3IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ifmA00
4IFMA 3IFMA 1PFIA 1QL2A 1IFNA 2IFMA 1IFMA 2IFNA 2KLVA 2XKMA 2KSJA 1ZN5A 1QL1A
chains in the Genus database with same CATH superfamily
2OARA 1QEXA 3MGNA 1EZVE 1UIIA 1S9KE 4UB6H 3RK2D 2VRSA 3SWKA 1NTME 1OX3A 1VQ5P 2WPRA 2AXCA 4RKUJ 1OZHA 2LR2A 3H1JG 1HJ0A 5APSA 1VQ7P 2HODB 1SVFA 2ZT9D 1L0LK 4AQRD 1M1KQ 3VMXA 3BCCD 1AA0A 1WT6A 2WSFH 3HE4A 4PD4D 1UIXA 2O3JA 2DW3A 2W27A 3SFDC 1M1JB 1Y9BA 3L75J 5APTA 3H1KD 4Y99C 1BGYJ 4NPDA 1SQXG 1JTHB 3LIDA 1KMIZ 3D71A 1GTWA 5APWA 2JP3A 3A0HH 1S1CX 2IX7C 3H1LJ 2W6AA 4EOTA 3CXHE 1L0ND 4XA4A 2AEJA 1NH4A 1RHZB 3CPWO 3Q1MA 4IL6H 4H44D 2WPVB 3AE5C 4LLHA 2HODA 2A45H 1JB0J 3AE8C 3LIEA 1MFZA 4JYBA 4U3FD 5AW8B 4PJ0H 3CCUP 1VF5C 2N9YB 1SQQG 2K88A 2ZJSE 4IL6X 3PLNA 1S5LE 5CCHD 4RJTA 3MUDC 3H1HE 1FOSF 3MUDA 2HLOA 1DEEG 1JTHA 1SQVD 4I7ZB 1PP9E 1SQPE 3L4FA 2Q1KA 2ZYAA 5GTHH 2IBZG 2R3SA 1VF5D 2LKMA 5KAFE 3RK3B 4K3AA 3RK3E 1N86A 1ZRTD 2W90A 2D2CB 3TGUE 3M91A 3RGUA 2KZIA 1PPJE 3BASA 4IFFA 2ZXXA 1X9VA 1ZP0C 2ITAA 5BU5A 1LJ2A 2QIWA 1FDIA 4WBAA 1AV1A 4DJGA 3VOPA 4WB4A 1N7LA 2W6BA 1RF1C 4JYCA 2K3RA 4UB6E 3TNUB 1RF1A 3H1ID 5TJHA 2Q6QA 3L72D 1KV4A 3KDPB 1JY2N 2QM7A 3D6ZA 2Q3IA 5AVQB 2B89A 1QLED 1GW3A 2RKLA 3MTUE 1VQPP 2C0XA 2QJYB 5K5GB 3CCLP 3U1CA 1R5SA 1EZVG 2V4HA 3R4YA 4XE5B 4L73A 2FXOA 5AVUB 4DZOA 1YTZI 1NU1D 3AEDC 1P84H 2KI7B 1P84I 4BRYB 3TGUD 3A0HE 2M5AA 1E5WA 1Q2NA 1FZEA 1URQB 1YJ9P 1XTGB 1N7SB 4JQ0D 3TNUA 4ZKUA 1K04A 2E75C 1GZLA 4B86A 5BVZA 4C7NB 1FDOA 1K73Q 1AVYA 3W68A 1Y8AA 3H6PA 2NZ2A 1ZV8A 2A06D 3A3YB 5AW9B 3O6QA 1KQGB 2N1TB 2WPSA 3TDKA 2E75D 4CPGA 5KLVJ 2R5BA 1KILD 2P2UA 1FDMA 3H1IG 3L74J 3E1RA 1X79B 1FZGA 3ABVC 3PJSK 5GTHE 2NPSC 4BRYA 3ZDMA 3VMYA 2KOGA 3A7OA 2OYIC 3CCQP 1KZUB 1ZW0A 2NPSA 1ZLLA 2XV5A 3KZIE 2OYIA 1IJDB 2P67A 3G71P 1L4AB 1AQ5A 4HH2A 4Y28J 3A0BH 5KLVK 1SQBE 4U7JA 2H8PD 3H1HG 2G8YA 1KN7A 2E74B 1JCCA 4YPCA 4O9BA 4WY4B 4H13D 2NPSD 2QJPC 1PP9G 1SQPG 1J1EB 1CI6A 3S1KA 1FJKA 1VQKP 1EDKA 4JPZB 1S2EA 1NTKD 1VQOP 1NAYA 1VPCA 2H7HA 1DD4A 3V4WA 2FYNB 3LW5H 3M0AA 3TGUG 2WSSH 1QL1A 1GW4A 3PH0A 1YYCA 3L73D 1PPJG 1NTZD 3L70J 2IYPA 1KYOH 3FX0A 1U7MA 1N73B 3BCCJ 2C9NY 2I1KA 3HE5A 5H2FE 3H1JD 1L4AA 4YXWH 3B71A 3EQ2A 3NXSA 3MD0A 2XU6A 3H1KJ 3SWFA 4I2LC 4WY4C 1Q7YQ 1P84E 1JNMA 2FYUD 4WY4A 2XZRA 3TF5A 3CC2P 4WWIA 3CWBE 2OTKE 1JMMA 3MP7B 2FYNC 1W2EA 4XFJA 5AVZB 1YITP 3P8CE 1YBKA 1BE3J 1L0NJ 1RQUA 2XKMA 1SQXD 1YJWP 1USDA 1OW8A 2I1JA 1USEA 1HVVA 1N73C 3B5NC 2FXMA 1BDCA 2YMYA 2POHA 5M1BA 1JCDA 3B5NA 1N73A 4U3FJ 5KAFH 3F89A 3FWNA 1LWUC 3SSUA 3CX5H 1KFNA 3G9RA 1LWUA 2MJZA 2K1AA 1NTKG 2H88C 5APVA 1L0NK 3B4SA 1JEKA 3KQGA 4D6TE 1NOHA 3B5ND 3HUSB 3L36A 1SQVJ 5AVYB 2PRRA 1YTZT 1SQQD 2A45G 1KB9D 5CCGC 1KQFB 3L73G 3T97B 1NTZG 2BCCJ 3M9BA 2PGDA 4ASVA 5CCGA 2GM4A 2Y9YA 3JC22 1HGVA 3GHGB 2JEEA 5TISH 3FXEA 1FJPA 3A0BE 2IBZD 3BRTB 1VQ8P 3CWBD 1LTJB 4ZKPA 5CCGD 3CD6P 1SLQA 3VP8A 1KTMA 1BCCE 1LTBC 3P8MC 2FYUG 2QEXP 2WZ7A 3KPEA 2XNDH 3H1IJ 2FBWC 3L72J 3NTNA 3L37A 1S4XA 2HPCA 2OTLP 1SQBG 3HUSC 1IK7A 1L0LE 1HUCA 2K9YA 2KLVA 3AEBC 3HUSA 3U59A 4GDOA 1KYOE 5APUA 4GODA 5L8RJ 5KLIB 4D6TD 1T3JA 2Z5HA 1IFJA 2RH0A 3BATA 1DH3A 3IFMA 1Q82Q 1FS0E 4HKZH 1LTJC 1NU1J 1LTJA 1N8RQ 1M56D 1FBMA 2QM8A 1EZVD 1S9KD 1Q86Q 4GOEA 1PGJA 1GU4A 1RH5B 3CL3D 1NTMD 2IYOA 1M1JC 1JUNA 1WMKA 2K37A 5APYA 3H25A 1JOCA 1LP1B 1M1JA 2WITA 3L75E 2V7QJ 1BGYE 2I8DA 2MKVA 2G3AA 1IZNB 3L71J 2P58A 3CCMP 1NU1K 1OIPA 5KKZB 1KD1Q 3A2AA 1OVVA 1DIPA 5B5EH 1PZQA 3CWBG 1J1DB 1GK6A 2JR8A 2KYVA 3H1LE 5KLIC 3KZIH 3CX5E 2ZYDA 4W80A 5AW4B 2E76B 4LGDE 5AVWB 2FXPA 2R44A 3D70A 1KYOD 4C46A 1U7JA 1VQ6P 1LTGC 4L76A 5KJ7C 2N9BA 5KJ7A 4EIJA 1T3UA 4BXLA 1NO4A 3V2PA 3CXHD 2K9JB 3Q3DA 1NGMB 1Y47A 2IZ0A 2QRXA 1OMIA 5TISE 3C8VA 