3WUVA

Structure basis of inactivating cell abscission with chimera peptide 2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
56
structure length
56
Chain Sequence
GAMGSFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Centrosomal protein of 55 kDa
publication title Structural and biochemical insights into the role of testis-expressed gene 14 (TEX14) in forming the stable intercellular bridges of germ cells
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 56
sequence length 56
chains with identical sequence B, D, E, G, H, J, K, M, N, P, Q
ec nomenclature
pdb deposition date 2014-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12180 EABR TSG101 and ALIX binding domain of CEP55
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 3wuvA00
4BRYB 3WUTA 4BRYA 1UIIA 2Q6QA 3WUUA 3WUVA 2WVRA 2ZXXA 3F5HA 3E1RA
chains in the Genus database with same CATH superfamily
3P32A 1K04A 3A2AA 4NPFX 1URQB 4D6TJ 1MFZA 1KV4A 4DJGA 3CWBG 1N7SC 3G9RA 1EZVG 2P10A 1BCCD 1JB0J 3OA7A 4HB1A 3QWOC 1PP9J 1GDTA 2KLVA 2N1TB 3E7KA 3USSA 3H1JE 1JEKA 1PZQA 1FS0E 3GF7A 1IJDB 1EDKA 4H13D 5CMZA 2W83C 1N8RQ 3V6IA 2JJLA 4WBAA 1DIPA 1Y47A 3W68A 2R5BA 2M3EA 1VQPP 1X22A 3L73D 2H89C 2V4HA 3H1IG 3TGUG 5KJ7A 3A3YB 1NTZJ 2WPQA 2AXTH 1H88A 3GMAA 2OTJP 1SFCB 1ZXGA 1U7JA 2QJYB 1LWUB 3LIDA 1L0NK 1VQKP 1VQ9P 3H1LD 2ZXXA 2E5TA 2W27A 2ZAEB 3L71G 2N9BA 2AEMA 2FYZA 1OVRA 3NTNA 3IN6A 3KXDA 1NOHA 1U57A 2JDIH 3MP7B 1KN7A 3GHGC 2FXOA 1KORA 1PGPA 2HLOA 3RK3D 1LTBC 5B66E 3AE6C 1K8AQ 1PPJG 4WB4A 4ZKPA 2P58A 1EZVI 1SQVJ 4D6TG 3ITKA 5E79H 2BCCE 3H1LJ 2YMKA 2ZYGA 3SFEC 3AE4C 3I55P 1PP9G 1N7SB 2A45H 5AW1B 3WUVA 1WT6A 4UB6E 2ZVNB 5KLVK 5C39A 3L72E 1PGOA 2A06G 2QVAA 2O1JA 1NU1D 5CCGC 1NTMJ 2Q5UA 3QH9A 2WPRA 4OH8B 2ZT9D 5M1BA 1NTZG 3SWKA 1BDDA 3G71P 1FOSF 4AYCA 2FYUK 3GLMA 3MTUE 1ZP0C 3FXEA 5CCGA 4ZKUA 1G1IA 1S3JA 5TISH 2IFNA 3B5NC 1SQPE 2W8ZA 1NU1J 3IFMA 2HODA 4I7ZC 3CX5D 1CI6A 3H1IE 3N7NA 1NWQA 3CX5H 1SQXD 2NPSC 5KLIC 2JO1A 1FZCC 1BE3D 1TU3F 2ZVOB 2OYIC 2E74C 3GHGB 2LR2A 4L74A 2KK7A 1SQVG 2Q7CA 3LW5H 3A0HE 2PP6A 2OQQA 1QL1A 4BWNA 3B5NA 2KP8A 2XKMA 3H1LG 1QGKB 1LTJA 2NPSA 1OWAA 5APQA 1VPCA 2Y9YA 2E76B 3F89A 2QM7A 1L0LE 2M8RA 5DJTB 2OYIA 1VQLP 3L4FA 3D70A 2XNDH 1SQXJ 2AXCA 4UB8H 1KQFB 2IBZE 3CCLP 3V5BA 1AV1A 4ZMDA 1Q2NA 3HD7C 4ASWA 3U1CA 3D6YA 1HGVA 3U1AA 3LW5J 3GF3A 2QJKC 1NTMG 1AFOA 5AW5B 4GKGA 1YYCA 2P7JA 1M90Q 4DOJA 4XE5B 3KPEA 2E43A 4DT0A 3ABVC 2A45G 3H1JD 3HD7A 2RN0A 3SWFA 3RBXA 1JCDA 1RF0C 2QM8A 1CI6B 3RK3C 1OVVA 1RQVA 2A06E 4LC1A 5AVYB 3BRVB 1IO4A 1JY3O 1Q81Q 2C9LY 1OW8A 2ZJSE 3KZIE 2JKVA 1NU1G 2B88A 1AJYA 2K3RA 2KUBA 1WRGA 1NTZE 3L75D 3B5NB 1SQQE 1X79B 1YITP 2K9JA 1ZMEC 4I7ZB 1MUUA 1KB9E 4EI2A 4YXWH 2GM4A 3H1JJ 2NPSB 4WY4D 5KLIB 3CCQP 