2WVRA

Human cdt1:geminin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
70
structure length
70
Chain Sequence
KENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
publication title Quaternary Structure of the Human Cdt1-Geminin Complex Regulates DNA Replication Licensing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 33
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07412 Geminin Geminin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2wvrA00
3E1RA 2Q6QA 3WUVA 1UIIA 2ZXXA 3WUTA 3WUUA 4BRYB 2WVRA 3F5HA 4BRYA
chains in the Genus database with same CATH superfamily
1NWQA 5CMZA 1BCCJ 5TISH 2BCCJ 2QJPB 1OVRA 1OW8A 3IAOA 2R3CA 3W68A 1IK7A 1HH0A 2WPSA 2O01J 1N73B 2E75C 2NPSC 3S9OA 1SQXE 1H0TB 1LTAC 3L70D 2YIUC 1Q82Q 4XA4A 3AE7C 5KLIB 3RK3E 1GTWA 1QL2A 3KZIE 3TGUG 1SQBD 1SQVE 3L71J 4WBAA 5AW5B 1VQOP 1VQLP 1KYOH 2AXTH 1A02J 2B87B 3JCUH 1GZLA 2WPRA 3L75E 1SFCA 2FYNC 2Y0EA 1IFJA 1J1EC 5APSA 1KQSO 5GTIE 5AVQB 1K73Q 1KILB 4Z1MH 1FJKA 2IFNA 3H1JE 3M9HA 2FXMA 4YXWH 1ZMEC 1EZVD 2WVRA 1K9MQ 5C39A 1GL2C 1NTKK 1EDKA 2FBWC 2E75B 1T8ZA 2NPSB 1JO5A 1U57A 4U3FD 3CMAP 2BCCE 2Y0DA 3GG2A 1H88A 4XE5B 1NTMJ 1SQPK 4NPEA 1FZGA 3BCCG 2KLUA 3WUVA 3Q5RA 1NTZK 1VDFA 2QM7A 2FY8A 3L72E 1S3JA 1JUNA 2GM4A 3OA7A 1MKMA 2ZFCA 3SFDC 1T2KC 3V2QA 3LIDA 3MGNA 3CXHH 2C0XA 5BVZA 1SLQA 3H1JG 1N73A 2QSIA 4M3LA 5E79E 1KB9E 1URQD 5AW7B 1L4AD 1LT1A 1L0LG 5AVWB 2E42A 2FYNB 1NHLA 2IYPA 3C1LA 3L71E 4AYCA 4JBZA 1J1EB 5AW4B 1G1IA 4IOIH 4RKUJ 5CCGD 4BWNA 1W5CE 4H44C 5APXA 3L73E 2B9BA 1NYHA 2K9JB 1RE4C 5AVVB 2M5AB 2KS1B 1HJBA 1VQKP 1HWTC 4C7NB 3V2PA 4I7ZC 5KLVK 2B87A 3U59A 1S5LX 2OTLP 1GL2B 5AW1B 1TU3F 1KYOI 3RGUA 3H1IG 1NH4A 2JP3A 4JYBA 2WITA 1SVFA 1SQQK 1N8RQ 4C7RA 1OW6A 1KILA 1YITP 3AECC 4W7YA 2WWWA 1W2EA 2HR3A 2NRGA 4L75A 1YI2P 1S5LE 1J2JB 3B71A 3CWBD 5CCHC 1BGYD 3HTKB 1T3UA 3CCLP 2Q3EA 2E74D 3MZWB 3ABVC 2KLVA 2XKMA 2NPSA 5KAFE 1OVUA 3KPEA 3BRTB 5AVUB 1IK9A 1FZEA 4GT1A 1BE3G 4H0LC 3H1KJ 4UB8E 1AJYA 1H89A 4KT0J 1S9KD 1K05A 2OARA 3D6YA 5GTHH 1HUCA 1AFOA 5AW2B 3OJAB 1YIJP 4WY4C 4H44B 4D6TG 2H43A 1OZHA 2OGUA 1LTBC 4I7ZB 4L76A 3CXHI 1Y47A 2H89C 1KYOD 1SQBE 2WSCJ 3M9BA 1LTTC 3L35A 1NTKD 4PJ0E 4OGQD 1SQPD 4EYYQ 2KNCB 2SPZA 2Q1KA 2K9JA 2M5AA 3H1HD 4C7NA 1NTZD 4LGDE 1A02F 1PP9E 4L73A 3Q2YA 4HB1A 3L70G 1QLED 1PV3A 3I55P 3M0DC 4WWIA 1GL2A 2KZIA 1FE6A 1M7LA 2A06E 2LXBA 1L0NG 2IBZE 2RMZA 1SQBG 2R32A 4H0LB 3AE4C 2Q6QA 1RHZB 1LGHB 2D2CC 3TSIA 4U3FE 3P8MC 4I1LA 3HTKA 3OW2O 1GW4A 3S4RA 1JEKA 4WY4B 1X8YA 1VQNP 2HPCA 1HGZA 3FXDA 2H7HA 3CXHD 2P7JA 4JQ0D 2ZT9D 2E5YA 2FFDC 1YJ9P 3O6QA 1HF9A 1QGKB 1JCCA 1YTZI 4HYTB 1RE3C 2RN0A 2QRXA 5AVRB 2KP8A 1EZVG 1EDIA 2P58A 1JY3P 1SQQD 1G1JA 3W67A 1CI6B 2K3RA 3I56P 