2WVRA

Human cdt1:geminin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
70
structure length
70
Chain Sequence
b'KENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
molecule tags Replication
source organism Homo sapiens
publication title Quaternary Structure of the Human Cdt1-Geminin Complex Regulates DNA Replication Licensing.
pubmed doi rcsb
total genus 33
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07412 Geminin Geminin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2wvrA00
3E1RA 3WUUA 2WVRA 4BRYA 2Q6QA 4BRYB 3F5HA 3WUVA 2ZXXA 3WUTA 1UIIA
chains in the Genus database with same CATH superfamily
3H1KD 5APYA 1SQQG 4KHXA 1N73A 3MGNA 1LT9A 1OVVA 2PAJA 3MIWA 1RF1C 3MUDC 3RL0D 4JYCA 2HLOA 3WU2E 2AEMA 3H1IG 1ZR2A 1LTAC 3S1KA 1BE3G 2FYZA 4ZKUA 3T97B 5AVTB 3A0BE 1J1DB 2HODA 1D7MA 3M0DC 3TGUD 2A06E 4Y99C 1N7SB 1KZUB 3H1HE 1RHZB 3NXSA 4JQ0D 5AW3B 3TDKA 1QVGO 4RO0A 2WT7B 1X0TA 4AYCA 1FZCB 1NTMK 1OX3A 3HD7B 2OYIB 3CCMP 1IJDB 3H1KG 3S9OA 1FC2C 2OYOA 5H2FE 1GD2E 2Y0DA 5CMZA 1DIPA 1G2CA 3CWBE 3RL0C 1BE3J 3Q1MA 1JMMA 5AVQB 3VP9A 4DCKA 4ZMDA 1FDMA 1L0NK 5GTHH 4U7JA 1KB9H 1MUUA 5AW8B 3TF5A 2FFDC 3L72J 2B87A 3E1IA 1HF9A 2IBZE 2K1AA 2NPSA 4A7PA 1SQVE 1M8OB 4IL6H 3CWBD 1FZEA 3L73J 1JNMA 3AEGC 4K3AA 1GU5A 3BCCE 3H25A 5CCHC 4PV1C 1KFMA 3HE5A 1OVRA 4IL6E 1NTME 4GKGA 4L75A 1NHLA 1FZGA 3BRTB 2YO2A 3CC7P 2Z5HA 3CMEP 1KQSO 1FJPA 4WWIA 2UWJE 4HYTB 4MN4C 4TLFA 1CI6B 1LWUB 3H1JG 1SQQE 4EIJA 2JEEA 1KYOE 1L0NE 1GZLA 2AEJA 3FWNA 5AW9B 5KKZB 3FWLA 3RK3B 2H7HA 2A45G 2QIWA 3JSVC 2AXTE 1SVFA 2FY8A 4HJGH 5AVSB 3Q5PA 1RF0A 1VQMP 2KI7B 3HD7D 3CXHI 3L36A 3P8CD 2P67A 4PD4E 1L0ND 2W90A 1FZBA 1MV8A 1BGYD 1P84D 4YXDC 2IBZG 3V2PA 2GUVA 2CK3H 2C0WA 3PRJA 5AW5B 1M7LA 1TU3F 3L72E 4H0LB 2YMKA 3SFDC 3H1JE 1KN7A 3AE2C 2H43A 4EI2A 2I8DA 1QLED 4EYYQ 3MD0A 1N73B 1K05A 4U3FE 2PGDA 3USSA 5CCGA 2QEXP 4BXLA 2ZT9C 4PJ0H 3HUSC 1SQPK 1H8AA 2P58A 2IYPA 3GLMA 2B87B 2OYHB 3I55P 1SQBG 2WQYC 1EZVD 2GUSA 1R5LA 2AEFA 3K5BA 3PTZA 1KQFB 1OVUA 2C9NY 4C7RA 1OFCX 3R4YA 5APVA 1G2CB 1T2KD 4OGQC 2V7QH 1N8RQ 3M9HA 1SQPG 1ZW0A 1M1JA 1NVOA 2K9YA 1KQLA 1Z56A 3CCSP 5DJTB 1NTMD 2ZT9D 5M1BA 1RE4A 2IBZI 2N1TD 4Y99B 3TGUE 4WVZA 4HB1A 3AECC 3H1LD 5CCHD 1OW7A 4N78D 5KAIH 3AEAC 2KUBA 3SSUA 1NU1J 1SQBE 2BASA 4GDOA 3M91A 1RF1B 2WSCJ 1BE3E 4I7ZB 5CBNA 3A2AA 3G3ZA 1JUNA 4I1LA 1EDLA 1SQXD 2HG5D 2M3EA 1LGHB 4RKUJ 4ZNCA 5CCGD 1BDCA 3NFQA 3PJSK 1EDIA 1SQPD 4LGDE 2WT7A 1FZCA 3HE4A 1N7LA 3CCQP 2KNCB 1T3JA 1OZHA 1GK6A 3KQGA 5AW1B 2BCCD 3TNUA 1CI6A 1E79H 1FS0E 1M57D 1NTZE 1NU1G 5KJ7D 2IYOA 2Q1KA 2AXCA 2L91A 2DW3A 1QVFO 5K5GB 1PP9D 2M5AA 1EZVE 3GHGB 1AA0A 1KQGB 3B5NA 1VDFA 4W7ZA 4Z1MH 3CPWO 2E75D 2P2UA 3H1HJ 2KIKA 1JY3P 1IK9A 4Y28J 