1SQBK

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
52
structure length
52
Chain Sequence
LTRFLGPRYRQLARNWVPTAQLWGAVGAVGLVWATDSRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 14
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqbK00
2WSFH 1NTKK 2FYUK 1NTZK 3M9QA 2LKMA 2WSEH 3CLQA 3G3ZA 1SQQK 5KLVK 1NTMK 3LW5H 1SQXK 2O01H 1L0LK 4IFDK 1NU1K 1SQBK 2WSCH 1SQPK 1L0NK 1SQVK 2J59M 2OARA
chains in the Genus database with same CATH superfamily
1IFIA 4U3FE 2FYUJ 2ZT9D 2ZVNB 2IBZG 1VDFA 1T2KD 3L74J 1BGYG 1DD4A 1JTHB 2JEEA 3L75E 1EDIA 4TT3H 3MTUE 3L72E 4C46A 1MFTA 3M0AA 2IZ1A 3WUUA 2IYPA 3AE2C 4QMAA 1GW4A 5H2FE 1HWTC 1N7SA 3BRTB 3SWFA 2IZ0A 4PJ0E 3E1RA 2QEXP 1N73A 1FZCA 1OZHA 2WPRA 5APQA 1W2EA 2V4HA 1YYCA 3RL0B 2YO3A 2IYOA 1L4AC 4C7RA 1M1JC 5KAFE 4EDFA 1EZVI 1D7MA 1SFCC 2FYNC 1LNQA 2IFNA 2QM7A 3GHGB 3IFMA 3KYQA 1EZVG 4ZKUA 3PTZA 3BRVB 1Q2NA 3CWBG 1L0NG 3GW6A 1BSNA 1YTZT 1MZ9A 2YKQA 5C39A 2Z4EA 4WWIA 2HG5D 1KC8Q 3CX5H 3AE8C 4IFMA 2CK3H 2I1JA 1N8RQ 3BASA 2W27A 1KILB 1FDOA 1CZQA 1NTKJ 3L36A 3CC4P 3CI9A 2A06D 1W5CE 2QJYB 1LWUA 3H32B 3MD0A 1GDTA 1BCCD 3OW2O 1M7LA 2GUSA 2IBZI 1EDKA 3H1KG 3L70D 4RJTA 5CHXA 2QVAA 3EQ2A 3HE4B 3LW5J 1SS1A 1URQC 2R5BA 3AEEC 2DW3A 2FXMA 3GG2A 1FZEA 1EQ7A 2N1TB 3TNUA 4B86A 4H44B 1RF1A 2YKPA 3H1IJ 2AXTH 2XV5A 3L71G 4BRYB 1EXJA 4IFDK 1JTHA 1SLQA 1RF1C 1R8EA 1Q81Q 4LLHA 2M5AA 2J5UA 2P58A 3H1HE 1URQA 1QL2A 2JO1A 1L0NK 1WMKA 1L0NE 2NPSB 1G2CA 2VRSA 3H1HG 3A0BE 3U59A 4AYCA 1KB9D 1URQD 3BCCJ 1GL2B 4JYCA 4PD4E 4NPEA 2WSFJ 3I56P 2E5TA 2WMMA 3P8CE 4RKUJ 2ZT9C 1ZN5A 3JCUE 2BCCD 1NYHA 3RGUA 3V2QA 1E79H 3EFFK 2HFED 2QJYC 5GTIE 1S1CX 4GOEA 2H7HA 4HYTB 1KQFB 3CCEP 1FJPA 3CCJP 2KB7P 1N7SD 3L70G 3RBZA 2P2UA 5APYA 1CSBA 3OA7A 4IL6E 5H2FH 2Z5HA 1HGZA 1HJBA 1PV3A 3CCVP 5AVSB 3L72G 2E75D 1T6AA 1SFCD 5B5EH 1RF1B 3D70A 5AVQB 3CCUP 5E79E 2JR8A 2YIUC 3B5NC 1RE4C 1AJYA 5TJHA 5BU5A 1Y9BA 4D6TE 4L76A 3VMAA 1FZCC 2RMZA 1KYOH 3JCUH 2WT7B 1FDMA 1N86A 2PAJA 5AW5B 3S1KA 1SQBE 1VF5B 4UB8H 2WZ7A 2WTYA 1YQ4C 2FXPA 1PGPA 2RH0A 1VQOP 1YJWP 3AE5C 3SWKA 3PP5A 2OTKE 3TGUE 5CCGC 3H1LE 3NMDA 2D2CC 2HPCA 3RL0C 2N1TD 2MJZA 2JKVA 1NU1D 1ZRTD 1KQLA 4L75A 2OGUA 3L72J 2ZFCA 2Y9ZA 2E43A 2YXQB 1BGYJ 1JO5A 3A0HE 3MUDC 3AE1C 1FZFA 2O01H 1GK6A 2P10A 2Q3EA 2WSSH 2XU6A 1T3JA 1JMMA 1IFPA 3CWBE 1ZLLA 3IAOA 3L72D 1FOSF 3L70J 3IN6A 5CCHC 1VQ6P 2QE7H 2OYHB 1RE3C 5GTHE 1S72P 2KSEA 2WWWA 1PZQA 2A06E 3H1JG 3MGNA 1NTMG 4PV1B 5CJ4A 1X9VA 2PRRA 3FWNA 4N78E 1MKMA 3B71A 3FXEA 4LGDE 1YTZI 2GA1A 2H8PD 4L73A 3RBXA 2QJPB 1IK9A 1FS0E 2B88A 1VQ5P 2M8RA 2OYHC 5AW6B 3O8ZA 3VMXA 3MP7B 4GOFA 3Q2YA 2BCCG 1NTZJ 2NZ2A 4ASWA 5KAFH 2JJLA 2B87B 1SQQG 5APVA 5AVUB 1DD3A 3M06A 2QJPC 4U3FG 1KQSO 2WT7A 1X79B 2KNCA 3A2AA 3RK3D 1FZAA 3SFDC 1SQXG 1NH4A 5AVZB 2AEMA 1KILA 1SVFA 2JWDA 4R4MA 2E74D 5L8RJ 3U1AA 1FBMA 2G8YA 2Y9YA 3P8CD 5TISH 2ZJSE 3CCLP 5AW0B 3L4FA 1PPJG 2ZT9B 1L0ND 3G6EP 1WRGA 3JC22 4YXDC 2AXCA 1HVVA 1VPCA 3G9RA 2XZRA 4U3FD 2LXBA 3L75G 2Q7CA 3VMYA 1A02J 3USSA 4H13C 1K8AQ 1P84E 1X8YA 2AEFA 1IFNA 2WSFH 1NTKE 4NPDA 4OGQD 1JY2O 1NTZK 3RL0D 1FU1A 3VMZA 4EOTA 1DIPA 2B87A 1RF0C 1NKNA 4OGQB 2P1JA 1SQQK 2QRXA 1LP1B 3H1LG 5CCGA 1JB0J 4DCKA 3NTNA 1PL5A 3CWBD 2KNCB 4PV1D 1ZOYC 3V2RA 2HPCB 2QIWA 3GMAA 1ZP0C 3A0HH 4OGQC 2PP6A 1YJNP 4UB6H 1OFCX 4I7ZB 1VF5C 1NKZB 3B5NA 2ITAA 3Q5RA 2R44A 3IR9A 4HJGH 1NTKG 2BCCE 1OW8A 4O9BA 1QEXA 2KK7A 4JPZB 3H6PA 1LWUC 1E5WA 2E76C 2R32A 4YTPC 1N7LA 3O6QB 1PPJE 4D6TJ 3CMAP 2L5GB 5CMZA 4W80A 3D71A 3CWBJ 1Z56A 3TGUG 2K1AA 1LGHB 4Z1MH 1KYOD 2FYUK 5TISE 1BSHA 2K88A 2SPZA 1YIJP 3E7KA 1KV4A 4H0LB 2LR2A 3WU2H 3CPWO 4KT0J 4JQ0D 1BE3G 3N4XA 4IFFA 2FFDC 1IFJA 2QJKC 1SQXJ 1SQXE 1JCCA 1SQQJ 1IO4A 1H8AA 1QVFO 4U3FJ 1GZLA 4WVZA 1Y8AA 4OWFA 2KZIA 3V4QA 2WQYC 4GKGA 5B5EE 2W6BA 4N3YB 1SFCB 2BEQD 2FYUG 2M5AB 