3A0HE 1RE4A 2IPPA 2LXCB 1OX3A 2JDIH 3ZDMA 3RBZA 5CBOA 3C8VA 2V7QH 2ZYDA 2Q7CA 4C46A 1FZFA 5AW3B 3GF3A 2VRSA 3N7NA 3B5ND 3E1IA 3KYQA 3L74G 3Q1MA 3RL0D 2KNCA 3WU2H 1UIIA 3WUTA 2D2CB 2N9YB 3NFQA 1HBWA 1YBKA 5CCHA 4OGQB 4HKZH 2YMKA 2M8RA 2WT7B 3CCUP 3TGUJ 4GOEA 2IFMA 1IFDA 3CWBE 4IL6H 3KQGA 5B66H 5APVA 2FFDB 1K04A 2HFED 3CCMP 4NPFX 2Z5IA 2QJPC 2OYHC 5CHXA 1SQXJ 3M91A 2RKLA 1ZN5A 1X22A 1QL1A 4WY4A 2PP6A 1NKZB 3WMM0 1JY2P 1G2CB 3RL0g 4GIFA 3G9RA 1S1CX 1ZRTE 3MTUE 3BASA 1KMIZ 1M90Q 1JY3O 3M06A 2Z4EA 2KOGA 3F5HA 1LT9A 3SWFA 1FZCC 2JO1A 1BGYG 4PD4H 5KLIC 2P67A 3L75J 3CX5H 1NKNA 3AE3C 1CI6A 1YYCA 3BCCJ 3QH9A 1N86A 3M0AA 4GKGA 1YQ4C 1DEBA 3L36A 2KI7B 4JPZB 3M0DA 3CLQA 1JTHB 2YMYA 4H13C 3H1JJ 3GLMA 2C0WA 3H1LD 3BVHA 1M56D 1JY2N 2UWJE 3USSA 3KXDA 1L0LJ 3TGUE 2OYHB 2YXRB 2YXQB 2E43A 3VMYA 1EZVI 1AQ5A 2QJYC 2QA4P 3RL0B 2WT7A 4ASWA 3EFFK 1NTKG 1DEEG 3L72J 1YQ3C 1SQPG 4RO0A 2FFDA 3GF7A 3GHGB 3H1HG 1RE3A 2YO3A 1NTZG 3OAKA 2OYIC 1FZCB 3EWKA 2AEJA 3H1IJ 1RH5B 3CL3D 1L0ND 1GU4A 2IZ1A 2KUBA 3B8EB 2FXOA 1XTCC 5AVZB 1JM0A 2B89A 2XZRA 4GOFA 1DH3A 1NU1K 1JNMA 2YKQA 1KQGB 1GMJA 2W27A 1ZW0A 3L73J 2L91A 1LWUC 2GA1A 2FYUK 3BCCE 3CCVP 1KC8Q 4H13B 1VPCA 3PJSK 3IR9A 4WVZA 3V4QA 1KV4A 3TNUB 1S2EA 3GW6A 1BE3J 2W6JH 5L8RJ 2IYOA 2FKWB 1BSHA 2MKVA 1KTMA 4UB6H 3CX5I 3KHUA 5KLVG 5H2FH 1CW5A 1E79H 3V2RA 1N7SD 2QJYB 1L0LE 1JTHA 3B4SA 4D6TJ 3A5TA 2ZXEB 1SQQG 2K88A 2N1TD 4WB4A 2YO2A 2IDBA 1MUUA 2OYIB 2OYHA 4N78D 1ZV8A 3L74D 3VOPA 3L37A 4HH2A 2K37A 2ZYGA 3H1IE 3UIAA 1JMBA 2GUSA 2A45H 1VQPP 2GUVA 3AE8C 1H0TA 4PV1D 1LWUB 2WSSH 4K3AA 4KJMA 5TJHA 1FZCA 1SP4A 4O9BA 2Q5UA 3H6PA 3IFMA 4QMAA 1SQBJ 4DJGA 1SQXK 3G6EP 1DD3A 1CSBA 1U7JA 3CX5D 1PPJD 1Q7YQ 2OTKE 2WSFH 3HE5B 1R8EA 4OVNF 2W83C 1BE3E 1FZBA 2JWDA 3NTNA 3P8CE 1PP9J 1URQC 1L4AC 3HD7D 1RF1B 2BASA 5B5EE 1SQVK 3TNUA 3WUUA 2E76D 1AQTA 4D6TE 3SSUA 1JB0J 1E5WA 4U7JA 3H1LE 5CCGC 4XFJA 1DX7A 2WPQA 4U3FJ 2O01H 2E5TA 2O1JA 1NU1D 1YJWP 3CCSP 5DJTB 1LTIC 2WMMA 1ZR4A 1K8AQ 1AVOA 2JWAA 1EDLA 2FYUD 1USDA 2OYIA 1RF0C 1IFIA 1QEXA 5E79H 1KB9H 3E1RA 2FYZA 2KB7P 3L70E 3D70A 3H1LG 4MN4C 1EQ7A 2W6AA 5KJ7D 2E74C 1L0NE 1Y9BA 1PIXA 2WTYA 1LWUA 2FXPA 2YKPA 3CCQP 3VMAA 2ITAA 1URQB 3AEDC 2AEFA 1L4AB 3RK2D 1OXZA 1YJNP 4ZKUA 1QVGO 4GODA 2KS1A 4PV1B 2N9BA 1EC5A 2G3AA 5KAIH 4GDOA 3A7OA 2Z5HA 4N3YB 1BDDA 4EDFA 1JMMA 2QVAA 1FOSE 3AEGC 3IF4A 1LNQA 1NAFA 2M3BA 1EZVE 1S5LH 5KJ7C 1D7MA 2Y9ZA 3FX0A 2P1JA 4ZMDA 1M1KQ 3L4FA 4OGQC 3CWBJ 1USEA 3K5BA 3CI9A 2HLOA 1KQFB 2E76B 5B66E 2IZ0A 5KLVD 1SFCD 4JF7A 2E74B 3L74E 2WPVB 4HJGH 1VQ8P 1NTMK 4ZKPA 1KD1Q 4RESB 5KKZC 1EXIA 3G3ZA 3RK3D 1WT6A 1T6AA 2CPSA 1NO4A 1EDJA 1KQLA 3TYYA 1LTJC 3JC22 1SQVD 3AE9C 3LIEA 2CK3H 1KB9I 2KZJA 3NMDA 3CPWO 4PJ0H 3VN0A 2QJKC 