2WVRA

Human cdt1:geminin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
70
structure length
70
Chain Sequence
KENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords GEMININ
publication title Quaternary Structure of the Human Cdt1-Geminin Complex Regulates DNA Replication Licensing.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07412 Geminin Geminin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2wvrA00
2WVRA 4BRYB 1UIIA 2Q6QA 4BRYA 3F5HA 3WUVA 3E1RA 2ZXXA 3WUTA 3WUUA
chains in the Genus database with same CATH superfamily
4H0LC 1IC2A 1IFDA 3VMYA 3E7KA 1KYOD 1S5LE 1P84H 1URQB 4DCKA 4EOTA 3C1LA 4EI2A 2PGDA 5DJTB 1Y8AA 1L0NG 1HTLC 2JR8A 3SSUA 5AW7B 4RO0A 2RMZA 1URQA 2QSIA 2H43A 1VQ8P 1DIPA 3O6QB 2WVRA 2G3AA 1JMMA 3GHGC 2FYZA 2H89C 1IK9A 5KKZB 3H6PA 4NPDA 1GW4A 3O6QA 5E79E 2WQYC 1NTKK 3H1KD 2ZXEB 1PZQA 3V2PA 1EZVD 1N7SD 1JY2O 1BSHA 2WSEJ 2ZT9D 2Z5HA 3KPEA 3H1LE 2IBZE 2BCCD 4IL6X 2W6JH 5TISH 3LW5H 4PD4H 1JY2N 1KQLA 1ZW0A 2QJYC 2CPBA 4I2LC 4C46A 3QH9A 4DT0A 3L74D 1T2KD 4H44D 3CC2P 2XNXA 4WY4C 1Q90D 1KC8Q 3HD7C 2KIKA 2CPSA 4ZNCA 2XDJA 1NOHA 1JCCA 5GTIE 3H1LJ 2YMKA 5AVVB 2E76C 5APQA 1RF0A 1OZHA 1IFIA 1BCCG 1EXIA 1LWUC 2M5AB 2ITAA 3A0BH 1JCDA 3AEEC 3GMAA 2O1KA 4JQ0D 1FZBA 1LTBC 1FJKA 1OXZA 1QVFO 1VQPP 2JJLA 1M1JC 3AE3C 2IFMA 3P32A 2H88C 4EDFA 3L73D 1BGYG 4UB6H 1K8AQ 4N78E 3FX0A 1D7MA 4KT0J 3RK2B 2W6BA 1IO4A 3CCJP 2R32A 1NGMB 3L75E 4LLHA 1PPJG 4OWFA 1VF5C 5KJ7D 1OVVA 3CWBG 2FXOA 2A06D 2GUVA 1N86A 2K9JB 1FZAA 1NTZG 4Z1MH 2J59M 2Y9ZA 2N1TC 1N73B 2RN0A 4D6TG 1SP4A 1DH3A 1PP9E 2KOGA 1GL2C 1UIXA 1NU1D 2OYIC 3IAOA 2K9JA 1P84D 3L72E 1L0LD 4RJTA 5APVA 4BRYA 1YYCA 3CX5E 1GD2E 2O01J 1VQNP 2R5BA 1RE4C 3D70A 1SQVD 1KZUB 1KQSO 3FXDA 2M3BA 3VP8A 2GUSA 1Q86Q 1SQXG 4WB4A 1H88A 3EFFK 1PP9J 1LGHB 4HYTB 4JYCA 4PJ0E 1S3JA 2FYUK 1ZMEC 3HRNA 2KUBA 5CCGA 3L72J 1L4AD 4PV1D 2YNYA 1N7SB 3TYYA 1SQPE 2ZT9B 2QJKB 1KMIZ 4ASWA 1H89A 2E75B 1KILC 1TU3F 2D2CD 1HWTC 1Y9BA 4OGQD 1N7SA 1S2EA 5H2FH 3SWFA 2JO1A 3CCUP 4H44B 3A7OA 3BRVB 4PD4D 2E5TA 3H1HE 3KQGA 1RF1B 2YO2A 1AQTA 3CMEP 4W80A 1SQPJ 1LTJA 2FBWC 2DW3A 2Q6QA 2FY8A 5B5EH 1CW5A 2WT7B 1SQQE 3L74G 4Y99C 3MD0A 1SVFA 1RF1A 5AW0B 1NTME 2O3JA 3V2NA 2Y0CA 2WT7A 3S1KA 3H1HJ 3M0AA 1FDIA 5L8RJ 1NJIQ 2L91A 2P1JA 2NRGA 2P7JA 1FZFA 1SQQJ 3CCMP 1NTMJ 3B5NA 1LT1A 5AVXB 2AEFA 1YIJP 2V7QJ 3O8ZA 3AE8C 3BCCD 5APSA 1GU5A 3L73G 2YIUB 3RK3D 4WWIA 1Q7YQ 2POHA 1R8EA 2BEZF 5APYA 1SLQA 3L35A 5GTHH 3A0HE 1RE3C 1QL1A 2QVAA 4L75A 5KJ7A 3L71D 1NWQA 4HJGH 3A3YB 2YO3A 4HKZH 3GF7A 2NPSC 4HH2A 2C9NY 2HYNA 1BCCE 1YBKA 4I7ZB 1YJWP 2PRRA 4XE5B 1NTKD 1ZRTD 3OJAB 1FDMA 1BE3G 4EYYQ 1G1JA 2P2UA 3M9HA 2RKLA 2HR3A 2AXTH 1M8OB 1JMBA 1NU1G 3V6IA 1EXJA 4C7NB 3PTZA 