3IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ifmA00
3IFMA 2KSJA 1ZN5A 1QL2A 1IFNA 2IFMA 1QL1A 1IFMA 2XKMA 2KLVA 1PFIA 2IFNA 4IFMA
chains in the Genus database with same CATH superfamily
1SQXD 1JM0A 2ZYDA 4N78E 1VF5D 2J58A 2WITA 3AEBC 1FE6A 1BCCE 3OA7A 1NKNA 2O01H 2B9BA 1KILC 3L35A 2H7HA 4BWNA 1LTIC 1NTKK 1IK7A 5H2FE 3LIEA 1S9KE 2PRRA 1G2CA 1VQ5P 3E1IA 1YJ9P 4PV1D 3T97B 1GL2C 1EC5A 4R4MA 3L72G 1LP1B 4W7YA 1FC2C 1ZR2A 1R8EA 1J1DB 2QA4P 3N7NA 2FFDC 2IYOA 2WSFH 2FFDB 3KYQA 3WUVA 3L72J 4H0LC 2QIWA 1EXIA 3IFMA 4H0LB 3JCUH 2FYUD 1QVGO 2YXRB 5KAFE 1FZCC 2E75C 2ITAA 1L0LK 1FU1A 2A45I 2Q3IA 1L0NE 2P1JA 5TISE 2YKQA 5KJ7D 1HBWA 2JDIH 1HF9A 3GHGB 5B66E 1IFJA 1P84E 1NTZE 1T3JA 3G3ZA 3MIWA 5C39A 3AEGC 1L2PA 1FDMA 3FWNA 3CX5E 1GTWA 2OQQA 3H1HE 3V4QA 1RE3A 1IFIA 1SLQA 3L4FA 2M8RA 1FAVA 4I7ZC 1JY3O 1MV8A 3CWBG 2Q7CA 3U1CA 1KILD 2XDJA 3CMEP 3L71D 1KN7A 1BGYD 1OW6A 3A5TA 1U7JA 3Q2YA 2A06D 3CWBJ 2IBZE 3M91A 1M57D 2XNDH 1S3JA 2Q1KA 5AVYB 5KKZB 3RGUA 1L0NK 5CJ4A 3L74E 5APQA 1FDIA 2E43A 5E79E 3BCCD 2RMZA 2HODA 3MUDA 3V6IA 4H0LD 1N8RQ 1KB9D 2E76C 1DX7A 1E5WA 4PD4D 5BVZA 2C9NY 2YKPA 1IFNA 2IFMA 4XFJA 2PP6A 3A2AA 1AQ5A 1DEBA 1JY2O 4JYBA 1NU1G 1SQBG 1EQ7A 4JYCA 1OIPA 3LIDA 1N73C 1KYOI 2JP3A 1NU1J 4AYCA 3G6EP 3A3YB 2JKVA 3KZIE 1VQ4P 1OVUA 1SQPK 3CCRP 1S1CX 3H1IG 4HB1A 4Y99C 1IC2A 3AEEC 1ZRTD 3ABVC 4YXWH 2I8DA 3QH9A 1S4XA 3L70E 3OJAB 2C9LY 4C46A 4C7NA 1H0TA 4R4LA 3D70A 1NTME 1LTAC 3H1IJ 1MZ9A 5KLVD 2XU6A 2ZJSE 4ZKUA 4GKGA 1FOSE 1MKMA 2KNCB 3PLNA 5BU5A 2W6BA 3HD7A 5AW0B 4LLHA 1YJWP 4D6TE 1NAFA 2AEMA 3IAOA 5CCHC 1YJNP 5APSA 1J1EC 1EZVD 3RK2C 3F89A 3HE4B 1J1EB 3TGUD 5TJHA 3Q3DA 2FXPA 3M06A 1X9VA 2K9YA 1G1JA 5H2FH 3SSUA 3TF5A 2BCCE 3L37A 1NTZG 1JEKA 1K05A 1LWUB 3H32B 3HTKA 3BATA 1IFPA 3H1HG 2I1JA 1NTZJ 3A0HE 4GT1A 1N7LA 5B5EE 2R3CA 1NTMK 2V7QJ 2GM4A 1FJKA 4OGQB 3H1HJ 1PP9D 1UIXA 1KV4A 2QRXA 4ASVA 1X22A 1RQUA 1SQVK 3RBXA 3H1KD 2IBZG 5TISH 1Q7YQ 5APYA 5B66H 4B86A 2N1TA 3GG2A 2N9YB 3CXHD 3USSA 5APWA 1N7SB 3RK3C 2WT7B 1PPJD 3RK3B 2N9BA 3CX5H 2WSCJ 1G2CB 1BE3E 2R32A 3R4YA 4L74A 1TU3F 1BDCA 1SQQG 5APVA 3W67A 3I56P 1PZQA 1VQLP 2P58A 2WPRA 3G71P 3PTZA 3RK2D 3L72E 2E5TA 4GOEA 1IO4A 1G1IA 1SQQJ 4WVZA 4A7PA 2BEQD 3L75D 4EI2A 1FS0E 4U3FG 1KQSO 1YTZI 2WSCH 3L71G 4M3LA 2LXBA 2O1JA 3Q5PA 1JO5A 1CI6A 4C7RA 2O3JA 1GZLA 5E79H 4U3FJ 5AW2B 1ZW0A 3NTNA 2C0WA 3L71J 2RH0A 2ZT9B 1L4AB 2KXPB 1HWTC 4DJGA 1FDOA 1JUNA 1RE3C 1T3UA 3K5BA 1IK9A 2C0XA 2R3SA 2YIUB 3L73D 3AEAC 4PD4I 2H43A 2KS1A 4KJMA 3BCCJ 1NTKD 4Y28J 2CK3H 2NRGA 3CWBE 2FBWC 5K5GB 1DIPA 3RK3D 2W6AA 1WRGA 2JWDA 3RL0g 3EQ2A 2J59M 1HTLC 2JWAA 3KZIH 3W68A 2GA1A 4WY4A 1GK4A 3MUDC 2FYNC 2FYNB 1M1JA 1RE4C 1QL2A 1L0LD 1OVRA 2E42A 3H1JD 1GU4A 1BCCD 2ZFCA 1J2JB 4DOJA 2M3EA 2CPSA 2LR2A 2NPSA 3CCVP 4TT3H 1H88A 3AE8C 1USEA 1YI2P 2ZT9D 3D6YA 2PFXA 2ZXEB 3PHLA 2OYOA 3AE5C 1YQ3C 3Q1MA 1EZVI 2GUVA 1T8ZA 2HYNA 5GTHE 2M5AB 1A02F 3H1LG 4DZOA 4I1LA 2Y9ZA 1KYOE 2IDBA 2MKVA 2BEZF 4RJTA 1KILB 3MTUE 5CCGA 1VQ9P 1BE3G 2WWWA 4BRYA 1YITP 3H1IE 3P8CD 2NZ2A 1L0ND 3H1LJ 1GW4A 2IX7C 1U57A 2IPPA 1OFCX 1SP4A 2SPZA 1ZV8A 4L75A 1BE3J 3FGAD 1GL2B 3HD7C 1NKZB 2YO3A 1RF1A 1S5LE 3HD7B 4XE5B 1NHLA 1N86A 1X8YA 3HRNA 1NU1K 1SQBK 2P10A 3M0DA 1VQKP 2OARA 1DD3A 2B88A 2WSEJ 1FZCB 4OWFA 2GUSA 2E75B 1OMIA 5L8RJ 3CXHI 4KHXA 1DH3A 4I2LC 1GMJA 3HTKB 2A45G 1JCCA 1MUUA 2B89A 3G4SP 2WTYA 2UWJE 4HJGH 2QVAA 3KDPB 1LT9C 3L74D 1SQPD 3OW2O 4MN4C 1QEXA 4ZKPA 3V5BA 1PIXA 1ZXGA 1USDA 2K3RA 4I7ZB 3LW5J 4RO0A 4EDFA 1VPCA 3B5NA 3CC2P 4IL6E 2J5UA 2QE7H 1QL1A 4HYTB 2OTJP 2N1TC 1BSNA 4AQRD 1WT6A 2QJYC 3RL0C 2QJYB 3RL0B 2FYUE 1KC8Q 1YYCA 3MP7B 1KORA 1NOHA 1GL2D 1BDDA 3B8EB 1T2KC 1NAYA 3FXDA 3HD7D 3UIAA 1E79H 2WQYC 3PJSK 3LW5H 1M7LA 4JPZB 5M1BA 1LTJA 2WVRA 3JC22 2HPCA 