4C7NA

Crystal structure of the synthetic peptide im10 in complex with the coiled-coil region of mitf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
b'SSVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICROPHTHALMIA ASSOCIATED TRANSCRIPTION FACTOR
publication title Improving Coiled Coil Stability While Maintaining Specificity by a Bacterial Hitchhiker Selection System.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4c7nA00
3M9BA 2WTYA 2WPQA 2C9LY 2E42A 4C7NB 1MUUA 2QM8A 3TYYA 5APVA 2ZFCA 2BASA 5CMZA 1GU4A 2Q3IA 3L36A 1KQLA 1H88A 1HJBA 3VMXA 3HE4B 1A02F 3V5BA 4EOTA 5AVWB 1HWTC 5AW9B 3LIEA 5AVQB 1SLQA 3I5CA 5AW5B 5AVRB 2R5DA 5AVVB 5AW2B 2H7HA 2JJLA 3O8ZA 5APSA 1CSBA 3NFQA 2WWWA 2Z5HA 5AVUB 5AW4B 1S9KE 1GK4A 2N9BA 3SWFA 3A7OA 3L37A 3UIAA 4HYTB 3M0AA 2ZXEB 4JYBA 5AW6B 4AYCA 1CI6A 5AVTB 1FOSF 1FAVA 2IPPA 1HUCA 3T97A 2R3CA 3A5TA 2WPSA 4AQRD 2P67A 5AW3B 5AW7B 1J2JB 1MFZA 1X8YA 3VN0A 3IR9A 4I6MC 3P32A 1OXZA 2Z5IA 2P7JA 2W27A 3VMYA 2YNYA 4GT1A 1S9KD 3P8MC 2E43A 3MGNA 3KDPB 1JUNA 3LIDA 1CI6B 5AVXB 2C9NY 2XU6A 4I2LC 3VTPC 3A3YB 4M3LA 1G2CB 5AVYB 1GTWA 1GU5A 2XV5A 3B8EB 3A2AA 2YO2A 1CZQA 3M91A 4XE5B 5APWA 1SP4A 1T2KC 3TNUA 1GK6A 3L35A 2Q5UA 2WT7A 1NWQA 5APTA 2QM7A 1GD2E 2Q7CA 1HBWA 1YYCA 5AVSB 1JNMA 2XZRA 5APXA 1OWAA 5APQA 4C46A 3VYIA 4RESB 3KQGA 4LC1A 4JYCA 1DH3A 1IO4A 5APYA 2R32A 2KP8A 5AW0B 1MV8A 5AW1B 2YO3A 5AW8B 4DZOA 3M9HA 1T2KD 3MD0A 4GKGA 3TNUB 4C7NA 1H8AA 3V4WA 3HTKA 4AUWA 1NAFA 2VRSA 2WT7B 5AVZB 2R5BA 1FOSE 2W6AA 3V4QA 3TK1A 3NMDA 3P7KA 3HE4A 1H89A 3M06A 3NTNA 3NXSA 2WPRA 5APUA 4KHXA 3VMZA 1GZLA 3HE5B 3OAKA 3M0DA 2P2UA 4B86A 1A02J 3HE5A
chains in the Genus database with same CATH superfamily
3MUDC 2WSEJ 1SQQG 1AA0A 4EYYQ 1NTKE 2E75B 4CPGA 1IJDB 1EDIA 3OW2O 1JMBA 3HE4B 2OYIA 2KS1B 1DEEG 5KLVD 1Q82Q 2KLUA 4QMAA 2FBWC 2YKOA 3S9OA 1Y8AA 1OFCX 3L74G 2OYOA 3TF5A 2IFMA 1FAVA 3CWBD 1IFIA 4C7RA 3AEDC 2M5AA 1SQQJ 4L75A 1VL2A 1KILE 3AEFC 2Z5IA 3CCQP 3AE6C 3C1LA 2P10A 2E43A 4WVZA 2YIUC 3CD6P 1SQXD 2KYVA 3Q1MA 1ZN5A 3CLQA 1L0NK 1EDKA 5M1BA 2IYPA 1QGKB 4C46A 3VOPA 2R32A 3AE7C 4PV1C 3V4WA 3H1KE 4H13C 1NU1E 2W6AA 1W5CE 1FZAA 2J58A 3HE4A 1EXIA 2Q1KA 1RE4C 2KS1A 3BCCD 2WTYA 2AEJA 1H0TB 2C9LY 1S5LE 3V5BA 3H1HE 3I5CA 1FE6A 1AVOA 1USEA 1JCDA 1K04A 3OA7A 3O6QB 3EFFK 3PLNA 1S9KE 3JCUH 3FX0A 4GODA 1QX8A 2R3CA 3TGUD 2FYNC 3D6ZA 1TU3F 1OXZA 3VMYA 2OTKE 4XFJA 1N2DC 1R8EA 1BSHA 3MGNA 4Y99C 2N1TB 1AV1A 1GU5A 5KAIE 3H1LG 1T6AA 2G8YA 2QJKC 4YPCA 2KK7A 1VQ7P 3CL3D 2FFDB 1M8OB 1YYCA 3Q5PA 2ZYGA 1AQTA 1RF1C 1Y9BA 4H0LD 1LTSC 5AW1B 4DCKA 3IF4A 1OW7A 1H0TA 4GKGA 4PJ0E 1NKNA 3H1JE 4NPEA 4D6TD 4RKUJ 3H1LJ 1SQVK 4IFDK 1VF5C 3O6QA 1S4XA 4LLHA 2HR3A 3C8VA 3B5NB 2E42A 3EWKA 5KKZC 1U7MA 2YIUB 2D2CB 1ZXGA 2BASA 3L36A 3OJAB 3CCSP 5KJ7A 3SWKA 4U3FG 4R4LA 5AVUB 5B66E 1LT1A 4W7ZA 2XNXA 4WY4C 1GK4A 4I1LA 2HPCB 3AEGC 1KYOH 3CXHI 2N1TA 1NTMJ 2Y9ZA 2DW3A 1RE3C 3HRNA 5AW7B 2E5YA 3QH9A 2LKMA 4H44B 2WPVB 1MZ9A 3PHLA 2FFDA 1L0LK 2A06D 1KB9I 3L72E 1SQBE 1NH4A 3WUUA 3P8MC 2AEMA 1L4AB 4U3FJ 1PFIA 1YJ9P 1RY3A 2K9JA 1Q2NA 1NOHA 4DJGA 1NTKK 1GK6A 2LXCB 1LTGC 1NWQA 2IFNA 1FZFA 4ZKPA 1OVVA 3FGAD 1FBMA 2JEEA 1N7SC 1Q90D 1AFOA 2YO3A 3CXHE 3MD0A 3B5NA 5C39A 3TNUB 2L91A 1NJIQ 2OYHA 1FZGA 3CX5I 1QLED 1BE3G 3P7KA 2OTLP 1OW6A 4NPFX 2WQYC 2SPZA 1KB9E 2RH0A 4PV1D 1PGOA 3L70G 3P8CE 3N7NA 3C9IA 2HPCA 4H13D 2KI7B 3IN6A 5AVWB 3AE1C 4HB1A 3HD7D 5CBOA 2HODB 2O01H 1T8ZA 1KZUB 1EDLA 1U7JA 1BE3J 1OX3A 3JC22 1VQOP 1L4AA 5CHXA 1OVRA 2RKLA 2QJYB 3L70J 3CX5E 1X8YA 3G3ZA 2MKVA 3USSA 1JM0A 1NU1K 3M9QA 1Y47A 1LTJC 1VF5B 2AXCA 3AE4C 2A45I 4GIFA 3A3YB 3H1IJ 1EC5A 1NTMD 2JP3A 4OGQB 1QVFO 2YKQA 3TNUA 3RK3B 1Q86Q 3GF7A 2CPBA 3L75E 3CCRP 5APXA 4RJTA 1ZRTD 1IK9A 1G1IA 1PGJA 1BGYE 1JY3O 4U3FD 3M9HA 4Y28J 1URQC 3AE2C 4RO0A 4L73A 3V2NA 5AVZB 1EZVE 2WSSH 2E76B 2Y9YA 2W83C 3G71P 1Z56A 3G6EP 3HE5B 2HODA 3CWBG 4TT3H 1PP9E 3E7KA 1GU4A 3BRTB 2YMKA 5TJHA 3MP7B 4ZMDA 2Y0EA 5AVRB 2M3BA 4UB6H 3I56P 2ZVOB 1LTBC 1CSBA 1SQPE 1N86A 1LJ2A 1SQXG 1IZNB 1M56D 1RH5B 5AW6B 2L5GB 1MFZA 1T3JA 2FYUD 2QSIA 1WMKA 5L8RJ 4WY4D 5CBNA 3WU2E 1RHZB 3CCLP 4OH8B 1CI6B 3B8EB 2K37A 2OARA 1EDJA 