2WVRA

Human cdt1:geminin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
70
structure length
70
Chain Sequence
KENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Quaternary Structure of the Human Cdt1-Geminin Complex Regulates DNA Replication Licensing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords GEMININ
total genus 33
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07412 Geminin Geminin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 2wvrA00
3F5HA 4BRYA 2Q6QA 3E1RA 2WVRA 3WUVA 1UIIA 3WUTA 3WUUA 2ZXXA 4BRYB
chains in the Genus database with same CATH superfamily
3PTZA 3HD7B 1ZN5A 3CL3D 3P7KA 1YHQP 2G3AA 2HPCA 1LTBC 3KZIH 1VQ6P 1DD3A 4UB8H 2C9NY 1K04A 5AW4B 1USDA 3AE9C 2YIUC 4YTPC 3RBZA 1JY2P 3I5CA 5APUA 1L0NG 1YJNP 2WSCJ 1GK6A 2P7JA 2YMYA 4KT0J 1SFCC 1Q82Q 2N1TD 1K05A 2PP6A 1FOSE 1NTZJ 3H1KG 3AEAC 1DX7A 1Q2NA 3H1HD 3V4WA 3L36A 3W68A 2GM4A 1AV1A 3P8MC 1SQPG 1AVYA 2QSIA 4H0LB 3USSA 1S72P 3M0DC 4UB8E 3TDKA 1SQBJ 3VP8A 2NPSC 2OTJP 1SQQE 1RE3A 4H0LD 2PAJA 1S1CX 1QVGO 1KD1Q 2IYOA 3CXHE 1OVRA 3NTNA 4WWIA 2QRXA 1L0LG 3S4RA 1JCDA 3V2QA 3V6IA 5KLIB 1SQVK 3AE3C 3L71J 3QH9A 1URQD 1KFNA 2Q6QA 5APXA 4RJTA 4BWNA 5CCGD 3BVHA 3B8EB 4PJ0H 3JCUH 4W7YA 1FBMA 2K9YA 2FYUJ 1R8EA 3CMAP 1X22A 3A7OA 3FXEA 1EQ7A 1RE4C 2KZIA 4GOEA 1PPJD 4YXDC 3VMXA 2YKOA 3CWBG 5KJ7A 1Q81Q 1EZVD 2ZVOB 1IFDA 3VP9A 3H1HG 3RL0D 3MGNA 1YITP 2C9LY 4R4LA 1LJ2A 1NTKG 3CXHH 5AVUB 2ITAA 2PRRA 1LTSC 3L73J 1LP1B 3P8CE 1L4AA 1KYOD 3HE4A 1M1KQ 2L5GB 5AVXB 2KSJA 2ZYGA 5CBNA 3A5TA 1RF1A 2KYVA 1FDMA 5AW9B 3M91A 2BCCJ 1IK9A 3R4YA 3RK3C 3VMZA 1LT9B 5AVVB 2M0BA 3EFFK 4NPDA 1HH0A 1QL1A 1KB9E 1ZRTE 2IZ1A 3H1IJ 3H1JG 3OA7A 4HH2A 1FZFA 3CD6P 3TNUA 3RK2C 1PP9G 3A2AA 1DD4A 1T3JA 3TGUG 4OVNF 1G2CB 1KB9I 3MUDA 1NU1E 2L91A 1HUCA 3L73E 5APSA 1YIJP 5AVYB 3II6A 3GG2A 2DW3A 2FYZA 1IO4A 3RL0g 2J58A 3C8VA 4PV1C 3CCEP 3L70E 4EYYQ 5TISH 1FZGA 5APVA 4ASVA 2YKQA 1KV4A 1KB9D 1NO4A 1N2DC 1VQ7P 1IFPA 4IL6E 1CZQA 3W67A 3CCRP 1SQPE 3MUDC 1KFMA 2WPQA 1PP9E 3PLNA 1S5LX 3AE7C 2WWWA 1NKZB 3HD7A 3NXSA 1ZW0A 1VQ8P 1NHLA 1PV3A 2BCCG 2BEZF 1NTME 1NTMK 1SP4A 3IR9A 3CCJP 1SVFA 2QJPB 4N78E 3WU2E 4C7NA 3AE4C 1H0TA 1U7JA 1PGPA 1YQ3C 1SQQG 3P32A 1PPJE 1L0LJ 2XDJA 1G1IA 5E79H 4I2LC 2YO2A 1BGYD 1P84H 3L74J 3MIWA 3O6QB 4YPCA 5KLVD 4D6TD 1SQVD 1S5LE 2W90A 2QA4P 3CXHI 4U3FJ 1FJKA 3JCUE 3NFQA 1PP9J 2IFMA 4L74A 5KJ7C 1KQLA 1S9KE 2IDBA 5KLIC 1JO5A 2ZXEB 3L71D 3H1KE 5APYA 1KILD 1X9VA 2WSCH 1JTHB 5KAIE 5BU8B 1A02J 1FOSF 3H25A 4RKUJ 2O1KA 1KTMA 4LLHA 2V7QJ 3BCCJ 3FWLA 3GHGB 5AW0B 2A06E 4IL6H 2ZYDA 4IFFA 3CCSP 2A45H 2YKPA 1IFIA 3N7NA 4BRYB 1GW4A 3R2PA 3CPWO 4DZOA 5GTHH 2IYPA 1BE3E 1JCCA 3CX5D 1BGYJ 3KPEA 5KLVJ 1VQ9P 1VPCA 3H32A 1KB9H 2KLVA 