4C7NA

Crystal structure of the synthetic peptide im10 in complex with the coiled-coil region of mitf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
SSVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICROPHTHALMIA ASSOCIATED TRANSCRIPTION FACTOR
publication title Improving Coiled Coil Stability While Maintaining Specificity by a Bacterial Hitchhiker Selection System.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4c7nA00
1GZLA 2Q5UA 5AVZB 1GU5A 1CI6A 4JYBA 5AW9B 4AQRD 1FOSE 5APSA 1X8YA 3HE5A 1DH3A 1HBWA 2QM7A 1J2JB 1HWTC 3M9BA 5AVVB 1CSBA 1IO4A 1GU4A 1GTWA 4RESB 1FOSF 1MUUA 5AVWB 1H89A 3A2AA 2YO3A 5AVUB 3P8MC 2WPRA 2YNYA 3P32A 3TNUB 3IR9A 4GT1A 5APTA 3NTNA 1T2KC 2WWWA 3L37A 4HYTB 5APWA 2C9NY 2R5DA 2R32A 3UIAA 1KQLA 1GD2E 3A5TA 2Q3IA 3NMDA 3TYYA 3M91A 5AW7B 2C9LY 3OAKA 3T97A 2IPPA 2R3CA 5AW2B 3VMXA 1YYCA 2Z5HA 1SLQA 5AW3B 5AVTB 2YO2A 3L36A 4DZOA 2WPSA 5AW5B 3O8ZA 3V4WA 4C7NA 2P7JA 2XV5A 5APVA 5AW6B 2P67A 2N9BA 2ZXEB 5CMZA 2WT7A 4GKGA 3V4QA 2WPQA 5AW8B 1NAFA 3HE4B 1OWAA 3M06A 3M0DA 5AW4B 1G2CB 3P7KA 3VTPC 3LIEA 2JJLA 4JYCA 4B86A 2E43A 4LC1A 3M9HA 4I2LC 3B8EB 3A3YB 5AW0B 1CI6B 4AUWA 4XE5B 1S9KD 1A02J 3V5BA 4C46A 3HE5B 3KQGA 3LIDA 3I5CA 5APXA 1GK4A 3MD0A 1FAVA 4AYCA 3NFQA 2KP8A 3A7OA 2QM8A 4KHXA 1HJBA 1MV8A 3TNUA 2W6AA 3MGNA 1OXZA 1S9KE 5APQA 2R5BA 2Z5IA 5AVRB 3VMZA 3VN0A 1A02F 5AVYB 5AVQB 2XZRA 3M0AA 4M3LA 2BASA 3L35A 3NXSA 3TK1A 4EOTA 1H8AA 1CZQA 4I6MC 2ZFCA 5APYA 1MFZA 2W27A 2WTYA 2P2UA 2Q7CA 1GK6A 1SP4A 2VRSA 5AVXB 1T2KD 1JNMA 1H88A 1JUNA 2XU6A 4C7NB 3VYIA 3SWFA 2WT7B 1NWQA 5APUA 3HE4A 2E42A 3HTKA 5AVSB 5AW1B 2H7HA 3VMYA 3KDPB 1HUCA
chains in the Genus database with same CATH superfamily
4JYBA 3O6QA 3CCMP 3BCCD 3N7NA 4N78D 3CCQP 1N7SA 5B5EH 2H89C 3RK2D 4RESB 5AVWB 1ZV8A 1Q90D 2J59M 2GUVA 3BCCE 4N78E 2KLUA 1NTMG 4WB4A 3L75J 3A5TA 1OVVA 5KLVG 1FZEA 1VDFA 2FYNB 4Y99B 1SQQJ 1ZR4A 4OWFA 2P7JA 2N9BA 1E5WA 1GW3A 3H6PA 1HH0A 1L4AA 3Q3DA 1NTMK 5AW4B 1KYOD 1OFCX 3L73G 5KLVK 2JEEA 3HE5B 1ZRTD 1QVFO 1PGOA 2IZ1A 4MN4C 3V2QA 1M1JB 1PFIA 1VQLP 3RL0B 2I1KA 1GL2D 3A7OA 1ZP0C 2WSFJ 1KYOE 2XKMA 4U7JA 1ZRTE 1OZHA 1BGYG 4YPCA 2FYUJ 3L70J 3D6ZA 2E76C 2POHA 3L71J 1RE3C 3RK3B 2R44A 1LTGC 4A7PA 2XNXA 3S9OA 2BCCE 1EDLA 2OYIB 1KD1Q 4CPGA 3VMYA 1KFNA 5KAIH 4H44B 4PJ0H 3AE9C 1PPJG 1MUUA 3E1IA 4GIFA 3H1JJ 2E75C 3KZIH 3IFMA 1IZNB 1Q7YQ 1RF1B 4ZNCA 1VF5C 2IBZI 1URQB 2A45H 2KS1B 1RE3A 1Z56A 1P84H 3SWYA 1S5LX 2R3SA 3CLQA 1FDIA 3P7KA 5CCHC 1YI2P 3IAOA 5APXA 2E74D 3MD0A 4WY4D 4H13D 1KILC 1YTZI 3L72D 3TNUA 2WSSH 3EQ2A 1PP9D 4KT0J 3L72E 2QVAA 2KXPB 2WSEJ 2OTKE 2P2UA 1EXIA 5AVXB 1PP9E 1HGZA 2WVRA 1EZVI 1M7LA 2YXQB 2L5GB 5AVZB 3MIWA 5M1BA 1CI6A 3MHVA 1LJ2A 4AQRD 5APSA 2ZVOB 1JY3N 2CK3H 1HBWA 1IK7A 2P10A 1N73C 3C9IA 2A45I 1JEKA 3WUUA 5KJ7C 2OQQA 4GT1A 1P84I 1IC2A 4NPEA 5KAIE 1KILA 3GW6A 1HGVA 4PJ0E 1AFOA 2YKPA 1NGMB 1EZVD 2Q3IA 4TT3H 3H1HJ 3WU2H 3BATA 4IFMA 3KZIE 2Y9ZA 5GTIH 3O8ZA 3D71A 3RK2C 1EZVE 3FXEA 2ZYAA 1NTKJ 1N8RQ 2JJLA 4B86A 1OW6A 1FZGA 1LTAC 1L0ND 5KKZB 4XE5B 3O6QB 1VQ7P 3W68A 2PGDA 3ABVC 1N7SB 4AYCA 2KP8A 5H2FE 1SQXK 1P84E 4UB6H 1HJBA 1L0NE 2W6AA 3MGNA 1J1DC 1N73A 1MFTA 3FXDA 2OTJP 1X0TA 3M0AA 4D6TD 1SFCA 1MFZA 3BRTB 1HF9A 5DJTB 4DCKA 4WBAA 2N1TA 3OA7A 3L72G 1NU1D 1GL2C 2O01H 3QWOC 3HTKA 4D6TE 2KYVA 1L4AB 1OW7A 1NTMJ 1PP9G 2I8DA 3CCVP 2KLVA 5KLVJ 1SQQK 1GU4A 1FOSF 2PAJA 3SFEC 1JCDA 1VPCA 1KQSO 2WPRA 4HYTB 1G1IA 1NHLA 1U7MA 3L73J 2A06D 2JDIH 3VMXA 2Y0CA 1FJPA 5BVZA 4BRYA 1KQGB 5DJUB 1NOHA 4ASVA 4I7ZB 1YJ9P 3V4QA 1L0LD 2B88A 1KB9D 2A06E 3VTPC 1K9MQ 1EZVG 3WU2E 1BGYJ 2WPVB 1GL2A 1S72P 5GTIE 2CPSA 1J1EB 3F89A 4KHXA 2ZT9D 1WMKA 3TGUD 2R5BA 1RY3A 5E79E 3KPEA 2YMKA 1L0NG 2BASA 2HODA 4OH8B 3TGUE 2NPSA 2E74C 1LP1A 3G9RA 4WY4C 2FYZA 4H13C 3VYIA 1FDMA 3CWBD 4HKZH 3CPWO 1M57D 3U59A 2FFDC 5AW1B 1GZLA 4H0LB 3CXHH 1X8YA 1L0NK 3U1AA 4D6TG 2AXTH 2HLOA 3CWBE 3HD7D 2KZJA 3LW5J 1NU1G 3P32A 1IFNA 3TNUB 3L37A 1R8EA 1IJDB 1JCCA 3T97A 4WVZA 2YO2A 3L36A 1QX8A 1S3JA 2H8PD 1M90Q 1PGQA 2P67A 1NU1K 2D2CB 1VL2A 3CCSP 3BVHA 3EFFK 3A3YB 1CI6B 3AE6C 1FE6A 3R2PA 3LIDA 3AE7C 2OYOA 2FFDA 2IFNA 3SWKA 1VQOP 1MV8A 1FZBA 1SS1A 