2W6JH 3A0HH 1VQNP 4WBAA 3BCCG 3RK2D 2QEXP 1YJNP 5AW8B 2M3EA 3H1ID 4DZOA 5TISE 2R3SA 1H8AA 1K05A 1LT9C 1LWUA 3R2PA 1FOSE 2IBZE 2H8PD 2BCCJ 1GZLA 3PJSK 2V4HA 1T3UA 2P2UA 3RL0C 1J1DC 3BCCJ 1SQBK 1W2BO 3TGUG 1KD1Q 1ZV8A 1SQQE 4N3YB 1BCCD 2IZ1A 3H6PA 2WVRA 2E74D 2N9YB 4W80A 2R5DA 1R5SA 3G4SP 5APSA 3N4XA 2IYOA 2WMMA 1N8RQ 2NPSB 2KZJA 3Q2YA 3EFGA 4MN4C 1JY2P 1IC2A 3M0AA 1FDOA 1CI6A 3L74E 1P84I 1L0ND 4EDFA 1FJPA 3TGUJ 1NKZB 5E79E 3M0DC 3Q5SA 3CCMP 5KTBA 2OQQA 2YNYA 3B71A 3ABVC 1KILC 2I1JA 5BU8B 3I55P 2XU6A 2XV5A 2ZT9D 1VQ8P 4D6TG 1T2KC 3ZDMA 3GHGB 1L0LG 2AXTH 1OWAA 3VYIA 4LC1A 4JYCA 1DH3A 3CPWO 3IAOA 1RF0C 4N6JA 2O01J 1P84E 3S4RA 1H89A 3NXSA 4D6TJ 1X79B 3BASA 1L0LJ 1NTZE 1URQD 2NPSA 5KLIC 3L71D 2ZVNB 2PP6A 2NZ2A 4BXLA 3HUSC 1KYOD 1A02F 2A06G 2HYNA 1SLQA 2BCCD 5AW2B 2H7HA 1JB0J 1WRGA 3HD7C 5KAFE 1AJYA 3CXHH 2B89A 3BATA 4I7ZB 1HH0A 2NRGA 3V2RA 4H0LB 2FKWB 5CCGA 1VDFA 3AEAC 2P67A 4IL6H 3GHGA 1VQ9P 1DX7A 4PD4D 1KB9H 4EIJA 2QJPB 1EXJA 5B5EE 2HG5D 1NYHA 1N73C 3H1LE 1PPJD 4WB4A 1FDIA 1SQVD 1M7LA 4WWIA 2KUBA 1SQPK 1FZEA 2H89C 1JCCA 3H25A 2QG4A 3CX5H 4AUWA 1NAFA 1JTHB 1X9VA 3H1KJ 1QEXA 2FXPA 4ZNCA 2FYZA 3CMAP 1K73Q 3HTKB 5EFWB 3KXDA 3TYYA 1KORA 4TLFA 5GTHE 3RL0D 1HVVA 1L0LD 1AQ5A 4N78D 1NTMG 3AE9C 3H32B 2BEZF 1NTKD 3CMEP 2K9YA 1FZCC 3RGUA 2QA4P 1OIPA 1KTMA 4ZKUA 2A45H 1KC8Q 1GL2C 1JUNA 1DEBA 2PAJA 2YXQB 5CCHC 1CZQA 1E5WA 3MUDA 4PV1B 4IL6X 4A7PA 1SQQK 4OWFA 1NO4A 3CC7P 1SVFA 2Q5UA 2Q3EA 4H13B 1SS1A 2KNCB 2WSFH 1JNMA 1KILD 2M8RA 1IO4A 3HD7B 3RK2C 3RK3E 1T2KD 3HTKA 2VRSA 1RQUA 4PD4H 2WT7B 1DIPA 1UIIA 1HF9A 3WU2H 3V6IA 1YIJP 2LXBA 1BE3E 3L73E 1M1JC 2KP8A 1LNQA 4C7NB 1JY2N 1SFCD 4K3AA 3H32A 2FYUG 1BDDA 3L70E 3H1KD 3KHUA 2FYNB 3W68A 1NU1D 3II6A 2KXPB 3A0BE 1J1EC 1LP1B 2QVAA 2E74C 2WWWA 1FS0E 3FXDA 5TISH 3RL0g 1VQ4P 4OVNF 3UIAA 1PL5A 4Y99B 2I8DA 1FOSF 1QL2A 3E1RA 1ZMEC 1BDCA 3VP9A 2GA1A 2QJKB 4UB8E 2KLVA 3AE8C 2FYUJ 3H1HD 2V7QH 2KNCA 2RMZA 3H1IG 1NTZK 1IFJA 1XTGB 1ZW0A 1RE4A 3FWNA 3L72J 1S9KD 3TSIA 1RF1B 1CW5A 3HD7A 2ZYAA 1VQLP 1G2CB 3JCUE 4XE5B 2OYIC 1LTIC 1NVOA 3VP8A 2ZT9C 1YITP 2WT7A 1EZVI 2H88C 1L2PA 4ASVA 2CK3H 4RESB 1MV8A 3MHVA 1BCCG 4C7NA 5KKZB 5E79H 1K8AQ 4DT0A 4U7JA 5KLVE 5APUA 3NTNA 4IFMA 3PH0A 3V2PA 1OMIA 1LP1A 4WY4B 3WUVA 1L0NG 3CWBE 2QM8A 2K88A 4K35A 3KZIE 1HJBA 2K1AA 1KQSO 2C0WA 3H1JD 1BCCJ 1ZLLA 1HWTC 2E5TA 5AVVB 3O8ZA 2Z5HA 1KV4A 5DJTB 3F89A 1RF1A 2E75C 4JYBA 1SQXE 1WT6A 1S1CX 1G2CA 2YMYA 1QVGO 2B9BA 2WPSA 1L0NJ 1J2JB 4IOIH 3SSUA 3PTZA 1JMMA 2JR8A 2P7JA 2HFED 1N7SB 3SFEC 4JPZB 1NHLA 1FJKA 3D70A 1XTCC 5APWA 1SP4A 4IFFA 2GUSA 2IBZI 3CCUP 1GL2D 2A45G 3L75J 2XZRA 3L71G 3BCCE 5APQA 4YXWH 2E74B 3L72D 5CCHD 1SQBD 1S5LH 4W7YA 1BGYJ 4WY4A 2BCCG 1QL1A 1M57D 1W2EA 5GTIE 1YBKA 3QWOC 1SQPG 1RE3A 5B5EH 3OAKA 3CCVP 3MTUE 3HE5A 2WSCH 2K3RA 2IZ0A 1MUUA 3L71J 3CXHD 2PFXA 3TGUE 2HLOA 3AE5C 2QE7H 1OW8A 2ZT9B 1GMJA 3GMAA 2Y0DA 3AECC 5AW4B 1KB9D 1LTJB 1SQPJ 2WSFJ 1S72P 2R44A 2BEQD 1N7SA 1VQPP 4HYTB 5KAIH 3PP5A 3P8CD 4AYCA 4YTPC 4XA4A 5AVTB 3CCJP 1PPJG 3KPEA 5AW3B 1SQVG 1HTLC 3IR9A 3AEEC 3P32A 1PZQA 1PGQA 1YI2P 3BRVB 1FU1A 1GDTA 2KZIA 4PJ0H 5AVYB 3GG2A 1NGMB 2YO2A 1JO5A 1URQB 5KJ7C 2ZYDA 3AE3C 4D6TE 3CX5D 4YXDC 2W8ZA 1X0TA 1SQVJ 1R5LA 5APYA 2N1TC 2W6BA 4GOEA 1PGPA 3AEBC 1USDA 3R4YA 4O9BA 2FFDC 3V4QA 1S3JA 1KFMA 3L75D 5B66H 3VMZA 3CC2P 1S5LX 1YTZI 2O01N 1NTKG 2WPQA 2V7QJ 1LTJA 1BGYD 4GDOA 5APVA 2ZFCA 5CMZA 1JEKA 1KQLA 2P1JA 1SFCC 4DOJA 5AVQB 1EZVD 1JY3P 1UIXA 2A06E 2JWAA 4BRYB 3B5NC 1PIXA 3L37A 3U59A 2OYHC 2PGDA 2D2CC 2JO1A 1PP9D 3L74J 1NTKJ 2OTJP 2NPSD 1URQA 3RBZA 3VN0A 1YQ4C 3L4FA 5KLVK 4GT1A 4UB6E 1DD3A 2E75D 1SQPD 1JOCA 1HJ0A 1ZR4A 3ITKA 1NAYA 1ZP0C 1MFTA 4KJMA 4H44C 3A0BH 1NTZG 1LT9B 1FDMA 5CCGD 3GF3A 1L4AC 3RL0B 1J1DB 1AVYA 2ITAA 3H1KG 3FWLA 3Q5RA 4Z1MH 4UB8H 1NU1G 1SQXK 1EQ7A 3U1CA 2R5BA 2OGUA 3M06A 2GUVA 3A0HE 3IFMA 4B86A 1NTZJ 4BRYA 3M9BA 3CCEP 2RN0A 5H2FE 2GM4A 1VQMP 3H1HG 1GW4A 2KIKA 1LTAC 2B88A 3LIEA 5AW9B 1KMIZ 2IBZD 1NU1J 3LW5J 1Q7YQ 3GW6A 3SWFA 1KILB 1NTME 2ZXEB 4HKZH 1SQQD 1KQFB 5CJ4A 1IK7A 1FZBA 4GOFA 1OVUA 3TDKA 4R4MA 3H1HJ 3V2QA 1LT9A 1ZRTE 4L76A 3KYQA 2O1KA 2K9JB 3SWYA 4U3FE 2LR2A 3KZIH 