1NTZK 3TK1A 1SQQE 1QGKB 1RE4A 5DJUB 2QJKC 2E76B 2V4HA 3N4XA 3NFQA 3S1KA 1LTBC 2E75D 2B87A 3CCJP 3AEFC 3MD0A 3CCQP 2LXCB 4QMAA 5APUA 2WPVB 1ZR4A 3CMAP 4L76A 1GK6A 3L70D 4U3FE 1NTMD 3V2RA 3L71E 2Y0DA 1BGYE 5GTIE 1PV3A 1N73B 4LGDE 1SQVD 1VQ6P 1D7MA 4D6TD 1R5SA 1AQTA 1W2BO 3BCCE 5CJ0A 2Y0CA 2ZYAA 2N1TD 4Y99B 3D71A 5AW8B 3CC4P 1HGVA 3RL0D 4GOFA 2BCCD 4W80A 1L0LJ 4GDOA 1X79B 4PD4E 2XKMA 4IFDK 3FX0A 2K9JA 1LTSC 2LKMA 2QJPC 2QJPB 2IZ1A 2WMMA 1K04A 5GTHH 3TNUA 3U59A 3I55P 1Y47A 4WY4C 5CBOA 4ZNCA 2KI7B 3G9RA 1SQXG 1KYOH 1M1JC 2E76D 4PJ0E 2FXMA 5AVZB 3T97A 3RK2B 4O9BA 1LGHB 1SQXJ 4Z1MH 5DJTB 1SFCC 2OYIA 3M9HA 1EDJA 4JBZA 3H25A 1DD4A 1AV1A 4U7JA 2NPSC 4N3YB 1KZUB 3S4RA 1S5LH 1JTHA 2W90A 2R44A 1NGMB 2ZXXA 5EFWB 1LT9A 5AVQB 3GHGA 3RBZA 1DEEG 2H8PD 1KQGB 3EFFK 1VQ8P 5KAFH 3VMYA 2K88A 3M9QA 2G8YA 3L72D 1SS1A 2KB7P 1Q81Q 2FYUG 2POHA 3JSVC 1M8OB 1PGPA 3AEDC 2Q3EA 3AE1C 5CCGC 5APXA 1VQMP 4H13C 1EZVE 1P84H 3H1LE 4BRYB 3TGUE 2V7QH 2R5DA 2W83C 1IJDB 2K1AA 2FYUJ 2Y0EA 2E74C 1VQ7P 3KHUA 2OYHA 1RF1C 1AVYA 1JMBA 3JCUE 3B4SA 2W27A 3M0AA 5CCHD 4IL6H 2PAJA 3WMM0 3M0DC 2RN0A 2FXOA 4EOTA 2HLOA 2KOGA 1OXZA 3HE5A 1BGYG 3PH0A 3CWBD 3ZDMA 3AE9C 1OWAA 2YXQB 2A06G 5AVVB 1NYHA 4IFMA 3CCEP 4N6JA 3KXDA 2KSJA 1LJ2A 4BXLA 1BGYJ 5KAIE 2W8ZA 1OW7A 3CXHE 1PPJE 3BCCG 3EWKA 1KB9I 4RKUJ 3BRTB 2JEEA 1KMIZ 3B5NC 5CCGD 3M9BA 2HG5D 1VQNP 2KP8A 1NVOA 5BU8B 5GTIH 1VF5C 3IR9A 1LT1A 3L75E 1FZBA 3P8MC 3GF7A 2E74D 2IFNA 3C9IA 1FBMA 1S5LX 3AECC 3KPEA 1PL5A 2QSIA 2ZVOB 3VMZA 5AVWB 1CZQA 3KQGA 1LTJC 4H44C 1NU1D 1SQBD 3ITKA 5KTBA 2HODB 3IN6A 2AEJA 2Q9IA 4L73A 2Z4EA 2Y9YA 4N78D 2KNCA 4PV1C 1AA0A 2QEXP 1PFIA 1PGQA 2Z5HA 2D2CC 2B87B 4PD4H 2BASA 2D2CB 1KYOD 4NPFX 3L73E 1PGOA 1SFCA 3O8ZA 4HH2A 2KLUA 2L91A 1YHQP 2KUBA 1XTGB 3H1ID 3OAKA 3MGNA 4W7ZA 3SWKA 1S9KD 5KLVG 1AFOA 1KFNA 4PJ0H 1MFZA 3RK3E 3GW6A 1RF0C 1JB0J 1CW5A 2ZAEB 1LWUA 4I6MC 3EFGA 3H32A 1IZNB 1Z56A 1W5CE 5KJ7C 5KLVJ 4IL6X 1EZVG 1FZAA 3AE7C 2P67A 3TGUG 2E5YA 5AVUB 3QWOC 1FOSF 1KFMA 2CPBA 2W6JH 1L0LE 4WB4A 2KK7A 3H1JE 2FKWB 1SVFA 4C7NB 1H0TB 2VRSA 3A0HH 3TGUJ 1ZLLA 5B5EH 5AVSB 2K9JB 3WU2E 4ZMDA 2YNYA 2WSSH 2WSFJ 1P84D 1JY3N 1NTZD 1NH4A 4H44D 3CL3D 3TNUB 1M90Q 1N7SA 2WT7A 3S9OA 1JCDA 2XZRA 3CX5D 3H1HD 5KLIC 5APTA 3CCSP 2KSEA 1T6AA 5KLIB 3GMAA 1PP9G 1AVOA 2D2CD 4K3AA 2JJLA 1SQXE 2M0BA 1URQA 3H1KG 4UB6E 1J1DC 2P7JA 3IF4A 2OYIC 3CCLP 1PP9J 2OYIB 1UIIA 1RHZB 3U1AA 2KZIA 2IBZD 3H1KJ 4IOIH 3D6ZA 1JTHB 1PPJG 3NXSA 3H6PA 3P8CE 3II6A 4NPDA 1NO4A 1ZN5A 3GHGC 2H88C 1LT9B 2ZVNB 1S72P 2WSEH 5AW7B 3B71A 1SQQD 2YKOA 3SFDC 3C8VA 5AW9B 1JY2N 1L4AA 2Q6QA 1CSBA 3L75G 1NWQA 2G3AA 1H89A 2N1TB 3VP8A 5KAIH 4WWIA 1SQXK 2A45H 3CXHH 3O6QA 3CLQA 2R5BA 3L75J 1EDKA 4U3FD 4KT0J 1HVVA 2OYHC 2KYVA 4TLFA 2OYHB 2H89C 1KQFB 2QM7A 1IFMA 2KLVA 3V2PA 2PGDA 1EDIA 4EYYQ 4JQ0D 5KKZC 1GDTA 1RH5B 2IZ0A 2I1KA 3L73G 4ASWA 1LNQA 2QJKB 3CD6P 1SQPE 1VQOP 3HUSA 2YO2A 1NTKG 3HE5B 3L73J 3MZWB 1CI6B 1KILE 2HFED 1JMMA 2QG4A 1NTKJ 3BASA 4OVNF 4UB8E 3A0BE 2A06E 3FWLA 5AW5B 1RF0A 1R5LA 1YIJP 3L36A 1GD2E 2FYUK 3FXEA 1FZEA 1LTTC 1ZMEC 1RQVA 1Q2NA 1Q90D 5KJ7A 1EXJA 3VMXA 1H8AA 1L0LG 3SWYA 3H1JG 2KS1B 3CCMP 3P32A 1QX8A 1SQBJ 4OH8B 2AXTE 1BCCG 3WUUA 1EDLA 3CPWO 1QLED 3CCUP 1SQQK 3C1LA 2AXCA 1KB9E 4NPEA 1OX3A 2M5AA 1GW3A 3H1JJ 2IYPA 3BRVB 1T2KD 2Z5IA 1BCCJ 5AVRB 1KILA 3VN0A 3CI9A 3V4WA 2WZ7A 4WY4B 1HJBA 5AW3B 4YPCA 3NMDA 1M1JB 1K73Q 1LP1A 1GL2A 1SQVE 3CC7P 2XNXA 1KTMA 1HH0A 4HKZH 2FFDA 1SFCB 3WU2H 1VL2A 2OGUA 3H1LD 3E1RA 1L0NG 3R2PA 2NPSB 1ZRTE 2L5GB 1WMKA 3TYYA 1OZHA 1P84I 5AW6B 2RKLA 3VYIA 1FZCA 1BE3D 3TDKA 4YTPC 1IFDA 1LWUC 1YTZT 1JOCA 3CX5I 1Y9BA 3GLMA 1L0NJ 3Q5RA 5KLVE 2O01N 1PGJA 3PP5A 3Q5SA 4UB6H 1QVFO 1KQLA 3AE2C 1Q82Q 1U7MA 1JY3P 4OGQC 3V2QA 3P7KA 4IFFA 3GF3A 4H13B 