4C7NA

Crystal structure of the synthetic peptide im10 in complex with the coiled-coil region of mitf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
SSVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MICROPHTHALMIA ASSOCIATED TRANSCRIPTION FACTOR
publication title Improving Coiled Coil Stability While Maintaining Specificity by a Bacterial Hitchhiker Selection System.
pubmed doi rcsb
molecule tags Transcription
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4c7nA00
2KP8A 5AVWB 3V5BA 1GTWA 3HE4A 1HUCA 2WWWA 3HE5A 5APVA 3B8EB 4B86A 1CI6B 3P8MC 4JYBA 3TNUA 2XV5A 3SWFA 2YO2A 2Q3IA 1OWAA 3UIAA 2WT7A 5AVZB 4C7NA 3L37A 2YO3A 2XZRA 5CMZA 3A5TA 5APQA 1KQLA 2E42A 2P67A 2N9BA 5AW5B 2R5BA 5AVTB 1DH3A 3I5CA 4JYCA 3L35A 3A3YB 2W27A 3KQGA 5AVSB 3M06A 3VMYA 3V4QA 3P7KA 5AVRB 3M9BA 3LIEA 1S9KE 4GT1A 3IR9A 1H88A 5APSA 4RESB 4AUWA 1MUUA 2QM7A 2R3CA 2R32A 1MV8A 3M9HA 5AW6B 2R5DA 3V4WA 1OXZA 1SLQA 3NMDA 5APUA 2C9LY 1FAVA 3M91A 5APWA 3VN0A 5AW3B 5AVYB 4AQRD 3A7OA 2ZFCA 1CI6A 3TYYA 3OAKA 3P32A 3A2AA 1CSBA 2P7JA 4KHXA 5AW8B 2P2UA 2H7HA 2XU6A 4C46A 2WTYA 1GK6A 3NFQA 2YNYA 3VMXA 1T2KC 5AVXB 4EOTA 5AW7B 1T2KD 3M0AA 4I2LC 5AW4B 5APTA 3NXSA 5AVUB 1A02J 3LIDA 1FOSF 5AW9B 3MD0A 3NTNA 2IPPA 1H8AA 4DZOA 1GU4A 3HE5B 1JNMA 1HJBA 1NWQA 4LC1A 4GKGA 3VTPC 2VRSA 1NAFA 1FOSE 2E43A 2WPSA 1HWTC 1IO4A 5AW0B 1J2JB 5AW2B 5AVQB 2WT7B 1GD2E 4C7NB 3L36A 1YYCA 2Z5IA 4XE5B 1A02F 2C9NY 2WPRA 3HTKA 4HYTB 1H89A 1SP4A 1CZQA 2Z5HA 3M0DA 4AYCA 5AW1B 4M3LA 3VMZA 1JUNA 1GU5A 3O8ZA 3VYIA 3KDPB 1X8YA 3T97A 5APXA 1HBWA 1GK4A 2Q7CA 3TK1A 2W6AA 3HE4B 1S9KD 1GZLA 2Q5UA 3MGNA 3TNUB 1MFZA 5AVVB 2ZXEB 2BASA 2JJLA 5APYA 2QM8A 1G2CB 2WPQA 4I6MC
chains in the Genus database with same CATH superfamily
1PP9E 1YJWP 2HODA 2NPSA 3H1HD 3GHGC 2JR8A 1LTJC 3B4SA 1OVUA 1LT1A 3CCRP 1L0NJ 2AXTE 1EZVE 1DH3A 1U57A 3V2QA 2RKLA 2XKMA 4OGQB 5AVSB 5KLVG 4IOIH 1MZ9A 1AQTA 1KYOH 1MV8A 1VQKP 3BVHA 3L72J 3AE5C 1KILB 1NVOA 3VP8A 1L0NE 5AVYB 1RE4C 2QJYC 1PGPA 1CI6A 2LR2A 1IK9A 1XTCC 1VQLP 1KN7A 1CSBA 2WQYC 1XTGB 3BATA 1EZVD 4H44B 3F89A 1RQVA 5APTA 2WSEH 5AVUB 1Q82Q 3L72E 1RY3A 1QLED 3D6YA 1Z56A 2VRSA 4TLFA 4YTPC 3H1HG 3JSVC 4H13C 1IFMA 2GUSA 2B9BA 3TDKA 1Q81Q 1L0LJ 1LT9C 2PRRA 3LW5J 2FYUJ 4Y99C 3W67A 4AYCA 2OYHB 1JY3P 1AJYA 3CXHH 3AE3C 1S9KD 3AEEC 3H25A 1PP9G 1VQPP 1L0LE 2JJLA 3TGUJ 1BGYD 3L71J 1SFCB 2Z4EA 1GTWA 2FYUE 1Y47A 3M0DC 2KLVA 2FFDB 1GW4A 1BCCJ 1EZVG 4IFMA 1SFCA 1LTJA 2M0BA 1QEXA 2R5BA 4HJGH 2FFDA 5GTIE 2L5GB 3TGUE 4GOFA 3L71E 1VQ9P 3VMYA 3BASA 4RESB 1RF1B 1J1DB 1BCCE 2KSEA 2ZFCA 1RE4A 1RF1A 1J1EB 1P84I 2H7HA 1S5LH 3WU2H 5AVXB 1T2KC 4D6TD 5AW4B 2KOGA 2WSFH 2OGUA 2OYOA 4L75A 3OA7A 4K3AA 3H1JJ 4OH8B 3SWKA 1HJBA 5KJ7D 1VF5C 1NAYA 1JM0A 1FOSE 2CPBA 1VQ4P 1HWTC 2MJZA 1JY3N 3IAOA 3II6A 1R5SA 5KKZC 1LT9A 4PD4E 2GM4A 2W8ZA 3R2PA 1NJIQ 5TJHA 4WY4D 1GU5A 5B5EE 5CCGD 2OTJP 3C1LA 3H1JE 1MFTA 5APXA 2KS1A 1RH5B 1PL5A 2FYUG 2A06E 1UIXA 2E75D 3RK3C 3GW6A 5C39A 4BXLA 2OYIB 4H0LB 5DJTB 3EQ2A 2QVAA 1NKZB 3L4FA 4D6TG 1L2PA 3JC22 1KYOE 3L71G 4DJGA 2AEMA 2ZYGA 4L73A 2H88C 3P7KA 2W6JH 2FBWC 4L74A 3H1IJ 1OIPA 3L73J 1Y9BA 1FAVA 4Y28J 1JEKA 1NU1J 2YMYA 1R8EA 3BRTB 2IYPA 2ZT9C 1LWUC 2HPCB 4KHXA 1FBMA 4JQ0D 2RMZA 3H1IE 3M0AA 3L73E 1USEA 5AW9B 1L4AD 1HH0A 1NU1E 2JDIH 5KKZB 4UB6E 1ZR2A 3HTKB 2E76D 3CXHE 4XA4A 3CD6P 3CMEP 1P84H 1KZUB 3EFFK 3H1KD 2SPZA 3CLQA 1BDDA 2M3BA 3HTKA 4HYTB 2OARA 4N6JA 3CX5H 3TSIA 3D6ZA 1X8YA 2J5UA 1NTZK 5CCHD 1R5LA 1HGVA 1DIPA 3L73D 4Z1MH 1SQXK 3QH9A 2ZYAA 3P8CE 4B86A 1EDJA 5CJ4A 1N7SD 4KT0J 2ZVOB 4C7NA 1M56D 1HJ0A 5APQA 1PPJE 1M1KQ 1FZEA 2DW3A 2LXBA 1SQQK 3PHLA 5AVRB 2E76B 1AVYA 3LIEA 3H1KG 5KLIC 3H1LJ 3MUDC 2QJKB 3M9HA 3VOPA 3WU2E 3CCVP 1G2CA 2A45I 2M5AB 2R44A 1D7MA 3USSA 2P58A 3WUUA 3H1IG 3Q1MA 3L73G 1LWUA 3P32A 2E74C 2M5AA 4GOEA 3ZDMA 4QMAA 1AA0A 3H1LE 1E5WA 1YBKA 1DEEG 2N1TD 3RL0D 3S1KA 2ZJSE 2AXTH 1PFIA 3Q5PA 1SQBD 1NTMK 4ZKPA 3U1AA 2ZYDA 1CW5A 1ZMEC 2QE7H 3D70A 4WB4A 5KTBA 1M7LA 3HE4B 3TK1A 1GZLA 1IFIA 3AEFC 2QRXA 1SQPD 2BASA 2ITAA 2WPQA 3HE4A 3HE5A 4DOJA 3RK2C 4EI2A 1FU1A 2WZ7A 1KQSO 4U3FJ 5L8RJ 5KLIB 1Q7YQ 2FKWB 1FE6A 1SQBG 2Y9YA 1VDFA 3L74D 3IR9A 