1LTTC 2QJYC 3B4SA 2WSCJ 3L74D 4ASWA 1M90Q 2KB7P 1SFCB 1HGVA 2Q7CA 3EQ2A 5KLIB 2OYHB 3H1JG 4OGQC 5KJ7D 5BU5A 2JWDA 3RK3C 2Z4EA 2MJZA 1D7MA 3HUSB 3TK1A 2AXTE 1JTHA 3G9RA 2N1TD 3RBXA 3M0DA 1HGZA 3D71A 2O1JA 1S2EA 3E1IA 1KILA 2E76C 3GLMA 2FXOA 1P84D 2FYUE 4EOTA 3H1JJ 3MZWB 4JF7A 5AW5B 1YTZT 2JJLA 3SFDC 1NTZD 1LGHB 3A7OA 2KSEA 5GTIH 1LWUC 2KOGA 1RF0A 2IPPA 1KN7A 1N73B 4I6MC 1SFCA 3L72G 2WSEH 1SQBG 2JKVA 3PRJA 3K5BA 3B5ND 2W27A 2B87B 1KQGB 2D2CD 3H1IE 3LIDA 2C9NY 1ZOYC 4I2LC 3A2AA 1DD4A 3CC4P 1MKMA 3W67A 3L73G 3JSVC 2J5UA 1GD2E 1IFMA 4IL6E 3HUSA 3WMM0 2QIWA 5DJUB 1SQBJ 1GW3A 4H44D 1BCCE 1G1JA 1JY2O 2WITA 3H1LD 2Y0CA 1JY3N 1L4AD 1OZHA 2M0BA 3L73J 2FY8A 1A02J 2AEFA 3S1KA 3CI9A 2G3AA 1FC2C 1Q81Q 1L0NE 2Q3IA 5CJ0A 1YQ3C 3VMXA 3BVHA 1PV3A 2ZXXA 1IFNA 1N73A 2IX7C 2J59M 1FZCB 4KT0J 2B87A 1U57A 2Q9IA 1GL2B 2I1KA 2PRRA 1HUCA 1KYOI 1K9MQ 2UWJE 4JQ0D 2NPSC 4LGDE 3F5HA 2ZAEB 3KDPB 3RK2B 5BVZA 4M3LA 4BWNA 2CPSA 1P84H 3T97B 2Q6QA 2QRXA 1X22A 2FXMA 5KLVG 4HJGH 3L75G 4PD4I 2QM7A 5AVSB 1IFDA 1VQ5P 1BGYG 4HH2A 3L71E 3Q3DA 1M1JB 5CCGC 2O3JA 1YJWP 2JDIH 1KFNA 1EZVG 1LWUB 1NTMK 3GHGC 1KYOE 1M1KQ 3VMAA 2BCCE 3LW5H 1VF5D 4JBZA 3FXEA 5KAFH 5KLVJ 4KHXA 1RQVA 1FZCA 1J1EB 4L74A 1PP9G 4OGQD 3U1AA 3MIWA 3RK3D 1GL2A 3CWBJ 1H88A 5CCHA 4PD4E 3D6YA 1BE3D 3L73D 3NFQA 2N9BA 2WZ7A 2C0XA 2E76D 2P58A 1SQXJ 3T97A 1PP9J 2XDJA 3A5TA 3L70D 1ZR2A 4AQRD 2OYIB 1PPJE 1SQVE 1IFPA 4I7ZC 5H2FH 2YKPA 5AVXB 3VTPC 1GTWA 2KSJA 1M1JA 3M91A 4H0LC 2M5AB 1YHQP 1BSNA 3L35A 1N7SD 2FYUK 2W90A 2QJPC 5APTA 3WUTA 1HBWA 2IDBA 1N7LA 2XKMA 3KQGA 5AW0B 2H43A 4EI2A 2POHA 1VQKP 2XNDH 2ZJSE 5GTHH 1VPCA 5K5GB 2IBZG 1VQ6P 2YXRB 3NMDA 2WPRA 1L0LE 1E79H 4NPDA 4N78E
chains in the Genus database with same CATH topology
3M9BA 4C7NB 1JY2N 1SFCD 3H32A 2GM4A 1IJDB 1GU4A 3BRTB 1GW4A 3HE4B 1LTAC 3LIEA 5AW9B 2OYIA 5AVRB 3II6A 2M3BA 1J1EC 1LTBC 1CSBA 2WWWA 1N86A 2YKOA 3SWFA 3UIAA 1KILB 2IFMA 4Y99B 2ZXEB 5AW6B 1FOSF 1FAVA 1QL2A 1IFIA 4C7RA 3VP9A 2L5GB 1MFZA 1T3JA 2KLVA 5CJ4A 1FZBA 4WY4D 1LT9A 3V2QA 2Z5IA 3KYQA 2O1KA 1NTZK 1IFJA 1XTGB 3TSIA 1RE4A 3SWYA 1S9KD 1RF1B 2E43A 1CW5A 4OH8B 3HD7A 1CI6B 1G2CB 1LTTC 3B8EB 4XE5B 2OARA 2KYVA 2OYIC 1ZN5A 3CLQA 1LTIC 1L0NK 3VP8A 2KB7P 1SFCB 1HGVA 2WT7A 4WBAA 3RK2D 2Q7CA 4C46A 4RESB 3VOPA 2R32A 1MV8A 3EQ2A 5AW8B 4DZOA 2OYHB 5KJ7D 5BU5A 4C7NA 1H8AA 3V4WA 3RK3C 2Z4EA 2MJZA 1LT9C 1LWUA 3R2PA 1FOSE 2W6AA 3HUSB 3TK1A 1FZAA 2J58A 3HE4A 1JTHA 2H8PD 3NTNA 5APUA 4IFMA 1RE4C 2N1TD 3V2PA 1GZLA 1T3UA 3M0DA 2P2UA 1HGZA 3RL0C 2O1JA 1J1DC 1SQBK 2WTYA 4WY4B 2C9LY 3E1IA 2QM8A 1ZV8A 1KILA 4N3YB 1HJBA 2C0WA 3H6PA 3V5BA 1ZLLA 4EOTA 1HWTC 4JF7A 4W80A 3I5CA 5AW5B 1YTZT 2R5DA 1JCDA 5AVVB 3OA7A 2JJLA 3O8ZA 5APSA 3N4XA 2NPSB 2Z5HA 1S9KE 3EFGA 1LGHB 3A7OA 1JY2P 1IC2A 3M0AA 1RF1A 4JYBA 1WT6A 1CI6A 1LWUC 2KOGA 1RF0A 2IPPA 1G2CA 2YMYA 2R3CA 1FJPA 2WPSA 1N73B 1J2JB 1NKZB 3M0DC 4I6MC 1JMMA 1SFCA 2WSEH 5KTBA 1OXZA 3B5ND 2P7JA 2W27A 2HFED 3VMYA 2YNYA 1N2DC 1N7SB 1KILC 2I1JA 5BU8B 3MGNA 4Y99C 3LIDA 2N1TB 2C9NY 1NHLA 2XU6A 4I2LC 1GU5A 2XV5A 1FJKA 3A2AA 1XTCC 5APWA 1SP4A 4IFFA 1T2KC 2GUSA 3GHGB 3CL3D 2FFDB 1GD2E 1IFMA 3HUSA 1GL2D 1YYCA 2A45G 2XZRA 1OWAA 5APQA 3VYIA 4LC1A 4JYCA 3WMM0 1RF1C 1DH3A 5CCHD 1RF0C 1LTSC 5AW1B 1GW3A 4W7YA 4N6JA 4WY4A 4GKGA 1G1JA 1NKNA 1QL1A 1W2EA 1JY2O 2WITA 1H89A 1RE3A 3NXSA 1X79B 3BASA 1JY3N 1L4AD 3OAKA 1SQVK 4IFDK 1A02J 3MTUE 2NPSA 3HE5A 1URQD 2WSCH 4LLHA 3B5NB 2E42A 1MUUA 3CI9A 2BASA 2PP6A 2HLOA 2Q3IA 5CJ0A 3L36A 3OJAB 3VMXA 3BVHA 3HUSC 1A02F 1IFNA 2HYNA 1N73A 1SLQA 2IX7C 2J59M 5KJ7A 5AW2B 2H7HA 1FZCB 1WRGA 3HD7C 5AVUB 5AW4B 4W7ZA 2XNXA 4WY4C 1GK4A 4I1LA 1LTJB 3BATA 2HPCB 2Q9IA 1GL2B 1N7SA 4HYTB 3PP5A 3P8CD 4AYCA 2N1TA 2I1KA 4XA4A 5AVTB 1HUCA 1HH0A 3V2RA 5CCGA 2FKWB 1RE3C 1VDFA 3HRNA 3KPEA 2P67A 5AW3B 5AW7B 1HTLC 3GHGA 3IR9A 2LKMA 1DX7A 3P32A 4EIJA 1MZ9A 2NPSC 2FFDA 3BRVB 1FU1A 1L0LK 4LGDE 1GDTA 2HG5D 1NH4A 3P8MC 3KDPB 3RK2B 1L4AB 5AVYB 4M3LA 5BVZA 2CPSA 1PFIA 1RY3A 2YO2A 1JO5A 1NOHA 1N73C 1URQB 2FXMA 1NTKK 1GK6A 5KJ7C 1LTGC 1NWQA 2IFNA 2QM7A 1FZFA 4ZKPA 4WB4A 5AVSB 1FBMA 1IFDA 1M7LA 1N7SC 2JEEA 4HH2A 5APYA 2N1TC 1AFOA 2W6BA 1SQPK 1FZEA 1M1JB 