2AEFA 2IBZI 2FYZA 2OTKE 2YMYA 3E7KA 2E74B 2O1KA 3A7OA 4K35A 4GIFA 1HJ0A 4WY4D 4DCKA 1FJPA 1N7SC 1RF1B 3L74G 1Y8AA 1SQPG 1KD1Q 1XTCC 1X0TA 2QM8A 2XV5A 5CHXA 2YMKA 4XA4A 3AE4C 3MHVA 4YXDC 1URQC 1Q86Q 3L74J 1URQB 5KLVK 1SQPJ 1SFCD 2DW3A 5AVXB 1PP9E 1YBKA 1HGZA 2K37A 2NPSD 2JR8A 1VDFA 5AW4B 3H1KE 1JY2P 3TSIA 2WPSA 5CMZA 5CBNA 4RESB 1VQPP 2M3BA 1NJIQ 1ZOYC 1GU5A 2HR3A 1HUCA 4GODA 5AW1B 1AJYA 1FZGA 2FY8A 2ZT9C 1L4AC 1N73A 1N2DC 4OGQD 4EIJA 3B5NB 1BSHA 2KIKA 4H13D 1OVVA 2JO1A 1M1KQ 2YIUC 4WBAA 2P2UA 2OTLP 3AE6C 4UB8H 3A0BH 1RY3A 5AVTB 3L70G 1OW8A 1VF5B 3VOPA 2KZJA 3O6QB 4CPGA 1NTMG 3SFEC 1FZFA 1YQ4C 3VP9A 1N7SD 1S2EA 3VTPC 3L70J 2WPQA 1LTJB 4H44B 3AE3C 1SQVG 1NTMJ 4D6TG 2HPCB 2MJZA 2AXTH 1A02J 4JF7A 4LC1A 1URQD 1KB9H 4PV1B 3HUSC 1LTGC 3HUSB 2ZYGA 1SQVJ 1K8AQ 4D6TJ 3BVHA 4AUWA 5CCHA 4DT0A 3HE4A 1W2EA 2BCCG 3F5HA 1NTKE 1M56D 1K9MQ 3WUTA 1MFTA 3PRJA 2BCCJ 3SWFA 3VMAA 2Q5UA 2O01J 1L4AD 3I5CA 1JNMA 3B5ND 1ZP0C 1NU1E 1SQBE 3V2NA
chains in the Genus database with same CATH topology
2FXMA 1HVVA 5AVZB 3T97A 1JO5A 1CI6A 4C7RA 2OYHC 2KYVA 3RK2B 4O9BA 2OYHB 1GZLA 4N78E 1LGHB 2QM7A 1IFMA 5AW2B 3NTNA 2J58A 2KLVA 2WITA 3V2PA 2C0WA 1SFCC 2OYIA 1L4AB 3OA7A 3M9HA 1NKNA 1HWTC 1GDTA 2O01H 1KILC 2I1KA 1RE3C 2NPSC 3L35A 1JUNA 1T3UA 2H7HA 4N3YB 1KZUB 1JTHA 1IK9A 2C0XA 3HUSA 1LTIC 2YO2A 1NTKK 2H43A 3LIEA 1S9KE 1G2CA 3HE5B 3E1IA 1LT9A 5AVQB 3GHGA 1CI6B 1GL2C 2H8PD 2HFED 1JMMA 3VMYA 4W7YA 3M9QA 3RK3D 2W6AA 1ZR2A 1WRGA 3BASA 1J1DB 3N7NA 2FFDC 2KB7P 2WSFH 5AW5B 1RF0A 2FFDB 3EQ2A 3L36A 1GD2E 2FYUK 2J59M 1HTLC 3KYQA 1FZEA 2POHA 1LTTC 5CCGC 5APXA 3IFMA 5KJ7A 1FZCC 3VMXA 4WY4A 1H8AA 2R5DA 1L0LK 1FU1A 1GK4A 3SWYA 1IJDB 2A45I 2Q3IA 1M1JA 1RE4C 1QL2A 2P1JA 3P32A 2YKQA 4OH8B 5KJ7D 1HBWA 2E42A 3GHGB 2OYHA 1SQQK 1IFJA 1GU4A 1RF1C 2ZFCA 1T3JA 3G3ZA 1GW3A 5CCHD 2W27A 3M0AA 3MIWA 3BRVB 1J2JB 4DOJA 2CPSA 1T2KD 2Z5IA 2PAJA 1FDMA 1GTWA 5AVRB 3V4QA 3WMM0 1KILA 3M0DC 1RE3A 2NPSA 1IFIA 1H88A 3VN0A 1SLQA 3CI9A 3L4FA 2M8RA 1FAVA 3V4WA 1JY3O 4EOTA 2WZ7A 2HLOA 1MV8A 4WY4B 2KOGA 2Q7CA 1HJBA 1OXZA 2ZXEB 5AW3B 3HE5A 3U1CA 1KILD 2XDJA 3NMDA 1M1JB 1OWAA 5AVVB 4IFMA 4N6JA 1GL2A 3A5TA 2GUVA 1T8ZA 2HYNA 2XNXA 2KSJA 1A02F 1HH0A 3M91A 2FFDA 4DZOA 1SFCB 4I1LA 5AVYB 1L0NK 3R2PA 1KILB 3MTUE 5CCGA 2NPSB 5CJ4A 2WWWA 5APQA 2E43A 2L5GB 3TYYA 3P8CD 5AW6B 3VYIA 1FZCA 1GW4A 3BRTB 2HODA 2IX7C 2JEEA 2IPPA 3MUDA 1IFDA 1SP4A 1LWUC 3B5NC 1YTZT 1JOCA 5CCGD 1DX7A 1ZV8A 3M9BA 2HG5D 1E5WA 1GL2B 3HD7C 3PP5A 2KP8A 1NKZB 2YO3A 1RF1A 5BU8B 3HD7B 1KQLA 4XE5B 1NHLA 1N86A 5BVZA 2C9NY 3IR9A 2YKPA 1FZBA 3P8MC 1IFNA 2IFMA 1JY3P 2PP6A 3A2AA 1AQ5A 2IFNA 3C9IA 1X8YA 1FBMA 1DEBA 1JY2O 3V2QA 3P7KA 3KPEA 4IFFA 4JYBA 3HRNA 1NU1K 1SQBK 3M0DA 1EQ7A 2OARA 3VMZA 5AVWB 1CZQA 3KQGA 1LTJC 3LIDA 2FYZA 4JYCA 1FZCB 1N73C 5KTBA 2YMYA 2GUSA 2HODB 4KHXA 1DH3A 2Q9IA 2Z4EA 4N78D 2O1KA 4I2LC 3HTKB 4AYCA 2A45G 3A7OA 4GIFA 4WY4D 1JCCA 1MUUA 1PFIA 1FJPA 3A3YB 2Z5HA 2WTYA 1N7SC 1RF1B 2BASA 1SQPK 1XTCC 3KDPB 1SFCA 2QM8A 4Y99C 1IC2A 3O8ZA 4HH2A 2XV5A 1LT9C 5CHXA 4XA4A 1XTGB 3OAKA 3MGNA 3OJAB 1URQC 3V5BA 4ZKPA 4W7ZA 2C9LY 4C46A 4C7NA 1S9KD 1URQB 5KLVK 1SFCD 1AFOA 5AVXB 1LTAC 1KFNA 1VPCA 1MFZA 1MZ9A 1HGZA 1RF0C 1CW5A 1LWUA 3B5NA 2NPSD 4I6MC 3EFGA 3H32A 1QL1A 1Z56A 2XU6A 4ZKUA 4GKGA 5AW4B 1VDFA 4HYTB 1FOSE 2N1TC 4AQRD 5KJ7C 1JY2P 3TSIA 5BU5A 2W6BA 2WPSA 3HD7A 5AW0B 4LLHA 1WT6A 5CMZA 1NAFA 3RL0C 4RESB 2M3BA 3RL0B 1FZAA 2P67A 5CCHC 1YYCA 5AVUB 1NOHA 1GL2D 5APSA 3B8EB 1J1EC 1FOSF 3RK2C 1KFMA 1T2KC 3UIAA 3HD7D 3HE4B 1J1EB 1GU5A 2CPBA 1HUCA 4WB4A 3M06A 3LW5H 5AW1B 1X9VA 2FKWB 1SVFA 1FZGA 4C7NB 1M7LA 1LTJA 1G1JA 2VRSA 1ZLLA 1L4AC 1N73A 1N2DC 5AVSB 2HPCA 3L37A 1NTZK 3TK1A 4EIJA 1LWUB 1RE4A 3B5NB 3H32B 3HTKA 3BATA 2YNYA 3N4XA 3NFQA 1JY3N 1NH4A 