1SQBK

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
b'LTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDSRLILDWVPYINGKFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqbK00
1L0LK 1NTKK 2OARA 1SQBK 1SQXK 2LKMA 3G3ZA 1SQVK 2J59M 2WSEH 3CLQA 1SQPK 2WSCH 1NTZK 1SQQK 1L0NK 2FYUK 3M9QA 3LW5H 2O01H 1NTMK 1NU1K 4IFDK 5KLVK 2WSFH
chains in the Genus database with same CATH superfamily
2OARA 2B87A 3RK3C 1KYOI 4EI2A 1EZVE 3HE5B 1L0NK 4D6TE 2JEEA 3M91A 2OYHC 2Q9IA 5APWA 4QMAA 3MTUE 5APXA 1JO5A 1KFMA 5AVZB 4R4LA 1YTZI 3MIWA 3GF3A 1NTZD 1SLQA 1X8YA 2HFED 5APTA 2Z5HA 4RKUJ 5KLVD 4IOIH 1K05A 5AW2B 3FWNA 3A0BH 4WB4A 1KILA 1VQNP 1PP9J 2QSIA 3L72E 4JPZB 3RL0B 2IBZD 2BCCJ 3HE4A 1GK6A 1P84D 2W8ZA 1LJ2A 1FE6A 1KQLA 3H1LJ 3CX5D 5AW5B 5B66E 5AVYB 2P67A 2Z4EA 1IC2A 1SQBD 3LIDA 5CCGA 2OYOA 4NPDA 1LTSC 1VQ4P 1M1JA 3O6QA 1PV3A 5GTIE 4W80A 3PJSK 3Q5PA 1IK9A 4RJTA 2FYZA 3CI9A 1WRGA 2WSFH 1BDCA 2NPSB 2R3CA 1XTCC 2D2CD 2WSFJ 2R3SA 1LTGC 5CCHA 2JWDA 4U3FD 3RK2B 5KAFH 1SFCC 1KQFB 1VQ7P 1LTIC 2ITAA 3A5TA 2E74B 3CXHD 4WWIA 1G2CB 1VQ9P 3Q3DA 2RN0A 3EQ2A 2IBZI 4UB8H 1HGZA 1EZVD 1X22A 1M90Q 3AE1C 2QEXP 1P84I 2G3AA 4D6TD 3CX5I 5CJ4A 3G9RA 2AEFA 2Y9ZA 2IX7C 3IR9A 2OYIB 1N7SC 2E5YA 2ZAEB 2IFNA 3CC4P 1M8OB 2KS1A 1Y8AA 1MKMA 1YHQP 3E7KA 3OJAB 1GL2B 3LW5H 2QA4P 2CPSA 2JP3A 3L72D 3LW5J 3P7KA 2WVRA 1FDIA 2A45G 1PPJD 1LTAC 1NTMJ 3L73G 3RK3E 3MGNA 1RQVA 4YXWH 1OMIA 2B88A 3K5BA 1HUCA 1S72P 2NPSD 1KV4A 4WY4C 4H44B 2HODA 4GDOA 1OVUA 3B71A 3B5NC 5BVZA 3HUSB 2QJKB 1NAFA 1E5WA 2E74D 2Q1KA 2WPSA 1A02F 3WUUA 2POHA 1GD2E 4A7PA 3H1IJ 3HE5A 3KHUA 3AEFC 3AEGC 4W7YA 2YKQA 1J1DC 4XA4A 3L75G 4OVNF 2J58A 2YIUC 4H13B 4LLHA 2R5BA 1NVOA 3MHVA 1L0LE 1HTLC 1U7JA 3NXSA 1YJWP 4OGQD 1FZCA 3A0HE 3AE8C 3CL3D 4UB6H 1KD1Q 3TGUE 2KSEA 1NTZK 4BWNA 2CPBA 3WU2H 1SQPG 2JKVA 1IFPA 3H1HG 1L4AD 3M9BA 3RBXA 1S3JA 2Q6QA 2E75C 3L70J 1DEBA 2E76B 1MV8A 1SQPK 3LIEA 2K88A 2FYUE 1N7LA 1SQXJ 2FYNC 1RF0A 5C39A 1SQVJ 1YJNP 1EDJA 3RK3D 1S5LH 3AE6C 3OA7A 2C9NY 1SQBK 3M9HA 3L71J 4I6MC 1QVGO 1LTTC 1NTKG 1ZRTE 1LTJA 2NPSA 3H1KE 1YYCA 2W6JH 3GW6A 1N86A 5M1BA 1VF5B 1JY2N 2BEZF 2P7JA 3Q5RA 3VN0A 1NU1J 2B89A 4H13D 3SWKA 1G2CA 1FZFA 2GUSA 4ZKUA 2N9BA 2YO2A 3KQGA 3USSA 1X0TA 2JDIH 3BCCG 3FX0A 1KQGB 1DX7A 3NFQA 4DJGA 2YXQB 2C0WA 4PD4H 1N7SB 1QLED 1N2DC 2OYIA 4ZKPA 4ZMDA 3VOPA 4PD4I 2E76D 2XZRA 1GL2A 4YXDC 2PAJA 4YTPC 2PP6A 2W83C 1PP9E 3P8CE 3A0BE 2ZJSE 1K04A 3CWBG 1RQUA 2J5UA 1FZCC 1EC5A 1OXZA 4IFFA 1FZBA 2BCCE 2N1TC 3KZIH 3G6EP 2O1JA 3L70G 3IN6A 3HD7C 1K8AQ 2RMZA 1VF5D 1PIXA 5AW1B 1BGYJ 3QWOC 1OVVA 1H88A 1JCCA 3KXDA 1VQLP 3HUSA 2FYUD 3VMYA 1BE3G 1GU4A 3RGUA 5AW9B 2N9YB 4GOFA 2XNDH 3MP7B 1S9KE 2KP8A 1UIIA 1CZQA 3AEAC 3FXDA 1EDLA 5KKZB 3W67A 1ZRTD 3H1KD 5BU5A 1N73C 1QVFO 5CJ0A 4I7ZC 3D70A 1JOCA 1VQ6P 1LTJC 3VP9A 1JNMA 1HF9A 1N7SD 1PGJA 3FXEA 4L73A 3WUTA 2W6BA 5AVRB 1UIXA 2OTKE 1BCCJ 5TISH 3L74E 3PHLA 4UB8E 2KI7B 1URQC 2KZJA 4WY4D 4NPFX 3OW2O 3C1LA 1H8AA 3V2NA 1FBMA 1SS1A 1GW4A 2O3JA 3B5ND 2QJPB 5KTBA 1PGOA 3H25A 1USEA 1BSHA 1W5CE 5KJ7C 3B4SA 2A06G 1S4XA 1LTBC 1LWUB 1R5SA 1PP9D 3P8CD 1EQ7A 5AW4B 1GMJA 2BCCD 4Y99C 4I1LA 3KYQA 3H1LD 3PRJA 1L0NG 4EOTA 3BASA 3H6PA 3L4FA 2Z5IA 1GW3A 4ZNCA 4IL6H 1S9KD 1IFMA 2D2CB 1KTMA 5H2FH 3N4XA 2FFDB 1QX8A 1K9MQ 3CCRP 2R5DA 1CI6A 4DOJA 3I55P 3E1IA 1S1CX 2ZT9C 1RF1C 5CMZA 4TT3H 5E79H 1AVYA 3JC22 2E75D 1J1EB 2M3BA 4ASVA 1SP4A 2A45H 1SVFA 2ZYAA 1L2PA 2KNCB 5CBNA 1YI2P 3AEBC 1L0LG 1PPJE 4O9BA 2ZYGA 3L73J 1T3JA 2H89C 1BCCG 3L74D 1CSBA 1LNQA 2O01H 3TGUG 2M5AB 3H1JG 1SQQG 1PGQA 2QJYC 1N8RQ 2O01J 3L37A 3Q2YA 1L0LK 2O1KA 3D71A 1HWTC 1RE3A 2YXRB 4UB6E 3TNUB 3AE3C 1IK7A 4IFMA 3WU2E 1YQ3C 1SQQK 2AEMA 1JTHB 3FGAD 1Q7YQ 2QM8A 1OX3A 1ZV8A 2K37A 2QIWA 2KLUA 1SQXE 1SQVE 2K3RA 1MZ9A 4ASWA 1NTMD 1FC2C 1HJBA 2M3EA 3L75J 