3AEFC 2ZJSE 2QG4A 1KN7A 1NTKJ 3CX5E 4CPGA 1URQA 1IJDB 2ZT9C 5CBNA 3MD0A 1L4AA 1SQPJ 2K9YA 2PAJA 3Q3DA 1NTZJ 1SQBK 3HRNA 5CCGA 2J5UA 1BCCD 3T97B 1NVOA 3EQ2A 2BCCD 3FWLA 1DD4A 3MUDC 1FZAA 1BGYE 2H8PD 5AVYB 3H32B 4EI2A 3AEAC 5TISE 1NOHA 1N7LA 2L5GB 2Y0CA 2PGDA 2YKOA 1ZXGA 2R5DA 1FOSF 1IO4A 4DZOA 2V4HA 3L72D 4L74A 1DIPA 1PPJG 3GMAA 2H88C 3B5NC 1Q81Q 5KKZB 1RF0A 4DOJA 1GK6A 4RJTA 3RL0C 3CMEP 1T3JA 1VF5D 3VYIA 1VQ7P 3Q5SA 1LTJB 1KB9D 1S9KE 1Q86Q 1VQ4P 2Q9IA 3SWKA 3GHGC 2G8YA 2QJKB 3L71D 1XTGB 2WSCH 4LC1A 1KILD 1SS1A 2IX7C 4R4MA 4A7PA 1SQQJ 2ZT9B 3AE1C 2ZXXA 1KYOE 2AXTE 5APQA 3TK1A 3IN6A 3VMZA 1JOCA 1M1JC 3JCUE 1NTKE 3LW5J 5APUA 3U1CA 1NU1G 2C9NY 1GK4A 1IC2A 3SWYA 2ZVNB 1SQPE 5AW9B 2E75D 2FYUG 2NPSD 3H1HE 3RBXA 2O1KA 1NTZE 3M9QA 5KJ7A 4JYCA 1LJ2A 2R44A 3CC2P 3B5NB 1R5SA 4YTPC 1NTMD 1ZR2A 2W90A 1FU1A 3NXSA 3T97A 5APWA 5AVXB 1Z56A 4EIJA 1OWAA 2IBZI 3H32A 2WZ7A 2XNXA 1MZ9A 1RQVA 1JY2O 3CCRP 3P7KA 3CXHE 1HJ0A 3V4WA 1VQ5P 5KLVE 2J58A 5CJ0A 5KTBA 1G2CA 1LTJA 3A0BH 1PGQA 1M1JB 2PRRA 1VL2A 2ZYAA 3KDPB 5K5GB 5APYA 1VQ9P 2O01N 1SQQE 2QIWA 1GL2D 1P84H 1FS0E 1WMKA 1VF5B 3VP8A 2I1KA 5EFWB 5AW8B 1S4XA 2I8DA 3VTPC 3FGAD 4PD4I 3H25A 2HG5D 1HTLC 1AA0A 2XNDH 1SQXG 3MIWA 2POHA 5M1BA 1PP9D 2AEMA 3FWNA 1FDIA 1T2KD 2CPBA 1IFMA 2A45G 3EFGA 1PGPA 2A06D 3MUDA 3H1LJ 2IBZD 1RF1C 4IFMA 1L2PA 1SQVG 2KSEA 1BCCE 3B5NA 3L75G 1PFIA 4H44D 3H1KD 2K1AA 1NGMB 1FDMA 2R5BA 2YIUB 3QWOC 2QEXP 3HUSC 4N6JA 1N7SC 4OWFA 1UIXA 3MP7B 3L70J 5GTHE 3BATA 3GHGA 3KZIH 2WSEJ 2HODB 2NZ2A 4DT0A 2JEEA 2N1TC 1L0NJ 4PD4D 1BCCG 1W2BO 2BCCG 2RH0A 3C9IA 1M1JA 1IFNA 1LTGC 1MV8A 4BRYB 5CCHD 4YPCA 1KILE 2BEZF 3P32A 3LW5H 5GTIH 2OTJP 5BU8B 3JSVC 3L72G 4W80A 2WQYC 1KORA 1PGJA 2V7QJ 1P84I 4H0LD 2DW3A 4PV1C 1WRGA 3MHVA 5KAIE 1LP1B 3N4XA 4WY4D 3L71G 2QM8A 3ITKA 4EOTA 1YTZT 1NTME 3L73G 2J59M 3HUSB 4AUWA 1N7SB 3D71A 2HPCB 3G71P 3F89A 2ZAEB 5AW6B 2JJLA 3PLNA 1IFPA 1L0LK 3PP5A 3HD7C 2N1TB 4ASVA 3L74J 1H8AA 3O6QB 2E76C 5BU5A 4TLFA 4Y99C 2XV5A 3R4YA 1ZRTD 2P10A 3BRVB 1FBMA 2OQQA 2XDJA 2A45I 2HODA 1NTMG 1PL5A 1P84D 2O3JA 3CD6P 3AEBC 3VMXA 4B86A 1LT9C 5AW0B 2D2CD 3V5BA 4BRYA 1LTSC 3V6IA 3HE5A 1FAVA 3G4SP 1R5LA 3AE6C 2KXPB 5B5EH 4R4LA 3A3YB 5APTA 1ZLLA 1U7MA 1GDTA 1M8OB 3A2AA 3WU2E 1RF1A 4IL6X 1VQ6P 4IFDK 3TGUD 4Y28J 1BGYJ 1LP1A 1MFZA 5KAFH 4W7ZA 3HD7B 3RK2C 3VP9A 4IL6E 1CZQA 4Y99B 2MJZA 1SQXD 4UB8H 4AQRD 4N78E 3CC7P 1VQMP 4I6MC 1JCDA 1NU1J 1GU5A 3HUSA 4BXLA 1N7SA 3H1KE 2QE7H 1PP9G 1PZQA 2FYUJ 2KYVA 1ZP0C 2JKVA 2WSEH 3II6A 3PTZA 2N1TA 4DCKA 2KK7A 1LT9B 2A06G 2KIKA 2IBZG 1FC2C 3TF5A 1GW3A 3L75D 3D6ZA 2PFXA 3SFEC 4PD4E 1GD2E 2ZVOB 1AVYA 3BCCD 1QVFO 1HGVA 4U3FG 1X0TA 1J1DC 1Q90D 1RY3A 4ZNCA 1PPJE 2HYNA 3H1KG 1SFCC 1FJPA 1BSNA 2W6BA 3AE2C 1HVVA 