4WBAA 1LTBC 2P2UA 3CL3D 3TNUB 3MD0A 1N7SA 1RY3A 5APUA 2I1JA 5AVTB 2WT7A 1JCDA 2XZRA 3VOPA 1ZR4A 4GT1A 1N7LA 5APTA 2R3CA 1NTMK 1GK6A 2GM4A 1FJKA 1FZFA 3VP9A 3V2RA 1N7SD 2JJLA 3VTPC 1URQA 1J1DC 2WPQA 2P7JA 1LTJB 1SQVK 2OYIC 1N73B 2OYIB 2HPCB 2MJZA 1A02J 4LGDE 5APYA 4JF7A 3U1AA 4LC1A 1URQD 4B86A 2N1TA 3HUSC 1LTGC 1JTHB 3HUSB 3NXSA 5APWA 1N7SB 3H6PA 3RK3C 2WT7B 3P8CE 3II6A 3RK3B 2N9BA 3BVHA 4AUWA 5CCHA 5CJ0A 1G2CB 2R32A 1NO4A 1ZN5A 2N1TD 3GHGC 4Y99B 3HE4A 1W2EA 1LT9B 5AW8B 2WSEH 1HGVA 5APVA 3RL0D 4W80A 1X79B 5AW7B 2XKMA 2YKOA 4IFDK 5AW9B 2WPRA 1JY2N 1L4AA 1LTSC 1CSBA 2LKMA 3RK2D 1NWQA 3SWFA 1IO4A 1G1IA 2Q5UA 1H89A 2N1TB 3VP8A 3TNUA 3U59A 4WY4C 1L4AD 3I5CA 1JNMA 1YTZI 2WSCH 3B5ND 4M3LA 1SQXK 2A45H 3CLQA 1M1JC 2R5BA 2O1JA 3V2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IFM A;  2KSJ A;  1ZN5 A;  1QL2 A;  1IFN A;  2IFM A;  1QL1 A;  1IFM A;  2XKM A;  2KLV A;  1PFI A;  2IFN A;  4IFM A; 
#chains in the Genus database with same CATH topology
 1SQX D;  1JM0 A;  2ZYD A;  4N78 E;  1VF5 D;  2J58 A;  2WIT A;  3AEB C;  1FE6 A;  1BCC E;  3OA7 A;  1NKN A;  2O01 H;  2B9B A;  1KIL C;  3L35 A;  2H7H A;  4BWN A;  1LTI C;  1NTK K;  1IK7 A;  5H2F E;  3LIE A;  1S9K E;  2PRR A;  1G2C A;  1VQ5 P;  3E1I A;  1YJ9 P;  4PV1 D;  3T97 B;  1GL2 C;  1EC5 A;  4R4M A;  3L72 G;  1LP1 B;  4W7Y A;  1FC2 C;  1ZR2 A;  1R8E A;  1J1D B;  2QA4 P;  3N7N A;  2FFD C;  2IYO A;  2WSF H;  2FFD B;  3KYQ A;  3WUV A;  3L72 J;  4H0L C;  2QIW A;  1EXI A;  3IFM A;  4H0L B;  3JCU H;  2FYU D;  1QVG O;  2YXR B;  5KAF E;  1FZC C;  2E75 C;  2ITA A;  1L0L K;  1FU1 A;  2A45 I;  2Q3I A;  1L0N E;  2P1J A;  5TIS E;  2YKQ A;  5KJ7 D;  1HBW A;  2JDI H;  1HF9 A;  3GHG B;  5B66 E;  1IFJ A;  1P84 E;  1NTZ E;  1T3J A;  3G3Z A;  3MIW A;  5C39 A;  3AEG C;  1L2P A;  1FDM A;  3FWN A;  3CX5 E;  1GTW A;  2OQQ A;  3H1H E;  3V4Q A;  1RE3 A;  1IFI A;  1SLQ A;  3L4F A;  2M8R A;  1FAV A;  4I7Z C;  1JY3 O;  1MV8 A;  3CWB G;  2Q7C A;  3U1C A;  1KIL D;  2XDJ A;  3CME P;  3L71 D;  1KN7 A;  1BGY D;  1OW6 A;  3A5T A;  1U7J A;  3Q2Y A;  2A06 D;  3CWB J;  2IBZ E;  3M91 A;  1M57 D;  2XND H;  1S3J A;  2Q1K A;  5AVY B;  5KKZ B;  3RGU A;  1L0N K;  5CJ4 A;  3L74 E;  5APQ A;  1FDI A;  2E43 A;  5E79 E;  3BCC D;  2RMZ A;  2HOD A;  3MUD A;  3V6I A;  4H0L D;  1N8R Q;  1KB9 D;  2E76 C;  1DX7 A;  1E5W A;  4PD4 D;  5BVZ A;  2C9N Y;  2YKP A;  1IFN A;  2IFM A;  4XFJ A;  2PP6 A;  3A2A A;  1AQ5 A;  1DEB A;  1JY2 O;  4JYB A;  1NU1 G;  1SQB G;  1EQ7 A;  4JYC A;  1OIP A;  3LID A;  1N73 C;  1KYO I;  2JP3 A;  1NU1 J;  4AYC A;  3G6E P;  3A3Y B;  2JKV A;  3KZI E;  1VQ4 P;  1OVU A;  1SQP K;  3CCR P;  1S1C X;  3H1I G;  4HB1 A;  4Y99 C;  1IC2 A;  3AEE C;  1ZRT D;  3ABV C;  4YXW H;  2I8D A;  3QH9 A;  1S4X A;  3L70 E;  3OJA B;  2C9L Y;  4C46 A;  4C7N A;  1H0T A;  4R4L A;  3D70 A;  1NTM E;  1LTA C;  3H1I J;  1MZ9 A;  5KLV D;  2XU6 A;  2ZJS E;  4ZKU A;  4GKG A;  1FOS E;  1MKM A;  2KNC B;  3PLN A;  5BU5 A;  2W6B A;  3HD7 A;  5AW0 B;  4LLH A;  1YJW P;  4D6T E;  1NAF A;  2AEM A;  3IAO A;  5CCH C;  1YJN P;  5APS A;  1J1E C;  1EZV D;  3RK2 C;  3F89 A;  3HE4 B;  1J1E B;  3TGU D;  5TJH A;  3Q3D A;  2FXP A;  3M06 A;  1X9V A;  2K9Y A;  1G1J A;  5H2F H;  3SSU A;  3TF5 A;  2BCC E;  3L37 A;  1NTZ G;  1JEK A;  1K05 A;  1LWU B;  3H32 B;  3HTK A;  3BAT A;  1IFP A;  3H1H G;  2I1J A;  1NTZ J;  3A0H E;  4GT1 A;  1N7L A;  5B5E E;  2R3C A;  1NTM K;  2V7Q J;  2GM4 A;  1FJK A;  4OGQ B;  3H1H J;  1PP9 D;  1UIX A;  1KV4 A;  2QRX A;  4ASV A;  1X22 A;  1RQU A;  1SQV K;  3RBX A;  3H1K D;  2IBZ G;  5TIS H;  1Q7Y Q;  5APY A;  5B66 H;  4B86 A;  2N1T A;  3GG2 A;  2N9Y B;  3CXH D;  3USS A;  5APW A;  1N7S B;  3RK3 C;  2WT7 B;  1PPJ D;  3RK3 B;  2N9B A;  