5B66H 3JCUH 4AUWA 3MUDA 2H8PD 3AEBC 2C9LY 4U3FE 1K05A 3A0HH 1S1CX 2K9JB 1WT6A 1YQ4C 4IL6X 1IZNB 1P84E 1FZGA 2FXOA 2JKVA 1FOSF 2J59M 4OGQC 3CX5E 4EYYQ 3CCSP 1NAFA 3L75D 3MHVA 3R4YA 2WITA 2GA1A 5AVQB 2POHA 4U3FD 3ABVC 1KILC 1YJNP 1N8RQ 1SP4A 3H6PA 4JF7A 1K9MQ 1KILE 4H44C 2J58A 2D2CD 5AVVB 1SQVK 1X0TA 2KI7B 4RJTA 3PP5A 2ZVNB 2JO1A 1LTSC 2JWAA 2YO3A 4YXWH 1KB9H 3AEGC 2W83C 1YJ9P 2Y9ZA 1VQ8P 2QA4P 3L70J 1FZFA 2OYHC 5AVTB 2RH0A 2WSCJ 4U3FG 3CC7P 5B5EH 3CCUP 2R3CA 1SFCC 3FWLA 1JOCA 1LTIC 4N78E 1VQ7P 3L70E 3KXDA 3OW2O 2AEJA 2FFDC 3OAKA 3AE8C 1FZBA 2FY8A 3Q5RA 3AE1C 2Y0EA 1PP9D 3CWBJ 1H8AA 5KLVK 1T8ZA 1RF1C 1J1DC 1J2JB 4NPDA 2WT7B 4W80A 1AFOA 3L36A 2HG5D 3G6EP 1IFPA 3L70D 1FDIA 3HUSB 1KILA 4OVNF 1KQGB 1EDKA 4JPZB 1X22A 3KDPB 1J1EC 1K04A 2XNDH 2FXMA 1FJKA 2ZAEB 1JB0J 2CK3H 1L0ND 5DJUB 3HD7D 2Q3IA 2C0WA 4UB6H 5B66E 2H43A 3JCUE 2O3JA 1BSNA 1LTGC 1YITP 1PGOA 3L72D 1IFJA 3A0HE 2OYHA 3GF3A 3BRVB 2H89C 3L70G 2R5DA 3NMDA 3U59A 1RE3C 2C0XA 2OYIC 4H0LC 1KV4A 4H13D 2OTKE 4JBZA 5KAIH 3N4XA 1M1JB 2G8YA 2QIWA 1X9VA 2WTYA 3G4SP 1L0LD 1L0NG 2OQQA 3NTNA 1GU4A 2FYUD 1IO4A 5CJ0A 3CCMP 2YIUB 3L72G 1K73Q 2I1KA 3TGUD 4W7YA 4WY4C 3L71D 1G1JA 2UWJE 2Q5UA 1LTAC 1KB9E 1BCCD 1OW7A 1S3JA 1IK7A 4DCKA 2N9YB 4R4LA 1OWAA 4EDFA 2B88A 2B89A 2PGDA 1L0LG 3AE6C 3Q3DA 1SQXJ 1URQD 1N86A 3N7NA 4JYCA 3CCJP 1ZRTE 2L91A 3V6IA 5E79E 1IC2A 4GT1A 1H0TB 2QM7A 2I1JA 2R32A 3V4WA 2IBZE 2YKPA 3RK3E 3TGUG 1RE3A 4PD4D 1N73B 1VF5D 1S4XA 2OYIA 4AQRD 1SQXE 1YIJP 3A0BH 1SQQJ 3CPWO 3H1JD 2P7JA 1BCCG 1KD1Q 1PGJA 1N73A 1USDA 3AE7C 2A06D 3LIDA 2OTLP 2CPSA 1W5CE 2PFXA 3BCCJ 2AEFA 2E76C 1T3UA 2IBZD 2QJKC 4W7ZA 4WY4B 2JEEA 3RK3D 1KYOD 2AXCA 4YPCA 1CZQA 1ZW0A 1OZHA 4WY4A 4DT0A 2HPCA 2E75B 3GF7A 1NTMJ 1EZVI 1JY2O 3ITKA 1S72P 1MFZA 3FXDA 2JP3A 1ZLLA 5AVWB 3PH0A 3C8VA 3H1JG 1AV1A 4JYBA 2YO2A 3B5ND 5TISH 2YXQB 4PV1D 1NTME 2A06G 3FWNA 4WWIA 3H1ID 1PGQA 2ZT9D 1E79H 4C7RA 2KYVA 1OFCX 1NU1D 3V4QA 3CCEP 2IBZG 5KAIE 1FDOA 5KAFH 2HR3A 2JWDA 3CXHD 3KYQA 3KHUA 1MUUA 5AW6B 1Q2NA 1SQXG 5BU8B 1VPCA 2KK7A 3M91A 3A7OA 3TYYA 1N7LA 2Q3EA 1L4AB 2XU6A 4C46A 1KFNA 2W90A 2YNYA 4LLHA 4RO0A 2IPPA 4I1LA 4DZOA 2IDBA 3P8CD 4LC1A 3VTPC 1SVFA 2E43A 3B5NB 1GD2E 2Z5IA 2P10A 3MTUE 4OWFA 1PPJD 4A7PA 1NU1G 1KTMA 1N2DC 3VMZA 1X79B 5CCHA 2WPVB 1JY2P 4HH2A 2WSCH 1N7SB 5APYA 1ZOYC 2KZIA 2ZXXA 2Q1KA 5APVA 3SWYA 1BE3J 3E1IA 4ZKUA 1JMBA 1T3JA 3L37A 3CI9A 4IFFA 2BCCJ 1SQVJ 3H1LD 4O9BA 2N9BA 1DX7A 1OW6A 3CMAP 2K9YA 1GL2D 3M06A 3A0BE 3O6QB 1VQ5P 2PP6A 2KUBA 1PPJG 3AEDC 3FXEA 2K37A 2BCCE 3O6QA 2E5TA 1SQVE 2MKVA 3Q5SA 1JCCA 3K5BA 2PAJA 2N1TB 3A2AA 3RL0B 4ASWA 4PD4I 3NFQA 3VMXA 2YKOA 3TF5A 1A02J 2KLUA 4IL6H 5CBOA 2WVRA 1S2EA 1SQBK 2WPSA 2YKQA 3H1LG 1YTZI 4MN4C 3T97B 1OMIA 1JY2N 3RK2D 3IF4A 1VQ6P 2K9JA 2A45H 1ZXGA 5KLVJ 2B87B 3T97A 1GL2B 1SQPK 1GK4A 5TISE 4KJMA 3QWOC 1NOHA 3V2PA 2IFMA 1HUCA 2WWWA 3B8EB 3KPEA 2NPSD 3AE2C 5KAFE 2LXCB 4NPEA 1P84D 3CCQP 4BRYB 3HUSC 1NTKK 2K1AA 3G3ZA 5H2FH 3CC2P 1LP1B 3CX5D 4BRYA 3H1HJ 3KZIH 1SQVG 5APSA 2Y0DA 1DD4A 2M3EA 4OGQD 1JO5A 3CXHI 5APWA 5AW3B 4HB1A 2BEQD 3RBXA 1VL2A 1FDMA 2K3RA 2V4HA 3H1HE 3RBZA 1KILD 1AQ5A 1GK6A 2NRGA 1FZCB 1EQ7A 1HVVA 1W2BO 2I8DA 1KC8Q 5EFWB 1FC2C 1NWQA 3W68A 4H44D 2HODB 2NPSB 1U7JA 1KFMA 2HYNA 3PTZA 3WMM0 4U7JA 1YYCA 5E79H 1LJ2A 2C9NY 3V2NA 2D2CB 3OJAB 1Q86Q 1M1JC 3FX0A 1VQNP 4GDOA 1PV3A 5GTHH 3AE9C 3SFEC 2WSSH 2KP8A 4N78D 3HD7C 1ZN5A 3Q2YA 1CI6B 2XV5A 2W6BA 2YMKA 1WMKA 2WT7A 2YIUC 1SFCD 1QGKB 3A5TA 1EC5A 3CWBE 5CMZA 2FYNB 1BGYJ 2V7QH 3HUSA 3VP9A 1YTZT 2O01H 4L76A 2YXRB 1WRGA 2W27A 1DD3A 1S9KE 3MIWA 1H88A 2E5YA 1OX3A 1RF0C 1TU3F 2KNCB 3G71P 1QVGO 1BGYE 3EWKA 4IL6E 1OW8A 3AEAC 1GW3A 2KNCA 3CWBD 1G1IA 1JNMA 4GKGA 2KB7P 5AW0B 2O1KA 4D6TJ 4ASVA 3GHGB 1QVFO 1M57D 1N73C 1LTJB 5AW1B 4YXDC 4M3LA 3GLMA 1NO4A 1DEBA 1M1JA 3GHGA 5KJ7C 3HD7B 2HFED 4D6TE 5CBNA 1L0NK 4I6MC 3V5BA 5H2FE 4RKUJ 3CWBG 5CHXA 3HD7A 1OVVA 2QJYB 1QL1A 4GIFA 3E7KA 5AVZB 3KZIE 5CCGC 3G9RA 3SSUA 2E42A 4H0LD 3C9IA 2P67A 1URQC 3I5CA 2E75C 3KQGA 2IZ1A 3WUVA 1BGYG 3I56P 4H13B 1NTZJ 1RF0A 2XNXA 1OXZA 3CX5I 1FZAA 5APUA 1LT9B 3VN0A 1S5LX 4Y99B 3GMAA 2Q9IA 1ZV8A 2KS1B 1L0LK 1IJDB 1KB9D 1T2KD 4I2LC 