4C7NA

Crystal structure of the synthetic peptide im10 in complex with the coiled-coil region of mitf
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
47
structure length
47
Chain Sequence
SSVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords MICROPHTHALMIA ASSOCIATED TRANSCRIPTION FACTOR
publication title Improving Coiled Coil Stability While Maintaining Specificity by a Bacterial Hitchhiker Selection System.
pubmed doi rcsb
total genus 21
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2013-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4c7nA00
5APXA 4JYBA 3M0DA 1GU5A 2WWWA 3NMDA 2QM8A 2W6AA 4M3LA 1H89A 4C7NA 3NXSA 4EOTA 3HTKA 1GD2E 3HE5A 1IO4A 5AW8B 2VRSA 5AW6B 4AUWA 5AVRB 2XZRA 5AVUB 5AVTB 4JYCA 3T97A 4AQRD 2YO3A 2Q5UA 5AW4B 1A02F 5APVA 2R5DA 3OAKA 1S9KD 2JJLA 3A5TA 1A02J 1GZLA 1T2KD 5APSA 2N9BA 2KP8A 1S9KE 1HBWA 2QM7A 3NTNA 3V5BA 3HE5B 3M0AA 5APTA 2IPPA 1HJBA 4KHXA 3M06A 3P7KA 1G2CB 2R32A 2WPRA 2BASA 3LIEA 5AVXB 3VYIA 3LIDA 2YO2A 4HYTB 5AW7B 4B86A 1GK4A 2C9LY 5AVZB 1J2JB 3M9HA 2YNYA 2P7JA 2E42A 3VMXA 2R5BA 5AW9B 3B8EB 3L35A 4XE5B 1MV8A 1MUUA 3KDPB 3P32A 3VMZA 2Z5HA 1H88A 2Q7CA 2WTYA 1JNMA 5CMZA 4DZOA 3A3YB 3TYYA 1X8YA 3I5CA 3SWFA 5AVWB 3VTPC 5APYA 5AVYB 2Q3IA 2C9NY 1HWTC 5AW5B 1OXZA 2E43A 2Z5IA 5APQA 3VN0A 4C46A 3KQGA 5APWA 1FOSE 1KQLA 1NAFA 2WPSA 5AVSB 3V4WA 1MFZA 4AYCA 3V4QA 2ZFCA 3O8ZA 2R3CA 2XV5A 4GT1A 3M91A 2P2UA 3P8MC 2WT7B 2P67A 1YYCA 2H7HA 1OWAA 5AVVB 1CSBA 1GU4A 1HUCA 1CI6B 1GK6A 5AW1B 3UIAA 1T2KC 3TNUB 3A7OA 3L37A 4LC1A 1H8AA 5AW2B 5AW3B 5AVQB 1CZQA 2ZXEB 2WT7A 3M9BA 3TK1A 3NFQA 1NWQA 1DH3A 3IR9A 3MD0A 5AW0B 3VMYA 1CI6A 2W27A 4I2LC 1JUNA 3HE4B 1FAVA 3TNUA 1SP4A 1FOSF 4GKGA 3A2AA 2WPQA 1SLQA 4I6MC 5APUA 3L36A 4C7NB 3MGNA 4RESB 1GTWA 2XU6A 3HE4A
chains in the Genus database with same CATH superfamily
1T6AA 1FJKA 2W90A 1FC2C 3HE5A 5AW8B 1LTTC 2KI7B 5APVA 1NTZE 2KS1B 3A5TA 4NPFX 1FZEA 5APSA 3NTNA 3L75D 3WU2E 3P7KA 5KJ7A 1RE4C 1G2CB 2BASA 1PGQA 3A0HE 1FU1A 1NU1D 3CD6P 2M3EA 2RH0A 1L4AC 1VQ4P 5GTHH 1GK4A 2OTKE 5KJ7D 3AEEC 1J2JB 1KYOE 3AEGC 4ZNCA 3B8EB 3L35A 1OZHA 5CCHC 2E74C 5C39A 1Q7YQ 2OYHA 2J58A 2AXTE 3B5NB 2IYPA 3GHGB 2E43A 2JWAA 1BCCE 1PFIA 2ZT9D 1KV4A 3PLNA 3L4FA 1PL5A 1RF1C 1VF5D 1OX3A 1NTKG 3P8MC 1SQPG 1OW7A 2FYUJ 1CI6B 4PD4D 1GMJA 3V2QA 2HPCB 2HLOA 1KD1Q 2V7QH 3H25A 1HGZA 4I7ZB 1BE3G 3L71E 3TF5A 4H13B 3WUTA 1BSNA 3P8CE 1QVFO 2YKPA 3BVHA 3C8VA 4RO0A 2W6BA 4BXLA 5KLVJ 1BGYJ 2JR8A 1MKMA 4PV1B 5E79E 5BU5A 4LGDE 5APTA 4JPZB 2JKVA 4KHXA 1P84D 1QVGO 1NHLA 4Y28J 3PTZA 3CWBJ 4H44C 2B87A 1FS0E 1K9MQ 3U59A 1WRGA 3MUDC 3AE6C 1J1DC 4PD4I 3L70J 2P7JA 1KFNA 1LTIC 1MUUA 2ITAA 1KILC 2Q1KA 1NJIQ 5APWA 4UB8E 2WMMA 1SVFA 2BCCE 3RK2C 2WSFH 2NPSC 3BRTB 3R2PA 3CC4P 4LC1A 3VOPA 4IL6E 2HODA 1YQ4C 1FZAA 1OFCX 4U3FJ 2B9BA 1P84I 1Y47A 3H1IE 1L0LD 3M9HA 4WY4C 2KXPB 2A45G 4KT0J 3M0DA 3V2PA 2WSFJ 1KB9E 4JBZA 3RK3B 3FXDA 4WBAA 2YXRB 2DW3A 1U57A 2D2CC 1S9KD 1SQBK 4NPDA 2QRXA 4BRYB 2ZYDA 2QM7A 4TLFA 3WMM0 3L74E 1X22A 1YHQP 3H1LE 2OARA 3IN6A 3O6QA 1SS1A 1URQC 1L0NG 2ZYAA 2RKLA 4H0LB 3AEDC 1FDIA 2YIUC 4EI2A 1IK7A 1NAYA 1RE4A 1SQBE 4R4MA 3VTPC 2CPBA 1HWTC 1Q81Q 3VN0A 2NRGA 1PP9E 3KQGA 1L4AA 1IC2A 1M90Q 3V4QA 3RL0C 1W5CE 3L73E 1NU1K 4PJ0H 5CCHA 1WT6A 3H1JG 2FFDC 3TNUB 1PPJG 1L4AD 4DCKA 3HRNA 1NTKJ 3USSA 1SQPJ 3CCSP 1LTSC 1IFMA 3HE4B 1SP4A 3A2AA 2I8DA 3RBXA 2E74D 3B71A 1RF1A 1OW8A 1JB0J 1BE3J 1GU5A 3L75E 3BRVB 4EOTA 1GD2E 4HKZH 4AUWA 3JCUH 5CBNA 4YXDC 3I55P 2XZRA 1NU1E 3H32B 1NYHA 5EFWB 3VP8A 1GL2D 2PP6A 1BDDA 1S4XA 3M9QA 2AEJA 4DJGA 4OGQC 2ZJSE 2N1TB 2FKWB 5AVXB 1IFJA 2N9YB 1SQVD 2AXCA 3AE2C 2AEFA 3Q5PA 2YNYA 2IBZD 3AEAC 1JNMA 1GDTA 3HD7C 4PD4E 1T3JA 3BCCG 1FZBA 1OVVA 3V2NA 4C46A 1FZCB 5H2FH 3CCUP 3MUDA 4K3AA 1S5LX 1VQOP 1HVVA 4Z1MH 1JTHA 4GT1A 3ABVC 4O9BA 2WSEJ 3CI9A 4H44D 1HJ0A 2H7HA 5AVVB 1JY2N 1CSBA 1GK6A 2A45H 1KILA 1QGKB 5AVQB 1AFOA 1KC8Q 3CC2P 3H1HD 2E75D 3HUSB 3CC7P 2WITA 3MGNA 3L72G 1KILD 4RESB 1NTMG 1JCCA 3PJSK 1LWUC 3WUVA 3EFFK 1VQ7P 1P84E 3A0BH 2VRSA 1KQGB 2E5YA 2M0BA 1EZVD 1QX8A 3AE7C 2IBZI 1ZOYC 3GHGC 1A02J 2PRRA 1JEKA 3KZIE 4WY4A 2R32A 3LIEA 2YO2A 1L0LK 5KLIB 4OVNF 4I7ZC 3S4RA 