3CCLP 1L0LG 1DEBA 1VQ6P 3C1LA 1KILB 2V7QH 3CXHI 4OVNF 1ZN5A 2C0WA 2OYHC 1PGJA 2KIKA 3FX0A 1RQVA 1SP4A 3A0HH 1JNMA 3VP9A 2YXRB 1OVRA 1L0LK 3TGUG 3VOPA 3AEAC 1NAYA 2QJKB 3M9BA 3PH0A 3R4YA 1LGHB 2Z4EA 1E79H 3SFDC 1SQXJ 3CWBG 1BDCA 3CXHE 3UIAA 1KQLA 1N73B 1BCCJ 3WUTA 3TYYA 1M56D 2MJZA 4IFDK 5CCGD 1SFCB 2N1TB 3HTKB 3M0DA 5AW0B 1VQ9P 5KAFH 2RKLA 3AE5C 1GDTA 1FAVA 1LTJC 1LT9A 3H1LD 1JY3O 3L72J 1ZOYC 1ZXGA 4HB1A 3W67A 3GHGC 1PP9J 1QLED 1USDA 1Q2NA 3RGUA 1PGPA 4I6MC 4W7ZA 2ZFCA 2O01N 2KSJA 3H1LE 4L76A 4PD4H 4BRYB 1GK6A 1JY3P 2XDJA 3RL0D 3GG2A 1VQ4P 2Q3EA 2ZT9C 1HUCA 2BCCD 2QJPC 1JB0J 4N6JA 2C0XA 3HUSC 3CL3D 3A0HE 1S5LH 4EIJA 2BEQD 3RK3D 3A2AA 2YO3A 1LTTC 3KXDA 2M3EA 3JC22 3IR9A 2WWWA 1EDJA 1N86A 3KHUA 1RH5B 3RK3E 2IPPA 2HODB 4H44D 5AW3B 3G6EP 4BWNA 4ZKUA 2NPSB 1LP1B 5APVA 3HD7C 2YIUB 4EI2A 2J5UA 2G8YA 1YQ4C 4EDFA 2OTLP 3FWLA 1L0NJ 3BCCG 5B5EE 1Y9BA 1RQUA 2HYNA 4PD4I 3NFQA 1JOCA 2KZIA 1URQD 1EDIA 5AVRB 2SPZA 1SQPD 3Q5RA 2AXCA 2FKWB 4D6TJ 2QJYB 3H1ID 1JMMA 1DIPA 2Q7CA 2IBZD 4OGQD 4O9BA 4PD4D 3H1LG 1SQPE 1NU1J 5KLIB 2YKQA 4DT0A 3H1IE 3SSUA 2IBZE 1BSHA 4PD4E 1IO4A 3ITKA 2FFDB 1DX7A 5KTBA 1HVVA 5TJHA 1N7LA 1T6AA 4PV1B 2R32A 1HJ0A 1LWUC 2BCCG 3N4XA 2AEFA 2KB7P 3K5BA 4DZOA 3AEDC 3E1RA 5CCHA 2HR3A 3FWNA 3M9QA 1G1JA 5AW8B 4DOJA 1S1CX 1FDOA 3L70D 1L0LJ 1G2CB 3L71D 2WSEH 2IYOA 3I5CA 4IL6X 4LGDE 5CCGC 1RE4C 3L70E 3L71E 1ZR2A 3MZWB 1OXZA 2Z5IA 1BE3D 2GA1A 5AVYB 1XTGB 1XTCC 3TGUJ 1P84D 1YQ3C 4M3LA 2FXOA 2W6JH 3H1JD 1IFJA 1W2BO 3V2PA 1ZLLA 1BE3E 3PLNA 2GM4A 1QEXA 2FYNC 4Y99C 2FY8A 4LLHA 3CWBJ 3H1JE 2M5AA 1GU5A 5KJ7A 5L8RJ 1SQPG 2QM7A 4Z1MH 1GTWA 1QGKB 3H1IG 1RF0C 5AVUB 1LT9B 2IBZG 2WQYC 1M1JC 4NPFX 3RL0C 1L4AD 1SQPK 3GF7A 2H88C 3GF3A 4GOFA 4C7NA 1IFMA 1VQ8P 2AEJA 3RK3C 4QMAA 5GTHH 1SQVD 2B89A 4JYCA 1NH4A 3CCRP 4JF7A 2ZVNB 2OYIC 3B8EB 4AUWA 1A02J 4RJTA 1L2PA 3PTZA 1JTHA 4N3YB 3AE8C 4H44C 3G4SP 1SQVE 3ZDMA 2OARA 1Q82Q 3PP5A 5AVQB 3WMM0 3P8CD 1AV1A 3CMEP 1M1JA 1H8AA 3H32A 3IN6A 2W27A 2AEMA 3G3ZA 1RF1C 1JUNA 3P8CE 4BXLA 3S1KA 2WSCJ 1JO5A 4L73A 2A45G 3Q5PA 3HE4A 1URQC 2QIWA 1BE3G 4YTPC 2KNCA 2CPBA 1PIXA 1FS0E 3AE1C 5AW9B 1EXJA 4IFFA 1HWTC 4L74A 4UB6E 1AVOA 2Y9YA 1NTKD 2LR2A 4U3FD 2E76B 3CX5H 3NTNA 5APWA 4OGQC 2JWAA 4ASWA 3NMDA 5AW7B 2C9LY 4H0LD 3CCUP 5CBOA 3A0BH 1NTKE 1YYCA 2Z5HA 1Q81Q 4U3FE 2JP3A 1Q86Q 2WPSA 3BCCJ 3Q1MA 1R5SA 1KMIZ 1OW8A 3M9HA 2O1KA 2E75B 3V5BA 2YMYA 3HRNA 2PP6A 2QSIA 2K1AA 4ZMDA 3CC2P 1VF5B 3H1LJ 3VN0A 5KLVD 2XZRA 1SQVG 4WY4A 3NXSA 1KORA 4I1LA 1DD4A 2DW3A 4GDOA 1ZMEC 5APYA 2A06G 3B5ND 3IF4A 2V7QJ 4W80A 2VRSA 5KLVE 2B9BA 2K9YA 1NWQA 3CX5I 3AEBC 1YIJP 3L74D 4NPDA 3L73D 3TDKA 1SQVK 2H43A 2W8ZA 2BCCJ 3JCUH 1J2JB 2FXMA 3L74E 3Q5SA 3L73E 1KYOH 1KILE 2C9NY 1LNQA 2LKMA 2KSEA 3CX5D 2JWDA 4R4MA 5EFWB 2R3CA 2LXBA 2QRXA 1GMJA 3CXHD 5AW5B 1JY2N 4UB8H 3V4WA 3CX5E 5CJ0A 2WT7A 4U3FG 3CCJP 4JQ0D 2XNDH 1KQFB 4LC1A 2OGUA 5B66H 2AXTE 1L4AC 3USSA 1ZW0A 3AEGC 2QE7H 5BU5A 3V2RA 1SFCD 2OYHA 1S4XA 2N1TD 2HFED 3RK2B 1SQBD 1IFIA 1SQPJ 2HPCA 2V4HA 3CC4P 5CJ4A 1T2KD 1AQTA 4C7NB 3H1IJ 3OJAB 1KYOI 2K88A 1SQBE 2L91A 1NTZD 1SLQA 1NJIQ 1FZFA 4I7ZC 1FOSE 3WUVA 1IFDA 5BU8B 1J1DB 1JTHB 1HTLC 3AECC 3B4SA 4RO0A 1KV4A 3H1KD 1NTZE 1M1KQ 1H0TA 1EQ7A 2M3BA 2YNYA 3H25A 1J1EC 2R5DA 3L74G 1K04A 1YITP 3CMAP 3MUDC 3JCUE 3H1KE 1GL2B 2Q1KA 3H32B 1WT6A 3RBZA 5AW6B 1OVUA 5CMZA 4GKGA 2ZXXA 3HE4B 2J58A 1LTJA 3M06A 2KNCB 2WSFH 3S4RA 1Y8AA 1GK4A 2QG4A 4UB8E 4H0LC 2ZAEB 1UIXA 1AVYA 1KZUB 4EYYQ 3GHGA 2NPSD 3TSIA 3D70A 3CI9A 1QVGO 1BE3J 5B66E 3PJSK 4K3AA 1K8AQ 1SQXD 2JO1A 1FBMA 3MUDA 1FC2C 1NVOA 1BCCD 2W83C 3SWFA 3HUSA 1EDKA 5AVSB 1K73Q 3KDPB 2IX7C 3FGAD 5KAFE 1SQXE 2D2CC 1U7JA 1SQBG 3T97B 5AVVB 2RH0A 1BCCE 2K37A 3RL0g 4WWIA 2QEXP 5H2FH 3B5NC 3V2NA 3P8MC 1YJNP 3L75D 1GW4A 1LT1A 1U57A 4IL6H 1NTZG 3M91A 2E74B 4WY4B 1FZCC 3HD7A 2IFMA 1SQQD 1OIPA 4H13B 4RKUJ 1SQBK 1NO4A 4OGQB 3L75E 4R4LA 3H1KG 1QL1A 1FU1A 1SQQE 3I55P 2E43A 4PV1D 1NTZK 2O3JA 4KJMA 1SQVJ 4K35A 3KQGA 1S5LE 2PFXA 1VQMP 2KUBA 2QJKC 1OMIA 2YKOA 3Q2YA 1UIIA 2M8RA 1KN7A 4GODA 1A02F 2FYUD 2K3RA 3B5NA 3EWKA 4EOTA 1X22A 2K9JA 2NZ2A 3F5HA 5TISH 4GOEA 2WTYA 2ITAA 2FYUE 1FZCA 2WT7B 5APUA 2N9YB 