2JR8A 2R3SA 3H1HJ 3H1JD 3I5CA 1PGOA 3RK3C 2YNYA 1L0NK 3HE4B 1AV1A 3FXEA 3E7KA 3RK2B 1L0LD 4KHXA 1S72P 2LR2A 4OH8B 1KFNA 3Q5PA 2M0BA 1NAYA 3CCEP 2Q3IA 4K35A 4IFFA 3S1KA 2AXCA 5CJ4A 1KZUB 1Q2NA 1M57D 1JY3N 2Y9YA 2C9LY 1NU1E 3HD7A 2LKMA 4YXDC 1OFCX 1OIPA 1N2DC 3H1ID 2KSJA 2FYUE 3TDKA 5KLVJ 1N73C 3U1AA 2W8ZA 2I1JA 3V2NA 4H13D 1J1DB 2XU6A 3CC4P 3A0HH 1OMIA 3PRJA 1MFTA 4I2LC 1SFCB 1EXJA 3L73D 3PHLA 3A0BE 1QX8A 3O8ZA 5AVSB 4TT3H 1SQVJ 3AEEC 3CWBG 1OVVA 1FDOA 3RK3B 5AVTB 1P84E 1KFMA 2M3EA 1YHQP 1RQUA 3R2PA 1BE3D 1VF5C 2OYOA 2WSFJ 2P2UA 3P8CD 1X9VA 2B88A 4LLHA 1OW7A 1NJIQ 3CCJP 4UB6E 1IZNB 2BEQD 5H2FE 4NPDA 1BDCA 4D6TD 3AE5C 1X79B 5DJUB 3HE4A 1KILC 1ZOYC 3PH0A 1Y8AA
chains in the Genus database with same CATH topology
3E1RA 2Q6QA 3WUVA 1UIIA 2ZXXA 3WUTA 3WUUA 4BRYB 2WVRA 3F5HA 4BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1R A;  2Q6Q A;  3WUV A;  1UII A;  2ZXX A;  3WUT A;  3WUU A;  4BRY B;  2WVR A;  3F5H A;  4BRY A; 
#chains in the Genus database with same CATH topology
 1NWQ A;  5CMZ A;  1BCC J;  5TIS H;  2BCC J;  2QJP B;  1OVR A;  1OW8 A;  3IAO A;  2R3C A;  3W68 A;  1IK7 A;  1HH0 A;  2WPS A;  2O01 J;  1N73 B;  2E75 C;  2NPS C;  3S9O A;  1SQX E;  1H0T B;  1LTA C;  3L70 D;  2YIU C;  1Q82 Q;  4XA4 A;  3AE7 C;  5KLI B;  3RK3 E;  1GTW A;  1QL2 A;  3KZI E;  3TGU G;  1SQB D;  1SQV E;  3L71 J;  4WBA A;  5AW5 B;  1VQO P;  1VQL P;  1KYO H;  2AXT H;  1A02 J;  2B87 B;  3JCU H;  1GZL A;  2WPR A;  3L75 E;  1SFC A;  2FYN C;  2Y0E A;  1IFJ A;  1J1E C;  5APS A;  1KQS O;  5GTI E;  5AVQ B;  1K73 Q;  1KIL B;  4Z1M H;  1FJK A;  2IFN A;  3H1J E;  3M9H A;  2FXM A;  4YXW H;  1ZME C;  1EZV D;  2WVR A;  1K9M Q;  5C39 A;  1GL2 C;  1NTK K;  1EDK A;  2FBW C;  2E75 B;  1T8Z A;  2NPS B;  1JO5 A;  1U57 A;  4U3F D;  3CMA P;  2BCC E;  2Y0D A;  3GG2 A;  1H88 A;  4XE5 B;  1NTM J;  1SQP K;  4NPE A;  1FZG A;  3BCC G;  2KLU A;  3WUV A;  3Q5R A;  1NTZ K;  1VDF A;  2QM7 A;  2FY8 A;  3L72 E;  1S3J A;  1JUN A;  2GM4 A;  3OA7 A;  1MKM A;  2ZFC A;  3SFD C;  1T2K C;  3V2Q A;  3LID A;  3MGN A;  3CXH H;  2C0X A;  5BVZ A;  1SLQ A;  3H1J G;  1N73 A;  2QSI A;  4M3L A;  5E79 E;  1KB9 E;  1URQ D;  5AW7 B;  1L4A D;  1LT1 A;  1L0L G;  5AVW B;  2E42 A;  2FYN B;  1NHL A;  2IYP A;  3C1L A;  3L71 E;  4AYC A;  4JBZ A;  1J1E B;  5AW4 B;  1G1I A;  4IOI H;  4RKU J;  5CCG D;  4BWN A;  1W5C E;  4H44 C;  5APX A;  3L73 E;  2B9B A;  1NYH A;  2K9J B;  1RE4 C;  5AVV B;  2M5A B;  2KS1 B;  1HJB A;  1VQK P;  1HWT C;  4C7N B;  3V2P A;  4I7Z C;  5KLV K;  2B87 A;  3U59 A;  1S5L X;  2OTL P;  1GL2 B;  5AW1 B;  1TU3 F;  1KYO I;  3RGU A;  3H1I G;  1NH4 A;  2JP3 A;  4JYB A;  2WIT A;  1SVF A;  1SQQ K;  1N8R Q;  4C7R A;  1OW6 A;  