3D6YA 2FFDA 5K5GB 1L4AB 2JDIH 1NTMJ 1FJKA 4K3AA 3RK2D 5BU8B 3W68A 3M0DC 2FYNB 2OARA 1HTLC 4GIFA 3AEAC 1VQ9P 1JY3P 1RQUA 1SQPG 2WVRA 5AVXB 4A7PA 3L71D 3H1KE 3K5BA 1VQPP 2Q9IA 3PHLA 1P84H 2IPPA 1SQVG 2V7QJ 1PP9D 1H88A 2O3JA 2KIKA 1FAVA 5AW1B 2FYZA 1FC2C 3HD7A 3Q5PA 3EFGA 1IFDA 4GODA 2W6AA 1GL2A 3AEGC 3PLNA 3TDKA 3GLMA 1LT9A 3L75D 3WUTA 5KJ7A 1VQ7P 2XKMA 4W7YA 4DZOA 1VF5D 3A5TA 2D2CD 2KSJA 3LIEA 2OYOA 2NRGA 1IC2A 2N1TC 1IZNB 1NU1K 3GHGC 3MIWA 5CCHD 1TU3F 2P67A 1SQVD 4UB6E 1M56D 1IJDB 1HBWA 3PH0A 1X22A 4XFJA 2QA4P 1NAYA 1NTME 1L4AA 2AEJA 3H1KD 3CCRP 3U1CA 3VTPC 1T8ZA 3HTKB 3B8EB 3L35A 1CW5A 1N73C 1AVOA 3CX5E 2WPSA 1NTZD 4TLFA 1DH3A 3L73D 1T2KC 1GTWA 2OYIA 1SQQD 1KILD 4MN4C 2E75C 3AE6C 4PD4I 1OW7A 2BEZF 3VOPA 4WBAA 4RESB 5APTA 1G1JA 1HF9A 3EWKA 5AW7B 1LTJA 3AECC 4IOIH 3CD6P 1SQVJ 1ZRTE 2KLVA 1EZVE 1KZUB 2K37A 2Y0CA 3HE4A 1HUCA 1LTTC 4IL6H 4OVNF 1JUNA 1L4AD 5KLVJ 3RK2B 3L70E 3RK3B 1KYOI 1L0LG 2A06G 2QG4A 2IBZD 3NFQA 4Y28J 3TGUJ 2N9BA 2YNYA 2ZYGA 3BATA 1KTMA 2O1JA 2KLUA 4H44D 2O1KA 5KAIE 1H89A 4D6TG 3E1IA 1LTSC 2WSCH 1S3JA 1SQPK 1R5LA 2LXCB 2Q5UA 5GTHH 3M9BA 3M9HA 5BVZA 2UWJE 2E5YA 2J59M 1BGYE 2Z5IA 3A0BH 5APSA 2HYNA 1RY3A 2G3AA 1OVUA 1UIXA 3L71J 3T97A 1QX8A 2IBZE 2QJKB 1M90Q 5KKZC 1Q86Q 4IL6X 1WT6A 4WB4A 4Y99C 2R3SA 3P32A 5APWA 3H1IG 1RF0A 3G3ZA 2HLOA 2H88C 5DJTB 1USDA 5KLVK 4HB1A 2KI7B 1L0LJ 3VP9A 1SQPE 3ITKA 3LW5H 1S5LH 1N7SB 1VQ8P 4H0LC 3ABVC 3H1KJ 1KILE 2WSEJ 2WPQA 1MUUA 1U7JA 1R5SA 1BE3D 4ZMDA 4I1LA 3CX5I 5AVVB 2R3CA 4D6TD 1P84I 3H1ID 3HRNA 4NPFX 4GT1A 1VQLP 1DEBA 1ZR2A 4M3LA 1NGMB 1L0NJ 1EDLA 1MFZA 1USEA 3H1HD 3G71P 1K73Q 2IFMA 3TYYA 1SQVE 3F5HA 1VQKP 3HUSB 3KPEA 5KLVE 1QGKB 2Y0DA 3D6ZA 4WY4C 1BE3E 1JY2P 1NU1J 1AQTA 2A45I 2E74B 2QSIA 4JF7A 3CLQA 2W83C 4DT0A 1KN7A 3HD7D 5AW8B 1DEEG 4C7NB 1L0LE 2FFDB 2M3BA 3B4SA 4XA4A 4CPGA 1ZMEC 2FBWC 1J1DB 5AVWB 5B66E 1FZGA 1NTMK 1Y47A 3I55P 1KB9I 3MZWB 2R5DA 1LT9B 2NPSD 1KORA 1OVVA 2OQQA 3HTKA 2CPBA 2FXOA 3RK3E 5KTBA 1NTZG 5EFWB 2N1TA 3TNUB 1NTZE 1S5LX 2PFXA 2YXRB 1GD2E 1PPJD 1KB9E 4H44C 4PD4D 2M3EA 1GMJA 2YMYA 3H1LD 3KQGA 5AW4B 4DJGA 2KZJA 1LT9C 4EYYQ 3FXDA 3CC2P 5CCHA 1LT1A 3TK1A 1NOHA 1AA0A 1RQVA 2I1KA 5AW9B 2O01N 4JYBA 3SWYA 3HUSC 3QH9A 1LTJC 3A7OA 4KJMA 2B9BA 1YHQP 2QM8A 1NWQA 4WY4B 5KLVG 4N78D 2OYIB 2HODB 1S4XA 5GTIH 1CI6A 3H1IE 1LTIC 1ZV8A 3A3YB 2IDBA 5APXA 3M0DA 5M1BA 4C7NA 4L74A 1EXIA 1PP9G 4HH2A 1KQGB 3M91A 3V2PA 1AQ5A 2KUBA 1HJ0A 3L37A 1SQXK 2K9JB 3BVHA 1GU5A 1GU4A 1ZR4A 2E75B 3V4WA 3G4SP 2W8ZA 1PIXA 3L73G 3TF5A 1L0LK 1G1IA 3WUVA 1U57A 4I2LC 1K9MQ 3GHGA 4EI2A 1YBKA 4I6MC 1SP4A 3H32A 4HKZH 3RL0g 3AEBC 1LP1A 2MKVA 1AV1A 2C9LY 3R4YA 2KS1B 3SSUA 3CL3D 1GW3A 1IFMA 1SQVK 1GL2C 2FKWB 3HD7B 4UB8E 5KJ7C 1FZCB 4H13B 3AE3C 1S9KE 1IK7A 3KZIH 2FYUE 4BXLA 1CI6B 3F89A 1FE6A 1BCCJ 2HODA 4KHXA 2Q6QA 2WSEH 3TSIA 1KD1Q 3L74E 1H0TA 1LWUB 2E76B 2D2CB 5AVTB 1JY2N 2RKLA 1N2DC 3NXSA 4AQRD 1GL2D 1NHLA 1XTGB 2E76D 2Q1KA 2ZAEB 5KJ7D 1YI2P 1BDDA 1LTGC 1G2CB 1M1KQ 3H25A 3CMEP 3CXHH 3V5BA 5DJUB 1LJ2A 2ZYDA 1KFNA 2C0WA 5B66H 2P7JA 5CBNA 1EDJA 3CXHD 1NVOA 1OWAA 3HE5A 1KFMA 2W6JH 4YPCA 1K04A 1JOCA 2J58A 2CPSA 3H1LJ 4BRYA 3B5NB 2GM4A 1M1JA 1NU1G 3FX0A 3FWLA 1N7SC 2POHA 5E79H 1SQBK 5CJ0A 1BDCA 3S4RA 3UIAA 3CCQP 4RO0A 2FYUD 1Q7YQ 3L73E 1NO4A 1LTAC 4XE5B 3VP8A 3Q5SA 3PRJA 1M8OB 3BCCE 3W67A 2E42A 4W7ZA 5KKZB 1VQ4P 1NTKK 1YITP 3OJAB 3JSVC 3VN0A 5CCGD 1H0TB 1J1EB 3WU2E 4GDOA 1S5LE 1U7MA 4EIJA 3CXHE 2KS1A 1PFIA 3Q1MA 1JM0A 1T3UA 4ZKPA 4PV1C 3HUSA 3MHVA 2ZXXA 2GUVA 1HGVA 4H0LD 1L0LD 4YXWH 4U7JA 2RN0A 5KLVD 1BCCE 3BCCG 3P7KA 1KILC 1SFCA 3KHUA 3V6IA 3H1HJ 3AEDC 2AXTE 2PGDA 2W90A 2BCCJ 3GF7A 1DX7A 1NTKD 1QLED 3GF3A 5AW3B 4AUWA 4PD4H 5CBOA 3CCMP 3CCSP 1J2JB 1QL1A 4R4LA 2OTJP 3PJSK 1AFOA 3I5CA 3AE7C 1JNMA 1FDIA 1JY3N 1VQNP 4WY4A 2C9NY 2E74C 2N9YB 3C1LA 