3P7KA 1JCDA 4PD4H 3V2NA 3LIDA 1SQPJ 3C1LA 4I2LC 2LR2A 4U3FD 3Q5SA 3VOPA 1VQPP 1K9MQ 1JY2O 1YITP 1JEKA 4H0LC 3PH0A 3A5TA 1PFIA 1NGMB 2NZ2A 2QJKC 1S9KE 5CCGC 1KYOH 3A7OA 1NTZD 2Z5IA 3AE4C 3HRNA 3HUSA 1W2BO 1SQXK 2NPSC 4GOFA 5KAIE 3L71G 4OGQB 1PPJE 1LTTC 1PP9G 2A45H 4UB8E 4QMAA 2Q7CA 2YIUB 1IFNA 3AEDC 1GL2A 1FAVA 2H88C 1SQVD 2R32A 2E76C 2LKMA 4WY4D 2C0XA 4I6MC 2I1KA 1LTJA 1BCCJ 2WSEH 3U1AA 1KORA 1U57A 5APWA 3CI9A 3RK3C 2FXPA 2IPPA 3L75G 5CBOA 3CMAP 5KKZC 4DOJA 2N1TB 1HH0A 5KLIC 5TISE 5B5EH 4C7NB 2JP3A 1Q86Q 3V4QA 4U3FJ 1NO4A 1J2JB 3D71A 5KLVG 5APQA 1UIIA 5GTHE 1MFZA 2OARA 2VRSA 1GK4A 1M90Q 1S3JA 1VQ7P 2R5BA 4OWFA 2QJPB 3GF7A 1YQ4C 3P32A 2P1JA 2FXOA 2J59M 3CL3D 3H1LG 2E5TA 3M9QA 2BEQD 2MJZA 2JO1A 2IFNA 2W6BA 5H2FH 2KP8A 2OTKE 3G71P 3S4RA 1FZFA 1OW6A 2FFDB 1ZV8A 2JWDA 2KZIA 3L70E 2WPSA 1NTZK 1P84H 2H8PD 3GHGA 3KXDA 1PP9E 1S4XA 1DEEG 1VQ5P 2IBZD 1YI2P 1GDTA 1RF1A 2N1TC 1H89A 2OYHA 1JY3O 1XTGB 3N4XA 2HFED 2N1TA 2WPRA 1AQTA 1SQXJ 2HR3A 2M3BA 1BGYJ 1OXZA 2N9BA 1SFCA 2ZJSE 3C8VA 1USDA 2BCCG 1GMJA 3RBXA 3TYYA 3I56P 1FE6A 1IFIA 1NU1D 1BDDA 2B9BA 2IDBA 2ZFCA 1K04A 2QJKB 3HE4B 3II6A 3PP5A 5B66H 5AVVB 1EZVI 1AVYA 1SP4A 3L73G 1OW8A 1HJ0A 1S5LX 2NPSB 2RN0A 2WWWA 2ZAEB 2WTYA 2FFDA 3L70G 1FDOA 2LXBA 1EDKA 1NTMJ 4JYBA 4N6JA 4UB8H 1KV4A 1RH5B 1AV1A 1LTSC 3HTKB 2J5UA 3D6ZA 3H1ID 2KS1A 3H1LE 3O6QB 2D2CB 1JCCA 1N7SD 2M8RA 3VMXA 2FXMA 3ITKA 1RQVA 1VPCA 4K35A 4DZOA 2RH0A 5E79E 1LT1A 2ZYGA 4N3YB 1Q90D 1T6AA 3EFGA 5KLVE 4NPEA 2W8ZA 1NTKE 1R8EA 3FXDA 1Y9BA 3CWBJ 2NRGA 1NAFA 3L73D 2E76D 3OA7A 4H13C 1GL2B 3A0BH 1VQOP 3H1IJ 1YJNP 1S9KD 1EDJA 1FU1A 3CCLP 1Y47A 1NU1K 1J1EB 2OQQA 2ZYDA 1L0LG 1N7SC 1SQVJ 1BE3D 2KXPB 4BRYB 3Q3DA 2Q9IA 1J1DC 1PGJA 1T8ZA 3G6EP 2XZRA 3HD7A 3CC2P 3CWBG 3EWKA 3H6PA 1YBKA 1SQVK 4I7ZC 3JC22 1U7JA 1CSBA 2K37A 1Q82Q 3QH9A 4N78E 2KOGA 2W83C 2KSJA 3AEEC 1HWTC 1OWAA 3KDPB 3FXEA 3U59A 3L4FA 1GTWA 1SFCB 4L73A 2QJYC 3RK2B 5KAFH 2M5AB 4HH2A 5APUA 5BVZA 2O01J 3WUTA 4GODA 2D2CD 3OAKA 1L4AD 1KB9D 4PV1D 3VMZA 3OW2O 2W27A 1YQ3C 1ZLLA 3U1CA 2A45I 2CPBA 1YHQP 1S72P 2ZXEB 5CJ0A 2NPSD 1PZQA 2ZT9B 4GT1A 2IZ1A 3RBZA 1AFOA 3GG2A 2WSFH 2BCCJ 4YTPC 5AVZB 2P7JA 2PP6A 1N73C 4OVNF 2WSEJ 1LWUA 1EXIA 4IFDK 4L76A 1X79B 2R3SA 2WSFJ 2KLVA 2E75C 4PD4I 2WVRA 2D2CC 1MKMA 1NKNA 2ZVOB 4TT3H 1QL2A 3CXHE 1KD1Q 3H1JD 3GW6A 1HBWA 1JTHB 2OGUA 3BCCJ 3L72D 1EXJA 3OJAB 1VQLP 3E1RA 2O1JA 1BCCD 1URQA 3BATA 3L75D 1Q7YQ 1X9VA 1ZXGA 2MKVA 3L73E 1VQNP 3H1LJ 3KHUA 2XNXA 2Y0CA 1N7SA 2ZYAA 2FYUG 5KLIB 3BRVB 3O6QA 3Q5RA 4CPGA 1SQQK 3LW5J 3KZIE 1VQ4P 3H32B 1NTZJ 1K73Q 4WY4C 5KLVJ 1LP1B 2Q6QA 1PGOA 4ZKPA 2WPVB 1JY2N 2XU6A 2JR8A 2ITAA 3MHVA 3A0HE 3MZWB 2QA4P 1YYCA 1NKZB 3CX5I 3H1IE 2W6AA 3VMAA 3H1HD 2IFMA 1JTHA 3KYQA 2I1JA 