3AE5C 1YI2P 5GTHE 1AQ5A 3I55P 1JY3N 1U57A 3M0DA 5KJ7D 2OARA 4I6MC 3AEFC 1H88A 2OYHA 3AECC 3RBXA 3MD0A 3UIAA 2HPCB 1IFJA 3GW6A 1NJIQ 4PD4E 5KAFH 1KC8Q 3JSVC 1SQXD 1L4AB 1IFMA 1M7LA 2W6AA 4Y99C 3H1LG 1KZUB 3LIDA 1NAYA 4OGQB 1JM0A 2WPRA 4MN4C 2V7QH 3OW2O 3CC4P 1OZHA 3CCMP 5CHXA 1SQQJ 2XU6A 3D6YA 2K9JA 4ZNCA 2WZ7A 3B5NB 4DJGA 1E79H 3L74D 4D6TJ 1EZVG 2HODA 5AVQB 5BU5A 3K5BA 1S5LH 2E74C 3G9RA 4WY4D 1SQBG 1LTGC 1N7SB 3L74E 4N78D 1NTKD 2R32A 1MFTA 1RQVA 3EQ2A 2H88C 2PGDA 3HUSC 1NGMB 4PV1D 1J1DB 2AXTH 4R4MA 2FYUE 5CCHA 1NU1K 4WY4B 1NVOA 1T2KD 3CMEP 1WRGA 3SFDC 2IZ0A 1FZAA 1S3JA 3VOPA 5KTBA 2H43A 1YTZT 1QL2A 3F89A 3L70J 3PH0A 4H0LC 1PGQA 1NOHA 2P58A 3BCCE 1SQPD 4JYBA 3OAKA 1NYHA 1OIPA 1UIXA 4Z1MH 1KYOI 2N1TA 1GK4A 2K37A 2R3CA 1VQOP 2OYOA 3TGUD 1URQC 4EI2A 3PHLA 3SFEC 3CX5E 1MFZA 4PD4H 1GU4A 1AQTA 1JOCA 1SLQA 1SFCD 3L73D 5C39A 4LC1A 5APWA 2LXBA 5H2FH 2Q9IA 1AA0A 2OTLP 1FE6A 3D6ZA 1RHZB 3CCUP 1RF1C 1KQSO 3M06A 1RF1B 1DH3A 4ZKUA 4IFMA 2O3JA 3U1CA 1FZBA 3RL0C 1VF5D 1BCCD 1PPJG 3H1LE 1YTZI 2C0XA 3L71E 1JY3O 3T97A 4YXWH 2OYHC 2NRGA 2H7HA 1LNQA 2BCCD 1VQPP 2G8YA 3KYQA 1SQVE 4QMAA 2Q7CA 1HVVA 1JY3P 3IN6A 4HJGH 2GUSA 2HLOA 2FYNB 3FGAD 1EZVE 3GHGA 1K8AQ 1SQQK 1RH5B 3AEGC 1NTZG 1L0LK 5CBOA 1HJBA 4JF7A 5B5EH 3Q1MA 4IFDK 2YXRB 4OH8B 4C46A 2FYNC 1M1JC 1BDDA 1OMIA 3KXDA 1P84E 2NZ2A 2QE7H 5B66H 2O01N 2D2CB 1JMMA 2P1JA 1SFCB 2A06G 1EDKA 2FYUD 3HRNA 3V4QA 5KLVK 2NPSA 3OJAB 5B66E 4GODA 2FKWB 4HKZH 1NTKE 1NTKK 4JBZA 4B86A 1YJ9P 2FXOA 2ZVNB 1BCCG 1YYCA 5L8RJ 1LTJC 2FBWC 2J5UA 2WPSA 3M9QA 4GKGA 4L73A 1OW7A 2ZYAA 1VF5B 3EFGA 1ZP0C 3H1JE 3IF4A 3S1KA 3U59A 1Y9BA 4DT0A 2K88A 1RY3A 2WSSH 1QVFO 2A45I 1RF0C 3H1KJ 3A0BH 4AYCA 1NU1D 2B9BA 1SQXE 3AE6C 1J2JB 1OW6A 2K9JB 3CC2P 1EDLA 4H44D 4H44C 2FYUK 2HYNA 2WTYA 1LWUA 2O01J 1JB0J 1KORA 1X0TA 3MTUE 1NTKJ 2IBZE 1FDIA 4GIFA 2XNXA 1PL5A 2RH0A 2B89A 1N7SA 2WITA 1CI6A 3AEBC 2JP3A 3S9OA 1OFCX 2IBZD 2M5AB 3NMDA 1ZR2A 2RKLA 1KQGB 5AW3B 1ZV8A 4UB6E 1M90Q 3SWFA 1LTJA 4WY4A 1BE3D 1M1JB 4JQ0D 1VQKP 1PGJA 4O9BA 5AW5B 2POHA 2FFDA 2WT7B 4ASWA 3I56P 1MKMA 3P8CD 5APQA 5CCHD 2B87A 2JEEA 1MV8A 2Q1KA 3KZIE 2J59M 3L75G 2Y0DA 4WB4A 5AVWB 3ZDMA 1JUNA 2RN0A 3HE4B 1QEXA 3AEDC 3L74G 3GMAA 4KJMA 2QM7A 3CLQA 3D71A 3G6EP 1GL2D 3CC7P 1LT9A 3H32B 1OX3A 1PIXA 1M57D 4WBAA 2W8ZA 2I8DA 1KILE 1KN7A 5AW6B 1FC2C 2AXCA 2Q3IA 2UWJE 2HFED 5CJ4A 3B5NC 1XTGB 4TT3H 3H6PA 2R5BA 2KIKA 1S9KD 4U3FD 2XNDH 4GDOA 2AXTE 4OWFA 2JDIH 2RMZA 3TNUB 1FZCB 1W5CE 1LT9C 2M3BA 2KSEA 1P84D 1H8AA 1JTHA 1BCCJ 3H1IG 1IFNA 2CK3H 1L0LD 1HGZA 1R5LA 2AEJA 3B71A 3KHUA 1XTCC 2FY8A 4L76A 2XKMA 4IOIH 1FZEA 2QJPC 4PJ0E 5AVRB 4N3YB 1YJWP 1P84I 3HTKB 1BE3G 3T97B 5KKZB 1BSNA 1NTMD 2HODB 4U7JA 3SWYA 3VN0A 1GU5A 1USEA 2HG5D 