5TJHA 3MTUE 4H13C 2KIKA 2O01N 4ZKUA 5B66E 1CW5A 1M1KQ 1L0NJ 4DZOA 3TYYA 3N7NA 2D2CD 1SQQG 1G1JA 1URQA 2BEQD 2OYIB 2OTJP 2ZFCA 4D6TD 3M91A 1GW4A 1L0LE 4PV1C 1EZVI 3MIWA 1SQXK 3L37A 2K9YA 1URQD 2ZXEB 3TGUG 3NFQA 1NWQA 4I2LC 1SFCB 2JEEA 3H1JJ 1QEXA 1SLQA 1EDIA 1J1EB 5KAFE 2A06G 4HB1A 4GOEA 2CK3H 2FFDA 4L74A 1IO4A 2GA1A 3RL0D 5AVUB 1JY2O 1SQXE 2GUVA 1KN7A 2WQYC 2K1AA 2FYNC 2H89C 1N7SB 3BATA 1K8AQ 1RQUA 1LT9B 5CBOA 3CCMP 2Y9ZA 1NTZG 2O1JA 3H1KD 5CJ0A 2KSEA 2KK7A 2ZT9B 2R3SA 2KNCA 3CL3D 1LNQA 2PGDA 1VF5B 4IOIH 2WVRA 2ZAEB 3VMZA 1MV8A 5CMZA 1KQSO 1JO5A 1UIIA 2FXOA 5B5EE 1M1JC 1NAFA 1OW6A 3RK3C 3BCCJ 4OGQD 3ITKA 3CXHI 5KTBA 2P67A 1EQ7A 1SQVK 2IX7C 1H8AA 2R44A 5CCGA 1BCCG 3IAOA 3HD7A 1ZRTD 1ZV8A 3IR9A 1DEEG 2JP3A 2UWJE 1HH0A 3CX5D 4N3YB 2P1JA 5CCGD 3HD7D 1GL2C 3NMDA 2QM8A 4IFMA 1H89A 3L71G 3HTKA 1RQVA 3JC22 3L72J 1NTMJ 1G2CA 1SQVE 2K9JA 3U1AA 1MFTA 4C7RA 1HBWA 3U1CA 2B87B 1LWUA 2IBZE 1QL2A 4HYTB 2QJPC 4K35A 1FJPA 1IK9A 4UB6H 3GHGA 1YJNP 3PH0A 2QJYB 2FY8A 4PJ0E 1JY3N 1G1IA 1LP1A 2KUBA 3V6IA 3CX5I 1PIXA 1FDMA 1KQLA 2YKOA 3H1HE 3LW5H 1OVUA 2FYUD 1SQQJ 2XV5A 3R4YA 2E75C 3B4SA 1KILE 1YYCA 1VQ5P 3TSIA 1DX7A 3I56P 2AEMA 5AW2B 2H43A 1S5LE 2BCCG 1CZQA 2WT7A 1HF9A 2G8YA 3FGAD 1S2EA 1EZVE 1ZR2A 1IZNB 4H13D 1FOSF 2E76B 3L36A 3IFMA 3QH9A 3TGUJ 3LW5J 3Q1MA 2O01H 2W6AA 1VL2A 2Y9YA 5KLVD 1BGYD 5AW6B 3H1IG 1LGHB 3E1IA 1L2PA 3T97A 2MKVA 4PV1D 1HTLC 2KP8A 2GUSA 4W7YA 1Q82Q 3WU2H 2I1JA 1HJBA 3CWBD 1JM0A 3O6QB 2XNDH 3M06A 3VYIA 2O01J 2M3BA 3LIDA 5AW7B 3L70D 1JY2P 3L74G 5H2FE 1M7LA 1X79B 1KMIZ 3D71A 3AE4C 2C9LY 4N6JA 4XA4A 5AVZB 1NTZJ 3HUSC 3VMXA 2ZVOB 3H1LG 4D6TE 3P32A 5KAIH 1N86A 2AXTH 1L4AB 2K3RA 1X9VA 2C9NY 1R5SA 5AW5B 2ZYGA 1EDLA 1ZN5A 1R5LA 2PFXA 2IZ0A 2E74B 2LKMA 2R3CA 1SQBG 2LXCB 1LTJB 3CMAP 4ASWA 1AA0A 1PP9G 5AW3B 2QE7H 4U3FD 2KSJA 3A0BE 2Q6QA 3CXHE 1RF1B 3L73G 3MD0A 1M1JA 1K05A 1DD4A 1PGOA 4NPEA 1BCCJ 1NO4A 5APUA 1IFNA 2OTLP 1FZGA 2Q9IA 4IFFA 2WWWA 3OW2O 1OIPA 4C7NA 1YI2P 3KYQA 3RK3D 4MN4C 1KTMA 1Y9BA 4AQRD 1A02F 3H1KE 5E79H 3L71J 3SWKA 3L75G 2N9BA 1LTGC 2L5GB 2IPPA 1GL2A 4EYYQ 1NU1G 2QJKB 2L91A 2RN0A 2O3JA 1S3JA 1VQ6P 1U7MA 1SFCC 2E42A 3S1KA 5AW9B 3KDPB 4H44B 2Q7CA 2WTYA 3SFEC 2G3AA 5APYA 2Q3IA 1IFPA 1Y8AA 1J1DB 1OXZA 4Y99B 1JTHB 1ZRTE 5AVSB 3G9RA 1LTAC 2YKQA 2WSEH 4A7PA 3EWKA 4JQ0D 4CPGA 1KILB 3CX5E 1RHZB 2O1KA 1NTKD 2KZJA 1SQPD 4IL6H 4DT0A 1NH4A 2CPSA 2IFMA 5CCGC 3RK2B 1VQ9P 4WVZA 3G71P 1LT9C 1W2BO 5AW0B 2W8ZA 2NPSB 1BE3D 2Z4EA 3H32A 2BCCJ 3K5BA 1NKZB 1VQPP 1VQMP 1MZ9A 2FYUK 5DJTB 4WY4B 2Y0EA 1H0TB 3IF4A 2PAJA 3H1IJ 2FBWC 2QA4P 2SPZA 1UIXA 1YIJP 1YQ3C 2M5AA 2D2CB 2QIWA 2QVAA 3B5NC 3RBZA 3SWYA 5GTHE 3FXEA 2XDJA 5KLVK 2FYUE 3CPWO 5TISH 3L74J 5CHXA 2E5TA 5K5GB 1URQB 5KKZB 3FX0A 3H1LJ 4ZKPA 2WSCH 4DOJA 1T8ZA 3II6A 1NVOA 2YIUB 1LJ2A 2YMKA 2OQQA 3HUSA 3CMEP 1OWAA 1PV3A 3VMAA 1BGYE 1SQBJ 3EQ2A 4EIJA 4RKUJ 5KLVE 1ZMEC 1OMIA 2Y0DA 1L0LG 2XNXA 1VQNP 1N73B 1PP9J 1K73Q 2WSCJ 4W80A 4GODA 1RE3C 3L73J 2IZ1A 3CWBE 1E79H 3F89A 3SSUA 3CCLP 2QJYC 2YO3A 2Q5UA 2JJLA 1JY3P 3L70E 3OJAB 4UB6E 1S9KE 2P58A 2IYOA 3HE5B 3AE1C 2FXMA 4OWFA 1VQLP 3MHVA 3TDKA 1SQXG 2KNCB 1JOCA 2HFED 1WMKA 2WPVB 1NGMB 1NU1J 1AQ5A 1L0ND 1DD3A 4OGQB 2POHA 3AE5C 4XE5B 1H88A 2OYIA 2E76C 2KZIA 1KZUB 1ZLLA 1X8YA 4PD4H 2XKMA 1BSHA 4U3FE 2WPSA 3L73D 1EXIA 4GOFA 3RL0g 2A45I 3O8ZA 3AE9C 1SFCA 2OYHB 3HD7B 1DIPA 1T2KC 3W68A 1PZQA 3H1JD 1PPJD 3RK3E 5CJ4A 1DH3A 1SFCD 1HGVA 2WPQA 4YTPC 3HTKB 1P84H 1ZP0C 2KLVA 1JCDA 2K9JB 4HJGH 2I1KA 1N7SA 1ZR4A 1LT9A 1KQFB 4JF7A 1GW3A 2R5DA 1E5WA 1LWUB 1NTKK 1SQPK 1XTCC 3KZIH 1N7SD 2KS1A 5KAIE 4H0LC 2HG5D 4WWIA 1SQVG 1LTJC 3EFGA 3GMAA 2KLUA 5GTIH 2IBZG 1YITP 2QEXP 1LP1B 4KJMA 5B66H 4N78D 3KPEA 2LR2A 4GDOA 3A3YB 1M56D 1NTKE 1SQPE 5AVWB 2Z5IA 3BCCD 3PP5A 1FOSE 2B88A 4AYCA 3B5NA 1BE3E 3CCEP 2IFNA 2Y0CA 2WT7B 2WSSH 3UIAA 1IJDB 3H1HG 4GIFA 3B5ND 2JO1A 2C0XA 1S72P 1CI6A 2W27A 1JUNA 2QJKC 2V7QJ 5BVZA 4I1LA 2GM4A 3GG2A 2HPCA 2NZ2A 5KAFH 1QL1A 3CLQA 1NKNA 1M57D 2XU6A 2J5UA 1YTZI 3N4XA 2HODB 1EXJA 3L72D 1BDCA 1NTMD 3T97B 1L0LJ 2BEZF 1FZFA 1EZVG 1W2EA 1USEA 3PHLA 3JCUE 5AVTB 2N1TC 5AW4B 1N8RQ 3OAKA 2YXQB 4Y99C 1EDKA 2JWDA 1RE3A 1LTBC 2Q3EA 2ZVNB 3Q5RA 