1FZCB 2C0XA 1AQ5A 2QRXA 2OYIB 2E74B 1S1CX 3FXDA 2E75D 2VRSA 4H13B 4IFFA 3L74D 2WT7A 2FFDC 4L76A 3NFQA 2ZT9C 3MUDC 2V7QH 3M06A 5AW0B 1NYHA 1Q7YQ 3BRTB 3AE3C 1L4AD 3VMYA 3CCVP 2IPPA 3HD7B 3FGAD 1RY3A 3Q5RA 4PD4E 1HWTC 2WQYC 2A45I 2RMZA 2KOGA 3OJAB 2FFDA 1AQTA 2PRRA 3CCUP 1EDJA 5AW9B 3GG2A 5AVXB 4IL6E 1HJBA 4UB6H 1KTMA 2K88A 1VQ7P 1YI2P 2V7QJ 5AW2B 2ZXEB 3PHLA 4N3YB 1EZVD 2ZYAA 1EXIA 2YXQB 5GTIE 3RK3B 2BCCJ 3T97B 4KT0J 1SQBK 2WTYA 3H32B 2FBWC 3C1LA 3II6A 4R4LA 1ZRTE 1PFIA 2WZ7A 2R3CA 1NTKE 1GW3A 1YIJP 3HUSC 3H1JG 2Z5IA 1URQC 1U7MA 1OIPA 2JWDA 2D2CD 1X9VA 3C8VA 1ZOYC 2IZ0A 3L72J 2Z4EA 4I6MC 2WT7B 4GIFA 3CX5I 2N1TC 1CZQA 1E79H 3I5CA 2M0BA 3BVHA 3H1ID 1J1EC 1Y8AA 3CCMP 3HUSA 1URQA 2XNXA 1M57D 3KQGA 1W2EA 1KD1Q 2Q6QA 1NAFA 2QEXP 1T3UA 3AE2C 2ZT9B 2QG4A 3L71D 1GZLA 2N1TA 2Q3IA 3B4SA 4C7RA 4EDFA 2KB7P 1SQPJ 4ZNCA 3WUTA 1KQLA 1L0LD 1L0NJ 3H1IJ 1NJIQ 3CPWO 1XTGB 2QJYC 4PV1C 2QIWA 2IBZD 1LWUC 5CBNA 3HRNA 2JWAA 1KYOE 5H2FE 1JCCA 4D6TD 1YBKA 2MKVA 3IF4A 4PJ0H 2CPSA 4Y28J 1VF5D 2BCCG 5BVZA 1PP9D 2FYNC 2MJZA 1LWUA 3K5BA 4U7JA 1LTTC 1LTSC 2IFMA 3S4RA 1L0LJ 1PIXA 3V4WA 1DEEG 2C0WA 2B9BA 4JBZA 3U59A 2A06D 2NRGA 2G3AA 3HUSB 3L72G 1NAYA 1IFPA 3RK2D 1VQ4P 3KZIH 2RH0A 3Q3DA 4R4MA 1L4AC 1LT9C 1NTZD 1SQQD 3TF5A 3UIAA 1KB9H 1J1EB 1BSNA 1VL2A 1N7SA 4EYYQ 2O1KA 2L91A 4BXLA 4B86A 2OTLP 5KAFE 5EFWB 1LT9A 1SQPG 4K35A 3CMEP 5CCHD 2WPSA 2YXRB 1L0NG 3VYIA 2XV5A 2GUVA 4IFDK 1SQQJ 4KJMA 2BEQD 1S5LE 3RL0D 1SQVD 2JEEA 2WSEJ 4PV1B 4OVNF 1RE4C 3CC4P 1YQ3C 1IFDA 1NKNA 1FZFA 1JM0A 5APUA 1DD4A 1KZUB 3N4XA 3LIEA 1L0LG 1FU1A 3CL3D 5GTHH 2KLUA 2KSEA 4IL6H 1XTCC 2FYNB 4EOTA 2IBZG 2XU6A 1AVYA 4I1LA 1RE4A 1YJ9P 2FXPA 2PFXA 1IFNA 4ASVA 1H8AA 1HBWA 4OGQD 3AE5C 4GOEA 3PTZA 1NTMD 3Q5PA 2E76C 1N7LA 3BATA 4TT3H 2Q9IA 1KILD 2LKMA 3CLQA 5GTIH 3GHGA 3M0DC 3O8ZA 1M56D 1NTKD 5AW7B 1GL2C 4DCKA 1L4AB 2ZYDA 1LT9B 5APSA 4MN4C 2PGDA 2FY8A 1JY2P 2R32A 1K9MQ 3M0DA 3R4YA 4N78E 1E5WA 3AE1C 4IOIH 4H0LC 1EC5A 1W2BO 1S9KE 1SQQG 1X0TA 2BASA 5DJUB 2PAJA 1NTKJ 4CPGA 2OYHC 1S2EA 4AQRD 1EXJA 2W6AA 2QSIA 3WU2E 3A0BE 1JNMA 1SS1A 2J59M 3AEGC 1L0NE 3RK2C 3JSVC 1LNQA 4EIJA 1KC8Q 2HG5D 3JC22 2IBZI 4OWFA 1KFNA 3C9IA 2OYHA 1GU5A 1KYOD 2C9NY 5H2FH 1KYOH 1VQMP 1ZW0A 2YO2A 1GD2E 4H44D 1PGJA 3JCUE 4H13C 4HJGH 3CXHD 3CXHH 1FZCA 4GT1A 3M9QA 1OW7A 3Q1MA 1VQ8P 3FX0A 2E5YA 3EWKA 5CCHC 1ZN5A 3P8CD 1HUCA 1DD3A 1LT1A 1HJ0A 1GL2B 3RL0C 1SQVK 4NPEA 1JMMA 5AVUB 3P8MC 5KLVE 3E1RA 1D7MA 2OTKE 1KB9I 1KMIZ 3RGUA 4IFMA 5BU5A 1NTKG 4H0LB 1VF5B 2WSCH 2H8PD 2K9YA 2Q3EA 1FZEA 4JYBA 2OYHB 1FJKA 3G4SP 2FYUE 5KAFH 3Q2YA 1BGYE 1NTMK 3CCSP 1JY3N 2L5GB 1HVVA 1RF0A 2KXPB 2YKPA 3RK2B 2GA1A 5APYA 5CHXA 3T97A 1SFCD 2IDBA 2WSCJ 3H32A 5L8RJ 1QVGO 1BCCE 1AVOA 4Y99C 3H1HE 3KYQA 2ITAA 3O6QB 5AVZB 4A7PA 1NU1K 