2A45G 1NTZE 4XFJA 3VMAA 2FYUK 1YQ3C 2QG4A 1EDIA 1H0TA 2WMMA 2V7QJ 2QJPC 1A02F 5GTHE 3PRJA 1Y8AA 3CCLP 2O01J 3M0DA 1NH4A 2QSIA 1Q90D 1EXJA 1EDLA 1ZRTD 3S4RA 1L4AC 4EIJA 1HBWA 2WSEJ 3H1KJ 1KORA 1NTZD 3SFDC 5KJ7A 1SQQE 3EFGA 1SQXD 3FGAD 3B5NC 1URQB 3UIAA 1M90Q 4PV1C 3AECC 5CCGA 3H1KE 3BCCE 5CCHC 1MKMA 2RN0A 1URQA 1SS1A 3L35A 4GODA 1VF5B 1SQQD 1PIXA 1HGZA 3IN6A 1N7SC 3MP7B 3CC4P 3IFMA 4IFDK 2IFNA 2K88A 1EXIA 1NKNA 2O1JA 4PJ0H 1KQFB 1NTZG 3BCCD 1HF9A 5AW8B 1FS0E 4EOTA 3PLNA 3NXSA 4UB8H 1KMIZ 1JTHB 3MD0A 3RK3B 2R3SA 2QJPB 4R4MA 3S9OA 1JCDA 2P1JA 3RGUA 5AW2B 4C7NB 1JTHA 4XE5B 1NTMD 2GUVA 4K35A 1W2EA 2IX7C 3I55P 1SQQG 1SQBJ 2N1TC 1LTTC 3RL0C 2HLOA 2WSFJ 1L4AA 2W6AA 3RL0g 1M8OB 3MZWB 2QM8A 1G2CB 1VQOP 4PV1B 3BCCG 3P8MC 2ZT9B 1S5LE 1SQPJ 1SQBE 1LWUB 3B5NA 4WVZA 1BDCA 1KQLA 1U7MA 2Y0CA 1NU1K 5K5GB 4TT3H 3A3YB 3HRNA 1GL2C 3D71A 1NTMG 1SQPE 1NTKJ 1GDTA 1N7SA 5M1BA 2O01N 2BEZF 4N3YB 2Q6QA 3L74J 1PZQA 3H32B 2E74D 2P2UA 1GMJA 1BE3E 1OVRA 1NTKE 3H32A 2LKMA 1T6AA 4ZNCA 3HE5B 1KB9I 3PJSK 3L74E 3V2RA 1AVOA 2QEXP 2WPRA 1LTBC 1IFDA 2Z5HA 3L75J 1JUNA 3O8ZA 2N1TA 2M8RA 3M9QA 2Q7CA 1BE3D 1K8AQ 1FZCC 3AE4C 1NTKD 3TNUB 4BWNA 2ZXEB 1QL2A 2KZJA 2FYZA 2BCCD 2KIKA 1SQVD 1HTLC 4I7ZC 2NPSC 3L75E 3TNUA 2IYOA 3SWFA 2IBZI 2E74B 1KYOI 2XZRA 3B71A 2NZ2A 2D2CC 5AW5B 2IZ0A 1JMMA 3LW5H 1SQPG 2B87A 4PJ0E 1GL2A 4HKZH 3M9BA 3U1CA 1UIIA 1FJPA 1YHQP 2KXPB 1RQUA 5KLVE 1SLQA 2KSJA 1LGHB 2FXPA 5GTIH 4UB8E 2G3AA 4LGDE 1BE3G 1BSHA 1NGMB 1ZP0C 1NTKG 1QX8A 2FYNC 1IFNA 1VQMP 5AW7B 2BCCG 3L74G 1LP1A 3GG2A 1ZR4A 3WUTA 3RK2B 4NPFX 1RHZB 5KLVD 3CL3D 4ZMDA 3E1RA 5BVZA 1LNQA 1PP9J 1H89A 5BU5A 4CPGA 4WBAA 1JY3O 3VYIA 1NYHA 4I7ZB 1NHLA 1FZCA 3MGNA 1YI2P 3F5HA 3L75G 2XDJA 4PD4H
chains in the Genus database with same CATH topology
5AVWB 3V5BA 3HE4A 3HE5A 5CHXA 4DOJA 3HD7A 3RK2C 4JYBA 2HODA 2NPSA 1QL1A 2YO2A 4GIFA 3B5ND 1FU1A 5AVZB 2WZ7A 5CCGC 3GHGC 1LTJC 2E42A 3C9IA 2P67A 1URQC 1DH3A 3I5CA 3V2QA 2XKMA 4C7RA 2KYVA 2FKWB 3KQGA 5AVSB 3V4QA 3KYQA 1VDFA 1MZ9A 3IR9A 4AUWA 1MUUA 5AW6B 1MV8A 1RF0A 2XNXA 5BU8B 1VPCA 3MUDA 1OXZA 2H8PD 3BVHA 1FZAA 5APUA 2C9LY 1LT9B 3M91A 1KILB 3VN0A 3VP8A 5AVYB 1RE4C 3A7OA 1CI6A 3TYYA 4Y99B 1WT6A 1IK9A 1N7LA 1XTCC 2Q9IA 1ZV8A 1CSBA 1L4AB 2XU6A 4C46A 1FZGA 1KFNA 1XTGB 1L0LK 2YNYA 3BATA 1IJDB 4LLHA 1T2KD 4I2LC 5APTA 2A45G 2WSEH 5AVUB 1RY3A 1FOSF 2FYUK 2J59M 2IPPA 4I1LA 4DZOA 3P8CD 4LC1A 1Z56A 3VTPC 2VRSA 1NAFA 1SVFA 2E43A 2WITA 1IFMA 3B5NB 5AVQB 2GUSA 1GD2E 2POHA 2Z5IA 1A02F 1LT9C 1KILC 3MTUE 1SP4A 3M0DA 1NH4A 4Y99C 4AYCA 2OYHB 1N2DC 1JY3P 3VMZA 3H6PA 4JF7A 1X79B 1L4AC 4EIJA 1HBWA 5CCHA 1S9KD 1JY2P 2J58A 5KJ7A 4HH2A 5AVVB 2WSCH 1N7SB 1SQVK 2JJLA 5APYA 3EFGA 1SFCB 2Z4EA 3PP5A 1GTWA 5APVA 3SWYA 3M0DC 1LTSC 3B5NC 2KLVA 3E1IA 2FFDB 1GW4A 4ZKUA 1URQB 3UIAA 1T3JA 3L37A 2YO3A 4IFMA 1SFCA 3CI9A 5CCGA 5CCHC 4IFFA 1LTJA 4O9BA 2N9BA 1FZFA 1DX7A 2R5BA 2OYHC 5AVTB 2FFDA 2L5GB 1URQA 3L35A 3VMYA 1GL2D 3M06A 3BASA 2PP6A 1HGZA 4RESB 1RF1B 1J1DB 2R3CA 1N7SC 3IFMA 1SFCC 4IFDK 2IFNA 1JOCA 1LTIC 4N78E 1NKNA 2O1JA 2ZFCA 1RE4A 1JCCA 1RF1A 2FFDC 3OAKA 2PAJA 2N1TB 3A2AA 3RL0B 1J1EB 5AW8B 2H7HA 3NFQA 1FZBA 3VMXA 1T2KC 5AVXB 4EOTA 2YKOA 5AW4B 2KOGA 2WSFH 3NXSA 1A02J 1JTHB 3MD0A 3RK3B 3OA7A 4OH8B 1H8AA 1JCDA 1HJBA 5KJ7D 5KLVK 1SQBK 2P1JA 1FOSE 1T8ZA 2CPBA 2WPSA 1RF1C 1J1DC 1HWTC 5AW2B 1J2JB 2MJZA 1JY3N 2WT7B 2YKQA 4C7NB 4W80A 1AFOA 3L36A 1JTHA 1YTZI 2HG5D 3II6A 4XE5B 2GUVA 1LT9A 3HUSB 1KILA 1JY2N 1W2EA 2GM4A 3R2PA 3RK2D 2IX7C 4WY4D 1GU5A 2A45H 5CCGD 2N1TC 1LTTC 3KDPB 3RL0C 3T97A 1GL2B 1J1EC 5APXA 2HLOA 1SQPK 1GK4A 1L4AA 2W6AA 2QM8A 1NOHA 2FXMA 1FJKA 1G2CB 3RK3C 3V2PA 2IFMA 1HUCA 2WWWA 3HD7D 2OYIB 3B8EB 3EQ2A 3KPEA 2NPSD 3P8MC 2Q3IA 1NKZB 1LWUB 3B5NA 2C0WA 3L4FA 2H43A 3HUSC 1KQLA 1NTKK 1LTGC 3G3ZA 1IFJA 1NU1K 2OYHA 3A3YB 3HRNA 1GL2C 3BRVB 3P7KA 5APSA 2R5DA 1GDTA 1N7SA 3NMDA 3U59A 1JO5A 1RE3C 1FAVA 2C0XA 5APWA 2OYIC 5AW3B 2YMYA 4N3YB 3BRTB 1FDMA 1LWUC 2HPCB 3N4XA 1M1JB 3H32B 4KHXA 2P2UA 1KILD 1FBMA 1X9VA 2WTYA 1AQ5A 1GK6A 1FZCB 3M0AA 1EQ7A 1HVVA 5AW9B 3NTNA 1L4AD 3H32A 1HH0A 2LKMA 1GU4A 3HE5B 1ZR2A 3HTKB 1NWQA 2HODB 2NPSB 3V2RA 4XA4A 1IO4A 1KFMA 2HYNA 5CJ0A 