1IK9A 5KJ7D 4D6TG 4I7ZC 2HFED 3QH9A 2Z5IA 2E5YA 2CPSA 1PFIA 2JO1A 4K35A 1J1DC 3RK3C 2J59M 4C7RA 1T8ZA 3N7NA 2W6JH 1LGHB 1MUUA 3L75D 2D2CC 1GD2E 3H1HD 1HF9A 4UB8H 5H2FH 1FZAA 1FZCB 2Q3EA 4A7PA 1OVRA 2HR3A 2OGUA 2P10A 1VL2A 1PP9D 1SQPD 1NTMG 2JKVA 1NTZJ 2JWAA 1RY3A 2O01N 4RESB 5AVXB 1K9MQ 3BVHA 3RK3D 1JY2O 3CX5D 3VMAA 4GKGA 3VP9A 1LT9B 5AW2B 4OGQB 3GG2A 1BCCG 2FY8A 2D2CD 2K9JA 2KNCB 3CCJP 3ITKA 1PPJD 3H1JJ 1ZOYC 2C0WA 4H0LB 4KHXA 2KLUA 3IF4A 2KSJA 1OW7A 3AECC 4NPEA 1CSBA 1L0LG 3TYYA 3KYQA 4TT3H 1XTCC 2FYUJ 1CW5A 2QJYC 3KHUA 1EDLA 1TU3F 1QVFO 1NJIQ 1A02F 1AQTA 2BEZF 3G6EP 2R32A 1AFOA 2YIUB 4PD4I 1KQSO 1HBWA 3G4SP 2O1KA 1SQXJ 2WSEJ 3C1LA 1S3JA 2XNXA 5E79E 3PP5A 1SFCB 3HTKB 2Y0CA 3G3ZA 2M3BA 1YIJP 5B5EE 3WU2H 1DEBA 1URQC 2M0BA 1JY2P 3S4RA 1FAVA 1N7SC 3E7KA 1URQA 1GK4A 4H0LC 1PL5A 1IFMA 5KTBA 4KT0J 1N7SA 2YMKA 4M3LA 2M3EA 1RE3C 2Y0DA 1SQXK 3L75G 3AE6C 1BGYG 2FKWB 4C7NA 1RE3A 1SS1A 1FZFA 2KS1B 3RBXA 1GMJA 1QX8A 1SQQJ 4L75A 1RF0A 3AEAC 1URQD 2AEFA 2E42A 2QG4A 3FGAD 1N7SD 2YIUC 1FOSE 2N1TC 1PV3A 3H1LG 4R4MA 1EXJA 1VQ9P 3WUUA 2N1TA 5KLVE 3Q2YA 4PV1B 3V2NA 3M0DC 1SFCC 1KC8Q 1NKNA 1ZR4A 3L74E 3WMM0 1K05A 1IFDA 4R4LA 5AW3B 1LNQA 1SFCA 3M0DA 3VN0A 4IFMA 2P1JA 3KXDA 3JSVC 3HD7B 2SPZA 1M8OB 3E1IA 4BWNA 2ZVNB 1SQQK 2N1TD 1L4AC 2Z4EA 1IC2A 4UB8E 2HYNA 3N4XA 2RMZA 1QVGO 2H89C 2E74C 4N3YB 1HTLC 1NYHA 3RL0B 1GL2B 2OQQA 1J1EC 2WPQA 3U1AA 5KAIH 4JF7A 1MFTA 1L4AD 1L2PA 3RK2B 2M8RA 3CLQA 1IFNA 3D6YA 5CJ4A 1SQBD 1VQLP 1LT1A 2Q9IA 2E74D 1LTIC 3L70E 4WY4D 1A02J 1NHLA 2ZT9B 2ZYGA 4EDFA 3BCCE 3H32B 1H8AA 4ASWA 2L5GB 4PD4E 5APQA 4GT1A 2OTJP 2AEMA 3AE2C 3RBZA 1ZXGA 3L35A 2WMMA 2ZFCA 5EFWB 3H1KE 1PIXA 1GL2C 3HE4B 1QGKB 1GL2A 1S72P 3TK1A 3PTZA 1JY3O 3SFEC 3WU2E 1WRGA 3M9QA 5GTIE 2W83C 3MIWA 1BE3E 2QSIA 1L0NE 2L91A 1HJBA 1BSNA 1P84D 2V7QH 1ZR2A 1H89A 4H44B 2ZT9C 5CJ0A 1YHQP 4TLFA 2XDJA 4OVNF 1SQVK 4HYTB 3H32A 4U3FE 4AYCA 3P8CD 5B66H 1PGPA 5CBNA 2WSCJ 4N6JA 2YNYA 2FYZA 3L70D 2QJKB 5AVVB 2QA4P 2PFXA 2YO3A 1SQVE 2KSEA 2WVRA 1VF5B 4DOJA 2BCCE 4ZMDA 1EC5A 3S9OA 3T97A 2JDIH 1OFCX 1ZRTE 2CPBA 1X0TA 1JY3P 3H1HJ 3GHGC 5KLVG 2WT7B 3GHGA 2ZXEB 4H44C 3V5BA 1VQMP 1PP9J 1SQPJ 1R5LA 3L74G 1J2JB 3I55P 1ZMEC 2Y0EA 1SP4A 1MV8A 5KAIE 1BE3D 4EYYQ 3TGUJ 3GF7A 5CCHC 2H43A 2JJLA 3FXDA 3H1IE 5CCHA 2QJKC 4DT0A 3L72E 4GIFA 1BDDA 1RE4C 1VDFA 1R8EA 1NVOA 1RE4A 1OXZA 3VMZA 2O01J 3GW6A 5AW6B 5E79H 3GLMA 2A45I 1SQPK 3CCVP 1X8YA 1BCCD 2GA1A 3V4QA 3EWKA 2ZVOB 3A5TA 1RF1B 1HWTC 5CMZA 1D7MA 1IFPA 1MZ9A 3AEGC 1VQNP 2QE7H 3JCUE 3CMAP 1EQ7A 3AEFC 3GMAA 1L0LD 2WT7A 1MKMA 1W5CE 2NRGA 2IFMA 4JBZA 2IDBA 1NU1E 2BCCD 4NPFX 2P7JA 3L70G 3I56P 2W8ZA 1H88A 2WSFJ 3OJAB 3HRNA 3NFQA 5C39A 1Q81Q 3BCCG 3WUTA 1BSHA 1OWAA 2B87B 2IFNA 2KUBA 2YKQA 1KFMA 5CHXA 1JMBA 1X22A 1M90Q 5DJTB 3F5HA 2WSEH 2BASA 4Z1MH 1ZN5A 2YXQB 1LP1A 1U57A 3H1KG 2LXCB 2M5AB 3L71E 3GF3A 2YKPA 1QL2A 4YXDC 5KKZC 3AE7C 2A06E 3RL0g 3P32A 3CI9A 5B66E 1NTKJ 3M06A 2KB7P 1FZBA 2E75B 3NMDA 2E76C 1KILB 1LTSC 3Q5PA 1BE3G 2KP8A 1L0NG 1BGYD 3FWLA 1KILE 3MHVA 5AVTB 5AW1B 3L73J 3O6QB 1PGQA 1KB9H 3H1LD 3UIAA 4U3FG 1KB9I 5DJUB 2Q7CA 5AVSB 2E76D 2B87A 1NTKK 2AXTH 1HH0A 3TSIA 4QMAA 1YI2P 2E43A 3IN6A 5AVRB 2YXRB 5BU8B 1GU5A 4H13B 2NPSB 4L74A 2IBZI 3I5CA 1SQVG 1M7LA 2OYIB 1NTZK 1Z56A 1YQ4C 2YKOA 2QVAA 2BCCG 1NTKE 5AW7B 2ZAEB 4I6MC 4PD4H 1KILC 2FFDB 3VTPC 1SQBJ 4IL6E 1M57D 2IPPA 1LTTC 1KILA 3L71D 2YO2A 1FZCC 1IFIA 1JM0A 3W67A 1VQ4P 1YQ3C 1CI6B 3L73E 2WTYA 1FZCA 1NTZE 3QWOC 2QJPB 3BRVB 4PJ0E 1AVOA 3EFFK 1IO4A 3OAKA 1EDJA 1LT9C 1NKZB 4OGQC 2FYUK 1OVUA 1LT9A 1EDIA 5GTIH 2KNCA 2GUSA 3H1JE 3L72G 1SQBK 3O8ZA 3P7KA 1KORA 3Q5RA 1RQVA 3USSA 2J5UA 4H13C 1KQLA 2WQYC 1PGOA 2C9LY 2KK7A 2FYUE 1RF0C 3HE5B 1H0TB 4OGQD 1NWQA 2HG5D 4W7ZA 2FFDC 2E5TA 1EZVI 1DD3A 