3IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
b'GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ifmA00
1PFIA 1QL2A 1IFNA 2IFMA 3IFMA 2KLVA 1QL1A 4IFMA 2IFNA 1ZN5A 2XKMA 1IFMA 2KSJA
chains in the Genus database with same CATH superfamily
2XNDH 4WY4D 4D6TJ 2KSEA 3L75J 2WTYA 4OGQC 3MGNA 1FU1A 3VMAA 1SFCB 4TLFA 1QL1A 3CC7P 1LNQA 1GD2E 3V5BA 1SQPK 2D2CD 1CSBA 1LTJC 2NPSB 1SQBE 1RF1C 4UB8E 3L71D 3R4YA 1OW7A 5B5EE 3EQ2A 1M1JB 1DH3A 2HPCA 2J59M 1NTZJ 2XZRA 3V4QA 3CXHE 4H44D 3CCRP 2A06G 1LWUC 5AW2B 3FX0A 3T97A 3MD0A 1ZV8A 5APUA 5CCHC 1Q82Q 1KYOH 2JP3A 4A7PA 3EFGA 1KB9E 2V7QJ 2WWWA 1SQXE 1PPJE 4PD4H 4O9BA 2XKMA 4Y99C 3P8MC 1QVFO 2KB7P 2A06D 1ZLLA 3Q5RA 2QA4P 1K73Q 1D7MA 3M9BA 1Y9BA 3CC4P 4H0LC 1PGOA 3SFEC 1PP9E 1PFIA 1FZCB 3I56P 1N8RQ 3JCUH 2H89C 3M0DA 1SQBG 2W8ZA 3CD6P 2BEQD 1H8AA 3WUTA 2JKVA 2K9JA 1VQOP 3RK3E 3JSVC 3CMAP 1JEKA 1T3JA 3T97B 1PGPA 2YKQA 1FZAA 3MUDA 2N1TC 2PRRA 5APVA 1SQBD 1R5SA 5CHXA 2ZFCA 5CJ0A 3BRTB 3HUSA 3AEFC 3SWKA 3CCJP 1FZGA 5CCGA 1SQXG 1SVFA 3H1JE 1U7JA 2E5TA 4N78E 2QE7H 1Q7YQ 1ZR2A 3VMZA 4JQ0D 4U7JA 1SQVK 1MFTA 3LIEA 2E43A 1AV1A 1FOSE 5K5GB 2YO3A 1OVUA 5AW8B 1KB9D 1KQSO 1RE3A 1SQXD 2K9JB 1VQNP 1PPJD 4BWNA 3HD7C 3RL0D 2BCCE 2M8RA 1SQPJ 1L4AB 2KNCB 1A02F 4H13C 3NXSA 2IBZE 1AVYA 2E75D 1ZN5A 1PP9D 1Q86Q 4GIFA 1S4XA 2QM7A 1U57A 2XV5A 3TF5A 1GDTA 1DD4A 4B86A 3L73J 3LW5J 4TT3H 4GKGA 2WPQA 3B71A 5APQA 1WMKA 3H1IE 2YKOA 3AE4C 3M06A 1S5LH 1HBWA 1W5CE 3F5HA 4WB4A 2E74D 2V7QH 1BE3E 5KLIB 2KI7B 1NAFA 3WU2H 2WSEH 2IYOA 1JNMA 3D6YA 1L0LK 1NU1E 4PV1D 5GTIH 1IJDB 2M0BA 3CMEP 1OWAA 2NRGA 2WPRA 5AVZB 1VQ9P 3AE9C 4YXDC 3CPWO 2ZVOB 5APYA 2ZYAA 3H1JD 1VQLP 3RK3B 2BCCG 3OW2O 4N78D 3U1AA 2Q3IA 2R32A 2B89A 2IBZG 3KZIH 1K9MQ 1FDIA 1JTHA 2OYHA 3CI9A 3EWKA 3U59A 2HODB 