3WMM0 1KZUB 1YYCA 2C9NY 2WPRA 3CLQA 2M3BA 3HTKA 4HYTB 1LTBC 2OARA 4N6JA 3V2NA 1IFDA 2I1KA 2Z5HA 3OJAB 4W7YA 4WY4C 1JUNA 3O8ZA 3TSIA 1M1JC 1X8YA 2N1TA 2M8RA 1G1JA 1NTZK 3M9QA 5CCHD 1HGVA 2Q7CA 1FZCC 2Q5UA 1LTAC 3TNUB 2ZXEB 1QL2A 2FYZA 1SQXK 1HTLC 2KP8A 4N78D 3HD7C 1ZN5A 3P8CE 4B86A 1CI6B 2NPSC 3TNUA 3SWFA 2XV5A 2W6BA 5CJ4A 1N7SD 1OWAA 2WT7A 4C7NA 1SFCD 2XZRA 5CMZA 3A5TA 5APQA 3HUSA 3VP9A 5AW5B 1FZEA 1URQD 1JMMA 3LW5H 1N86A 1YTZT 3N7NA 4JYCA 2O01H 1WRGA 2W27A 1SQQK 1GL2A 5AVRB 3M9BA 3U1CA 1IC2A 3LIEA 1S9KE 3MIWA 4GT1A 1H88A 1FJPA 1RF0C 2QM7A 2I1JA 2R32A 3M9HA 3V4WA 3VOPA 1SLQA 2YKPA 2KSJA 1G2CA 2A45I 1RE3A 1LGHB 1N73B 2OYIA 4AQRD 4LGDE 1GW3A 1LWUA 3P32A 2P7JA 1IFNA 1G1IA 1N73A 5AW7B 1E5WA 3LIDA 2N1TD 3RL0D 2CPSA 1PFIA 1JNMA 4GKGA 1ZR4A 3RK2B 2KB7P 5AW0B 1T3UA 1NTMK 2O1KA 3CL3D 4W7ZA 4WY4B 4ZKPA 2JEEA 3RK3D 5BVZA 3U1AA 1CW5A 3GHGB 1N73C 1LTJB 1H89A 5BU5A 1CZQA 5AW1B 4WBAA 1JY3O 4M3LA 4WY4A 3VYIA 4WB4A 2HPCA 5KTBA 1NO4A 1DEBA 3GHGA 1M1JA 1M7LA 3HE4B 3TK1A 1NHLA 1GZLA 1IFIA 5KJ7C 1FZCA 1JY2O 3HD7B 3MGNA 2HFED 1MFZA 2BASA 2XDJA 1L0NK 1ZLLA 2WPQA 4I6MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KP8 A;  5AVW B;  3V5B A;  1GTW A;  3HE4 A;  1HUC A;  2WWW A;  3HE5 A;  5APV A;  3B8E B;  4B86 A;  1CI6 B;  3P8M C;  4JYB A;  3TNU A;  2XV5 A;  3SWF A;  2YO2 A;  2Q3I A;  1OWA A;  3UIA A;  2WT7 A;  5AVZ B;  4C7N A;  3L37 A;  2YO3 A;  2XZR A;  5CMZ A;  3A5T A;  5APQ A;  1KQL A;  2E42 A;  2P67 A;  2N9B A;  5AW5 B;  2R5B A;  5AVT B;  1DH3 A;  3I5C A;  4JYC A;  3L35 A;  3A3Y B;  2W27 A;  3KQG A;  5AVS B;  3M06 A;  3VMY A;  3V4Q A;  3P7K A;  5AVR B;  3M9B A;  3LIE A;  1S9K E;  4GT1 A;  3IR9 A;  1H88 A;  5APS A;  4RES B;  4AUW A;  1MUU A;  2QM7 A;  2R3C A;  2R32 A;  1MV8 A;  3M9H A;  5AW6 B;  2R5D A;  3V4W A;  1OXZ A;  1SLQ A;  3NMD A;  5APU A;  2C9L Y;  1FAV A;  3M91 A;  5APW A;  3VN0 A;  5AW3 B;  5AVY B;  4AQR D;  3A7O A;  2ZFC A;  1CI6 A;  3TYY A;  3OAK A;  3P32 A;  3A2A A;  1CSB A;  2P7J A;  4KHX A;  5AW8 B;  2P2U A;  2H7H A;  2XU6 A;  4C46 A;  2WTY A;  1GK6 A;  3NFQ A;  2YNY A;  3VMX A;  1T2K C;  5AVX B;  4EOT A;  5AW7 B;  1T2K D;  3M0A A;  4I2L C;  5AW4 B;  5APT A;  3NXS A;  5AVU B;  1A02 J;  3LID A;  1FOS F;  5AW9 B;  3MD0 A;  3NTN A;  2IPP A;  1H8A A;  4DZO A;  1GU4 A;  3HE5 B;  1JNM A;  1HJB A;  1NWQ A;  4LC1 A;  4GKG A;  3VTP C;  2VRS A;  1NAF A;  1FOS E;  2E43 A;  2WPS A;  1HWT C;  1IO4 A;  5AW0 B;  1J2J B;  5AW2 B;  5AVQ B;  2WT7 B;  1GD2 E;  4C7N B;  3L36 A;  1YYC A;  2Z5I A;  4XE5 B;  1A02 F;  2C9N Y;  2WPR A;  3HTK A;  4HYT B;  1H89 A;  1SP4 A;  1CZQ A;  2Z5H A;  3M0D A;  4AYC A;  5AW1 B;  4M3L A;  3VMZ A;  1JUN A;  1GU5 A;  3O8Z A;  3VYI A;  3KDP B;  1X8Y A;  3T97 A;  5APX A;  1HBW A;  1GK4 A;  2Q7C A;  3TK1 A;  2W6A A;  3HE4 B;  1S9K D;  1GZL A;  2Q5U A;  3MGN A;  3TNU B;  1MFZ A;  5AVV B;  2ZXE B;  2BAS A;  2JJL A;  5APY A;  2QM8 A;  1G2C B;  2WPQ A;  4I6M C; 
#chains in the Genus database with same CATH topology
 1PP9 E;  1YJW P;  2HOD A;  2NPS A;  3H1H D;  3GHG C;  2JR8 A;  1LTJ C;  3B4S A;  1OVU A;  1LT1 A;  3CCR P;  1L0N J;  2AXT E;  1EZV E;  1DH3 A;  1U57 A;  3V2Q A;  2RKL A;  2XKM A;  4OGQ B;  5AVS B;  5KLV G;  4IOI H;  1MZ9 A;  1AQT A;  1KYO H;  1MV8 A;  1VQK P;  3BVH A;  3L72 J;  3AE5 C;  1KIL B;  1NVO A;  3VP8 A;  1L0N E;  5AVY B;  1RE4 C;  2QJY C;  1PGP A;  1CI6 A;  2LR2 A;  1IK9 A;  1XTC C;  1VQL P;  1KN7 A;  1CSB A;  2WQY C;  1XTG B;  3BAT A;  1EZV D;  4H44 B;  3F89 A;  1RQV A;  5APT A;  2WSE H;  5AVU B;  1Q82 Q;  3L72 E;  1RY3 A;  1QLE D;  3D6Y A;  1Z56 A;  2VRS A;  4TLF A;  4YTP C;  3H1H G;  3JSV C;  4H13 C;  1IFM A;  2GUS A;  2B9B A;  3TDK A;  1Q81 Q;  1L0L J;  1LT9 C;  2PRR A;  3LW5 J;  2FYU J;  4Y99 C;  3W67 A;  4AYC A;  2OYH B;  1JY3 P;  1AJY A;  3CXH H;  3AE3 C;  1S9K D;  3AEE C;  3H25 A;  1PP9 G;  1VQP P;  1L0L E;  2JJL A;  3TGU J;  1BGY D;  3L71 J;  1SFC B;  2Z4E A;  1GTW A;  2FYU E;  1Y47 A;  3M0D C;  2KLV A;  2FFD B;  1GW4 A;  1BCC J;  1EZV G;  4IFM A;  1SFC A;  1LTJ A;  2M0B A;  1QEX A;  2R5B A;  4HJG H;  2FFD A;  5GTI E;  2L5G B;  3TGU E;  4GOF A;  3L71 