4IOIH 2OYOA 5AW0B 4H0LD 2FFDA 4AUWA 1SQXE 3OA7A 1T6AA 4EI2A 3M9HA 5CBOA 2GUVA 2R3CA 3R2PA 2Q5UA 1NU1G 2KZJA 4HJGH 1Q90D 3CWBJ 3HTKA 3WUVA 2B9BA 3K5BA 1OW6A 2O1JA 3CCSP 3AE3C 2J58A 4ZNCA 1G2CB 4OWFA 3PRJA 1DX7A 1SFCD 3B5NB 1GDTA 3OW2O 1YJNP 2LXBA 4N78E 4WVZA 4YTPC 3L71G 3Q5SA 1KYOI 1NAFA 4HB1A 3II6A 3VYIA 4OH8B 1SQQE 1KB9E 1H0TA 4LC1A 2KS1A 1N2DC 1EXIA 3AE4C 4KJMA 1W2BO 1LWUB 2A06G 3CXHH 1FE6A 1JO5A 2WSCH 3CXHI 4RO0A 2OYHB 2AXTE 2UWJE 3PHLA 4PV1C 3CC4P 4D6TJ 3CCEP 2KXPB 5APXA 2PAJA 2IBZE 1LTAC 3IR9A 2Y9ZA 2CK3H 1FU1A 3HD7C 3C9IA 1CZQA 2WWWA 5AW5B 3HD7A 1HGZA 4GOFA 5KLVD 1S5LH 2RN0A 1T2KC 1FC2C 1JY3N 4PV1D 3V2QA 1G2CA 1NTMJ 3JCUH 4W7YA 1K8AQ 2IZ1A 3L74D 3B8EB 3CCRP 1G1IA 4I1LA 3AE9C 1AJYA 2BEQD 2KIKA 3SWYA 3CMEP 3RL0C 3HD7D 1S5LX 1BCCJ 2PP6A 3AE1C 1G1JA 3MZWB 3LW5J 1T2KD 3CX5I 3RK2C 3AEEC 2HPCB 2OYHC 3EFGA 4IFDK 3IAOA 1E79H 2OYHA 4N78D 2R5DA 2JWDA 1L0LJ 1NTMK 3V6IA 4Y99B 2B88A 3V2RA 3CC7P 4DCKA 3RL0D 2O01H 1GL2D 4MN4C
chains in the Genus database with same CATH topology
2C0WA 2OARA 1HWTC 5CMZA 4KHXA 1MZ9A 2KSJA 3MGNA 1N73B 1S9KE 1EQ7A 3RK2D 1CSBA 2C9NY 3TYYA 2WT7A 3KYQA 2VRSA 2I1KA 1XTCC 3HE5A 2WPRA 2IFMA 1CW5A 2P7JA 1L4AA 1A02F 5APSA 3EQ2A 1H88A 2HODB 3NXSA 3MD0A 3OJAB 1SVFA 3HRNA 3NFQA 1L0LK 2R32A 2XU6A 1AFOA 4AQRD 3VMXA 1HBWA 3SWFA 1WT6A 2O1KA 4I2LC 4WY4C 2WSFH 1OWAA 3HE4A 1JNMA 2IFNA 2YKQA 4WY4A 2XZRA 1KFMA 5CHXA 2XNXA 3PP5A 1SFCB 2W27A 3HTKB 2WSEH 1M1JB 1JMMA 2BASA 1W2EA 1ZN5A 3G3ZA 2M3BA 5AVZB 3P8CE 4Y99C 5APTA 2YKPA 1QL2A 2XKMA 1JTHB 1DEBA 1URQC 3LIDA 1JY2P 1FAVA 1N7SC 1GTWA 1URQA 1GK4A 5APWA 1IFMA 3P32A 5KTBA 1N7SA 2I1JA 3CI9A 4M3LA 3M06A 1HVVA 1N73C 3B5NC 2FXMA 2KB7P 1FZBA 1RE3C 2IX7C 1SQXK 2YMYA 2W6AA 2POHA 3NMDA 1JCDA 3B5NA 1N73A 1KILB 1LTSC 2FKWB 2KP8A 4EOTA 4C7NA 1RE3A 1FZFA 4XA4A 1NH4A 5AVTB 1LWUC 5AW1B 1RF0A 1KFNA 1LWUA 1URQD 2MJZA 2E42A 4LLHA 5APVA 1N7SD 2HODA 1FOSE 2N1TC 1L0NK 2A45H 3KQGA 2N1TA 1NOHA 3LIEA 3UIAA 1MFZA 4JYBA 3B5ND 3HUSB 5AW8B 3L36A 3V2NA 5AVYB 5AVSB 2Q7CA 1YTZT 3M0DC 1SFCC 1NTKK 2A45G 1NKNA 5CCGC 1ZR4A 3WMM0 3M9BA 1IFDA 5AW3B 3M0DA 1SFCA 5CCHD 1HH0A 5CCGA 3TSIA 3VN0A 4IFMA 2P1JA 2E43A 3HD7B 2GM4A 5AVRB 1HGVA 1FOSF 5BU8B 3MUDA 3E1IA 1GU5A 2NPSB 1SQQK 2JEEA 2HLOA 2N1TD 3GHGB 3I5CA 1JTHA 1M7LA 2OYIB 1FJPA 1NTZK 1Z56A 3L4FA 1L4AC 2YKOA 2Z4EA 1IC2A 3BRTB 5AW7B 2LKMA 4I6MC 3RK3B 2HYNA 3N4XA 1LTJB 4ZKPA 5CCGD 1N86A 1KILC 2FFDB 3VTPC 1SLQA 4N3YB 3VP8A 2IPPA 1HTLC 1LTTC 1KILA 3M91A 2YO2A 1FZCC 1IFIA 3RL0B 1LTBC 1GL2B 1J1EC 3P8MC 1CI6B 2WTYA 1FZCA 2WPQA 3U1AA 2WZ7A 3BASA 3KPEA 4IFFA 3BRVB 4JF7A 3NTNA 3L37A 1IO4A 1L4AD 1X9VA 5BU5A 3RK2B 2M8RA 2HPCA 3CLQA 4WBAA 1IFNA 5CJ4A 3OAKA 1LT9C 3HUSC 1NKZB 3VOPA 1HUCA 2FYUK 4WB4A 1N7LA 1LT9A 2KLVA 3HUSA 3U59A 2Q9IA 2W6BA 1RF1C 4JYCA 2GUSA 1LTIC 4WY4D 1A02J 1NHLA 3TNUB 1RF1A 1SQBK 3O8ZA 3P7KA 5APUA 3KDPB 1JY2N 2QM7A 2Q3IA 3H32B 1H8AA 5AVQB 1T3JA 1KQLA 2Z5HA 1IFJA 2L5GB 2C9LY 5APQA 1GW3A 3BATA 1RF0C 3HE5B 4GT1A 1DH3A 3IFMA 1NWQA 3MTUE 2HG5D 3L35A 2C0XA 1LTJC 4W7ZA 3U1CA 2FFDC 1LTJA 2ZFCA 5AW0B 2FFDA 1FBMA 2QM8A 4AUWA 1GL2C 1S9KD 3OA7A 3HE4B 4XE5B 1GU4A 1GL2A 5AVUB 4DZOA 3M9HA 3CL3D 2GUVA 1YTZI 3TK1A 2R3CA 3R2PA 1JY3O 2Q5UA 1M1JC 1JUNA 5APYA 1JOCA 3HTKA 1WRGA 1M1JA 3M9QA 2WITA 3MIWA 2O1JA 1E5WA 1HJBA 1NU1K 2J58A 1FZEA 1ZR2A 1URQB 1G2CB 1H89A 3A2AA 1XTGB 1N7SB 5CJ0A 3TNUA 1DX7A 4ZKUA 1J1DB 1GK6A 2KYVA 1GZLA 1SFCD 4B86A 3B5NB 5BVZA 1GDTA 4C7NB 4N78E 2XDJA 4W80A 1SQVK 4HYTB 3H32A 5AW4B 4LGDE 5AVWB 1NAFA 3P8CD 4AYCA 3II6A 3VYIA 3H6PA 4OH8B 4LC1A 1N2DC 4N6JA 2YNYA 4C46A 1ZV8A 1LWUB 2FYZA 1LTGC 3A3YB 5AW9B 5KJ7C 1JO5A 5AVVB 2WSCH 2N9BA 5KJ7A 2N1TB 2WPSA 1T3UA 4EIJA 2OYHB 1NO4A 3V2PA 2YO3A 2R5BA 1KILD 5APXA 2PAJA 2P2UA 1LTAC 4DOJA 1FDMA 3IR9A 3T97A 1FU1A 1X79B 