1KIL A;  1YIT P;  3AEC C;  4W7Y A;  2WWW A;  1W2E A;  2HR3 A;  2NRG A;  4L75 A;  1YI2 P;  1S5L E;  1J2J B;  3B71 A;  3CWB D;  5CCH C;  1BGY D;  3HTK B;  1T3U A;  3CCL P;  2Q3E A;  2E74 D;  3MZW B;  3ABV C;  2KLV A;  2XKM A;  2NPS A;  5KAF E;  1OVU A;  3KPE A;  3BRT B;  5AVU B;  1IK9 A;  1FZE A;  4GT1 A;  1BE3 G;  4H0L C;  3H1K J;  4UB8 E;  1AJY A;  1H89 A;  4KT0 J;  1S9K D;  1K05 A;  2OAR A;  3D6Y A;  5GTH H;  1HUC A;  1AFO A;  5AW2 B;  3OJA B;  1YIJ P;  4WY4 C;  4H44 B;  4D6T G;  2H43 A;  1OZH A;  2OGU A;  1LTB C;  4I7Z B;  4L76 A;  3CXH I;  1Y47 A;  2H89 C;  1KYO D;  1SQB E;  2WSC J;  3M9B A;  1LTT C;  3L35 A;  1NTK D;  4PJ0 E;  4OGQ D;  1SQP D;  4EYY Q;  2KNC B;  2SPZ A;  2Q1K A;  2K9J A;  2M5A A;  3H1H D;  4C7N A;  1NTZ D;  4LGD E;  1A02 F;  1PP9 E;  4L73 A;  3Q2Y A;  4HB1 A;  3L70 G;  1QLE D;  1PV3 A;  3I55 P;  3M0D C;  4WWI A;  1GL2 A;  2KZI A;  1FE6 A;  1M7L A;  2A06 E;  2LXB A;  1L0N G;  2IBZ E;  2RMZ A;  1SQB G;  2R32 A;  4H0L B;  3AE4 C;  2Q6Q A;  1RHZ B;  1LGH B;  2D2C C;  3TSI A;  4U3F E;  3P8M C;  4I1L A;  3HTK A;  3OW2 O;  1GW4 A;  3S4R A;  1JEK A;  4WY4 B;  1X8Y A;  1VQN P;  2HPC A;  1HGZ A;  3FXD A;  2H7H A;  3CXH D;  2P7J A;  4JQ0 D;  2ZT9 D;  2E5Y A;  2FFD C;  1YJ9 P;  3O6Q A;  1HF9 A;  1QGK B;  1JCC A;  1YTZ I;  4HYT B;  1RE3 C;  2RN0 A;  2QRX A;  5AVR B;  2KP8 A;  1EZV G;  1EDI A;  2P58 A;  1JY3 P;  1SQQ D;  1G1J A;  3W67 A;  1CI6 B;  2K3R A;  3I56 P;  3A0H E;  1RE4 A;  2IPP A;  2LXC B;  1OX3 A;  2JDI H;  3ZDM A;  3RBZ A;  5CBO A;  3C8V A;  2V7Q H;  2ZYD A;  2Q7C A;  4C46 A;  1FZF A;  5AW3 B;  3GF3 A;  2VRS A;  3N7N A;  3B5N D;  3E1I A;  3KYQ A;  3L74 G;  3Q1M A;  3RL0 D;  2KNC A;  3WU2 H;  1UII A;  3WUT A;  2D2C B;  2N9Y B;  3NFQ A;  1HBW A;  1YBK A;  5CCH A;  4OGQ B;  4HKZ H;  2YMK A;  2M8R A;  2WT7 B;  3CCU P;  3TGU J;  4GOE A;  2IFM A;  1IFD A;  3CWB E;  4IL6 H;  3KQG A;  5B66 H;  5APV A;  2FFD B;  1K04 A;  2HFE D;  3CCM P;  4NPF X;  2Z5I A;  2QJP C;  2OYH C;  5CHX A;  1SQX J;  3M91 A;  2RKL A;  1ZN5 A;  1X22 A;  1QL1 A;  4WY4 A;  2PP6 A;  1NKZ B;  3WMM 0;  1JY2 P;  1G2C B;  3RL0 g;  4GIF A;  3G9R A;  1S1C X;  1ZRT E;  3MTU E;  3BAS A;  1KMI Z;  1M90 Q;  1JY3 O;  3M06 A;  2Z4E A;  2KOG A;  3F5H A;  1LT9 A;  3SWF A;  1FZC C;  2JO1 A;  1BGY G;  4PD4 H;  5KLI C;  2P67 A;  3L75 J;  3CX5 H;  1NKN A;  3AE3 C;  1CI6 A;  1YYC A;  3BCC J;  3QH9 A;  1N86 A;  3M0A A;  4GKG A;  1YQ4 C;  1DEB A;  3L36 A;  2KI7 B;  4JPZ B;  3M0D A;  3CLQ A;  1JTH B;  2YMY A;  4H13 C;  3H1J J;  3GLM A;  2C0W A;  3H1L D;  3BVH A;  1M56 D;  1JY2 N;  2UWJ E;  3USS A;  3KXD A;  1L0L J;  3TGU E;  2OYH B;  2YXR B;  2YXQ B;  2E43 A;  3VMY A;  1EZV I;  1AQ5 A;  2QJY C;  2QA4 