E;  1VQ9 P;  3VMY A;  3BAS A;  4RES B;  1RF1 B;  1J1D B;  1BCC E;  2KSE A;  2ZFC A;  1RE4 A;  1RF1 A;  1J1E B;  1P84 I;  2H7H A;  1S5L H;  3WU2 H;  5AVX B;  1T2K C;  4D6T D;  5AW4 B;  2KOG A;  2WSF H;  2OGU A;  2OYO A;  4L75 A;  3OA7 A;  4K3A A;  3H1J J;  4OH8 B;  3SWK A;  1HJB A;  5KJ7 D;  1VF5 C;  1NAY A;  1JM0 A;  1FOS E;  2CPB A;  1VQ4 P;  1HWT C;  2MJZ A;  1JY3 N;  3IAO A;  3II6 A;  1R5S A;  5KKZ C;  1LT9 A;  4PD4 E;  2GM4 A;  2W8Z A;  3R2P A;  1NJI Q;  5TJH A;  4WY4 D;  1GU5 A;  5B5E E;  5CCG D;  2OTJ P;  3C1L A;  3H1J E;  1MFT A;  5APX A;  2KS1 A;  1RH5 B;  1PL5 A;  2FYU G;  2A06 E;  1UIX A;  2E75 D;  3RK3 C;  3GW6 A;  5C39 A;  4BXL A;  2OYI B;  4H0L B;  5DJT B;  3EQ2 A;  2QVA A;  1NKZ B;  3L4F A;  4D6T G;  1L2P A;  3JC2 2;  1KYO E;  3L71 G;  4DJG A;  2AEM A;  2ZYG A;  4L73 A;  2H88 C;  3P7K A;  2W6J H;  2FBW C;  4L74 A;  3H1I J;  1OIP A;  3L73 J;  1Y9B A;  1FAV A;  4Y28 J;  1JEK A;  1NU1 J;  2YMY A;  1R8E A;  3BRT B;  2IYP A;  2ZT9 C;  1LWU C;  2HPC B;  4KHX A;  1FBM A;  4JQ0 D;  2RMZ A;  3H1I E;  3M0A A;  3L73 E;  1USE A;  5AW9 B;  1L4A D;  1HH0 A;  1NU1 E;  2JDI H;  5KKZ B;  4UB6 E;  1ZR2 A;  3HTK B;  2E76 D;  3CXH E;  4XA4 A;  3CD6 P;  3CME P;  1P84 H;  1KZU B;  3EFF K;  3H1K D;  2SPZ A;  3CLQ A;  1BDD A;  2M3B A;  3HTK A;  4HYT B;  2OAR A;  4N6J A;  3CX5 H;  3TSI A;  3D6Z A;  1X8Y A;  2J5U A;  1NTZ K;  5CCH D;  1R5L A;  1HGV A;  1DIP A;  3L73 D;  4Z1M H;  1SQX K;  3QH9 A;  2ZYA A;  3P8C E;  4B86 A;  1EDJ A;  5CJ4 A;  1N7S D;  4KT0 J;  2ZVO B;  4C7N A;  1M56 D;  1HJ0 A;  5APQ A;  1PPJ E;  1M1K Q;  1FZE A;  2DW3 A;  2LXB A;  1SQQ K;  3PHL A;  5AVR B;  2E76 B;  1AVY A;  3LIE A;  3H1K G;  5KLI C;  3H1L J;  3MUD C;  2QJK B;  3M9H A;  3VOP A;  3WU2 E;  3CCV P;  1G2C A;  2A45 I;  2M5A B;  2R44 A;  1D7M A;  3USS A;  2P58 A;  3WUU A;  3H1I G;  3Q1M A;  3L73 G;  1LWU A;  3P32 A;  2E74 C;  2M5A A;  4GOE A;  3ZDM A;  4QMA A;  1AA0 A;  3H1L E;  1E5W A;  1YBK A;  1DEE G;  2N1T D;  3RL0 D;  3S1K A;  2ZJS E;  2AXT H;  1PFI A;  3Q5P A;  1SQB D;  1NTM K;  4ZKP A;  3U1A A;  2ZYD A;  1CW5 A;  1ZME C;  2QE7 H;  3D70 A;  4WB4 A;  5KTB A;  1M7L A;  3HE4 B;  3TK1 A;  1GZL A;  1IFI A;  3AEF C;  2QRX A;  1SQP D;  2BAS A;  2ITA A;  2WPQ A;  3HE4 A;  3HE5 A;  4DOJ A;  3RK2 C;  4EI2 A;  1FU1 A;  2WZ7 A;  1KQS O;  4U3F J;  5L8R J;  5KLI B;  1Q7Y Q;  2FKW B;  1FE6 A;  1SQB G;  2Y9Y A;  1VDF A;  3L74 D;  3IR9 A;  5B66 H;  3JCU H;  4AUW A;  3MUD A;  2H8P D;  3AEB C;  2C9L Y;  4U3F E;  1K05 A;  3A0H H;  1S1C X;  2K9J B;  1WT6 A;  1YQ4 C;  4IL6 X;  1IZN B;  1P84 E;  1FZG A;  2FXO A;  2JKV A;  1FOS F;  2J59 M;  4OGQ C;  3CX5 E;  4EYY Q;  3CCS P;  1NAF A;  3L75 D;  3MHV A;  3R4Y A;  2WIT A;  2GA1 A;  5AVQ B;  2POH A;  4U3F D;  3ABV C;  1KIL C;  1YJN P;  1N8R Q;  1SP4 A;  3H6P A;  4JF7 A;  1K9M Q;  1KIL E;  4H44 C;  2J58 A;  2D2C D;  5AVV B;  1SQV K;  1X0T A;  2KI7 B;  4RJT A;  3PP5 A;  2ZVN B;  2JO1 A;  1LTS C;  2JWA A;  2YO3 A;  4YXW H;  1KB9 H;  3AEG C;  2W83 C;  1YJ9 P;  2Y9Z A;  1VQ8 P;  2QA4 P;  3L70 J;  1FZF A;  2OYH C;  5AVT B;  2RH0 A;  2WSC J;  4U3F G;  3CC7 P;  5B5E H;  3CCU P;  2R3C A;  1SFC C;  3FWL A;  1JOC A;  1LTI C;  4N78 E;  1VQ7 P;  3L70 E;  3KXD A;  3OW2 O;  2AEJ A;  2FFD C;  3OAK A;  3AE8 C;  1FZB A;  2FY8 A;  3Q5R A;  3AE1 C;  2Y0E A;  1PP9 D;  3CWB J;  1H8A A;  5KLV K;  1T8Z A;  1RF1 C;  1J1D C;  1J2J B;  4NPD A;  2WT7 B;  4W80 A;  1AFO A;  3L36 A;  2HG5 D;  3G6E P;  1IFP A;  3L70 D;  1FDI A;  3HUS B;  1KIL A;  4OVN F;  1KQG B;  1EDK A;  4JPZ B;  1X22 A;  3KDP B;  1J1E C;  1K04 A;  2XND H;  2FXM A;  1FJK A;  2ZAE B;  1JB0 J;  2CK3 H;  1L0N D;  5DJU B;  3HD7 D;  2Q3I A;  2C0W A;  4UB6 H;  5B66 E;  2H43 A;  3JCU E;  2O3J A;  1BSN A;  1LTG C;  1YIT P;  1PGO A;  3L72 D;  1IFJ A;  3A0H E;  2OYH A;  3GF3 A;  3BRV B;  2H89 C;  3L70 G;  2R5D A;  3NMD A;  3U59 A;  1RE3 C;  2C0X A;  2OYI C;  4H0L C;  1KV4 A;  4H13 D;  2OTK E;  4JBZ A;  5KAI H;  3N4X A;  1M1J B;  2G8Y A;  2QIW A;  1X9V A;  2WTY A;  3G4S P;  1L0L D;  1L0N G;  2OQQ A;  3NTN A;  1GU4 A;  2FYU D;  1IO4 A;  5CJ0 A;  3CCM P;  2YIU B;  