2Y0EA 4I2LC 2XDJA 2WSSH 2HPCA 4WWIA 1VQOP 5B66H 4M3LA 3BCCE 1VQ5P 1FE6A 1BSHA 4JPZB 2HYNA 3L73E 3TNUA 1USDA 1LGHB 1NHLA 1RHZB 2BCCD 1RE3C 2YMYA 2M5AB 2AXTE 5AVVB 3SFDC 1YJWP 3RL0B 1EDLA 1IFMA 1N7SD 4RESB 1R5LA 3MUDA 1FDOA 3AE7C 1SQXK 5AVQB 1T2KD 4YXDC 3L72D 2O3JA 5KJ7D 4H44C 5KTBA 1A02J 2WPVB 5APVA 1KQGB 2W6BA 1JOCA 1MZ9A 3RK3E 2H7HA 4L73A 5B5EE 2FXMA 1DX7A 1W5CE 1KILB 1LTAC 3OW2O 1BDCA 3CCJP 3WU2H 3A0BH 1T8ZA 2HPCB 1SQPD 3I56P 5BU8B 1L0ND 1T6AA 3FWNA 3VMAA 3WMM0 4Y99B 2I8DA 1FZAA 2YO3A 1KYOI 1IK7A 2IX7C 5AVRB 2YKOA 3TNUB 1S4XA 3AE9C 3PRJA 3TSIA 2H88C 2Y0DA 4YTPC 1FAVA 2WWWA 1USEA 2BEZF 1OFCX 1FJPA 3A0HH 3JCUH 3CXHI 3WUUA 3L36A 1OW6A 2YIUC 1A02F 4BRYB 3B71A 2M3BA 3PP5A 3TDKA 1CW5A 3G6EP 3HE4A 1FBMA 1LJ2A 1HGZA 1MFTA 2HR3A 2O01J 2JR8A 3AEEC 1KQSO 2W6JH 3ZDMA 1YJNP 1P84E 2KZIA 4TLFA 4WY4C 1QLED 4O9BA 1Y9BA 5KLVD 1N73C 1IC2A 3H1KE 1BE3E 3VOPA 1IFIA 3V2PA 2YNYA 4H44B 1PL5A 2GUSA 1JO5A 5CCGD 1NGMB 3RBZA 1Q90D 2E75C 3V2RA 3SWYA 1SQBE 1CSBA 3CCRP 1LP1A 1FZBA 4WY4A 1MV8A 2KS1B 1JUNA 2P2UA 2KYVA 1GMJA 2AEJA 1EQ7A 3AE8C 2FYUD 1BGYD 3KDPB 2CPBA 3W67A 3CI9A 5KLVJ 3AECC 2XZRA 3L70E 3IR9A 3B5ND 1KB9D 5AVTB 2QE7H 2KI7B 1PV3A 3G3ZA 2NPSD 2WSEH 3S9OA 1RF1B 1NO4A 1JY2O 3NXSA 3H1HD 2E74D 1T2KC 1L4AA 3HE4B 1MKMA 2FYUJ 3H6PA 5KJ7C 3H25A 2YIUB 1BGYJ 5APWA 1JY2N 1NKZB 3B8EB 3E1IA 3EQ2A 3TYYA 3BCCD 4RKUJ 4C7NB 2K1AA 4JQ0D 5AW8B 1Z56A 1GK4A 4IL6X 1BCCJ 4PD4D 2D2CC 3HD7D 4NPDA 3L75E 1GW4A 3H1HJ 4PD4H 3V2QA 1LP1B 4WY4B 1SQPK 3AEBC 2HFED 4JF7A 1N73B 2R3SA 2Z5HA 1VQ6P 4L75A 1HTLC 4U3FE 3BCCJ 2E75B 3MHVA 1KFMA 3L74E 3L73J 1QVFO 1OXZA 1HH0A 3F5HA 3Q5SA 1H89A 5KLVG 2J5UA 1YHQP 2KNCA 2RKLA 5B5EH 3MIWA 1ZRTD 2SPZA 1M1KQ 1J1DC 2OYOA 1QEXA 3FWLA 1L0LK 1GTWA 4HKZH 1OVUA 3EFGA 4DZOA 1DH3A 1QL2A 3GW6A 2KIKA 5KKZC 5CBOA 4YPCA 1NVOA 1FZGA 3VMZA 3VN0A 2FYUG 2IZ1A 4QMAA 3D71A 5KAIE 1BGYG 5CJ0A 5AVSB 1GL2A 5AVWB 1VF5C 1EDIA 4XFJA 1RQUA 1SLQA 1M1JC 1YTZI 3CWBE 1RH5B 1EZVE 4Z1MH 1YTZT 1BCCG 3H1HG 2B89A 1ZV8A 3AEFC 4RJTA 1FDMA 2I1JA 2D2CB 1M1JA 3RL0g 1NTZK 1UIXA 1SQQK 2B87A 2KNCB 3BCCG 1P84D 2KSJA 1P84H 1Q86Q 1LTJC 3TGUE 3L73G 3HTKA 3H1KD 2P67A 4C46A 3VP8A 3SSUA 4N6JA 3R2PA 1SQBD 2WSFH 2ZFCA 3L71E 3O6QA 1UIIA 1G2CA 3HE5A 1YQ4C 1Q82Q 1J1DB 2OGUA 2W90A 2R44A 1X8YA 4LLHA 3V2NA 1URQD 1K05A 1K73Q 3L35A 1OZHA 5KKZB 3L70D 1R5SA 1PPJE 1BE3J 3H1KJ 3S1KA 2QJPC 5CCHA 5APTA 4AUWA 4D6TE 1JTHA 2N1TD 4W7YA 2M5AA 3KHUA 4PJ0E 1FDIA 2WITA 1SQBJ 2WSFJ 2UWJE 1GK6A 5AW6B 2H43A 2O01N 1M1JB 1PP9E 2YKQA 3VMXA 2E42A 4W7ZA 3CMAP 1S5LX 3OAKA 4GDOA 4GODA 2B87B 4OGQC 1AA0A 1KILC 2HODB 2J58A 3L70J 3P7KA 3HTKB 1S5LH 4WVZA 1NTKK 1IK9A 1G1JA 4PV1D 4PD4I 3IAOA 1NH4A 3MD0A 3VP9A 3AEAC 1OMIA 1G2CB 1KILA 3HE5B 1H0TA 1LTJB 2G8YA 3L37A 3M9BA 1T3JA 4U3FD 2KZJA 3CC2P 3MGNA 2AEFA 