1KC8Q 5AW0B 1E5WA 2IX7C 3M0DA 1SFCD 1IFMA 2FKWB 1W5CE 4LLHA 1DD4A 3B8EB 3CCUP 1PP9J 3M06A 3B5NB 3L71J 3ABVC 2QJPC 3O8ZA 4IFFA 1ZP0C 2WPQA 3CXHD 3RL0g 1T2KC 3MUDA 3GF3A 1SQBD 3IAOA 3P8MC 1NWQA 1LT9C 3L74G 1ZR4A 1AQ5A 1L0LE 1VQ6P 1BGYE 1P84E 2ZXXA 4KT0J 2JWAA 3H1KE 1A02F 5GTIH 4HKZH 5AVXB 3GHGC 2Y9ZA 2KLUA 5E79H 1M1JB 2K9JA 1DD3A 1SQVG 1ZOYC 4O9BA 1L0NJ 2E76B 3FGAD 1GL2D 3RL0B 1FBMA 1KMIZ 1G1IA 1A02J 2V7QJ 1KB9E 1PGPA 1PL5A 2BEZF 2KS1B 1HUCA 1N86A 2QE7H 1JY3N 3B5NC 3IF4A 3JCUH 2PFXA 1HTLC 2XKMA 1IFDA 3KZIH 5APTA 3RK2C 3RK3E 3TGUG 1RQUA 1L0NG 2OYIC 1VF5C 4C46A 2HYNA 5C39A 5AVUB 1DX7A 2E74D 5B66E 1IFPA 2L5GB 4NPFX 1YTZI 3L37A 1P84I 2QVAA 2WITA 2V4HA 3IR9A 3FX0A 5AW2B 2YNYA 4DT0A 1QGKB 2LXCB 3CXHH 3L35A 2KB7P 3L74J 1GU4A 1OIPA 2OTLP 1EQ7A 2W6JH 5AW6B 3RK2D 1FJKA 1L0LD 1BSNA 1Q2NA 5APXA 3CCEP 1HGZA 1LTJC 5TISH 1DH3A 4PJ0E 2B89A 3WUVA 5BU5A 2R44A 3NTNA 3QWOC 1IFJA 1Y8AA 2KSEA 2WZ7A 4PD4D 1RE4C 1NTKK 2Y0EA 4R4MA 1L2PA 2K88A 2OYHC 1SQXG 3AEBC 3B5ND 3HUSB 4RESB 1X8YA 4JBZA 2Z4EA 1S2EA 1IK7A 1VQKP 1KYOD 3V5BA 1NTZG 1SQQD 4GOEA 4BWNA 1FDIA 2H89C 2O3JA 2A06G 1AVOA 1NTKG 3VMYA 1QEXA 2FYUJ 3RK3D 1U7MA 3VYIA 2FYNB 5B5EE 1VQ8P 1M1KQ 2C9LY 1KYOI 4AQRD 1IC2A 1NAYA 1Q81Q 1JO5A 1VL2A 3W68A 1ZMEC 1LTJB 2RMZA 3AE9C 2JJLA 2XDJA 3E7KA 4H44B 3VP8A 2AXTH 3R2PA 3D6YA 4UB6H 1NTKJ 3AE8C 3L75E 2O01H 4H44C 3AEFC 1SQPE 2E42A 1ZRTD 3PLNA 2YXRB 4YPCA 3Q2YA 1LTBC 1KILB 3SWKA 3CX5H 3H32A 3C9IA 1LJ2A 3HE5B 1CW5A 1SQBK 3L71E 3LIEA 3AE6C 2E43A 3D70A 1BCCG 1VF5B 3VTPC 4W7YA 5DJUB 2E74B 2YXQB 1PPJD 2RKLA 3A0HH 1MFTA 2KZJA 2YKPA 3SWFA 3B4SA 2P10A 4D6TD 1YIJP 1FOSF 2POHA 1ZRTE 5CJ4A 3TSIA 1MZ9A 1AJYA 4PV1B 2KYVA 3EFFK 3TK1A 2YKOA 1NJIQ 1M1JC 2Q3IA 5CHXA 4H13B 1S1CX 1G1JA 2QG4A 1JM0A 3AE3C 3B71A 1YJ9P 5AVWB 1M56D 2OYIA 1L4AC 1N2DC 3L74E 1PV3A 3H1HG 4IFMA 4M3LA 2O01N 1ZN5A 2Q5UA 4H44D 5AVRB 4WY4A 3WUUA 3TGUJ 1KB9I 1S5LE 3JCUE 3L72G 2BCCE 3CC4P 2J58A 1L0LJ 3I5CA 1WRGA 2JDIH 1BSHA 2HODB 2FBWC 4D6TE 1LWUC 1BCCE 3A3YB 4H0LD 4RJTA 1FZCC 1KTMA 4WB4A 1JB0J 1L0LK 4YXWH 1CZQA 4C7NA 4DJGA 2PRRA 2XNDH 3BCCD 3H1KJ 1URQD 4XA4A 1VQ9P 3IN6A 1RY3A 3SFEC 2CPSA 1EC5A 3AE5C 5L8RJ 3GMAA 4XE5B 3SWYA 3CCVP 3BASA 3V2RA 1NTKD 1OMIA 3CLQA 1LNQA 3P8CE 1PIXA 3AE7C 1WMKA 3IFMA 2SPZA 2FYUE 2WMMA 5KAFE 1IO4A 1NOHA 2HPCA 2JKVA 4OGQD 3WU2H 2KK7A 3AE1C 2O1KA 3L70D 4R4LA 2FYUD 1S5LH 4H13D 2E5YA 1LT9B 1JY2P 1L4AB 1NTMG 4OH8B 3L70J 5KLVK 2WSSH 5KTBA 1SQQJ 1H0TA 5TJHA 3EQ2A 2R5DA 3BCCG 3W67A 5APSA 4KJMA 3V4WA 3VN0A 2XV5A 1GW3A 3CCRP 4AUWA 1X22A 1GW4A 3HD7C 3NMDA 1QX8A 1SQXE 2N9YB 1BGYG 2YKQA 3MTUE 1KFNA 1NU1E 1SQBJ 1XTCC 2B88A 2WSCH 3ZDMA 1YJWP 3BVHA 3V2QA 1NYHA 3L71D 3MP7B 4ASVA 2E74C 3HTKA 2K3RA 2K9JB 1KILC 5CCHA 1URQC 5AVYB 4D6TG 1JOCA 1HJBA 