2CPBA 3HD7C 3C9IA 1CZQA 1FZGA 1JY3P 1IK9A 2WWWA 5AW5B 2NPSC 3GHGC 3HD7A 5KJ7D 1HGZA 3VMYA 2WT7B 2KOGA 3A7OA 2OYIC 1KZUB 2HFED 2NPSA 2ZXEB 3GHGA 1ZLLA 2XV5A 2Z5IA 1T2KC 1JY3N 3V5BA 1IJDB 2CPSA 2P67A 2OYIA 1PFIA 3V2QA 1G2CA 4W7YA 1L4AB 1J1DC 3RK3C 2J59M 1J2JB 4C7RA 1T8ZA 3B8EB 3N7NA 1G1IA 4I1LA 1AQ5A 4HH2A 1LGHB 1SP4A 1MV8A 5KLVK 1MUUA 2H8PD 1GD2E 3SWYA 3RL0C 3HD7D 1JCCA 4O9BA 1FZAA 5CCHC 2H43A 2JJLA 1FZCB 4WY4B 2PP6A 2NPSD 1J1EB 1CI6A 5CCHA 1G1JA 1FJKA 1RY3A 4GIFA 4RESB 5AVXB 1T2KD 3BVHA 3RK2C 1RE4C 2HPCB 2OYHC 1VPCA 3EFGA 2H7HA 1VDFA 4IFDK 3V4WA 3RK3D 1RE4A 1JY2O 1OXZA 3VMZA 2OYHA 4GKGA 4N78D 3LW5H 2R5DA 5AW6B 3VP9A 1LT9B 3M0AA 2A45I 1SQPK 5AW2B 1NTMK 1X8YA 4Y99B 3V2RA 3V4QA 1QL1A 1GW4A 3RL0D 1YYCA 2O01H 3A5TA 1RF1B 1GL2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFM A;  3IFM A;  1PFI A;  1QL2 A;  1IFN A;  2IFM A;  1IFM A;  2IFN A;  2KLV A;  2XKM A;  2KSJ A;  1ZN5 A;  1QL1 A; 
#chains in the Genus database with same CATH topology
 2OAR A;  1QEX A;  3MGN A;  1EZV E;  1UII A;  1S9K E;  4UB6 H;  3RK2 D;  2VRS A;  3SWK A;  1NTM E;  1OX3 A;  1VQ5 P;  2WPR A;  2AXC A;  4RKU J;  1OZH A;  2LR2 A;  3H1J G;  1HJ0 A;  5APS A;  1VQ7 P;  2HOD B;  1SVF A;  2ZT9 D;  1L0L K;  4AQR D;  1M1K Q;  3VMX A;  3BCC D;  1AA0 A;  1WT6 A;  2WSF H;  3HE4 A;  4PD4 D;  1UIX A;  2O3J A;  2DW3 A;  2W27 A;  3SFD C;  1M1J B;  1Y9B A;  3L75 J;  5APT A;  3H1K D;  4Y99 C;  1BGY J;  4NPD A;  1SQX G;  1JTH B;  3LID A;  1KMI Z;  3D71 A;  1GTW A;  5APW A;  2JP3 A;  3A0H H;  1S1C X;  2IX7 C;  3H1L J;  2W6A A;  4EOT A;  3CXH E;  1L0N D;  4XA4 A;  2AEJ A;  1NH4 A;  1RHZ B;  3CPW O;  3Q1M A;  4IL6 H;  4H44 D;  2WPV B;  3AE5 C;  4LLH A;  2HOD A;  2A45 H;  1JB0 J;  3AE8 C;  3LIE A;  1MFZ A;  4JYB A;  4U3F D;  5AW8 B;  4PJ0 H;  3CCU P;  1VF5 C;  2N9Y B;  1SQQ G;  2K88 A;  2ZJS E;  4IL6 X;  3PLN A;  1S5L E;  5CCH D;  4RJT A;  3MUD C;  3H1H E;  1FOS F;  3MUD A;  2HLO A;  1DEE G;  1JTH A;  1SQV D;  4I7Z B;  1PP9 E;  1SQP E;  3L4F A;  2Q1K A;  2ZYA A;  5GTH H;  2IBZ G;  2R3S A;  1VF5 D;  2LKM A;  5KAF E;  3RK3 B;  4K3A A;  3RK3 E;  1N86 A;  1ZRT D;  2W90 A;  2D2C B;  3TGU E;  3M91 A;  3RGU A;  2KZI A;  1PPJ E;  3BAS A;  4IFF A;  2ZXX A;  1X9V A;  1ZP0 C;  2ITA A;  5BU5 A;  1LJ2 A;  2QIW A;  1FDI A;  4WBA A;  1AV1 A;  4DJG A;  3VOP A;  4WB4 A;  1N7L A;  2W6B A;  1RF1 C;  4JYC A;  2K3R A;  4UB6 E;  3TNU B;  1RF1 A;  3H1I D;  5TJH A;  2Q6Q A;  3L72 D;  1KV4 A;  3KDP B;  1JY2 N;  2QM7 A;  3D6Z A;  2Q3I A;  5AVQ B;  2B89 A;  1QLE D;  1GW3 A;  2RKL A;  3MTU E;  1VQP P;  2C0X A;  2QJY B;  5K5G B;  3CCL P;  3U1C A;  1R5S A;  1EZV G;  2V4H A;  3R4Y A;  4XE5 B;  4L73 A;  2FXO A;  5AVU B;  4DZO A;  1YTZ I;  1NU1 D;  3AED C;  1P84 H;  2KI7 B;  1P84 I;  4BRY B;  3TGU D;  3A0H E;  2M5A A;  1E5W A;  1Q2N A;  1FZE A;  1URQ B;  1YJ9 P;  1XTG B;  1N7S B;  4JQ0 D;  3TNU A;  4ZKU A;  1K04 A;  2E75 C;  1GZL A;  4B86 A;  5BVZ A;  4C7N B;  1FDO A;  1K73 Q;  1AVY A;  3W68 A;  1Y8A A;  3H6P A;  2NZ2 A;  1ZV8 A;  2A06 D;  3A3Y B;  5AW9 B;  3O6Q A;  1KQG B;  2N1T B;  2WPS A;  3TDK A;  2E75 D;  4CPG A;  5KLV J;  2R5B A;  1KIL D;  2P2U A;  1FDM A;  3H1I G;  3L74 J;  3E1R A;  1X79 B;  1FZG A;  3ABV C;  3PJS K;  5GTH E;  2NPS C;  4BRY A;  3ZDM A;  3VMY A;  2KOG A;  3A7O A;  2OYI C;  3CCQ P;  1KZU B;  1ZW0 A;  2NPS A;  1ZLL A;  2XV5 A;  3KZI E;  2OYI A;  1IJD B;  2P67 A;  3G71 P;  1L4A B;  1AQ5 A;  4HH2 A;  4Y28 J;  3A0B H;  5KLV K;  1SQB E;  4U7J A;  2H8P D;  3H1H G;  2G8Y A;  1KN7 A;  2E74 B;  1JCC A;  4YPC A;  4O9B A;  4WY4 B;  4H13 D;  2NPS D;  2QJP C;  1PP9 G;  1SQP G;  1J1E B;  1CI6 A;  3S1K A;  1FJK A;  1VQK P;  1EDK A;  4JPZ B;  1S2E A;  1NTK D;  1VQO P;  1NAY A;  1VPC A;  