1BGYE 3PHLA 1L0LG 3MP7B 1WT6A 1BCCJ 3CI9A 3H32B 2IX7C 2OGUA 1SQVG 1VQOP 1L4AB 2Q5UA 1YQ4C 4C7NA 2QJPB 5CCHD 4DJGA 3CWBE 2OYHB 3H32A 2KI7B 1FS0E 1L4AA 2D2CB 5K5GB 1E79H 2C0WA 1BGYJ 1GK6A 3HUSB 1NYHA 5KLVK 2FYNB 3Q2YA 2OYHA 1LTTC 4D6TE 3FWNA 1JY3O 3NXSA 4YXWH 2R5DA 2HLOA 3HUSA 3FXEA 1JTHA 2B9BA 4XA4A 2ZVOB 1JY3P 1KYOE 3G6EP 3CWBJ 1QGKB 1X79B 2Q9IA 3B4SA 1T8ZA 2WPRA 3LIEA 2WSFH 1KQFB 4IL6H 1SQXE 2QG4A 4H0LD 2R44A 1MFTA 2J5UA 4GKGA 1FZCB 3KZIH 3P8CD 4W7YA 5KKZC 2IBZI 1VDFA 4N6JA 2JEEA 5AVRB 5AW8B 1CI6B 1FZCA 3RK3B 3H1KE 1AA0A 1DEBA 1T6AA 1AJYA 3CXHH 3JCUH 3NFQA 5KAFE 1CI6A 2KSJA 1DEEG 1KB9H 2BCCE 3AE9C 1LTGC 3EQ2A 1AVOA 5BU8B 3AE2C 1SQBD 3L74E 2FYUD 3H1KJ 2Z5IA 3L71G 3D6YA 3GG2A 3H1HG 4WBAA 2BEQD 3I56P 3AE5C 3C9IA 3MZWB 2BCCJ 4W7ZA 2LXBA 1NTKG 1SQQG 2WSCH 1OW6A 2E74C 4UB8E 1NTMG 1Y47A 1NAYA 3L74J 4ZKUA 3MIWA 4O9BA 1FC2C 3TF5A 4WY4D 2K1AA 5CCGD 3VP9A 3H25A 3L73E 1FU1A 2ZYDA 2WWWA 3OW2O 2K37A 3V4QA 2IPPA 3MHVA 5CCHA 1U7MA 1S5LX 4GOFA 2M3EA 2XU6A 1H0TB 4YPCA 4B86A 2E43A 4DZOA 2SPZA 1L0NK 2E75D 2A06E 5AW1B 1JY2P 3AE1C 1N8RQ 2PAJA 4JYBA 4GODA 1QEXA 3L73J 3I55P 1HVVA 1H0TA 3CX5I 4QMAA 1N73C 1OVUA 3OAKA 2QRXA 1BE3E 2W8ZA 1LT9C 1HF9A 4LGDE 1Q82Q 1VPCA 2M0BA 3V5BA 1KFMA 3BASA 2KP8A 1NU1E 1J2JB 2N9YB 1YTZT 1IFMA 1P84E 1ZV8A 3CCVP 1L0LE 3II6A 4H0LB 3CCRP 3H1JD 1VQ9P 3TSIA 1SQVE 2YKPA 1K04A 2HPCB 1BE3J 2A45G 4YTPC 2XV5A 1YQ3C 2NZ2A 3B5ND 2AEJA 1NU1J 1LJ2A 4JBZA 2HPCA 2ZT9C 1L0LJ 4PJ0H 3P8MC 3PLNA 3TGUD 1SQVJ 1HUCA 3GHGB 1T2KC 1SS1A 3CXHD 3ABVC 2ZXXA 1KB9D 4BXLA 2RH0A 2E42A 5TISE 4EIJA 3GHGA 4PD4E 3Q5SA 1ZXGA 3T97A 2QM8A 4BRYB 1GTWA 3VTPC 2FKWB 1KILD 3VN0A 1SQBG 2B89A 2FYUG 3CCLP 2QJYB 5KLIB 1KD1Q 5BU5A 3W68A 2K88A 3IR9A 5KLVD 5AW6B 3RL0C 1BSNA 2KZIA 1OMIA 1FZGA 2OYOA 1YHQP 3LW5J 1M7LA 4WY4B 3GF3A 1PL5A 1KFNA 1S4XA 3A0BE 1NKNA 2ZYGA 1OVRA 1QL2A 1SFCC 4U3FD 1QX8A 3HE5B 2E76B 5DJUB 1OFCX 3VMZA 4YXDC 1GDTA 1NTZK 2YXRB 3S9OA 1LWUB 4WY4A 4M3LA 4IFFA 1K9MQ 1NO4A 2YIUC 5KJ7C 1BDDA 4UB6E 3M9BA 2JWDA 3HE5A 2J58A 3BCCE 1VQ5P 1X8YA 2Q3IA 3RK3E 2Y0DA 1LWUA 5AVSB 4N78D 1YTZI 1M1JB 3AE6C 1ZR4A 3H1KG 1HGZA 1ZOYC 2XKMA 1LTJB 2K3RA 2H8PD 1EZVG 3L75D 2YKOA 2OTJP 2A45I 3L71E 5APWA 1PIXA 1M1JA 1SQXK 2BCCG 4TT3H 3SWYA 3BCCJ 3F89A 3CC7P 1CZQA 1J1DC 3VOPA 1NTKE 1ZRTE 2WPQA 1LNQA 1PGQA 3PH0A 4I6MC 1RY3A 3I5CA 3CCQP 5B66H 1RHZB 3WU2H 3L71J 3IF4A 4IFMA 4KJMA 5AVQB 4H13C 1M90Q 3B5NB 1RQUA 4PV1C 3AEAC 3H1JG 2FFDC 3U1CA 2N1TA 1NTKJ 1A02F 4OVNF 2KSEA 2WTYA 1GL2A 4OGQC 1JO5A 3U1AA 1KYOI 2FYNC 2W27A 1NVOA 1RE4A 2LR2A 1KV4A 3H1ID 2XZRA 5CMZA 4BWNA 3M06A 3ZDMA 1QLED 4AYCA 5H2FE 3BATA 4U7JA 5KAIH 3MUDC 2A06G 3D71A 3CCEP 4GIFA 1KILB 1FJPA 1VQKP 1PV3A 2G8YA 3AE7C 4GDOA 5B5EE 1AQ5A 3MGNA 2HG5D 1KILA 