2LKMA 3KZIE 1JEKA 1J1EC 1M57D 1EZVD 4K35A 4WY4D 3C9IA 5AW2B 4ASVA 2ZVOB 1YQ3C 2WSCJ 2OYHA 2KYVA 1J1DC 2BASA 2KP8A 4LC1A 3SFEC 3B5ND 3LIDA 5KLIC 3AEFC 1UIIA 3KDPB 2XNDH 2K9JA 2C0XA 5AVYB 2XNXA 3R2PA 1XTCC 3S9OA 1OVRA 1SQQE 1ZXGA 1W2BO 1VQMP 4JBZA 2NPSC 1SQXD 3IF4A 3KXDA 2IX7C 1QVGO 3CX5D 5KLIB 4ZNCA 3OAKA 5AVRB 2WPVB 3ZDMA 3BCCD 3L75J 1BCCG 2JP3A 1BGYD 2ZYAA 2JWAA 1FZBA 1Q90D 1NTMD 4OH8B 4DOJA 3H1JD 1URQB 2NPSA 1FOSE 1P84D 3VYIA 1KYOE 2KXPB 3RK2C 2Y0EA 3RK3C 1LTJB 3Q3DA 3H1JE 1OX3A 1OXZA 2HR3A 1PGOA 2I8DA 2K9YA 1SQBJ 3O6QA 1YJ9P 1ZW0A 2H43A 1N73B 1JMBA 1RHZB 3CXHI 2WITA 3N7NA 4H13D 2OYIC 3M9QA 1X0TA 4BWNA 3AE4C 3QWOC 1A02F 4Y99B 1Q82Q 1JY3O 5APUA 2ZXEB 3FGAD 3C8VA 3L73J 1HH0A 2B89A 1NJIQ 1JCDA 1K05A 1PP9E 2K3RA 1NAFA 1PP9J 1OW6A 2XDJA 4PJ0H 3V2NA 2YIUB 3L74G 2M0BA 1S2EA 3P8MC 1EC5A 1RE4A 3TGUD 1MV8A 3L74D 3L71E 4N6JA 1OIPA 2A45H 3AE9C 3T97B 1KMIZ 1SQPD 2FY8A 1L2PA 2L91A 2YKOA 3HE5B 1RE3A 3II6A 4I7ZC 1LTBC 1SQBD 1BE3J 1NU1E 1M1JB 1PGJA 1PGQA 3CC7P 1AVYA 1SQBG 2A45G 1S9KD 2Q3IA 3HD7C 1SQPJ 1KB9H 5KAIH 2V7QH 3H1JJ 3WMM0 3MUDA 2OTLP 2KOGA 2O01J 1RH5B 2YO2A 2H89C 2YMKA 1OMIA 1VL2A 1GK4A
chains in the Genus database with same CATH topology
1IFIA 1VDFA 1T2KD 2JEEA 1JTHB 3MTUE 3M0AA 1GW4A 1HWTC 1N7SA 3BRTB 3SWFA 1N73A 1FZCA 2WPRA 5APQA 1W2EA 3RL0B 1YYCA 2YO3A 1L4AC 1M1JC 2IFNA 3KYQA 1SFCC 2QM7A 3GHGB 4ZKUA 3IFMA 3BRVB 2Z4EA 2YKQA 1YTZT 1MZ9A 2HG5D 4IFMA 2I1JA 3BASA 2W27A 1KILB 1CZQA 3L36A 3CI9A 1LWUA 3H32B 3MD0A 1GDTA 1M7LA 2GUSA 5CHXA 3EQ2A 3HE4B 1URQC 2R5BA 2FXMA 1FZEA 1EQ7A 2N1TB 3TNUA 4B86A 1RF1A 2YKPA 4IFDK 2XV5A 1JTHA 1SLQA 1RF1C 4LLHA 1URQA 1QL2A 2NPSB 1L0NK 2VRSA 4C46A 1G2CA 3U59A 1N73B 4AYCA 1URQD 4JYCA 1GL2B 1FDMA 3P8CE 1ZN5A 3V2QA 2HFED 2H7HA 4HYTB 1FJPA 2KB7P 1N7SD 2P2UA 5APYA 1CSBA 3OA7A 2Z5HA 1HGZA 1HJBA 5AVSB 1SFCD 1RF1B 5AVQB 3B5NC 1RE4C 5BU5A 1FZCC 2WT7B 1N86A 2PAJA 5AW5B 2WZ7A 2WTYA 3PP5A 5CCGC 3NMDA 2HPCA 3RL0C 2N1TD 2MJZA 1KQLA 2ZFCA 2E43A 1FZFA 2O01H 1GK6A 2XU6A 1T3JA 1JMMA 1ZLLA 1FOSF 5CCHC 2OYHB 1RE3C 2WWWA 3MGNA 1X9VA 4N78E 4LGDE 2GM4A 1YTZI 2H8PD 1IK9A 2OYHC 2M8RA 5AW6B 3O8ZA 3VMXA 2JJLA 5APVA 5AVUB 3M06A 2WT7A 1X79B 3A2AA 3RK3D 1FZAA 1NH4A 5AVZB 1KILA 1SVFA 3U1AA 1FBMA 3P8CD 5AW0B 3L4FA 1WRGA 1HVVA 1VPCA 3VMYA 2XZRA 2Q7CA 1A02J 1X8YA 1IFNA 2WSFH 4EOTA 1JY2O 1NTZK 3RL0D 1FU1A 3VMZA 1RF0C 1NKNA 2P1JA 1SQQK 5CCGA 3NTNA 2PP6A 1NKZB 3B5NA 3IR9A 4O9BA 3H6PA 1LWUC 1E5WA 2R32A 1N7LA 2L5GB 5CMZA 4W80A 1Z56A 1LGHB 2FYUK 3N4XA 4IFFA 2FFDC 1IFJA 1JCCA 1IO4A 1H8AA 1GZLA 3V4QA 4GKGA 2W6BA 4N3YB 1SFCB 2FFDA 1L4AB 5BU8B 1FJKA 3RK2D 3M0DC 2OARA 1HTLC 4GIFA 1JY3P 5AVXB 2Q9IA 2IPPA 1H88A 1FAVA 5AW1B 2FYZA 3HD7A 3EFGA 1IFDA 2W6AA 1GL2A 5KJ7A 1LT9A 2XKMA 4W7YA 4DZOA 3A5TA 2KSJA 3LIEA 3GHGC 1IC2A 2N1TC 1NU1K 3MIWA 5CCHD 2P67A 1IJDB 1HBWA 1L4AA 3VTPC 1T8ZA 3HTKB 3B8EB 3L35A 1CW5A 1N73C 2WPSA 1DH3A 1T2KC 1GTWA 2OYIA 1KILD 3VOPA 4WBAA 4RESB 5APTA 1G1JA 5AW7B 1LTJA 3HE4A 2KLVA 1KZUB 3VN0A 1JUNA 1HUCA 1LTTC 1L4AD 3RK2B 3RK3B 3NFQA 2N9BA 2YNYA 3BATA 2O1JA 1H89A 2C9LY 2O1KA 3E1IA 1LTSC 2WSCH 1SQPK 2Q5UA 3M9BA 3M9HA 5BVZA 2J59M 2Z5IA 5APSA 2HYNA 1RY3A 3T97A 4Y99C 1WT6A 4WB4A 3P32A 5APWA 1RF0A 3G3ZA 2HLOA 5KLVK 3VP9A 3LW5H 1N7SB 2WPQA 1MUUA 4I1LA 5AVVB 2R3CA 3HRNA 4GT1A 1DEBA 1ZR2A 4M3LA 1MFZA 2IFMA 3TYYA 3HUSB 3KPEA 4WY4C 5AW3B 1JY2P 2A45I 5AW9B 4JF7A 3CLQA 3HD7D 5AW8B 4C7NB 2FFDB 2M3BA 4XA4A 1J1DB 5AVWB 1FZGA 1NTMK 2R5DA 1LT9B 2NPSD 3HTKA 5KTBA 2CPBA 2N1TA 3TNUB 1GD2E 3KQGA 2YMYA 5AW4B 1LT9C 5CCHA 3TK1A 1NOHA 2I1KA 4JYBA 3SWYA 3HUSC 1LTJC 3A7OA 1NWQA 2QM8A 4WY4B 4N78D 2OYIB 2HODB 1CI6A 1LTIC 1ZV8A 5APXA 3M0DA 4C7NA 4HH2A 3V2PA 3M91A 1AQ5A 3L37A 1SQXK 1GU5A 1GU4A 1ZR4A 3V4WA 1L0LK 1G1IA 4I2LC 3GHGA 4I6MC 1SP4A 3H32A 3V2RA 3CL3D 1GW3A 1IFMA 1SQVK 1GL2C 2FKWB 3HD7B 