2H7H A;  1DD4 A;  3V4W A;  2FYN B;  3LW5 H;  3M0A A;  3TGU G;  2WSS H;  1QL1 A;  1GW4 A;  3PH0 A;  1YYC A;  3L73 D;  1PPJ G;  1NTZ D;  3L70 J;  2IYP A;  1KYO H;  3FX0 A;  1U7M A;  1N73 B;  3BCC J;  2C9N Y;  2I1K A;  3HE5 A;  5H2F E;  3H1J D;  1L4A A;  4YXW H;  3B71 A;  3EQ2 A;  3NXS A;  3MD0 A;  2XU6 A;  3H1K J;  3SWF A;  4I2L C;  4WY4 C;  1Q7Y Q;  1P84 E;  1JNM A;  2FYU D;  4WY4 A;  2XZR A;  3TF5 A;  3CC2 P;  4WWI A;  3CWB E;  2OTK E;  1JMM A;  3MP7 B;  2FYN C;  1W2E A;  4XFJ A;  5AVZ B;  1YIT P;  3P8C E;  1YBK A;  1BE3 J;  1L0N J;  1RQU A;  2XKM A;  1SQX D;  1YJW P;  1USD A;  1OW8 A;  2I1J A;  1USE A;  1HVV A;  1N73 C;  3B5N C;  2FXM A;  1BDC A;  2YMY A;  2POH A;  5M1B A;  1JCD A;  3B5N A;  1N73 A;  4U3F J;  5KAF H;  3F89 A;  3FWN A;  1LWU C;  3SSU A;  3CX5 H;  1KFN A;  3G9R A;  1LWU A;  2MJZ A;  2K1A A;  1NTK G;  2H88 C;  5APV A;  1L0N K;  3B4S A;  1JEK A;  3KQG A;  4D6T E;  1NOH A;  3B5N D;  3HUS B;  3L36 A;  1SQV J;  5AVY B;  2PRR A;  1YTZ T;  1SQQ D;  2A45 G;  1KB9 D;  5CCG C;  1KQF B;  3L73 G;  3T97 B;  1NTZ G;  2BCC J;  3M9B A;  2PGD A;  4ASV A;  5CCG A;  2GM4 A;  2Y9Y A;  3JC2 2;  1HGV A;  3GHG B;  2JEE A;  5TIS H;  3FXE A;  1FJP A;  3A0B E;  2IBZ D;  3BRT B;  1VQ8 P;  3CWB D;  1LTJ B;  4ZKP A;  5CCG D;  3CD6 P;  1SLQ A;  3VP8 A;  1KTM A;  1BCC E;  1LTB C;  3P8M C;  2FYU G;  2QEX P;  2WZ7 A;  3KPE A;  2XND H;  3H1I J;  2FBW C;  3L72 J;  3NTN A;  3L37 A;  1S4X A;  2HPC A;  2OTL P;  1SQB G;  3HUS C;  1IK7 A;  1L0L E;  1HUC A;  2K9Y A;  2KLV A;  3AEB C;  3HUS A;  3U59 A;  4GDO A;  1KYO E;  5APU A;  4GOD A;  5L8R J;  5KLI B;  4D6T D;  1T3J A;  2Z5H A;  1IFJ A;  2RH0 A;  3BAT A;  1DH3 A;  3IFM A;  1Q82 Q;  1FS0 E;  4HKZ H;  1LTJ C;  1NU1 J;  1LTJ A;  1N8R Q;  1M56 D;  1FBM A;  2QM8 A;  1EZV D;  1S9K D;  1Q86 Q;  4GOE A;  1PGJ A;  1GU4 A;  1RH5 B;  3CL3 D;  1NTM D;  2IYO A;  1M1J C;  1JUN A;  1WMK A;  2K37 A;  5APY A;  3H25 A;  1JOC A;  1LP1 B;  1M1J A;  2WIT A;  3L75 E;  2V7Q J;  1BGY E;  2I8D A;  2MKV A;  2G3A A;  1IZN B;  3L71 J;  2P58 A;  3CCM P;  1NU1 K;  1OIP A;  5KKZ B;  1KD1 Q;  3A2A A;  1OVV A;  1DIP A;  5B5E H;  1PZQ A;  3CWB G;  1J1D B;  1GK6 A;  2JR8 A;  2KYV A;  3H1L E;  5KLI C;  3KZI H;  3CX5 E;  2ZYD A;  4W80 A;  5AW4 B;  2E76 B;  4LGD E;  5AVW B;  2FXP A;  2R44 A;  3D70 A;  1KYO D;  4C46 A;  1U7J A;  1VQ6 P;  1LTG C;  4L76 A;  5KJ7 C;  2N9B A;  5KJ7 A;  4EIJ A;  1T3U A;  4BXL A;  1NO4 A;  3V2P A;  3CXH D;  2K9J B;  3Q3D A;  1NGM B;  1Y47 A;  2IZ0 A;  2QRX A;  1OMI A;  5TIS E;  3C8V A;  1IK9 A;  5KJ7 D;  4D6T G;  4I7Z C;  2HFE D;  3QH9 A;  2Z5I A;  2E5Y A;  2CPS A;  1PFI A;  2JO1 A;  4K35 A;  1J1D C;  3RK3 C;  2J59 M;  4C7R A;  1T8Z A;  3N7N A;  2W6J H;  1LGH B;  1MUU A;  3L75 D;  2D2C C;  1GD2 E;  3H1H D;  1HF9 A;  4UB8 H;  5H2F H;  1FZA A;  1FZC B;  2Q3E A;  4A7P A;  1OVR A;  2HR3 A;  2OGU A;  2P10 A;  1VL2 A;  1PP9 D;  1SQP D;  1NTM G;  2JKV A;  1NTZ J;  2JWA A;  1RY3 A;  2O01 N;  4RES B;  5AVX B;  1K9M Q;  3BVH A;  3RK3 D;  1JY2 O;  3CX5 D;  3VMA A;  4GKG A;  3VP9 A;  1LT9 B;  5AW2 B;  4OGQ B;  3GG2 A;  1BCC G;  2FY8 A;  2D2C D;  2K9J A;  2KNC B;  3CCJ P;  3ITK A;  1PPJ D;  3H1J J;  1ZOY C;  2C0W A;  4H0L B;  4KHX A;  2KLU A;  3IF4 A;  2KSJ A;  1OW7 A;  3AEC C;  4NPE A;  1CSB A;  1L0L G;  3TYY A;  3KYQ A;  4TT3 H;  1XTC C;  2FYU J;  1CW5 A;  2QJY C;  3KHU A;  1EDL A;  1TU3 F;  1QVF O;  1NJI Q;  1A02 F;  1AQT A;  2BEZ F;  3G6E P;  2R32 A;  1AFO A;  2YIU B;  4PD4 I;  1KQS O;  1HBW A;  3G4S P;  2O1K A;  1SQX J;  2WSE J;  3C1L A;  1S3J A;  2XNX A;  5E79 E;  3PP5 A;  1SFC B;  3HTK B;  2Y0C A;  3G3Z A;  2M3B A;  1YIJ P;  5B5E E;  3WU2 H;  1DEB A;  1URQ C;  2M0B A;  1JY2 P;  3S4R A;  1FAV A;  