3CX5 H;  2WSC J;  1G2C B;  1BE3 E;  2R32 A;  3R4Y A;  4L74 A;  1TU3 F;  1BDC A;  1SQQ G;  5APV A;  3W67 A;  3I56 P;  1PZQ A;  1VQL P;  2P58 A;  2WPR A;  3G71 P;  3PTZ A;  3RK2 D;  3L72 E;  2E5T A;  4GOE A;  1IO4 A;  1G1I A;  1SQQ J;  4WVZ A;  4A7P A;  2BEQ D;  3L75 D;  4EI2 A;  1FS0 E;  4U3F G;  1KQS O;  1YTZ I;  2WSC H;  3L71 G;  4M3L A;  2LXB A;  2O1J A;  3Q5P A;  1JO5 A;  1CI6 A;  4C7R A;  2O3J A;  1GZL A;  5E79 H;  4U3F J;  5AW2 B;  1ZW0 A;  3NTN A;  2C0W A;  3L71 J;  2RH0 A;  2ZT9 B;  1L4A B;  2KXP B;  1HWT C;  4DJG A;  1FDO A;  1JUN A;  1RE3 C;  1T3U A;  3K5B A;  1IK9 A;  2C0X A;  2R3S A;  2YIU B;  3L73 D;  3AEA C;  4PD4 I;  2H43 A;  2KS1 A;  4KJM A;  3BCC J;  1NTK D;  4Y28 J;  2CK3 H;  2NRG A;  3CWB E;  2FBW C;  5K5G B;  1DIP A;  3RK3 D;  2W6A A;  1WRG A;  2JWD A;  3RL0 g;  3EQ2 A;  2J59 M;  1HTL C;  2JWA A;  3KZI H;  3W68 A;  2GA1 A;  4WY4 A;  1GK4 A;  3MUD C;  2FYN C;  2FYN B;  1M1J A;  1RE4 C;  1QL2 A;  1L0L D;  1OVR A;  2E42 A;  3H1J D;  1GU4 A;  1BCC D;  2ZFC A;  1J2J B;  4DOJ A;  2M3E A;  2CPS A;  2LR2 A;  2NPS A;  3CCV P;  4TT3 H;  1H88 A;  3AE8 C;  1USE A;  1YI2 P;  2ZT9 D;  3D6Y A;  2PFX A;  2ZXE B;  3PHL A;  2OYO A;  3AE5 C;  1YQ3 C;  3Q1M A;  1EZV I;  2GUV A;  1T8Z A;  2HYN A;  5GTH E;  2M5A B;  1A02 F;  3H1L G;  4DZO A;  4I1L A;  2Y9Z A;  1KYO E;  2IDB A;  2MKV A;  2BEZ F;  4RJT A;  1KIL B;  3MTU E;  5CCG A;  1VQ9 P;  1BE3 G;  2WWW A;  4BRY A;  1YIT P;  3H1I E;  3P8C D;  2NZ2 A;  1L0N D;  3H1L J;  1GW4 A;  2IX7 C;  1U57 A;  2IPP A;  1OFC X;  1SP4 A;  2SPZ A;  1ZV8 A;  4L75 A;  1BE3 J;  3FGA D;  1GL2 B;  3HD7 C;  1NKZ B;  2YO3 A;  1RF1 A;  1S5L E;  3HD7 B;  4XE5 B;  1NHL A;  1N86 A;  1X8Y A;  3HRN A;  1NU1 K;  1SQB K;  2P10 A;  3M0D A;  1VQK P;  2OAR A;  1DD3 A;  2B88 A;  2WSE J;  1FZC B;  4OWF A;  2GUS A;  2E75 B;  1OMI A;  5L8R J;  3CXH I;  4KHX A;  1DH3 A;  4I2L C;  1GMJ A;  3HTK B;  2A45 G;  1JCC A;  1MUU A;  2B89 A;  3G4S P;  2WTY A;  2UWJ E;  4HJG H;  2QVA A;  3KDP B;  1LT9 C;  3L74 D;  1SQP D;  3OW2 O;  4MN4 C;  1QEX A;  4ZKP A;  3V5B A;  1PIX A;  1ZXG A;  1USD A;  2K3R A;  4I7Z B;  3LW5 J;  4RO0 A;  4EDF A;  1VPC A;  3B5N A;  3CC2 P;  4IL6 E;  2J5U A;  2QE7 H;  1QL1 A;  4HYT B;  2OTJ P;  2N1T C;  1BSN A;  4AQR D;  1WT6 A;  2QJY C;  3RL0 C;  2QJY B;  3RL0 B;  2FYU E;  1KC8 Q;  1YYC A;  3MP7 B;  1KOR A;  1NOH A;  1GL2 D;  1BDD A;  3B8E B;  1T2K C;  1NAY A;  3FXD A;  3HD7 D;  3UIA A;  1E79 H;  2WQY C;  3PJS K;  3LW5 H;  1M7L A;  4JPZ B;  5M1B A;  1LTJ A;  2WVR A;  3JC2 2;  2HPC A;  1NTZ K;  3TK1 A;  1SQQ E;  1QGK B;  1RE4 A;  5DJU B;  2QJK C;  2E76 B;  2V4H A;  3N4X A;  3NFQ A;  3S1K A;  1LTB C;  2E75 D;  2B87 A;  3CCJ P;  3AEF C;  3MD0 A;  3CCQ P;  2LXC B;  4QMA A;  5APU A;  2WPV B;  1ZR4 A;  3CMA P;  4L76 A;  1GK6 A;  3L70 D;  4U3F E;  1NTM D;  3V2R A;  3L71 E;  2Y0D A;  1BGY E;  5GTI E;  1PV3 A;  1N73 B;  4LGD E;  1SQV D;  1VQ6 P;  1D7M A;  4D6T D;  1R5S A;  1AQT A;  1W2B O;  3BCC E;  5CJ0 A;  2Y0C A;  2ZYA A;  2N1T D;  4Y99 B;  3D71 A;  5AW8 B;  3CC4 P;  1HGV A;  3RL0 D;  4GOF A;  2BCC D;  4W80 A;  1L0L J;  4GDO A;  1X79 B;  4PD4 E;  2XKM A;  4IFD K;  3FX0 A;  2K9J A;  1LTS C;  2LKM A;  2QJP C;  2QJP B;  2IZ1 A;  2WMM A;  1K04 A;  5GTH H;  3TNU A;  3U59 A;  3I55 P;  1Y47 A;  4WY4 C;  5CBO A;  4ZNC A;  2KI7 B;  3G9R A;  1SQX G;  1KYO H;  1M1J C;  2E76 D;  4PJ0 E;  2FXM A;  5AVZ B;  3T97 A;  3RK2 B;  4O9B A;  1LGH B;  1SQX J;  4Z1M H;  5DJT B;  1SFC C;  2OYI A;  3M9H A;  1EDJ A;  4JBZ A;  3H25 A;  1DD4 A;  1AV1 A;  4U7J A;  2NPS C;  4N3Y B;  1KZU B;  3S4R A;  1S5L H;  1JTH A;  2W90 A;  2R44 A;  1NGM B;  2ZXX A;  5EFW B;  1LT9 A;  5AVQ B;  3GHG A;  3RBZ A;  1DEE G;  2H8P D;  1KQG B;  