5CCGC 1JCCA 2YO3A 1KFNA 3MD0A 3B5NA 3TNUB 3GHGC 1LWUB 1NTMK 4AUWA 1NAFA 2OYHA 1FZGA 1JTHB 1X9VA 4O9BA 2FFDC 3LW5H 3V4QA 3P7KA 1KFMA 4KHXA 3VMZA 2FYZA 1FZCA 1J1EB 1YTZI 3U1AA 2WPQA 3P8CE 1LTJA 3MIWA 3N7NA 3RK3D 3HTKB 3C9IA 2HPCA 1GL2A 3TYYA 5APVA 2ZFCA 5CMZA 1KQLA 2P1JA 1H88A 1SFCC 5CCHA 4DOJA 5AVWB 5AVQB 3HD7D 3RL0D 2HODB 1JY3P 1HVVA 1AQ5A 4N78D 2O01H 1T8ZA 1KZUB 3NFQA 3B5NC 2N9BA 3H32B 2WZ7A 3L37A 3U59A 2OYHC 2C0XA 1L4AA 5CHXA 3T97A 2XDJA 3A5TA 1ZR2A 4AQRD 2OYIB 2NPSD 1URQA 3VN0A 1X8YA 3G3ZA 1FZCC 1NU1K 3M9QA 3L4FA 5KLVK 4ZKUA 2A45H 4GT1A 1LTJC 1GL2C 1JOCA 2YKPA 2A45I 1DEBA 1JUNA 1ZR4A 2PAJA 4GIFA 5AVXB 3VTPC 1GTWA 3A3YB 2KSJA 1M1JA 5CCHC 3M91A 1CZQA 1E5WA 3MUDA 2YKQA 3TNUA 1SQQK 1NO4A 3L35A 3RK3B 1SVFA 2Q5UA 1N7SD 2FYUK 1LT9B 1FDMA 5APTA 2CPBA 2WSFH 1HBWA 1JNMA 1KILD 2M8RA 1N7LA 5APXA 2XKMA 5CCGD 3KQGA 1IO4A 3HD7B 5AW0B 3RK2C 1IK9A 1L4AC 2H43A 3RL0B 2POHA 1G1IA 1J1DB 1JY3O 1T2KD 3M9HA 1URQC 3HTKA 1SQXK 1VPCA 2VRSA 1EQ7A 3V2NA 2WT7B 5AVZB 3U1CA 2R5BA 3NMDA 3M06A 2GUVA 2WPRA 1Z56A 4N78E 3HE5B 2HODA 3IFMA 4B86A 1M1JC 2KP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  2WTY A;  2WPQ A;  2C9L Y;  2E42 A;  4C7N B;  1MUU A;  2QM8 A;  3TYY A;  5APV A;  2ZFC A;  2BAS A;  5CMZ A;  1GU4 A;  2Q3I A;  3L36 A;  1KQL A;  1H88 A;  1HJB A;  3VMX A;  3HE4 B;  1A02 F;  3V5B A;  4EOT A;  5AVW B;  1HWT C;  5AW9 B;  3LIE A;  5AVQ B;  1SLQ A;  3I5C A;  5AW5 B;  5AVR B;  2R5D A;  5AVV B;  5AW2 B;  2H7H A;  2JJL A;  3O8Z A;  5APS A;  1CSB A;  3NFQ A;  2WWW A;  2Z5H A;  5AVU B;  5AW4 B;  1S9K E;  1GK4 A;  2N9B A;  3SWF A;  3A7O A;  3L37 A;  3UIA A;  4HYT B;  3M0A A;  2ZXE B;  4JYB A;  5AW6 B;  4AYC A;  1CI6 A;  5AVT B;  1FOS F;  1FAV A;  2IPP A;  1HUC A;  3T97 A;  2R3C A;  3A5T A;  2WPS A;  4AQR D;  2P67 A;  5AW3 B;  5AW7 B;  1J2J B;  1MFZ A;  1X8Y A;  3VN0 A;  3IR9 A;  4I6M C;  3P32 A;  1OXZ A;  2Z5I A;  2P7J A;  2W27 A;  3VMY A;  2YNY A;  4GT1 A;  1S9K D;  3P8M C;  2E43 A;  3MGN A;  3KDP B;  1JUN A;  3LID A;  1CI6 B;  5AVX B;  2C9N Y;  2XU6 A;  4I2L C;  3VTP C;  3A3Y B;  4M3L A;  1G2C B;  5AVY B;  1GTW A;  1GU5 A;  2XV5 A;  3B8E B;  3A2A A;  2YO2 A;  1CZQ A;  3M91 A;  4XE5 B;  5APW A;  1SP4 A;  1T2K C;  3TNU A;  1GK6 A;  3L35 A;  2Q5U A;  2WT7 A;  1NWQ A;  5APT A;  2QM7 A;  1GD2 E;  2Q7C A;  1HBW A;  1YYC A;  5AVS B;  1JNM A;  2XZR A;  5APX A;  1OWA A;  5APQ A;  4C46 A;  3VYI A;  4RES B;  3KQG A;  4LC1 A;  4JYC A;  1DH3 A;  1IO4 A;  5APY A;  2R32 A;  2KP8 A;  5AW0 B;  1MV8 A;  5AW1 B;  2YO3 A;  5AW8 B;  4DZO A;  3M9H A;  1T2K D;  3MD0 A;  4GKG A;  3TNU B;  4C7N A;  1H8A A;  3V4W A;  3HTK A;  4AUW A;  1NAF A;  2VRS A;  2WT7 B;  5AVZ B;  2R5B A;  1FOS E;  2W6A A;  3V4Q A;  3TK1 A;  3NMD A;  3P7K A;  3HE4 A;  1H89 A;  3M06 A;  3NTN A;  3NXS A;  2WPR A;  5APU A;  4KHX A;  3VMZ A;  1GZL A;  3HE5 B;  3OAK A;  3M0D A;  2P2U A;  4B86 A;  1A02 J;  3HE5 A; 
#chains in the Genus database with same CATH topology
 3MUD C;  2WSE J;  1SQQ G;  1AA0 A;  4EYY Q;  1NTK E;  2E75 B;  4CPG A;  1IJD B;  1EDI A;  3OW2 O;  1JMB A;  3HE4 B;  2OYI A;  2KS1 B;  1DEE G;  5KLV D;  1Q82 Q;  2KLU A;  4QMA A;  2FBW C;  2YKO A;  3S9O A;  1Y8A A;  1OFC X;  3L74 G;  2OYO A;  3TF5 A;  2IFM A;  1FAV A;  3CWB D;  1IFI A;  4C7R A;  3AED C;  2M5A A;  1SQQ J;  4L75 A;  1VL2 A;  1KIL E;  3AEF C;  2Z5I A;  3CCQ P;  3AE6 C;  3C1L A;  2P10 A;  2E43 A;  4WVZ A;  2YIU C;  3CD6 P;  1SQX D;  2KYV A;  3Q1M A;  1ZN5 A;  3CLQ A;  1L0N K;  1EDK A;  5M1B A;  2IYP A;  1QGK B;  4C46 A;  3VOP A;  2R32 A;  3AE7 C;  4PV1 C;  3V4W A;  3H1K E;  4H13 C;  1NU1 E;  2W6A A;  1W5C E;  1FZA A;  2J58 A;  3HE4 A;  1EXI A;  2Q1K A;  1RE4 C;  2KS1 A;  3BCC D;  2WTY A;  2AEJ A;  1H0T B;  2C9L Y;  1S5L E;  3V5B A;  3H1H E;  3I5C A;  1FE6 A;  1AVO A;  1USE A;  1JCD A;  1K04 A;  3OA7 A;  3O6Q B;  3EFF K;  3PLN A;  1S9K E;  3JCU H;  3FX0 A;  4GOD A;  1QX8 A;  2R3C A;  3TGU D;  2FYN C;  3D6Z A;  1TU3 F;  1OXZ A;  3VMY A;  2OTK E;  4XFJ A;  1N2D C;  1R8E A;  1BSH A;  3MGN A;  4Y99 C;  2N1T B;  1AV1 A;  1GU5 A;  5KAI E;  3H1L G;  1T6A A;  2G8Y A;  2QJK C;  4YPC A;  2KK7 