2OGUA 3E7KA 2KS1B 1PP9D 1GDTA 3CWBD 3EWKA 1K9MQ 1JMBA 1SQXG 2IX7C 4I1LA 5AW2B 3C1LA 2YO3A 3PP5A 3TYYA 2VRSA 3H1IE 1J1EB 3Q5RA 1L2PA 1FAVA 3RL0B 1IJDB 1MZ9A 2WSEJ 2Z5HA 3KDPB 2KK7A 3RGUA 1GL2B 2QJYC 3L70D 2PFXA 3BRTB 3E1IA 3L72G 1URQA 5M1BA 1T8ZA 3A0HE 1NWQA 1J1DC 3ITKA 4U3FG 1HJ0A 2N1TC 2N1TB 3L35A 2KI7B 2ZAEB 2LKMA 1RE3C 2E5YA 3G3ZA 4A7PA 2H8PD 3VTPC 2YXQB 1LT1A 4TLFA 1DEEG 2GA1A 3TSIA 4K35A 4W7ZA 3V2RA 5H2FE 2QJKC 3A0BE 2OQQA 2NPSD 3TGUJ 1GD2E 3MHVA 1Z56A 2QG4A 3L75J 3L72J 3SWKA 3LW5H 2OYIB 2KNCB 2O01H 1JY2O 2A45G 2I1KA 3H1JJ 4M3LA 4OGQD 1NTZE 1Y8AA 2W6JH 1QX8A 1SQPJ 3CI9A 2JR8A 2P10A 5AW8B 4HYTB 1LWUC 4NPFX 1KYOE 1Q90D 3A3YB 2ZJSE 3JC22 1SQXJ 1BGYG 1NTMJ 2WVRA 2QM8A 3AE8C 2BEQD 5KLVG 1KQFB 1SQVG 2Y9ZA 1Y47A 1LWUB 4EIJA 1K73Q 1L0NJ 1KILB 2W27A 1QLED 3HUSB 3U1AA 3L71G 2R5DA 2Y0EA 3WUTA 2WQYC 1NTZK 2E74B 3HE5B 1T6AA 3L4FA 2V4HA 3BCCG 1W2BO 2B88A 1HGVA 1J1EC 2OYHB 2E42A 5AVZB 1NU1G 1UIIA 2WT7A 1T3UA 4NPEA 2M8RA 4U3FE 1JNMA 1AFOA 2B87B 2ZXXA 3BRVB 5AVTB 3RK3B 1ZR4A 4Y28J 3LW5J 3VYIA 1VL2A 3LIEA 5CJ0A 1WT6A 4I7ZC 1YQ4C 4PD4D 2KP8A 2Q5UA 4Y99B 1RE4A 1IC2A 1L0NE 1L0NK 3CXHD 2LR2A 2JWDA 3RK3D 4CPGA 4BXLA 2QEXP 1HWTC 2NPSB 1DIPA 5KKZC 4W80A 1N86A 3V2PA 3B5NA 3VMYA 1GW3A 1R5SA 1N73A 3CCVP 3CCLP 3V5BA 2OTKE 4LGDE 4WVZA 5TISE 3H1LJ 4ZMDA 5GTIH 1VQLP 2WSEH 1SQPK 1S2EA 2FXPA 3O8ZA 1LP1A 2IBZI 1BE3J 1NAFA 1PGOA 1SQVJ 2Y9YA 2BCCE 2Z5IA 3KQGA 3WMM0 3H1HE 5DJUB 1EXJA 2P2UA 1H0TB 1M8OB 2KB7P 3H1LD 3MZWB 1BCCE 3HE5A 3D70A 1CW5A 1YBKA 3L75E 1U7MA 4JYCA 5CMZA 5BVZA 1WMKA 5TJHA 3WUVA 1PZQA 1HBWA 1BSHA 1CSBA 1L0ND 1BDCA 3BCCD 5EFWB 2JO1A 5CCGA 1JY2N 2AEFA 2E74D 2K1AA 4H13D 4WY4C 1NU1J 3C9IA 2W6BA 2WSFH 2YNYA 2BASA 3H1KD 4JPZB 4DCKA 4EOTA 1SQBD 1G2CA 1OVVA 1SFCA 1T2KC 1N7SC 1VF5C 3QWOC 2MKVA 1VQMP 1GL2C 2KUBA 2SPZA 3B4SA 1FDOA 4GOFA 5KAIH 3G71P 4K3AA 3Q3DA 2XZRA 3H1JD 2Q3EA 1QGKB 2FFDB 4IL6X 1NH4A 4DOJA 2YMKA 2KLUA 2GUVA 4AQRD 2KXPB 3IAOA 1GL2A 1RF0A 3M0AA 2FXMA 2WSFJ 1SS1A 1LTAC 2R44A 1ZLLA 2D2CC 1IZNB 3Q5PA 4AUWA 2KOGA 1RQUA 2YIUB 1EZVI 1HF9A 2E75D 2R3SA 3N4XA 1KYOH 1EC5A 2M3EA 3AE1C 2JKVA 1SQBK 5B5EE 1ZXGA 4KHXA 1OVUA 1FS0E 2K3RA 3WUUA 1JEKA 2E75B 2JJLA 1EXIA 1OXZA 3L73G 1FZCA 5CCHC 1CI6B 1VDFA 1N7SD 3PJSK 1G1JA 4N6JA 2M5AA 2KNCA 3L72D 4C7NB 3L75D 5KAFE 2LXCB 4L75A 1LTJB 1M1JA 3CWBJ 3PRJA 2E5TA 3F5HA 1KMIZ 3O6QA 2ZT9D 2QJKB 1VQ5P 3Q5SA 2OYIA 1N8RQ 2AEMA 1LTTC 2IFNA 3HTKA 3MP7B 3IFMA 3M9BA 2O1JA 3GHGC 5AW1B 1ZOYC 2JWAA 3Q2YA 2ZT9B 2N9BA 1KILA 2W83C 3A0HH 3FX0A 4XA4A 1PFIA 4I7ZB 1OWAA 4UB6H 1D7MA 1TU3F 1HTLC 1ZRTD 3ABVC 3GF7A 1L4AC 4XE5B 1N7LA 2ZT9C 3H1ID 5AVSB 3RK2B 2MJZA 5CCGC 3CX5I 1AJYA 4C7RA 1W2EA 3E1RA 1FU1A 3CX5H 1GMJA 4OGQC 3V2NA 3RK2D 1NKNA 5GTIE 3CWBE 4H13B 2HR3A 1E5WA 