5K5GB 4K3AA 2P1JA 1JTHB 2R5DA 3VTPC 1SQXG 1IFJA 3L75J 1FOSE 1N86A 4W80A 3H1KG 1BE3G 3CCEP 2K37A 1SQVE 1J2JB 4BRYA 3V4QA 5CJ4A 3H1LE 1SQBG 2QJPB 1N2DC 2OARA 4U3FJ 1RE3A 2QJKB 2WVRA 1SVFA 2FKWB 4N78D 5GTHE 3L74J 1R8EA 1OX3A 4GOFA 3MZWB 1LTGC 5KAIH 3TK1A 2QA4P 2DW3A 1S9KD 3L70G 1QX8A 4OGQB 3CWBD 2IYPA 1DEBA 2K9JB 5E79E 1NTME 1JY3P 1H0TB 4LGDE 1KILE 2LXCB 5AW3B 2Y0CA 1VQNP 2Q1KA 3M9HA 2Y9ZA 1WMKA 4HYTB 4HH2A 1JMBA 2KS1A 1RF1C 2O01H 3EFFK 2I1KA 3AEDC 1M7LA 1P84I 1NU1E 1GU4A 3CWBJ 4JYCA 3D6ZA 1VDFA 2JP3A 3TGUD 3NMDA 1LTIC 2IYOA 2NZ2A 1IZNB 3L75G 2N9YB 1ZLLA 4XA4A 1FC2C 5AW4B 1S72P 1RF1A 3M0AA 2E76D 2FFDB 1PGQA 3BASA 3PJSK 1ZR4A 5TISE 3A5TA 1SP4A 4U3FG 1GL2D 3A7OA 4KHXA 1SFCC 3CX5E 5APXA 3L74G 3TGUJ 1SQXE 4C7NA 3CD6P 1PPJD 4RO0A 1M8OB 3PLNA 4H0LD 5TJHA 3L71J 1SFCA 3CXHE 3CC7P 1N73A 3M91A 2LXBA 1L2PA 2WMMA 4UB8E 1ZR2A 3P8CE 1HF9A 3PH0A 2CK3H 2POHA
chains in the Genus database with same CATH topology
4BRYB 3WUTA 4BRYA 1UIIA 2Q6QA 3WUUA 3WUVA 2WVRA 2ZXXA 3F5HA 3E1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY B;  3WUT A;  4BRY A;  1UII A;  2Q6Q A;  3WUU A;  3WUV A;  2WVR A;  2ZXX A;  3F5H A;  3E1R A; 
#chains in the Genus database with same CATH topology
 3P32 A;  1K04 A;  3A2A A;  4NPF X;  1URQ B;  4D6T J;  1MFZ A;  1KV4 A;  4DJG A;  3CWB G;  1N7S C;  3G9R A;  1EZV G;  2P10 A;  1BCC D;  1JB0 J;  3OA7 A;  4HB1 A;  3QWO C;  1PP9 J;  1GDT A;  2KLV A;  2N1T B;  3E7K A;  3USS A;  3H1J E;  1JEK A;  1PZQ A;  1FS0 E;  3GF7 A;  1IJD B;  1EDK A;  4H13 D;  5CMZ A;  2W83 C;  1N8R Q;  3V6I A;  2JJL A;  4WBA A;  1DIP A;  1Y47 A;  3W68 A;  2R5B A;  2M3E A;  1VQP P;  1X22 A;  3L73 D;  2H89 C;  2V4H A;  3H1I G;  3TGU G;  5KJ7 A;  3A3Y B;  1NTZ J;  2WPQ A;  2AXT H;  1H88 A;  3GMA A;  2OTJ P;  1SFC B;  1ZXG A;  1U7J A;  2QJY B;  1LWU B;  3LID A;  1L0N K;  1VQK P;  1VQ9 P;  3H1L D;  2ZXX A;  2E5T A;  2W27 A;  2ZAE B;  3L71 G;  2N9B A;  2AEM A;  2FYZ A;  1OVR A;  3NTN A;  3IN6 A;  3KXD A;  1NOH A;  1U57 A;  2JDI H;  3MP7 B;  1KN7 A;  3GHG C;  2FXO A;  1KOR A;  1PGP A;  2HLO A;  3RK3 D;  1LTB C;  5B66 E;  3AE6 C;  1K8A Q;  1PPJ G;  4WB4 A;  4ZKP A;  2P58 A;  1EZV I;  1SQV J;  4D6T G;  3ITK A;  5E79 H;  2BCC E;  3H1L J;  2YMK A;  2ZYG A;  3SFE C;  3AE4 C;  3I55 P;  1PP9 G;  1N7S B;  2A45 H;  5AW1 B;  3WUV A;  1WT6 A;  4UB6 E;  2ZVN B;  5KLV K;  5C39 A;  3L72 E;  1PGO A;  2A06 G;  2QVA A;  2O1J A;  1NU1 D;  5CCG C;  1NTM J;  2Q5U A;  3QH9 A;  2WPR A;  4OH8 B;  2ZT9 D;  5M1B A;  1NTZ G;  3SWK A;  1BDD A;  3G71 P;  1FOS F;  4AYC A;  2FYU K;  3GLM A;  3MTU E;  1ZP0 C;  3FXE A;  5CCG A;  4ZKU A;  1G1I A;  1S3J A;  5TIS H;  2IFN A;  3B5N C;  1SQP E;  2W8Z A;  1NU1 J;  3IFM A;  2HOD A;  4I7Z C;  3CX5 D;  1CI6 A;  3H1I E;  