2E5YA 1L0ND 1X0TA 1FZCC 1FDOA 1G1IA 1PGJA 2KS1B 1IZNB 3P8CE 4AUWA 2WPSA 5AVZB 3PP5A 3RK3C 1GU4A 1M56D 2KS1A 3K5BA 2IYPA 1VQ7P 4K3AA 1JTHB 4DOJA 1FBMA 3SFDC 4NPEA 1R5LA 1MZ9A 1IFJA 2OQQA 1HGVA 3HTKB 4K35A 5GTHE 1AFOA 3LIDA 1LTIC 1SQBE 2FYUE 1URQC 3L37A 5CBOA 1JM0A 1VQ4P 3HTKA 1S5LH 3M0DA 1LTSC 3CL3D 4WVZA 1K05A 1UIIA 1ZLLA 4CPGA 3SFEC 1XTGB 1RQVA 2WITA 1E5WA 1JOCA 2K9YA 2JP3A 1RE3A 3KDPB 1SQBJ 1H8AA 2FYUJ 5EFWB 1K73Q 2WSEH 1MKMA 1OIPA 1FOSF 4I1LA 3AEGC 3EWKA 1W5CE 4C7RA 3Q1MA 1J1EB 3C8VA 2E74D 1EZVE 5E79H 3V4WA 1YJNP 2YKQA 3AEFC 1PPJD 3G71P 3MTUE 2GM4A 2I8DA 1YI2P 2WZ7A 3BCCG 2JKVA 1P84I 1RF0C 2MKVA 1XTCC 3H1IG 1EQ7A 1T3UA 1NTZD 3AEDC 4IOIH 1WRGA 4D6TD 2ZJSE 3WMM0 2IZ1A 1A02J 4TLFA 2Y0EA 1N7LA 3G9RA 2QEXP 3H1JE 5GTIH 2QA4P 1AVYA 4IL6E 3V2QA 1SQPK 2O01N 4N3YB 3L70D 3HD7D 1OW7A 1SQXD 2PP6A 3RK2C 3CD6P 3RBXA 2IFNA 3KZIE 1VQMP 5KTBA 2E76D 1S1CX 1AV1A 5AW9B 2QE7H 1L2PA 4PD4I 3H1JJ 3KHUA 3TGUE 2WSFJ 3VMAA 2Q1KA 1N2DC 5AW5B 5TJHA 3CXHE 3R2PA 1MFZA 1SQQK 3JCUE 1NTMK 1KB9E 4ZKPA 1X9VA 5CJ0A 3TK1A 4HB1A 1S9KD 1GZLA 2O01H 3CC4P 5AW4B 4MN4C 3TGUJ 1G2CB 1QVGO 5APUA 3BRTB 1VF5D 5KLIC 1WMKA 1KILE 2W90A 2GA1A 3KXDA 4ZMDA 1IFNA 3RBZA 1DD4A 2B88A 2UWJE 5KLVE 1G2CA 3JSVC 5CJ4A 4KHXA 1NH4A 5CCGC 3NTNA 3G4SP 1GMJA 2C9LY 1EDKA 2WSSH 3EFGA 3CX5H 2BASA 3CPWO 2N1TD 1FE6A 2HFED 4L73A 1KQGB 3CCSP 5AVWB 4U3FE 1GL2D 2H7HA 2CK3H 4ASVA 3Q3DA 1N7SC 3VMXA 2I1KA 3L4FA 2QIWA 2QJKC 2E74B 2LKMA 5KLVJ 3RL0D 2E75C 2M5AA 1LTJC 2WSCJ 3T97B 1IJDB 1SFCD 2XNDH 1R5SA 4H44C 4U3FJ 1FOSE 2OTKE 2KLVA 2WPVB 5AW2B 2IYOA 1VQ6P 1Q2NA 1RF1C 2N9BA 3L36A 1JB0J 3N4XA 3IN6A 3H1LD 2IBZD 1X22A 1Z56A 3TDKA 3M91A 1KORA 5AVUB 4GT1A 3M9QA 3R4YA 1USEA 3P7KA 1BE3D 3GLMA 3D6ZA 1YJ9P 3JC22 3L75J 1ZR2A 4OH8B 1ZN5A 1IFPA 2O1JA 3B5NC 2ZVNB 1LT9B 1DX7A 3A2AA 2P10A 2V7QH 3HD7B 1HJ0A 4L74A 1N73A 3S4RA 2PFXA 1EDJA 3GW6A 1EDIA 1LT9A 1DD3A 4R4LA 3E1RA 3HD7A 2Q3EA 3L70G 4L76A 3BVHA 4A7PA 3CMAP 2B87B 2L5GB 5M1BA 1SQBK 2FXPA 4H13D 5APTA 3AEBC 3H1IE 1Q81Q 2B87A 4RKUJ 2IZ0A 2KNCB 2W6AA 3A0HH 2KZJA 4I7ZC 1NHLA 1MV8A 1VF5B 3AE4C 4RESB 2KNCA 5AVTB 1HBWA 1USDA 3SWKA 3H1IJ 2HODB 4Y28J 1PP9D 4R4MA 3PRJA 2N1TB 1L0NE 1PFIA 2FXMA 1OX3A 2A45H 4AQRD 2JWAA 2HODA 1GL2B 3L72D 2NPSD 3WUVA 1OW8A 3B71A 1L4AC 3W67A 3G3ZA 1YITP 2OYIB 5APXA 1ZP0C 3B8EB 3CX5D 1M57D 2QJPC 3HE4B 2AXCA 2ZAEB 3N7NA 1GK4A 3RL0B 2OYHC 2VRSA 2D2CC 2OYIA 3WUUA 3HUSC 3HE4A 3RL0g 1L0NJ 1NKZB 1SFCB 3AECC 1S72P 1IK7A 3TGUG 4LC1A 1SQPD 2OTLP 1BDCA 3M0DC 1JEKA 3Q5RA 1SFCA 1CSBA 2P67A 2Q7CA 2ZFCA 2P58A 3OA7A 1KYOH 2KK7A 3H1LG 2IBZG 3H1HD 3PJSK 1VQLP 5CBNA 1NAFA 3KYQA 2KB7P 2Y9YA 1EC5A 1SQQD 5B66E 5C39A 4NPFX 3FWLA 3WU2E 1NTMD 1EZVI 5KLVG 1URQD 5AVYB 1J1DB 4Y99B 1GW3A 2V4HA 3U59A 1FAVA 1VL2A 1J1EC 3ITKA 2KXPB 1HJBA 4XFJA 4U3FG 1PGPA 4H13B 1JUNA 2Z4EA 2MJZA 2JDIH 4PV1B 2QM7A 2FFDB 1PPJE 3E1IA 2R3CA 1NU1K 1KTMA 5KAFH 2YMYA 1LTAC 4JF7A 1L0LK 1JNMA 2FFDA 4OGQB 1OWAA 1NTZE 1SQVK 3L75G 5KAIE 2ZYAA 3V2RA 3USSA 2LXCB 3NMDA 1W2BO 5CHXA 1JY3N 1RH5B 1BCCD 1U7JA 1HH0A 3TNUB 3WUTA 3UIAA 2NPSB 3F5HA 2AXTE 4GOEA 3IFMA 3CLQA 1NTZJ 2OARA 2W83C 2WMMA 5CCHC 1T3JA 3L70E 1PP9G 4UB8H 1M1KQ 3MUDA 4D6TJ 3TNUA 1PGOA 3Q5PA 1KN7A 2KLUA 2C0XA 2IDBA 2NPSA 3CXHI 3FGAD 1BGYD 3L72G 4IFDK 1KB9I 1LP1B 3VYIA 2AEMA 1LP1A 3RGUA 3L70J 1W2EA 3QWOC 4JPZB 1FZEA 3CWBD 2YXQB 2KYVA 1SQXJ 3RK2D 1U57A 2M8RA 5BVZA 5AW3B 1EDLA 1MUUA 2R3SA 2I1JA 1S9KE 1SQPG 3A5TA
chains in the Genus database with same CATH topology
2WVRA 4BRYB 1UIIA 2Q6QA 4BRYA 3F5HA 3WUVA 3E1RA 2ZXXA 3WUTA 3WUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVR A;  4BRY B;  1UII A;  2Q6Q A;  4BRY A;  3F5H A;  3WUV A;  3E1R A;  2ZXX A;  3WUT A;  3WUU A; 
#chains in the Genus database with same CATH topology
 4H0L C;  1IC2 A;  1IFD A;  3VMY A;  3E7K A;  1KYO D;  1S5L E;  1P84 H;  1URQ B;  4DCK A;  4EOT A;  3C1L A;  4EI2 A;  2PGD A;  5DJT B;  1Y8A A;  1L0N G;  1HTL C;  2JR8 A;  3SSU A;  5AW7 B;  4RO0 A;  2RMZ A;  1URQ A;  2QSI A;  2H43 A;  1VQ8 P;  1DIP A;  3O6Q B;  2WVR A;  2G3A A;  1JMM A;  3GHG C;  2FYZ A;  2H89 C;  1IK9 A;  5KKZ B;  3H6P A;  4NPD A;  1GW4 A;  3O6Q A;  5E79 E;  2WQY C;  1NTK K;  3H1K D;  2ZXE B;  1PZQ A;  3V2P A;  1EZV D;  1N7S D;  1JY2 O;  1BSH A;  2WSE J;  2ZT9 D;  2Z5H A;  3KPE A;  3H1L E;  2IBZ E;  2BCC D;  4IL6 X;  2W6J H;  5TIS H;  3LW5 H;  4PD4 H;  1JY2 N;  1KQL A;  1ZW0 A;  2QJY C;  2CPB A;  4I2L C;  4C46 A;  3QH9 A;  4DT0 A;  3L74 D;  1T2K D;  4H44 D;  3CC2 P;  2XNX A;  4WY4 C;  1Q90 D;  1KC8 Q;  3HD7 C;  2KIK A;  2CPS A;  4ZNC A;  2XDJ A;  1NOH A;  1JCC A;  5GTI E;  3H1L J;  2YMK A;  5AVV B;  2E76 C;  5APQ A;  1RF0 A;  1OZH A;  1IFI A;  1BCC G;  1EXI A;  1LWU C;  2M5A B;  2ITA A;  3A0B H;  1JCD A;  3AEE C;  3GMA A;  2O1K A;  4JQ0 D;  1FZB A;  1LTB C;  1FJK A;  1OXZ A;  1QVF O;  1VQP P;  2JJL A;  1M1J C;  3AE3 C;  2IFM A;  3P32 A;  2H88 C;  4EDF A;  3L73 D;  1BGY G;  4UB6 H;  1K8A Q;  4N78 E;  3FX0 A;  1D7M A;  4KT0 J;  3RK2 B;  2W6B A;  1IO4 A;  3CCJ P;  2R32 A;  1NGM B;  3L75 E;  4LLH A;  1PPJ G;  4OWF A;  1VF5 C;  5KJ7 D;  1OVV A;  3CWB G;  2FXO A;  2A06 D;  2GUV A;  1N86 A;  2K9J B;  1FZA A;  1NTZ G;  4Z1M H;  2J59 M;  2Y9Z A;  2N1T C;  1N73 B;  2RN0 A;  4D6T G;  1SP4 A;  1DH3 A;  1PP9 E;  2KOG A;  1GL2 C;  1UIX A;  1NU1 D;  2OYI C;  3IAO A;  2K9J A;  1P84 D;  3L72 E;  1L0L D;  4RJT A;  5APV A;  4BRY A;  1YYC A;  3CX5 E;  1GD2 E;  2O01 J;  1VQN P;  2R5B A;  1RE4 C;  3D70 A;  1SQV