1JY3O 1LT9B 2FYUK 3O8ZA 2L91A 1VQMP 3U1CA 3L71E 1S5LE 4AUWA 1YJ9P 3GHGB 2DW3A 3V5BA 3V2RA 3V4WA 1DIPA 1JMBA 1KFNA 3C8VA 5AW7B 1DEEG 1NU1E 4EYYQ 1H89A 3SWFA 2R44A 1SQPJ 1JEKA 3H1HJ 4BXLA 1LP1B 4HKZH 3WUVA 3H1ID 2ZXXA 3JCUH 5EFWB 1ZXGA 3HTKB 1IFIA 3VTPC 1NH4A 4LC1A 2N1TD 5AW8B 3HD7D 1W2EA 4OGQB 5KLIB 3SSUA 4DT0A 5APYA 3A3YB 4PD4E 1W2BO 2HR3A 2KK7A 1M57D 1KILC 3BRTB 1L4AB 3CCQP 1VL2A 4PV1C 1NTKJ 1LWUA 4OWFA 1LGHB 2OTLP 1GK4A 3GLMA 2IDBA 1VQPP 2B9BA 1GTWA 3VMZA 5DJUB 2P1JA 4KJMA 2ZVOB 4BRYB 4WVZA 1EDKA 5CCGC 3RK3B 3KZIE 2QRXA 4K35A 1BGYE 1M1JC 1AA0A 2C9LY 3CCEP 3D6ZA 1SQXD 2OYHB 1SQVD 1ZW0A 3BCCJ 2FFDA 1DD4A 1JY3P 1QGKB 1QEXA 3L71D 5CCHC 1AVOA 1VDFA 1NTZG 1XTGB 5KLVG 4GT1A 1PL5A 2AEJA 2IYOA 1NU1D 4AYCA 2KNCA 5AVXB 2IBZG 3VMXA 3CWBJ 4H0LC 3AEEC 5AVVB 5KLVK 1Q86Q 1JCDA 3B8EB 2KSJA 1GZLA 2RH0A 2WT7B 2M5AA 3C9IA 2L5GB 2MJZA 2XNXA 4WBAA 5TISE 1SQBG 3TNUA 5DJTB 1BE3J 2XDJA 4N6JA 4PD4D 2HG5D 1JTHA 4MN4C 2ZFCA 4N78D 1WMKA 5APQA 1SFCB 1HH0A 4U3FG 5GTHH 3II6A 2KZIA 5CBOA 3V4QA 1YBKA 3EFFK 2ZT9D 3S1KA 1U7MA 1LT9A 1ZOYC 2I1KA 2OGUA 1OW7A 1RE4A 3GHGA 2NRGA 1BGYD 1NYHA 1YQ4C 1EZVG 2NZ2A 2V7QH 4D6TG 2V7QJ 1KB9H 3AEDC 1KILE 1ZMEC 3H32B 3F89A 2LKMA 4IL6E 2WSEH 1OIPA 3I5CA 5H2FE 1JUNA 1KQSO 1IFDA 3MUDA 2WSEJ 4XE5B 2LR2A 3IAOA 2ZYDA 3W68A 2HLOA 4U7JA 1VPCA 3L72G 1YIJP 2H8PD 1PPJG 1H0TB 1L4AA 1NWQA 4WY4B 3L73E 3RL0C 3VMAA 1X9VA 1AV1A 1GDTA 1L0NJ 3H1LE 2FXMA 3B5NB 1ZR2A 1SFCD 4EIJA 1PZQA 2ZXEB 3S9OA 1S5LX 3VYIA 2WPRA 3QH9A 1RF0C 2I8DA 1J1DB 2Q7CA 2OYHA 1RY3A 1OZHA 2ZVNB 1R8EA 1JB0J 2NPSC 2YIUB 3MZWB 5AVTB 1IZNB 3F5HA 1NHLA 5AW0B 3RK2C 3M06A 1SQXK 5KAFE 3CC2P 1SQVK 1L0LJ 2E74C 3A0HH 1M56D 3CCVP 1S2EA 2OTJP 2Y0DA 3KPEA 3NMDA 3TGUJ 3H1JJ 1SQQJ 1KILD 3U1AA 4PV1D 3SWYA 2E75B 4YPCA 3E1RA 2WT7A 3I56P 1DH3A 3CCJP 3T97B 2OYIC 2LXBA 3JCUE 2FYNB 3MUDC 3V2QA 2WITA 1M7LA 4Y28J 1T8ZA 2FYUJ 3IFMA 5CCGD 1OW6A 1KC8Q 3CLQA 2YO3A 1GL2C 3SFEC 3AE2C 1NTME 3L73D 3NTNA 1WT6A 4PJ0H 1NTKE 3TK1A 4DZOA 1YITP 5CCHD 2UWJE 4H44C 2SPZA 2XU6A 5AW6B 3V2PA 2WTYA 1KYOH 2XV5A 4RO0A 3HUSC 1FDMA 1VQ5P 2QJKC 2H7HA 2K9JB 3H1IE 3L35A 4NPEA 2KIKA 2PRRA 3EWKA 4H0LD 5B5EH 3H32A 3EFGA 3UIAA 2BASA 3BCCE 1X79B 1N7SA 5TJHA 2GA1A 1E79H 3L75D 4JYBA 2Q5UA 1JMMA 1FU1A 4OH8B 1VQOP 4H13C 2A45I 3Q5SA 1FDOA 1HJ0A 2KUBA 1KN7A 4Z1MH 1RHZB 1FZCB 1H0TA 2N1TB 2H88C 1JY2O 1SQPD 1R5LA 4WY4A 3HD7B 2PGDA 3CWBE 4CPGA 3H1HD 3A2AA 1Q90D 4M3LA 1T6AA 3M0DA 2JWAA 5K5GB 3B5NA 1IJDB 3RL0g 2Q3IA 3L70E 3CMEP 2WZ7A 2E43A 2FYUG 2E76C 1GU5A 4JF7A 1BE3E 2W27A 4KHXA 3ZDMA 1FZGA 1J2JB 1HVVA 2FXOA 4L75A 1VQKP 2R32A 1N73B 1FOSF 4I7ZB 3H1KG 1NTKD 5KAIH 1M1KQ 3CD6P 1LTJB 1NAYA 2BEQD 1NTZJ 2AXTH 5APSA 4W7ZA 4HH2A 5KLVJ 2J59M 1KORA 4IL6X 1VF5C 3A7OA 3AE7C 2KXPB 4C7RA 2OQQA 1G1JA 5GTHE 3P8MC 1NOHA 1IFNA 3TF5A 1FAVA 1P84H 1FZEA 5AVSB 2AXCA 4XFJA 2WQYC 1JM0A 3CX5H 3PP5A 3L74J 2HPCB 5APVA 1URQB 1VQ8P 3TDKA 1T2KC 3BCCD 5BU8B 3RL0D 1SQBJ 1MFTA 2H43A 2KYVA 2W90A 1KB9E 1FS0E 3T97A 2QG4A 1D7MA 1BSNA 2QVAA 1A02J 1QL1A 1ZR4A 4RESB 2FXPA 4N78E 2WWWA 2A06E 1JY2P 1PP9G 4Y99B 4U3FJ 3ABVC 3CWBD 3S4RA 2BCCG 3G71P 2M8RA 2G8YA 3CXHH 3H1LG 3JSVC 3L70D 3PH0A 1RE3C 1ZN5A 1L0NE 4JBZA 3D6YA 3CXHI 1YTZT 3M9QA 4GOEA 3M0DC 4HJGH 3RK2D 2O01N 1BE3D 3HRNA 1EZVI 4D6TJ 2Y0EA 3R4YA 3V6IA 2ZT9B 3CCUP 4L74A 1RF1B 2K9JA 3FWLA 4JQ0D 5KKZC 1FJKA 1URQD 4LGDE 2P10A 2RKLA 4R4MA 4B86A 1PGPA 2QM7A 1U57A 2P58A 3L72J 1HGVA 1TU3F 5KJ7D 1ZLLA 1AQTA 4AQRD 5B66H 2YNYA 3AE5C 2QE7H 3L74G 2QJYB 4JYCA 1Q82Q 1NJIQ 1BCCE 1AFOA 1GL2D 5CHXA 2KLVA 3G3ZA 1BDDA 2N1TA 3H1JE 1SQQE 1MUUA 3HD7A 3BATA 4KT0J 1KB9D 3CMAP 5GTIH 2IYPA 3M0AA 2WPQA 3PTZA 1DD3A 1QL2A 3SFDC 4C7NB 3IF4A 4H44D 2YKOA 2P2UA 3P32A 1AQ5A 1HBWA 2KOGA 2QJPC 2A06D 4GKGA 1IFJA 1N73A 4DCKA 3OAKA 1NTMG 2IPPA 4N3YB 2JJLA 1MFZA 1LWUC 2WPVB 2WMMA 1Y9BA 3CCMP 