5KJ7C 1FZCB 1S9KE 1CI6B 2HODA 4KHXA 2WSEH 3TSIA 1LWUB 5AVTB 1JY2N 1N2DC 3NXSA 4AQRD 1GL2D 1NHLA 1XTGB 5KJ7D 1JO5A 1LTGC 1G2CB 3V5BA 1KFNA 2C0WA 2P7JA 1OWAA 3HE5A 1KFMA 1JOCA 2J58A 2CPSA 3B5NB 1M1JA 1N7SC 2POHA 1SQBK 5CJ0A 3UIAA 1NO4A 1LTAC 4XE5B 3VP8A 2E42A 4W7ZA 1NTKK 3OJAB 5CCGD 1J1EB 4EIJA 1PFIA 1T3UA 4ZKPA 3HUSA 2GUVA 1HGVA 3P7KA 1KILC 1SFCA 1DX7A 4AUWA 1J2JB 1QL1A 1AFOA 3I5CA 1JNMA 1JY3N 4WY4A 2C9NY 2HPCB 2LKMA 4C7RA 1J1EC 5AW2B 4WY4D 3C9IA 2OYHA 2KYVA 1J1DC 2BASA 2KP8A 4LC1A 3B5ND 3LIDA 5AVYB 3KDPB 2C0XA 2XNXA 3R2PA 1XTCC 2NPSC 2IX7C 3OAKA 5AVRB 4OH8B 4DOJA 1FZBA 1URQB 2NPSA 1FOSE 3VYIA 3RK2C 3RK3C 1LTJB 1OXZA 2H43A 3N7NA 2WITA 2OYIC 3M9QA 1A02F 4Y99B 1JY3O 5APUA 2ZXEB 1HH0A 1JCDA 2XDJA 3V2NA 1NAFA 3P8MC 1RE4A 1MV8A 4N6JA 3BVHA 2A45H 3HE5B 3II6A 2YKOA 1RE3A 1LTBC 1M1JB 1S9KD 2A45G 2Q3IA 3HD7C 3WMM0 3MUDA 2KOGA 2YO2A 3A3YB 5CJ4A 3U1CA 1GK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF H;  1NTK K;  2FYU K;  1NTZ K;  3M9Q A;  2LKM A;  2WSE H;  3CLQ A;  3G3Z A;  1SQQ K;  5KLV K;  1NTM K;  3LW5 H;  1SQX K;  2O01 H;  1L0L K;  4IFD K;  1NU1 K;  1SQB K;  2WSC H;  1SQP K;  1L0N K;  1SQV K;  2J59 M;  2OAR A; 
#chains in the Genus database with same CATH topology
 1IFI A;  4U3F E;  2FYU J;  2ZT9 D;  2ZVN B;  2IBZ G;  1VDF A;  1T2K D;  3L74 J;  1BGY G;  1DD4 A;  1JTH B;  2JEE A;  3L75 E;  1EDI A;  4TT3 H;  3MTU E;  3L72 E;  4C46 A;  1MFT A;  3M0A A;  2IZ1 A;  3WUU A;  2IYP A;  3AE2 C;  4QMA A;  1GW4 A;  5H2F E;  1HWT C;  1N7S A;  3BRT B;  3SWF A;  2IZ0 A;  4PJ0 E;  3E1R A;  2QEX P;  1N73 A;  1FZC A;  1OZH A;  2WPR A;  5APQ A;  1W2E A;  2V4H A;  1YYC A;  3RL0 B;  2YO3 A;  2IYO A;  1L4A C;  4C7R A;  1M1J C;  5KAF E;  4EDF A;  1EZV I;  1D7M A;  1SFC C;  2FYN C;  1LNQ A;  2IFN A;  2QM7 A;  3GHG B;  3IFM A;  3KYQ A;  1EZV G;  4ZKU A;  3PTZ A;  3BRV B;  1Q2N A;  3CWB G;  1L0N G;  3GW6 A;  1BSN A;  1YTZ T;  1MZ9 A;  2YKQ A;  5C39 A;  2Z4E A;  4WWI A;  2HG5 D;  1KC8 Q;  3CX5 H;  3AE8 C;  4IFM A;  2CK3 H;  2I1J A;  1N8R Q;  3BAS A;  2W27 A;  1KIL B;  1FDO A;  1CZQ A;  1NTK J;  3L36 A;  3CC4 P;  3CI9 A;  2A06 D;  1W5C E;  2QJY B;  1LWU A;  3H32 B;  3MD0 A;  1GDT A;  1BCC D;  3OW2 O;  1M7L A;  2GUS A;  2IBZ I;  1EDK A;  3H1K G;  3L70 D;  4RJT A;  5CHX A;  2QVA A;  3EQ2 A;  3HE4 B;  3LW5 J;  1SS1 A;  1URQ C;  2R5B A;  3AEE C;  2DW3 A;  2FXM A;  3GG2 A;  1FZE A;  1EQ7 A;  2N1T B;  3TNU A;  4B86 A;  4H44 B;  1RF1 A;  2YKP A;  3H1I J;  2AXT H;  2XV5 A;  3L71 G;  4BRY B;  1EXJ A;  4IFD K;  1JTH A;  1SLQ A;  1RF1 C;  1R8E A;  1Q81 Q;  4LLH A;  2M5A A;  2J5U A;  2P58 A;  3H1H E;  1URQ A;  1QL2 A;  2JO1 A;  1L0N K;  1WMK A;  1L0N E;  2NPS B;  1G2C A;  2VRS A;  3H1H G;  3A0B E;  3U59 A;  4AYC A;  1KB9 D;  1URQ D;  3BCC J;  1GL2 B;  4JYC A;  4PD4 E;  4NPE A;  2WSF J;  3I56 P;  2E5T A;  2WMM A;  3P8C E;  4RKU J;  2ZT9 C;  1ZN5 A;  3JCU E;  2BCC D;  1NYH A;  3RGU A;  3V2Q A;  1E79 H;  3EFF K;  2HFE D;  2QJY C;  5GTI E;  1S1C X;  4GOE A;  2H7H A;  4HYT B;  1KQF B;  3CCE P;  1FJP A;  3CCJ P;  2KB7 P;  1N7S D;  3L70 G;  3RBZ A;  2P2U A;  5APY A;  1CSB A;  3OA7 A;  4IL6 E;  5H2F H;  2Z5H A;  1HGZ A;  1HJB A;  1PV3 A;  3CCV P;  5AVS B;  3L72 G;  2E75 D;  1T6A A;  1SFC D;  5B5E H;  1RF1 B;  3D70 A;  5AVQ B;  3CCU P;  5E79 E;  2JR8 A;  2YIU C;  3B5N C;  1RE4 C;  1AJY A;  5TJH A;  5BU5 A;  1Y9B A;  4D6T E;  4L76 A;  3VMA A;  1FZC C;  2RMZ A;  1KYO H;  3JCU H;  2WT7 B;  1FDM A;  1N86 A;  2PAJ A;  5AW5 B;  3S1K A;  1SQB E;  1VF5 B;  4UB8 H;  2WZ7 A;  2WTY A;  1YQ4 C;  2FXP A;  1PGP A;  2RH0 A;  1VQO P;  1YJW P;  3AE5 C;  3SWK A;  3PP5 A;  2OTK E;  3TGU E;  5CCG C;  3H1L E;  3NMD A;  2D2C C;  2HPC A;  3RL0 C;  2N1T D;  2MJZ A;  2JKV A;  1NU1 D;  1ZRT D;  1KQL A;  4L75 A;  2OGU A;  3L72 