3V2NA 3G3ZA 4N3YB 5KTBA 1CI6B 4XFJA 3USSA 4L75A 3KYQA 3QH9A 3CX5I 2BCCD 3H1HE 2RKLA 3H1IG 1KZUB 1MFZA 1IFMA 5AVXB 2IBZD 3O8ZA 3D6ZA 3L74J 3B5NB 2B9BA 2FYUE 1NTZE 2R3SA 1S1CX 3MIWA 1ZP0C 2IZ0A 1BE3G 1OZHA 3A0HE 1M7LA 2WSFJ 2JJLA 3D70A 3AEAC 4OH8B 1NU1G 3TGUG 1JY2O 2ZT9B 1BDCA 2Z4EA 3H1ID 3GHGB 3GMAA 1TU3F 2YMKA 1SQVJ 3VTPC 2H88C 3AE7C 1KFMA 5AVSB 2Q1KA 2PFXA 5BU5A 3N7NA 1J1DC 4D6TG 3TYYA 1BE3D 1JTHB 1VQ6P 5C39A 3L75G 1GL2A 3VMYA 1NU1D 1H0TB 4U3FE 1JY3P 1NTME 3M9QA 1EQ7A 1Q2NA 1N7SC 1T8ZA 4D6TD 1N2DC 4HKZH 3FWLA 1EZVI 1IFJA 4ZMDA 2GUVA 3LW5H 3MHVA 2AXTE 1GL2D 2YKPA 1AFOA 5GTHE 3W67A 1RQUA 3H1LE 2P67A 3NFQA 1BCCJ 2M3BA 2OARA 1R8EA 1NTZG 1X22A 3HE4A 1CW5A 5AW6B 3RK2D 4NPDA 4I7ZC 1KQLA 1ZXGA 1RF1A 3H1HD 1IZNB 2Q7CA 4OGQD 5AW4B 2KLVA 1QVGO 2A45H 3VMXA 3IAOA 4I1LA 2AEMA 2FYUD 1NTZD 1L0LJ 1YQ4C 2Y0CA 1NWQA 1KD1Q 2QSIA 1UIXA 1L0NK 1GTWA 1GK6A 5B66E 1LWUA 5KLVK 4HH2A 2QRXA 1KC8Q 4U3FG 5TISH 1W2BO 2HG5D 1NKZB 4YXWH 3RK2B 1J1EB 1OIPA 5AW9B 5CCHA 1T2KC 3RBZA 3A0BH 3G71P 1NH4A 1ZR4A 3HE5A 1NTKK 1OXZA 3L72J 2J5UA 1PZQA 1N73B 1FAVA 1URQC 1SQPE 4U3FD 2PP6A 2OYIB 1DEBA 1AA0A 5CCHD 1BSNA 4HJGH 1SLQA 2FYNB 2JR8A 3M0AA 3BCCE 3L73E 3RL0g 1VF5D 3CXHH 1M90Q 3BRVB 3H1LD 1T3UA 1Y8AA 4H0LD 3FWNA 1PL5A 2GUSA 3RGUA 2HFED 5KKZC 1A02J 3E1IA 3CC2P 2N1TA 1VQ7P 1AQ5A 1EXIA 3P7KA 1IFPA 3EFFK 1GK4A 1PGJA 1NAYA 4XE5B 3Q5PA 3WUVA 2YNYA 2KS1B 1VF5B 2KK7A 3C1LA 2N1TD 1VL2A 3CLQA 1ZMEC 1P84E 3II6A 1SQPG 2W6AA 2YO2A 3S9OA 5AW0B 4LC1A 1X79B 4IL6X 3VYIA 1U7MA 3CX5H 1PGQA 2OQQA 1RQVA 2G3AA 3IFMA 5KAFH 2O1KA 3MZWB 4ZKUA 2FXMA 1E5WA 3BCCG 3C9IA 2QIWA 3CCSP 3HD7A 3L73G 3HTKA 4WY4B 3M9HA 3B4SA 3SFDC 1EDJA 3A7OA 1SQPD 1OW6A 2YIUB 1HWTC 2M3EA 4L74A 4PJ0E 2R5BA 1JUNA 3H32B 3GF3A 1RE4C 2QJYC 3HRNA 5APTA 1KILC 2D2CB 1HH0A 