1SFCC 1VQKP 1D7MA 2WMMA 4DJGA 2N1TC 3RBXA 1KTMA 1YHQP 3EFGA 1NKNA 1DH3A 1KC8Q 2Y0DA 1CSBA 2P58A 1TU3F 1LWUA 2RN0A 1SQXG 2ZYDA 1KB9H 2UWJE 2IYPA 1N7SD 2OYHB 1BCCG 1T2KC 4U3FJ 4HJGH 5E79H 1NYHA 2E5YA 1MZ9A 2O01J 2W6BA 1PV3A 5AVTB 4C7RA 1T3JA 1T8ZA 1JM0A 2HPCB 5CBNA 2B87A 2KK7A 3GLMA 4IL6E 1CW5A 3L75G 2WITA 3PRJA 2O1JA 3AE4C 5CCGA 4I2LC 3VP8A 1RE4A 2MKVA 1S9KD 4C46A 1WRGA 1SQQG 2GUSA 2Q9IA 4JPZB 2JR8A 4YXWH 2M0BA 2QM8A 4HH2A 1H0TB 3MTUE 1W2EA 2FXPA 1S9KE 1S2EA 4L75A 2RMZA 2KOGA 3I56P 3GMAA 1NU1E 1CZQA 1X9VA 2G3AA 1FJKA 1VQ5P 1LTBC 1IK9A 1KB9I 3KYQA 2FBWC 3U1CA 1IFPA 4YXDC 1JMBA 2H7HA 2NPSC 1LTJB 2Q5UA 2FYUG 1JY2O 3L70G 3L74J 3L71G 3TF5A 1RF0A 2YIUC 3HE5A 5TISE 2QA4P 1Y47A 3BRVB 1H89A 2LXCB 3GHGB 3JSVC 4XA4A 1JY2P 3CD6P 1GD2E 3H1HD 2FYUK 2W90A 1USEA 1VQNP 1W5CE 3MP7B 5AW2B 1AA0A 4XFJA 2Q6QA 1L0LE 1KB9E 3H1JG 1AJYA 2ZT9B 4IOIH 3CC7P 1YTZT 1LTIC 2QJPB 2OYIA 1LTSC 3H1HE 2WPQA 1R5LA 3C8VA 1NAFA 3HUSB 2QJYC 2Y0EA 2E76D 3LIEA 3V6IA 3L4FA 2NRGA 1QL2A 5KLIC 2WSCH 1RHZB 5CHXA 1NKZB 1FZAA 1YBKA 2IDBA 4TLFA 5APQA 1K05A 1N2DC 2ZYGA 3BASA 1RF1A 3VMAA 3L35A 4PV1C 3HD7B 2HG5D 2E75D 1URQA 1SQBJ 3G71P 2KS1A 3OW2O 1H88A 2XU6A 5GTHE 1NTMD 2E5TA 1PL5A 3B71A 3QH9A 2D2CD 3E7KA 1VF5D 1NTZJ 3LW5H 4W7YA 5K5GB 1NTME 1BDDA 2P1JA 1DD3A 4Y28J 3H1KJ 5APTA 5CCHD 1PZQA 3AE2C 1DEEG 1X79B 1YJWP 3B5NB 3OAKA 1KILD 2PRRA 3D6YA 2K9JB 5C39A 1VQPP 5KKZC 1KFMA 1M8OB 2XV5A 2ZXEB 1FZCB 1OWAA 1AQ5A 1N7SC 3PHLA 1BGYD 2E42A 2JKVA 3H1HG 3AEFC 1MKMA 4ZKPA 3M0DC 2WZ7A 1LWUB 1BGYE 3AE3C 3AEEC 1NTKG 4JBZA 2I1JA 1G2CA 3II6A 3VMZA 2M5AB 1BSNA 1LT9C 2IZ0A 3A0BE 3TK1A 1PPJD 1EC5A 1OX3A 1T3UA 5KJ7D 2ZJSE 2BEZF 2B87B 1NTKK 1PPJE 2KI7B 1SVFA 3CCEP
chains in the Genus database with same CATH topology
1GZLA 2IX7C 1GU5A 4JYBA 5KJ7A 1X8YA 1L0NK 3U1AA 2QM7A 3N7NA 4N78D 5AVVB 2HLOA 1N7SA 3RK2D 4RESB 3HD7D 1GTWA 5AVWB 1ZV8A 3B5NC 1RF0C 5AVUB 3V2NA 3P8MC 1LT9B 3P32A 1IFNA 3TNUB 2J59M 2GUVA 1M1JC 3L37A 1GW4A 3RL0C 4N78E 4WB4A 1IJDB 3A5TA 3M91A 1JCCA 1L4AD 4WY4B 1FZCC 3T97A 3HD7A 2IFMA 1FZEA 1SQPK 1VDFA 1SQBK 1NO4A 4Y99B 2YO2A 3L36A 1ZR4A 2H8PD 4C7NA 2P7JA 2P67A 2N9BA 1QL1A 1E5WA 1IFMA 1GW3A 1NU1K 3RK3C 1FU1A 3H6PA 1HH0A 1L4AA 1NTMK 5AW4B 3BVHA 4JYCA 2E43A 1NH4A 1NTZK 4JF7A 2OYIC 3B8EB 3A3YB 5KLVK 1CI6B 2FFDC 4AUWA 1A02J 2JEEA 3HE5B 3KQGA 3R2PA 3LIDA 1PFIA 3V2QA 1JTHA 1M1JB 2FFDA 4N3YB 3RL0B 2I1KA 2IFNA 1GL2D 3A7OA 2YKOA 1MV8A 2XKMA 2OARA 1FZBA 2M8RA 1DEBA 3PP5A 1A02F 5AVQB 1KILB 3WMM0 3P8CD 3B5NA 1ZN5A 2C0WA 2OYHC 2POHA 4EOTA 1M1JA 1RE3C 1H8AA 3H32A 3RK3B 1LTGC 2W27A 2WTYA 3G3ZA 2XNXA 1SP4A 1RF1C 1JNMA 1JUNA 1FZCA 2OYIB 3P8CE 1JO5A 2WT7B 3VP9A 2A45G 5APUA 3HE4A 1URQC 1L0LK 1SFCC 3VOPA 3VMYA 2CPBA 1KFNA 2N1TC 3EFGA 5AW9B 1NKNA 1DH3A 4IFFA 3M9BA 1HWTC 1CSBA 1LGHB 1LWUA 1MUUA 3E1IA 4GIFA 2Z4EA 1N7SD 2OYHB 3NTNA 1T2KC 5APWA 3IFMA 3UIAA 1KQLA 1N73B 3NMDA 3TYYA 1MZ9A 5AW7B 1RF1B 2C9LY 2MJZA 2W6BA 4IFDK 5CCGD 1YYCA 2Z5HA 5AVTB 4C7RA 1T3JA 1T8ZA 1URQB 2WPSA 1SFCB 2A45H 2HPCB 2N1TB 1RE3A 1Z56A 3SWYA 1CW5A 2WITA 2O1JA 3CLQA 3HTKB 3M0DA 3P7KA 5CCHC 5CCGA 3M9HA 4I2LC 3VP8A 1RE4A 2O1KA 5AW0B 1S9KD 3V5BA 1WRGA 2YMYA 4C46A 3HRNA 2PP6A 5APXA 1GDTA 2GUSA 3MD0A 1FAVA 4WY4D 2Q9IA 1LTJC 1KILC 2QM8A 1YTZI 4HH2A 1LT9A 3MTUE 3TNUA 1JY3O 3EQ2A 1W2EA 1S9KE 3VN0A 2XZRA 2KOGA 4WY4A 3GHGC 3NXSA 4I1LA 1CZQA 4I6MC 4W7ZA 2ZFCA 5APYA 1X9VA 2KSJA 1FJKA 3B5ND 4W80A 1LTBC 1IK9A 2P2UA 1GK6A 2VRSA 1JY3P 5AVXB 3KYQA 2XDJA 3RL0D 1HGZA 3U1CA 1NWQA 1M7LA 2H7HA 1HUCA 2NPSC 1LTJB 2L5GB 2Q5UA 5AVZB 3MIWA 1JY2O 1SQVK 1CI6A 2H43A 4N6JA 2C0XA 4AQRD 5APSA 1RF0A 1JY3N 3HE5A 1HBWA 3HUSC 1J2JB 3CL3D 2FXMA 1N73C 4EIJA 3C9IA 3BRVB 2A45I 3RK3D 1H89A 3A2AA 2YO3A 1LTTC 5KJ7C 3GHGB 3IR9A 4GT1A 4XA4A 1IC2A 2WWWA 2C9NY 1JY2P 2LKMA 1KILA 1HGVA 1GD2E 1AFOA 2YKPA 2Q3IA 1N86A 2FYUK 2IPPA 2R3CA 5AW2B 3BATA 2HODB 5AW3B 4IFMA 5AW5B 1JY2N 4ZKUA 2NPSB 1YTZT 1LTIC 3O8ZA 3V4WA 2OYIA 1LTSC 5APVA 3RK2C 3HD7C 5CJ0A 2WT7A 2WPQA 1NAFA 3HUSB 3LIEA 2JJLA 4B86A 4LC1A 1LTAC 1FZGA 3L4FA 4XE5B 1QL2A 2WSCH 1L4AC 5CHXA 1N7SB 2HYNA 4AYCA 3NFQA 1NKZB 2KP8A 5BU5A 1FZAA 1JOCA 3V2RA 1SQXK 1URQD 1SFCD 1HJBA 2OYHA 2W6AA 3MGNA 1J1DC 5APQA 