1W2EA 2QRXA 2Y9YA 4L74A 4WY4B 4IOIH 2G8YA 1WT6A 4LC1A 3TNUB 4ASWA 3L74D 1H88A 4JPZB 2YMYA 1NH4A 1UIXA 3UIAA 1L4AA 1H0TB 2YIUC 1RE3C 5EFWB 2ZVNB 3CX5E 1SLQA 2FYUK 4W80A 5KLVD 4WBAA 1EZVG 2R3CA 2M0BA 2A06D 2KNCA 2QM8A 1KILD 4U3FG 3G4SP 3N7NA 3CCJP 2OTJP 4JF7A 1K8AQ 1RF0C 1R5SA 1URQB 4UB6E 1JMBA 2QM7A 5AW4B 5AW7B 2FYNC 3WMM0 2E75B 4IL6X 3RGUA 4B86A 1HVVA 1IZNB 1RE3A 1YTZT 3L75J 5BU8B 2Q3EA 4EOTA 1VF5D 3F5HA 1J1EC 4XFJA 1KILE 3M9BA 1SS1A 3LW5H 4D6TJ 2HPCB 2IZ0A 5GTIE 3H1JJ 3KPEA 1PGQA 3F89A 4GIFA 4BRYA 1LP1A 4EDFA 3CX5D 1KILA 1GL2C 2G3AA 2GM4A 1QL1A 3T97A 5KJ7A 1FOSE 1T3UA 2YO3A 1USEA 3G9RA 5KJ7C 3CD6P 1FZAA 3PHLA 3V6IA 2QSIA 1DEBA 1HGVA 3M0AA 4NPDA 2QJYB 1LTGC 1SFCC 1PPJG 2GA1A 1LTIC
chains in the Genus database with same CATH topology
3E1RA 3WUUA 2WVRA 4BRYA 2Q6QA 4BRYB 3F5HA 3WUVA 2ZXXA 3WUTA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1R A;  3WUU A;  2WVR A;  4BRY A;  2Q6Q A;  4BRY B;  3F5H A;  3WUV A;  2ZXX A;  3WUT A;  1UII A; 
#chains in the Genus database with same CATH topology
 3H1K D;  5APY A;  1SQQ G;  4KHX A;  1N73 A;  3MGN A;  1LT9 A;  1OVV A;  2PAJ A;  3MIW A;  1RF1 C;  3MUD C;  3RL0 D;  4JYC A;  2HLO A;  3WU2 E;  2AEM A;  3H1I G;  1ZR2 A;  1LTA C;  3S1K A;  1BE3 G;  2FYZ A;  4ZKU A;  3T97 B;  5AVT B;  3A0B E;  1J1D B;  2HOD A;  1D7M A;  3M0D C;  3TGU D;  2A06 E;  4Y99 C;  1N7S B;  1KZU B;  3H1H E;  1RHZ B;  3NXS A;  4JQ0 D;  5AW3 B;  3TDK A;  1QVG O;  4RO0 A;  2WT7 B;  1X0T A;  4AYC A;  1FZC B;  1NTM K;  1OX3 A;  3HD7 B;  2OYI B;  3CCM P;  1IJD B;  3H1K G;  3S9O A;  1FC2 C;  2OYO A;  5H2F E;  1GD2 E;  2Y0D A;  5CMZ A;  1DIP A;  1G2C A;  3CWB E;  3RL0 C;  1BE3 J;  3Q1M A;  1JMM A;  5AVQ B;  3VP9 A;  4DCK A;  4ZMD A;  1FDM A;  1L0N K;  5GTH H;  4U7J A;  1KB9 H;  1MUU A;  5AW8 B;  3TF5 A;  2FFD C;  3L72 J;  2B87 A;  3E1I A;  1HF9 A;  2IBZ E;  2K1A A;  2NPS A;  4A7P A;  1SQV E;  1M8O B;  4IL6 H;  3CWB D;  1FZE A;  3L73 J;  1JNM A;  3AEG C;  4K3A A;  1GU5 A;  3BCC E;  3H25 A;  5CCH C;  4PV1 C;  1KFM A;  3HE5 A;  1OVR A;  4IL6 E;  1NTM E;  4GKG A;  4L75 A;  1NHL A;  1FZG A;  3BRT B;  2YO2 A;  3CC7 P;  2Z5H A;  3CME P;  1KQS O;  1FJP A;  4WWI A;  2UWJ E;  4HYT B;  4MN4 C;  4TLF A;  1CI6 B;  1LWU B;  3H1J G;  1SQQ E;  4EIJ A;  2JEE A;  1KYO E;  1L0N E;  1GZL A;  2AEJ A;  3FWN A;  5AW9 B;  5KKZ B;  3FWL A;  3RK3 B;  2H7H A;  2A45 G;  2QIW A;  3JSV C;  2AXT E;  1SVF A;  2FY8 A;  4HJG H;  5AVS B;  3Q5P A;  1RF0 A;  1VQM P;  2KI7 B;  3HD7 D;  3CXH I;  3L36 A;  3P8C D;  2P67 A;  4PD4 E;  1L0N D;  2W90 A;  1FZB A;  1MV8 A;  1BGY D;  1P84 D;  4YXD C;  2IBZ G;  3V2P A;  2GUV A;  2CK3 H;  2C0W A;  3PRJ A;  5AW5 B;  1M7L A;  1TU3 F;  3L72 E;  4H0L B;  