A;  1VQ7 P;  3CL3 D;  2FFD B;  1M8O B;  1YYC A;  3Q5P A;  2ZYG A;  1AQT A;  1RF1 C;  1Y9B A;  4H0L D;  1LTS C;  5AW1 B;  4DCK A;  3IF4 A;  1OW7 A;  1H0T A;  4GKG A;  4PJ0 E;  1NKN A;  3H1J E;  4NPE A;  4D6T D;  4RKU J;  3H1L J;  1SQV K;  4IFD K;  1VF5 C;  3O6Q A;  1S4X A;  4LLH A;  2HR3 A;  3C8V A;  3B5N B;  2E42 A;  3EWK A;  5KKZ C;  1U7M A;  2YIU B;  2D2C B;  1ZXG A;  2BAS A;  3L36 A;  3OJA B;  3CCS P;  5KJ7 A;  3SWK A;  4U3F G;  4R4L A;  5AVU B;  5B66 E;  1LT1 A;  4W7Z A;  2XNX A;  4WY4 C;  1GK4 A;  4I1L A;  2HPC B;  3AEG C;  1KYO H;  3CXH I;  2N1T A;  1NTM J;  2Y9Z A;  2DW3 A;  1RE3 C;  3HRN A;  5AW7 B;  2E5Y A;  3QH9 A;  2LKM A;  4H44 B;  2WPV B;  1MZ9 A;  3PHL A;  2FFD A;  1L0L K;  2A06 D;  1KB9 I;  3L72 E;  1SQB E;  1NH4 A;  3WUU A;  3P8M C;  2AEM A;  1L4A B;  4U3F J;  1PFI A;  1YJ9 P;  1RY3 A;  2K9J A;  1Q2N A;  1NOH A;  4DJG A;  1NTK K;  1GK6 A;  2LXC B;  1LTG C;  1NWQ A;  2IFN A;  1FZF A;  4ZKP A;  1OVV A;  3FGA D;  1FBM A;  2JEE A;  1N7S C;  1Q90 D;  1AFO A;  2YO3 A;  3CXH E;  3MD0 A;  3B5N A;  5C39 A;  3TNU B;  2L91 A;  1NJI Q;  2OYH A;  1FZG A;  3CX5 I;  1QLE D;  1BE3 G;  3P7K A;  2OTL P;  1OW6 A;  4NPF X;  2WQY C;  2SPZ A;  1KB9 E;  2RH0 A;  4PV1 D;  1PGO A;  3L70 G;  3P8C E;  3N7N A;  3C9I A;  2HPC A;  4H13 D;  2KI7 B;  3IN6 A;  5AVW B;  3AE1 C;  4HB1 A;  3HD7 D;  5CBO A;  2HOD B;  2O01 H;  1T8Z A;  1KZU B;  1EDL A;  1U7J A;  1BE3 J;  1OX3 A;  3JC2 2;  1VQO P;  1L4A A;  5CHX A;  1OVR A;  2RKL A;  2QJY B;  3L70 J;  3CX5 E;  1X8Y A;  3G3Z A;  2MKV A;  3USS A;  1JM0 A;  1NU1 K;  3M9Q A;  1Y47 A;  1LTJ C;  1VF5 B;  2AXC A;  3AE4 C;  2A45 I;  4GIF A;  3A3Y B;  3H1I J;  1EC5 A;  1NTM D;  2JP3 A;  4OGQ B;  1QVF O;  2YKQ A;  3TNU A;  3RK3 B;  1Q86 Q;  3GF7 A;  2CPB A;  3L75 E;  3CCR P;  5APX A;  4RJT A;  1ZRT D;  1IK9 A;  1G1I A;  1PGJ A;  1BGY E;  1JY3 O;  4U3F D;  3M9H A;  4Y28 J;  1URQ C;  3AE2 C;  4RO0 A;  4L73 A;  3V2N A;  5AVZ B;  1EZV E;  2WSS H;  2E76 B;  2Y9Y A;  2W83 C;  3G71 P;  1Z56 A;  3G6E P;  3HE5 B;  2HOD A;  3CWB G;  4TT3 H;  1PP9 E;  3E7K A;  1GU4 A;  3BRT B;  2YMK A;  5TJH A;  3MP7 B;  4ZMD A;  2Y0E A;  5AVR B;  2M3B A;  4UB6 H;  3I56 P;  2ZVO B;  1LTB C;  1CSB A;  1SQP E;  1N86 A;  1LJ2 A;  1SQX G;  1IZN B;  1M56 D;  1RH5 B;  5AW6 B;  2L5G B;  1MFZ A;  1T3J A;  2FYU D;  2QSI A;  1WMK A;  5L8R J;  4WY4 D;  5CBN A;  3WU2 E;  1RHZ B;  3CCL P;  4OH8 B;  1CI6 B;  3B8E B;  2K37 A;  2OAR A;  1EDJ A;  2W6J H;  3A0H H;  1VQN P;  4WBA A;  3BCC G;  3RK2 D;  2QEX P;  1YJN P;  5AW8 B;  2M3E A;  3H1I D;  4DZO A;  5TIS E;  2R3S A;  1H8A A;  1K05 A;  1LT9 C;  1LWU A;  3R2P A;  1FOS E;  2IBZ E;  2H8P D;  2BCC J;  1GZL A;  3PJS K;  2V4H A;  1T3U A;  2P2U A;  3RL0 C;  1J1D C;  3BCC J;  1SQB K;  1W2B O;  3TGU G;  1KD1 Q;  1ZV8 A;  1SQQ E;  4N3Y B;  1BCC D;  2IZ1 A;  3H6P A;  2WVR A;  2E74 D;  2N9Y B;  4W80 A;  2R5D A;  1R5S A;  3G4S P;  5APS A;  3N4X A;  2IYO A;  2WMM A;  1N8R Q;  2NPS B;  2KZJ A;  3Q2Y A;  3EFG A;  4MN4 C;  1JY2 P;  1IC2 A;  3M0A A;  1FDO A;  1CI6 A;  3L74 E;  1P84 I;  1L0N D;  4EDF A;  1FJP A;  3TGU J;  1NKZ B;  5E79 E;  3M0D C;  3Q5S A;  3CCM P;  5KTB A;  2OQQ A;  2YNY A;  3B71 A;  3ABV C;  1KIL C;  2I1J A;  5BU8 B;  3I55 P;  2XU6 A;  2XV5 A;  2ZT9 D;  1VQ8 P;  4D6T G;  1T2K C;  3ZDM A;  3GHG B;  1L0L G;  2AXT H;  1OWA A;  3VYI A;  4LC1 A;  4JYC A;  1DH3 A;  3CPW O;  3IAO A;  1RF0 C;  4N6J A;  2O01 J;  1P84 E;  3S4R A;  1H89 A;  3NXS A;  4D6T J;  1X79 B;  3BAS A;  1L0L J;  1NTZ E;  1URQ D;  2NPS A;  5KLI C;  3L71 D;  2ZVN B;  2PP6 A;  2NZ2 A;  4BXL A;  3HUS C;  1KYO D;  1A02 F;  2A06 G;  2HYN A;  1SLQ A;  2BCC D;  5AW2 B;  2H7H A;  1JB0 J;  1WRG A;  3HD7 C;  5KAF E;  1AJY A;  3CXH H;  2B89 A;  3BAT A;  4I7Z B;  1HH0 A;  2NRG A;  3V2R A;  4H0L B;  2FKW B;  5CCG A;  1VDF A;  3AEA C;  2P67 A;  4IL6 H;  3GHG A;  1VQ9 P;  1DX7 A;  4PD4 D;  1KB9 H;  4EIJ A;  2QJP B;  1EXJ A;  5B5E E;  2HG5 D;  1NYH A;  1N73 C;  3H1L E;  1PPJ D;  4WB4 A;  1FDI A;  1SQV D;  1M7L A;  4WWI A;  2KUB A;  1SQP K;  1FZE A;  2H89 C;  1JCC A;  3H25 A;  2QG4 A;  3CX5 H;  4AUW A;  