1L0ND 4K3AA 3CPWO 1EDIA 4PJ0E 3GF7A 1NTMK 1NKNA 1PFIA 1FJPA 2B87B 1Z56A 4C46A 1NTKK 3MD0A 3TYYA 3BRVB 2HYNA 1LP1A 2D2CC 1KYOE 1EXJA 3H1IG 3CCSP 2HPCA 2FFDC 2FY8A 3HTKA 1KB9I 1KMIZ 1OFCX 2JR8A 1CI6B 1G1IA 1URQA 1USDA 4IFDK 1FZAA 3L36A 3Q1MA 4GIFA 1AJYA 5B5EE 1JY3N 2E42A 2VRSA 1ZP0C 3ITKA 3KDPB 2MKVA 5E79E 1KILB 4HB1A 1J1EC 2M0BA 5KJ7A 2YMYA 4PV1B 1L0LD 1Y47A 3GMAA 2YKPA 2WSSH 1BCCD 4HYTB 3HE4B 3VP8A 1FOSE 1LT1A 3TGUD 3H1JD 1K73Q 1SQQD 2V4HA 2XKMA 3AECC 1Q81Q 2LXCB 2Y0CA 3PLNA 2GM4A 5AVQB 2CK3H 4BRYA 1M1JB 2W6AA 3O6QB 5AVUB 1OW8A 5APUA 1RH5B 2E5TA 1SQXG 1NKZB 1SQVG 3TSIA 1RF1A 4I2LC 1NGMB 3WMM0 3L71G 1OVRA 3L75E 2I1JA 1T2KD 2K9YA 3CCLP 1LT9C 1NTZE 1Q2NA 5KAIE 4TLFA 4L76A 1RE4C 3GHGC 5KLVE 2AXTE 2IZ1A 2Y9YA 1NU1G 4H0LB 2GUVA 5AW3B 2IBZE 1SQPE 1KYOD 2FKWB 2C0XA 2Q3EA 3H1HE 1P84E 5L8RJ 2JO1A 1NU1K 3CX5E 3CC7P 2IFMA 3R2PA 2KS1B 1SQBE 1NO4A 2YMKA 2FBWC 1KZUB 3RBZA 1CW5A 3G4SP 1OWAA 3GG2A 4C7NA 3AE9C 4OGQC 5KLIC 1T3UA 1IO4A 1EXIA 3N7NA 4EDFA 3H1KJ 2IZ0A 1SFCA 1L4AC 3BVHA 2K1AA 2HODB 3AE4C 4U3FE 2WSCH 5AVWB 2KB7P 3U59A 2WSCJ 2PFXA 3CXHE 4GODA 1BGYG
chains in the Genus database with same CATH topology
1GZLA 3PP5A 2OARA 2WT7B 3C9IA 5AW1B 2L5GB 2MJZA 1H88A 2XNXA 2HPCB 3RK3C 1JCCA 4WBAA 5APVA 3HUSA 1URQB 3HE5B 3VMYA 1T2KC 1GU4A 3TNUA 5BU8B 3RL0D 1L0NK 5AW9B 1S9KE 2XDJA 2H43A 2JEEA 2KP8A 2KYVA 4N6JA 1CZQA 3M91A 2OYHC 2Q9IA 5APWA 2HG5D 3MTUE 5APXA 1JO5A 1KFMA 5AVZB 1JTHA 3T97A 1YTZI 5BU5A 1N73C 3MIWA 2ZFCA 4N78D 1SLQA 1A02J 1QL1A 5CJ0A 1X8YA 2HFED 1ZR4A 4RESB 5APTA 2Z5HA 4N78E 2WWWA 5APQA 1JOCA 1SFCB 5AW2B 1LTJC 3VP9A 1HH0A 1JY2P 1JNMA 3II6A 1N7SD 4WB4A 1KILA 4Y99B 3V4QA 1LT9A 3RL0B 2M8RA 2I1KA 2W6BA 1RE4A 3GHGA 5AVRB 3HE4A 1GK6A 1KQLA 1RE3C 1ZN5A 1YTZT 3M9QA 5AW5B 3M0DC 5AVYB 2P67A 2Z4EA 3RK2D 1IC2A 3HRNA 3LIDA 5CCGA 1URQC 1LTSC 3H32B 2LKMA 2WSEH 4WY4D 1M1JA 1H8AA 3I5CA 3V2NA 1RF1B 1FBMA 1JUNA 1GW4A 1IFDA 3MUDA 4W80A 4XE5B 3B5ND 1IK9A 2FYZA 1FJKA 3CI9A 5KTBA 1WRGA 2WSFH 1URQD 5KJ7C 4LGDE 2NPSB 2R3CA 1XTCC 1LTBC 2HLOA 1LTGC 5CCHA 1LWUB 1VPCA 3P8CD 4B86A 3RK2B 1EQ7A 1SFCC 5AW4B 2QM7A 2H8PD 1HGVA 1LTIC 4Y99C 1L4AA 3A5TA 5KJ7D 1NWQA 4WY4B 4I1LA 3KYQA 3RL0C 1G2CB 1ZLLA 4EOTA 4AQRD 3BASA 1X9VA 2YNYA 3EQ2A 3H6PA 1GDTA 4JYCA 3L4FA 2FXMA 2Z5IA 3B5NB 1HGZA 1AFOA 1GL2D 1ZR2A 1SFCD 5CHXA 1GW3A 2KLVA 3G3ZA 2N1TA 4EIJA 1S9KD 1MUUA 3HD7A 3BATA 2ZXEB 1IFMA 5CJ4A 3N4XA 2FFDB 3M0AA 2WPQA 3VYIA 2R5DA 2IX7C 2WPRA 1QL2A 3IR9A 2OYIB 1N7SC 4C7NB 1RF0C 1CI6A 4DOJA 2IFNA 2YKOA 3E1IA 2P2UA 3P32A 1RF1C 1AQ5A 1HBWA 2KOGA 5CMZA 1J1DB 2Q7CA 2OYHA 1RY3A 4GKGA 3OJAB 1GL2B 3LW5H 1IFJA 1J1EB 2M3BA 2NPSC 1SP4A 2CPSA 1N73A 3OAKA 5AVTB 2IPPA 2A45H 4N3YB 2JJLA 1NHLA 1MFZA 3P7KA 2A45G 1LWUC 1SVFA 1LTAC 5AW0B 3RK2C 3M06A 1SQXK 3MGNA 1SQVK 4O9BA 1T3JA 1HUCA 2NPSD 1CSBA 4WY4C 2O01H 1NTMK 2HODA 3KPEA 1NKNA 1PFIA 1FJPA 3B5NC 1Z56A 3NMDA 4C46A 5BVZA 3L37A 1KILD 3U1AA 1L0LK 2O1KA 3HUSB 1NTKK 1HWTC 1RE3A 3MD0A 3TYYA 3TNUB 3BRVB 3SWYA 1NAFA 1E5WA 4IFMA 2WPSA 1A02F 2HYNA 2WT7A 1SQQK 2HPCA 2FFDC 1DH3A 2POHA 3HTKA 1GD2E 1JTHB 1CI6B 1G1IA 1URQA 3HE5A 4IFDK 1FZAA 2QM8A 3L36A 2OYIC 3V2QA 1ZV8A 2WITA 1M7LA 1T8ZA 4W7YA 4GIFA 3IFMA 2YKQA 1J1DC 5CCGD 2E42A 1JY3N 1MZ9A 2VRSA 3CLQA 2YO3A 3KDPB 4XA4A 1GL2C 2J58A 1KILB 1J1EC 1HJBA 5KJ7A 2YMYA 1JY3O 1LT9B 2FYUK 3NTNA 3O8ZA 1WT6A 3U1CA 4LLHA 2R5BA 4AUWA 2YKPA 3GHGB 4HYTB 3HE4B 3V5BA 1HTLC 3V2RA 3V4WA 3VP8A 3NXSA 1FOSE 3TK1A 1KFNA 1FZCA 4DZOA 5AW7B 2XKMA 3CL3D 5CCHD 1NTZK 2CPBA 2GM4A 5AVQB 2XU6A 5AW6B 3V2PA 2WTYA 1H89A 3SWFA 2XV5A 1L4AD 3HUSC 3M9BA 1FDMA 1M1JB 2W6AA 5AVUB 2H7HA 1DEBA 1MV8A 3HTKB 1IFIA 3VTPC 1NH4A 4LC1A 3L35A 1SQPK 5APUA 3LIEA 2N1TD 1NKZB 3H32A 3EFGA 3UIAA 3TSIA 2BASA 1X79B 1N7LA 5AW8B 3HD7D 1N7SA 1RF0A 1W2EA 5APYA 1RF1A 4I2LC 3WMM0 3A3YB 4JYBA 3RK3D 2Q5UA 