2YMK A;  3SFD C;  3H1J E;  1KN7 A;  3AE2 C;  2H43 A;  4EI2 A;  2I8D A;  1QLE D;  4EYY Q;  3MD0 A;  1N73 B;  1K05 A;  4U3F E;  2PGD A;  3USS A;  5CCG A;  2QEX P;  4BXL A;  2ZT9 C;  4PJ0 H;  3HUS C;  1SQP K;  1H8A A;  2P58 A;  2IYP A;  3GLM A;  2B87 B;  2OYH B;  3I55 P;  1SQB G;  2WQY C;  1EZV D;  2GUS A;  1R5L A;  2AEF A;  3K5B A;  3PTZ A;  1KQF B;  1OVU A;  2C9N Y;  4C7R A;  1OFC X;  3R4Y A;  5APV A;  1G2C B;  1T2K D;  4OGQ C;  2V7Q H;  1N8R Q;  3M9H A;  1SQP G;  1ZW0 A;  1M1J A;  1NVO A;  2K9Y A;  1KQL A;  1Z56 A;  3CCS P;  5DJT B;  1NTM D;  2ZT9 D;  5M1B A;  1RE4 A;  2IBZ I;  2N1T D;  4Y99 B;  3TGU E;  4WVZ A;  4HB1 A;  3AEC C;  3H1L D;  5CCH D;  1OW7 A;  4N78 D;  5KAI H;  3AEA C;  2KUB A;  3SSU A;  1NU1 J;  1SQB E;  2BAS A;  4GDO A;  3M91 A;  1RF1 B;  2WSC J;  1BE3 E;  4I7Z B;  5CBN A;  3A2A A;  3G3Z A;  1JUN A;  4I1L A;  1EDL A;  1SQX D;  2HG5 D;  2M3E A;  1LGH B;  4RKU J;  4ZNC A;  5CCG D;  1BDC A;  3NFQ A;  3PJS K;  1EDI A;  1SQP D;  4LGD E;  2WT7 A;  1FZC A;  3HE4 A;  1N7L A;  3CCQ P;  2KNC B;  1T3J A;  1OZH A;  1GK6 A;  3KQG A;  5AW1 B;  2BCC D;  3TNU A;  1CI6 A;  1E79 H;  1FS0 E;  1M57 D;  1NTZ E;  1NU1 G;  5KJ7 D;  2IYO A;  2Q1K A;  2AXC A;  2L91 A;  2DW3 A;  1QVF O;  5K5G B;  1PP9 D;  2M5A A;  1EZV E;  3GHG B;  1AA0 A;  1KQG B;  3B5N A;  1VDF A;  4W7Z A;  4Z1M H;  3CPW O;  2E75 D;  2P2U A;  3H1H J;  2KIK A;  1JY3 P;  1IK9 A;  4Y28 J;  3P7K A;  1JCD A;  4PD4 H;  3V2N A;  3LID A;  1SQP J;  3C1L A;  4I2L C;  2LR2 A;  4U3F D;  3Q5S A;  3VOP A;  1VQP P;  1K9M Q;  1JY2 O;  1YIT P;  1JEK A;  4H0L C;  3PH0 A;  3A5T A;  1PFI A;  1NGM B;  2NZ2 A;  2QJK C;  1S9K E;  5CCG C;  1KYO H;  3A7O A;  1NTZ D;  2Z5I A;  3AE4 C;  3HRN A;  3HUS A;  1W2B O;  1SQX K;  2NPS C;  4GOF A;  5KAI E;  3L71 G;  4OGQ B;  1PPJ E;  1LTT C;  1PP9 G;  2A45 H;  4UB8 E;  4QMA A;  2Q7C A;  2YIU B;  1IFN A;  3AED C;  1GL2 A;  1FAV A;  2H88 C;  1SQV D;  2R32 A;  2E76 C;  2LKM A;  4WY4 D;  2C0X A;  4I6M C;  2I1K A;  1LTJ A;  1BCC J;  2WSE H;  3U1A A;  1KOR A;  1U57 A;  5APW A;  3CI9 A;  3RK3 C;  2FXP A;  2IPP A;  3L75 G;  5CBO A;  3CMA P;  5KKZ C;  4DOJ A;  2N1T B;  1HH0 A;  5KLI C;  5TIS E;  5B5E H;  4C7N B;  2JP3 A;  1Q86 Q;  3V4Q A;  4U3F J;  1NO4 A;  1J2J B;  3D71 A;  5KLV G;  5APQ A;  1UII A;  5GTH E;  1MFZ A;  2OAR A;  2VRS A;  1GK4 A;  1M90 Q;  1S3J A;  1VQ7 P;  2R5B A;  4OWF A;  2QJP B;  3GF7 A;  1YQ4 C;  3P32 A;  2P1J A;  2FXO A;  2J59 M;  3CL3 D;  3H1L G;  2E5T A;  3M9Q A;  2BEQ D;  2MJZ A;  2JO1 A;  2IFN A;  2W6B A;  5H2F H;  2KP8 A;  2OTK E;  3G71 P;  3S4R A;  1FZF A;  1OW6 A;  2FFD B;  1ZV8 A;  2JWD A;  2KZI A;  3L70 E;  2WPS A;  1NTZ K;  1P84 H;  2H8P D;  3GHG A;  3KXD A;  1PP9 E;  1S4X A;  1DEE G;  1VQ5 P;  2IBZ D;  1YI2 P;  1GDT A;  1RF1 A;  2N1T C;  1H89 A;  2OYH A;  1JY3 O;  1XTG B;  3N4X A;  2HFE D;  2N1T A;  2WPR A;  1AQT A;  1SQX J;  2HR3 A;  2M3B A;  1BGY J;  1OXZ A;  2N9B A;  1SFC A;  2ZJS E;  3C8V A;  1USD A;  2BCC G;  1GMJ A;  3RBX A;  3TYY A;  3I56 P;  1FE6 A;  1IFI A;  1NU1 D;  1BDD A;  2B9B A;  2IDB A;  2ZFC A;  1K04 A;  2QJK B;  3HE4 B;  3II6 A;  3PP5 A;  5B66 H;  5AVV B;  1EZV I;  1AVY A;  1SP4 A;  3L73 G;  1OW8 A;  1HJ0 A;  1S5L X;  2NPS B;  2RN0 A;  2WWW A;  2ZAE B;  2WTY A;  2FFD A;  3L70 G;  1FDO A;  2LXB A;  1EDK A;  1NTM J;  4JYB A;  4N6J A;  4UB8 H;  1KV4 A;  1RH5 B;  1AV1 A;  1LTS C;  3HTK B;  2J5U A;  3D6Z A;  3H1I D;  2KS1 A;  3H1L E;  3O6Q B;  2D2C B;  1JCC A;  1N7S D;  2M8R A;  3VMX A;  2FXM A;  3ITK A;  1RQV A;  1VPC A;  4K35 A;  4DZO A;  2RH0 A;  5E79 E;  1LT1 A;  2ZYG A;  4N3Y B;  1Q90 D;  1T6A A;  3EFG A;  5KLV E;  4NPE A;  2W8Z A;  1NTK E;  1R8E A;  3FXD A;  1Y9B A;  3CWB J;  2NRG A;  1NAF A;  3L73 D;  2E76 D;  3OA7 A;  4H13 C;  1GL2 B;  3A0B H;  1VQO P;  3H1I J;  1YJN P;  1S9K D;  1EDJ A;  1FU1 A;  3CCL P;  1Y47 A;  1NU1 K;  1J1E B;  2OQQ A;  2ZYD A;  1L0L G;  1N7S C;  1SQV J;  1BE3 D;  2KXP B;  4BRY B;  3Q3D A;  2Q9I A;  1J1D C;  1PGJ A;  1T8Z A;  3G6E P;  2XZR A;  3HD7 A;  3CC2 P;  3CWB G;  3EWK A;  3H6P A;  1YBK A;  1SQV K;  4I7Z C;  3JC2 2;  1U7J A;  1CSB A;  2K37 A;  1Q82 Q;  3QH9 A;  4N78 E;  2KOG A;  2W83 C;  2KSJ A;  3AEE C;  1HWT C;  1OWA A;  3KDP B;  3FXE A;  3U59 A;  3L4F A;  1GTW A;  1SFC B;  4L73 A;  2QJY C;  3RK2 B;  5KAF H;  2M5A B;  4HH2 A;  5APU A;  5BVZ A;  2O01 J;  3WUT A;  4GOD A;  2D2C D;  3OAK A;  1L4A D;  1KB9 D;  4PV1 D;  3VMZ A;  3OW2 O;  2W27 A;  1YQ3 C;  1ZLL A;  3U1C A;  2A45 I;  2CPB A;  1YHQ P;  1S72 P;  2ZXE B;  5CJ0 A;  2NPS D;  1PZQ A;  2ZT9 B;  4GT1 A;  2IZ1 A;  3RBZ A;  1AFO A;  3GG2 A;  2WSF H;  2BCC J;  4YTP C;  5AVZ B;  2P7J A;  2PP6 A;  1N73 C;  4OVN F;  2WSE J;  1LWU A;  1EXI A;  4IFD K;  4L76 A;  1X79 B;  2R3S A;  2WSF J;  2KLV A;  2E75 C;  4PD4 I;  2WVR A;  2D2C C;  1MKM A;  1NKN A;  2ZVO B;  4TT3 H;  1QL2 A;  3CXH E;  1KD1 Q;  3H1J D;  3GW6 A;  1HBW A;  1JTH B;  2OGU A;  3BCC J;  3L72 D;  1EXJ A;  3OJA B;  1VQL P;  3E1R A;  2O1J A;  1BCC D;  1URQ A;  3BAT A;  3L75 D;  1Q7Y Q;  1X9V A;  1ZXG A;  2MKV A;  3L73 E;  1VQN P;  3H1L J;  3KHU A;  2XNX A;  2Y0C A;  1N7S A;  2ZYA A;  2FYU G;  5KLI B;  3BRV B;  3O6Q A;  3Q5R A;  4CPG A;  1SQQ K;  3LW5 J;  3KZI E;  1VQ4 P;  3H32 B;  1NTZ J;  1K73 Q;  4WY4 C;  5KLV J;  1LP1 B;  2Q6Q A;  1PGO A;  4ZKP A;  2WPV B;  1JY2 N;  2XU6 A;  2JR8 A;  2ITA A;  3MHV A;  3A0H E;  3MZW B;  2QA4 P;  1YYC A;  1NKZ B;  3CX5 I;  3H1I E;  