J;  2ZFC A;  2Y9Z A;  2E43 A;  2YXQ B;  1BGY J;  1JO5 A;  3A0H E;  3MUD C;  3AE1 C;  1FZF A;  2O01 H;  1GK6 A;  2P10 A;  2Q3E A;  2WSS H;  2XU6 A;  1T3J A;  1JMM A;  1IFP A;  3CWB E;  1ZLL A;  3IAO A;  3L72 D;  1FOS F;  3L70 J;  3IN6 A;  5CCH C;  1VQ6 P;  2QE7 H;  2OYH B;  1RE3 C;  5GTH E;  1S72 P;  2KSE A;  2WWW A;  1PZQ A;  2A06 E;  3H1J G;  3MGN A;  1NTM G;  4PV1 B;  5CJ4 A;  1X9V A;  2PRR A;  3FWN A;  4N78 E;  1MKM A;  3B71 A;  3FXE A;  4LGD E;  1YTZ I;  2GA1 A;  2H8P D;  4L73 A;  3RBX A;  2QJP B;  1IK9 A;  1FS0 E;  2B88 A;  1VQ5 P;  2M8R A;  2OYH C;  5AW6 B;  3O8Z A;  3VMX A;  3MP7 B;  4GOF A;  3Q2Y A;  2BCC G;  1NTZ J;  2NZ2 A;  4ASW A;  5KAF H;  2JJL A;  2B87 B;  1SQQ G;  5APV A;  5AVU B;  1DD3 A;  3M06 A;  2QJP C;  4U3F G;  1KQS O;  2WT7 A;  1X79 B;  2KNC A;  3A2A A;  3RK3 D;  1FZA A;  3SFD C;  1SQX G;  1NH4 A;  5AVZ B;  2AEM A;  1KIL A;  1SVF A;  2JWD A;  4R4M A;  2E74 D;  5L8R J;  3U1A A;  1FBM A;  2G8Y A;  2Y9Y A;  3P8C D;  5TIS H;  2ZJS E;  3CCL P;  5AW0 B;  3L4F A;  1PPJ G;  2ZT9 B;  1L0N D;  3G6E P;  1WRG A;  3JC2 2;  4YXD C;  2AXC A;  1HVV A;  1VPC A;  3G9R A;  2XZR A;  4U3F D;  2LXB A;  3L75 G;  2Q7C A;  3VMY A;  1A02 J;  3USS A;  4H13 C;  1K8A Q;  1P84 E;  1X8Y A;  2AEF A;  1IFN A;  2WSF H;  1NTK E;  4NPD A;  4OGQ D;  1JY2 O;  1NTZ K;  3RL0 D;  1FU1 A;  3VMZ A;  4EOT A;  1DIP A;  2B87 A;  1RF0 C;  1NKN A;  4OGQ B;  2P1J A;  1SQQ K;  2QRX A;  1LP1 B;  3H1L G;  5CCG A;  1JB0 J;  4DCK A;  3NTN A;  1PL5 A;  3CWB D;  2KNC B;  4PV1 D;  1ZOY C;  3V2R A;  2HPC B;  2QIW A;  3GMA A;  1ZP0 C;  3A0H H;  4OGQ C;  2PP6 A;  1YJN P;  4UB6 H;  1OFC X;  4I7Z B;  1VF5 C;  1NKZ B;  3B5N A;  2ITA A;  3Q5R A;  2R44 A;  3IR9 A;  4HJG H;  1NTK G;  2BCC E;  1OW8 A;  4O9B A;  1QEX A;  2KK7 A;  4JPZ B;  3H6P A;  1LWU C;  1E5W A;  2E76 C;  2R32 A;  4YTP C;  1N7L A;  3O6Q B;  1PPJ E;  4D6T J;  3CMA P;  2L5G B;  5CMZ A;  4W80 A;  3D71 A;  3CWB J;  1Z56 A;  3TGU G;  2K1A A;  1LGH B;  4Z1M H;  1KYO D;  2FYU K;  5TIS E;  1BSH A;  2K88 A;  2SPZ A;  1YIJ P;  3E7K A;  1KV4 A;  4H0L B;  2LR2 A;  3WU2 H;  3CPW O;  4KT0 J;  4JQ0 D;  1BE3 G;  3N4X A;  4IFF A;  2FFD C;  1IFJ A;  2QJK C;  1SQX J;  1SQX E;  1JCC A;  1SQQ J;  1IO4 A;  1H8A A;  1QVF O;  4U3F J;  1GZL A;  4WVZ A;  1Y8A A;  4OWF A;  2KZI A;  3V4Q A;  2WQY C;  4GKG A;  5B5E E;  2W6B A;  4N3Y B;  1SFC B;  2BEQ D;  2FYU G;  2M5A B;  3D6Y A;  2FFD A;  5K5G B;  1L4A B;  2JDI H;  1NTM J;  1FJK A;  4K3A A;  3RK2 D;  5BU8 B;  3W68 A;  3M0D C;  2FYN B;  2OAR A;  1HTL C;  4GIF A;  3AEA C;  1VQ9 P;  1JY3 P;  1RQU A;  1SQP G;  2WVR A;  5AVX B;  4A7P A;  3L71 D;  3H1K E;  3K5B A;  1VQP P;  2Q9I A;  3PHL A;  1P84 H;  2IPP A;  1SQV G;  2V7Q J;  1PP9 D;  1H88 A;  2O3J A;  2KIK A;  1FAV A;  5AW1 B;  2FYZ A;  1FC2 C;  3HD7 A;  3Q5P A;  3EFG A;  1IFD A;  4GOD A;  2W6A A;  1GL2 A;  3AEG C;  3PLN A;  3TDK A;  3GLM A;  1LT9 A;  3L75 D;  3WUT A;  5KJ7 A;  1VQ7 P;  2XKM A;  4W7Y A;  4DZO A;  1VF5 D;  3A5T A;  2D2C D;  2KSJ A;  3LIE A;  2OYO A;  2NRG A;  1IC2 A;  2N1T C;  1IZN B;  1NU1 K;  3GHG C;  3MIW A;  5CCH D;  1TU3 F;  2P67 A;  1SQV D;  4UB6 E;  1M56 D;  1IJD B;  1HBW A;  3PH0 A;  1X22 A;  4XFJ A;  2QA4 P;  1NAY A;  1NTM E;  1L4A A;  2AEJ A;  3H1K D;  3CCR P;  3U1C A;  3VTP C;  1T8Z A;  3HTK B;  3B8E B;  3L35 A;  1CW5 A;  1N73 C;  1AVO A;  3CX5 E;  2WPS A;  1NTZ D;  4TLF A;  1DH3 A;  3L73 D;  1T2K C;  1GTW A;  2OYI A;  1SQQ D;  1KIL D;  4MN4 C;  2E75 C;  3AE6 C;  4PD4 I;  1OW7 A;  2BEZ F;  3VOP A;  4WBA A;  4RES B;  5APT A;  1G1J A;  1HF9 A;  3EWK A;  5AW7 B;  1LTJ A;  3AEC C;  4IOI H;  3CD6 P;  1SQV J;  1ZRT E;  2KLV A;  1EZV E;  1KZU B;  2K37 A;  2Y0C A;  3HE4 A;  1HUC A;  1LTT C;  4IL6 H;  4OVN F;  1JUN A;  1L4A D;  5KLV J;  3RK2 