3EFF K;  1VQ8 P;  5KAF H;  3VMY A;  2K88 A;  3M9Q A;  2G8Y A;  3L72 D;  1SS1 A;  2KB7 P;  1Q81 Q;  2FYU G;  2POH A;  3JSV C;  1M8O B;  1PGP A;  3AED C;  2Q3E A;  3AE1 C;  5CCG C;  5APX A;  1VQM P;  4H13 C;  1EZV E;  1P84 H;  3H1L E;  4BRY B;  3TGU E;  2V7Q H;  2R5D A;  2W83 C;  1IJD B;  2K1A A;  2FYU J;  2Y0E A;  2E74 C;  1VQ7 P;  3KHU A;  2OYH A;  1RF1 C;  1AVY A;  1JMB A;  3JCU E;  3B4S A;  2W27 A;  3M0A A;  5CCH D;  4IL6 H;  2PAJ A;  3WMM 0;  3M0D C;  2RN0 A;  2FXO A;  4EOT A;  2HLO A;  2KOG A;  1OXZ A;  3HE5 A;  1BGY G;  3PH0 A;  3CWB D;  3ZDM A;  3AE9 C;  1OWA A;  2YXQ B;  2A06 G;  5AVV B;  1NYH A;  4IFM A;  3CCE P;  4N6J A;  3KXD A;  2KSJ A;  1LJ2 A;  4BXL A;  1BGY J;  5KAI E;  2W8Z A;  1OW7 A;  3CXH E;  1PPJ E;  3BCC G;  3EWK A;  1KB9 I;  4RKU J;  3BRT B;  2JEE A;  1KMI Z;  3B5N C;  5CCG D;  3M9B A;  2HG5 D;  1VQN P;  2KP8 A;  1NVO A;  5BU8 B;  5GTI H;  1VF5 C;  3IR9 A;  1LT1 A;  3L75 E;  1FZB A;  3P8M C;  3GF7 A;  2E74 D;  2IFN A;  3C9I A;  1FBM A;  1S5L X;  3AEC C;  3KPE A;  1PL5 A;  2QSI A;  2ZVO B;  3VMZ A;  5AVW B;  1CZQ A;  3KQG A;  1LTJ C;  4H44 C;  1NU1 D;  1SQB D;  3ITK A;  5KTB A;  2HOD B;  3IN6 A;  2AEJ A;  2Q9I A;  4L73 A;  2Z4E A;  2Y9Y A;  4N78 D;  2KNC A;  4PV1 C;  1AA0 A;  2QEX P;  1PFI A;  1PGQ A;  2Z5H A;  2D2C C;  2B87 B;  4PD4 H;  2BAS A;  2D2C B;  1KYO D;  4NPF X;  3L73 E;  1PGO A;  1SFC A;  3O8Z A;  4HH2 A;  2KLU A;  2L91 A;  1YHQ P;  2KUB A;  1XTG B;  3H1I D;  3OAK A;  3MGN A;  4W7Z A;  3SWK A;  1S9K D;  5KLV G;  1AFO A;  1KFN A;  4PJ0 H;  1MFZ A;  3RK3 E;  3GW6 A;  1RF0 C;  1JB0 J;  1CW5 A;  2ZAE B;  1LWU A;  4I6M C;  3EFG A;  3H32 A;  1IZN B;  1Z56 A;  1W5C E;  5KJ7 C;  5KLV J;  4IL6 X;  1EZV G;  1FZA A;  3AE7 C;  2P67 A;  3TGU G;  2E5Y A;  5AVU B;  3QWO C;  1FOS F;  1KFM A;  2CPB A;  2W6J H;  1L0L E;  4WB4 A;  2KK7 A;  3H1J E;  2FKW B;  1SVF A;  4C7N B;  1H0T B;  2VRS A;  3A0H H;  3TGU J;  1ZLL A;  5B5E H;  5AVS B;  2K9J B;  3WU2 E;  4ZMD A;  2YNY A;  2WSS H;  2WSF J;  1P84 D;  1JY3 N;  1NTZ D;  1NH4 A;  4H44 D;  3CL3 D;  3TNU B;  1M90 Q;  1N7S A;  2WT7 A;  3S9O A;  1JCD A;  2XZR A;  3CX5 D;  3H1H D;  5KLI C;  5APT A;  3CCS P;  2KSE A;  1T6A A;  5KLI B;  3GMA A;  1PP9 G;  1AVO A;  2D2C D;  4K3A A;  2JJL A;  1SQX E;  2M0B A;  1URQ A;  3H1K G;  4UB6 E;  1J1D C;  2P7J A;  3IF4 A;  2OYI C;  3CCL P;  1PP9 J;  2OYI B;  1UII A;  1RHZ B;  3U1A A;  2KZI A;  2IBZ D;  3H1K J;  4IOI H;  3D6Z A;  1JTH B;  1PPJ G;  3NXS A;  3H6P A;  3P8C E;  3II6 A;  4NPD A;  1NO4 A;  1ZN5 A;  3GHG C;  2H88 C;  1LT9 B;  2ZVN B;  1S72 P;  2WSE H;  5AW7 B;  3B71 A;  1SQQ D;  2YKO A;  3SFD C;  3C8V A;  5AW9 B;  1JY2 N;  1L4A A;  2Q6Q A;  1CSB A;  3L75 G;  1NWQ A;  2G3A A;  1H89 A;  2N1T B;  3VP8 A;  5KAI H;  4WWI A;  1SQX K;  2A45 H;  3CXH H;  3O6Q A;  3CLQ A;  2R5B A;  3L75 J;  1EDK A;  4U3F D;  4KT0 J;  1HVV A;  2OYH C;  2KYV A;  4TLF A;  2OYH B;  2H89 C;  1KQF B;  2QM7 A;  1IFM A;  2KLV A;  3V2P A;  2PGD A;  1EDI A;  4EYY Q;  4JQ0 D;  5KKZ C;  1GDT A;  1RH5 B;  2IZ0 A;  2I1K A;  3L73 G;  4ASW A;  1LNQ A;  2QJK B;  3CD6 P;  1SQP E;  1VQO P;  3HUS A;  2YO2 A;  1NTK G;  3HE5 B;  3L73 J;  3MZW B;  1CI6 B;  1KIL E;  2HFE D;  1JMM A;  2QG4 A;  1NTK J;  3BAS A;  4OVN F;  4UB8 E;  3A0B E;  2A06 E;  3FWL A;  5AW5 B;  1RF0 A;  1R5L A;  1YIJ P;  3L36 A;  1GD2 E;  2FYU K;  3FXE A;  1FZE A;  1LTT C;  1ZME C;  1RQV A;  1Q2N A;  1Q90 D;  5KJ7 A;  1EXJ A;  3VMX A;  1H8A A;  1L0L G;  3SWY A;  3H1J G;  2KS1 B;  3CCM P;  3P32 A;  1QX8 A;  1SQB J;  4OH8 B;  2AXT E;  1BCC G;  3WUU A;  1EDL A;  3CPW O;  1QLE D;  3CCU P;  1SQQ K;  3C1L A;  2AXC A;  1KB9 E;  4NPE A;  1OX3 A;  2M5A A;  1GW3 A;  3H1J J;  2IYP A;  3BRV B;  1T2K