3L72 G;  1K73 Q;  2I1K A;  3TGU D;  4W7Y A;  4WY4 C;  3L71 D;  1G1J A;  2UWJ E;  2Q5U A;  1LTA C;  1KB9 E;  1BCC D;  1OW7 A;  1S3J A;  1IK7 A;  4DCK A;  2N9Y B;  4R4L A;  1OWA A;  4EDF A;  2B88 A;  2B89 A;  2PGD A;  1L0L G;  3AE6 C;  3Q3D A;  1SQX J;  1URQ D;  1N86 A;  3N7N A;  4JYC A;  3CCJ P;  1ZRT E;  2L91 A;  3V6I A;  5E79 E;  1IC2 A;  4GT1 A;  1H0T B;  2QM7 A;  2I1J A;  2R32 A;  3V4W A;  2IBZ E;  2YKP A;  3RK3 E;  3TGU G;  1RE3 A;  4PD4 D;  1N73 B;  1VF5 D;  1S4X A;  2OYI A;  4AQR D;  1SQX E;  1YIJ P;  3A0B H;  1SQQ J;  3CPW O;  3H1J D;  2P7J A;  1BCC G;  1KD1 Q;  1PGJ A;  1N73 A;  1USD A;  3AE7 C;  2A06 D;  3LID A;  2OTL P;  2CPS A;  1W5C E;  2PFX A;  3BCC J;  2AEF A;  2E76 C;  1T3U A;  2IBZ D;  2QJK C;  4W7Z A;  4WY4 B;  2JEE A;  3RK3 D;  1KYO D;  2AXC A;  4YPC A;  1CZQ A;  1ZW0 A;  1OZH A;  4WY4 A;  4DT0 A;  2HPC A;  2E75 B;  3GF7 A;  1NTM J;  1EZV I;  1JY2 O;  3ITK A;  1S72 P;  1MFZ A;  3FXD A;  2JP3 A;  1ZLL A;  5AVW B;  3PH0 A;  3C8V A;  3H1J G;  1AV1 A;  4JYB A;  2YO2 A;  3B5N D;  5TIS H;  2YXQ B;  4PV1 D;  1NTM E;  2A06 G;  3FWN A;  4WWI A;  3H1I D;  1PGQ A;  2ZT9 D;  1E79 H;  4C7R A;  2KYV A;  1OFC X;  1NU1 D;  3V4Q A;  3CCE P;  2IBZ G;  5KAI E;  1FDO A;  5KAF H;  2HR3 A;  2JWD A;  3CXH D;  3KYQ A;  3KHU A;  1MUU A;  5AW6 B;  1Q2N A;  1SQX G;  5BU8 B;  1VPC A;  2KK7 A;  3M91 A;  3A7O A;  3TYY A;  1N7L A;  2Q3E A;  1L4A B;  2XU6 A;  4C46 A;  1KFN A;  2W90 A;  2YNY A;  4LLH A;  4RO0 A;  2IPP A;  4I1L A;  4DZO A;  2IDB A;  3P8C D;  4LC1 A;  3VTP C;  1SVF A;  2E43 A;  3B5N B;  1GD2 E;  2Z5I A;  2P10 A;  3MTU E;  4OWF A;  1PPJ D;  4A7P A;  1NU1 G;  1KTM A;  1N2D C;  3VMZ A;  1X79 B;  5CCH A;  2WPV B;  1JY2 P;  4HH2 A;  2WSC H;  1N7S B;  5APY A;  1ZOY C;  2KZI A;  2ZXX A;  2Q1K A;  5APV A;  3SWY A;  1BE3 J;  3E1I A;  4ZKU A;  1JMB A;  1T3J A;  3L37 A;  3CI9 A;  4IFF A;  2BCC J;  1SQV J;  3H1L D;  4O9B A;  2N9B A;  1DX7 A;  1OW6 A;  3CMA P;  2K9Y A;  1GL2 D;  3M06 A;  3A0B E;  3O6Q B;  1VQ5 P;  2PP6 A;  2KUB A;  1PPJ G;  3AED C;  3FXE A;  2K37 A;  2BCC E;  3O6Q A;  2E5T A;  1SQV E;  2MKV A;  3Q5S A;  1JCC A;  3K5B A;  2PAJ A;  2N1T B;  3A2A A;  3RL0 B;  4ASW A;  4PD4 I;  3NFQ A;  3VMX A;  2YKO A;  3TF5 A;  1A02 J;  2KLU A;  4IL6 H;  5CBO A;  2WVR A;  1S2E A;  1SQB K;  2WPS A;  2YKQ A;  3H1L G;  1YTZ I;  4MN4 C;  3T97 B;  1OMI A;  1JY2 N;  3RK2 D;  3IF4 A;  1VQ6 P;  2K9J A;  2A45 H;  1ZXG A;  5KLV J;  2B87 B;  3T97 A;  1GL2 B;  1SQP K;  1GK4 A;  5TIS E;  4KJM A;  3QWO C;  1NOH A;  3V2P A;  2IFM A;  1HUC A;  2WWW A;  3B8E B;  3KPE A;  2NPS D;  3AE2 C;  5KAF E;  2LXC B;  4NPE A;  1P84 D;  3CCQ P;  4BRY B;  3HUS C;  1NTK K;  2K1A A;  3G3Z A;  5H2F H;  3CC2 P;  1LP1 B;  3CX5 D;  4BRY A;  3H1H J;  3KZI H;  1SQV G;  5APS A;  2Y0D A;  1DD4 A;  2M3E A;  4OGQ D;  1JO5 A;  3CXH I;  5APW A;  5AW3 B;  4HB1 A;  2BEQ D;  3RBX A;  1VL2 A;  1FDM A;  2K3R A;  2V4H A;  3H1H E;  3RBZ A;  1KIL D;  1AQ5 A;  1GK6 A;  2NRG A;  1FZC B;  1EQ7 A;  1HVV A;  1W2B O;  2I8D A;  1KC8 Q;  5EFW B;  1FC2 C;  1NWQ A;  3W68 A;  4H44 D;  2HOD B;  2NPS B;  1U7J A;  1KFM A;  2HYN A;  3PTZ A;  3WMM 0;  4U7J A;  1YYC A;  5E79 H;  1LJ2 A;  2C9N Y;  3V2N A;  2D2C B;  3OJA B;  1Q86 Q;  1M1J C;  3FX0 A;  1VQN P;  4GDO A;  1PV3 A;  5GTH H;  3AE9 C;  3SFE C;  2WSS H;  2KP8 A;  4N78 D;  3HD7 C;  1ZN5 A;  3Q2Y A;  1CI6 B;  2XV5 A;  2W6B A;  2YMK A;  1WMK A;  2WT7 A;  2YIU C;  1SFC D;  1QGK B;  3A5T A;  1EC5 A;  3CWB E;  5CMZ A;  2FYN B;  1BGY J;  2V7Q H;  3HUS A;  3VP9 A;  1YTZ T;  2O01 H;  4L76 A;  2YXR B;  1WRG A;  2W27 A;  1DD3 A;  1S9K E;  3MIW A;  1H88 A;  2E5Y A;  1OX3 A;  1RF0 C;  1TU3 F;  2KNC B;  3G71 P;  1QVG O;  1BGY E;  3EWK A;  4IL6 E;  1OW8 A;  3AEA C;  1GW3 A;  2KNC A;  3CWB D;  1G1I A;  1JNM A;  4GKG A;  2KB7 P;  5AW0 B;  2O1K A;  4D6T J;  4ASV A;  3GHG B;  1QVF O;  1M57 D;  1N73 C;  1LTJ B;  5AW1 B;  4YXD C;  4M3L A;  3GLM A;  1NO4 A;  1DEB A;  1M1J A;  3GHG A;  5KJ7 C;  3HD7 B;  2HFE D;  4D6T E;  5CBN A;  1L0N K;  4I6M C;  3V5B A;  5H2F E;  4RKU J;  3CWB G;  5CHX A;  3HD7 A;  1OVV A;  2QJY B;  1QL1 A;  4GIF