4ZKPA 2E76B 1FJPA 3HD7D 4BRYA 1LGHB 2I1JA 3VMAA 2QIWA 4XFJA 4EDFA 1VQNP 1L4AD 1NTMG 1BGYE 2XV5A 5KLVE 1KILC 3TGUE 2Z4EA 2E76C 4GT1A 2E76D 5K5GB 3L72E 2E75C 1GZLA 2A06D 2E43A 1VQ4P 3RK3E 2OYIC 1GTWA 1MUUA 1N73C 1N73B 3B5ND 3HD7C 3GLMA 1L0LE 3FWNA 2C0WA 2ZFCA 1EDJA 2KS1A 5E79E 2IPPA 1LTIC 5AW7B 1OW8A 3L70G 3TK1A 3G4SP 3H1HJ 4PV1B 1FZCC 3BATA 1IK7A 1M56D 1ZMEC 1DEBA 1NTZD 3WU2H 4D6TE 3SSUA 1Q86Q 3CCQP 1H89A 2WPVB 3BASA 4H13C 1EDIA 4H44B 3L37A 4RESB 2QVAA 3TF5A 2CPBA 4HB1A 2FFDC 4RO0A 2N9YB 3AE2C 1URQB 1Q7YQ 1SQXK 2QJYB 1SQQD 2KZJA 2FYUG 3AEEC 4PD4I 3GF3A 1A02F 3FXDA 2P67A 2WMMA 1X79B 3HUSA 2D2CD 2CPSA 2Y0CA 3M9HA 5DJTB 5APTA 1S4XA 2IBZG 1AVOA 4D6TG 1SQBE 2H89C 1X8YA
chains in the Genus database with same CATH topology
3F5HA 4BRYA 2Q6QA 3E1RA 2WVRA 3WUVA 1UIIA 3WUTA 3WUUA 2ZXXA 4BRYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F5H A;  4BRY A;  2Q6Q A;  3E1R A;  2WVR A;  3WUV A;  1UII A;  3WUT A;  3WUU A;  2ZXX A;  4BRY B; 
#chains in the Genus database with same CATH topology
 3PTZ A;  3HD7 B;  1ZN5 A;  3CL3 D;  3P7K A;  1YHQ P;  2G3A A;  2HPC A;  1LTB C;  3KZI H;  1VQ6 P;  1DD3 A;  4UB8 H;  2C9N Y;  1K04 A;  5AW4 B;  1USD A;  3AE9 C;  2YIU C;  4YTP C;  3RBZ A;  1JY2 P;  3I5C A;  5APU A;  1L0N G;  1YJN P;  2WSC J;  1GK6 A;  2P7J A;  2YMY A;  4KT0 J;  1SFC C;  1Q82 Q;  2N1T D;  1K05 A;  2PP6 A;  1FOS E;  1NTZ J;  3H1K G;  3AEA C;  1DX7 A;  1Q2N A;  3H1H D;  3V4W A;  3L36 A;  3W68 A;  2GM4 A;  1AV1 A;  3P8M C;  1SQP G;  1AVY A;  2QSI A;  4H0L B;  3USS A;  1S72 P;  3M0D C;  4UB8 E;  3TDK A;  1SQB J;  3VP8 A;  2NPS C;  2OTJ P;  1SQQ E;  1RE3 A;  4H0L D;  2PAJ A;  1S1C X;  1QVG O;  1KD1 Q;  2IYO A;  3CXH E;  1OVR A;  3NTN A;  4WWI A;  2QRX A;  1L0L G;  3S4R A;  1JCD A;  3V2Q A;  3V6I A;  5KLI B;  1SQV K;  3AE3 C;  3L71 J;  3QH9 A;  1URQ D;  1KFN A;  2Q6Q A;  5APX A;  4RJT A;  4BWN A;  5CCG D;  3BVH A;  3B8E B;  4PJ0 H;  3JCU H;  4W7Y A;  1FBM A;  2K9Y A;  2FYU J;  1R8E A;  3CMA P;  1X22 A;  3A7O A;  3FXE A;  1EQ7 A;  1RE4 C;  2KZI A;  4GOE A;  1PPJ D;  4YXD C;  3VMX A;  2YKO A;  3CWB G;  5KJ7 A;  1Q81 Q;  1EZV D;  2ZVO B;  1IFD A;  3VP9 A;  3H1H G;  3RL0 D;  3MGN A;  1YIT P;  2C9L Y;  4R4L A;  1LJ2 A;  1NTK G;  3CXH H;  5AVU B;  2ITA A;  2PRR A;  1LTS C;  3L73 J;  1LP1 B;  3P8C E;  1L4A A;  1KYO D;  3HE4 A;  1M1K Q;  2L5G B;  5AVX B;  2KSJ A;  2ZYG A;  5CBN A;  3A5T A;  1RF1 A;  2KYV A;  1FDM A;  5AW9 B;  3M91 A;  2BCC J;  1IK9 A;  3R4Y A;  3RK3 C;  3VMZ A;  1LT9 B;  5AVV B;  2M0B A;  3EFF K;  4NPD A;  1HH0 A;  1QL1 A;  1KB9 E;  1ZRT E;  2IZ1 A;  3H1I J;  3H1J G;  3OA7 A;  4HH2 A;  1FZF A;  3CD6 P;  3TNU A;  3RK2 C;  1PP9 G;  3A2A A;  1DD4 A;  1T3J A;  3TGU G;  