D;  2Z5I A;  1BCC J;  5AVR B;  1KIL A;  3VN0 A;  3CI9 A;  3V4W A;  2WZ7 A;  4WY4 B;  1HJB A;  5AW3 B;  4YPC A;  3NMD A;  1M1J B;  1K73 Q;  1LP1 A;  1GL2 A;  1SQV E;  3CC7 P;  2XNX A;  1KTM A;  1HH0 A;  4HKZ H;  2FFD A;  1SFC B;  3WU2 H;  1VL2 A;  2OGU A;  3H1L D;  3E1R A;  1L0N G;  3R2P A;  2NPS B;  1ZRT E;  2L5G B;  1WMK A;  3TYY A;  1OZH A;  1P84 I;  5AW6 B;  2RKL A;  3VYI A;  1FZC A;  1BE3 D;  3TDK A;  4YTP C;  1IFD A;  1LWU C;  1YTZ T;  1JOC A;  3CX5 I;  1Y9B A;  3GLM A;  1L0N J;  3Q5R A;  5KLV E;  2O01 N;  1PGJ A;  3PP5 A;  3Q5S A;  4UB6 H;  1QVF O;  1KQL A;  3AE2 C;  1Q82 Q;  1U7M A;  1JY3 P;  4OGQ C;  3V2Q A;  3P7K A;  4IFF A;  3GF3 A;  4H13 B;  2AEF A;  2IBZ I;  2FYZ A;  2OTK E;  2YMY A;  3E7K A;  2E74 B;  2O1K A;  3A7O A;  4K35 A;  4GIF A;  1HJ0 A;  4WY4 D;  4DCK A;  1FJP A;  1N7S C;  1RF1 B;  3L74 G;  1Y8A A;  1SQP G;  1KD1 Q;  1XTC C;  1X0T A;  2QM8 A;  2XV5 A;  5CHX A;  2YMK A;  4XA4 A;  3AE4 C;  3MHV A;  4YXD C;  1URQ C;  1Q86 Q;  3L74 J;  1URQ B;  5KLV K;  1SQP J;  1SFC D;  2DW3 A;  5AVX B;  1PP9 E;  1YBK A;  1HGZ A;  2K37 A;  2NPS D;  2JR8 A;  1VDF A;  5AW4 B;  3H1K E;  1JY2 P;  3TSI A;  2WPS A;  5CMZ A;  5CBN A;  4RES B;  1VQP P;  2M3B A;  1NJI Q;  1ZOY C;  1GU5 A;  2HR3 A;  1HUC A;  4GOD A;  5AW1 B;  1AJY A;  1FZG A;  2FY8 A;  2ZT9 C;  1L4A C;  1N73 A;  1N2D C;  4OGQ D;  4EIJ A;  3B5N B;  1BSH A;  2KIK A;  4H13 D;  1OVV A;  2JO1 A;  1M1K Q;  2YIU C;  4WBA A;  2P2U A;  2OTL P;  3AE6 C;  4UB8 H;  3A0B H;  1RY3 A;  5AVT B;  3L70 G;  1OW8 A;  1VF5 B;  3VOP A;  2KZJ A;  3O6Q B;  4CPG A;  1NTM G;  3SFE C;  1FZF A;  1YQ4 C;  3VP9 A;  1N7S D;  1S2E A;  3VTP C;  3L70 J;  2WPQ A;  1LTJ B;  4H44 B;  3AE3 C;  1SQV G;  1NTM J;  4D6T G;  2HPC B;  2MJZ A;  2AXT H;  1A02 J;  4JF7 A;  4LC1 A;  1URQ D;  1KB9 H;  4PV1 B;  3HUS C;  1LTG C;  3HUS B;  2ZYG A;  1SQV J;  1K8A Q;  4D6T J;  3BVH A;  4AUW A;  5CCH A;  4DT0 A;  3HE4 A;  1W2E A;  2BCC G;  3F5H A;  1NTK E;  1M56 D;  1K9M Q;  3WUT A;  1MFT A;  3PRJ A;  2BCC J;  3SWF A;  3VMA A;  2Q5U A;  2O01 J;  1L4A D;  3I5C A;  1JNM A;  3B5N D;  1ZP0 C;  1NU1 E;  1SQB E;  3V2N A; 
#chains in the Genus database with same CATH homology
 2FXM A;  1HVV A;  5AVZ B;  3T97 A;  1JO5 A;  1CI6 A;  4C7R A;  2OYH C;  2KYV A;  3RK2 B;  4O9B A;  2OYH B;  1GZL A;  4N78 E;  1LGH B;  2QM7 A;  1IFM A;  5AW2 B;  3NTN A;  2J58 A;  2KLV A;  2WIT A;  3V2P A;  2C0W A;  1SFC C;  2OYI A;  1L4A B;  3OA7 A;  3M9H A;  1NKN A;  1HWT C;  1GDT A;  2O01 H;  1KIL C;  2I1K A;  1RE3 C;  2NPS C;  3L35 A;  1JUN A;  1T3U A;  2H7H A;  4N3Y B;  1KZU B;  1JTH A;  1IK9 A;  2C0X A;  3HUS A;  1LTI C;  2YO2 A;  1NTK K;  2H43 A;  3LIE A;  1S9K E;  1G2C A;  3HE5 B;  3E1I A;  1LT9 A;  5AVQ B;  3GHG A;  1CI6 B;  1GL2 C;  2H8P D;  2HFE D;  1JMM A;  3VMY A;  4W7Y A;  3M9Q A;  3RK3 D;  2W6A A;  1ZR2 A;  1WRG A;  3BAS A;  1J1D B;  3N7N A;  2FFD C;  2KB7 P;  2WSF H;  5AW5 B;  1RF0 A;  2FFD B;  3EQ2 A;  3L36 A;  1GD2 E;  2FYU K;  2J59 M;  1HTL C;  3KYQ A;  1FZE A;  2POH A;  1LTT C;  5CCG C;  5APX A;  3IFM A;  5KJ7 A;  1FZC C;  3VMX A;  4WY4 A;  1H8A A;  2R5D A;  1L0L K;  1FU1 A;  1GK4 A;  3SWY A;  1IJD B;  2A45 I;  2Q3I A;  1M1J A;  1RE4 C;  1QL2 A;  2P1J A;  3P32 A;  2YKQ A;  4OH8 B;  5KJ7 D;  1HBW A;  2E42 A;  3GHG B;  2OYH A;  1SQQ K;  1IFJ A;  1GU4 A;  1RF1 C;  2ZFC A;  1T3J A;  3G3Z A;  1GW3 A;  5CCH D;  2W27 A;  3M0A A;  3MIW A;  3BRV B;  1J2J B;  4DOJ A;  2CPS A;  1T2K D;  2Z5I A;  2PAJ A;  1FDM A;  1GTW A;  5AVR B;  3V4Q A;  3WMM 0;  1KIL A;  3M0D C;  1RE3 A;  2NPS A;  1IFI A;  1H88 A;  3VN0 A;  1SLQ A;  3CI9 A;  3L4F A;  2M8R A;  1FAV A;  3V4W A;  1JY3 O;  4EOT A;  2WZ7 A;  2HLO A;  1MV8 A;  4WY4 B;  2KOG A;  2Q7C