A;  3E7K A;  5AVZ B;  3KZI E;  5CCG C;  3G9R A;  3SSU A;  2E42 A;  4H0L D;  3C9I A;  2P67 A;  1URQ C;  3I5C A;  2E75 C;  3KQG A;  2IZ1 A;  3WUV A;  1BGY G;  3I56 P;  4H13 B;  1NTZ J;  1RF0 A;  2XNX A;  1OXZ A;  3CX5 I;  1FZA A;  5APU A;  1LT9 B;  3VN0 A;  1S5L X;  4Y99 B;  3GMA A;  2Q9I A;  1ZV8 A;  2KS1 B;  1L0L K;  1IJD B;  1KB9 D;  1T2K D;  4I2L C;  2A45 G;  1NTZ E;  4XFJ A;  3VMA A;  2FYU K;  1YQ3 C;  2QG4 A;  1EDI A;  1H0T A;  2WMM A;  2V7Q J;  2QJP C;  1A02 F;  5GTH E;  3PRJ A;  1Y8A A;  3CCL P;  2O01 J;  3M0D A;  1NH4 A;  2QSI A;  1Q90 D;  1EXJ A;  1EDL A;  1ZRT D;  3S4R A;  1L4A C;  4EIJ A;  1HBW A;  2WSE J;  3H1K J;  1KOR A;  1NTZ D;  3SFD C;  5KJ7 A;  1SQQ E;  3EFG A;  1SQX D;  3FGA D;  3B5N C;  1URQ B;  3UIA A;  1M90 Q;  4PV1 C;  3AEC C;  5CCG A;  3H1K E;  3BCC E;  5CCH C;  1MKM A;  2RN0 A;  1URQ A;  1SS1 A;  3L35 A;  4GOD A;  1VF5 B;  1SQQ D;  1PIX A;  1HGZ A;  3IN6 A;  1N7S C;  3MP7 B;  3CC4 P;  3IFM A;  4IFD K;  2IFN A;  2K88 A;  1EXI A;  1NKN A;  2O1J A;  4PJ0 H;  1KQF B;  1NTZ G;  3BCC D;  1HF9 A;  5AW8 B;  1FS0 E;  4EOT A;  3PLN A;  3NXS A;  4UB8 H;  1KMI Z;  1JTH B;  3MD0 A;  3RK3 B;  2R3S A;  2QJP B;  4R4M A;  3S9O A;  1JCD A;  2P1J A;  3RGU A;  5AW2 B;  4C7N B;  1JTH A;  4XE5 B;  1NTM D;  2GUV A;  4K35 A;  1W2E A;  2IX7 C;  3I55 P;  1SQQ G;  1SQB J;  2N1T C;  1LTT C;  3RL0 C;  2HLO A;  2WSF J;  1L4A A;  2W6A A;  3RL0 g;  1M8O B;  3MZW B;  2QM8 A;  1G2C B;  1VQO P;  4PV1 B;  3BCC G;  3P8M C;  2ZT9 B;  1S5L E;  1SQP J;  1SQB E;  1LWU B;  3B5N A;  4WVZ A;  1BDC A;  1KQL A;  1U7M A;  2Y0C A;  1NU1 K;  5K5G B;  4TT3 H;  3A3Y B;  3HRN A;  1GL2 C;  3D71 A;  1NTM G;  1SQP E;  1NTK J;  1GDT A;  1N7S A;  5M1B A;  2O01 N;  2BEZ F;  4N3Y B;  2Q6Q A;  3L74 J;  1PZQ A;  3H32 B;  2E74 D;  2P2U A;  1GMJ A;  1BE3 E;  1OVR A;  1NTK E;  3H32 A;  2LKM A;  1T6A A;  4ZNC A;  3HE5 B;  1KB9 I;  3PJS K;  3L74 E;  3V2R A;  1AVO A;  2QEX P;  2WPR A;  1LTB C;  1IFD A;  2Z5H A;  3L75 J;  1JUN A;  3O8Z A;  2N1T A;  2M8R A;  3M9Q A;  2Q7C A;  1BE3 D;  1K8A Q;  1FZC C;  3AE4 C;  1NTK D;  3TNU B;  4BWN A;  2ZXE B;  1QL2 A;  2KZJ A;  2FYZ A;  2BCC D;  2KIK A;  1SQV D;  1HTL C;  4I7Z C;  2NPS C;  3L75 E;  3TNU A;  2IYO A;  3SWF A;  2IBZ I;  2E74 B;  1KYO I;  2XZR A;  3B71 A;  2NZ2 A;  2D2C C;  5AW5 B;  2IZ0 A;  1JMM A;  3LW5 H;  1SQP G;  2B87 A;  4PJ0 E;  1GL2 A;  4HKZ H;  3M9B A;  3U1C A;  1UII A;  1FJP A;  1YHQ P;  2KXP B;  1RQU A;  5KLV E;  1SLQ A;  2KSJ A;  1LGH B;  2FXP A;  5GTI H;  4UB8 E;  2G3A A;  4LGD E;  1BE3 G;  1BSH A;  1NGM B;  1ZP0 C;  1NTK G;  1QX8 A;  2FYN C;  1IFN A;  1VQM P;  5AW7 B;  2BCC G;  3L74 G;  1LP1 A;  3GG2 A;  1ZR4 A;  3WUT A;  3RK2 B;  4NPF X;  1RHZ B;  5KLV D;  3CL3 D;  4ZMD A;  3E1R A;  5BVZ A;  1LNQ A;  1PP9 J;  1H89 A;  5BU5 A;  4CPG A;  4WBA A;  1JY3 O;  3VYI A;  1NYH A;  4I7Z B;  1NHL A;  1FZC A;  3MGN A;  1YI2 P;  3F5H A;  3L75 G;  2XDJ A;  4PD4 H; 
#chains in the Genus database with same CATH homology
 5AVW B;  3V5B A;  3HE4 A;  3HE5 A;  5CHX A;  4DOJ A;  3HD7 A;  3RK2 C;  4JYB A;  2HOD A;  2NPS A;  1QL1 A;  2YO2 A;  4GIF A;  3B5N D;  1FU1 A;  5AVZ B;  2WZ7 A;  5CCG C;  3GHG C;  1LTJ C;  2E42 A;  3C9I A;  2P67 A;  1URQ C;  1DH3 A;  3I5C A;  3V2Q A;  2XKM A;  4C7R A;  2KYV A;  2FKW B;  3KQG A;  5AVS B;  3V4Q A;  3KYQ A;  1VDF A;  1MZ9 A;  3IR9 A;  4AUW A;  1MUU A;  5AW6 B;  1MV8 A;  1RF0 A;  2XNX A;  5BU8 B;  1VPC A;  3MUD A;  1OXZ A;  2H8P D;  3BVH A;  1FZA A;  5APU A;  2C9L Y;  1LT9 B;  3M91 A;  1KIL B;  3VN0 A;  3VP8 A;  5AVY B;  1RE4 C;  3A7O A;  1CI6 A;  3TYY A;  4Y99 B;  1WT6 A;  1IK9 A;  1N7L A;  1XTC C;  2Q9I A;  1ZV8 A;  1CSB A;  1L4A B;  2XU6 A;  4C46 A;  1FZG A;  1KFN A;  1XTG B;  1L0L K;  2YNY A;  3BAT A;  1IJD B;  4LLH A;  1T2K D;  4I2L C;  5APT A;  2A45 G;  2WSE H;  5AVU B;  1RY3 A;  1FOS F;  2FYU K;  2J59 M;  2IPP A;  4I1L A;  4DZO A;  3P8C D;  4LC1 A;  1Z56 A;  3VTP C;  2VRS A;  1NAF A;  1SVF A;  2E43 A;  2WIT A;  1IFM A;  3B5N B;  5AVQ B;  2GUS A;  1GD2 E;  2POH A;  2Z5I A;  1A02 F;  1LT9 C;  1KIL C;  3MTU E;  1SP4 A;  3M0D A;  1NH4 A;  4Y99 C;  