 D;  3M0D A;  1ZR4 A;  1IFJ A;  1SQX K;  4B86 A;  1KQL A;  3OA7 A;  3TNU B;  2ZXE B;  5AVT B;  1E5W A;  2WSE H;  5AVQ B;  1GL2 A;  1HBW A;  1G1I A;  1HGZ A;  2KOG A;  4GT1 A;  2J59 M;  3M9B A;  2KLV A;  1AQ5 A;  1SLQ A;  5APY A;  1IO4 A;  3NTN A;  3OAK A;  4GKG A;  1L4A C;  1ZN5 A;  5AW8 B;  4C7N B;  1T2K C;  5BVZ A;  1RE4 C;  1X8Y A;  1L4A B;  1L0L K;  3VP8 A;  2R5D A;  5CCH C;  1GU5 A;  2FFD C;  1RF0 C;  1RE3 A;  3L37 A;  1LTA C;  2HLO A;  1A02 J;  3B5N C;  1GL2 D;  2FFD B;  3B5N B;  4WY4 D;  1JCD A;  1W2E A;  2WTY A;  5AW7 B;  1CI6 B;  1G2C B;  1FZC A;  1NTM K;  1JY3 N;  2N1T C;  1JY2 P;  3U1C A;  1SP4 A;  1JOC A;  1M7L A;  1FAV A;  5AVW B;  3E1I A;  4C7N A;  3A7O A;  2N1T B;  3IFM A;  3U1A A;  3P8C D;  3VOP A;  1YYC A;  2GUV A;  3P7K A;  4GIF A;  1URQ C;  2C0W A;  1Z56 A;  1OWA A;  3HTK A;  2A45 H;  1WT6 A;  1URQ B;  2ZFC A;  2FFD A;  1RF0 A;  4ZKP A;  1J2J B;  1CI6 A;  1G2C A;  2WIT A;  1LTS C;  2YMY A;  5APW A;  2XZR A;  2YNY A;  1KFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...