1N7S C;  3E7K A;  1URQ A;  1GK4 A;  4H0L C;  1PL5 A;  1IFM A;  5KTB A;  4KT0 J;  1N7S A;  2YMK A;  4M3L A;  2M3E A;  1RE3 C;  2Y0D A;  1SQX K;  3L75 G;  3AE6 C;  1BGY G;  2FKW B;  4C7N A;  1RE3 A;  1SS1 A;  1FZF A;  2KS1 B;  3RBX A;  1GMJ A;  1QX8 A;  1SQQ J;  4L75 A;  1RF0 A;  3AEA C;  1URQ D;  2AEF A;  2E42 A;  2QG4 A;  3FGA D;  1N7S D;  2YIU C;  1FOS E;  2N1T C;  1PV3 A;  3H1L G;  4R4M A;  1EXJ A;  1VQ9 P;  3WUU A;  2N1T A;  5KLV E;  3Q2Y A;  4PV1 B;  3V2N A;  3M0D C;  1SFC C;  1KC8 Q;  1NKN A;  1ZR4 A;  3L74 E;  3WMM 0;  1K05 A;  1IFD A;  4R4L A;  5AW3 B;  1LNQ A;  1SFC A;  3M0D A;  3VN0 A;  4IFM A;  2P1J A;  3KXD A;  3JSV C;  3HD7 B;  2SPZ A;  1M8O B;  3E1I A;  4BWN A;  2ZVN B;  1SQQ K;  2N1T D;  1L4A C;  2Z4E A;  1IC2 A;  4UB8 E;  2HYN A;  3N4X A;  2RMZ A;  1QVG O;  2H89 C;  2E74 C;  4N3Y B;  1HTL C;  1NYH A;  3RL0 B;  1GL2 B;  2OQQ A;  1J1E C;  2WPQ A;  3U1A A;  5KAI H;  4JF7 A;  1MFT A;  1L4A D;  1L2P A;  3RK2 B;  2M8R A;  3CLQ A;  1IFN A;  3D6Y A;  5CJ4 A;  1SQB D;  1VQL P;  1LT1 A;  2Q9I A;  2E74 D;  1LTI C;  3L70 E;  4WY4 D;  1A02 J;  1NHL A;  2ZT9 B;  2ZYG A;  4EDF A;  3BCC E;  3H32 B;  1H8A A;  4ASW A;  2L5G B;  4PD4 E;  5APQ A;  4GT1 A;  2OTJ P;  2AEM A;  3AE2 C;  3RBZ A;  1ZXG A;  3L35 A;  2WMM A;  2ZFC A;  5EFW B;  3H1K E;  1PIX A;  1GL2 C;  3HE4 B;  1QGK B;  1GL2 A;  1S72 P;  3TK1 A;  3PTZ A;  1JY3 O;  3SFE C;  3WU2 E;  1WRG A;  3M9Q A;  5GTI E;  2W83 C;  3MIW A;  1BE3 E;  2QSI A;  1L0N E;  2L91 A;  1HJB A;  1BSN A;  1P84 D;  2V7Q H;  1ZR2 A;  1H89 A;  4H44 B;  2ZT9 C;  5CJ0 A;  1YHQ P;  4TLF A;  2XDJ A;  4OVN F;  1SQV K;  4HYT B;  3H32 A;  4U3F E;  4AYC A;  3P8C D;  5B66 H;  1PGP A;  5CBN A;  2WSC J;  4N6J A;  2YNY A;  2FYZ A;  3L70 D;  2QJK B;  5AVV B;  2QA4 P;  2PFX A;  2YO3 A;  1SQV E;  2KSE A;  2WVR A;  1VF5 B;  4DOJ A;  2BCC E;  4ZMD A;  1EC5 A;  3S9O A;  3T97 A;  2JDI H;  1OFC X;  1ZRT E;  2CPB A;  1X0T A;  1JY3 P;  3H1H J;  3GHG C;  5KLV G;  2WT7 B;  3GHG A;  2ZXE B;  4H44 C;  3V5B A;  1VQM P;  1PP9 J;  1SQP J;  1R5L A;  3L74 G;  1J2J B;  3I55 P;  1ZME C;  2Y0E A;  1SP4 A;  1MV8 A;  5KAI E;  1BE3 D;  4EYY Q;  3TGU J;  3GF7 A;  5CCH C;  2H43 A;  2JJL A;  3FXD A;  3H1I E;  5CCH A;  2QJK C;  4DT0 A;  3L72 E;  4GIF A;  1BDD A;  1RE4 C;  1VDF A;  1R8E A;  1NVO A;  1RE4 A;  1OXZ A;  3VMZ A;  2O01 J;  3GW6 A;  5AW6 B;  5E79 H;  3GLM A;  2A45 I;  1SQP K;  3CCV P;  1X8Y A;  1BCC D;  2GA1 A;  3V4Q A;  3EWK A;  2ZVO B;  3A5T A;  1RF1 B;  1HWT C;  5CMZ A;  1D7M A;  1IFP A;  1MZ9 A;  3AEG C;  1VQN P;  2QE7 H;  3JCU E;  3CMA P;  1EQ7 A;  3AEF C;  3GMA A;  1L0L D;  2WT7 A;  1MKM A;  1W5C E;  2NRG A;  2IFM A;  4JBZ A;  2IDB A;  1NU1 E;  2BCC D;  4NPF X;  2P7J A;  3L70 G;  3I56 P;  2W8Z A;  1H88 A;  2WSF J;  3OJA B;  3HRN A;  3NFQ A;  5C39 A;  1Q81 Q;  3BCC G;  3WUT A;  1BSH A;  1OWA A;  2B87 B;  2IFN A;  2KUB A;  2YKQ A;  1KFM A;  5CHX A;  1JMB A;  1X22 A;  1M90 Q;  5DJT B;  3F5H A;  2WSE H;  2BAS A;  4Z1M H;  1ZN5 A;  2YXQ B;  1LP1 A;  1U57 A;  3H1K G;  2LXC B;  2M5A B;  3L71 E;  3GF3 A;  2YKP A;  1QL2 A;  4YXD C;  5KKZ C;  3AE7 C;  2A06 E;  3RL0 g;  3P32 A;  3CI9 A;  5B66 E;  1NTK J;  3M06 A;  2KB7 P;  1FZB A;  2E75 B;  3NMD A;  2E76 C;  1KIL B;  1LTS C;  3Q5P A;  1BE3 G;  2KP8 A;  1L0N G;  1BGY D;  3FWL A;  1KIL E;  3MHV A;  5AVT B;  5AW1 B;  3L73 J;  3O6Q B;  1PGQ A;  1KB9 H;  3H1L D;  3UIA A;  4U3F G;  1KB9 I;  5DJU B;  2Q7C A;  5AVS B;  2E76 D;  2B87 A;  1NTK K;  2AXT H;  1HH0 A;  3TSI A;  4QMA A;  1YI2 P;  2E43 A;  3IN6 A;  5AVR B;  2YXR B;  5BU8 B;  1GU5 A;  4H13 B;  2NPS B;  4L74 A;  2IBZ I;  3I5C A;  1SQV G;  1M7L A;  2OYI B;  1NTZ K;  1Z56 A;  1YQ4 C;  2YKO A;  2QVA A;  2BCC G;  1NTK E;  