P;  3RL0 B;  2WT7 A;  4ASW A;  3EFF K;  1NTK G;  1DEE G;  3L72 J;  1YQ3 C;  1SQP G;  4RO0 A;  2FFD A;  3GF7 A;  3GHG B;  3H1H G;  1RE3 A;  2YO3 A;  1NTZ G;  3OAK A;  2OYI C;  1FZC B;  3EWK A;  2AEJ A;  3H1I J;  1RH5 B;  3CL3 D;  1L0N D;  1GU4 A;  2IZ1 A;  2KUB A;  3B8E B;  2FXO A;  1XTC C;  5AVZ B;  1JM0 A;  2B89 A;  2XZR A;  4GOF A;  1DH3 A;  1NU1 K;  1JNM A;  2YKQ A;  1KQG B;  1GMJ A;  2W27 A;  1ZW0 A;  3L73 J;  2L91 A;  1LWU C;  2GA1 A;  2FYU K;  3BCC E;  3CCV P;  1KC8 Q;  4H13 B;  1VPC A;  3PJS K;  3IR9 A;  4WVZ A;  3V4Q A;  1KV4 A;  3TNU B;  1S2E A;  3GW6 A;  1BE3 J;  2W6J H;  5L8R J;  2IYO A;  2FKW B;  1BSH A;  2MKV A;  1KTM A;  4UB6 H;  3CX5 I;  3KHU A;  5KLV G;  5H2F H;  1CW5 A;  1E79 H;  3V2R A;  1N7S D;  2QJY B;  1L0L E;  1JTH A;  3B4S A;  4D6T J;  3A5T A;  2ZXE B;  1SQQ G;  2K88 A;  2N1T D;  4WB4 A;  2YO2 A;  2IDB A;  1MUU A;  2OYI B;  2OYH A;  4N78 D;  1ZV8 A;  3L74 D;  3VOP A;  3L37 A;  4HH2 A;  2K37 A;  2ZYG A;  3H1I E;  3UIA A;  1JMB A;  2GUS A;  2A45 H;  1VQP P;  2GUV A;  3AE8 C;  1H0T A;  4PV1 D;  1LWU B;  2WSS H;  4K3A A;  4KJM A;  5TJH A;  1FZC A;  1SP4 A;  4O9B A;  2Q5U A;  3H6P A;  3IFM A;  4QMA A;  1SQB J;  4DJG A;  1SQX K;  3G6E P;  1DD3 A;  1CSB A;  1U7J A;  3CX5 D;  1PPJ D;  1Q7Y Q;  2OTK E;  2WSF H;  3HE5 B;  1R8E A;  4OVN F;  2W83 C;  1BE3 E;  1FZB A;  2JWD A;  3NTN A;  3P8C E;  1PP9 J;  1URQ C;  1L4A C;  3HD7 D;  1RF1 B;  2BAS A;  5B5E E;  1SQV K;  3TNU A;  3WUU A;  2E76 D;  1AQT A;  4D6T E;  3SSU A;  1JB0 J;  1E5W A;  4U7J A;  3H1L E;  5CCG C;  4XFJ A;  1DX7 A;  2WPQ A;  4U3F J;  2O01 H;  2E5T A;  2O1J A;  1NU1 D;  1YJW P;  3CCS P;  5DJT B;  1LTI C;  2WMM A;  1ZR4 A;  1K8A Q;  1AVO A;  2JWA A;  1EDL A;  2FYU D;  1USD A;  2OYI A;  1RF0 C;  1IFI A;  1QEX A;  5E79 H;  1KB9 H;  3E1R A;  2FYZ A;  2KB7 P;  3L70 E;  3D70 A;  3H1L G;  4MN4 C;  1EQ7 A;  2W6A A;  5KJ7 D;  2E74 C;  1L0N E;  1Y9B A;  1PIX A;  2WTY A;  1LWU A;  2FXP A;  2YKP A;  3CCQ P;  3VMA A;  2ITA A;  1URQ B;  3AED C;  2AEF A;  1L4A B;  3RK2 D;  1OXZ A;  1YJN P;  4ZKU A;  1QVG O;  4GOD A;  2KS1 A;  4PV1 B;  2N9B A;  1EC5 A;  2G3A A;  5KAI H;  4GDO A;  3A7O A;  2Z5H A;  4N3Y B;  1BDD A;  4EDF A;  1JMM A;  2QVA A;  1FOS E;  3AEG C;  3IF4 A;  1LNQ A;  1NAF A;  2M3B A;  1EZV E;  1S5L H;  5KJ7 C;  1D7M A;  2Y9Z A;  3FX0 A;  2P1J A;  4ZMD A;  1M1K Q;  3L4F A;  4OGQ C;  3CWB J;  1USE A;  3K5B A;  3CI9 A;  2HLO A;  1KQF B;  2E76 B;  5B66 E;  2IZ0 A;  5KLV D;  1SFC D;  4JF7 A;  2E74 B;  3L74 E;  2WPV B;  4HJG H;  1VQ8 P;  1NTM K;  4ZKP A;  1KD1 Q;  4RES B;  5KKZ C;  1EXI A;  3G3Z A;  3RK3 D;  1WT6 A;  1T6A A;  2CPS A;  1NO4 A;  1EDJ A;  1KQL A;  3TYY A;  1LTJ C;  3JC2 2;  1SQV D;  3AE9 C;  3LIE A;  2CK3 H;  1KB9 I;  2KZJ A;  3NMD A;  3CPW O;  4PJ0 H;  3VN0 A;  2QJK C;  3AEF C;  2ZJS E;  2QG4 A;  1KN7 A;  1NTK J;  3CX5 E;  4CPG A;  1URQ A;  1IJD B;  2ZT9 C;  5CBN A;  3MD0 A;  1L4A A;  1SQP J;  2K9Y A;  2PAJ A;  3Q3D A;  1NTZ J;  1SQB K;  3HRN A;  5CCG A;  2J5U A;  1BCC D;  3T97 B;  1NVO A;  3EQ2 A;  2BCC D;  3FWL A;  1DD4 A;  3MUD C;  1FZA A;  1BGY E;  2H8P D;  5AVY B;  3H32 B;  4EI2 A;  3AEA C;  5TIS E;  1NOH A;  1N7L A;  2L5G B;  2Y0C A;  2PGD A;  2YKO A;  1ZXG A;  2R5D A;  1FOS F;  1IO4 A;  4DZO A;  2V4H A;  3L72 D;  4L74 A;  1DIP A;  1PPJ G;  3GMA A;  2H88 C;  3B5N C;  1Q81 Q;  5KKZ B;  1RF0 A;  4DOJ A;  1GK6 A;  4RJT A;  3RL0 C;  3CME P;  1T3J A;  1VF5 D;  3VYI A;  1VQ7 P;  3Q5S A;  1LTJ B;  1KB9 D;  1S9K E;  1Q86 Q;  1VQ4 P;  2Q9I A;  3SWK A;  3GHG C;  2G8Y A;  2QJK B;  3L71 D;  1XTG B;  2WSC H;  4LC1 A;  1KIL D;  1SS1 A;  2IX7 C;  4R4M A;  4A7P A;  1SQQ J;  2ZT9 B;  3AE1 C;  2ZXX A;  1KYO E;  2AXT E;  5APQ A;  3TK1 A;  3IN6 A;  3VMZ A;  1JOC A;  1M1J C;  3JCU E;  1NTK E;  3LW5 J;  5APU A;  3U1C A;  1NU1 G;  2C9N Y;  1GK4 A;  1IC2 A;  3SWY A;  2ZVN B;  1SQP E;  5AW9 B;  2E75 D;  2FYU G;  2NPS D;  3H1H E;  3RBX A;  2O1K A;  1NTZ E;  3M9Q A;  5KJ7 A;  4JYC A;  1LJ2 A;  2R44 A;  3CC2 P;  3B5N B;  1R5S A;  4YTP C;  1NTM D;  1ZR2 A;  2W90 A;  1FU1 A;  3NXS A;  3T97 A;  5APW A;  5AVX B;  1Z56 A;  4EIJ A;  1OWA A;  2IBZ I;  3H32 A;  2WZ7 A;  2XNX A;  1MZ9 A;  1RQV A;  1JY2 O;  3CCR P;  3P7K A;  3CXH E;  1HJ0 A;  3V4W A;  1VQ5 P;  5KLV E;  2J58 A;  5CJ0 A;  5KTB A;  1G2C A;  1LTJ A;  3A0B H;  1PGQ A;  1M1J B;  2PRR A;  1VL2 A;  2ZYA A;  3KDP B;  5K5G B;  5APY A;  1VQ9 P;  2O01 N;  1SQQ E;  2QIW A;  1GL2 D;  1P84 H;  1FS0 E;  1WMK A;  1VF5 B;  3VP8 A;  2I1K A;  5EFW B;  5AW8 B;  1S4X A;  2I8D A;  3VTP C;  3FGA D;  4PD4 I;  3H25 A;  2HG5 D;  1HTL C;  1AA0 A;  2XND H;  1SQX G;  3MIW A;  2POH A;  5M1B A;  1PP9 D;  2AEM A;  3FWN A;  1FDI A;  1T2K D;  2CPB A;  1IFM A;  2A45 G;  3EFG A;  1PGP A;  2A06 D;  3MUD A;  3H1L J;  2IBZ D;  1RF1 C;  4IFM A;  1L2P A;  1SQV G;  2KSE A;  1BCC E;  3B5N A;  3L75 G;  1PFI A;  4H44 D;  3H1K D;  2K1A A;  1NGM B;  1FDM A;  2R5B A;  2YIU B;  3QWO C;  2QEX P;  3HUS C;  4N6J A;  1N7S C;  4OWF A;  1UIX A;  3MP7 B;  3L70 J;  5GTH E;  3BAT A;  3GHG A;  3KZI H;  2WSE J;  2HOD B;  2NZ2 A;  4DT0 A;  2JEE A;  2N1T C;  1L0N J;  4PD4 D;  1BCC G;  1W2B O;  2BCC G;  2RH0 A;  3C9I A;  1M1J A;  1IFN A;  1LTG C;  1MV8 A;  4BRY B;  5CCH D;  4YPC A;  1KIL E;  2BEZ F;  3P32 A;  3LW5 H;  5GTI H;  2OTJ P;  5BU8 B;  3JSV C;  3L72 G;  4W80 A;  2WQY C;  1KOR A;  1PGJ A;  2V7Q J;  1P84 I;  4H0L D;  2DW3 A;  4PV1 C;  1WRG A;  3MHV