5DJUB 3AEFC 3AE3C 1M8OB 3KXDA 2FYNB 3WUUA 1SQXJ 2OYOA 1AVOA 1FZCC 2R5BA 2QSIA 3AE8C 3I5CA 3A0HH 1YJWP 1KFMA 2V4HA 5B5EH 1SQQD 4D6TG 3V4WA 1KORA 2MJZA 2K88A 1Z56A 1KYOH 1D7MA 1JMBA 2W6JH 5AW1B 1VQKP 1M1JB 2QG4A 1PGJA 2C0WA 1L0NK 3GLMA 4L73A 3TGUD 2E76D 2ZXXA 3MP7B 4C7NB 3CCRP 1VPCA 3G4SP 4RJTA 1S1CX 2A06D 4M3LA 3AEBC 3NXSA 2KYVA 3QWOC 1SQXD 1FE6A 3Q3DA 3FWLA 4JYCA 4U7JA 5KKZC 1JY3O 1GL2B 1AQTA 2FYZA 3SFDC 1T2KD 5KLIC 1L0NE 4LLHA 3M0AA 3S9OA 5TISE 4BRYA 1R8EA 1RF0C 3H1KG 2YMYA 3GF7A 1IFIA 1NTZD 1SQVJ 3BASA 3C1LA 5L8RJ 3ZDMA 4W7ZA 1N73C 2OYIC 4YXWH 2H88C 1LTJA 2QJPB 1XTGB 1ZW0A 4WB4A 3H1JE 3MZWB 5APQA 1PPJE 1RH5B 2B89A 5CCHD 1KYOD 4H0LD 3RGUA 5BU8B 1GU4A 1J1EC 5M1BA 1S5LH 2FXPA 1TU3F 1ZXGA 3M9BA 1BCCD 1Q90D 3C9IA 4UB8H 3CCJP 3TNUA 2E75B 4GKGA 4I6MC 1N7LA 3H1HJ 1EDJA 1GTWA 3FWNA 2OGUA 4TT3H 3HE4A 1X0TA 5APXA 4JYBA 5KJ7C 4ASVA 1RY3A 1N7SC 5AVRB 3L71D 1AJYA 2H8PD 4L75A 1NOHA 3D6ZA 4HH2A 3P8CD 2M5AB 2HYNA 1GZLA 2WZ7A 2ZT9C 2JDIH 4N78E 1AVYA 2WPRA 2OYHC 1VQ8P 1VF5C 1DEBA 1KB9H 4R4LA 2K37A 1EC5A 4BWNA 1VDFA 1KYOI 3GW6A 1K04A 2N1TA 3BCCE 3W67A 1NTMK 1LT1A 4ZMDA 2N1TD 1QLED 5AVYB 4EDFA 2FYUG 2LXBA 3PRJA 4IL6X 2NPSA 2P2UA 1FZCA 4IFDK 3JSVC 4D6TJ 1HUCA 3L72E 3VP9A 1NTME 3A7OA 3RK2D 2J59M 1JMMA 3CCQP 1U7JA 3CXHH 4OH8B 3G3ZA 2NPSD 2BCCD 1FAVA 1PGPA 1T3UA 2RMZA 4QMAA 3E7KA 3H6PA 2W83C 2M8RA 5KLVG 1BGYG 1H0TA 1N2DC 3D70A 1SQQK 1OVRA 1YTZT 1YBKA 3RL0B 3AECC 4WY4D 3H1ID 5GTIE 3V2RA 3CWBG 3G6EP 2FFDB 3CCVP 3V5BA 1Q2NA 1FDOA 1KB9D 3Q2YA 3L70G 4XFJA 2HR3A 4B86A 1USDA 1SQQE 3L74D 3H1KJ 4L76A 3OA7A 2Z5HA 4YPCA 1FBMA 3H1LD 3SWFA 1AV1A 3L75J 1RF0A 2KB7P 2P10A 1MFZA 2KOGA 3CX5H 3TGUE 2IDBA 3Q5SA 3GF3A 3M0DC 1N73A 4U3FG 1SQBD 2A06E 1NTZK 1IFDA 3CXHD 3F5HA 1PP9D 3TK1A 3VMYA 1YJ9P 3E1RA 3KHUA 1KB9I 1Q86Q 3D6YA
chains in the Genus database with same CATH topology
2Q9IA 1FJKA 1LWUC 4IFFA 2WWWA 4C7NA 1FZFA 3KYQA 1W2EA 3HE5A 3RK3D 5AW8B 1LTTC 2VRSA 5AVTB 2N1TC 4AQRD 5AW4B 1A02F 5APVA 3OAKA 4Y99C 3GHGC 3A5TA 1A02J 1FZEA 5APSA 2N9BA 3NTNA 1RE3A 1LTGC 2L5GB 2IPPA 1LTBC 4WY4A 3P7KA 1GL2A 5KJ7A 1RE4C 1G2CB 2R32A 2BASA 3LIEA 1FU1A 2YO2A 1L0LK 1L4AC 1GK4A 5KJ7D 1SFCC 1J2JB 3MTUE 1FZCC 2E42A 2R5BA 5AW9B 3B8EB 3L35A 4ZKUA 3KDPB 1CW5A 5CCHC 2Q7CA 2WTYA 4DZOA 3TYYA 3I5CA 3N7NA 2OYHA 2J58A 3B5NB 5APYA 2Q3IA 4Y99B 1J1DB 1G1JA 1KFMA 1OXZA 3GHGB 2E43A 1JTHB 5AVSB 1PFIA 1URQA 3V4WA 2OYIB 1LTAC 2YKQA 3L4FA 2WSEH 2ZFCA 2MJZA 1RF1C 1Z56A 1KILB 3M91A 3P8MC 1GW4A 2O1KA 3MIWA 1SQXK 5AW1B 1CI6B 3L37A 1NH4A 1M1JB 1URQD 2CPSA 2IFMA 5CCGC 3V2QA 2HPCB 3RK2B 2HLOA 2ZXEB 2C0WA 1HGZA 1L0NK 3NFQA 1LT9C 1NWQA 5AW0B 4I2LC 1SFCB 2NPSB 2JEEA 2Z4EA 1SLQA 1J1EB 3H32A 4C7NB 3P8CE 2YKPA 3BVHA 1VPCA 4M3LA 1NKZB 2FFDA 3NXSA 2KYVA 1IO4A 2W6BA 3RL0D 1MZ9A 5AVUB 2FYUK 4JYCA 1JY2O 2GUVA 4WY4B 1JY3O 1GL2B 2FYZA 1T2KD 2PAJA 5BU5A 4LGDE 4LLHA 3M0AA 5APTA 1N7SB 4KHXA 3BATA 1LT9B 1NHLA 1RF0C 2YMYA 2O1JA 1IFIA 5CJ0A 3U59A 3B5NC 1WRGA 3CL3D 1J1DC 3SWYA 2XDJA 3BASA 2P7JA 5KLVK 1KFNA 1LTIC 3VMZA 4W7ZA 1MV8A 1MUUA 1N73C 2OYIC 5CMZA 5CHXA 1KILC 1URQB 1JO5A 1LTJA 1XTGB 4WB4A 4ZKPA 2WSCH 5APQA 4DOJA 1T8ZA 1M1JC 5APWA 1NAFA 1SVFA 3II6A 3RK3C 3RK2C 5CCHD 2WSFH 2NPSC 3HUSA 3BRTB 5KTBA 2P67A 3R2PA 5BU8B 1EQ7A 1OWAA 1SQVK 2IX7C 1GU4A 1J1EC 1H8AA 4LC1A 3VOPA 5CCGA 2HODA 3HD7A 1FZAA 3EQ2A 3M9BA 4EIJA 1ZV8A 3IR9A 3C9IA 3TNUA 4GKGA 2XNXA 4I6MC 1N73B 1HH0A 1N7LA 4N3YB 2P1JA 4W80A 5CCGD 1GTWA 1RE3C 3HD7D 3M9HA 4WY4C 3HE4A 5APXA 2A45G 1GL2C 4JYBA 5KJ7C 3M0DA 3V2PA 3NMDA 2QM8A 4IFMA 1H89A 3HTKA 1RY3A 1N7SC 3RK3B 5AVRB 4WBAA 2H8PD 1G2CA 1NOHA 2YO3A 2Q5UA 1S9KD 3U1AA 4HH2A 2JJLA 1JY3P 3P8CD 1SQBK 2HYNA 3OJAB 1GZLA 4C7RA 1HBWA 1S9KE 2WZ7A 2QM7A 3WMM0 3U1CA 3HE5B 2FXMA 4N78E 1LWUA 2WPRA 2OYHC 1DEBA 2OARA 1QL2A 1JOCA 1VDFA 4HYTB 2HFED 1URQC 2N1TA 1AQ5A 1FJPA 1IK9A 1NTMK 3GHGA 2POHA 4XE5B 1H88A 2OYIA 1KZUB 1ZLLA 1RE4A 1X8YA 1JY3N 2N1TD 1G1IA 2XKMA 3VTPC 2CPBA 5AVYB 1HWTC 1FDMA 3VN0A 3KQGA 1KQLA 2YKOA 2WPSA 1L4AA 1IC2A 3LW5H 3V4QA 3RL0C 2A45I 3O8ZA 2OYHB 1SFCA 2NPSA 2XV5A 3HD7B 2P2UA 1FZCA 1NU1K 4IFDK 1YYCA 1WT6A 1HUCA 3TSIA 5CCHA 1T2KC 2FFDC 1DX7A 3VP9A 3TNUB 3A7OA 1L4AD 5AW2B 3RK2D 2H43A 2J59M 1JMMA 3HRNA 1CZQA 2WT7A 4OH8B 3G3ZA 5CJ4A 1DH3A 1SFCD 2NPSD 1LTSC 1ZR2A 1HGVA 1IFMA 1FAVA 3HE4B 1SP4A 1FOSF 1T3UA 3A2AA 2WPQA 3L36A 3IFMA 1RF1A 3HTKB 3H6PA 2M8RA 2O01H 1GU5A 1N2DC 2KLVA 1JCDA 2W6AA 3BRVB 1SQQK 4EOTA 2I1KA 1GD2E 1N7SA 5AW6B 4AUWA 1YTZT 1ZR4A 2XZRA 3RL0B 1LGHB 3E1IA 3H32B 3T97A 1LT9A 4WY4D 3VP8A 4JF7A 1GW3A 1GL2D 3V2RA 2R5DA 1E5WA 1LWUB 2PP6A 1NTKK 1SQPK 1XTCC 1HTLC 2KP8A 3M9QA 2GUSA 4W7YA 2FFDB 3V5BA 1N7SD 2I1JA 1HJBA 3M06A 2HG5D 2N1TB 2FKWB 1LTJC 3EFGA 5AVXB 3VYIA 1IFJA 2M3BA 3LIDA 5AW7B 4B86A 1JY2P 1M7LA 1X79B 2C9LY 4N6JA 4XA4A 5AVZB 3HUSC 2YNYA 4N78D 3VMXA 3OA7A 3P32A 2Z5HA 3KPEA 1FBMA 1JNMA 3A3YB 1N86A 3SWFA 1L4AB 1GDTA 3HD7C 5AVWB 1T3JA 1X9VA 2C9NY 1RF0A 5AW5B 1FZBA 2KB7P 3V2NA 2Z5IA 4C46A 3PP5A 1FOSE 1FZCB 1ZN5A 1MFZA 4AYCA 3B5NA 3MUDA 2KOGA 2LKMA 2IFNA 1HVVA 2R3CA 1JTHA 4GT1A 4O9BA 2WT7B 1LTJB 3CI9A 3M0DC 1N73A 2H7HA 5AVVB 1JY2N 1CSBA 1GK6A 3UIAA 1NTZK 1IFDA 2A45H 1IJDB 1KILA 5AW3B 4GIFA 3B5ND 1AFOA 2KSJA 5AVQB 3TK1A 1RF1B 3MD0A 2C0XA 3VMYA 1CI6A 2W27A 1JUNA 3HUSB 1M1JA 5BVZA 2GM4A 4I1LA 2HPCA 1QL1A 3CLQA 1NO4A 2WITA 1NKNA 5APUA 3MGNA 4RESB 1KILD 1JCCA 1IFNA 2XU6A 1YTZI 3N4XA 1FZGA 2HODB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APX A;  4JYB A;  3M0D A;  1GU5 A;  2WWW A;  3NMD A;  2QM8 A;  2W6A A;  4M3L A;  1H89 A;  4C7N A;  3NXS A;  4EOT A;  3HTK A;  1GD2 E;  3HE5 A;  1IO4 A;  5AW8 B;  2VRS A;  5AW6 B;  4AUW A;  5AVR B;  2XZR A;  5AVU B;  5AVT B;  4JYC A;  3T97 A;  4AQR D;  2YO3 A;  2Q5U A;  5AW4 B;  1A02 F;  5APV A;  2R5D A;  3OAK A;  1S9K D;  2JJL A;  3A5T A;  1A02 J;  1GZL A;  1T2K D;  5APS A;  2N9B A;  2KP8 A;  1S9K E;  1HBW A;  2QM7 A;  3NTN A;  3V5B A;  3HE5 B;  3M0A A;  5APT A;  2IPP A;  1HJB A;  4KHX A;  3M06 A;  3P7K A;  1G2C B;  2R32 A;  2WPR A;  2BAS A;  3LIE A;  5AVX B;  3VYI A;  3LID A;  2YO2 A;  4HYT B;  5AW7 B;  4B86 A;  1GK4 A;  2C9L Y;  5AVZ B;  1J2J B;  3M9H A;  2YNY A;  2P7J A;  2E42 A;  3VMX A;  2R5B A;  5AW9 B;  3B8E B;  3L35 A;  4XE5 B;  1MV8 A;  1MUU A;  3KDP B;  3P32 A;  3VMZ A;  2Z5H A;  1H88 A;  2Q7C A;  2WTY A;  1JNM A;  5CMZ A;  4DZO A;  3A3Y B;  3TYY A;  1X8Y A;  3I5C A;  3SWF A;  5AVW B;  3VTP C;  5APY A;  5AVY B;  2Q3I A;  2C9N Y;  1HWT C;  5AW5 B;  1OXZ A;  2E43 A;  2Z5I A;  5APQ A;  3VN0 A;  4C46 A;  3KQG A;  5APW A;  1FOS E;  1KQL A;  1NAF A;  2WPS A;  5AVS B;  3V4W A;  1MFZ A;  4AYC A;  3V4Q A;  2ZFC A;  3O8Z A;  2R3C A;  2XV5 A;  4GT1 A;  3M91 A;  2P2U A;  3P8M C;  2WT7 B;  2P67 A;  1YYC A;  2H7H A;  1OWA A;  5AVV B;  1CSB A;  1GU4 A;  1HUC A;  1CI6 B;  1GK6 A;  5AW1 B;  3UIA A;  1T2K C;  3TNU B;  3A7O A;  3L37 A;  4LC1 A;  1H8A A;  5AW2 B;  5AW3 B;  5AVQ B;  1CZQ A;  2ZXE B;  2WT7 A;  3M9B A;  3TK1 A;  3NFQ A;  1NWQ A;  1DH3 A;  3IR9 A;  3MD0 A;  5AW0 B;  3VMY A;  1CI6 A;  2W27 A;  4I2L C;  1JUN A;  3HE4 B;  1FAV A;  3TNU A;  1SP4 A;  1FOS F;  4GKG A;  3A2A A;  2WPQ A;  1SLQ A;  4I6M C;  5APU A;  3L36 A;  4C7N B;  3MGN A;  4RES B;  1GTW A;  2XU6 A;  3HE4 A; 
#chains in the Genus database with same CATH topology
 1T6A A;  1FJK A;  2W90 A;  1FC2 C;  3HE5 A;  5AW8 B;  1LTT C;  2KI7 B;  5APV A;  1NTZ E;  2KS1 B;  3A5T A;  4NPF X;  1FZE A;  5APS A;  3NTN A;  3L75 D;  3WU2 E;  3P7K A;  5KJ7 A;  1RE4 C;  1G2C B;  2BAS A;  1PGQ A;  3A0H E;  1FU1 A;  1NU1 D;  3CD6 P;  2M3E A;  2RH0 A;  1L4A C;  1VQ4 P;  5GTH H;  1GK4 A;  2OTK E;  5KJ7 D;  3AEE C;  1J2J B;  1KYO E;  3AEG C;  4ZNC A;  3B8E B;  3L35 A;  1OZH A;  5CCH C;  2E74 C;  5C39 A;  1Q7Y Q;  2OYH A;  2J58 A;  2AXT E;  3B5N B;  2IYP A;  3GHG B;  2E43 A;  2JWA A;  1BCC E;  1PFI A;  2ZT9 D;  1KV4 A;  3PLN A;  3L4F A;  1PL5 A;  1RF1 C;  1VF5 D;  1OX3 A;  1NTK G;  3P8M C;  1SQP G;  1OW7 A;  2FYU J;  1CI6 B;  4PD4 D;  1GMJ A;  3V2Q A;  2HPC B;  2HLO A;  1KD1 Q;  2V7Q H;  3H25 A;  1HGZ A;  4I7Z B;  1BE3 G;  3L71 E;  3TF5 A;  4H13 B;  3WUT A;  1BSN A;  3P8C E;  1QVF O;  2YKP A;  3BVH A;  3C8V A;  4RO0 A;  2W6B A;  4BXL A;  5KLV J;  1BGY J;  2JR8 A;  1MKM A;  4PV1 B;  5E79 E;  5BU5 A;  4LGD E;  5APT A;  4JPZ B;  2JKV A;  4KHX A;  1P84 D;  1QVG O;  1NHL A;  4Y28 J;  3PTZ A;  3CWB J;  4H44 C;  2B87 