2N1TD 5AVRB 1N73A 1N2DC 3BASA 2HFED 3M0AA 1RF1A 3L35A 3RK2B 3HD7B 1IFIA 2HG5D 1URQA 1SFCA 2FKWB 1MFZA 2HPCA 3BRTB 1JMMA 4WBAA 2Q7CA 2N1TA 5CJ4A 3OA7A 1T2KD 1H88A 2XU6A 4C7NB 4O9BA 1GL2C 2O01H 3OJAB 3HTKA 2YKQA 2KYVA 1L4AB 1SLQA 1FZFA 2KLVA 1FOSE 3LW5H 4W7YA 1IFDA 5BU8B 1J1DB 1SQQK 1IO4A 1JTHB 1GU4A 2FFDB 1FOSF 1HTLC 1DX7A 2PAJA 2P1JA 5KTBA 1JCDA 1VPCA 1HVVA 1EQ7A 2M3BA 1N7LA 2WPRA 2YNYA 5APTA 5CCHD 1J1EC 4HYTB 2R5DA 2R32A 1LWUC 1G1IA 1NHLA 1X79B 3B5NB 3N4XA 3OAKA 1KILD 3VMXA 2KB7P 1GL2B 3H32B 1FJPA 5BVZA 1WT6A 4DZOA 5CCHA 1NOHA 1KFMA 2XV5A 5AW6B 2ZXEB 1FZCB 5CMZA 3M9QA 4GKGA 3V4QA 1G1JA 5AW8B 4DOJA 3HE4B 1OWAA 1AQ5A 1N7SC 2J58A 1LTJA 3M06A 2E42A 1G2CB 3VTPC 2WSEH 1GL2A 2WSFH 4ZKPA 3I5CA 1GK4A 2CPSA 3M0DC 1J1EB 4LGDE 2WZ7A 1LWUB 5CCGC 1RE4C 1KZUB 4KHXA 3GHGA 1ZR2A 2NPSD 1OXZA 3TSIA 3CI9A 2I1JA 2R5BA 1RY3A 1G2CA 2Z5IA 3II6A 3VMZA 5AVYB 1XTGB 1XTCC 1LT9C 3KPEA 4M3LA 2BASA 3TK1A 2HODA 1IFJA 1T3UA 4OH8B 5KJ7D 1ZLLA 3V2PA 1FBMA 2NPSA 3MUDA 4WY4C 2GM4A 2FYZA 3VYIA 3SWFA 1FDMA 1NTKK 3HUSA 4Y99C 4LLHA 1SVFA 5AVSB 3U59A 5AW1B 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZL A;  2Q5U A;  5AVZ B;  1GU5 A;  1CI6 A;  4JYB A;  5AW9 B;  4AQR D;  1FOS E;  5APS A;  1X8Y A;  3HE5 A;  1DH3 A;  1HBW A;  2QM7 A;  1J2J B;  1HWT C;  3M9B A;  5AVV B;  1CSB A;  1IO4 A;  1GU4 A;  1GTW A;  4RES B;  1FOS F;  1MUU A;  5AVW B;  1H89 A;  3A2A A;  2YO3 A;  5AVU B;  3P8M C;  2WPR A;  2YNY A;  3P32 A;  3TNU B;  3IR9 A;  4GT1 A;  5APT A;  3NTN A;  1T2K C;  2WWW A;  3L37 A;  4HYT B;  5APW A;  2C9N Y;  2R5D A;  2R32 A;  3UIA A;  1KQL A;  1GD2 E;  3A5T A;  2Q3I A;  3NMD A;  3TYY A;  3M91 A;  5AW7 B;  2C9L Y;  3OAK A;  3T97 A;  2IPP A;  2R3C A;  5AW2 B;  3VMX A;  1YYC A;  2Z5H A;  1SLQ A;  5AW3 B;  5AVT B;  2YO2 A;  3L36 A;  4DZO A;  2WPS A;  5AW5 B;  3O8Z A;  3V4W A;  4C7N A;  2P7J A;  2XV5 A;  5APV A;  5AW6 B;  2P67 A;  2N9B A;  2ZXE B;  5CMZ A;  2WT7 A;  4GKG A;  3V4Q A;  2WPQ A;  5AW8 B;  1NAF A;  3HE4 B;  1OWA A;  3M06 A;  3M0D A;  5AW4 B;  1G2C B;  3P7K A;  3VTP C;  3LIE A;  2JJL A;  4JYC A;  4B86 A;  2E43 A;  4LC1 A;  3M9H A;  4I2L C;  3B8E B;  3A3Y B;  5AW0 B;  1CI6 B;  4AUW A;  4XE5 B;  1S9K D;  1A02 J;  3V5B A;  4C46 A;  3HE5 B;  3KQG A;  3LID A;  3I5C A;  5APX A;  1GK4 A;  3MD0 A;  1FAV A;  4AYC A;  3NFQ A;  2KP8 A;  3A7O A;  2QM8 A;  4KHX A;  1HJB A;  1MV8 A;  3TNU A;  2W6A A;  3MGN A;  1OXZ A;  1S9K E;  5APQ A;  2R5B A;  2Z5I A;  5AVR B;  3VMZ A;  3VN0 A;  1A02 F;  5AVY B;  5AVQ B;  2XZR A;  3M0A A;  4M3L A;  2BAS A;  3L35 A;  3NXS A;  3TK1 A;  4EOT A;  1H8A A;  1CZQ A;  4I6M C;  2ZFC A;  5APY A;  1MFZ A;  2W27 A;  2WTY A;  2P2U A;  2Q7C A;  1GK6 A;  1SP4 A;  2VRS A;  5AVX B;  1T2K D;  1JNM A;  1H88 A;  1JUN A;  2XU6 A;  4C7N B;  3VYI A;  3SWF A;  2WT7 B;  1NWQ A;  5APU A;  3HE4 A;  2E42 A;  3HTK A;  5AVS B;  5AW1 B;  2H7H A;  3VMY A;  3KDP B;  1HUC A; 
#chains in the Genus database with same CATH topology
 4JYB A;  3O6Q A;  3CCM P;  3BCC D;  3N7N A;  4N78 D;  3CCQ P;  1N7S A;  5B5E H;  2H89 C;  3RK2 D;  4RES B;  5AVW B;  1ZV8 A;  1Q90 D;  2J59 M;  2GUV A;  3BCC E;  4N78 E;  2KLU A;  1NTM G;  4WB4 A;  3L75 J;  3A5T A;  1OVV A;  5KLV G;  1FZE A;  1VDF A;  2FYN B;  4Y99 B;  1SQQ J;  1ZR4 A;  4OWF A;  2P7J A;  2N9B A;  1E5W A;  1GW3 A;  3H6P A;  1HH0 A;  1L4A A;  3Q3D A;  1NTM K;  5AW4 B;  1KYO D;  1OFC X;  3L73 G;  5KLV K;  2JEE A;  3HE5 B;  1ZRT D;  1QVF O;  1PGO A;  2IZ1 A;  4MN4 C;  3V2Q A;  1M1J B;  1PFI A;  1VQL P;  3RL0 B;  2I1K A;  1GL2 D;  3A7O A;  1ZP0 C;  2WSF J;  1KYO E;  2XKM A;  4U7J A;  1ZRT E;  1OZH A;  1BGY G;  4YPC A;  2FYU J;  3L70 J;  3D6Z A;  2E76 C;  2POH A;  3L71 J;  1RE3 C;  3RK3 B;  2R44 A;  1LTG C;  4A7P A;  2XNX A;  3S9O A;  2BCC E;  1EDL A;  2OYI B;  1KD1 Q;  4CPG A;  3VMY A;  1KFN A;  5KAI H;  4H44 B;  4PJ0 H;  3AE9 C;  1PPJ G;  1MUU A;  3E1I A;  4GIF A;  3H1J J;  2E75 C;  3KZI H;  3IFM A;  1IZN B;  1Q7Y Q;  1RF1 B;  4ZNC A;  1VF5 C;  2IBZ I;  1URQ B;  2A45 H;  2KS1 B;  1RE3 A;  1Z56 A;  1P84 H;  3SWY A;  1S5L X;  2R3S A;  3CLQ A;  1FDI A;  3P7K A;  5CCH C;  1YI2 P;  