B;  3L70 E;  3RK3 B;  1KYO I;  1L0L G;  2A06 G;  2QG4 A;  2IBZ D;  3NFQ A;  4Y28 J;  3TGU J;  2N9B A;  2YNY A;  2ZYG A;  3BAT A;  1KTM A;  2O1J A;  2KLU A;  4H44 D;  2O1K A;  5KAI E;  1H89 A;  4D6T G;  3E1I A;  1LTS C;  2WSC H;  1S3J A;  1SQP K;  1R5L A;  2LXC B;  2Q5U A;  5GTH H;  3M9B A;  3M9H A;  5BVZ A;  2UWJ E;  2E5Y A;  2J59 M;  1BGY E;  2Z5I A;  3A0B H;  5APS A;  2HYN A;  1RY3 A;  2G3A A;  1OVU A;  1UIX A;  3L71 J;  3T97 A;  1QX8 A;  2IBZ E;  2QJK B;  1M90 Q;  5KKZ C;  1Q86 Q;  4IL6 X;  1WT6 A;  4WB4 A;  4Y99 C;  2R3S A;  3P32 A;  5APW A;  3H1I G;  1RF0 A;  3G3Z A;  2HLO A;  2H88 C;  5DJT B;  1USD A;  5KLV K;  4HB1 A;  2KI7 B;  1L0L J;  3VP9 A;  1SQP E;  3ITK A;  3LW5 H;  1S5L H;  1N7S B;  1VQ8 P;  4H0L C;  3ABV C;  3H1K J;  1KIL E;  2WSE J;  2WPQ A;  1MUU A;  1U7J A;  1R5S A;  1BE3 D;  4ZMD A;  4I1L A;  3CX5 I;  5AVV B;  2R3C A;  4D6T D;  1P84 I;  3H1I D;  3HRN A;  4NPF X;  4GT1 A;  1VQL P;  1DEB A;  1ZR2 A;  4M3L A;  1NGM B;  1L0N J;  1EDL A;  1MFZ A;  1USE A;  3H1H D;  3G71 P;  1K73 Q;  2IFM A;  3TYY A;  1SQV E;  3F5H A;  1VQK P;  3HUS B;  3KPE A;  5KLV E;  1QGK B;  2Y0D A;  3D6Z A;  4WY4 C;  1BE3 E;  1JY2 P;  1NU1 J;  1AQT A;  2A45 I;  2E74 B;  2QSI A;  4JF7 A;  3CLQ A;  2W83 C;  4DT0 A;  1KN7 A;  3HD7 D;  5AW8 B;  1DEE G;  4C7N B;  1L0L E;  2FFD B;  2M3B A;  3B4S A;  4XA4 A;  4CPG A;  1ZME C;  2FBW C;  1J1D B;  5AVW B;  5B66 E;  1FZG A;  1NTM K;  1Y47 A;  3I55 P;  1KB9 I;  3MZW B;  2R5D A;  1LT9 B;  2NPS D;  1KOR A;  1OVV A;  2OQQ A;  3HTK A;  2CPB A;  2FXO A;  3RK3 E;  5KTB A;  1NTZ G;  5EFW B;  2N1T A;  3TNU B;  1NTZ E;  1S5L X;  2PFX A;  2YXR B;  1GD2 E;  1PPJ D;  1KB9 E;  4H44 C;  4PD4 D;  2M3E A;  1GMJ A;  2YMY A;  3H1L D;  3KQG A;  5AW4 B;  4DJG A;  2KZJ A;  1LT9 C;  4EYY Q;  3FXD A;  3CC2 P;  5CCH A;  1LT1 A;  3TK1 A;  1NOH A;  1AA0 A;  1RQV A;  2I1K A;  5AW9 B;  2O01 N;  4JYB A;  3SWY A;  3HUS C;  3QH9 A;  1LTJ C;  3A7O A;  4KJM A;  2B9B A;  1YHQ P;  2QM8 A;  1NWQ A;  4WY4 B;  5KLV G;  4N78 D;  2OYI B;  2HOD B;  1S4X A;  5GTI H;  1CI6 A;  3H1I E;  1LTI C;  1ZV8 A;  3A3Y B;  2IDB A;  5APX A;  3M0D A;  5M1B A;  4C7N A;  4L74 A;  1EXI A;  1PP9 G;  4HH2 A;  1KQG B;  3M91 A;  3V2P A;  1AQ5 A;  2KUB A;  1HJ0 A;  3L37 A;  1SQX K;  2K9J B;  3BVH A;  1GU5 A;  1GU4 A;  1ZR4 A;  2E75 B;  3V4W A;  3G4S P;  2W8Z A;  1PIX A;  3L73 G;  3TF5 A;  1L0L K;  1G1I A;  3WUV A;  1U57 A;  4I2L C;  1K9M Q;  3GHG A;  4EI2 A;  1YBK A;  4I6M C;  1SP4 A;  3H32 A;  4HKZ H;  3RL0 g;  3AEB C;  1LP1 A;  2MKV A;  1AV1 A;  2C9L Y;  3R4Y A;  2KS1 B;  3SSU A;  3CL3 D;  1GW3 A;  1IFM A;  1SQV K;  1GL2 C;  2FKW B;  3HD7 B;  4UB8 E;  5KJ7 C;  1FZC B;  4H13 B;  3AE3 C;  1S9K E;  1IK7 A;  3KZI H;  2FYU E;  4BXL A;  1CI6 B;  3F89 A;  1FE6 A;  1BCC J;  2HOD A;  4KHX A;  2Q6Q A;  2WSE H;  3TSI A;  1KD1 Q;  3L74 E;  1H0T A;  1LWU B;  2E76 B;  2D2C B;  5AVT B;  1JY2 N;  2RKL A;  1N2D C;  3NXS A;  4AQR D;  1GL2 D;  1NHL A;  1XTG B;  2E76 D;  2Q1K A;  2ZAE B;  5KJ7 D;  1YI2 P;  1BDD A;  1LTG C;  1G2C B;  1M1K Q;  3H25 A;  3CME P;  3CXH H;  3V5B A;  5DJU B;  1LJ2 A;  2ZYD A;  1KFN A;  2C0W A;  5B66 H;  2P7J A;  5CBN A;  1EDJ A;  3CXH D;  1NVO A;  1OWA A;  3HE5 A;  1KFM A;  2W6J H;  4YPC A;  1K04 A;  1JOC A;  2J58 A;  2CPS A;  3H1L J;  4BRY A;  3B5N B;  2GM4 A;  1M1J A;  1NU1 G;  3FX0 A;  3FWL A;  1N7S C;  2POH A;  5E79 H;  1SQB K;  5CJ0 A;  1BDC A;  3S4R A;  3UIA A;  3CCQ P;  4RO0 A;  2FYU D;  1Q7Y Q;  3L73 E;  1NO4 A;  1LTA C;  4XE5 B;  3VP8 A;  3Q5S A;  3PRJ A;  1M8O B;  3BCC E;  3W67 A;  2E42 A;  4W7Z A;  5KKZ B;  1VQ4 P;  1NTK K;  1YIT P;  3OJA B;  3JSV C;  3VN0 A;  5CCG D;  1H0T B;  1J1E B;  3WU2 E;  4GDO A;  1S5L E;  1U7M A;  4EIJ A;  3CXH E;  2KS1 A;  1PFI A;  3Q1M A;  1JM0 