D;  1KZU B;  1KQS O;  3FXD A;  2M3B A;  3VP8 A;  2GUS A;  1Q86 Q;  1SQX G;  4WB4 A;  1H88 A;  3EFF K;  1PP9 J;  1LGH B;  4HYT B;  4JYC A;  4PJ0 E;  1S3J A;  2FYU K;  1ZME C;  3HRN A;  2KUB A;  5CCG A;  3L72 J;  1L4A D;  4PV1 D;  2YNY A;  1N7S B;  3TYY A;  1SQP E;  2ZT9 B;  2QJK B;  1KMI Z;  4ASW A;  1H89 A;  2E75 B;  1KIL C;  1TU3 F;  2D2C D;  1HWT C;  1Y9B A;  4OGQ D;  1N7S A;  1S2E A;  5H2F H;  3SWF A;  2JO1 A;  3CCU P;  4H44 B;  3A7O A;  3BRV B;  4PD4 D;  2E5T A;  3H1H E;  3KQG A;  1RF1 B;  2YO2 A;  1AQT A;  3CME P;  4W80 A;  1SQP J;  1LTJ A;  2FBW C;  2DW3 A;  2Q6Q A;  2FY8 A;  5B5E H;  1CW5 A;  2WT7 B;  1SQQ E;  3L74 G;  4Y99 C;  3MD0 A;  1SVF A;  1RF1 A;  5AW0 B;  1NTM E;  2O3J A;  3V2N A;  2Y0C A;  2WT7 A;  3S1K A;  3H1H J;  3M0A A;  1FDI A;  5L8R J;  1NJI Q;  2L91 A;  2P1J A;  2NRG A;  2P7J A;  1FZF A;  1SQQ J;  3CCM P;  1NTM J;  3B5N A;  1LT1 A;  5AVX B;  2AEF A;  1YIJ P;  2V7Q J;  3O8Z A;  3AE8 C;  3BCC D;  5APS A;  1GU5 A;  3L73 G;  2YIU B;  3RK3 D;  4WWI A;  1Q7Y Q;  2POH A;  1R8E A;  2BEZ F;  5APY A;  1SLQ A;  3L35 A;  5GTH H;  3A0H E;  1RE3 C;  1QL1 A;  2QVA A;  4L75 A;  5KJ7 A;  3L71 D;  1NWQ A;  4HJG H;  3A3Y B;  2YO3 A;  4HKZ H;  3GF7 A;  2NPS C;  4HH2 A;  2C9N Y;  2HYN A;  1BCC E;  1YBK A;  4I7Z B;  1YJW P;  2PRR A;  4XE5 B;  1NTK D;  1ZRT D;  3OJA B;  1FDM A;  1BE3 G;  4EYY Q;  1G1J A;  2P2U A;  3M9H A;  2RKL A;  2HR3 A;  2AXT H;  1M8O B;  1JMB A;  1NU1 G;  3V6I A;  1EXJ A;  4C7N B;  3PTZ A;  1BGY E;  3PHL A;  1L0L G;  3MP7 B;  1WT6 A;  1BCC J;  3CI9 A;  3H32 B;  2IX7 C;  2OGU A;  1SQV G;  1VQO P;  1L4A B;  2Q5U A;  1YQ4 C;  4C7N A;  2QJP B;  5CCH D;  4DJG A;  3CWB E;  2OYH B;  3H32 A;  2KI7 B;  1FS0 E;  1L4A A;  2D2C B;  5K5G B;  1E79 H;  2C0W A;  1BGY J;  1GK6 A;  3HUS B;  1NYH A;  5KLV K;  2FYN B;  3Q2Y A;  2OYH A;  1LTT C;  4D6T E;  3FWN A;  1JY3 O;  3NXS A;  4YXW H;  2R5D A;  2HLO A;  3HUS A;  3FXE A;  1JTH A;  2B9B A;  4XA4 A;  2ZVO B;  1JY3 P;  1KYO E;  3G6E P;  3CWB J;  1QGK B;  1X79 B;  2Q9I A;  3B4S A;  1T8Z A;  2WPR A;  3LIE A;  2WSF H;  1KQF B;  4IL6 H;  1SQX E;  2QG4 A;  4H0L D;  2R44 A;  1MFT A;  2J5U A;  4GKG A;  1FZC B;  3KZI H;  3P8C D;  4W7Y A;  5KKZ C;  2IBZ I;  1VDF A;  4N6J A;  2JEE A;  5AVR B;  5AW8 B;  1CI6 B;  1FZC A;  3RK3 B;  3H1K E;  1AA0 A;  1DEB A;  1T6A A;  1AJY A;  3CXH H;  3JCU H;  3NFQ A;  5KAF E;  1CI6 A;  2KSJ A;  1DEE G;  1KB9 H;  2BCC E;  3AE9 C;  1LTG C;  3EQ2 A;  1AVO A;  5BU8 B;  3AE2 C;  1SQB D;  3L74 E;  2FYU D;  3H1K J;  2Z5I A;  3L71 G;  3D6Y A;  3GG2 A;  3H1H G;  4WBA A;  2BEQ D;  3I56 P;  3AE5 C;  3C9I A;  3MZW B;  2BCC J;  4W7Z A;  2LXB A;  1NTK G;  1SQQ G;  2WSC H;  1OW6 A;  2E74 C;  