1JMMA 3OA7A 2C9NY 1FU1A 1SQBK 2I1JA 1T2KD 3M9HA 4I6MC 1KILC 3BRTB 1L4AB 4OH8B 1LTTC 1LTJA 2NPSA 1YYCA 1LT9C 2A45I 1N86A 1LWUA 1JY2N 1RE4C 1LGHB 3GHGC 2P7JA 1GK4A 1FZCB 3VN0A 2N1TB 2GUVA 1GTWA 5AW3B 1JY2O 3VMZA 4WY4A 3HD7B 2P1JA 1G2CA 3A2AA 1FZFA 2FKWB 2GUSA 4M3LA 2C0XA 4ZKUA 3M0DA 2N9BA 3B5NA 5CCGC 2YO2A 3RK3B 1IJDB 2Q3IA 3KQGA 2WZ7A 1NU1K 1M1JC 2IFMA 2C9LY 3R2PA 2E43A 1GU5A 2OYHB 3NFQA 4JF7A 1DX7A 1NO4A 2W27A 2FFDA 4KHXA 1KZUB 2C0WA 1CW5A 1N7SB 1FZGA 1J2JB 1HVVA 1OWAA 1JY3P 1N2DC 2OYIA 2R32A 1N73B 4C7NA 1T3UA 1IO4A 4ZKPA 1FOSF 5CCHC 3VOPA 1VDFA 3N7NA 2XZRA 1LTJB 1GL2A 1XTGB 1SFCA 5APSA 1L4AC 4GT1A 3BVHA 2PAJA 4W7ZA 4HH2A 2J59M 2HODB 3A7OA 2PP6A 2WSCH 3P8CE 4AYCA 4C7RA 1G1JA 3P8MC 5AVWB 5AVXB 1NOHA 1IFNA 1FZCC 2KB7P 3U59A 1OXZA 4IFFA 3VMXA 1FZBA 2N1TC 1FAVA 5AVVB 1FZEA 5KLVK 5AVSB 1JCDA 3B8EB 2O1JA 2KSJA 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L K;  1NTK K;  2OAR A;  1SQB K;  1SQX K;  2LKM A;  3G3Z A;  1SQV K;  2J59 M;  2WSE H;  3CLQ A;  1SQP K;  2WSC H;  1NTZ K;  1SQQ K;  1L0N K;  2FYU K;  3M9Q A;  3LW5 H;  2O01 H;  1NTM K;  1NU1 K;  4IFD K;  5KLV K;  2WSF H; 
#chains in the Genus database with same CATH topology
 2OAR A;  2B87 A;  3RK3 C;  1KYO I;  4EI2 A;  1EZV E;  3HE5 B;  1L0N K;  4D6T E;  2JEE A;  3M91 A;  2OYH C;  2Q9I A;  5APW A;  4QMA A;  3MTU E;  5APX A;  1JO5 A;  1KFM A;  5AVZ B;  4R4L A;  1YTZ I;  3MIW A;  3GF3 A;  1NTZ D;  1SLQ A;  1X8Y A;  2HFE D;  5APT A;  2Z5H A;  4RKU J;  5KLV D;  4IOI H;  1K05 A;  5AW2 B;  3FWN A;  3A0B H;  4WB4 A;  1KIL A;  1VQN P;  1PP9 J;  2QSI A;  3L72 E;  4JPZ B;  3RL0 B;  2IBZ D;  2BCC J;  3HE4 A;  1GK6 A;  1P84 D;  2W8Z A;  1LJ2 A;  1FE6 A;  1KQL A;  3H1L J;  3CX5 D;  5AW5 B;  5B66 E;  5AVY B;  2P67 A;  2Z4E A;  1IC2 A;  1SQB D;  3LID A;  5CCG A;  2OYO A;  4NPD A;  1LTS C;  1VQ4 P;  1M1J A;  3O6Q A;  1PV3 A;  5GTI E;  4W80 A;  3PJS K;  3Q5P A;  1IK9 A;  4RJT A;  2FYZ A;  3CI9 A;  1WRG A;  2WSF H;  1BDC A;  2NPS B;  2R3C A;  1XTC C;  2D2C D;  2WSF J;  2R3S A;  1LTG C;  5CCH A;  2JWD A;  4U3F D;  3RK2 B;  5KAF H;  1SFC C;  1KQF B;  1VQ7 P;  1LTI C;  2ITA A;  3A5T A;  2E74 B;  3CXH D;  4WWI A;  1G2C B;  1VQ9 P;  3Q3D A;  2RN0 A;  3EQ2 A;  2IBZ I;  4UB8 H;  1HGZ A;  1EZV D;  1X22 A;  1M90 Q;  3AE1 C;  2QEX P;  1P84 I;  2G3A A;  4D6T D;  3CX5 I;  5CJ4 A;  3G9R A;  2AEF A;  2Y9Z A;  2IX7 C;  3IR9 A;  2OYI B;  1N7S C;  2E5Y A;  2ZAE B;  2IFN A;  3CC4 P;  1M8O B;  2KS1 A;  1Y8A A;  1MKM A;  1YHQ P;  3E7K A;  3OJA B;  1GL2 B;  3LW5 H;  2QA4 P;  2CPS A;  2JP3 A;  3L72 D;  3LW5 J;  3P7K A;  2WVR A;  1FDI A;  2A45 G;  1PPJ D;  1LTA C;  1NTM J;  3L73 G;  3RK3 E;  3MGN A;  1RQV A;  4YXW H;  1OMI A;  2B88 A;  3K5B A;  1HUC A;  1S72 P;  2NPS D;  1KV4 A;  4WY4 C;  4H44 B;  2HOD A;  4GDO A;  1OVU A;  3B71 A;  3B5N C;  5BVZ A;  3HUS B;  2QJK B;  1NAF A;  1E5W A;  2E74 D;  2Q1K A;  2WPS A;  1A02 F;  3WUU A;  2POH A;  1GD2 E;  4A7P A;  3H1I J;  3HE5 A;  3KHU A;  3AEF C;  3AEG C;  4W7Y A;  2YKQ A;  1J1D C;  4XA4 A;  3L75 G;  4OVN F;  2J58 A;  2YIU C;  4H13 B;  4LLH A;  2R5B A;  1NVO A;  3MHV A;  1L0L E;  1HTL C;  1U7J A;  3NXS A;  1YJW P;  4OGQ D;  1FZC A;  3A0H E;  3AE8 C;  3CL3 D;  4UB6 H;  1KD1 Q;  3TGU E;  2KSE A;  1NTZ K;  4BWN A;  2CPB A;  3WU2 H;  1SQP G;  2JKV A;  1IFP A;  3H1H G;  1L4A D;  3M9B A;  3RBX A;  1S3J A;  2Q6Q A;  2E75 C;  3L70 J;  1DEB A;  2E76 B;  1MV8 A;  1SQP K;  3LIE A;  2K88 A;  2FYU E;  1N7L A;  1SQX J;  2FYN C;  1RF0 A;  5C39 A;  1SQV J;  1YJN P;  1EDJ A;  3RK3 D;  1S5L H;  3AE6 C;  3OA7 A;  2C9N Y;  1SQB K;  3M9H A;  3L71 J;  4I6M C;  1QVG O;  1LTT C;  1NTK G;  1ZRT E;  1LTJ A;  2NPS A;  3H1K E;  1YYC A;  2W6J H;  3GW6 A;  1N86 A;  5M1B A;  1VF5 B;  1JY2 N;  2BEZ F;  2P7J A;  3Q5R