5AW7 B;  2ZAE B;  4I6M C;  4PD4 H;  1KIL C;  2FFD B;  3VTP C;  1SQB J;  4IL6 E;  1M57 D;  2IPP A;  1LTT C;  1KIL A;  3L71 D;  2YO2 A;  1FZC C;  1IFI A;  1JM0 A;  3W67 A;  1VQ4 P;  1YQ3 C;  1CI6 B;  3L73 E;  2WTY A;  1FZC A;  1NTZ E;  3QWO C;  2QJP B;  3BRV B;  4PJ0 E;  1AVO A;  3EFF K;  1IO4 A;  3OAK A;  1EDJ A;  1LT9 C;  1NKZ B;  4OGQ C;  2FYU K;  1OVU A;  1LT9 A;  1EDI A;  5GTI H;  2KNC A;  2GUS A;  3H1J E;  3L72 G;  1SQB K;  3O8Z A;  3P7K A;  1KOR A;  3Q5R A;  1RQV A;  3USS A;  2J5U A;  4H13 C;  1KQL A;  2WQY C;  1PGO A;  2C9L Y;  2KK7 A;  2FYU E;  1RF0 C;  3HE5 B;  1H0T B;  4OGQ D;  1NWQ A;  2HG5 D;  4W7Z A;  2FFD C;  2E5T A;  1EZV I;  1DD3 A;  4IOI H;  2OYO A;  5AW0 B;  4H0L D;  2FFD A;  4AUW A;  1SQX E;  3OA7 A;  1T6A A;  4EI2 A;  3M9H A;  5CBO A;  2GUV A;  2R3C A;  3R2P A;  2Q5U A;  1NU1 G;  2KZJ A;  4HJG H;  1Q90 D;  3CWB J;  3HTK A;  3WUV A;  2B9B A;  3K5B A;  1OW6 A;  2O1J A;  3CCS P;  3AE3 C;  2J58 A;  4ZNC A;  1G2C B;  4OWF A;  3PRJ A;  1DX7 A;  1SFC D;  3B5N B;  1GDT A;  3OW2 O;  1YJN P;  2LXB A;  4N78 E;  4WVZ A;  4YTP C;  3L71 G;  3Q5S A;  1KYO I;  1NAF A;  4HB1 A;  3II6 A;  3VYI A;  4OH8 B;  1SQQ E;  1KB9 E;  1H0T A;  4LC1 A;  2KS1 A;  1N2D C;  1EXI A;  3AE4 C;  4KJM A;  1W2B O;  1LWU B;  2A06 G;  3CXH H;  1FE6 A;  1JO5 A;  2WSC H;  3CXH I;  4RO0 A;  2OYH B;  2AXT E;  2UWJ E;  3PHL A;  4PV1 C;  3CC4 P;  4D6T J;  3CCE P;  2KXP B;  5APX A;  2PAJ A;  2IBZ E;  1LTA C;  3IR9 A;  2Y9Z A;  2CK3 H;  1FU1 A;  3HD7 C;  3C9I A;  1CZQ A;  2WWW A;  5AW5 B;  3HD7 A;  1HGZ A;  4GOF A;  5KLV D;  1S5L H;  2RN0 A;  1T2K C;  1FC2 C;  1JY3 N;  4PV1 D;  3V2Q A;  1G2C A;  1NTM J;  3JCU H;  4W7Y A;  1K8A Q;  2IZ1 A;  3L74 D;  3B8E B;  3CCR P;  1G1I A;  4I1L A;  3AE9 C;  1AJY A;  2BEQ D;  2KIK A;  3SWY A;  3CME P;  3RL0 C;  3HD7 D;  1S5L X;  1BCC J;  2PP6 A;  3AE1 C;  1G1J A;  3MZW B;  3LW5 J;  1T2K D;  3CX5 I;  3RK2 C;  3AEE C;  2HPC B;  2OYH C;  3EFG A;  4IFD K;  3IAO A;  1E79 H;  2OYH A;  4N78 D;  2R5D A;  2JWD A;  1L0L J;  1NTM K;  3V6I A;  4Y99 B;  2B88 A;  3V2R A;  3CC7 P;  4DCK A;  3RL0 D;  2O01 H;  1GL2 D;  4MN4 C; 
#chains in the Genus database with same CATH homology
 2C0W A;  2OAR A;  1HWT C;  5CMZ A;  4KHX A;  1MZ9 A;  2KSJ A;  3MGN A;  1N73 B;  1S9K E;  1EQ7 A;  3RK2 D;  1CSB A;  2C9N Y;  3TYY A;  2WT7 A;  3KYQ A;  2VRS A;  2I1K A;  1XTC C;  3HE5 A;  2WPR A;  2IFM A;  1CW5 A;  2P7J A;  1L4A A;  1A02 F;  5APS A;  3EQ2 A;  1H88 A;  2HOD B;  3NXS A;  3MD0 A;  3OJA B;  1SVF A;  3HRN A;  3NFQ A;  1L0L K;  2R32 A;  2XU6 A;  1AFO A;  4AQR D;  3VMX A;  1HBW A;  3SWF A;  1WT6 A;  2O1K A;  4I2L C;  4WY4 C;  2WSF H;  1OWA A;  3HE4 A;  1JNM A;  2IFN A;  2YKQ A;  4WY4 A;  2XZR A;  1KFM A;  5CHX A;  2XNX A;  3PP5 A;  1SFC B;  2W27 A;  3HTK B;  2WSE H;  1M1J B;  1JMM A;  2BAS A;  1W2E A;  1ZN5 A;  3G3Z A;  2M3B A;  5AVZ B;  3P8C E;  4Y99 C;  5APT A;  2YKP A;  1QL2 A;  2XKM A;  1JTH B;  1DEB A;  1URQ C;  3LID A;  1JY2 P;  1FAV A;  1N7S C;  1GTW A;  1URQ A;  1GK4 A;  5APW A;  1IFM A;  3P32 A;  5KTB A;  1N7S A;  2I1J A;  3CI9 A;  4M3L A;  3M06 A;  1HVV A;  1N73 C;  3B5N C;  2FXM A;  2KB7 P;  1FZB A;  1RE3 C;  2IX7 C;  1SQX K;  2YMY A;  2W6A A;  2POH A;  3NMD A;  1JCD A;  3B5N A;  1N73 A;  1KIL B;  1LTS C;  2FKW B;  2KP8 A;  4EOT A;  4C7N A;  1RE3 A;  1FZF A;  4XA4 A;  1NH4 A;  5AVT B;  1LWU C;  5AW1 B;  1RF0 A;  1KFN A;  1LWU A;  1URQ D;  2MJZ A;  2E42 A;  4LLH A;  5APV A;  1N7S D;  2HOD A;  1FOS E;  2N1T C;  1L0N K;  2A45 H;  3KQG A;  2N1T A;  1NOH A;  3LIE A;  3UIA A;  1MFZ A;  4JYB A;  3B5N D;  3HUS B;  5AW8 B;  3L36 A;  3V2N A;  5AVY B;  5AVS B;  2Q7C A;  1YTZ T;  3M0D C;  1SFC C;  1NTK K;  2A45 G;  1NKN A;  5CCG