3IAO A;  5APX A;  2E74 D;  3MD0 A;  4WY4 D;  4H13 D;  1KIL C;  1YTZ I;  3L72 D;  3TNU A;  2WSS H;  3EQ2 A;  1PP9 D;  4KT0 J;  3L72 E;  2QVA A;  2KXP B;  2WSE J;  2OTK E;  2P2U A;  1EXI A;  5AVX B;  1PP9 E;  1HGZ A;  2WVR A;  1EZV I;  1M7L A;  2YXQ B;  2L5G B;  5AVZ B;  3MIW A;  5M1B A;  1CI6 A;  3MHV A;  1LJ2 A;  4AQR D;  5APS A;  2ZVO B;  1JY3 N;  2CK3 H;  1HBW A;  1IK7 A;  2P10 A;  1N73 C;  3C9I A;  2A45 I;  1JEK A;  3WUU A;  5KJ7 C;  2OQQ A;  4GT1 A;  1P84 I;  1IC2 A;  4NPE A;  5KAI E;  1KIL A;  3GW6 A;  1HGV A;  4PJ0 E;  1AFO A;  2YKP A;  1NGM B;  1EZV D;  2Q3I A;  4TT3 H;  3H1H J;  3WU2 H;  3BAT A;  4IFM A;  3KZI E;  2Y9Z A;  5GTI H;  3O8Z A;  3D71 A;  3RK2 C;  1EZV E;  3FXE A;  2ZYA A;  1NTK J;  1N8R Q;  2JJL A;  4B86 A;  1OW6 A;  1FZG A;  1LTA C;  1L0N D;  5KKZ B;  4XE5 B;  3O6Q B;  1VQ7 P;  3W68 A;  2PGD A;  3ABV C;  1N7S B;  4AYC A;  2KP8 A;  5H2F E;  1SQX K;  1P84 E;  4UB6 H;  1HJB A;  1L0N E;  2W6A A;  3MGN A;  1J1D C;  1N73 A;  1MFT A;  3FXD A;  2OTJ P;  1X0T A;  3M0A A;  4D6T D;  1SFC A;  1MFZ A;  3BRT B;  1HF9 A;  5DJT B;  4DCK A;  4WBA A;  2N1T A;  3OA7 A;  3L72 G;  1NU1 D;  1GL2 C;  2O01 H;  3QWO C;  3HTK A;  4D6T E;  2KYV A;  1L4A B;  1OW7 A;  1NTM J;  1PP9 G;  2I8D A;  3CCV P;  2KLV A;  5KLV J;  1SQQ K;  1GU4 A;  1FOS F;  2PAJ A;  3SFE C;  1JCD A;  1VPC A;  1KQS O;  2WPR A;  4HYT B;  1G1I A;  1NHL A;  1U7M A;  3L73 J;  2A06 D;  2JDI H;  3VMX A;  2Y0C A;  1FJP A;  5BVZ A;  4BRY A;  1KQG B;  5DJU B;  1NOH A;  4ASV A;  4I7Z B;  1YJ9 P;  3V4Q A;  1L0L D;  2B88 A;  1KB9 D;  2A06 E;  3VTP C;  1K9M Q;  1EZV G;  3WU2 E;  1BGY J;  2WPV B;  1GL2 A;  1S72 P;  5GTI E;  2CPS A;  1J1E B;  3F89 A;  4KHX A;  2ZT9 D;  1WMK A;  3TGU D;  2R5B A;  1RY3 A;  5E79 E;  3KPE A;  2YMK A;  1L0N G;  2BAS A;  2HOD A;  4OH8 B;  3TGU E;  2NPS A;  2E74 C;  1LP1 A;  3G9R A;  4WY4 C;  2FYZ A;  4H13 C;  3VYI A;  1FDM A;  3CWB D;  4HKZ H;  3CPW O;  1M57 D;  3U59 A;  2FFD C;  5AW1 B;  1GZL A;  4H0L B;  3CXH H;  1X8Y A;  1L0N K;  3U1A A;  4D6T G;  2AXT H;  2HLO A;  3CWB E;  3HD7 D;  2KZJ A;  3LW5 J;  1NU1 G;  3P32 A;  1IFN A;  3TNU B;  3L37 A;  1R8E A;  1IJD B;  1JCC A;  3T97 A;  4WVZ A;  2YO2 A;  3L36 A;  1QX8 A;  1S3J A;  2H8P D;  1M90 Q;  1PGQ A;  2P67 A;  1NU1 K;  2D2C B;  1VL2 A;  3CCS P;  3BVH A;  3EFF K;  3A3Y B;  1CI6 B;  3AE6 C;  1FE6 A;  3R2P A;  3LID A;  3AE7 C;  2OYO A;  2FFD A;  2IFN A;  3SWK A;  1VQO P;  1MV8 A;  1FZB A;  1SS1 A;  3CCL P;  1L0L G;  1DEB A;  1VQ6 P;  3C1L A;  1KIL B;  2V7Q H;  3CXH I;  4OVN F;  1ZN5 A;  2C0W A;  2OYH C;  1PGJ A;  2KIK A;  3FX0 A;  1RQV A;  1SP4 A;  3A0H H;  1JNM A;  3VP9 A;  2YXR B;  1OVR A;  1L0L K;  3TGU G;  3VOP A;  3AEA C;  1NAY A;  2QJK B;  3M9B A;  3PH0 A;  3R4Y A;  1LGH B;  2Z4E A;  1E79 H;  3SFD C;  1SQX J;  3CWB G;  1BDC A;  3CXH E;  3UIA A;  1KQL A;  1N73 B;  1BCC J;  3WUT A;  3TYY A;  1M56 D;  2MJZ A;  4IFD K;  5CCG D;  1SFC B;  2N1T B;  3HTK B;  3M0D A;  5AW0 B;  1VQ9 P;  5KAF H;  2RKL A;  3AE5 C;  1GDT A;  1FAV A;  1LTJ C;  1LT9 A;  3H1L D;  1JY3 O;  3L72 J;  1ZOY C;  1ZXG A;  4HB1 A;  3W67 A;  3GHG C;  1PP9 J;  1QLE D;  1USD A;  1Q2N A;  3RGU A;  1PGP A;  4I6M C;  4W7Z A;  2ZFC A;  2O01 N;  2KSJ A;  3H1L E;  4L76 A;  4PD4 H;  4BRY B;  1GK6 A;  1JY3 P;  2XDJ A;  3RL0 D;  3GG2 A;  1VQ4 P;  2Q3E A;  2ZT9 C;  1HUC A;  2BCC D;  2QJP C;  1JB0 J;  4N6J A;  2C0X A;  3HUS C;  3CL3 D;  3A0H E;  1S5L H;  4EIJ A;  2BEQ D;  3RK3 D;  3A2A A;  2YO3 A;  1LTT C;  3KXD A;  2M3E A;  3JC2 2;  3IR9 A;  2WWW A;  1EDJ A;  1N86 A;  3KHU A;  1RH5 B;  3RK3 E;  2IPP A;  2HOD B;  4H44 D;  5AW3 B;  3G6E P;  4BWN A;  4ZKU A;  2NPS B;  1LP1 B;  5APV A;  3HD7 C;  2YIU B;  4EI2 A;  2J5U A;  2G8Y A;  1YQ4 C;  4EDF A;  2OTL P;  3FWL A;  1L0N J;  3BCC G;  5B5E E;  1Y9B A;  1RQU A;  2HYN A;  4PD4 I;  3NFQ A;  1JOC A;  2KZI A;  1URQ D;  1EDI A;  5AVR B;  2SPZ A;  1SQP D;  3Q5R A;  2AXC A;  2FKW B;  4D6T J;  2QJY B;  3H1I D;  1JMM A;  1DIP A;  2Q7C A;  2IBZ D;  4OGQ D;  4O9B A;  4PD4 D;  3H1L G;  1SQP E;  1NU1 J;  5KLI B;  2YKQ A;  4DT0 A;  3H1I E;  3SSU A;  2IBZ E;  1BSH A;  