4OVN F;  1G2C B;  1KB9 I;  3MUD A;  1NU1 E;  2L91 A;  1HUC A;  3L73 E;  5APS A;  1YIJ P;  5AVY B;  3II6 A;  3GG2 A;  2DW3 A;  2FYZ A;  1IO4 A;  3RL0 g;  2J58 A;  3C8V A;  4PV1 C;  3CCE P;  3L70 E;  4EYY Q;  5TIS H;  1FZG A;  5APV A;  4ASV A;  2YKQ A;  1KV4 A;  1KB9 D;  1NO4 A;  1N2D C;  1VQ7 P;  1IFP A;  4IL6 E;  1CZQ A;  3W67 A;  3CCR P;  1SQP E;  3MUD C;  1KFM A;  2WPQ A;  1PP9 E;  3PLN A;  1S5L X;  3AE7 C;  2WWW A;  1NKZ B;  3HD7 A;  3NXS A;  1ZW0 A;  1VQ8 P;  1NHL A;  1PV3 A;  2BCC G;  2BEZ F;  1NTM E;  1NTM K;  1SP4 A;  3IR9 A;  3CCJ P;  1SVF A;  2QJP B;  4N78 E;  3WU2 E;  4C7N A;  3AE4 C;  1H0T A;  1U7J A;  1PGP A;  1YQ3 C;  1SQQ G;  3P32 A;  1PPJ E;  1L0L J;  2XDJ A;  1G1I A;  5E79 H;  4I2L C;  2YO2 A;  1BGY D;  1P84 H;  3L74 J;  3MIW A;  3O6Q B;  4YPC A;  5KLV D;  4D6T D;  1SQV D;  1S5L E;  2W90 A;  2QA4 P;  3CXH I;  4U3F J;  1FJK A;  3JCU E;  3NFQ A;  1PP9 J;  2IFM A;  4L74 A;  5KJ7 C;  1KQL A;  1S9K E;  2IDB A;  5KLI C;  1JO5 A;  2ZXE B;  3L71 D;  3H1K E;  5APY A;  1KIL D;  1X9V A;  2WSC H;  1JTH B;  5KAI E;  5BU8 B;  1A02 J;  1FOS F;  3H25 A;  4RKU J;  2O1K A;  1KTM A;  4LLH A;  2V7Q J;  3BCC J;  3FWL A;  3GHG B;  5AW0 B;  2A06 E;  4IL6 H;  2ZYD A;  4IFF A;  3CCS P;  2A45 H;  2YKP A;  1IFI A;  3N7N A;  4BRY B;  1GW4 A;  3R2P A;  3CPW O;  4DZO A;  5GTH H;  2IYP A;  1BE3 E;  1JCC A;  3CX5 D;  1BGY J;  3KPE A;  5KLV J;  1VQ9 P;  1VPC A;  3H32 A;  1KB9 H;  2KLV A;  3AE5 C;  1YI2 P;  5GTH E;  1AQ5 A;  3I55 P;  1JY3 N;  1U57 A;  3M0D A;  5KJ7 D;  2OAR A;  4I6M C;  3AEF C;  1H88 A;  2OYH A;  3AEC C;  3RBX A;  3MD0 A;  3UIA A;  2HPC B;  1IFJ A;  3GW6 A;  1NJI Q;  4PD4 E;  5KAF H;  1KC8 Q;  3JSV C;  1SQX D;  1L4A B;  1IFM A;  1M7L A;  2W6A A;  4Y99 C;  3H1L G;  1KZU B;  3LID A;  1NAY A;  4OGQ B;  1JM0 A;  2WPR A;  4MN4 C;  2V7Q H;  3OW2 O;  3CC4 P;  1OZH A;  3CCM P;  5CHX A;  1SQQ J;  2XU6 A;  3D6Y A;  2K9J A;  4ZNC A;  2WZ7 A;  3B5N B;  4DJG A;  1E79 H;  3L74 D;  4D6T J;  1EZV G;  2HOD A;  5AVQ B;  5BU5 A;  3K5B A;  1S5L H;  2E74 C;  3G9R A;  4WY4 D;  1SQB G;  1LTG C;  1N7S B;  3L74 E;  4N78 D;  1NTK D;  2R32 A;  1MFT A;  1RQV A;  3EQ2 A;  2H88 C;  2PGD A;  3HUS C;  1NGM B;  4PV1 D;  1J1D B;  2AXT H;  4R4M A;  2FYU E;  5CCH A;  1NU1 K;  4WY4 B;  1NVO A;  1T2K D;  3CME P;  1WRG A;  3SFD C;  2IZ0 A;  1FZA A;  1S3J A;  3VOP A;  5KTB A;  2H43 A;  1YTZ T;  1QL2 A;  3F89 A;  3L70 J;  3PH0 A;  4H0L C;  1PGQ A;  1NOH A;  2P58 A;  3BCC E;  1SQP D;  4JYB A;  3OAK A;  1NYH A;  1OIP A;  1UIX A;  4Z1M H;  1KYO I;  2N1T A;  1GK4 A;  2K37 A;  2R3C A;  1VQO P;  2OYO A;  3TGU D;  1URQ C;  4EI2 A;  3PHL A;  3SFE C;  3CX5 E;  1MFZ A;  4PD4 H;  1GU4 A;  1AQT A;  1JOC A;  