A;  5KAI E;  1LP1 B;  3N4X A;  4WY4 D;  3L71 G;  2QM8 A;  3ITK A;  4EOT A;  1YTZ T;  1NTM E;  3L73 G;  2J59 M;  3HUS B;  4AUW A;  1N7S B;  3D71 A;  2HPC B;  3G71 P;  3F89 A;  2ZAE B;  5AW6 B;  2JJL A;  3PLN A;  1IFP A;  1L0L K;  3PP5 A;  3HD7 C;  2N1T B;  4ASV A;  3L74 J;  1H8A A;  3O6Q B;  2E76 C;  5BU5 A;  4TLF A;  4Y99 C;  2XV5 A;  3R4Y A;  1ZRT D;  2P10 A;  3BRV B;  1FBM A;  2OQQ A;  2XDJ A;  2A45 I;  2HOD A;  1NTM G;  1PL5 A;  1P84 D;  2O3J A;  3CD6 P;  3AEB C;  3VMX A;  4B86 A;  1LT9 C;  5AW0 B;  2D2C D;  3V5B A;  4BRY A;  1LTS C;  3V6I A;  3HE5 A;  1FAV A;  3G4S P;  1R5L A;  3AE6 C;  2KXP B;  5B5E H;  4R4L A;  3A3Y B;  5APT A;  1ZLL A;  1U7M A;  1GDT A;  1M8O B;  3A2A A;  3WU2 E;  1RF1 A;  4IL6 X;  1VQ6 P;  4IFD K;  3TGU D;  4Y28 J;  1BGY J;  1LP1 A;  1MFZ A;  5KAF H;  4W7Z A;  3HD7 B;  3RK2 C;  3VP9 A;  4IL6 E;  1CZQ A;  4Y99 B;  2MJZ A;  1SQX D;  4UB8 H;  4AQR D;  4N78 E;  3CC7 P;  1VQM P;  4I6M C;  1JCD A;  1NU1 J;  1GU5 A;  3HUS A;  4BXL A;  1N7S A;  3H1K E;  2QE7 H;  1PP9 G;  1PZQ A;  2FYU J;  2KYV A;  1ZP0 C;  2JKV A;  2WSE H;  3II6 A;  3PTZ A;  2N1T A;  4DCK A;  2KK7 A;  1LT9 B;  2A06 G;  2KIK A;  2IBZ G;  1FC2 C;  3TF5 A;  1GW3 A;  3L75 D;  3D6Z A;  2PFX A;  3SFE C;  4PD4 E;  1GD2 E;  2ZVO B;  1AVY A;  3BCC D;  1QVF O;  1HGV A;  4U3F G;  1X0T A;  1J1D C;  1Q90 D;  1RY3 A;  4ZNC A;  1PPJ E;  2HYN A;  3H1K G;  1SFC C;  1FJP A;  1BSN A;  2W6B A;  3AE2 C;  1HVV A;  2JR8 A;  2R3S A;  3H1H J;  3H1J D;  3I5C A;  1PGO A;  3RK3 C;  2YNY A;  1L0N K;  3HE4 B;  1AV1 A;  3FXE A;  3E7K A;  3RK2 B;  1L0L D;  4KHX A;  1S72 P;  2LR2 A;  4OH8 B;  1KFN A;  3Q5P A;  2M0B A;  1NAY A;  3CCE P;  2Q3I A;  4K35 A;  4IFF A;  3S1K A;  2AXC A;  5CJ4 A;  1KZU B;  1Q2N A;  1M57 D;  1JY3 N;  2Y9Y A;  2C9L Y;  1NU1 E;  3HD7 A;  2LKM A;  4YXD C;  1OFC X;  1OIP A;  1N2D C;  3H1I D;  2KSJ A;  2FYU E;  3TDK A;  5KLV J;  1N73 C;  3U1A A;  2W8Z A;  2I1J A;  3V2N A;  4H13 D;  1J1D B;  2XU6 A;  3CC4 P;  3A0H H;  1OMI A;  3PRJ A;  1MFT A;  4I2L C;  1SFC B;  1EXJ A;  3L73 D;  3PHL A;  3A0B E;  1QX8 A;  3O8Z A;  5AVS B;  4TT3 H;  1SQV J;  3AEE C;  3CWB G;  1OVV A;  1FDO A;  3RK3 B;  5AVT B;  1P84 E;  1KFM A;  2M3E A;  1YHQ P;  1RQU A;  3R2P A;  1BE3 D;  1VF5 C;  2OYO A;  2WSF J;  2P2U A;  3P8C D;  1X9V A;  2B88 A;  4LLH A;  1OW7 A;  1NJI Q;  3CCJ P;  4UB6 E;  1IZN B;  2BEQ D;  5H2F E;  4NPD A;  1BDC A;  4D6T D;  3AE5 C;  1X79 B;  5DJU B;  3HE4 A;  1KIL C;  1ZOY C;  3PH0 A;  1Y8A A; 
#chains in the Genus database with same CATH homology
 3E1R A;  2Q6Q A;  3WUV A;  1UII A;  2ZXX A;  3WUT A;  3WUU A;  4BRY B;  2WVR A;  3F5H A;  4BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...