4PD4 E;  1IO4 A;  3ITK A;  2FFD B;  1DX7 A;  5KTB A;  1HVV A;  5TJH A;  1N7L A;  1T6A A;  4PV1 B;  2R32 A;  1HJ0 A;  1LWU C;  2BCC G;  3N4X A;  2AEF A;  2KB7 P;  3K5B A;  4DZO A;  3AED C;  3E1R A;  5CCH A;  2HR3 A;  3FWN A;  3M9Q A;  1G1J A;  5AW8 B;  4DOJ A;  1S1C X;  1FDO A;  3L70 D;  1L0L J;  1G2C B;  3L71 D;  2WSE H;  2IYO A;  3I5C A;  4IL6 X;  4LGD E;  5CCG C;  1RE4 C;  3L70 E;  3L71 E;  1ZR2 A;  3MZW B;  1OXZ A;  2Z5I A;  1BE3 D;  2GA1 A;  5AVY B;  1XTG B;  1XTC C;  3TGU J;  1P84 D;  1YQ3 C;  4M3L A;  2FXO A;  2W6J H;  3H1J D;  1IFJ A;  1W2B O;  3V2P A;  1ZLL A;  1BE3 E;  3PLN A;  2GM4 A;  1QEX A;  2FYN C;  4Y99 C;  2FY8 A;  4LLH A;  3CWB J;  3H1J E;  2M5A A;  1GU5 A;  5KJ7 A;  5L8R J;  1SQP G;  2QM7 A;  4Z1M H;  1GTW A;  1QGK B;  3H1I G;  1RF0 C;  5AVU B;  1LT9 B;  2IBZ G;  2WQY C;  1M1J C;  4NPF X;  3RL0 C;  1L4A D;  1SQP K;  3GF7 A;  2H88 C;  3GF3 A;  4GOF A;  4C7N A;  1IFM A;  1VQ8 P;  2AEJ A;  3RK3 C;  4QMA A;  5GTH H;  1SQV D;  2B89 A;  4JYC A;  1NH4 A;  3CCR P;  4JF7 A;  2ZVN B;  2OYI C;  3B8E B;  4AUW A;  1A02 J;  4RJT A;  1L2P A;  3PTZ A;  1JTH A;  4N3Y B;  3AE8 C;  4H44 C;  3G4S P;  1SQV E;  3ZDM A;  2OAR A;  1Q82 Q;  3PP5 A;  5AVQ B;  3WMM 0;  3P8C D;  1AV1 A;  3CME P;  1M1J A;  1H8A A;  3H32 A;  3IN6 A;  2W27 A;  2AEM A;  3G3Z A;  1RF1 C;  1JUN A;  3P8C E;  4BXL A;  3S1K A;  2WSC J;  1JO5 A;  4L73 A;  2A45 G;  3Q5P A;  3HE4 A;  1URQ C;  2QIW A;  1BE3 G;  4YTP C;  2KNC A;  2CPB A;  1PIX A;  1FS0 E;  3AE1 C;  5AW9 B;  1EXJ A;  4IFF A;  1HWT C;  4L74 A;  4UB6 E;  1AVO A;  2Y9Y A;  1NTK D;  2LR2 A;  4U3F D;  2E76 B;  3CX5 H;  3NTN A;  5APW A;  4OGQ C;  2JWA A;  4ASW A;  3NMD A;  5AW7 B;  2C9L Y;  4H0L D;  3CCU P;  5CBO A;  3A0B H;  1NTK E;  1YYC A;  2Z5H A;  1Q81 Q;  4U3F E;  2JP3 A;  1Q86 Q;  2WPS A;  3BCC J;  3Q1M A;  1R5S A;  1KMI Z;  1OW8 A;  3M9H A;  2O1K A;  2E75 B;  3V5B A;  2YMY A;  3HRN A;  2PP6 A;  2QSI A;  2K1A A;  4ZMD A;  3CC2 P;  1VF5 B;  3H1L J;  3VN0 A;  5KLV D;  2XZR A;  1SQV G;  4WY4 A;  3NXS A;  1KOR A;  4I1L A;  1DD4 A;  2DW3 A;  4GDO A;  1ZME C;  5APY A;  2A06 G;  3B5N D;  3IF4 A;  2V7Q J;  4W80 A;  2VRS A;  5KLV E;  2B9B A;  2K9Y A;  1NWQ A;  3CX5 I;  3AEB C;  1YIJ P;  3L74 D;  4NPD A;  3L73 D;  3TDK A;  1SQV K;  2H43 A;  2W8Z A;  2BCC J;  3JCU H;  1J2J B;  2FXM A;  3L74 E;  3Q5S A;  3L73 E;  1KYO H;  1KIL E;  2C9N Y;  1LNQ A;  2LKM A;  2KSE A;  3CX5 D;  2JWD A;  4R4M A;  5EFW B;  2R3C A;  2LXB A;  2QRX A;  1GMJ A;  3CXH D;  5AW5 B;  1JY2 N;  4UB8 H;  3V4W A;  3CX5 E;  5CJ0 A;  2WT7 A;  4U3F G;  3CCJ P;  4JQ0 D;  2XND H;  1KQF B;  4LC1 A;  2OGU A;  5B66 H;  2AXT E;  1L4A C;  3USS A;  1ZW0 A;  3AEG C;  2QE7 H;  5BU5 A;  3V2R A;  1SFC D;  2OYH A;  1S4X A;  2N1T D;  2HFE D;  3RK2 B;  1SQB D;  1IFI A;  1SQP J;  2HPC A;  2V4H A;  3CC4 P;  5CJ4 A;  1T2K D;  1AQT A;  4C7N B;  3H1I J;  3OJA B;  1KYO I;  2K88 A;  1SQB E;  2L91 A;  1NTZ D;  1SLQ A;  1NJI Q;  1FZF A;  4I7Z C;  1FOS E;  3WUV A;  1IFD A;  5BU8 B;  1J1D B;  1JTH B;  1HTL C;  3AEC C;  3B4S A;  4RO0 A;  1KV4 A;  3H1K D;  1NTZ E;  1M1K Q;  1H0T A;  1EQ7 A;  2M3B A;  2YNY A;  3H25 A;  1J1E C;  2R5D A;  3L74 G;  1K04 A;  1YIT P;  3CMA P;  3MUD C;  3JCU E;  3H1K E;  1GL2 B;  2Q1K A;  3H32 B;  1WT6 A;  3RBZ A;  5AW6 B;  1OVU A;  5CMZ A;  4GKG A;  2ZXX A;  3HE4 B;  2J58 A;  1LTJ A;  3M06 A;  2KNC B;  2WSF H;  3S4R A;  1Y8A A;  1GK4 A;  2QG4 A;  4UB8 E;  4H0L C;  2ZAE B;  1UIX A;  1AVY A;  1KZU B;  4EYY Q;  3GHG A;  2NPS D;  3TSI A;  3D70 A;  3CI9 A;  1QVG O;  1BE3 J;  5B66 E;  3PJS K;  4K3A A;  1K8A Q;  1SQX D;  2JO1 A;  1FBM A;  3MUD A;  1FC2 C;  1NVO A;  1BCC D;  2W83 C;  3SWF A;  3HUS A;  1EDK A;  5AVS B;  1K73 Q;  3KDP B;  2IX7 C;  3FGA D;  5KAF E;  1SQX E;  2D2C C;  1U7J A;  1SQB G;  3T97 B;  5AVV B;  2RH0 A;  1BCC E;  2K37 A;  3RL0 g;  4WWI A;  2QEX P;  5H2F H;  3B5N C;  3V2N A;  3P8M C;  1YJN P;  3L75 D;  1GW4 A;  1LT1 A;  1U57 A;  4IL6 H;  1NTZ G;  3M91 A;  2E74 B;  4WY4 B;  1FZC C;  3HD7 A;  2IFM A;  1SQQ D;  1OIP A;  4H13 B;  4RKU J;  1SQB K;  1NO4 A;  4OGQ B;  3L75 E;  4R4L A;  3H1K