A;  3VN0 A;  1NU1 J;  2B89 A;  4H13 D;  3SWK A;  1G2C A;  1FZF A;  2GUS A;  4ZKU A;  2N9B A;  2YO2 A;  3KQG A;  3USS A;  1X0T A;  2JDI H;  3BCC G;  3FX0 A;  1KQG B;  1DX7 A;  3NFQ A;  4DJG A;  2YXQ B;  2C0W A;  4PD4 H;  1N7S B;  1QLE D;  1N2D C;  2OYI A;  4ZKP A;  4ZMD A;  3VOP A;  4PD4 I;  2E76 D;  2XZR A;  1GL2 A;  4YXD C;  2PAJ A;  4YTP C;  2PP6 A;  2W83 C;  1PP9 E;  3P8C E;  3A0B E;  2ZJS E;  1K04 A;  3CWB G;  1RQU A;  2J5U A;  1FZC C;  1EC5 A;  1OXZ A;  4IFF A;  1FZB A;  2BCC E;  2N1T C;  3KZI H;  3G6E P;  2O1J A;  3L70 G;  3IN6 A;  3HD7 C;  1K8A Q;  2RMZ A;  1VF5 D;  1PIX A;  5AW1 B;  1BGY J;  3QWO C;  1OVV A;  1H88 A;  1JCC A;  3KXD A;  1VQL P;  3HUS A;  2FYU D;  3VMY A;  1BE3 G;  1GU4 A;  3RGU A;  5AW9 B;  2N9Y B;  4GOF A;  2XND H;  3MP7 B;  1S9K E;  2KP8 A;  1UII A;  1CZQ A;  3AEA C;  3FXD A;  1EDL A;  5KKZ B;  3W67 A;  1ZRT D;  3H1K D;  5BU5 A;  1N73 C;  1QVF O;  5CJ0 A;  4I7Z C;  3D70 A;  1JOC A;  1VQ6 P;  1LTJ C;  3VP9 A;  1JNM A;  1HF9 A;  1N7S D;  1PGJ A;  3FXE A;  4L73 A;  3WUT A;  2W6B A;  5AVR B;  1UIX A;  2OTK E;  1BCC J;  5TIS H;  3L74 E;  3PHL A;  4UB8 E;  2KI7 B;  1URQ C;  2KZJ A;  4WY4 D;  4NPF X;  3OW2 O;  3C1L A;  1H8A A;  3V2N A;  1FBM A;  1SS1 A;  1GW4 A;  2O3J A;  3B5N D;  2QJP B;  5KTB A;  1PGO A;  3H25 A;  1USE A;  1BSH A;  1W5C E;  5KJ7 C;  3B4S A;  2A06 G;  1S4X A;  1LTB C;  1LWU B;  1R5S A;  1PP9 D;  3P8C D;  1EQ7 A;  5AW4 B;  1GMJ A;  2BCC D;  4Y99 C;  4I1L A;  3KYQ A;  3H1L D;  3PRJ A;  1L0N G;  4EOT A;  3BAS A;  3H6P A;  3L4F A;  2Z5I A;  1GW3 A;  4ZNC A;  4IL6 H;  1S9K D;  1IFM A;  2D2C B;  1KTM A;  5H2F H;  3N4X A;  2FFD B;  1QX8 A;  1K9M Q;  3CCR P;  2R5D A;  1CI6 A;  4DOJ A;  3I55 P;  3E1I A;  1S1C X;  2ZT9 C;  1RF1 C;  5CMZ A;  4TT3 H;  5E79 H;  1AVY A;  3JC2 2;  2E75 D;  1J1E B;  2M3B A;  4ASV A;  1SP4 A;  2A45 H;  1SVF A;  2ZYA A;  1L2P A;  2KNC B;  5CBN A;  1YI2 P;  3AEB C;  1L0L G;  1PPJ E;  4O9B A;  2ZYG A;  3L73 J;  1T3J A;  2H89 C;  1BCC G;  3L74 D;  1CSB A;  1LNQ A;  2O01 H;  3TGU G;  2M5A B;  3H1J G;  1SQQ G;  1PGQ A;  2QJY C;  1N8R Q;  2O01 J;  3L37 A;  3Q2Y A;  1L0L K;  2O1K A;  3D71 A;  1HWT C;  1RE3 A;  2YXR B;  4UB6 E;  3TNU B;  3AE3 C;  1IK7 A;  4IFM A;  3WU2 E;  1YQ3 C;  1SQQ K;  2AEM A;  1JTH B;  3FGA D;  1Q7Y Q;  2QM8 A;  1OX3 A;  1ZV8 A;  2K37 A;  2QIW A;  2KLU A;  1SQX E;  1SQV E;  2K3R A;  1MZ9 A;  4ASW A;  1NTM D;  1FC2 C;  1HJB A;  2M3E A;  3L75 J;  1JY3 O;  1LT9 B;  2FYU K;  3O8Z A;  2L91 A;  1VQM P;  3U1C A;  3L71 E;  1S5L E;  4AUW A;  1YJ9 P;  3GHG B;  2DW3 A;  3V5B A;  3V2R A;  3V4W A;  1DIP A;  1JMB A;  1KFN A;  3C8V A;  5AW7 B;  1DEE G;  1NU1 E;  4EYY Q;  1H89 A;  3SWF A;  2R44 A;  1SQP J;  1JEK A;  3H1H J;  4BXL A;  1LP1 B;  4HKZ H;  3WUV A;  3H1I D;  2ZXX A;  3JCU H;  5EFW B;  1ZXG A;  3HTK B;  1IFI A;  3VTP C;  1NH4 A;  4LC1 A;  2N1T D;  5AW8 B;  3HD7 D;  1W2E A;  4OGQ B;  5KLI B;  3SSU A;  4DT0 A;  5APY A;  3A3Y B;  4PD4 E;  1W2B O;  2HR3 A;  2KK7 A;  1M57 D;  1KIL C;  3BRT B;  1L4A B;  3CCQ P;  1VL2 A;  4PV1 C;  1NTK J;  1LWU A;  4OWF A;  1LGH B;  2OTL P;  1GK4 A;  3GLM A;  2IDB A;  1VQP P;  2B9B A;  1GTW A;  3VMZ A;  5DJU B;  2P1J A;  4KJM A;  2ZVO B;  4BRY B;  4WVZ A;  1EDK A;  5CCG C;  3RK3 B;  3KZI E;  2QRX A;  4K35 A;  1BGY E;  1M1J C;  1AA0 A;  2C9L Y;  3CCE P;  3D6Z A;  1SQX D;  2OYH B;  1SQV D;  1ZW0 A;  3BCC J;  2FFD A;  1DD4 A;  1JY3 P;  1QGK B;  1QEX A;  3L71 D;  5CCH C;  1AVO A;  1VDF A;  1NTZ G;  1XTG B;  5KLV G;  4GT1 A;  1PL5 A;  2AEJ A;  2IYO A;  1NU1 D;  4AYC A;  2KNC A;  5AVX B;  2IBZ G;  3VMX A;  3CWB J;  4H0L C;  3AEE C;  5AVV B;  5KLV K;  1Q86 Q;  1JCD A;  3B8E B;  2KSJ A;  1GZL A;  2RH0 A;  2WT7 B;  2M5A A;  3C9I A;  2L5G B;  2MJZ A;  2XNX A;  4WBA