1NAF A;  1JTH B;  1X9V A;  3H1K J;  1QEX A;  2FXP A;  4ZNC A;  2FYZ A;  3CMA P;  1K73 Q;  3HTK B;  5EFW B;  3KXD A;  3TYY A;  1KOR A;  4TLF A;  5GTH E;  3RL0 D;  1HVV A;  1L0L D;  1AQ5 A;  4N78 D;  1NTM G;  3AE9 C;  3H32 B;  2BEZ F;  1NTK D;  3CME P;  2K9Y A;  1FZC C;  3RGU A;  2QA4 P;  1OIP A;  1KTM A;  4ZKU A;  2A45 H;  1KC8 Q;  1GL2 C;  1JUN A;  1DEB A;  2PAJ A;  2YXQ B;  5CCH C;  1CZQ A;  1E5W A;  3MUD A;  4PV1 B;  4IL6 X;  4A7P A;  1SQQ K;  4OWF A;  1NO4 A;  3CC7 P;  1SVF A;  2Q5U A;  2Q3E A;  4H13 B;  1SS1 A;  2KNC B;  2WSF H;  1JNM A;  1KIL D;  2M8R A;  1IO4 A;  3HD7 B;  3RK2 C;  3RK3 E;  1T2K D;  3HTK A;  2VRS A;  1RQU A;  4PD4 H;  2WT7 B;  1DIP A;  1UII A;  1HF9 A;  3WU2 H;  3V6I A;  1YIJ P;  2LXB A;  1BE3 E;  3L73 E;  1M1J C;  2KP8 A;  1LNQ A;  4C7N B;  1JY2 N;  1SFC D;  4K3A A;  3H32 A;  2FYU G;  1BDD A;  3L70 E;  3H1K D;  3KHU A;  2FYN B;  3W68 A;  1NU1 D;  3II6 A;  2KXP B;  3A0B E;  1J1E C;  1LP1 B;  2QVA A;  2E74 C;  2WWW A;  1FS0 E;  3FXD A;  5TIS H;  3RL0 g;  1VQ4 P;  4OVN F;  3UIA A;  1PL5 A;  4Y99 B;  2I8D A;  1FOS F;  1QL2 A;  3E1R A;  1ZME C;  1BDC A;  3VP9 A;  2GA1 A;  2QJK B;  4UB8 E;  2KLV A;  3AE8 C;  2FYU J;  3H1H D;  2V7Q H;  2KNC A;  2RMZ A;  3H1I G;  1NTZ K;  1IFJ A;  1XTG B;  1ZW0 A;  1RE4 A;  3FWN A;  3L72 J;  1S9K D;  3TSI A;  1RF1 B;  1CW5 A;  3HD7 A;  2ZYA A;  1VQL P;  1G2C B;  3JCU E;  4XE5 B;  2OYI C;  1LTI C;  1NVO A;  3VP8 A;  2ZT9 C;  1YIT P;  2WT7 A;  1EZV I;  2H88 C;  1L2P A;  4ASV A;  2CK3 H;  4RES B;  1MV8 A;  3MHV A;  1BCC G;  4C7N A;  5KKZ B;  5E79 H;  1K8A Q;  4DT0 A;  4U7J A;  5KLV E;  5APU A;  3NTN A;  4IFM A;  3PH0 A;  3V2P A;  1OMI A;  1LP1 A;  4WY4 B;  3WUV A;  1L0N G;  3CWB E;  2QM8 A;  2K88 A;  4K35 A;  3KZI E;  1HJB A;  2K1A A;  1KQS O;  2C0W A;  3H1J D;  1BCC J;  1ZLL A;  1HWT C;  2E5T A;  5AVV B;  3O8Z A;  2Z5H A;  1KV4 A;  5DJT B;  3F89 A;  1RF1 A;  2E75 C;  4JYB A;  1SQX E;  1WT6 A;  1S1C X;  1G2C A;  2YMY A;  1QVG O;  2B9B A;  2WPS A;  1L0N J;  1J2J B;  4IOI H;  3SSU A;  3PTZ A;  1JMM A;  2JR8 A;  2P7J A;  2HFE D;  1N7S B;  3SFE C;  4JPZ B;  1NHL A;  1FJK A;  3D70 A;  1XTC C;  5APW A;  1SP4 A;  4IFF A;  2GUS A;  2IBZ I;  3CCU P;  1GL2 D;  2A45 G;  3L75 J;  2XZR A;  3L71 G;  3BCC E;  5APQ A;  4YXW H;  2E74 B;  3L72 D;  5CCH D;  1SQB D;  1S5L H;  4W7Y A;  1BGY J;  4WY4 A;  2BCC G;  1QL1 A;  1M57 D;  1W2E A;  5GTI E;  1YBK A;  3QWO C;  1SQP G;  1RE3 A;  5B5E H;  3OAK A;  3CCV P;  3MTU E;  3HE5 A;  2WSC H;  2K3R A;  2IZ0 A;  1MUU A;  3L71 J;  3CXH D;  2PFX A;  3TGU E;  2HLO A;  3AE5 C;  2QE7 H;  1OW8 A;  2ZT9 B;  1GMJ A;  3GMA A;  2Y0D A;  3AEC C;  5AW4 B;  1KB9 D;  1LTJ B;  1SQP J;  2WSF J;  1S72 P;  2R44 A;  2BEQ D;  1N7S A;  1VQP P;  4HYT B;  5KAI H;  3PP5 A;  3P8C D;  4AYC A;  4YTP C;  4XA4 A;  5AVT B;  3CCJ P;  1PPJ G;  3KPE A;  5AW3 B;  1SQV G;  1HTL C;  3IR9 A;  3AEE C;  3P32 A;  1PZQ A;  1PGQ A;  1YI2 P;  3BRV B;  1FU1 A;  1GDT A;  2KZI A;  4PJ0 H;  5AVY B;  3GG2 A;  1NGM B;  2YO2 A;  1JO5 A;  1URQ B;  5KJ7 C;  2ZYD A;  3AE3 C;  4D6T E;  3CX5 D;  4YXD C;  2W8Z A;  1X0T A;  1SQV J;  1R5L A;  5APY A;  2N1T C;  2W6B A;  4GOE A;  1PGP A;  3AEB C;  1USD A;  3R4Y A;  4O9B A;  2FFD C;  3V4Q A;  1S3J A;  1KFM A;  3L75 D;  5B66 H;  3VMZ A;  3CC2 P;  1S5L X;  1YTZ I;  2O01 N;  1NTK G;  2WPQ A;  2V7Q J;  1LTJ A;  1BGY D;  4GDO A;  5APV A;  2ZFC A;  5CMZ A;  1JEK A;  1KQL A;  2P1J A;  1SFC C;  4DOJ A;  5AVQ B;  1EZV D;  1JY3 P;  1UIX A;  2A06 E;  2JWA A;  4BRY B;  3B5N C;  1PIX A;  3L37 A;  3U59 A;  2OYH C;  2PGD A;  2D2C C;  2JO1 A;  1PP9 D;  3L74 J;  1NTK J;  2OTJ P;  2NPS D;  1URQ A;  3RBZ A;  3VN0 A;  1YQ4 C;  3L4F A;  5KLV K;  4GT1 A;  4UB6 E;  1DD3 A;  2E75 D;  1SQP D;  1JOC A;  1HJ0 A;  1ZR4 A;  3ITK A;  1NAY A;  1ZP0 C;  1MFT A;  4KJM A;  4H44 C;  3A0B H;  1NTZ G;  1LT9 B;  1FDM A;  5CCG D;  3GF3 A;  1L4A C;  3RL0 B;  1J1D B;  1AVY A;  2ITA A;  3H1K G;  3FWL A;  3Q5R A;  4Z1M H;  4UB8 H;  1NU1 G;  1SQX K;  1EQ7 A;  3U1C A;  2R5B A;  2OGU A;  3M06 A;  2GUV A;  3A0H E;  3IFM A;  4B86 A;  1NTZ J;  4BRY A;  3M9B A;  3CCE P;  