G;  1QL1 A;  1FU1 A;  1SQQ E;  3I55 P;  2E43 A;  4PV1 D;  1NTZ K;  2O3J A;  4KJM A;  1SQV J;  4K35 A;  3KQG A;  1S5L E;  2PFX A;  1VQM P;  2KUB A;  2QJK C;  1OMI A;  2YKO A;  3Q2Y A;  1UII A;  2M8R A;  1KN7 A;  4GOD A;  1A02 F;  2FYU D;  2K3R A;  3B5N A;  3EWK A;  4EOT A;  1X22 A;  2K9J A;  2NZ2 A;  3F5H A;  5TIS H;  4GOE A;  2WTY A;  2ITA A;  2FYU E;  1FZC A;  2WT7 B;  5APU A;  2N9Y B;  1SFC C;  1VQK P;  1D7M A;  2WMM A;  4DJG A;  2N1T C;  3RBX A;  1KTM A;  1YHQ P;  3EFG A;  1NKN A;  1DH3 A;  1KC8 Q;  2Y0D A;  1CSB A;  2P58 A;  1TU3 F;  1LWU A;  2RN0 A;  1SQX G;  2ZYD A;  1KB9 H;  2UWJ E;  2IYP A;  1N7S D;  2OYH B;  1BCC G;  1T2K C;  4U3F J;  4HJG H;  5E79 H;  1NYH A;  2E5Y A;  1MZ9 A;  2O01 J;  2W6B A;  1PV3 A;  5AVT B;  4C7R A;  1T3J A;  1T8Z A;  1JM0 A;  2HPC B;  5CBN A;  2B87 A;  2KK7 A;  3GLM A;  4IL6 E;  1CW5 A;  3L75 G;  2WIT A;  3PRJ A;  2O1J A;  3AE4 C;  5CCG A;  4I2L C;  3VP8 A;  1RE4 A;  2MKV A;  1S9K D;  4C46 A;  1WRG A;  1SQQ G;  2GUS A;  2Q9I A;  4JPZ B;  2JR8 A;  4YXW H;  2M0B A;  2QM8 A;  4HH2 A;  1H0T B;  3MTU E;  1W2E A;  2FXP A;  1S9K E;  1S2E A;  4L75 A;  2RMZ A;  2KOG A;  3I56 P;  3GMA A;  1NU1 E;  1CZQ A;  1X9V A;  2G3A A;  1FJK A;  1VQ5 P;  1LTB C;  1IK9 A;  1KB9 I;  3KYQ A;  2FBW C;  3U1C A;  1IFP A;  4YXD C;  1JMB A;  2H7H A;  2NPS C;  1LTJ B;  2Q5U A;  2FYU G;  1JY2 O;  3L70 G;  3L74 J;  3L71 G;  3TF5 A;  1RF0 A;  2YIU C;  3HE5 A;  5TIS E;  2QA4 P;  1Y47 A;  3BRV B;  1H89 A;  2LXC B;  3GHG B;  3JSV C;  4XA4 A;  1JY2 P;  3CD6 P;  1GD2 E;  3H1H D;  2FYU K;  2W90 A;  1USE A;  1VQN P;  1W5C E;  3MP7 B;  5AW2 B;  1AA0 A;  4XFJ A;  2Q6Q A;  1L0L E;  1KB9 E;  3H1J G;  1AJY A;  2ZT9 B;  4IOI H;  3CC7 P;  1YTZ T;  1LTI C;  2QJP B;  2OYI A;  1LTS C;  3H1H E;  2WPQ A;  1R5L A;  3C8V A;  1NAF A;  3HUS B;  2QJY C;  2Y0E A;  2E76 D;  3LIE A;  3V6I A;  3L4F A;  2NRG A;  1QL2 A;  5KLI C;  2WSC H;  1RHZ B;  5CHX A;  1NKZ B;  1FZA A;  1YBK A;  2IDB A;  4TLF A;  5APQ A;  1K05 A;  1N2D C;  2ZYG A;  3BAS A;  1RF1 A;  3VMA A;  3L35 A;  4PV1 C;  3HD7 B;  2HG5 D;  2E75 D;  1URQ A;  1SQB J;  3G71 P;  2KS1 A;  3OW2 O;  1H88 A;  2XU6 A;  5GTH E;  1NTM D;  2E5T A;  1PL5 A;  3B71 A;  3QH9 A;  2D2C D;  3E7K A;  1VF5 D;  1NTZ J;  3LW5 H;  4W7Y A;  5K5G B;  1NTM E;  1BDD A;  2P1J A;  1DD3 A;  4Y28 J;  3H1K J;  5APT A;  5CCH D;  1PZQ A;  3AE2 C;  1DEE G;  1X79 B;  1YJW P;  3B5N B;  3OAK A;  1KIL D;  2PRR A;  3D6Y A;  2K9J B;  5C39 A;  1VQP P;  5KKZ C;  1KFM A;  1M8O B;  2XV5 A;  2ZXE B;  1FZC B;  1OWA A;  1AQ5 A;  1N7S C;  3PHL A;  1BGY D;  2E42 A;  2JKV A;  3H1H G;  3AEF C;  1MKM A;  4ZKP A;  3M0D C;  2WZ7 A;  1LWU B;  1BGY E;  3AE3 C;  3AEE C;  1NTK G;  4JBZ A;  2I1J A;  1G2C A;  3II6 A;  3VMZ A;  2M5A B;  1BSN A;  1LT9 C;  2IZ0 A;  3A0B E;  3TK1 A;  1PPJ D;  1EC5 A;  1OX3 A;  1T3U A;  5KJ7 D;  2ZJS E;  2BEZ F;  2B87 B;  1NTK K;  1PPJ E;  2KI7 B;  1SVF A;  3CCE P; 
#chains in the Genus database with same CATH homology
 1GZL A;  2IX7 C;  1GU5 A;  4JYB A;  5KJ7 A;  1X8Y A;  1L0N K;  3U1A A;  2QM7 A;  3N7N A;  4N78 D;  5AVV B;  2HLO A;  1N7S A;  3RK2 D;  4RES B;  3HD7 D;  1GTW A;  5AVW B;  1ZV8 A;  3B5N C;  1RF0 C;  5AVU B;  3V2N A;  3P8M C;  1LT9 B;  3P32 A;  1IFN A;  3TNU B;  2J59 M;  2GUV A;  1M1J C;  3L37 A;  1GW4 A;  3RL0 C;  4N78 E;  4WB4 A;  1IJD B;  3A5T A;  3M91 A;  1JCC A;  1L4A D;  4WY4 B;  1FZC C;  3T97 A;  3HD7 A;  2IFM A;  1FZE A;  1SQP K;  1VDF A;  1SQB K;  1NO4 A;  4Y99 B;  2YO2 A;  3L36 A;  1ZR4 A;  2H8P D;  4C7N A;  2P7J A;  2P67 A;  2N9B A;  1QL1 A;  1E5W A;  1IFM A;  1GW3 A;  1NU1 K;  3RK3 C;  1FU1 A;  3H6P A;  1HH0 A;  1L4A A;  1NTM K;  5AW4 B;  3BVH A;  4JYC A;  2E43 A;  1NH4 A;  1NTZ K;  4JF7 A;  2OYI C;  3B8E B;  3A3Y B;  5KLV K;  1CI6 B;  2FFD C;  4AUW A;  1A02 J;  2JEE A;  3HE5 B;  3KQG A;  3R2P A;  3LID A;  1PFI A;  3V2Q A;  1JTH A;  1M1J B;  2FFD A;  4N3Y B;  3RL0 B;  2I1K A;  2IFN A;  1GL2 D;  3A7O A;  2YKO A;  1MV8 A;  2XKM A;  2OAR A;  1FZB A;  2M8R A;  1DEB A;  3PP5 A;  1A02 F;  5AVQ B;  1KIL B;  3WMM 0;  3P8C D;  3B5N A;  1ZN5 A;  2C0W A;  2OYH C;  