A;  5TIS E;  1SQB G;  3TNU A;  5DJT B;  1BE3 J;  2XDJ A;  4N6J A;  4PD4 D;  2HG5 D;  1JTH A;  4MN4 C;  2ZFC A;  4N78 D;  1WMK A;  5APQ A;  1SFC B;  1HH0 A;  4U3F G;  5GTH H;  3II6 A;  2KZI A;  5CBO A;  3V4Q A;  1YBK A;  3EFF K;  2ZT9 D;  3S1K A;  1U7M A;  1LT9 A;  1ZOY C;  2I1K A;  2OGU A;  1OW7 A;  1RE4 A;  3GHG A;  2NRG A;  1BGY D;  1NYH A;  1YQ4 C;  1EZV G;  2NZ2 A;  2V7Q H;  4D6T G;  2V7Q J;  1KB9 H;  3AED C;  1KIL E;  1ZME C;  3H32 B;  3F89 A;  2LKM A;  4IL6 E;  2WSE H;  1OIP A;  3I5C A;  5H2F E;  1JUN A;  1KQS O;  1IFD A;  3MUD A;  2WSE J;  4XE5 B;  2LR2 A;  3IAO A;  2ZYD A;  3W68 A;  2HLO A;  4U7J A;  1VPC A;  3L72 G;  1YIJ P;  2H8P D;  1PPJ G;  1H0T B;  1L4A A;  1NWQ A;  4WY4 B;  3L73 E;  3RL0 C;  3VMA A;  1X9V A;  1AV1 A;  1GDT A;  1L0N J;  3H1L E;  2FXM A;  3B5N B;  1ZR2 A;  1SFC D;  4EIJ A;  1PZQ A;  2ZXE B;  3S9O A;  1S5L X;  3VYI A;  2WPR A;  3QH9 A;  1RF0 C;  2I8D A;  1J1D B;  2Q7C A;  2OYH A;  1RY3 A;  1OZH A;  2ZVN B;  1R8E A;  1JB0 J;  2NPS C;  2YIU B;  3MZW B;  5AVT B;  1IZN B;  3F5H A;  1NHL A;  5AW0 B;  3RK2 C;  3M06 A;  1SQX K;  5KAF E;  3CC2 P;  1SQV K;  1L0L J;  2E74 C;  3A0H H;  1M56 D;  3CCV P;  1S2E A;  2OTJ P;  2Y0D A;  3KPE A;  3NMD A;  3TGU J;  3H1J J;  1SQQ J;  1KIL D;  3U1A A;  4PV1 D;  3SWY A;  2E75 B;  4YPC A;  3E1R A;  2WT7 A;  3I56 P;  1DH3 A;  3CCJ P;  3T97 B;  2OYI C;  2LXB A;  3JCU E;  2FYN B;  3MUD C;  3V2Q A;  2WIT A;  1M7L A;  4Y28 J;  1T8Z A;  2FYU J;  3IFM A;  5CCG D;  1OW6 A;  1KC8 Q;  3CLQ A;  2YO3 A;  1GL2 C;  3SFE C;  3AE2 C;  1NTM E;  3L73 D;  3NTN A;  1WT6 A;  4PJ0 H;  1NTK E;  3TK1 A;  4DZO A;  1YIT P;  5CCH D;  2UWJ E;  4H44 C;  2SPZ A;  2XU6 A;  5AW6 B;  3V2P A;  2WTY A;  1KYO H;  2XV5 A;  4RO0 A;  3HUS C;  1FDM A;  1VQ5 P;  2QJK C;  2H7H A;  2K9J B;  3H1I E;  3L35 A;  4NPE A;  2KIK A;  2PRR A;  3EWK A;  4H0L D;  5B5E H;  3H32 A;  3EFG A;  3UIA A;  2BAS A;  3BCC E;  1X79 B;  1N7S A;  5TJH A;  2GA1 A;  1E79 H;  3L75 D;  4JYB A;  2Q5U A;  1JMM A;  1FU1 A;  4OH8 B;  1VQO P;  4H13 C;  2A45 I;  3Q5S A;  1FDO A;  1HJ0 A;  2KUB A;  1KN7 A;  4Z1M H;  1RHZ B;  1FZC B;  1H0T A;  2N1T B;  2H88 C;  1JY2 O;  1SQP D;  1R5L A;  4WY4 A;  3HD7 B;  2PGD A;  3CWB E;  4CPG A;  3H1H D;  3A2A A;  1Q90 D;  4M3L A;  1T6A A;  3M0D A;  2JWA A;  5K5G B;  3B5N A;  1IJD B;  3RL0 g;  2Q3I A;  3L70 E;  3CME P;  2WZ7 A;  2E43 A;  2FYU G;  2E76 C;  1GU5 A;  4JF7 A;  1BE3 E;  2W27 A;  4KHX A;  3ZDM A;  1FZG A;  1J2J B;  1HVV A;  2FXO A;  4L75 A;  1VQK P;  2R32 A;  1N73 B;  1FOS F;  4I7Z B;  3H1K G;  1NTK D;  5KAI H;  1M1K Q;  3CD6 P;  1LTJ B;  1NAY A;  2BEQ D;  1NTZ J;  2AXT H;  5APS A;  4W7Z A;  4HH2 A;  5KLV J;  2J59 M;  1KOR A;  4IL6 X;  1VF5 C;  3A7O A;  3AE7 C;  2KXP B;  4C7R A;  2OQQ A;  1G1J A;  5GTH E;  3P8M C;  1NOH A;  1IFN A;  3TF5 A;  1FAV A;  1P84 H;  1FZE A;  5AVS B;  2AXC A;  4XFJ A;  2WQY C;  1JM0 A;  3CX5 H;  3PP5 A;  3L74 J;  2HPC B;  5APV A;  1URQ B;  1VQ8 P;  3TDK A;  1T2K C;  3BCC D;  5BU8 B;  3RL0 D;  1SQB J;  1MFT A;  2H43 A;  2KYV A;  2W90 A;  1KB9 E;  1FS0 E;  3T97 A;  2QG4 A;  1D7M A;  1BSN A;  2QVA A;  1A02 J;  1QL1 A;  1ZR4 A;  4RES B;  2FXP A;  4N78 E;  2WWW A;  2A06 E;  1JY2 P;  1PP9 G;  4Y99 B;  4U3F J;  3ABV C;  3CWB D;  3S4R A;  2BCC G;  3G71 P;  2M8R A;  2G8Y A;  3CXH H;  3H1L G;  3JSV C;  3L70 D;  3PH0 A;  1RE3 C;  1ZN5 A;  1L0N E;  4JBZ A;  3D6Y A;  3CXH I;  1YTZ T;  3M9Q A;  4GOE A;  3M0D C;  4HJG H;  3RK2 D;  2O01 N;  1BE3 D;  3HRN A;  1EZV I;  4D6T J;  2Y0E A;  3R4Y A;  3V6I A;  2ZT9 B;  3CCU P;  4L74 A;  1RF1 B;  2K9J A;  3FWL A;  4JQ0 D;  5KKZ C;  1FJK A;  1URQ D;  4LGD E;  2P10 A;  2RKL A;  4R4M A;  4B86 A;  1PGP A;  2QM7 A;  1U57 A;  2P58 A;  3L72 J;  1HGV A;  1TU3 F;  5KJ7 D;  1ZLL A;  