3L36A 1LT9B 1ZOYC 3HD7D 2O01N 2WPVB 3BCCD 3L73D 1E79H 5KAIE 2FXPA 4H13D 1L0NJ 2W6BA 2H7HA 4CPGA 5KLVJ 1IFNA 3WMM0 1VQMP 3M91A 4C7NA 2WSEJ 2FFDC 3OAKA 4LGDE 1FJKA 5AVRB 1M57D 4H44B 5H2FE 1G1IA 1NTKJ 2YMYA 3KXDA 2OTJP 2HPCB 4L73A 1RH5B 1SFCC 2FY8A 2WT7A 1FZFA 3PLNA 2C9NY 3PJSK 3TSIA 1JO5A 2LR2A 1P84D 1BGYJ 1XTGB 1X9VA 3Q5SA 1OW8A 3S1KA 4GOEA 1BSHA 3L74G 2NPSC 1LTIC 4HYTB 4BXLA 4W7YA 1M1JC 2B87A 3V2PA 2Q9IA 1JY2N 3A5TA 2Z5HA 3V6IA 4DT0A 2YXQB 1SQVG 2A45I 3RBXA 5KJ7A 1L0LE 1HGVA 4K35A 2UWJE 1OVRA 5CCGD 1DEEG 1KYOE 3K5BA 1BDDA 4ZKPA 1QEXA 4RJTA 1MZ9A 5AVVB 3KHUA 4PD4E 5EFWB 5AVQB 5KJ7D 2Y9ZA 3CCEP 3BVHA 1VQPP 3L71J 2OYOA 1GW3A 1OMIA 1FZCC 1FC2C 1RF0A 1LTSC 1IK9A 2IPPA 3NTNA 1BCCG 3JCUE 1Y47A 3HUSB 3IF4A 1LTGC 1VQ5P 2KYVA 3B8EB 2QG4A 1N7SA 1NHLA 3NMDA 1MKMA 3RL0B 2G8YA 2WPSA 2ZXXA 3A2AA 2C9LY 3CXHI 2QM8A 3CCUP 2E75B 2J58A 4R4LA 1L0LG 3Q2YA 1N7SD 3TGUE 2HLOA 3QWOC 1N86A 2N9BA 2GM4A 3AEEC 3O6QA 3FGAD 1KB9I 3H25A 2NZ2A 2QJPB 2QVAA 4D6TE 1USDA 2O3JA 1GU5A 1RY3A 1L0LD 3M0DC 4GOFA 3L75E 3Q3DA 4EIJA 1YJNP 2SPZA 5CJ4A 3L72G 2E74B 1KYOD 3P32A 4C7RA 4L76A 1PV3A 5APWA 3V2RA 3VP9A 1CZQA 1EZVG 2V4HA 5AVYB 4PV1B 2WITA 3MTUE 4PD4D 3N4XA 1L4AC 2KZJA 1PIXA 3MUDC 2E76D 4GDOA 2Z5IA 4EDFA 4ZNCA 1URQA 2Q3EA 2K3RA 4DCKA 1QGKB 1JY2P 1EZVD 5AW7B 4QMAA 2E5YA 3H1KJ 2K37A 4JF7A 2R44A 1S5LE 4RESB 2IZ1A 1URQD 2K1AA 1W2EA 5KLIC 2E76B 1L0NE 4UB6H 3ABVC 3GF7A 1MV8A 2OYHB 2RMZA 1SQXJ 1YJWP 1KILE 1NU1K 3WU2E 2K88A 3TDKA 3TGUD 2P2UA 1RHZB 5GTIE 3CCLP 1EDKA 2M5AA 3AE5C 1NYHA 1NTKE 2P7JA 3RK3C 1PP9J 4OVNF 1DD3A 1K04A 4KJMA 1YJ9P 2WZ7A 3L70J 1AVOA 3L75D 2GA1A 3GG2A 2IBZI 3KZIE 1Q90D 1FDOA 3A3YB 2RN0A 1KMIZ 1LT1A 1ZW0A 3VOPA 5E79H 1LTJA 4IL6H 3TNUA 4HB1A 1ZRTE 2I1JA 4YPCA 3B5NC 2FYUK 4WBAA 2OTLP 2QJKB 2N9YB 1L0NG 1GL2B 