2RN0 A;  5H2F E;  2GM4 A;  1VQM P;  3H1H G;  1GW4 A;  2KIK A;  1LTA C;  2B88 A;  3LIE A;  5AW9 B;  1KMI Z;  2IBZ D;  1NU1 J;  3LW5 J;  1Q7Y Q;  3GW6 A;  3SWF A;  1KIL B;  1NTM E;  2ZXE B;  4HKZ H;  1SQQ D;  1KQF B;  5CJ4 A;  1IK7 A;  1FZB A;  4GOF A;  1OVU A;  3TDK A;  4R4M A;  3H1H J;  3V2Q A;  1LT9 A;  1ZRT E;  4L76 A;  3KYQ A;  2O1K A;  2K9J B;  3SWY A;  4U3F E;  2LR2 A;  3KZI H;  1LTT C;  2QJY C;  3B4S A;  2WSC J;  3L74 D;  4ASW A;  1M90 Q;  2KB7 P;  1SFC B;  1HGV A;  2Q7C A;  3EQ2 A;  5KLI B;  2OYH B;  3H1J G;  4OGQ C;  5KJ7 D;  5BU5 A;  2JWD A;  3RK3 C;  2Z4E A;  2MJZ A;  1D7M A;  3HUS B;  3TK1 A;  2AXT E;  1JTH A;  3G9R A;  2N1T D;  3RBX A;  3M0D A;  1HGZ A;  3D71 A;  2O1J A;  1S2E A;  3E1I A;  1KIL A;  2E76 C;  3GLM A;  2FXO A;  1P84 D;  2FYU E;  4EOT A;  3H1J J;  3MZW B;  4JF7 A;  5AW5 B;  1YTZ T;  2JJL A;  3SFD C;  1NTZ D;  1LGH B;  3A7O A;  2KSE A;  5GTI H;  1LWU C;  2KOG A;  1RF0 A;  2IPP A;  1KN7 A;  1N73 B;  4I6M C;  1SFC A;  3L72 G;  2WSE H;  1SQB G;  2JKV A;  3PRJ A;  3K5B A;  3B5N D;  2W27 A;  2B87 B;  1KQG B;  2D2C D;  3H1I E;  3LID A;  2C9N Y;  1ZOY C;  4I2L C;  3A2A A;  1DD4 A;  3CC4 P;  1MKM A;  3W67 A;  3L73 G;  3JSV C;  2J5U A;  1GD2 E;  1IFM A;  4IL6 E;  3HUS A;  3WMM 0;  2QIW A;  5DJU B;  1SQB J;  1GW3 A;  4H44 D;  1BCC E;  1G1J A;  1JY2 O;  2WIT A;  3H1L D;  2Y0C A;  1JY3 N;  1L4A D;  1OZH A;  2M0B A;  3L73 J;  2FY8 A;  1A02 J;  2AEF A;  3S1K A;  3CI9 A;  2G3A A;  1FC2 C;  1Q81 Q;  1L0N E;  2Q3I A;  5CJ0 A;  1YQ3 C;  3VMX A;  3BVH A;  1PV3 A;  2ZXX A;  1IFN A;  1N73 A;  2IX7 C;  2J59 M;  1FZC B;  4KT0 J;  2B87 A;  1U57 A;  2Q9I A;  1GL2 B;  2I1K A;  2PRR A;  1HUC A;  1KYO I;  1K9M Q;  2UWJ E;  4JQ0 D;  2NPS C;  4LGD E;  3F5H A;  2ZAE B;  3KDP B;  3RK2 B;  5BVZ A;  4M3L A;  4BWN A;  2CPS A;  1P84 H;  3T97 B;  2Q6Q A;  2QRX A;  1X22 A;  2FXM A;  5KLV G;  4HJG H;  3L75 G;  4PD4 I;  2QM7 A;  5AVS B;  1IFD A;  1VQ5 P;  1BGY G;  4HH2 A;  3L71 E;  3Q3D A;  1M1J B;  5CCG C;  2O3J A;  1YJW P;  2JDI H;  1KFN A;  1EZV G;  1LWU B;  1NTM K;  3GHG C;  1KYO E;  1M1K Q;  3VMA A;  2BCC E;  3LW5 H;  1VF5 D;  4JBZ A;  3FXE A;  5KAF H;  5KLV J;  4KHX A;  1RQV A;  1FZC A;  1J1E B;  4L74 A;  1PP9 G;  4OGQ D;  3U1A A;  3MIW A;  3RK3 D;  1GL2 A;  3CWB J;  1H88 A;  5CCH A;  4PD4 E;  3D6Y A;  1BE3 D;  3L73 D;  3NFQ A;  2N9B A;  2WZ7 A;  2C0X A;  2E76 D;  2P58 A;  1SQX J;  3T97 A;  1PP9 J;  2XDJ A;  3A5T A;  3L70 D;  1ZR2 A;  4AQR D;  2OYI B;  1PPJ E;  1SQV E;  1IFP A;  4I7Z C;  5H2F H;  2YKP A;  5AVX B;  3VTP C;  1GTW A;  2KSJ A;  1M1J A;  3M91 A;  4H0L C;  2M5A B;  1YHQ P;  1BSN A;  3L35 A;  1N7S D;  2FYU K;  2W90 A;  2QJP C;  5APT A;  3WUT A;  1HBW A;  2IDB A;  1N7L A;  2XKM A;  3KQG A;  5AW0 B;  2H43 A;  4EI2 A;  2POH A;  1VQK P;  2XND H;  2ZJS E;  5GTH H;  1VPC A;  5K5G B;  2IBZ G;  1VQ6 P;  2YXR B;  3NMD A;  2WPR A;  1L0L E;  1E79 H;  4NPD A;  4N78 E; 
#chains in the Genus database with same CATH homology
 3M9B A;  4C7N B;  1JY2 N;  1SFC D;  3H32 A;  2GM4 A;  1IJD B;  1GU4 A;  3BRT B;  1GW4 A;  3HE4 B;  1LTA C;  3LIE A;  5AW9 B;  2OYI A;  5AVR B;  3II6 A;  2M3B A;  1J1E C;  1LTB C;  1CSB A;  2WWW A;  1N86 A;  2YKO A;  3SWF A;  3UIA A;  1KIL B;  2IFM A;  4Y99 B;  2ZXE B;  5AW6 B;  1FOS F;  1FAV A;  1QL2 A;  1IFI A;  4C7R A;  3VP9 A;  2L5G B;  1MFZ A;  1T3J A;  2KLV A;  5CJ4 A;  1FZB A;  4WY4 D;  1LT9 A;  3V2Q A;  2Z5I A;  3KYQ A;  2O1K A;  1NTZ K;  1IFJ A;  1XTG B;  3TSI A;  1RE4 A;  3SWY A;  1S9K D;  1RF1 B;  2E43 A;  1CW5 A;  4OH8 B;  3HD7 A;  1CI6 B;  1G2C B;  1LTT C;  3B8E B;  4XE5 B;  2OAR A;  2KYV A;  2OYI C;  1ZN5 A;  3CLQ A;  1LTI C;  1L0N K;  3VP8 A;  2KB7 P;  1SFC B;  1HGV A;  2WT7 A;  4WBA A;  3RK2 D;  2Q7C A;  4C46 A;  4RES B;  3VOP A;  2R32 A;  1MV8 A;  3EQ2 A;  5AW8 B;  4DZO A;  2OYH B;  5KJ7 D;  5BU5 A;  4C7N A;  1H8A A;  3V4W A;  3RK3 C;  2Z4E A;  2MJZ A;  1LT9 C;  1LWU A;  3R2P A;  1FOS E;  2W6A A;  3HUS B;  3TK1 A;  1FZA A;  2J58 A;  3HE4 A;  1JTH A;  2H8P D;  3NTN A;  5APU A;  4IFM A;  1RE4 C;  2N1T D;  3V2P A;  1GZL A;  1T3U A;  3M0D A;  2P2U A;  1HGZ A;  3RL0 C;  2O1J A;  1J1D C;  1SQB K;  2WTY A;  4WY4 B;  2C9L Y;  3E1I A;  2QM8 A;  1ZV8 A;  1KIL A;  4N3Y B;  1HJB A;  2C0W A;  3H6P A;  3V5B A;  1ZLL A;  4EOT A;  1HWT C;  4JF7 A;  4W80 A;  3I5C A;  5AW5 B;  1YTZ T;  2R5D A;  1JCD A;  5AVV B;  3OA7 A;  2JJL A;  3O8Z A;  5APS A;  3N4X A;  2NPS B;  2Z5H A;  1S9K E;  3EFG A;  1LGH B;  3A7O A;  1JY2 P;  1IC2 A;  3M0A A;  1RF1 A;  4JYB A;  1WT6 A;  1CI6 A;  1LWU C;  2KOG A;  1RF0 A;  2IPP A;  1G2C A;  2YMY A;  2R3C A;  1FJP A;  2WPS A;  1N73 B;  1J2J B;  1NKZ B;  3M0D C;  4I6M C;  1JMM A;  1SFC A;  2WSE H;  5KTB A;  1OXZ A;  3B5N D;  2P7J A;  2W27 A;  2HFE D;  3VMY A;  2YNY A;  1N2D C;  1N7S B;  1KIL C;  2I1J A;  5BU8 B;  3MGN A;  4Y99 C;  3LID A;  2N1T B;  2C9N Y;  1NHL A;  2XU6 A;  4I2L C;  1GU5 A;  2XV5 A;  1FJK A;  3A2A A;  1XTC C;  5APW A;  1SP4 A;  4IFF A;  1T2K C;  2GUS A;  3GHG B;  3CL3 D;  2FFD B;  1GD2 E;  1IFM A;  3HUS A;  1GL2 D;  1YYC A;  2A45 G;  2XZR A;  1OWA A;  5APQ A;  3VYI A;  4LC1 A;  4JYC A;  3WMM 0;  1RF1 C;  1DH3 A;  5CCH D;  1RF0 C;  1LTS C;  5AW1 B;  1GW3 A;  4W7Y A;  4N6J A;  4WY4 A;  4GKG A;  1G1J A;  1NKN A;  1QL1 A;  1W2E A;  1JY2 O;  2WIT A;  1H89 A;  1RE3 A;  3NXS A;  1X79 B;  3BAS A;  1JY3 N;  1L4A D;  3OAK A;  1SQV K;  4IFD K;  1A02 J;  3MTU E;  2NPS A;  3HE5 A;  1URQ D;  2WSC H;  4LLH A;  3B5N B;  2E42 A;  1MUU A;  3CI9 A;  2BAS A;  2PP6 A;  2HLO A;  2Q3I A;  5CJ0 A;  3L36 A;  3OJA B;  3VMX A;  3BVH A;  3HUS C;  1A02 F;  1IFN A;  2HYN A;  1N73 A;  1SLQ A;  2IX7 C;  2J59 M;  5KJ7 A;  5AW2 B;  2H7H A;  1FZC B;  1WRG A;  3HD7 C;  5AVU B;  5AW4 B;  4W7Z A;  2XNX A;  4WY4 C;  1GK4 A;  4I1L A;  1LTJ B;  3BAT A;  2HPC B;  2Q9I A;  1GL2 B;  1N7S A;  4HYT B;  3PP5 A;  3P8C D;  4AYC A;  2N1T A;  2I1K A;  4XA4 A;  5AVT B;  1HUC A;  1HH0 A;  3V2R A;  5CCG A;  2FKW B;  1RE3 C;  1VDF A;  3HRN A;  3KPE A;  2P67 A;  5AW3 B;  5AW7 B;  1HTL C;  3GHG A;  3IR9 A;  2LKM A;  1DX7 A;  3P32 A;  4EIJ A;  1MZ9 A;  2NPS C;  2FFD A;  3BRV B;  1FU1 A;  1L0L K;  4LGD E;  1GDT A;  2HG5 D;  1NH4 A;  3P8M C;  3KDP B;  3RK2 B;  1L4A B;  5AVY B;  4M3L A;  5BVZ A;  2CPS A;  1PFI A;  1RY3 A;  2YO2 A;  1JO5 A;  1NOH A;  1N73 C;  1URQ B;  2FXM A;  1NTK K;  1GK6 A;  5KJ7 C;  1LTG C;  1NWQ A;  2IFN A;  2QM7 A;  1FZF A;  4ZKP A;  4WB4 A;  5AVS B;  1FBM A;  1IFD A;  1M7L A;  1N7S C;  2JEE A;  4HH2 A;  5APY A;  2N1T C;  1AFO A;  2W6B A;  1SQP K;  1FZE A;  1M1J B;  5CCG C;  1JCC A;  2YO3 A;  1KFN A;  3MD0 A;  3B5N A;  3TNU B;  3GHG C;  1LWU B;  1NTM K;  4AUW A;  1NAF A;  2OYH A;  1FZG A;  1JTH B;  1X9V A;  4O9B A;  2FFD C;  3LW5 H;  3V4Q A;  3P7K A;  1KFM A;  4KHX A;  3VMZ A;  2FYZ A;  1FZC A;  1J1E B;  1YTZ I;  3U1A A;  2WPQ A;  3P8C E;  1LTJ A;  3MIW A;  3N7N A;  3RK3 D;  3HTK B;  3C9I A;  2HPC A;  1GL2 A;  3TYY A;  5APV A;  2ZFC A;  5CMZ A;  1KQL A;  2P1J A;  1H88 A;  1SFC C;  5CCH A;  4DOJ A;  5AVW B;  5AVQ B;  3HD7 D;  3RL0 D;  2HOD B;  1JY3 P;  1HVV A;  1AQ5 A;  4N78 D;  2O01 H;  1T8Z A;  1KZU B;  3NFQ A;  3B5N C;  2N9B A;  3H32 B;  2WZ7 A;  3L37 A;  3U59 A;  2OYH C;  2C0X A;  1L4A A;  5CHX A;  3T97 A;  2XDJ A;  3A5T A;  1ZR2 A;  4AQR D;  2OYI B;  2NPS D;  1URQ A;  3VN0 A;  1X8Y A;  3G3Z A;  1FZC C;  1NU1 K;  3M9Q A;  3L4F A;  5KLV K;  4ZKU A;  2A45 H;  4GT1 A;  1LTJ C;  1GL2 C;  1JOC A;  2YKP A;  2A45 I;  1DEB A;  1JUN A;  1ZR4 A;  2PAJ A;  4GIF A;  5AVX B;  3VTP C;  1GTW A;  3A3Y B;  2KSJ A;  1M1J A;  5CCH C;  3M91 A;  1CZQ A;  1E5W A;  3MUD A;  2YKQ A;  3TNU A;  1SQQ K;  1NO4 A;  3L35 A;  3RK3 B;  1SVF A;  2Q5U A;  1N7S D;  2FYU K;  1LT9 B;  1FDM A;  5APT A;  2CPB A;  2WSF H;  1HBW A;  1JNM A;  1KIL D;  2M8R A;  1N7L A;  5APX A;  2XKM A;  5CCG D;  3KQG A;  1IO4 A;  3HD7 B;  5AW0 B;  3RK2 C;  1IK9 A;  1L4A C;  2H43 A;  3RL0 B;  2POH A;  1G1I A;  1J1D B;  1JY3 O;  1T2K D;  3M9H A;  1URQ C;  3HTK A;  1SQX K;  1VPC A;  2VRS A;  1EQ7 A;  3V2N A;  2WT7 B;  5AVZ B;  3U1C A;  2R5B A;  3NMD A;  3M06 A;  2GUV A;  2WPR A;  1Z56 A;  4N78 E;  3HE5 B;  2HOD A;  3IFM A;  4B86 A;  1M1J C;  2KP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...