4UB8 E;  1NTM G;  1Y47 A;  1NAY A;  3L74 J;  4ZKU A;  3MIW A;  4O9B A;  1FC2 C;  3TF5 A;  4WY4 D;  2K1A A;  5CCG D;  3VP9 A;  3H25 A;  3L73 E;  1FU1 A;  2ZYD A;  2WWW A;  3OW2 O;  2K37 A;  3V4Q A;  2IPP A;  3MHV A;  5CCH A;  1U7M A;  1S5L X;  4GOF A;  2M3E A;  2XU6 A;  1H0T B;  4YPC A;  4B86 A;  2E43 A;  4DZO A;  2SPZ A;  1L0N K;  2E75 D;  2A06 E;  5AW1 B;  1JY2 P;  3AE1 C;  1N8R Q;  2PAJ A;  4JYB A;  4GOD A;  1QEX A;  3L73 J;  3I55 P;  1HVV A;  1H0T A;  3CX5 I;  4QMA A;  1N73 C;  1OVU A;  3OAK A;  2QRX A;  1BE3 E;  2W8Z A;  1LT9 C;  1HF9 A;  4LGD E;  1Q82 Q;  1VPC A;  2M0B A;  3V5B A;  1KFM A;  3BAS A;  2KP8 A;  1NU1 E;  1J2J B;  2N9Y B;  1YTZ T;  1IFM A;  1P84 E;  1ZV8 A;  3CCV P;  1L0L E;  3II6 A;  4H0L B;  3CCR P;  3H1J D;  1VQ9 P;  3TSI A;  1SQV E;  2YKP A;  1K04 A;  2HPC B;  1BE3 J;  2A45 G;  4YTP C;  2XV5 A;  1YQ3 C;  2NZ2 A;  3B5N D;  2AEJ A;  1NU1 J;  1LJ2 A;  4JBZ A;  2HPC A;  2ZT9 C;  1L0L J;  4PJ0 H;  3P8M C;  3PLN A;  3TGU D;  1SQV J;  1HUC A;  3GHG B;  1T2K C;  1SS1 A;  3CXH D;  3ABV C;  2ZXX A;  1KB9 D;  4BXL A;  2RH0 A;  2E42 A;  5TIS E;  4EIJ A;  3GHG A;  4PD4 E;  3Q5S A;  1ZXG A;  3T97 A;  2QM8 A;  4BRY B;  1GTW A;  3VTP C;  2FKW B;  1KIL D;  3VN0 A;  1SQB G;  2B89 A;  2FYU G;  3CCL P;  2QJY B;  5KLI B;  1KD1 Q;  5BU5 A;  3W68 A;  2K88 A;  3IR9 A;  5KLV D;  5AW6 B;  3RL0 C;  1BSN A;  2KZI A;  1OMI A;  1FZG A;  2OYO A;  1YHQ P;  3LW5 J;  1M7L A;  4WY4 B;  3GF3 A;  1PL5 A;  1KFN A;  1S4X A;  3A0B E;  1NKN A;  2ZYG A;  1OVR A;  1QL2 A;  1SFC C;  4U3F D;  1QX8 A;  3HE5 B;  2E76 B;  5DJU B;  1OFC X;  3VMZ A;  4YXD C;  1GDT A;  1NTZ K;  2YXR B;  3S9O A;  1LWU B;  4WY4 A;  4M3L A;  4IFF A;  1K9M Q;  1NO4 A;  2YIU C;  5KJ7 C;  1BDD A;  4UB6 E;  3M9B A;  2JWD A;  3HE5 A;  2J58 A;  3BCC E;  1VQ5 P;  1X8Y A;  2Q3I A;  3RK3 E;  2Y0D A;  1LWU A;  5AVS B;  4N78 D;  1YTZ I;  1M1J B;  3AE6 C;  1ZR4 A;  3H1K G;  1HGZ A;  1ZOY C;  2XKM A;  1LTJ B;  2K3R A;  2H8P D;  1EZV G;  3L75 D;  2YKO A;  2OTJ P;  2A45 I;  3L71 E;  5APW A;  1PIX A;  1M1J A;  1SQX K;  2BCC G;  4TT3 H;  3SWY A;  3BCC J;  3F89 A;  3CC7 P;  1CZQ A;  1J1D C;  3VOP A;  1NTK E;  1ZRT E;  2WPQ A;  1LNQ A;  1PGQ A;  3PH0 A;  4I6M C;  1RY3 A;  3I5C A;  3CCQ P;  5B66 H;  1RHZ B;  3WU2 H;  3L71 J;  3IF4 A;  4IFM A;  4KJM A;  5AVQ B;  4H13 C;  1M90 Q;  3B5N B;  1RQU A;  4PV1 C;  3AEA C;  3H1J G;  2FFD C;  3U1C A;  2N1T A;  1NTK J;  1A02 F;  4OVN F;  2KSE A;  2WTY A;  1GL2 A;  4OGQ C;  1JO5 A;  3U1A A;  1KYO I;  2FYN C;  2W27 A;  1NVO A;  1RE4 A;  2LR2 A;  1KV4 A;  3H1I D;  2XZR A;  5CMZ A;  4BWN A;  3M06 A;  3ZDM A;  1QLE D;  4AYC A;  5H2F E;  3BAT A;  4U7J A;  5KAI H;  3MUD C;  2A06 G;  3D71 