A;  1HJB A;  1OXZ A;  2ZXE B;  5AW3 B;  3HE5 A;  3U1C A;  1KIL D;  2XDJ A;  3NMD A;  1M1J B;  1OWA A;  5AVV B;  4IFM A;  4N6J A;  1GL2 A;  3A5T A;  2GUV A;  1T8Z A;  2HYN A;  2XNX A;  2KSJ A;  1A02 F;  1HH0 A;  3M91 A;  2FFD A;  4DZO A;  1SFC B;  4I1L A;  5AVY B;  1L0N K;  3R2P A;  1KIL B;  3MTU E;  5CCG A;  2NPS B;  5CJ4 A;  2WWW A;  5APQ A;  2E43 A;  2L5G B;  3TYY A;  3P8C D;  5AW6 B;  3VYI A;  1FZC A;  1GW4 A;  3BRT B;  2HOD A;  2IX7 C;  2JEE A;  2IPP A;  3MUD A;  1IFD A;  1SP4 A;  1LWU C;  3B5N C;  1YTZ T;  1JOC A;  5CCG D;  1DX7 A;  1ZV8 A;  3M9B A;  2HG5 D;  1E5W A;  1GL2 B;  3HD7 C;  3PP5 A;  2KP8 A;  1NKZ B;  2YO3 A;  1RF1 A;  5BU8 B;  3HD7 B;  1KQL A;  4XE5 B;  1NHL A;  1N86 A;  5BVZ A;  2C9N Y;  3IR9 A;  2YKP A;  1FZB A;  3P8M C;  1IFN A;  2IFM A;  1JY3 P;  2PP6 A;  3A2A A;  1AQ5 A;  2IFN A;  3C9I A;  1X8Y A;  1FBM A;  1DEB A;  1JY2 O;  3V2Q A;  3P7K A;  3KPE A;  4IFF A;  4JYB A;  3HRN A;  1NU1 K;  1SQB K;  3M0D A;  1EQ7 A;  2OAR A;  3VMZ A;  5AVW B;  1CZQ A;  3KQG A;  1LTJ C;  3LID A;  2FYZ A;  4JYC A;  1FZC B;  1N73 C;  5KTB A;  2YMY A;  2GUS A;  2HOD B;  4KHX A;  1DH3 A;  2Q9I A;  2Z4E A;  4N78 D;  2O1K A;  4I2L C;  3HTK B;  4AYC A;  2A45 G;  3A7O A;  4GIF A;  4WY4 D;  1JCC A;  1MUU A;  1PFI A;  1FJP A;  3A3Y B;  2Z5H A;  2WTY A;  1N7S C;  1RF1 B;  2BAS A;  1SQP K;  1XTC C;  3KDP B;  1SFC A;  2QM8 A;  4Y99 C;  1IC2 A;  3O8Z A;  4HH2 A;  2XV5 A;  1LT9 C;  5CHX A;  4XA4 A;  1XTG B;  3OAK A;  3MGN A;  3OJA B;  1URQ C;  3V5B A;  4ZKP A;  4W7Z A;  2C9L Y;  4C46 A;  4C7N A;  1S9K D;  1URQ B;  5KLV K;  1SFC D;  1AFO A;  5AVX B;  1LTA C;  1KFN A;  1VPC A;  1MFZ A;  1MZ9 A;  1HGZ A;  1RF0 C;  1CW5 A;  1LWU A;  3B5N A;  2NPS D;  4I6M C;  3EFG A;  3H32 A;  1QL1 A;  1Z56 A;  2XU6 A;  4ZKU A;  4GKG A;  5AW4 B;  1VDF A;  4HYT B;  1FOS E;  2N1T C;  4AQR D;  5KJ7 C;  1JY2 P;  3TSI A;  5BU5 A;  2W6B A;  2WPS A;  3HD7 A;  5AW0 B;  4LLH A;  1WT6 A;  5CMZ A;  1NAF A;  3RL0 C;  4RES B;  2M3B A;  3RL0 B;  1FZA A;  2P67 A;  5CCH C;  1YYC A;  5AVU B;  1NOH A;  1GL2 D;  5APS A;  3B8E B;  1J1E C;  1FOS F;  3RK2 C;  1KFM A;  1T2K C;  3UIA A;  3HD7 D;  3HE4 B;  1J1E B;  1GU5 A;  2CPB A;  1HUC A;  4WB4 A;  3M06 A;  3LW5 H;  5AW1 B;  1X9V A;  2FKW B;  1SVF A;  1FZG A;  4C7N B;  1M7L A;  1LTJ A;  1G1J A;  2VRS A;  1ZLL A;  1L4A C;  1N73 A;  1N2D C;  5AVS B;  2HPC A;  3L37 A;  1NTZ K;  3TK1 A;  4EIJ A;  1LWU B;  1RE4 A;  3B5N B;  3H32 B;  3HTK A;  3BAT A;  2YNY A;  3N4X A;  3NFQ A;  1JY3 N;  1NH4 A;  4WBA A;  1LTB C;  2P2U A;  3CL3 D;  3TNU B;  3MD0 A;  1N7S A;  1RY3 A;  5APU A;  2I1J A;  5AVT B;  2WT7 A;  1JCD A;  2XZR A;  3VOP A;  1ZR4 A;  4GT1 A;  1N7L A;  5APT A;  2R3C A;  1NTM K;  1GK6 A;  2GM4 A;  1FJK A;  1FZF A;  3VP9 A;  3V2R A;  1N7S D;  2JJL A;  3VTP C;  1URQ A;  1J1D C;  2WPQ A;  2P7J A;  1LTJ B;  1SQV K;  2OYI C;  1N73 B;  2OYI B;  2HPC B;  2MJZ A;  1A02 J;  4LGD E;  5APY A;  4JF7 A;  3U1A A;  4LC1 A;  1URQ D;  4B86 A;  2N1T A;  3HUS C;  1LTG C;  1JTH B;  3HUS B;  3NXS A;  5APW A;  1N7S B;  3H6P A;  3RK3 C;  2WT7 B;  3P8C E;  3II6 A;  3RK3 B;  2N9B A;  3BVH A;  4AUW A;  5CCH A;  5CJ0 A;  1G2C B;  2R32 A;  1NO4 A;  1ZN5 A;  2N1T D;  3GHG C;  4Y99 B;  3HE4 A;  1W2E A;  1LT9 B;  5AW8 B;  2WSE H;  1HGV A;  5APV A;  3RL0 D;  4W80 A;  1X79 B;  5AW7 B;  2XKM A;  2YKO A;  4IFD K;  5AW9 B;  2WPR A;  1JY2 N;  1L4A A;  1LTS C;  1CSB A;  2LKM A;  3RK2 D;  1NWQ A;  3SWF A;  1IO4 A;  1G1I A;  2Q5U A;  1H89 A;  2N1T B;  3VP8 A;  3TNU A;  3U59 A;  4WY4 C;  1L4A D;  3I5C A;  1JNM A;  1YTZ I;  2WSC H;  3B5N D;  4M3L A;  1SQX K;  2A45 H;  3CLQ A;  1M1J C;  2R5B A;  2O1J A;  3V2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...