3N7N A;  1NWQ A;  3CX5 H;  1SQX D;  2NPS C;  5KLI C;  2JO1 A;  1FZC C;  1BE3 D;  1TU3 F;  2ZVO B;  2OYI C;  2E74 C;  3GHG B;  2LR2 A;  4L74 A;  2KK7 A;  1SQV G;  2Q7C A;  3LW5 H;  3A0H E;  2PP6 A;  2OQQ A;  1QL1 A;  4BWN A;  3B5N A;  2KP8 A;  2XKM A;  3H1L G;  1QGK B;  1LTJ A;  2NPS A;  1OWA A;  5APQ A;  1VPC A;  2Y9Y A;  2E76 B;  3F89 A;  2QM7 A;  1L0L E;  2M8R A;  5DJT B;  2OYI A;  1VQL P;  3L4F A;  3D70 A;  2XND H;  1SQX J;  2AXC A;  4UB8 H;  1KQF B;  2IBZ E;  3CCL P;  3V5B A;  1AV1 A;  4ZMD A;  1Q2N A;  3HD7 C;  4ASW A;  3U1C A;  3D6Y A;  1HGV A;  3U1A A;  3LW5 J;  3GF3 A;  2QJK C;  1NTM G;  1AFO A;  5AW5 B;  4GKG A;  1YYC A;  2P7J A;  1M90 Q;  4DOJ A;  4XE5 B;  3KPE A;  2E43 A;  4DT0 A;  3ABV C;  2A45 G;  3H1J D;  3HD7 A;  2RN0 A;  3SWF A;  3RBX A;  1JCD A;  1RF0 C;  2QM8 A;  1CI6 B;  3RK3 C;  1OVV A;  1RQV A;  2A06 E;  4LC1 A;  5AVY B;  3BRV B;  1IO4 A;  1JY3 O;  1Q81 Q;  2C9L Y;  1OW8 A;  2ZJS E;  3KZI E;  2JKV A;  1NU1 G;  2B88 A;  1AJY A;  2K3R A;  2KUB A;  1WRG A;  1NTZ E;  3L75 D;  3B5N B;  1SQQ E;  1X79 B;  1YIT P;  2K9J A;  1ZME C;  4I7Z B;  1MUU A;  1KB9 E;  4EI2 A;  4YXW H;  2GM4 A;  3H1J J;  2NPS B;  4WY4 D;  5KLI B;  3CCQ P;  1FZC B;  2C0X A;  1AQ5 A;  2QRX A;  2OYI B;  2E74 B;  1S1C X;  3FXD A;  2E75 D;  2VRS A;  4H13 B;  4IFF A;  3L74 D;  2WT7 A;  2FFD C;  4L76 A;  3NFQ A;  2ZT9 C;  3MUD C;  2V7Q H;  3M06 A;  5AW0 B;  1NYH A;  1Q7Y Q;  3BRT B;  3AE3 C;  1L4A D;  3VMY A;  3CCV P;  2IPP A;  3HD7 B;  3FGA D;  1RY3 A;  3Q5R A;  4PD4 E;  1HWT C;  2WQY C;  2A45 I;  2RMZ A;  2KOG A;  3OJA B;  2FFD A;  1AQT A;  2PRR A;  3CCU P;  1EDJ A;  5AW9 B;  3GG2 A;  5AVX B;  4IL6 E;  1HJB A;  4UB6 H;  1KTM A;  2K88 A;  1VQ7 P;  1YI2 P;  2V7Q J;  5AW2 B;  2ZXE B;  3PHL A;  4N3Y B;  1EZV D;  2ZYA A;  1EXI A;  2YXQ B;  5GTI E;  3RK3 B;  2BCC J;  3T97 B;  4KT0 J;  1SQB K;  2WTY A;  3H32 B;  2FBW C;  3C1L A;  3II6 A;  4R4L A;  1ZRT E;  1PFI A;  2WZ7 A;  2R3C A;  1NTK E;  1GW3 A;  1YIJ P;  3HUS C;  3H1J G;  2Z5I A;  1URQ C;  1U7M A;  1OIP A;  2JWD A;  2D2C D;  1X9V A;  3C8V A;  1ZOY C;  2IZ0 A;  3L72 J;  2Z4E A;  4I6M C;  2WT7 B;  4GIF A;  3CX5 I;  2N1T C;  1CZQ A;  1E79 H;  3I5C A;  2M0B A;  3BVH A;  3H1I D;  1J1E C;  1Y8A A;  3CCM P;  3HUS A;  1URQ A;  2XNX A;  1M57 D;  3KQG A;  1W2E A;  1KD1 Q;  2Q6Q A;  1NAF A;  2QEX P;  1T3U A;  3AE2 C;  2ZT9 B;  2QG4 A;  3L71 D;  1GZL A;  2N1T A;  2Q3I A;  3B4S A;  4C7R A;  4EDF A;  2KB7 P;  1SQP J;  4ZNC A;  3WUT A;  1KQL A;  1L0L D;  1L0N J;  3H1I J;  1NJI Q;  3CPW O;  1XTG B;  2QJY C;  4PV1 C;  2QIW A;  2IBZ D;  1LWU C;  5CBN A;  3HRN A;  2JWA A;  1KYO E;  5H2F E;  1JCC A;  4D6T D;  1YBK A;  2MKV A;  3IF4 A;  4PJ0 H;  2CPS A;  4Y28 J;  1VF5 D;  2BCC G;  