A;  3CCE P;  4GIF A;  1KIL B;  1FJP A;  1VQK P;  1PV3 A;  2G8Y A;  3AE7 C;  4GDO A;  5B5E E;  1AQ5 A;  3MGN A;  2HG5 D;  1KIL A;  2E5Y A;  1L0N D;  1X0T A;  1FZC C;  1FDO A;  1G1I A;  1PGJ A;  2KS1 B;  1IZN B;  3P8C E;  4AUW A;  2WPS A;  5AVZ B;  3PP5 A;  3RK3 C;  1GU4 A;  1M56 D;  2KS1 A;  3K5B A;  2IYP A;  1VQ7 P;  4K3A A;  1JTH B;  4DOJ A;  1FBM A;  3SFD C;  4NPE A;  1R5L A;  1MZ9 A;  1IFJ A;  2OQQ A;  1HGV A;  3HTK B;  4K35 A;  5GTH E;  1AFO A;  3LID A;  1LTI C;  1SQB E;  2FYU E;  1URQ C;  3L37 A;  5CBO A;  1JM0 A;  1VQ4 P;  3HTK A;  1S5L H;  3M0D A;  1LTS C;  3CL3 D;  4WVZ A;  1K05 A;  1UII A;  1ZLL A;  4CPG A;  3SFE C;  1XTG B;  1RQV A;  2WIT A;  1E5W A;  1JOC A;  2K9Y A;  2JP3 A;  1RE3 A;  3KDP B;  1SQB J;  1H8A A;  2FYU J;  5EFW B;  1K73 Q;  2WSE H;  1MKM A;  1OIP A;  1FOS F;  4I1L A;  3AEG C;  3EWK A;  1W5C E;  4C7R A;  3Q1M A;  1J1E B;  3C8V A;  2E74 D;  1EZV E;  5E79 H;  3V4W A;  1YJN P;  2YKQ A;  3AEF C;  1PPJ D;  3G71 P;  3MTU E;  2GM4 A;  2I8D A;  1YI2 P;  2WZ7 A;  3BCC G;  2JKV A;  1P84 I;  1RF0 C;  2MKV A;  1XTC C;  3H1I G;  1EQ7 A;  1T3U A;  1NTZ D;  3AED C;  4IOI H;  1WRG A;  4D6T D;  2ZJS E;  3WMM 0;  2IZ1 A;  1A02 J;  4TLF A;  2Y0E A;  1N7L A;  3G9R A;  2QEX P;  3H1J E;  5GTI H;  2QA4 P;  1AVY A;  4IL6 E;  3V2Q A;  1SQP K;  2O01 N;  4N3Y B;  3L70 D;  3HD7 D;  1OW7 A;  1SQX D;  2PP6 A;  3RK2 C;  3CD6 P;  3RBX A;  2IFN A;  3KZI E;  1VQM P;  5KTB A;  2E76 D;  1S1C X;  1AV1 A;  5AW9 B;  2QE7 H;  1L2P A;  4PD4 I;  3H1J J;  3KHU A;  3TGU E;  2WSF J;  3VMA A;  2Q1K A;  1N2D C;  5AW5 B;  5TJH A;  3CXH E;  3R2P A;  1MFZ A;  1SQQ K;  3JCU E;  1NTM K;  1KB9 E;  4ZKP A;  1X9V A;  5CJ0 A;  3TK1 A;  4HB1 A;  1S9K D;  1GZL A;  2O01 H;  3CC4 P;  5AW4 B;  4MN4 C;  3TGU J;  1G2C B;  1QVG O;  5APU A;  3BRT B;  1VF5 D;  5KLI C;  1WMK A;  1KIL E;  2W90 A;  2GA1 A;  3KXD A;  4ZMD A;  1IFN A;  3RBZ A;  1DD4 A;  2B88 A;  2UWJ E;  5KLV E;  1G2C A;  3JSV C;  5CJ4 A;  4KHX A;  1NH4 A;  5CCG C;  3NTN A;  3G4S P;  1GMJ A;  2C9L Y;  1EDK A;  2WSS H;  3EFG A;  3CX5 H;  2BAS A;  3CPW O;  2N1T D;  1FE6 A;  2HFE D;  4L73 A;  1KQG B;  3CCS P;  5AVW B;  4U3F E;  1GL2 D;  2H7H A;  2CK3 H;  4ASV A;  3Q3D A;  1N7S C;  3VMX A;  2I1K A;  3L4F A;  2QIW A;  2QJK C;  2E74 B;  2LKM A;  5KLV J;  3RL0 D;  2E75 C;  2M5A A;  1LTJ C;  2WSC J;  3T97 B;  1IJD B;  1SFC D;  2XND H;  1R5S A;  4H44 C;  4U3F J;  1FOS E;  2OTK E;  2KLV A;  2WPV B;  5AW2 B;  2IYO A;  1VQ6 P;  1Q2N A;  1RF1 C;  2N9B A;  3L36 A;  1JB0 J;  3N4X A;  3IN6 A;  3H1L D;  2IBZ D;  1X22 A;  1Z56 A;  3TDK A;  3M91 A;  1KOR A;  5AVU B;  4GT1 A;  3M9Q A;  3R4Y A;  1USE A;  3P7K A;  1BE3 D;  3GLM A;  3D6Z A;  1YJ9 P;  