A;  1FS0 E;  1K9M Q;  3U59 A;  1WRG A;  3MUD C;  3AE6 C;  1J1D C;  4PD4 I;  3L70 J;  2P7J A;  1KFN A;  1LTI C;  1MUU A;  2ITA A;  1KIL C;  2Q1K A;  1NJI Q;  5APW A;  4UB8 E;  2WMM A;  1SVF A;  2BCC E;  3RK2 C;  2WSF H;  2NPS C;  3BRT B;  3R2P A;  3CC4 P;  4LC1 A;  3VOP A;  4IL6 E;  2HOD A;  1YQ4 C;  1FZA A;  1OFC X;  4U3F J;  2B9B A;  1P84 I;  1Y47 A;  3H1I E;  1L0L D;  3M9H A;  4WY4 C;  2KXP B;  2A45 G;  4KT0 J;  3M0D A;  3V2P A;  2WSF J;  1KB9 E;  4JBZ A;  3RK3 B;  3FXD A;  4WBA A;  2YXR B;  2DW3 A;  1U57 A;  2D2C C;  1S9K D;  1SQB K;  4NPD A;  2QRX A;  4BRY B;  2ZYD A;  2QM7 A;  4TLF A;  3WMM 0;  3L74 E;  1X22 A;  1YHQ P;  3H1L E;  2OAR A;  3IN6 A;  3O6Q A;  1SS1 A;  1URQ C;  1L0N G;  2ZYA A;  2RKL A;  4H0L B;  3AED C;  1FDI A;  2YIU C;  4EI2 A;  1IK7 A;  1NAY A;  1RE4 A;  1SQB E;  4R4M A;  3VTP C;  2CPB A;  1HWT C;  1Q81 Q;  3VN0 A;  2NRG A;  1PP9 E;  3KQG A;  1L4A A;  1IC2 A;  1M90 Q;  3V4Q A;  3RL0 C;  1W5C E;  3L73 E;  1NU1 K;  4PJ0 H;  5CCH A;  1WT6 A;  3H1J G;  2FFD C;  3TNU B;  1PPJ G;  1L4A D;  4DCK A;  3HRN A;  1NTK J;  3USS A;  1SQP J;  3CCS P;  1LTS C;  1IFM A;  3HE4 B;  1SP4 A;  3A2A A;  2I8D A;  3RBX A;  2E74 D;  3B71 A;  1RF1 A;  1OW8 A;  1JB0 J;  1BE3 J;  1GU5 A;  3L75 E;  3BRV B;  4EOT A;  1GD2 E;  4HKZ H;  4AUW A;  3JCU H;  5CBN A;  4YXD C;  3I55 P;  2XZR A;  1NU1 E;  3H32 B;  1NYH A;  5EFW B;  3VP8 A;  1GL2 D;  2PP6 A;  1BDD A;  1S4X A;  3M9Q A;  2AEJ A;  4DJG A;  4OGQ C;  2ZJS E;  2N1T B;  2FKW B;  5AVX B;  1IFJ A;  2N9Y B;  1SQV D;  2AXC A;  3AE2 C;  2AEF A;  3Q5P A;  2YNY A;  2IBZ D;  3AEA C;  1JNM A;  1GDT A;  3HD7 C;  4PD4 E;  1T3J A;  3BCC G;  1FZB A;  1OVV A;  3V2N A;  4C46 A;  1FZC B;  5H2F H;  3CCU P;  3MUD A;  4K3A A;  1S5L X;  1VQO P;  1HVV A;  4Z1M H;  1JTH A;  4GT1 A;  3ABV C;  4O9B A;  2WSE J;  3CI9 A;  4H44 D;  1HJ0 A;  2H7H A;  5AVV B;  1JY2 N;  1CSB A;  1GK6 A;  2A45 H;  1KIL A;  1QGK B;  5AVQ B;  1AFO A;  1KC8 Q;  3CC2 P;  3H1H D;  2E75 D;  3HUS B;  3CC7 P;  2WIT A;  3MGN A;  3L72 G;  1KIL D;  4RES B;  1NTM G;  1JCC A;  3PJS K;  1LWU C;  3WUV A;  3EFF K;  1VQ7 P;  1P84 E;  3A0B H;  2VRS A;  1KQG B;  2E5Y A;  2M0B A;  1EZV D;  1QX8 A;  3AE7 C;  2IBZ I;  1ZOY C;  3GHG C;  1A02 J;  2PRR A;  1JEK A;  3KZI E;  4WY4 A;  2R32 A;  3LIE A;  2YO2 A;  1L0L K;  5KLI B;  4OVN F;  4I7Z C;  3S4R A;  5TJH A;  3MTU E;  4H13 C;  2KIK A;  2O01 N;  4ZKU A;  5B66 E;  1CW5 A;  1M1K Q;  1L0N J;  4DZO A;  3TYY A;  3N7N A;  2D2C D;  1SQQ G;  1G1J A;  1URQ A;  2BEQ D;  2OYI B;  2OTJ P;  2ZFC A;  4D6T D;  3M91 A;  1GW4 A;  1L0L E;  4PV1 C;  1EZV I;  3MIW A;  1SQX K;  3L37 A;  2K9Y A;  1URQ D;  2ZXE B;  3TGU G;  3NFQ A;  1NWQ A;  4I2L C;  1SFC B;  2JEE A;  3H1J J;  1QEX A;  1SLQ A;  1EDI A;  1J1E B;  5KAF E;  2A06 G;  4HB1 A;  4GOE A;  2CK3 H;  2FFD A;  4L74 A;  1IO4 A;  2GA1 A;  3RL0 D;  5AVU B;  1JY2 O;  1SQX E;  2GUV A;  1KN7 A;  2WQY C;  2K1A A;  2FYN C;  2H89 C;  1N7S B;  3BAT A;  1K8A Q;  1RQU A;  1LT9 B;  5CBO A;  3CCM P;  2Y9Z A;  1NTZ G;  2O1J A;  3H1K D;  5CJ0 A;  2KSE A;  2KK7 A;  2ZT9 B;  2R3S A;  2KNC A;  3CL3 D;  1LNQ A;  2PGD A;  1VF5 B;  4IOI H;  2WVR A;  2ZAE B;  3VMZ A;  1MV8 A;  5CMZ A;  1KQS O;  1JO5 A;  1UII A;  2FXO A;  5B5E E;  1M1J C;  1NAF A;  1OW6 A;  3RK3 C;  3BCC J;  4OGQ D;  3ITK A;  3CXH I;  5KTB A;  2P67 A;  1EQ7 A;  1SQV K;  2IX7 C;  1H8A A;  2R44 A;  5CCG A;  1BCC G;  3IAO A;  3HD7 A;  1ZRT D;  1ZV8 A;  3IR9 A;  1DEE G;  2JP3 A;  2UWJ E;  1HH0 A;  3CX5 D;  4N3Y B;  2P1J A;  5CCG D;  3HD7 D;  1GL2 C;  3NMD A;  2QM8 A;  4IFM A;  1H89 A;  3L71 G;  3HTK A;  1RQV A;  3JC2 2;  3L72 J;  1NTM J;  1G2C A;  1SQV E;  2K9J A;  3U1A A;  1MFT A;  4C7R A;  1HBW A;  3U1C A;  2B87 B;  1LWU A;  2IBZ E;  1QL2 A;  4HYT B;  2QJP C;  4K35 A;  1FJP A;  1IK9 A;  4UB6 H;  3GHG A;  1YJN P;  3PH0 A;  2QJY B;  2FY8 A;  4PJ0 E;  1JY3 N;  1G1I A;  1LP1 A;  2KUB A;  3V6I A;  3CX5 I;  1PIX A;  1FDM A;  1KQL A;  2YKO A;  3H1H E;  3LW5 H;  1OVU A;  2FYU D;  1SQQ J;  2XV5 A;  3R4Y A;  2E75 C;  3B4S A;  1KIL E;  1YYC A;  1VQ5 P;  3TSI A;  1DX7 A;  3I56 P;  2AEM A;  5AW2 B;  2H43 A;  1S5L