5BVZ A;  1PP9 D;  2FYN C;  2MJZ A;  1LWU A;  3K5B A;  4U7J A;  1LTT C;  1LTS C;  2IFM A;  3S4R A;  1L0L J;  1PIX A;  3V4W A;  1DEE G;  2C0W A;  2B9B A;  4JBZ A;  3U59 A;  2A06 D;  2NRG A;  2G3A A;  3HUS B;  3L72 G;  1NAY A;  1IFP A;  3RK2 D;  1VQ4 P;  3KZI H;  2RH0 A;  3Q3D A;  4R4M A;  1L4A C;  1LT9 C;  1NTZ D;  1SQQ D;  3TF5 A;  3UIA A;  1KB9 H;  1J1E B;  1BSN A;  1VL2 A;  1N7S A;  4EYY Q;  2O1K A;  2L91 A;  4BXL A;  4B86 A;  2OTL P;  5KAF E;  5EFW B;  1LT9 A;  1SQP G;  4K35 A;  3CME P;  5CCH D;  2WPS A;  2YXR B;  1L0N G;  3VYI A;  2XV5 A;  2GUV A;  4IFD K;  1SQQ J;  4KJM A;  2BEQ D;  1S5L E;  3RL0 D;  1SQV D;  2JEE A;  2WSE J;  4PV1 B;  4OVN F;  1RE4 C;  3CC4 P;  1YQ3 C;  1IFD A;  1NKN A;  1FZF A;  1JM0 A;  5APU A;  1DD4 A;  1KZU B;  3N4X A;  3LIE A;  1L0L G;  1FU1 A;  3CL3 D;  5GTH H;  2KLU A;  2KSE A;  4IL6 H;  1XTC C;  2FYN B;  4EOT A;  2IBZ G;  2XU6 A;  1AVY A;  4I1L A;  1RE4 A;  1YJ9 P;  2FXP A;  2PFX A;  1IFN A;  4ASV A;  1H8A A;  1HBW A;  4OGQ D;  3AE5 C;  4GOE A;  3PTZ A;  1NTM D;  3Q5P A;  2E76 C;  1N7L A;  3BAT A;  4TT3 H;  2Q9I A;  1KIL D;  2LKM A;  3CLQ A;  5GTI H;  3GHG A;  3M0D C;  3O8Z A;  1M56 D;  1NTK D;  5AW7 B;  1GL2 C;  4DCK A;  1L4A B;  2ZYD A;  1LT9 B;  5APS A;  4MN4 C;  2PGD A;  2FY8 A;  1JY2 P;  2R32 A;  1K9M Q;  3M0D A;  3R4Y A;  4N78 E;  1E5W A;  3AE1 C;  4IOI H;  4H0L C;  1EC5 A;  1W2B O;  1S9K E;  1SQQ G;  1X0T A;  2BAS A;  5DJU B;  2PAJ A;  1NTK J;  4CPG A;  2OYH C;  1S2E A;  4AQR D;  1EXJ A;  2W6A A;  2QSI A;  3WU2 E;  3A0B E;  1JNM A;  1SS1 A;  2J59 M;  3AEG C;  1L0N E;  3RK2 C;  3JSV C;  1LNQ A;  4EIJ A;  1KC8 Q;  2HG5 D;  3JC2 2;  2IBZ I;  4OWF A;  1KFN A;  3C9I A;  2OYH A;  1GU5 A;  1KYO D;  2C9N Y;  5H2F H;  1KYO H;  1VQM P;  1ZW0 A;  2YO2 A;  1GD2 E;  4H44 D;  1PGJ A;  3JCU E;  4H13 C;  4HJG H;  3CXH D;  3CXH H;  1FZC A;  4GT1 A;  3M9Q A;  1OW7 A;  3Q1M A;  1VQ8 P;  3FX0 A;  2E5Y A;  3EWK A;  5CCH C;  1ZN5 A;  3P8C D;  1HUC A;  1DD3 A;  1LT1 A;  1HJ0 A;  1GL2 B;  3RL0 C;  1SQV K;  4NPE A;  1JMM A;  5AVU B;  3P8M C;  5KLV E;  3E1R A;  1D7M A;  2OTK E;  1KB9 I;  1KMI Z;  3RGU A;  4IFM A;  5BU5 A;  1NTK G;  4H0L B;  1VF5 B;  2WSC H;  2H8P D;  2K9Y A;  2Q3E A;  1FZE A;  4JYB A;  2OYH B;  1FJK A;  3G4S P;  2FYU E;  5KAF H;  3Q2Y A;  1BGY E;  1NTM K;  3CCS P;  1JY3 N;  2L5G B;  1HVV A;  1RF0 A;  2KXP B;  2YKP A;  3RK2 B;  2GA1 A;  5APY A;  5CHX A;  3T97 A;  1SFC D;  2IDB A;  2WSC J;  3H32 A;  5L8R J;  1QVG O;  1BCC E;  1AVO A;  4Y99 C;  3H1H E;  3KYQ A;  2ITA A;  3O6Q B;  5AVZ B;  4A7P A;  1NU1 K;  2Y0E A;  4I2L C;  2XDJ A;  2WSS H;  2HPC A;  4WWI A;  1VQO P;  5B66 H;  4M3L A;  3BCC E;  1VQ5 P;  1FE6 A;  1BSH A;  4JPZ B;  2HYN A;  3L73 E;  3TNU A;  1USD A;  1LGH