3JC2 2;  3L75 J;  1ZR2 A;  4OH8 B;  1ZN5 A;  1IFP A;  2O1J A;  3B5N C;  2ZVN B;  1LT9 B;  1DX7 A;  3A2A A;  2P10 A;  2V7Q H;  3HD7 B;  1HJ0 A;  4L74 A;  1N73 A;  3S4R A;  2PFX A;  1EDJ A;  3GW6 A;  1EDI A;  1LT9 A;  1DD3 A;  4R4L A;  3E1R A;  3HD7 A;  2Q3E A;  3L70 G;  4L76 A;  3BVH A;  4A7P A;  3CMA P;  2B87 B;  2L5G B;  5M1B A;  1SQB K;  2FXP A;  4H13 D;  5APT A;  3AEB C;  3H1I E;  1Q81 Q;  2B87 A;  4RKU J;  2IZ0 A;  2KNC B;  2W6A A;  3A0H H;  2KZJ A;  4I7Z C;  1NHL A;  1MV8 A;  1VF5 B;  3AE4 C;  4RES B;  2KNC A;  5AVT B;  1HBW A;  1USD A;  3SWK A;  3H1I J;  2HOD B;  4Y28 J;  1PP9 D;  4R4M A;  3PRJ A;  2N1T B;  1L0N E;  1PFI A;  2FXM A;  1OX3 A;  2A45 H;  4AQR D;  2JWA A;  2HOD A;  1GL2 B;  3L72 D;  2NPS D;  3WUV A;  1OW8 A;  3B71 A;  1L4A C;  3W67 A;  3G3Z A;  1YIT P;  2OYI B;  5APX A;  1ZP0 C;  3B8E B;  3CX5 D;  1M57 D;  2QJP C;  3HE4 B;  2AXC A;  2ZAE B;  3N7N A;  1GK4 A;  3RL0 B;  2OYH C;  2VRS A;  2D2C C;  2OYI A;  3WUU A;  3HUS C;  3HE4 A;  3RL0 g;  1L0N J;  1NKZ B;  1SFC B;  3AEC C;  1S72 P;  1IK7 A;  3TGU G;  4LC1 A;  1SQP D;  2OTL P;  1BDC A;  3M0D C;  1JEK A;  3Q5R A;  1SFC A;  1CSB A;  2P67 A;  2Q7C A;  2ZFC A;  2P58 A;  3OA7 A;  1KYO H;  2KK7 A;  3H1L G;  2IBZ G;  3H1H D;  3PJS K;  1VQL P;  5CBN A;  1NAF A;  3KYQ A;  2KB7 P;  2Y9Y A;  1EC5 A;  1SQQ D;  5B66 E;  5C39 A;  4NPF X;  3FWL A;  3WU2 E;  1NTM D;  1EZV I;  5KLV G;  1URQ D;  5AVY B;  1J1D B;  4Y99 B;  1GW3 A;  2V4H A;  3U59 A;  1FAV A;  1VL2 A;  1J1E C;  3ITK A;  2KXP B;  1HJB A;  4XFJ A;  4U3F G;  1PGP A;  4H13 B;  1JUN A;  2Z4E A;  2MJZ A;  2JDI H;  4PV1 B;  2QM7 A;  2FFD B;  1PPJ E;  3E1I A;  2R3C A;  1NU1 K;  1KTM A;  5KAF H;  2YMY A;  1LTA C;  4JF7 A;  1L0L K;  1JNM A;  2FFD A;  4OGQ B;  1OWA A;  1NTZ E;  1SQV K;  3L75 G;  5KAI E;  2ZYA A;  3V2R A;  3USS A;  2LXC B;  3NMD A;  1W2B O;  5CHX A;  1JY3 N;  1RH5 B;  1BCC D;  1U7J A;  1HH0 A;  3TNU B;  3WUT A;  3UIA A;  2NPS B;  3F5H A;  2AXT E;  4GOE A;  3IFM A;  3CLQ A;  1NTZ J;  2OAR A;  2W83 C;  2WMM A;  5CCH C;  1T3J A;  3L70 E;  1PP9 G;  4UB8 H;  1M1K Q;  3MUD A;  4D6T J;  3TNU A;  1PGO A;  3Q5P A;  1KN7 A;  2KLU A;  2C0X A;  2IDB A;  2NPS A;  3CXH I;  3FGA D;  1BGY D;  3L72 G;  4IFD K;  1KB9 I;  1LP1 B;  3VYI A;  2AEM A;  1LP1 A;  3RGU A;  3L70 J;  1W2E A;  3QWO C;  4JPZ B;  1FZE A;  3CWB D;  2YXQ B;  2KYV A;  1SQX J;  3RK2 D;  1U57 A;  2M8R A;  5BVZ A;  5AW3 B;  1EDL A;  1MUU A;  2R3S A;  2I1J A;  1S9K E;  1SQP G;  3A5T A; 
#chains in the Genus database with same CATH homology
 2WVR A;  4BRY B;  1UII A;  2Q6Q A;  4BRY A;  3F5H A;  3WUV A;  3E1R A;  2ZXX A;  3WUT A;  3WUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...