1AQT A;  4AQR D;  5B66 H;  2YNY A;  3AE5 C;  2QE7 H;  3L74 G;  2QJY B;  4JYC A;  1Q82 Q;  1NJI Q;  1BCC E;  1AFO A;  1GL2 D;  5CHX A;  2KLV A;  3G3Z A;  1BDD A;  2N1T A;  3H1J E;  1SQQ E;  1MUU A;  3HD7 A;  3BAT A;  4KT0 J;  1KB9 D;  3CMA P;  5GTI H;  2IYP A;  3M0A A;  2WPQ A;  3PTZ A;  1DD3 A;  1QL2 A;  3SFD C;  4C7N B;  3IF4 A;  4H44 D;  2YKO A;  2P2U A;  3P32 A;  1AQ5 A;  1HBW A;  2KOG A;  2QJP C;  2A06 D;  4GKG A;  1IFJ A;  1N73 A;  4DCK A;  3OAK A;  1NTM G;  2IPP A;  4N3Y B;  2JJL A;  1MFZ A;  1LWU C;  2WPV B;  2WMM A;  1Y9B A;  3CCM P;  1L0N D;  4K3A A;  3CPW O;  1EDI A;  4PJ0 E;  3GF7 A;  1NTM K;  1NKN A;  1PFI A;  1FJP A;  2B87 B;  1Z56 A;  4C46 A;  1NTK K;  3MD0 A;  3TYY A;  3BRV B;  2HYN A;  1LP1 A;  2D2C C;  1KYO E;  1EXJ A;  3H1I G;  3CCS P;  2HPC A;  2FFD C;  2FY8 A;  3HTK A;  1KB9 I;  1KMI Z;  1OFC X;  2JR8 A;  1CI6 B;  1G1I A;  1URQ A;  1USD A;  4IFD K;  1FZA A;  3L36 A;  3Q1M A;  4GIF A;  1AJY A;  5B5E E;  1JY3 N;  2E42 A;  2VRS A;  1ZP0 C;  3ITK A;  3KDP B;  2MKV A;  5E79 E;  1KIL B;  4HB1 A;  1J1E C;  2M0B A;  5KJ7 A;  2YMY A;  4PV1 B;  1L0L D;  1Y47 A;  3GMA A;  2YKP A;  2WSS H;  1BCC D;  4HYT B;  3HE4 B;  3VP8 A;  1FOS E;  1LT1 A;  3TGU D;  3H1J D;  1K73 Q;  1SQQ D;  2V4H A;  2XKM A;  3AEC C;  1Q81 Q;  2LXC B;  2Y0C A;  3PLN A;  2GM4 A;  5AVQ B;  2CK3 H;  4BRY A;  1M1J B;  2W6A A;  3O6Q B;  5AVU B;  1OW8 A;  5APU A;  1RH5 B;  2E5T A;  1SQX G;  1NKZ B;  1SQV G;  3TSI A;  1RF1 A;  4I2L C;  1NGM B;  3WMM 0;  3L71 G;  1OVR A;  3L75 E;  2I1J A;  1T2K D;  2K9Y A;  3CCL P;  1LT9 C;  1NTZ E;  1Q2N A;  5KAI E;  4TLF A;  4L76 A;  1RE4 C;  3GHG C;  5KLV E;  2AXT E;  2IZ1 A;  2Y9Y A;  1NU1 G;  4H0L B;  2GUV A;  5AW3 B;  2IBZ E;  1SQP E;  1KYO D;  2FKW B;  2C0X A;  2Q3E A;  3H1H E;  1P84 E;  5L8R J;  2JO1 A;  1NU1 K;  3CX5 E;  3CC7 P;  2IFM A;  3R2P A;  2KS1 B;  1SQB E;  1NO4 A;  2YMK A;  2FBW C;  1KZU B;  3RBZ A;  1CW5 A;  3G4S P;  1OWA A;  3GG2 A;  4C7N A;  3AE9 C;  4OGQ C;  5KLI C;  1T3U A;  1IO4 A;  1EXI A;  3N7N A;  4EDF A;  3H1K J;  2IZ0 A;  1SFC A;  1L4A C;  3BVH A;  2K1A A;  2HOD B;  3AE4 C;  4U3F E;  2WSC H;  5AVW B;  2KB7 P;  3U59 A;  2WSC J;  2PFX A;  3CXH E;  4GOD A;  1BGY G; 
#chains in the Genus database with same CATH homology
 1GZL A;  3PP5 A;  2OAR A;  2WT7 B;  3C9I A;  5AW1 B;  2L5G B;  2MJZ A;  1H88 A;  2XNX A;  2HPC B;  3RK3 C;  1JCC A;  4WBA A;  5APV A;  3HUS A;  1URQ B;  3HE5 B;  3VMY A;  1T2K C;  1GU4 A;  3TNU A;  5BU8 B;  3RL0 D;  1L0N K;  5AW9 B;  1S9K E;  2XDJ A;  2H43 A;  2JEE A;  2KP8 A;  2KYV A;  4N6J A;  1CZQ A;  3M91 A;  2OYH C;  2Q9I A;  5APW A;  2HG5 D;  3MTU E;  5APX A;  1JO5 A;  1KFM A;  5AVZ B;  1JTH A;  3T97 A;  1YTZ I;  5BU5 A;  1N73 C;  3MIW A;  2ZFC A;  4N78 D;  1SLQ A;  1A02 J;  1QL1 A;  5CJ0 A;  1X8Y A;  2HFE D;  1ZR4 A;  4RES B;  5APT A;  2Z5H A;  4N78 E;  2WWW A;  5APQ A;  1JOC A;  1SFC B;  5AW2 B;  1LTJ C;  3VP9 A;  1HH0 A;  1JY2 P;  1JNM A;  3II6 A;  1N7S D;  4WB4 A;  1KIL A;  4Y99 B;  3V4Q A;  1LT9 A;  3RL0 B;  2M8R A;  2I1K A;  2W6B A;  1RE4 A;  3GHG A;  5AVR B;  3HE4 A;  1GK6 A;  1KQL A;  1RE3 C;  1ZN5 A;  1YTZ T;  3M9Q A;  5AW5 B;  3M0D C;  5AVY B;  2P67 A;  2Z4E A;  3RK2 D;  1IC2 A;  3HRN A;  3LID A;  5CCG A;  1URQ C;  1LTS C;  3H32 B;  2LKM A;  2WSE H;  4WY4 D;  1M1J A;  1H8A A;  3I5C A;  3V2N A;  1RF1 B;  1FBM A;  1JUN A;  1GW4 A;  1IFD A;  3MUD A;  4W80 A;  4XE5 B;  3B5N D;  1IK9 A;  2FYZ A;  1FJK A;  3CI9 A;  5KTB A;  1WRG A;  2WSF H;  1URQ D;  5KJ7 C;  4LGD E;  2NPS B;  2R3C A;  1XTC C;  1LTB C;  2HLO A;  1LTG C;  5CCH A;  1LWU B;  1VPC A;  3P8C D;  4B86 A;  3RK2 B;  1EQ7 A;  1SFC C;  5AW4 B;  2QM7 A;  2H8P D;  1HGV A;  1LTI C;  4Y99 C;  1L4A A;  3A5T A;  5KJ7 D;  1NWQ A;  4WY4 B;  