1SLQ A;  1SFC D;  3L73 D;  5C39 A;  4LC1 A;  5APW A;  2LXB A;  5H2F H;  2Q9I A;  1AA0 A;  2OTL P;  1FE6 A;  3D6Z A;  1RHZ B;  3CCU P;  1RF1 C;  1KQS O;  3M06 A;  1RF1 B;  1DH3 A;  4ZKU A;  4IFM A;  2O3J A;  3U1C A;  1FZB A;  3RL0 C;  1VF5 D;  1BCC D;  1PPJ G;  3H1L E;  1YTZ I;  2C0X A;  3L71 E;  1JY3 O;  3T97 A;  4YXW H;  2OYH C;  2NRG A;  2H7H A;  1LNQ A;  2BCC D;  1VQP P;  2G8Y A;  3KYQ A;  1SQV E;  4QMA A;  2Q7C A;  1HVV A;  1JY3 P;  3IN6 A;  4HJG H;  2GUS A;  2HLO A;  2FYN B;  3FGA D;  1EZV E;  3GHG A;  1K8A Q;  1SQQ K;  1RH5 B;  3AEG C;  1NTZ G;  1L0L K;  5CBO A;  1HJB A;  4JF7 A;  5B5E H;  3Q1M A;  4IFD K;  2YXR B;  4OH8 B;  4C46 A;  2FYN C;  1M1J C;  1BDD A;  1OMI A;  3KXD A;  1P84 E;  2NZ2 A;  2QE7 H;  5B66 H;  2O01 N;  2D2C B;  1JMM A;  2P1J A;  1SFC B;  2A06 G;  1EDK A;  2FYU D;  3HRN A;  3V4Q A;  5KLV K;  2NPS A;  3OJA B;  5B66 E;  4GOD A;  2FKW B;  4HKZ H;  1NTK E;  1NTK K;  4JBZ A;  4B86 A;  1YJ9 P;  2FXO A;  2ZVN B;  1BCC G;  1YYC A;  5L8R J;  1LTJ C;  2FBW C;  2J5U A;  2WPS A;  3M9Q A;  4GKG A;  4L73 A;  1OW7 A;  2ZYA A;  1VF5 B;  3EFG A;  1ZP0 C;  3H1J E;  3IF4 A;  3S1K A;  3U59 A;  1Y9B A;  4DT0 A;  2K88 A;  1RY3 A;  2WSS H;  1QVF O;  2A45 I;  1RF0 C;  3H1K J;  3A0B H;  4AYC A;  1NU1 D;  2B9B A;  1SQX E;  3AE6 C;  1J2J B;  1OW6 A;  2K9J B;  3CC2 P;  1EDL A;  4H44 D;  4H44 C;  2FYU K;  2HYN A;  2WTY A;  1LWU A;  2O01 J;  1JB0 J;  1KOR A;  1X0T A;  3MTU E;  1NTK J;  2IBZ E;  1FDI A;  4GIF A;  2XNX A;  1PL5 A;  2RH0 A;  2B89 A;  1N7S A;  2WIT A;  1CI6 A;  3AEB C;  2JP3 A;  3S9O A;  1OFC X;  2IBZ D;  2M5A B;  3NMD A;  1ZR2 A;  2RKL A;  1KQG B;  5AW3 B;  1ZV8 A;  4UB6 E;  1M90 Q;  3SWF A;  1LTJ A;  4WY4 A;  1BE3 D;  1M1J B;  4JQ0 D;  1VQK P;  1PGJ A;  4O9B A;  5AW5 B;  2POH A;  2FFD A;  2WT7 B;  4ASW A;  3I56 P;  1MKM A;  3P8C D;  5APQ A;  5CCH D;  2B87 A;  2JEE A;  1MV8 A;  2Q1K A;  3KZI E;  2J59 M;  3L75 G;  2Y0D A;  4WB4 A;  5AVW B;  3ZDM A;  1JUN A;  2RN0 A;  3HE4 B;  1QEX A;  3AED C;  3L74 G;  3GMA A;  4KJM A;  2QM7 A;  3CLQ A;  3D71 A;  3G6E P;  1GL2 D;  3CC7 P;  1LT9 A;  3H32 B;  1OX3 A;  1PIX A;  1M57 D;  4WBA A;  2W8Z A;  2I8D A;  1KIL E;  1KN7 A;  5AW6 B;  1FC2 C;  2AXC A;  2Q3I A;  2UWJ E;  2HFE D;  5CJ4 A;  3B5N C;  1XTG B;  4TT3 H;  3H6P A;  2R5B A;  2KIK A;  1S9K D;  4U3F D;  2XND H;  4GDO A;  2AXT E;  4OWF A;  2JDI H;  2RMZ A;  3TNU B;  1FZC B;  1W5C E;  1LT9 C;  2M3B A;  2KSE A;  1P84 D;  1H8A A;  1JTH A;  1BCC J;  3H1I G;  1IFN A;  2CK3 H;  1L0L D;  1HGZ A;  1R5L A;  2AEJ A;  3B71 A;  3KHU A;  1XTC C;  2FY8 A;  4L76 A;  2XKM A;  4IOI H;  1FZE A;  2QJP C;  4PJ0 E;  5AVR B;  4N3Y B;  1YJW P;  1P84 I;  3HTK B;  1BE3 G;  3T97 B;  5KKZ B;  1BSN A;  1NTM D;  2HOD B;  4U7J A;  3SWY A;  3VN0 A;  1GU5 A;  1USE A;  2HG5 D;  2OGU A;  3E7K A;  2KS1 B;  1PP9 D;  1GDT A;  3CWB D;  3EWK A;  1K9M Q;  1JMB A;  1SQX G;  2IX7 C;  4I1L A;  5AW2 B;  3C1L A;  2YO3 A;  3PP5 A;  3TYY A;  2VRS A;  3H1I E;  1J1E B;  3Q5R A;  1L2P A;  1FAV A;  3RL0 B;  1IJD B;  1MZ9 A;  2WSE J;  2Z5H A;  3KDP B;  2KK7 A;  3RGU A;  1GL2 B;  2QJY C;  3L70 D;  2PFX A;  3BRT B;  3E1I A;  3L72 G;  1URQ A;  5M1B A;  1T8Z A;  3A0H E;  1NWQ A;  1J1D C;  3ITK A;  4U3F G;  1HJ0 A;  2N1T C;  2N1T B;  3L35 A;  2KI7 B;  2ZAE B;  2LKM A;  1RE3 C;  2E5Y A;  3G3Z A;  4A7P A;  2H8P D;  3VTP C;  2YXQ B;  1LT1 A;  4TLF A;  1DEE G;  2GA1 A;  3TSI A;  4K35 A;  4W7Z A;  3V2R A;  5H2F E;  2QJK C;  3A0B E;  2OQQ A;  2NPS D;  3TGU J;  1GD2 E;  3MHV A;  1Z56 A;  2QG4 A;  3L75 J;  3L72 J;  3SWK A;  3LW5 H;  2OYI B;  2KNC B;  2O01 H;  1JY2 O;  2A45 G;  2I1K A;  3H1J J;  4M3L A;  4OGQ D;  1NTZ E;  1Y8A A;  2W6J H;  1QX8 A;  1SQP J;  3CI9 A;  2JR8 A;  2P10 A;  5AW8 B;  4HYT B;  1LWU C;  4NPF X;  1KYO E;  1Q90 D;  3A3Y B;  2ZJS E;  3JC2 2;  1SQX J;  1BGY G;  1NTM J;  2WVR A;  2QM8 A;  3AE8 C;  2BEQ D;  5KLV G;  1KQF B;  1SQV G;  2Y9Z A;  1Y47 A;  1LWU B;  4EIJ A;  1K73 Q;  1L0N J;  1KIL B;  2W27 A;  1QLE D;  3HUS B;  3U1A A;  3L71 G;  2R5D A;  2Y0E A;  3WUT A;  2WQY C;  1NTZ K;  2E74 B;  3HE5 B;  1T6A A;  3L4F A;  2V4H A;  3BCC G;  1W2B O;  2B88 A;  1HGV A;  1J1E C;  2OYH B;  2E42 A;  5AVZ B;  1NU1 G;  1UII A;  2WT7 A;  1T3U A;  4NPE A;  2M8R A;  4U3F E;  1JNM A;  1AFO A;  2B87 B;  2ZXX A;  3BRV B;  5AVT B;  3RK3 B;  1ZR4 A;  4Y28 J;  3LW5 J;  3VYI A;  1VL2 A;  3LIE A;  5CJ0 A;  1WT6 A;  4I7Z C;  1YQ4 C;  4PD4 D;  2KP8 A;  2Q5U A;  4Y99 B;  1RE4 A;  1IC2 A;  1L0N E;  1L0N K;  3CXH D;  2LR2 A;  2JWD A;  3RK3 D;  4CPG A;  4BXL A;  2QEX P;  1HWT C;  2NPS B;  1DIP A;  5KKZ C;  4W80 A;  1N86 A;  3V2P A;  3B5N A;  3VMY A;  1GW3 A;  1R5S A;  1N73 A;  3CCV P;  3CCL P;  3V5B A;  2OTK E;  4LGD E;  4WVZ A;  5TIS E;  3H1L J;  4ZMD A;  5GTI H;  1VQL P;  2WSE H;  1SQP K;  1S2E A;  2FXP A;  3O8Z A;  1LP1 A;  2IBZ I;  1BE3 J;  1NAF A;  1PGO A;  1SQV J;  2Y9Y A;  2BCC E;  2Z5I A;  3KQG A;  3WMM 0;  3H1H E;  5DJU B;  1EXJ A;  2P2U A;  1H0T B;  1M8O B;  2KB7 P;  3H1L D;  3MZW B;  1BCC E;  3HE5 A;  3D70 A;  1CW5 A;  1YBK A;  3L75 E;  1U7M A;  4JYC A;  5CMZ A;  5BVZ A;  1WMK A;  5TJH A;  3WUV A;  1PZQ A;  1HBW A;  1BSH A;  1CSB A;  1L0N D;  1BDC A;  3BCC D;  5EFW B;  2JO1 A;  5CCG A;  1JY2 N;  2AEF A;  2E74 D;  2K1A A;  4H13 D;  4WY4 C;  1NU1 J;  3C9I A;  2W6B A;  2WSF H;  2YNY A;  2BAS A;  3H1K D;  4JPZ B;  4DCK A;  4EOT A;  1SQB D;  1G2C A;  1OVV A;  1SFC A;  1T2K C;  1N7S