2POH A;  4EOT A;  1M1J A;  1RE3 C;  1H8A A;  3H32 A;  3RK3 B;  1LTG C;  2W27 A;  2WTY A;  3G3Z A;  2XNX A;  1SP4 A;  1RF1 C;  1JNM A;  1JUN A;  1FZC A;  2OYI B;  3P8C E;  1JO5 A;  2WT7 B;  3VP9 A;  2A45 G;  5APU A;  3HE4 A;  1URQ C;  1L0L K;  1SFC C;  3VOP A;  3VMY A;  2CPB A;  1KFN A;  2N1T C;  3EFG A;  5AW9 B;  1NKN A;  1DH3 A;  4IFF A;  3M9B A;  1HWT C;  1CSB A;  1LGH B;  1LWU A;  1MUU A;  3E1I A;  4GIF A;  2Z4E A;  1N7S D;  2OYH B;  3NTN A;  1T2K C;  5APW A;  3IFM A;  3UIA A;  1KQL A;  1N73 B;  3NMD A;  3TYY A;  1MZ9 A;  5AW7 B;  1RF1 B;  2C9L Y;  2MJZ A;  2W6B A;  4IFD K;  5CCG D;  1YYC A;  2Z5H A;  5AVT B;  4C7R A;  1T3J A;  1T8Z A;  1URQ B;  2WPS A;  1SFC B;  2A45 H;  2HPC B;  2N1T B;  1RE3 A;  1Z56 A;  3SWY A;  1CW5 A;  2WIT A;  2O1J A;  3CLQ A;  3HTK B;  3M0D A;  3P7K A;  5CCH C;  5CCG A;  3M9H A;  4I2L C;  3VP8 A;  1RE4 A;  2O1K A;  5AW0 B;  1S9K D;  3V5B A;  1WRG A;  2YMY A;  4C46 A;  3HRN A;  2PP6 A;  5APX A;  1GDT A;  2GUS A;  3MD0 A;  1FAV A;  4WY4 D;  2Q9I A;  1LTJ C;  1KIL C;  2QM8 A;  1YTZ I;  4HH2 A;  1LT9 A;  3MTU E;  3TNU A;  1JY3 O;  3EQ2 A;  1W2E A;  1S9K E;  3VN0 A;  2XZR A;  2KOG A;  4WY4 A;  3GHG C;  3NXS A;  4I1L A;  1CZQ A;  4I6M C;  4W7Z A;  2ZFC A;  5APY A;  1X9V A;  2KSJ A;  1FJK A;  3B5N D;  4W80 A;  1LTB C;  1IK9 A;  2P2U A;  1GK6 A;  2VRS A;  1JY3 P;  5AVX B;  3KYQ A;  2XDJ A;  3RL0 D;  1HGZ A;  3U1C A;  1NWQ A;  1M7L A;  2H7H A;  1HUC A;  2NPS C;  1LTJ B;  2L5G B;  2Q5U A;  5AVZ B;  3MIW A;  1JY2 O;  1SQV K;  1CI6 A;  2H43 A;  4N6J A;  2C0X A;  4AQR D;  5APS A;  1RF0 A;  1JY3 N;  3HE5 A;  1HBW A;  3HUS C;  1J2J B;  3CL3 D;  2FXM A;  1N73 C;  4EIJ A;  3C9I A;  3BRV B;  2A45 I;  3RK3 D;  1H89 A;  3A2A A;  2YO3 A;  1LTT C;  5KJ7 C;  3GHG B;  3IR9 A;  4GT1 A;  4XA4 A;  1IC2 A;  2WWW A;  2C9N Y;  1JY2 P;  2LKM A;  1KIL A;  1HGV A;  1GD2 E;  1AFO A;  2YKP A;  2Q3I A;  1N86 A;  2FYU K;  2IPP A;  2R3C A;  5AW2 B;  3BAT A;  2HOD B;  5AW3 B;  4IFM A;  5AW5 B;  1JY2 N;  4ZKU A;  2NPS B;  1YTZ T;  1LTI C;  3O8Z A;  3V4W A;  2OYI A;  1LTS C;  5APV A;  3RK2 C;  3HD7 C;  5CJ0 A;  2WT7 A;  2WPQ A;  1NAF A;  3HUS B;  3LIE A;  2JJL A;  4B86 A;  4LC1 A;  1LTA C;  1FZG A;  3L4F A;  4XE5 B;  1QL2 A;  2WSC H;  1L4A C;  5CHX A;  1N7S B;  2HYN A;  4AYC A;  3NFQ A;  1NKZ B;  2KP8 A;  5BU5 A;  1FZA A;  1JOC A;  3V2R A;  1SQX K;  1URQ D;  1SFC D;  1HJB A;  2OYH A;  2W6A A;  3MGN A;  1J1D C;  5APQ A;  2N1T D;  5AVR B;  1N73 A;  1N2D C;  3BAS A;  2HFE D;  3M0A A;  1RF1 A;  3L35 A;  3RK2 B;  3HD7 B;  1IFI A;  2HG5 D;  1URQ A;  1SFC A;  2FKW B;  1MFZ A;  2HPC A;  3BRT B;  1JMM A;  4WBA A;  2Q7C A;  2N1T A;  5CJ4 A;  3OA7 A;  1T2K D;  1H88 A;  2XU6 A;  4C7N B;  4O9B A;  1GL2 C;  2O01 H;  3OJA B;  3HTK A;  2YKQ A;  2KYV A;  1L4A B;  1SLQ A;  1FZF A;  2KLV A;  1FOS E;  3LW5 H;  4W7Y A;  1IFD A;  5BU8 B;  1J1D B;  1SQQ K;  1IO4 A;  1JTH B;  1GU4 A;  2FFD B;  1FOS F;  1HTL C;  1DX7 A;  2PAJ A;  2P1J A;  5KTB A;  1JCD A;  1VPC A;  1HVV A;  1EQ7 A;  2M3B A;  1N7L A;  2WPR A;  2YNY A;  5APT A;  5CCH D;  1J1E C;  4HYT B;  2R5D A;  2R32 A;  1LWU C;  1G1I A;  1NHL A;  1X79 B;  3B5N B;  3N4X A;  3OAK A;  1KIL D;  3VMX A;  2KB7 P;  1GL2 B;  3H32 B;  1FJP A;  5BVZ A;  1WT6 A;  4DZO A;  5CCH A;  1NOH A;  1KFM A;  2XV5 A;  5AW6 B;  2ZXE B;  1FZC B;  5CMZ A;  3M9Q A;  4GKG A;  3V4Q A;  1G1J A;  5AW8 B;  4DOJ A;  3HE4 B;  1OWA A;  1AQ5 A;  1N7S C;  2J58 A;  1LTJ A;  3M06 A;  2E42 A;  1G2C B;  3VTP C;  2WSE H;  1GL2 A;  2WSF H;  4ZKP A;  3I5C A;  1GK4 A;  2CPS A;  3M0D C;  1J1E B;  4LGD E;  2WZ7 A;  1LWU B;  5CCG C;  1RE4 C;  1KZU B;  4KHX A;  3GHG A;  1ZR2 A;  2NPS D;  1OXZ A;  3TSI A;  3CI9 A;  2I1J A;  2R5B A;  1RY3 A;  1G2C A;  2Z5I A;  3II6 A;  3VMZ A;  5AVY B;  1XTG B;  1XTC C;  1LT9 C;  3KPE A;  4M3L A;  2BAS A;  3TK1 A;  2HOD A;  1IFJ A;  1T3U A;  4OH8 B;  5KJ7 D;  1ZLL A;  3V2P A;  1FBM A;  2NPS A;  3MUD A;  4WY4 C;  2GM4 A;  2FYZ A;  3VYI A;  3SWF A;  1FDM A;  1NTK K;  3HUS A;  4Y99 C;  4LLH A;  1SVF A;  5AVS B;  3U59 A;  5AW1 B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...