B;  1NHL A;  1RHZ B;  2BCC D;  1RE3 C;  2YMY A;  2M5A B;  2AXT E;  5AVV B;  3SFD C;  1YJW P;  3RL0 B;  1EDL A;  1IFM A;  1N7S D;  4RES B;  1R5L A;  3MUD A;  1FDO A;  3AE7 C;  1SQX K;  5AVQ B;  1T2K D;  4YXD C;  3L72 D;  2O3J A;  5KJ7 D;  4H44 C;  5KTB A;  1A02 J;  2WPV B;  5APV A;  1KQG B;  2W6B A;  1JOC A;  1MZ9 A;  3RK3 E;  2H7H A;  4L73 A;  5B5E E;  2FXM A;  1DX7 A;  1W5C E;  1KIL B;  1LTA C;  3OW2 O;  1BDC A;  3CCJ P;  3WU2 H;  3A0B H;  1T8Z A;  2HPC B;  1SQP D;  3I56 P;  5BU8 B;  1L0N D;  1T6A A;  3FWN A;  3VMA A;  3WMM 0;  4Y99 B;  2I8D A;  1FZA A;  2YO3 A;  1KYO I;  1IK7 A;  2IX7 C;  5AVR B;  2YKO A;  3TNU B;  1S4X A;  3AE9 C;  3PRJ A;  3TSI A;  2H88 C;  2Y0D A;  4YTP C;  1FAV A;  2WWW A;  1USE A;  2BEZ F;  1OFC X;  1FJP A;  3A0H H;  3JCU H;  3CXH I;  3WUU A;  3L36 A;  1OW6 A;  2YIU C;  1A02 F;  4BRY B;  3B71 A;  2M3B A;  3PP5 A;  3TDK A;  1CW5 A;  3G6E P;  3HE4 A;  1FBM A;  1LJ2 A;  1HGZ A;  1MFT A;  2HR3 A;  2O01 J;  2JR8 A;  3AEE C;  1KQS O;  2W6J H;  3ZDM A;  1YJN P;  1P84 E;  2KZI A;  4TLF A;  4WY4 C;  1QLE D;  4O9B A;  1Y9B A;  5KLV D;  1N73 C;  1IC2 A;  3H1K E;  1BE3 E;  3VOP A;  1IFI A;  3V2P A;  2YNY A;  4H44 B;  1PL5 A;  2GUS A;  1JO5 A;  5CCG D;  1NGM B;  3RBZ A;  1Q90 D;  2E75 C;  3V2R A;  3SWY A;  1SQB E;  1CSB A;  3CCR P;  1LP1 A;  1FZB A;  4WY4 A;  1MV8 A;  2KS1 B;  1JUN A;  2P2U A;  2KYV A;  1GMJ A;  2AEJ A;  1EQ7 A;  3AE8 C;  2FYU D;  1BGY D;  3KDP B;  2CPB A;  3W67 A;  3CI9 A;  5KLV J;  3AEC C;  2XZR A;  3L70 E;  3IR9 A;  3B5N D;  1KB9 D;  5AVT B;  2QE7 H;  2KI7 B;  1PV3 A;  3G3Z A;  2NPS D;  2WSE H;  3S9O A;  1RF1 B;  1NO4 A;  1JY2 O;  3NXS A;  3H1H D;  2E74 D;  1T2K C;  1L4A A;  3HE4 B;  1MKM A;  2FYU J;  3H6P A;  5KJ7 C;  3H25 A;  2YIU B;  1BGY J;  5APW A;  1JY2 N;  1NKZ B;  3B8E B;  3E1I A;  3EQ2 A;  3TYY A;  3BCC D;  4RKU J;  4C7N B;  2K1A A;  4JQ0 D;  5AW8 B;  1Z56 A;  1GK4 A;  4IL6 X;  1BCC J;  4PD4 D;  2D2C C;  3HD7 D;  4NPD A;  3L75 E;  1GW4 A;  3H1H J;  4PD4 H;  3V2Q A;  1LP1 B;  4WY4 B;  1SQP K;  3AEB C;  2HFE D;  4JF7 A;  1N73 B;  2R3S A;  2Z5H A;  1VQ6 P;  4L75 A;  1HTL C;  4U3F E;  3BCC J;  2E75 B;  3MHV A;  1KFM A;  3L74 E;  3L73 J;  1QVF O;  1OXZ A;  1HH0 A;  3F5H A;  3Q5S A;  1H89 A;  5KLV G;  2J5U A;  1YHQ P;  2KNC A;  2RKL A;  5B5E H;  3MIW A;  1ZRT D;  2SPZ A;  1M1K Q;  1J1D C;  2OYO A;  1QEX A;  3FWL A;  1L0L K;  1GTW A;  4HKZ H;  1OVU A;  3EFG A;  4DZO A;  1DH3 A;  1QL2 A;  3GW6 A;  2KIK A;  5KKZ C;  5CBO A;  4YPC A;  1NVO A;  1FZG A;  3VMZ A;  3VN0 A;  2FYU G;  2IZ1 A;  4QMA A;  3D71 A;  5KAI E;  1BGY G;  5CJ0 A;  5AVS B;  1GL2 A;  5AVW B;  1VF5 C;  1EDI A;  4XFJ A;  1RQU A;  1SLQ A;  1M1J C;  1YTZ I;  3CWB E;  1RH5 B;  1EZV E;  4Z1M H;  1YTZ T;  1BCC G;  3H1H G;  2B89 A;  1ZV8 A;  3AEF C;  4RJT A;  1FDM A;  2I1J A;  2D2C B;  1M1J A;  3RL0 g;  1NTZ K;  1UIX A;  1SQQ K;  2B87 A;  2KNC B;  3BCC G;  1P84 D;  2KSJ A;  1P84 H;  1Q86 Q;  1LTJ C;  3TGU E;  3L73 G;  3HTK A;  3H1K D;  2P67 A;  4C46 A;  3VP8 A;  3SSU A;  4N6J A;  3R2P A;  1SQB D;  2WSF H;  2ZFC A;  3L71 E;  3O6Q A;  1UII A;  1G2C A;  3HE5 A;  1YQ4 C;  1Q82 Q;  1J1D B;  2OGU A;  2W90 A;  2R44 A;  1X8Y A;  4LLH A;  3V2N A;  1URQ D;  1K05 A;  1K73 Q;  3L35 A;  1OZH A;  5KKZ B;  3L70 D;  1R5S A;  1PPJ E;  1BE3 J;  3H1K J;  3S1K A;  2QJP C;  5CCH A;  5APT A;  4AUW A;  4D6T E;  1JTH A;  2N1T D;  4W7Y A;  2M5A A;  3KHU A;  4PJ0 E;  1FDI A;  2WIT A;  1SQB J;  2WSF J;  2UWJ E;  1GK6 A;  5AW6 B;  2H43 A;  2O01 N;  1M1J B;  1PP9 E;  2YKQ A;  3VMX A;  2E42 A;  4W7Z A;  3CMA P;  1S5L X;  3OAK A;  4GDO A;  4GOD A;  2B87 B;  4OGQ C;  1AA0 A;  1KIL C;  2HOD B;  2J58 A;  3L70 J;  3P7K A;  3HTK B;  1S5L H;  4WVZ A;  1NTK K;  1IK9 A;  1G1J A;  4PV1 D;  4PD4 I;  3IAO A;  1NH4 A;  3MD0 A;  3VP9 A;  3AEA C;  1OMI A;  1G2C B;  1KIL A;  3HE5 B;  1H0T A;  1LTJ B;  2G8Y A;  3L37 A;  3M9B A;  1T3J A;  4U3F D;  2KZJ A;  3CC2 P;  3MGN A;  2AEF A;  5K5G B;  4K3A A;  2P1J A;  1JTH B;  2R5D A;  3VTP C;  1SQX G;  1IFJ A;  3L75 J;  1FOS E;  1N86 A;  4W80 A;  3H1K G;  1BE3 G;  3CCE P;  2K37 A;  1SQV E;  1J2J B;  4BRY A;  3V4Q A;  5CJ4 A;  3H1L E;  1SQB G;  2QJP B;  1N2D C;  2OAR A;  4U3F J;  1RE3 A;  2QJK B;  2WVR A;  1SVF A;  2FKW B;  4N78 D;  5GTH E;  3L74 J;  1R8E A;  1OX3 A;  4GOF A;  3MZW B;  1LTG C;  5KAI H;  3TK1 A;  2QA4 P;  2DW3 A;  1S9K D;  3L70 G;  1QX8 A;  4OGQ B;  3CWB D;  2IYP A;  1DEB A;  2K9J B;  5E79 E;  1NTM E;  1JY3 P;  1H0T B;  4LGD E;  1KIL E;  2LXC B;  5AW3 B;  2Y0C A;  1VQN P;  2Q1K A;  3M9H A;  2Y9Z A;  1WMK A;  4HYT B;  4HH2 A;  1JMB A;  2KS1 A;  1RF1 C;  2O01 H;  3EFF K;  2I1K A;  3AED C;  1M7L A;  1P84 I;  1NU1 E;  1GU4 A;  3CWB J;  4JYC A;  3D6Z A;  1VDF A;  2JP3 A;  3TGU D;  3NMD A;  1LTI C;  2IYO A;  2NZ2 A;  1IZN B;  3L75 G;  2N9Y B;  1ZLL A;  4XA4 A;  1FC2 C;  5AW4 B;  1S72 P;  1RF1 A;  3M0A A;  2E76 D;  2FFD B;  1PGQ A;  3BAS A;  3PJS K;  1ZR4 A;  5TIS E;  3A5T A;  1SP4 A;  4U3F G;  1GL2 D;  3A7O A;  4KHX A;  1SFC C;  3CX5 E;  5APX A;  3L74 G;  3TGU J;  1SQX E;  4C7N A;  3CD6 P;  1PPJ D;  4RO0 A;  1M8O B;  3PLN A;  4H0L D;  5TJH A;  3L71 J;  1SFC A;  3CXH E;  3CC7 P;  1N73 A;  3M91 A;  2LXB A;  1L2P A;  2WMM A;  4UB8 E;  1ZR2 A;  3P8C E;  1HF9 A;  3PH0 A;  2CK3 H;  2POH A; 
#chains in the Genus database with same CATH homology
 4BRY B;  3WUT A;  4BRY A;  1UII A;  2Q6Q A;  3WUU A;  3WUV A;  2WVR A;  2ZXX A;  3F5H A;  3E1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...