5KLVG 1RE4A 3PHLA 4IFDK 3IN6A 2ZT9C 1KILA 3H1JJ 3GHGC 1YTZT 1GW4A 1FS0E 2AEFA 3S4RA 2WSCH 2IYPA 1NTKG 4IFMA 1QLED 1X0TA 1HF9A 4OGQB 1KN7A 1L0ND 3L35A 1Q81Q 5KLVD 3AEBC 1KQFB 2FFDA 1KILD 1G2CA 1M1KQ 3HE4B 3MP7B 1VDFA 1NTMK 4UB8H 3AECC 2ITAA 1LTJB 4GODA 5B5EH 1RF1B 1NTKD 4YTPC 2Q5UA 2I8DA 3GLMA 4DJGA 1FZEA 1IO4A 2IDBA 2CPBA 4WWIA 3ZDMA 1LWUB 3P8CE 5AVTB 1S2EA 4OWFA 1SQQK 2KLUA 3F89A 4MN4C 2NPSA 2ZXEB 2C0XA 2LXBA 2MKVA 1KB9H 2WQYC 1ZRTD 1M1JA 1Z56A 3HE5B 1SS1A 2WMMA 3CWBJ 1N7LA 1XTCC 1MUUA 4Y99B 1NU1J 1K8AQ 4JPZB 1YYCA 1USEA 3E7KA 1R5LA 4ASVA 5CBOA 3SSUA 4Z1MH 4H0LB 4KT0J 4W7ZA 4RO0A 2ZYDA 2WSSH 2KZIA 1OVVA 5TISE 5AVUB 3RK2C 1J1EC 3L71G 1H88A 2W27A 3A0BE 1VQKP 3KPEA 2KUBA 1NVOA 2I1KA 1EC5A 2PAJA 2Y9YA 1N73C 2OYIC 3UIAA 3H1HJ 5TJHA 2OTKE 2N1TB 3CCVP 1FZCA 3G4SP 2HYNA 4IFFA 1JM0A 3L74E 2FYNC 2L5GB 1KQGB 4W80A 2FYUJ 1JCDA 2HR3A 1IK7A 1DX7A 3PH0A 2A45G 4BRYA 2H43A 3H1KE 1WRGA 3I55P 1JMMA 3P8CD 1SQVE 2L91A 3GW6A 3VP8A 5APSA 1AJYA 4GT1A 1EDLA 3HD7B 3HTKB 2P1JA 1VF5C 1G1JA 4U3FJ 2P10A 5AW1B 1NTMJ 4H13B 5CMZA 2K9YA 3AE6C 1YHQP 1FDMA 2P58A 2XU6A 1YQ3C 3BATA 3L70E 1J2JB 2XNXA 2FKWB 1BCCE 1SQBK 3CX5E 1QX8A 3H1LJ 5KAFE 1AQTA 2Q6QA 5M1BA 3SWYA 4BRYB 4WY4C 1FOSF 1L4AA 1EXJA 2KNCA 2YIUC 3IR9A 2KOGA 1SQQJ 2B88A 4C7NB 3H1KG 1S72P 1FJPA 4AQRD 3L74D 2WVRA 3PP5A 1M8OB 4EYYQ 2D2CC 3FXDA 1LT9C 4EI2A 4IOIH 3C8VA 1WT6A 3W68A 1L4AD 5CBNA 2O01J 2AXCA 1PPJG 3CXHD 1OFCX 1SQXK 2FXOA 3H1KD 2WT7B 1L2PA 1VPCA 2KIKA 1H89A 2C0WA 1SQVD 2O1JA 1PP9G 1LTBC 4H44C 1P84I 3L70G 3L72E 3I5CA 1JCCA 2W90A 1UIIA 2B87B 1JY3N 3FXEA 1EZVE 3L37A 2CPSA 2IX7C 2Y0DA 4DOJA 4NPEA 2JDIH 4C46A 2VRSA 1YIJP 3A0HH 2ZVNB 1IC2A 3BCCJ 3L70D 2JWAA 1IFIA 1BCCD 3CX5D 2HODA 3TK1A 1CI6A 3OA7A 3RK3D 1KFNA 1K05A 1YI2P 5DJUB 3H1JG 2POHA 3G6EP 