C;  1ZR4 A;  3WMM 0;  3M9B A;  1IFD A;  5AW3 B;  3M0D A;  1SFC A;  5CCH D;  1HH0 A;  5CCG A;  3TSI A;  3VN0 A;  4IFM A;  2P1J A;  2E43 A;  3HD7 B;  2GM4 A;  5AVR B;  1HGV A;  1FOS F;  5BU8 B;  3MUD A;  3E1I A;  1GU5 A;  2NPS B;  1SQQ K;  2JEE A;  2HLO A;  2N1T D;  3GHG B;  3I5C A;  1JTH A;  1M7L A;  2OYI B;  1FJP A;  1NTZ K;  1Z56 A;  3L4F A;  1L4A C;  2YKO A;  2Z4E A;  1IC2 A;  3BRT B;  5AW7 B;  2LKM A;  4I6M C;  3RK3 B;  2HYN A;  3N4X A;  1LTJ B;  4ZKP A;  5CCG D;  1N86 A;  1KIL C;  2FFD B;  3VTP C;  1SLQ A;  4N3Y B;  3VP8 A;  2IPP A;  1HTL C;  1LTT C;  1KIL A;  3M91 A;  2YO2 A;  1FZC C;  1IFI A;  3RL0 B;  1LTB C;  1GL2 B;  1J1E C;  3P8M C;  1CI6 B;  2WTY A;  1FZC A;  2WPQ A;  3U1A A;  2WZ7 A;  3BAS A;  3KPE A;  4IFF A;  3BRV B;  4JF7 A;  3NTN A;  3L37 A;  1IO4 A;  1L4A D;  1X9V A;  5BU5 A;  3RK2 B;  2M8R A;  2HPC A;  3CLQ A;  4WBA A;  1IFN A;  5CJ4 A;  3OAK A;  1LT9 C;  3HUS C;  1NKZ B;  3VOP A;  1HUC A;  2FYU K;  4WB4 A;  1N7L A;  1LT9 A;  2KLV A;  3HUS A;  3U59 A;  2Q9I A;  2W6B A;  1RF1 C;  4JYC A;  2GUS A;  1LTI C;  4WY4 D;  1A02 J;  1NHL A;  3TNU B;  1RF1 A;  1SQB K;  3O8Z A;  3P7K A;  5APU A;  3KDP B;  1JY2 N;  2QM7 A;  2Q3I A;  3H32 B;  1H8A A;  5AVQ B;  1T3J A;  1KQL A;  2Z5H A;  1IFJ A;  2L5G B;  2C9L Y;  5APQ A;  1GW3 A;  3BAT A;  1RF0 C;  3HE5 B;  4GT1 A;  1DH3 A;  3IFM A;  1NWQ A;  3MTU E;  2HG5 D;  3L35 A;  2C0X A;  1LTJ C;  4W7Z A;  3U1C A;  2FFD C;  1LTJ A;  2ZFC A;  5AW0 B;  2FFD A;  1FBM A;  2QM8 A;  4AUW A;  1GL2 C;  1S9K D;  3OA7 A;  3HE4 B;  4XE5 B;  1GU4 A;  1GL2 A;  5AVU B;  4DZO A;  3M9H A;  3CL3 D;  2GUV A;  1YTZ I;  3TK1 A;  2R3C A;  3R2P A;  1JY3 O;  2Q5U A;  1M1J C;  1JUN A;  5APY A;  1JOC A;  3HTK A;  1WRG A;  1M1J A;  3M9Q A;  2WIT A;  3MIW A;  2O1J A;  1E5W A;  1HJB A;  1NU1 K;  2J58 A;  1FZE A;  1ZR2 A;  1URQ B;  1G2C B;  1H89 A;  3A2A A;  1XTG B;  1N7S B;  5CJ0 A;  3TNU A;  1DX7 A;  4ZKU A;  1J1D B;  1GK6 A;  2KYV A;  1GZL A;  1SFC D;  4B86 A;  3B5N B;  5BVZ A;  1GDT A;  4C7N B;  4N78 E;  2XDJ A;  4W80 A;  1SQV K;  4HYT B;  3H32 A;  5AW4 B;  4LGD E;  5AVW B;  1NAF A;  3P8C D;  4AYC A;  3II6 A;  3VYI A;  3H6P A;  4OH8 B;  4LC1 A;  1N2D C;  4N6J A;  2YNY A;  4C46 A;  1ZV8 A;  1LWU B;  2FYZ A;  1LTG C;  3A3Y B;  5AW9 B;  5KJ7 C;  1JO5 A;  5AVV B;  2WSC H;  2N9B A;  5KJ7 A;  2N1T B;  2WPS A;  1T3U A;  4EIJ A;  2OYH B;  1NO4 A;  3V2P A;  2YO3 A;  2R5B A;  1KIL D;  5APX A;  2PAJ A;  2P2U A;  1LTA C;  4DOJ A;  1FDM A;  3IR9 A;  3T97 A;  1FU1 A;  1X79 B;  2CPB A;  3HD7 C;  3C9I A;  1CZQ A;  1FZG A;  1JY3 P;  1IK9 A;  2WWW A;  5AW5 B;  2NPS C;  3GHG C;  3HD7 A;  5KJ7 D;  1HGZ A;  3VMY A;  2WT7 B;  2KOG A;  3A7O A;  2OYI C;  1KZU B;  2HFE D;  2NPS A;  2ZXE B;  3GHG A;  1ZLL A;  2XV5 A;  2Z5I A;  1T2K C;  1JY3 N;  3V5B A;  1IJD B;  2CPS A;  2P67 A;  2OYI A;  1PFI A;  3V2Q A;  1G2C A;  4W7Y A;  1L4A B;  1J1D C;  3RK3 C;  2J59 M;  1J2J B;  4C7R A;  1T8Z A;  3B8E B;  3N7N A;  1G1I A;  4I1L A;  1AQ5 A;  4HH2 A;  1LGH B;  1SP4 A;  1MV8 A;  5KLV K;  1MUU A;  2H8P D;  1GD2 E;  3SWY A;  3RL0 C;  3HD7 D;  1JCC A;  4O9B A;  1FZA A;  5CCH C;  2H43 A;  2JJL A;  1FZC B;  4WY4 B;  2PP6 A;  2NPS D;  1J1E B;  1CI6 A;  5CCH A;  1G1J A;  1FJK A;  1RY3 A;  4GIF A;  4RES B;  5AVX B;  1T2K D;  3BVH A;  3RK2 C;  1RE4 C;  2HPC B;  2OYH C;  1VPC A;  3EFG A;  2H7H A;  1VDF A;  4IFD K;  3V4W A;  3RK3 D;  1RE4 A;  1JY2 O;  1OXZ A;  3VMZ A;  2OYH A;  4GKG A;  4N78 D;  3LW5 H;  2R5D A;  5AW6 B;  3VP9 A;  1LT9 B;  3M0A A;  2A45 I;  1SQP K;  5AW2 B;  1NTM K;  1X8Y A;  4Y99 B;  3V2R A;  3V4Q A;  1QL1 A;  1GW4 A;  3RL0 D;  1YYC A;  2O01 H;  3A5T A;  1RF1 B;  1GL2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...