E;  2BCC G;  1CZQ A;  2WT7 A;  1HF9 A;  2G8Y A;  3FGA D;  1S2E A;  1EZV E;  1ZR2 A;  1IZN B;  4H13 D;  1FOS F;  2E76 B;  3L36 A;  3IFM A;  3QH9 A;  3TGU J;  3LW5 J;  3Q1M A;  2O01 H;  2W6A A;  1VL2 A;  2Y9Y A;  5KLV D;  1BGY D;  5AW6 B;  3H1I G;  1LGH B;  3E1I A;  1L2P A;  3T97 A;  2MKV A;  4PV1 D;  1HTL C;  2KP8 A;  2GUS A;  4W7Y A;  1Q82 Q;  3WU2 H;  2I1J A;  1HJB A;  3CWB D;  1JM0 A;  3O6Q B;  2XND H;  3M06 A;  3VYI A;  2O01 J;  2M3B A;  3LID A;  5AW7 B;  3L70 D;  1JY2 P;  3L74 G;  5H2F E;  1M7L A;  1X79 B;  1KMI Z;  3D71 A;  3AE4 C;  2C9L Y;  4N6J A;  4XA4 A;  5AVZ B;  1NTZ J;  3HUS C;  3VMX A;  2ZVO B;  3H1L G;  4D6T E;  3P32 A;  5KAI H;  1N86 A;  2AXT H;  1L4A B;  2K3R A;  1X9V A;  2C9N Y;  1R5S A;  5AW5 B;  2ZYG A;  1EDL A;  1ZN5 A;  1R5L A;  2PFX A;  2IZ0 A;  2E74 B;  2LKM A;  2R3C A;  1SQB G;  2LXC B;  1LTJ B;  3CMA P;  4ASW A;  1AA0 A;  1PP9 G;  5AW3 B;  2QE7 H;  4U3F D;  2KSJ A;  3A0B E;  2Q6Q A;  3CXH E;  1RF1 B;  3L73 G;  3MD0 A;  1M1J A;  1K05 A;  1DD4 A;  1PGO A;  4NPE A;  1BCC J;  1NO4 A;  5APU A;  1IFN A;  2OTL P;  1FZG A;  2Q9I A;  4IFF A;  2WWW A;  3OW2 O;  1OIP A;  4C7N A;  1YI2 P;  3KYQ A;  3RK3 D;  4MN4 C;  1KTM A;  1Y9B A;  4AQR D;  1A02 F;  3H1K E;  5E79 H;  3L71 J;  3SWK A;  3L75 G;  2N9B A;  1LTG C;  2L5G B;  2IPP A;  1GL2 A;  4EYY Q;  1NU1 G;  2QJK B;  2L91 A;  2RN0 A;  2O3J A;  1S3J A;  1VQ6 P;  1U7M A;  1SFC C;  2E42 A;  3S1K A;  5AW9 B;  3KDP B;  4H44 B;  2Q7C A;  2WTY A;  3SFE C;  2G3A A;  5APY A;  2Q3I A;  1IFP A;  1Y8A A;  1J1D B;  1OXZ A;  4Y99 B;  1JTH B;  1ZRT E;  5AVS B;  3G9R A;  1LTA C;  2YKQ A;  2WSE H;  4A7P A;  3EWK A;  4JQ0 D;  4CPG A;  1KIL B;  3CX5 E;  1RHZ B;  2O1K A;  1NTK D;  2KZJ A;  1SQP D;  4IL6 H;  4DT0 A;  1NH4 A;  2CPS A;  2IFM A;  5CCG C;  3RK2 B;  1VQ9 P;  4WVZ A;  3G71 P;  1LT9 C;  1W2B O;  5AW0 B;  2W8Z A;  2NPS B;  1BE3 D;  2Z4E A;  3H32 A;  2BCC J;  3K5B A;  1NKZ B;  1VQP P;  1VQM P;  1MZ9 A;  2FYU K;  5DJT B;  4WY4 B;  2Y0E A;  1H0T B;  3IF4 A;  2PAJ A;  3H1I J;  2FBW C;  2QA4 P;  2SPZ A;  1UIX A;  1YIJ P;  1YQ3 C;  2M5A A;  2D2C B;  2QIW A;  2QVA A;  3B5N C;  3RBZ A;  3SWY A;  5GTH E;  3FXE A;  2XDJ A;  5KLV K;  2FYU E;  3CPW O;  5TIS H;  3L74 J;  5CHX A;  2E5T A;  5K5G B;  1URQ B;  5KKZ B;  3FX0 A;  3H1L J;  4ZKP A;  2WSC H;  4DOJ A;  1T8Z A;  3II6 A;  1NVO A;  2YIU B;  1LJ2 A;  2YMK A;  2OQQ A;  3HUS A;  3CME P;  1OWA A;  1PV3 A;  3VMA A;  1BGY E;  1SQB J;  3EQ2 A;  4EIJ A;  4RKU J;  5KLV E;  1ZME C;  1OMI A;  2Y0D A;  1L0L G;  2XNX A;  1VQN P;  1N73 B;  1PP9 J;  1K73 Q;  2WSC J;  4W80 A;  4GOD A;  1RE3 C;  3L73 J;  2IZ1 A;  3CWB E;  1E79 H;  3F89 A;  3SSU A;  3CCL P;  2QJY C;  2YO3 A;  2Q5U A;  2JJL A;  1JY3 P;  3L70 E;  3OJA B;  4UB6 E;  1S9K E;  2P58 A;  2IYO A;  3HE5 B;  3AE1 C;  2FXM A;  4OWF A;  1VQL P;  3MHV A;  3TDK A;  1SQX G;  2KNC B;  1JOC A;  2HFE D;  1WMK A;  2WPV B;  1NGM B;  1NU1 J;  1AQ5 A;  1L0N D;  1DD3 A;  4OGQ B;  2POH A;  3AE5 C;  4XE5 B;  1H88 A;  2OYI A;  2E76 C;  2KZI A;  1KZU B;  1ZLL A;  1X8Y A;  4PD4 H;  2XKM A;  1BSH A;  4U3F E;  2WPS A;  3L73 D;  1EXI A;  4GOF A;  3RL0 g;  2A45 I;  3O8Z A;  3AE9 C;  1SFC A;  2OYH B;  3HD7 B;  1DIP A;  1T2K C;  3W68 A;  1PZQ A;  3H1J D;  1PPJ D;  3RK3 E;  5CJ4 A;  1DH3 A;  1SFC D;  1HGV A;  2WPQ A;  4YTP C;  3HTK B;  1P84 H;  1ZP0 C;  2KLV A;  1JCD A;  2K9J B;  4HJG H;  2I1K A;  1N7S A;  1ZR4 A;  1LT9 A;  1KQF B;  4JF7 A;  1GW3 A;  2R5D A;  1E5W A;  1LWU B;  1NTK K;  1SQP K;  1XTC C;  3KZI H;  1N7S D;  2KS1 A;  5KAI E;  4H0L C;  2HG5 D;  4WWI A;  1SQV G;  1LTJ C;  3EFG A;  3GMA A;  2KLU A;  5GTI H;  2IBZ G;  1YIT P;  2QEX P;  1LP1 B;  4KJM A;  5B66 H;  4N78 D;  3KPE A;  2LR2 A;  4GDO A;  3A3Y B;  1M56 D;  1NTK E;  1SQP E;  5AVW B;  2Z5I A;  3BCC D;  3PP5 A;  1FOS E;  2B88 A;  4AYC A;  3B5N A;  1BE3 E;  3CCE P;  2IFN A;  2Y0C A;  2WT7 B;  2WSS H;  3UIA A;  1IJD B;  3H1H G;  4GIF A;  3B5N D;  2JO1 A;  2C0X A;  1S72 P;  1CI6 A;  2W27 A;  1JUN A;  2QJK C;  2V7Q J;  5BVZ A;  4I1L A;  2GM4 A;  3GG2 A;  2HPC A;  2NZ2 A;  5KAF H;  1QL1 A;  3CLQ A;  1NKN A;  1M57 D;  2XU6 A;  