C;  1VF5 C;  3QWO C;  2MKV A;  1VQM P;  1GL2 C;  2KUB A;  2SPZ A;  3B4S A;  1FDO A;  4GOF A;  5KAI H;  3G71 P;  4K3A A;  3Q3D A;  2XZR A;  3H1J D;  2Q3E A;  1QGK B;  2FFD B;  4IL6 X;  1NH4 A;  4DOJ A;  2YMK A;  2KLU A;  2GUV A;  4AQR D;  2KXP B;  3IAO A;  1GL2 A;  1RF0 A;  3M0A A;  2FXM A;  2WSF J;  1SS1 A;  1LTA C;  2R44 A;  1ZLL A;  2D2C C;  1IZN B;  3Q5P A;  4AUW A;  2KOG A;  1RQU A;  2YIU B;  1EZV I;  1HF9 A;  2E75 D;  2R3S A;  3N4X A;  1KYO H;  1EC5 A;  2M3E A;  3AE1 C;  2JKV A;  1SQB K;  5B5E E;  1ZXG A;  4KHX A;  1OVU A;  1FS0 E;  2K3R A;  3WUU A;  1JEK A;  2E75 B;  2JJL A;  1EXI A;  1OXZ A;  3L73 G;  1FZC A;  5CCH C;  1CI6 B;  1VDF A;  1N7S D;  3PJS K;  1G1J A;  4N6J A;  2M5A A;  2KNC A;  3L72 D;  4C7N B;  3L75 D;  5KAF E;  2LXC B;  4L75 A;  1LTJ B;  1M1J A;  3CWB J;  3PRJ A;  2E5T A;  3F5H A;  1KMI Z;  3O6Q A;  2ZT9 D;  2QJK B;  1VQ5 P;  3Q5S A;  2OYI A;  1N8R Q;  2AEM A;  1LTT C;  2IFN A;  3HTK A;  3MP7 B;  3IFM A;  3M9B A;  2O1J A;  3GHG C;  5AW1 B;  1ZOY C;  2JWA A;  3Q2Y A;  2ZT9 B;  2N9B A;  1KIL A;  2W83 C;  3A0H H;  3FX0 A;  4XA4 A;  1PFI A;  4I7Z B;  1OWA A;  4UB6 H;  1D7M A;  1TU3 F;  1HTL C;  1ZRT D;  3ABV C;  3GF7 A;  1L4A C;  4XE5 B;  1N7L A;  2ZT9 C;  3H1I D;  5AVS B;  3RK2 B;  2MJZ A;  5CCG C;  3CX5 I;  1AJY A;  4C7R A;  1W2E A;  3E1R A;  1FU1 A;  3CX5 H;  1GMJ A;  4OGQ C;  3V2N A;  3RK2 D;  1NKN A;  5GTI E;  3CWB E;  4H13 B;  2HR3 A;  1E5W A;  4ZKP A;  2E76 B;  1FJP A;  3HD7 D;  4BRY A;  1LGH B;  2I1J A;  3VMA A;  2QIW A;  4XFJ A;  4EDF A;  1VQN P;  1L4A D;  1NTM G;  1BGY E;  2XV5 A;  5KLV E;  1KIL C;  3TGU E;  2Z4E A;  2E76 C;  4GT1 A;  2E76 D;  5K5G B;  3L72 E;  2E75 C;  1GZL A;  2A06 D;  2E43 A;  1VQ4 P;  3RK3 E;  2OYI C;  1GTW A;  1MUU A;  1N73 C;  1N73 B;  3B5N D;  3HD7 C;  3GLM A;  1L0L E;  3FWN A;  2C0W A;  2ZFC A;  1EDJ A;  2KS1 A;  5E79 E;  2IPP A;  1LTI C;  5AW7 B;  1OW8 A;  3L70 G;  3TK1 A;  3G4S P;  3H1H J;  4PV1 B;  1FZC C;  3BAT A;  1IK7 A;  1M56 D;  1ZME C;  1DEB A;  1NTZ D;  3WU2 H;  4D6T E;  3SSU A;  1Q86 Q;  3CCQ P;  1H89 A;  2WPV B;  3BAS A;  4H13 C;  1EDI A;  4H44 B;  3L37 A;  4RES B;  2QVA A;  3TF5 A;  2CPB A;  4HB1 A;  2FFD C;  4RO0 A;  2N9Y B;  3AE2 C;  1URQ B;  1Q7Y Q;  1SQX K;  2QJY B;  1SQQ D;  2KZJ A;  2FYU G;  3AEE C;  4PD4 I;  3GF3 A;  1A02 F;  3FXD A;  2P67 A;  2WMM A;  1X79 B;  3HUS A;  2D2C D;  2CPS A;  2Y0C A;  3M9H A;  5DJT B;  5APT A;  1S4X A;  2IBZ G;  1AVO A;  4D6T G;  1SQB E;  2H89 C;  1X8Y A; 
#chains in the Genus database with same CATH homology
 3F5H A;  4BRY A;  2Q6Q A;  3E1R A;  2WVR A;  3WUV A;  1UII A;  3WUT A;  3WUU A;  2ZXX A;  4BRY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...