4AYC A;  2OYH B;  1N2D C;  1JY3 P;  3VMZ A;  3H6P A;  4JF7 A;  1X79 B;  1L4A C;  4EIJ A;  1HBW A;  5CCH A;  1S9K D;  1JY2 P;  2J58 A;  5KJ7 A;  4HH2 A;  5AVV B;  2WSC H;  1N7S B;  1SQV K;  2JJL A;  5APY A;  3EFG A;  1SFC B;  2Z4E A;  3PP5 A;  1GTW A;  5APV A;  3SWY A;  3M0D C;  1LTS C;  3B5N C;  2KLV A;  3E1I A;  2FFD B;  1GW4 A;  4ZKU A;  1URQ B;  3UIA A;  1T3J A;  3L37 A;  2YO3 A;  4IFM A;  1SFC A;  3CI9 A;  5CCG A;  5CCH C;  4IFF A;  1LTJ A;  4O9B A;  2N9B A;  1FZF A;  1DX7 A;  2R5B A;  2OYH C;  5AVT B;  2FFD A;  2L5G B;  1URQ A;  3L35 A;  3VMY A;  1GL2 D;  3M06 A;  3BAS A;  2PP6 A;  1HGZ A;  4RES B;  1RF1 B;  1J1D B;  2R3C A;  1N7S C;  3IFM A;  1SFC C;  4IFD K;  2IFN A;  1JOC A;  1LTI C;  4N78 E;  1NKN A;  2O1J A;  2ZFC A;  1RE4 A;  1JCC A;  1RF1 A;  2FFD C;  3OAK A;  2PAJ A;  2N1T B;  3A2A A;  3RL0 B;  1J1E B;  5AW8 B;  2H7H A;  3NFQ A;  1FZB A;  3VMX A;  1T2K C;  5AVX B;  4EOT A;  2YKO A;  5AW4 B;  2KOG A;  2WSF H;  3NXS A;  1A02 J;  1JTH B;  3MD0 A;  3RK3 B;  3OA7 A;  4OH8 B;  1H8A A;  1JCD A;  1HJB A;  5KJ7 D;  5KLV K;  1SQB K;  2P1J A;  1FOS E;  1T8Z A;  2CPB A;  2WPS A;  1RF1 C;  1J1D C;  1HWT C;  5AW2 B;  1J2J B;  2MJZ A;  1JY3 N;  2WT7 B;  2YKQ A;  4C7N B;  4W80 A;  1AFO A;  3L36 A;  1JTH A;  1YTZ I;  2HG5 D;  3II6 A;  4XE5 B;  2GUV A;  1LT9 A;  3HUS B;  1KIL A;  1JY2 N;  1W2E A;  2GM4 A;  3R2P A;  3RK2 D;  2IX7 C;  4WY4 D;  1GU5 A;  2A45 H;  5CCG D;  2N1T C;  1LTT C;  3KDP B;  3RL0 C;  3T97 A;  1GL2 B;  1J1E C;  5APX A;  2HLO A;  1SQP K;  1GK4 A;  1L4A A;  2W6A A;  2QM8 A;  1NOH A;  2FXM A;  1FJK A;  1G2C B;  3RK3 C;  3V2P A;  2IFM A;  1HUC A;  2WWW A;  3HD7 D;  2OYI B;  3B8E B;  3EQ2 A;  3KPE A;  2NPS D;  3P8M C;  2Q3I A;  1NKZ B;  1LWU B;  3B5N A;  2C0W A;  3L4F A;  2H43 A;  3HUS C;  1KQL A;  1NTK K;  1LTG C;  3G3Z A;  1IFJ A;  1NU1 K;  2OYH A;  3A3Y B;  3HRN A;  1GL2 C;  3BRV B;  3P7K A;  5APS A;  2R5D A;  1GDT A;  1N7S A;  3NMD A;  3U59 A;  1JO5 A;  1RE3 C;  1FAV A;  2C0X A;  5APW A;  2OYI C;  5AW3 B;  2YMY A;  4N3Y B;  3BRT B;  1FDM A;  1LWU C;  2HPC B;  3N4X A;  1M1J B;  3H32 B;  4KHX A;  2P2U A;  1KIL D;  1FBM A;  1X9V A;  2WTY A;  1AQ5 A;  1GK6 A;  1FZC B;  3M0A A;  1EQ7 A;  1HVV A;  5AW9 B;  3NTN A;  1L4A D;  3H32 A;  1HH0 A;  2LKM A;  1GU4 A;  3HE5 B;  1ZR2 A;  3HTK B;  1NWQ A;  2HOD B;  2NPS B;  3V2R A;  4XA4 A;  1IO4 A;  1KFM A;  2HYN A;  5CJ0 A;  3WMM 0;  1KZU B;  1YYC A;  2C9N Y;  2WPR A;  3CLQ A;  2M3B A;  3HTK A;  4HYT B;  1LTB C;  2OAR A;  4N6J A;  3V2N A;  1IFD A;  2I1K A;  2Z5H A;  3OJA B;  4W7Y A;  4WY4 C;  1JUN A;  3O8Z A;  3TSI A;  1M1J C;  1X8Y A;  2N1T A;  2M8R A;  1G1J A;  1NTZ K;  3M9Q A;  5CCH D;  1HGV A;  2Q7C A;  1FZC C;  2Q5U A;  1LTA C;  3TNU B;  2ZXE B;  1QL2 A;  2FYZ A;  1SQX K;  1HTL C;  2KP8 A;  4N78 D;  3HD7 C;  1ZN5 A;  3P8C E;  4B86 A;  1CI6 B;  2NPS C;  3TNU A;  3SWF A;  2XV5 A;  2W6B A;  5CJ4 A;  1N7S D;  1OWA A;  2WT7 A;  4C7N A;  1SFC D;  2XZR A;  5CMZ A;  3A5T A;  5APQ A;  3HUS A;  3VP9 A;  5AW5 B;  1FZE A;  1URQ D;  1JMM A;  3LW5 H;  1N86 A;  1YTZ T;  3N7N A;  4JYC A;  2O01 H;  1WRG A;  2W27 A;  1SQQ K;  1GL2 A;  5AVR B;  3M9B A;  3U1C A;  1IC2 A;  3LIE A;  1S9K E;  3MIW A;  4GT1 A;  1H88 A;  1FJP A;  1RF0 C;  2QM7 A;  2I1J A;  2R32 A;  3M9H A;  3V4W A;  3VOP A;  1SLQ A;  2YKP A;  2KSJ A;  1G2C A;  2A45 I;  1RE3 A;  1LGH B;  1N73 B;  2OYI A;  4AQR D;  4LGD E;  1GW3 A;  1LWU A;  3P32 A;  2P7J A;  1IFN A;  1G1I A;  1N73 A;  5AW7 B;  1E5W A;  3LID A;  2N1T D;  3RL0 D;  2CPS A;  1PFI A;  1JNM A;  4GKG A;  1ZR4 A;  3RK2 B;  2KB7 P;  5AW0 B;  1T3U A;  1NTM K;  2O1K A;  3CL3 D;  4W7Z A;  4WY4 B;  4ZKP A;  2JEE A;  3RK3 D;  5BVZ A;  3U1A A;  1CW5 A;  3GHG B;  1N73 C;  1LTJ B;  1H89 A;  5BU5 A;  1CZQ A;  5AW1 B;  4WBA A;  1JY3 O;  4M3L A;  4WY4 A;  3VYI A;  4WB4 A;  2HPC A;  5KTB A;  1NO4 A;  1DEB A;  3GHG A;  1M1J A;  1M7L A;  3HE4 B;  3TK1 A;  1NHL A;  1GZL A;  1IFI A;  5KJ7 C;  1FZC A;  1JY2 O;  3HD7 B;  3MGN A;  2HFE D;  1MFZ A;  2BAS A;  2XDJ A;  1L0N K;  1ZLL A;  2WPQ A;  4I6M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...