2J5U A;  1YTZ I;  3N4X A;  2HOD B;  1EXJ A;  3L72 D;  1BDC A;  1NTM D;  3T97 B;  1L0L J;  2BEZ F;  1FZF A;  1EZV G;  1W2E A;  1USE A;  3PHL A;  3JCU E;  5AVT B;  2N1T C;  5AW4 B;  1N8R Q;  3OAK A;  2YXQ B;  4Y99 C;  1EDK A;  2JWD A;  1RE3 A;  1LTB C;  2Q3E A;  2ZVN B;  3Q5R A;  5DJU B;  3AEF C;  3AE3 C;  1M8O B;  3KXD A;  2FYN B;  3WUU A;  1SQX J;  2OYO A;  1AVO A;  1FZC C;  2R5B A;  2QSI A;  3AE8 C;  3I5C A;  3A0H H;  1YJW P;  1KFM A;  2V4H A;  5B5E H;  1SQQ D;  4D6T G;  3V4W A;  1KOR A;  2MJZ A;  2K88 A;  1Z56 A;  1KYO H;  1D7M A;  1JMB A;  2W6J H;  5AW1 B;  1VQK P;  1M1J B;  2QG4 A;  1PGJ A;  2C0W A;  1L0N K;  3GLM A;  4L73 A;  3TGU D;  2E76 D;  2ZXX A;  3MP7 B;  4C7N B;  3CCR P;  1VPC A;  3G4S P;  4RJT A;  1S1C X;  2A06 D;  4M3L A;  3AEB C;  3NXS A;  2KYV A;  3QWO C;  1SQX D;  1FE6 A;  3Q3D A;  3FWL A;  4JYC A;  4U7J A;  5KKZ C;  1JY3 O;  1GL2 B;  1AQT A;  2FYZ A;  3SFD C;  1T2K D;  5KLI C;  1L0N E;  4LLH A;  3M0A A;  3S9O A;  5TIS E;  4BRY A;  1R8E A;  1RF0 C;  3H1K G;  2YMY A;  3GF7 A;  1IFI A;  1NTZ D;  1SQV J;  3BAS A;  3C1L A;  5L8R J;  3ZDM A;  4W7Z A;  1N73 C;  2OYI C;  4YXW H;  2H88 C;  1LTJ A;  2QJP B;  1XTG B;  1ZW0 A;  4WB4 A;  3H1J E;  3MZW B;  5APQ A;  1PPJ E;  1RH5 B;  2B89 A;  5CCH D;  1KYO D;  4H0L D;  3RGU A;  5BU8 B;  1GU4 A;  1J1E C;  5M1B A;  1S5L H;  2FXP A;  1TU3 F;  1ZXG A;  3M9B A;  1BCC D;  1Q90 D;  3C9I A;  4UB8 H;  3CCJ P;  3TNU A;  2E75 B;  4GKG A;  4I6M C;  1N7L A;  3H1H J;  1EDJ A;  1GTW A;  3FWN A;  2OGU A;  4TT3 H;  3HE4 A;  1X0T A;  5APX A;  4JYB A;  5KJ7 C;  4ASV A;  1RY3 A;  1N7S C;  5AVR B;  3L71 D;  1AJY A;  2H8P D;  4L75 A;  1NOH A;  3D6Z A;  4HH2 A;  3P8C D;  2M5A B;  2HYN A;  1GZL A;  2WZ7 A;  2ZT9 C;  2JDI H;  4N78 E;  1AVY A;  2WPR A;  2OYH C;  1VQ8 P;  1VF5 C;  1DEB A;  1KB9 H;  4R4L A;  2K37 A;  1EC5 A;  4BWN A;  1VDF A;  1KYO I;  3GW6 A;  1K04 A;  2N1T A;  3BCC E;  3W67 A;  1NTM K;  1LT1 A;  4ZMD A;  2N1T D;  1QLE D;  5AVY B;  4EDF A;  2FYU G;  2LXB A;  3PRJ A;  4IL6 X;  2NPS A;  2P2U A;  1FZC A;  4IFD K;  3JSV C;  4D6T J;  1HUC A;  3L72 E;  3VP9 A;  1NTM E;  3A7O A;  3RK2 D;  2J59 M;  1JMM A;  3CCQ P;  1U7J A;  3CXH H;  4OH8 B;  3G3Z A;  2NPS D;  2BCC D;  1FAV A;  1PGP A;  1T3U A;  2RMZ A;  4QMA A;  3E7K A;  3H6P A;  2W83 C;  2M8R A;  5KLV G;  1BGY G;  1H0T A;  1N2D C;  3D70 A;  1SQQ K;  1OVR A;  1YTZ T;  1YBK A;  3RL0 B;  3AEC C;  4WY4 D;  3H1I D;  5GTI E;  3V2R A;  3CWB G;  3G6E P;  2FFD B;  3CCV P;  3V5B A;  1Q2N A;  1FDO A;  1KB9 D;  3Q2Y A;  3L70 G;  4XFJ A;  2HR3 A;  4B86 A;  1USD A;  1SQQ E;  3L74 D;  3H1K J;  4L76 A;  3OA7 A;  2Z5H A;  4YPC A;  1FBM A;  3H1L D;  3SWF A;  1AV1 A;  3L75 J;  1RF0 A;  2KB7 P;  2P10 A;  1MFZ A;  2KOG A;  3CX5 H;  3TGU E;  2IDB A;  3Q5S A;  3GF3 A;  3M0D C;  1N73 A;  4U3F G;  1SQB D;  2A06 E;  1NTZ K;  1IFD A;  3CXH D;  3F5H A;  1PP9 D;  3TK1 A;  3VMY A;  1YJ9 P;  3E1R A;  3KHU A;  1KB9 I;  1Q86 Q;  3D6Y A; 
#chains in the Genus database with same CATH homology
 2Q9I A;  1FJK A;  1LWU C;  4IFF A;  2WWW A;  4C7N A;  1FZF A;  3KYQ A;  1W2E A;  3HE5 A;  3RK3 D;  5AW8 B;  1LTT C;  2VRS A;  5AVT B;  2N1T C;  4AQR D;  5AW4 B;  1A02 F;  5APV A;  3OAK A;  4Y99 C;  3GHG C;  3A5T A;  1A02 J;  1FZE A;  5APS A;  2N9B A;  3NTN A;  1RE3 A;  1LTG C;  2L5G B;  2IPP A;  1LTB C;  4WY4 A;  3P7K A;  1GL2 A;  5KJ7 A;  1RE4 C;  1G2C B;  2R32 A;  2BAS A;  3LIE A;  1FU1 A;  2YO2 A;  1L0L K;  1L4A C;  1GK4 A;  5KJ7 D;  1SFC C;  1J2J B;  3MTU E;  1FZC C;  2E42 A;  2R5B A;  5AW9 B;  3B8E B;  3L35 A;  4ZKU A;  3KDP B;  1CW5 A;  5CCH C;  2Q7C A;  2WTY A;  4DZO A;  3TYY A;  3I5C A;  3N7N A;  2OYH A;  2J58 A;  3B5N B;  5APY A;  2Q3I A;  4Y99 B;  1J1D B;  1G1J A;  1KFM A;  1OXZ A;  3GHG B;  2E43 A;  1JTH B;  5AVS B;  1PFI A;  1URQ A;  3V4W A;  2OYI B;  1LTA C;  2YKQ A;  3L4F A;  2WSE H;  2ZFC A;  2MJZ A;  1RF1 C;  1Z56 A;  1KIL B;  3M91 A;  3P8M C;  1GW4 A;  2O1K A;  3MIW A;  1SQX K;  5AW1 B;  1CI6 B;  3L37 A;  1NH4 A;  1M1J B;  1URQ D;  2CPS A;  2IFM A;  5CCG C;  3V2Q A;  2HPC B;  3RK2 B;  2HLO A;  2ZXE B;  2C0W A;  1HGZ A;  1L0N K;  3NFQ A;  