2W6A A;  3VMA A;  3H1H D;  2IFM A;  1JTH A;  3KYQ A;  2I1J A;  1KC8 Q;  5AW0 B;  1E5W A;  2IX7 C;  3M0D A;  1SFC D;  1IFM A;  2FKW B;  1W5C E;  4LLH A;  1DD4 A;  3B8E B;  3CCU P;  1PP9 J;  3M06 A;  3B5N B;  3L71 J;  3ABV C;  2QJP C;  3O8Z A;  4IFF A;  1ZP0 C;  2WPQ A;  3CXH D;  3RL0 g;  1T2K C;  3MUD A;  3GF3 A;  1SQB D;  3IAO A;  3P8M C;  1NWQ A;  1LT9 C;  3L74 G;  1ZR4 A;  1AQ5 A;  1L0L E;  1VQ6 P;  1BGY E;  1P84 E;  2ZXX A;  4KT0 J;  2JWA A;  3H1K E;  1A02 F;  5GTI H;  4HKZ H;  5AVX B;  3GHG C;  2Y9Z A;  2KLU A;  5E79 H;  1M1J B;  2K9J A;  1DD3 A;  1SQV G;  1ZOY C;  4O9B A;  1L0N J;  2E76 B;  3FGA D;  1GL2 D;  3RL0 B;  1FBM A;  1KMI Z;  1G1I A;  1A02 J;  2V7Q J;  1KB9 E;  1PGP A;  1PL5 A;  2BEZ F;  2KS1 B;  1HUC A;  1N86 A;  2QE7 H;  1JY3 N;  3B5N C;  3IF4 A;  3JCU H;  2PFX A;  1HTL C;  2XKM A;  1IFD A;  3KZI H;  5APT A;  3RK2 C;  3RK3 E;  3TGU G;  1RQU A;  1L0N G;  2OYI C;  1VF5 C;  4C46 A;  2HYN A;  5C39 A;  5AVU B;  1DX7 A;  2E74 D;  5B66 E;  1IFP A;  2L5G B;  4NPF X;  1YTZ I;  3L37 A;  1P84 I;  2QVA A;  2WIT A;  2V4H A;  3IR9 A;  3FX0 A;  5AW2 B;  2YNY A;  4DT0 A;  1QGK B;  2LXC B;  3CXH H;  3L35 A;  2KB7 P;  3L74 J;  1GU4 A;  1OIP A;  2OTL P;  1EQ7 A;  2W6J H;  5AW6 B;  3RK2 D;  1FJK A;  1L0L D;  1BSN A;  1Q2N A;  5APX A;  3CCE P;  1HGZ A;  1LTJ C;  5TIS H;  1DH3 A;  4PJ0 E;  2B89 A;  3WUV A;  5BU5 A;  2R44 A;  3NTN A;  3QWO C;  1IFJ A;  1Y8A A;  2KSE A;  2WZ7 A;  4PD4 D;  1RE4 C;  1NTK K;  2Y0E A;  4R4M A;  1L2P A;  2K88 A;  2OYH C;  1SQX G;  3AEB C;  3B5N D;  3HUS B;  4RES B;  1X8Y A;  4JBZ A;  2Z4E A;  1S2E A;  1IK7 A;  1VQK P;  1KYO D;  3V5B A;  1NTZ G;  1SQQ D;  4GOE A;  4BWN A;  1FDI A;  2H89 C;  2O3J A;  2A06 G;  1AVO A;  1NTK G;  3VMY A;  1QEX A;  2FYU J;  3RK3 D;  1U7M A;  3VYI A;  2FYN B;  5B5E E;  1VQ8 P;  1M1K Q;  2C9L Y;  1KYO I;  4AQR D;  1IC2 A;  1NAY A;  1Q81 Q;  1JO5 A;  1VL2 A;  3W68 A;  1ZME C;  1LTJ B;  2RMZ A;  3AE9 C;  2JJL A;  2XDJ A;  3E7K A;  4H44 B;  3VP8 A;  2AXT H;  3R2P A;  3D6Y A;  4UB6 H;  1NTK J;  3AE8 C;  3L75 E;  2O01 H;  4H44 C;  3AEF C;  1SQP E;  2E42 A;  1ZRT D;  3PLN A;  2YXR B;  4YPC A;  3Q2Y A;  1LTB C;  1KIL B;  3SWK A;  3CX5 H;  3H32 A;  3C9I A;  1LJ2 A;  3HE5 B;  1CW5 A;  1SQB K;  3L71 E;  3LIE A;  3AE6 C;  2E43 A;  3D70 A;  1BCC G;  1VF5 B;  3VTP C;  4W7Y A;  5DJU B;  2E74 B;  2YXQ B;  1PPJ D;  2RKL A;  3A0H H;  1MFT A;  2KZJ A;  2YKP A;  3SWF A;  3B4S A;  2P10 A;  4D6T D;  1YIJ P;  1FOS F;  2POH A;  1ZRT E;  5CJ4 A;  3TSI A;  1MZ9 A;  1AJY A;  4PV1 B;  2KYV A;  3EFF K;  3TK1 A;  2YKO A;  1NJI Q;  1M1J C;  2Q3I A;  5CHX A;  4H13 B;  1S1C X;  1G1J A;  2QG4 A;  1JM0 A;  3AE3 C;  3B71 A;  1YJ9 P;  5AVW B;  1M56 