A;  1T3U A;  4ZKP A;  4PV1 C;  3HUS A;  3MHV A;  2ZXX A;  2GUV A;  1HGV A;  4H0L D;  1L0L D;  4YXW H;  4U7J A;  2RN0 A;  5KLV D;  1BCC E;  3BCC G;  3P7K A;  1KIL C;  1SFC A;  3KHU A;  3V6I A;  3H1H J;  3AED C;  2AXT E;  2PGD A;  2W90 A;  2BCC J;  3GF7 A;  1DX7 A;  1NTK D;  1QLE D;  3GF3 A;  5AW3 B;  4AUW A;  4PD4 H;  5CBO A;  3CCM P;  3CCS P;  1J2J B;  1QL1 A;  4R4L A;  2OTJ P;  3PJS K;  1AFO A;  3I5C A;  3AE7 C;  1JNM A;  1FDI A;  1JY3 N;  1VQN P;  4WY4 A;  2C9N Y;  2E74 C;  2N9Y B;  3C1L A;  2LKM A;  3KZI E;  1JEK A;  1J1E C;  1M57 D;  1EZV D;  4K35 A;  4WY4 D;  3C9I A;  5AW2 B;  4ASV A;  2ZVO B;  1YQ3 C;  2WSC J;  2OYH A;  2KYV A;  1J1D C;  2BAS A;  2KP8 A;  4LC1 A;  3SFE C;  3B5N D;  3LID A;  5KLI C;  3AEF C;  1UII A;  3KDP B;  2XND H;  2K9J A;  2C0X A;  5AVY B;  2XNX A;  3R2P A;  1XTC C;  3S9O A;  1OVR A;  1SQQ E;  1ZXG A;  1W2B O;  1VQM P;  4JBZ A;  2NPS C;  1SQX D;  3IF4 A;  3KXD A;  2IX7 C;  1QVG O;  3CX5 D;  5KLI B;  4ZNC A;  3OAK A;  5AVR B;  2WPV B;  3ZDM A;  3BCC D;  3L75 J;  1BCC G;  2JP3 A;  1BGY D;  2ZYA A;  2JWA A;  1FZB A;  1Q90 D;  1NTM D;  4OH8 B;  4DOJ A;  3H1J D;  1URQ B;  2NPS A;  1FOS E;  1P84 D;  3VYI A;  1KYO E;  2KXP B;  3RK2 C;  2Y0E A;  3RK3 C;  1LTJ B;  3Q3D A;  3H1J E;  1OX3 A;  1OXZ A;  2HR3 A;  1PGO A;  2I8D A;  2K9Y A;  1SQB J;  3O6Q A;  1YJ9 P;  1ZW0 A;  2H43 A;  1N73 B;  1JMB A;  1RHZ B;  3CXH I;  2WIT A;  3N7N A;  4H13 D;  2OYI C;  3M9Q A;  1X0T A;  4BWN A;  3AE4 C;  3QWO C;  1A02 F;  4Y99 B;  1Q82 Q;  1JY3 O;  5APU A;  2ZXE B;  3FGA D;  3C8V A;  3L73 J;  1HH0 A;  2B89 A;  1NJI Q;  1JCD A;  1K05 A;  1PP9 E;  2K3R A;  1NAF A;  1PP9 J;  1OW6 A;  2XDJ A;  4PJ0 H;  3V2N A;  2YIU B;  3L74 G;  2M0B A;  1S2E A;  3P8M C;  1EC5 A;  1RE4 A;  3TGU D;  1MV8 A;  3L74 D;  3L71 E;  4N6J A;  1OIP A;  2A45 H;  3AE9 C;  3T97 B;  1KMI Z;  1SQP D;  2FY8 A;  1L2P A;  2L91 A;  2YKO A;  3HE5 B;  1RE3 A;  3II6 A;  4I7Z C;  1LTB C;  1SQB D;  1BE3 J;  1NU1 E;  1M1J B;  1PGJ A;  1PGQ A;  3CC7 P;  1AVY A;  1SQB G;  2A45 G;  1S9K D;  2Q3I A;  3HD7 C;  1SQP J;  1KB9 H;  5KAI H;  2V7Q H;  3H1J J;  3WMM 0;  3MUD A;  2OTL P;  2KOG A;  2O01 J;  1RH5 B;  2YO2 A;  2H89 C;  2YMK A;  1OMI A;  1VL2 A;  1GK4 A; 
#chains in the Genus database with same CATH homology
 1IFI A;  1VDF A;  1T2K D;  2JEE A;  1JTH B;  3MTU E;  3M0A A;  1GW4 A;  1HWT C;  1N7S A;  3BRT B;  3SWF A;  1N73 A;  1FZC A;  2WPR A;  5APQ A;  1W2E A;  3RL0 B;  1YYC A;  2YO3 A;  1L4A C;  1M1J C;  2IFN A;  3KYQ A;  1SFC C;  2QM7 A;  3GHG B;  4ZKU A;  3IFM A;  3BRV B;  2Z4E A;  2YKQ A;  1YTZ T;  1MZ9 A;  2HG5 D;  4IFM A;  2I1J A;  3BAS A;  2W27 A;  1KIL B;  1CZQ A;  3L36 A;  3CI9 A;  1LWU A;  3H32 B;  3MD0 A;  1GDT A;  1M7L A;  2GUS A;  5CHX A;  3EQ2 A;  3HE4 B;  1URQ C;  2R5B A;  2FXM A;  1FZE A;  1EQ7 A;  2N1T B;  3TNU A;  4B86 A;  1RF1 A;  2YKP A;  4IFD K;  2XV5 A;  1JTH A;  1SLQ A;  1RF1 C;  4LLH A;  1URQ A;  1QL2 A;  2NPS B;  1L0N K;  2VRS A;  4C46 A;  1G2C A;  3U59 A;  1N73 B;  4AYC A;  1URQ D;  4JYC A;  1GL2 B;  1FDM A;  3P8C E;  1ZN5 A;  3V2Q A;  2HFE D;  2H7H A;  4HYT B;  1FJP A;  2KB7 P;  1N7S D;  2P2U A;  5APY A;  1CSB A;  3OA7 A;  2Z5H A;  1HGZ A;  1HJB A;  5AVS B;  1SFC D;  1RF1 B;  5AVQ B;  3B5N C;  1RE4 C;  5BU5 A;  1FZC C;  2WT7 B;  1N86 A;  2PAJ A;  5AW5 B;  2WZ7 A;  2WTY A;  3PP5 A;  5CCG C;  3NMD A;  2HPC A;  3RL0 C;  2N1T D;  2MJZ A;  1KQL A;  2ZFC A;  2E43 A;  1FZF A;  2O01 H;  1GK6 A;  2XU6 A;  1T3J A;  1JMM A;  1ZLL A;  1FOS F;  5CCH C;  2OYH B;  1RE3 C;  2WWW A;  3MGN A;  1X9V A;  4N78 E;  4LGD E;  2GM4 A;  1YTZ I;  2H8P D;  1IK9 A;  2OYH C;  2M8R A;  5AW6 B;  3O8Z A;  3VMX A;  2JJL A;  5APV A;  5AVU B;  3M06 A;  2WT7 A;  1X79 B;  3A2A A;  3RK3 D;  1FZA A;  1NH4 A;  5AVZ B;  1KIL A;  1SVF A;  3U1A A;  1FBM A;  3P8C D;  5AW0 B;  3L4F A;  1WRG A;  1HVV A;  1VPC A;  3VMY A;  2XZR A;  2Q7C A;  1A02 J;  1X8Y A;  1IFN A;  2WSF H;  4EOT A;  1JY2 O;  1NTZ K;  3RL0 D;  1FU1 A;  3VMZ A;  1RF0 C;  1NKN A;  2P1J A;  1SQQ K;  5CCG A;  3NTN A;  2PP6 A;  1NKZ B;  3B5N A;  3IR9 A;  4O9B A;  3H6P A;  1LWU C;  1E5W A;  2R32 A;  1N7L A;  2L5G B;  5CMZ A;  4W80 A;  1Z56 A;  1LGH B;  2FYU K;  3N4X A;  4IFF A;  2FFD C;  1IFJ A;  1JCC A;  1IO4 A;  1H8A A;  1GZL A;  3V4Q A;  4GKG A;  2W6B A;  4N3Y B;  1SFC B;  2FFD A;  1L4A B;  5BU8 B;  1FJK A;  3RK2 D;  3M0D C;  2OAR A;  1HTL C;  4GIF A;  1JY3 P;  5AVX B;  2Q9I A;  2IPP A;  1H88 A;  1FAV A;  5AW1 B;  2FYZ A;  3HD7 A;  3EFG A;  1IFD A;  2W6A A;  1GL2 A;  5KJ7 A;  1LT9 A;  2XKM A;  4W7Y A;  4DZO A;  3A5T A;  2KSJ A;  3LIE A;  3GHG C;  1IC2 A;  2N1T C;  1NU1 K;  3MIW A;  5CCH D;  2P67 A;  1IJD B;  1HBW A;  1L4A A;  3VTP C;  1T8Z A;  3HTK B;  3B8E B;  3L35 A;  1CW5 A;  1N73 C;  2WPS A;  1DH3 A;  1T2K C;  1GTW A;  2OYI A;  1KIL D;  3VOP A;  4WBA A;  4RES B;  5APT A;  1G1J A;  5AW7 B;  1LTJ A;  3HE4 A;  2KLV A;  1KZU B;  3VN0 A;  1JUN A;  1HUC A;  1LTT C;  1L4A D;  3RK2 B;  3RK3 B;  3NFQ A;  2N9B A;  2YNY A;  3BAT A;  2O1J A;  1H89 A;  2C9L Y;  2O1K A;  3E1I A;  1LTS C;  2WSC H;  1SQP K;  2Q5U A;  3M9B A;  3M9H A;  5BVZ A;  2J59 M;  2Z5I A;  5APS A;  2HYN A;  1RY3 A;  3T97 A;  4Y99 C;  1WT6 A;  4WB4 A;  3P32 A;  5APW A;  1RF0 A;  3G3Z A;  2HLO A;  5KLV K;  3VP9 A;  3LW5 H;  1N7S B;  2WPQ A;  1MUU A;  4I1L A;  5AVV B;  2R3C A;  3HRN A;  4GT1 A;  1DEB A;  1ZR2 A;  4M3L A;  1MFZ A;  2IFM A;  3TYY A;  3HUS B;  3KPE A;  4WY4 C;  5AW3 B;  1JY2 P;  2A45 I;  5AW9 B;  4JF7 A;  3CLQ A;  3HD7 D;  5AW8 B;  4C7N B;  2FFD B;  2M3B A;  4XA4 A;  1J1D B;  5AVW B;  1FZG A;  1NTM K;  2R5D A;  1LT9 B;  2NPS D;  3HTK A;  5KTB A;  2CPB A;  2N1T A;  3TNU B;  1GD2 E;  3KQG A;  2YMY A;  5AW4 B;  1LT9 C;  5CCH A;  3TK1 A;  1NOH A;  2I1K A;  4JYB A;  3SWY A;  3HUS C;  1LTJ C;  3A7O A;  1NWQ A;  2QM8 A;  4WY4 B;  4N78 D;  2OYI B;  2HOD B;  1CI6 A;  1LTI C;  1ZV8 A;  5APX A;  3M0D A;  4C7N A;  4HH2 A;  3V2P A;  3M91 A;  1AQ5 A;  3L37 A;  1SQX K;  1GU5 A;  1GU4 A;  1ZR4 A;  3V4W A;  1L0L K;  1G1I A;  4I2L C;  3GHG A;  4I6M C;  1SP4 A;  3H32 A;  3V2R A;  3CL3 D;  1GW3 A;  1IFM A;  1SQV K;  1GL2 C;  2FKW B;  3HD7 B;  5KJ7 C;  1FZC B;  1S9K E;  1CI6 B;  2HOD A;  4KHX A;  2WSE H;  3TSI A;  1LWU B;  5AVT B;  1JY2 N;  1N2D C;  3NXS A;  4AQR D;  1GL2 D;  1NHL A;  1XTG B;  5KJ7 D;  1JO5 A;  1LTG C;  1G2C B;  3V5B A;  1KFN A;  2C0W A;  2P7J A;  1OWA A;  3HE5 A;  1KFM A;  1JOC A;  2J58 A;  2CPS A;  3B5N B;  1M1J A;  1N7S C;  2POH A;  1SQB K;  5CJ0 A;  3UIA A;  1NO4 A;  1LTA C;  4XE5 B;  3VP8 A;  2E42 A;  4W7Z A;  1NTK K;  3OJA B;  5CCG D;  1J1E B;  4EIJ A;  1PFI A;  1T3U A;  4ZKP A;  3HUS A;  2GUV A;  1HGV A;  3P7K A;  1KIL C;  1SFC A;  1DX7 A;  4AUW A;  1J2J B;  1QL1 A;  1AFO A;  3I5C A;  1JNM A;  1JY3 N;  4WY4 A;  2C9N Y;  2HPC B;  2LKM A;  4C7R A;  1J1E C;  5AW2 B;  4WY4 D;  3C9I A;  2OYH A;  2KYV A;  1J1D C;  2BAS A;  2KP8 A;  4LC1 A;  3B5N D;  3LID A;  5AVY B;  3KDP B;  2C0X A;  2XNX A;  3R2P A;  1XTC C;  2NPS C;  2IX7 C;  3OAK A;  5AVR B;  4OH8 B;  4DOJ A;  1FZB A;  1URQ B;  2NPS A;  1FOS E;  3VYI A;  3RK2 C;  3RK3 C;  1LTJ B;  1OXZ A;  2H43 A;  3N7N A;  2WIT A;  2OYI C;  3M9Q A;  1A02 F;  4Y99 B;  1JY3 O;  5APU A;  2ZXE B;  1HH0 A;  1JCD A;  2XDJ A;  3V2N A;  1NAF A;  3P8M C;  1RE4 A;  1MV8 A;  4N6J A;  3BVH A;  2A45 H;  3HE5 B;  3II6 A;  2YKO A;  1RE3 A;  1LTB C;  1M1J B;  1S9K D;  2A45 G;  2Q3I A;  3HD7 C;  3WMM 0;  3MUD A;  2KOG A;  2YO2 A;  3A3Y B;  5CJ4 A;  3U1C A;  1GK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...