1LT9 C;  1NWQ A;  5AW0 B;  4I2L C;  1SFC B;  2NPS B;  2JEE A;  2Z4E A;  1SLQ A;  1J1E B;  3H32 A;  4C7N B;  3P8C E;  2YKP A;  3BVH A;  1VPC A;  4M3L A;  1NKZ B;  2FFD A;  3NXS A;  2KYV A;  1IO4 A;  2W6B A;  3RL0 D;  1MZ9 A;  5AVU B;  2FYU K;  4JYC A;  1JY2 O;  2GUV A;  4WY4 B;  1JY3 O;  1GL2 B;  2FYZ A;  1T2K D;  2PAJ A;  5BU5 A;  4LGD E;  4LLH A;  3M0A A;  5APT A;  1N7S B;  4KHX A;  3BAT A;  1LT9 B;  1NHL A;  1RF0 C;  2YMY A;  2O1J A;  1IFI A;  5CJ0 A;  3U59 A;  3B5N C;  1WRG A;  3CL3 D;  1J1D C;  3SWY A;  2XDJ A;  3BAS A;  2P7J A;  5KLV K;  1KFN A;  1LTI C;  3VMZ A;  4W7Z A;  1MV8 A;  1MUU A;  1N73 C;  2OYI C;  5CMZ A;  5CHX A;  1KIL C;  1URQ B;  1JO5 A;  1LTJ A;  1XTG B;  4WB4 A;  4ZKP A;  2WSC H;  5APQ A;  4DOJ A;  1T8Z A;  1M1J C;  5APW A;  1NAF A;  1SVF A;  3II6 A;  3RK3 C;  3RK2 C;  5CCH D;  2WSF H;  2NPS C;  3HUS A;  3BRT B;  5KTB A;  2P67 A;  3R2P A;  5BU8 B;  1EQ7 A;  1OWA A;  1SQV K;  2IX7 C;  1GU4 A;  1J1E C;  1H8A A;  4LC1 A;  3VOP A;  5CCG A;  2HOD A;  3HD7 A;  1FZA A;  3EQ2 A;  3M9B A;  4EIJ A;  1ZV8 A;  3IR9 A;  3C9I A;  3TNU A;  4GKG A;  2XNX A;  4I6M C;  1N73 B;  1HH0 A;  1N7L A;  4N3Y B;  2P1J A;  4W80 A;  5CCG D;  1GTW A;  1RE3 C;  3HD7 D;  3M9H A;  4WY4 C;  3HE4 A;  5APX A;  2A45 G;  1GL2 C;  4JYB A;  5KJ7 C;  3M0D A;  3V2P A;  3NMD A;  2QM8 A;  4IFM A;  1H89 A;  3HTK A;  1RY3 A;  1N7S C;  3RK3 B;  5AVR B;  4WBA A;  2H8P D;  1G2C A;  1NOH A;  2YO3 A;  2Q5U A;  1S9K D;  3U1A A;  4HH2 A;  2JJL A;  1JY3 P;  3P8C D;  1SQB K;  2HYN A;  3OJA B;  1GZL A;  4C7R A;  1HBW A;  1S9K E;  2WZ7 A;  2QM7 A;  3WMM 0;  3U1C A;  3HE5 B;  2FXM A;  4N78 E;  1LWU A;  2WPR A;  2OYH C;  1DEB A;  2OAR A;  1QL2 A;  1JOC A;  1VDF A;  4HYT B;  2HFE D;  1URQ C;  2N1T A;  1AQ5 A;  1FJP A;  1IK9 A;  1NTM K;  3GHG A;  2POH A;  4XE5 B;  1H88 A;  2OYI A;  1KZU B;  1ZLL A;  1RE4 A;  1X8Y A;  1JY3 N;  2N1T D;  1G1I A;  2XKM A;  3VTP C;  2CPB A;  5AVY B;  1HWT C;  1FDM A;  3VN0 A;  3KQG A;  1KQL A;  2YKO A;  2WPS A;  1L4A A;  1IC2 A;  3LW5 H;  3V4Q A;  3RL0 C;  2A45 I;  3O8Z A;  2OYH B;  1SFC A;  2NPS A;  2XV5 A;  3HD7 B;  2P2U A;  1FZC A;  1NU1 K;  4IFD K;  1YYC A;  1WT6 A;  1HUC A;  3TSI A;  5CCH A;  1T2K C;  2FFD C;  1DX7 A;  3VP9 A;  3TNU B;  3A7O A;  1L4A D;  5AW2 B;  3RK2 D;  2H43 A;  2J59 M;  1JMM A;  3HRN A;  1CZQ A;  2WT7 A;  4OH8 B;  3G3Z A;  5CJ4 A;  1DH3 A;  1SFC D;  2NPS D;  1LTS C;  1ZR2 A;  1HGV A;  1IFM A;  1FAV A;  3HE4 B;  1SP4 A;  1FOS F;  1T3U A;  3A2A A;  2WPQ A;  3L36 A;  3IFM A;  1RF1 A;  3HTK B;  3H6P A;  2M8R A;  2O01 H;  1GU5 A;  1N2D C;  2KLV A;  1JCD A;  2W6A A;  3BRV B;  1SQQ K;  4EOT A;  2I1K A;  1GD2 E;  1N7S A;  5AW6 B;  4AUW A;  1YTZ T;  1ZR4 A;  2XZR A;  3RL0 B;  1LGH B;  3E1I A;  3H32 B;  3T97 A;  1LT9 A;  4WY4 D;  3VP8 A;  4JF7 A;  1GW3 A;  1GL2 D;  3V2R A;  2R5D A;  1E5W A;  1LWU B;  2PP6 A;  1NTK K;  1SQP K;  1XTC C;  1HTL C;  2KP8 A;  3M9Q A;  2GUS A;  4W7Y A;  2FFD B;  3V5B A;  1N7S D;  2I1J A;  1HJB A;  3M06 A;  2HG5 D;  2N1T B;  2FKW B;  1LTJ C;  3EFG A;  5AVX B;  3VYI A;  1IFJ A;  2M3B A;  3LID A;  5AW7 B;  4B86 A;  1JY2 P;  1M7L A;  1X79 B;  2C9L Y;  4N6J A;  4XA4 A;  5AVZ B;  3HUS C;  2YNY A;  4N78 D;  3VMX A;  3OA7 A;  3P32 A;  2Z5H A;  3KPE A;  1FBM A;  1JNM A;  3A3Y B;  1N86 A;  3SWF A;  1L4A B;  1GDT A;  3HD7 C;  5AVW B;  1T3J A;  1X9V A;  2C9N Y;  1RF0 A;  5AW5 B;  1FZB A;  2KB7 P;  3V2N A;  2Z5I A;  4C46 A;  3PP5 A;  1FOS E;  1FZC B;  1ZN5 A;  1MFZ A;  4AYC A;  3B5N A;  3MUD A;  2KOG A;  2LKM A;  2IFN A;  1HVV A;  2R3C A;  1JTH A;  4GT1 A;  4O9B A;  2WT7 B;  1LTJ B;  3CI9 A;  3M0D C;  1N73 A;  2H7H A;  5AVV B;  1JY2 N;  1CSB A;  1GK6 A;  3UIA A;  1NTZ K;  1IFD A;  2A45 H;  1IJD B;  1KIL A;  5AW3 B;  4GIF A;  3B5N D;  1AFO A;  2KSJ A;  5AVQ B;  3TK1 A;  1RF1 B;  3MD0 A;  2C0X A;  3VMY A;  1CI6 A;  2W27 A;  1JUN A;  3HUS B;  1M1J A;  5BVZ A;  2GM4 A;  4I1L A;  2HPC A;  1QL1 A;  3CLQ A;  1NO4 A;  2WIT A;  1NKN A;  5APU A;  3MGN A;  4RES B;  1KIL D;  1JCC A;  1IFN A;  2XU6 A;  1YTZ I;  3N4X A;  1FZG A;  2HOD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...