D;  2OYI A;  1L4A C;  1N2D C;  3L74 E;  1PV3 A;  3H1H G;  4IFM A;  4M3L A;  2O01 N;  1ZN5 A;  2Q5U A;  4H44 D;  5AVR B;  4WY4 A;  3WUU A;  3TGU J;  1KB9 I;  1S5L E;  3JCU E;  3L72 G;  2BCC E;  3CC4 P;  2J58 A;  1L0L J;  3I5C A;  1WRG A;  2JDI H;  1BSH A;  2HOD B;  2FBW C;  4D6T E;  1LWU C;  1BCC E;  3A3Y B;  4H0L D;  4RJT A;  1FZC C;  1KTM A;  4WB4 A;  1JB0 J;  1L0L K;  4YXW H;  1CZQ A;  4C7N A;  4DJG A;  2PRR A;  2XND H;  3BCC D;  3H1K J;  1URQ D;  4XA4 A;  1VQ9 P;  3IN6 A;  1RY3 A;  3SFE C;  2CPS A;  1EC5 A;  3AE5 C;  5L8R J;  3GMA A;  4XE5 B;  3SWY A;  3CCV P;  3BAS A;  3V2R A;  1NTK D;  1OMI A;  3CLQ A;  1LNQ A;  3P8C E;  1PIX A;  3AE7 C;  1WMK A;  3IFM A;  2SPZ A;  2FYU E;  2WMM A;  5KAF E;  1IO4 A;  1NOH A;  2HPC A;  2JKV A;  4OGQ D;  3WU2 H;  2KK7 A;  3AE1 C;  2O1K A;  3L70 D;  4R4L A;  2FYU D;  1S5L H;  4H13 D;  2E5Y A;  1LT9 B;  1JY2 P;  1L4A B;  1NTM G;  4OH8 B;  3L70 J;  5KLV K;  2WSS H;  5KTB A;  1SQQ J;  1H0T A;  5TJH A;  3EQ2 A;  2R5D A;  3BCC G;  3W67 A;  5APS A;  4KJM A;  3V4W A;  3VN0 A;  2XV5 A;  1GW3 A;  3CCR P;  4AUW A;  1X22 A;  1GW4 A;  3HD7 C;  3NMD A;  1QX8 A;  1SQX E;  2N9Y B;  1BGY G;  2YKQ A;  3MTU E;  1KFN A;  1NU1 E;  1SQB J;  1XTC C;  2B88 A;  2WSC H;  3ZDM A;  1YJW P;  3BVH A;  3V2Q A;  1NYH A;  3L71 D;  3MP7 B;  4ASV A;  2E74 C;  3HTK A;  2K3R A;  2K9J B;  1KIL C;  5CCH A;  1URQ C;  5AVY B;  4D6T G;  1JOC A;  1HJB A;  1W2E A;  2QRX A;  2Y9Y A;  4L74 A;  4WY4 B;  4IOI H;  2G8Y A;  1WT6 A;  4LC1 A;  3TNU B;  4ASW A;  3L74 D;  1H88 A;  4JPZ B;  2YMY A;  1NH4 A;  1UIX A;  3UIA A;  1L4A A;  1H0T B;  2YIU C;  1RE3 C;  5EFW B;  2ZVN B;  3CX5 E;  1SLQ A;  2FYU K;  4W80 A;  5KLV D;  4WBA A;  1EZV G;  2R3C A;  2M0B A;  2A06 D;  2KNC A;  2QM8 A;  1KIL D;  4U3F G;  3G4S P;  3N7N A;  3CCJ P;  2OTJ P;  4JF7 A;  1K8A Q;  1RF0 C;  1R5S A;  1URQ B;  4UB6 E;  1JMB A;  2QM7 A;  5AW4 B;  5AW7 B;  2FYN C;  3WMM 0;  2E75 B;  4IL6 X;  3RGU A;  4B86 A;  1HVV A;  1IZN B;  1RE3 A;  1YTZ T;  3L75 J;  5BU8 B;  2Q3E A;  4EOT A;  1VF5 D;  3F5H A;  1J1E C;  4XFJ A;  1KIL E;  3M9B A;  1SS1 A;  3LW5 H;  4D6T J;  2HPC B;  2IZ0 A;  5GTI E;  3H1J J;  3KPE A;  1PGQ A;  3F89 A;  4GIF A;  4BRY A;  1LP1 A;  4EDF A;  3CX5 D;  1KIL A;  1GL2 C;  2G3A A;  2GM4 A;  1QL1 A;  3T97 A;  5KJ7 A;  1FOS E;  1T3U A;  2YO3 A;  1USE A;  3G9R A;  5KJ7 C;  3CD6 P;  1FZA A;  3PHL A;  3V6I A;  2QSI A;  1DEB A;  1HGV A;  3M0A A;  4NPD A;  2QJY B;  1LTG C;  1SFC C;  1PPJ G;  2GA1 A;  1LTI C; 
#chains in the Genus database with same CATH homology
 3E1R A;  3WUU A;  2WVR A;  4BRY A;  2Q6Q A;  4BRY B;  3F5H A;  3WUV A;  2ZXX A;  3WUT A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...