4I1L A;  3KYQ A;  3RL0 C;  1G2C B;  1ZLL A;  4EOT A;  4AQR D;  3BAS A;  1X9V A;  2YNY A;  3EQ2 A;  3H6P A;  1GDT A;  4JYC A;  3L4F A;  2FXM A;  2Z5I A;  3B5N B;  1HGZ A;  1AFO A;  1GL2 D;  1ZR2 A;  1SFC D;  5CHX A;  1GW3 A;  2KLV A;  3G3Z A;  2N1T A;  4EIJ A;  1S9K D;  1MUU A;  3HD7 A;  3BAT A;  2ZXE B;  1IFM A;  5CJ4 A;  3N4X A;  2FFD B;  3M0A A;  2WPQ A;  3VYI A;  2R5D A;  2IX7 C;  2WPR A;  1QL2 A;  3IR9 A;  2OYI B;  1N7S C;  4C7N B;  1RF0 C;  1CI6 A;  4DOJ A;  2IFN A;  2YKO A;  3E1I A;  2P2U A;  3P32 A;  1RF1 C;  1AQ5 A;  1HBW A;  2KOG A;  5CMZ A;  1J1D B;  2Q7C A;  2OYH A;  1RY3 A;  4GKG A;  3OJA B;  1GL2 B;  3LW5 H;  1IFJ A;  1J1E B;  2M3B A;  2NPS C;  1SP4 A;  2CPS A;  1N73 A;  3OAK A;  5AVT B;  2IPP A;  2A45 H;  4N3Y B;  2JJL A;  1NHL A;  1MFZ A;  3P7K A;  2A45 G;  1LWU C;  1SVF A;  1LTA C;  5AW0 B;  3RK2 C;  3M06 A;  1SQX K;  3MGN A;  1SQV K;  4O9B A;  1T3J A;  1HUC A;  2NPS D;  1CSB A;  4WY4 C;  2O01 H;  1NTM K;  2HOD A;  3KPE A;  1NKN A;  1PFI A;  1FJP A;  3B5N C;  1Z56 A;  3NMD A;  4C46 A;  5BVZ A;  3L37 A;  1KIL D;  3U1A A;  1L0L K;  2O1K A;  3HUS B;  1NTK K;  1HWT C;  1RE3 A;  3MD0 A;  3TYY A;  3TNU B;  3BRV B;  3SWY A;  1NAF A;  1E5W A;  4IFM A;  2WPS A;  1A02 F;  2HYN A;  2WT7 A;  1SQQ K;  2HPC A;  2FFD C;  1DH3 A;  2POH A;  3HTK A;  1GD2 E;  1JTH B;  1CI6 B;  1G1I A;  1URQ A;  3HE5 A;  4IFD K;  1FZA A;  2QM8 A;  3L36 A;  2OYI C;  3V2Q A;  1ZV8 A;  2WIT A;  1M7L A;  1T8Z A;  4W7Y A;  4GIF A;  3IFM A;  2YKQ A;  1J1D C;  5CCG D;  2E42 A;  1JY3 N;  1MZ9 A;  2VRS A;  3CLQ A;  2YO3 A;  3KDP B;  4XA4 A;  1GL2 C;  2J58 A;  1KIL B;  1J1E C;  1HJB A;  5KJ7 A;  2YMY A;  1JY3 O;  1LT9 B;  2FYU K;  3NTN A;  3O8Z A;  1WT6 A;  3U1C A;  4LLH A;  2R5B A;  4AUW A;  2YKP A;  3GHG B;  4HYT B;  3HE4 B;  3V5B A;  1HTL C;  3V2R A;  3V4W A;  3VP8 A;  3NXS A;  1FOS E;  3TK1 A;  1KFN A;  1FZC A;  4DZO A;  5AW7 B;  2XKM A;  3CL3 D;  5CCH D;  1NTZ K;  2CPB A;  2GM4 A;  5AVQ B;  2XU6 A;  5AW6 B;  3V2P A;  2WTY A;  1H89 A;  3SWF A;  2XV5 A;  1L4A D;  3HUS C;  3M9B A;  1FDM A;  1M1J B;  2W6A A;  5AVU B;  2H7H A;  1DEB A;  1MV8 A;  3HTK B;  1IFI A;  3VTP C;  1NH4 A;  4LC1 A;  3L35 A;  1SQP K;  5APU A;  3LIE A;  2N1T D;  1NKZ B;  3H32 A;  3EFG A;  3UIA A;  3TSI A;  2BAS A;  1X79 B;  1N7L A;  5AW8 B;  3HD7 D;  1N7S A;  1RF0 A;  1W2E A;  5APY A;  1RF1 A;  4I2L C;  3WMM 0;  3A3Y B;  4JYB A;  3RK3 D;  2Q5U A;  1JMM A;  3OA7 A;  2C9N Y;  1FU1 A;  1SQB K;  2I1J A;  1T2K D;  3M9H A;  4I6M C;  1KIL C;  3BRT B;  1L4A B;  4OH8 B;  1LTT C;  1LTJ A;  2NPS A;  1YYC A;  1LT9 C;  2A45 I;  1N86 A;  1LWU A;  1JY2 N;  1RE4 C;  1LGH B;  3GHG C;  2P7J A;  1GK4 A;  1FZC B;  3VN0 A;  2N1T B;  2GUV A;  1GTW A;  5AW3 B;  1JY2 O;  3VMZ A;  4WY4 A;  3HD7 B;  2P1J A;  1G2C A;  3A2A A;  1FZF A;  2FKW B;  2GUS A;  4M3L A;  2C0X A;  4ZKU A;  3M0D A;  2N9B A;  3B5N A;  5CCG C;  2YO2 A;  3RK3 B;  1IJD B;  2Q3I A;  3KQG A;  2WZ7 A;  1NU1 K;  1M1J C;  2IFM A;  2C9L Y;  3R2P A;  2E43 A;  1GU5 A;  2OYH B;  3NFQ A;  4JF7 A;  1DX7 A;  1NO4 A;  2W27 A;  2FFD A;  4KHX A;  1KZU B;  2C0W A;  1CW5 A;  1N7S B;  1FZG A;  1J2J B;  1HVV A;  1OWA A;  1JY3 P;  1N2D C;  2OYI A;  2R32 A;  1N73 B;  4C7N A;  1T3U A;  1IO4 A;  4ZKP A;  1FOS F;  5CCH C;  3VOP A;  1VDF A;  3N7N A;  2XZR A;  1LTJ B;  1GL2 A;  1XTG B;  1SFC A;  5APS A;  1L4A C;  4GT1 A;  3BVH A;  2PAJ A;  4W7Z A;  4HH2 A;  2J59 M;  2HOD B;  3A7O A;  2PP6 A;  2WSC H;  3P8C E;  4AYC A;  4C7R A;  1G1J A;  3P8M C;  5AVW B;  5AVX B;  1NOH A;  1IFN A;  1FZC C;  2KB7 P;  3U59 A;  1OXZ A;  4IFF A;  3VMX A;  1FZB A;  2N1T C;  1FAV A;  5AVV B;  1FZE A;  5KLV K;  5AVS B;  1JCD A;  3B8E B;  2O1J A;  2KSJ A;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...