1J1DB 2H8PD 3B5NA 1NGMB 1X8YA 3CWBE 3CCQP 2WSCJ 4EOTA 3GHGA 1DIPA 3B5ND 1N7SB 2AXTH 3JC22 4JBZA 5GTHH 4KHXA 3H6PA 1YBKA 1SQBJ 1NOHA 1S3JA 1M56D 2ZT9D 5APXA 3L72D 4WVZA 2KXPB 4AYCA 1H0TA 1LJ2A 3LIDA 1HGZA 3HUSC 5CCGC 1T2KD 4I7ZB 2JWDA 3SWFA 3L4FA 1HTLC 2KP8A 3O6QB 1EDIA 1LP1A 2LXCB 3VN0A 3RL0C 5KJ7C 3U1CA 2IFNA 2CK3H 1GZLA 2O01H 4K3AA 5B66H 2E75C 3CWBG 2JEEA 2JO1A 4I6MC 5KLVE 4DZOA 1S9KE 2BEZF 2XDJA 1SP4A 4M3LA 1RE3C 3V4WA 1HJ0A 2ZAEB 1KYOI 2MJZA 3E1RA 2QJPC 4PD4I 3CWBD 1RF0C 4I2LC 1URQB 1FE6A 1NKNA 5BU8B 2E74C 5BVZA 1JB0J 1QL2A 3PTZA 4XA4A 1JY3O 1HVVA 1BGYE 1S5LX 5AVWB 2R3CA 1LP1B 3AEDC 3H1HG 3AE1C 4PV1C 1KORA 1OX3A 2OGUA 1IFDA 1GMJA 2BASA 2FYUG 2KSJA 2DW3A 4N6JA 1N73A 2E42A 4AUWA 1NTZK 2PGDA 3KDPB 5KKZB 2OYIA 3G9RA 1FZBA 1SQQE 5AW5B 2AEJA 3AE8C 5L8RJ 3AE3C 3Q1MA 4NPFX 2M5AB 1NJIQ 3AE2C 1GU4A 1LTAC 3BASA 2W6JH 1YITP 1KTMA 2YXRB 2E76C 2LKMA 4Y28J 1JOCA 3KQGA 3CCMP 1P84H 4RKUJ 2OYHC 4UB6E 1S9KD 1YTZI 1NTMG 5AW3B 2BCCJ 2FYZA 1KV4A 1BGYG 3L71E 2IFMA 3TNUB 2R5DA 4JYBA 2W83C 2KS1A 3H1LG 1HJBA 3CL3D 1LTTC 1JMBA 4PJ0H 2RH0A 1SFCA 1NTMD 2Y0EA 4R4MA 1VQ4P 4JYCA 1VQ8P 2ZJSE 3V2QA 2ZYGA 2QJYB 1SQQG 3H1IJ 1BGYD 1KILB 3D71A 3OJAB 2WSFH 3WUUA 3R2PA 1T6AA 2FBWC 5KAIH 5E79E 4ASWA 4IL6E 1BE3J 1SFCD 4WY4A 2QEXP 5DJTB 3ITKA 2QJKC 3PRJA 2A06E 1GL2C 3TGUJ 2FFDB 1G2CB 1LGHB 1SQQD 4LLHA 3H32A 5H2FH 1HUCA 2NPSD 1NO4A 1FBMA 1LT9A 3AEGC
chains in the Genus database with same CATH topology
3HE4A 4WY4D 1FOSF 1CW5A 1GU5A 5AW6B 1L4AA 1RY3A 3RK2D 3M0DC 3IR9A 2KOGA 1KQLA 4EIJA 1RF1A 4C7NB 2WTYA 5CJ4A 3MGNA 2Q7CA 1FU1A 1FJPA 5AW4B 3P32A 1SFCB 4C7RA 2KLVA 5APWA 1QL1A 4AQRD 3V2RA 3VP9A 1CZQA 2A45H 3PP5A 3VMXA 1LT9C 3V5BA 5AVYB 1GD2E 4I1LA 1SQPK 2WITA 3MTUE 1CSBA 3N4XA 1NWQA 1L4AC 1WT6A 1L4AD 1LTJC 2NPSB 1L0NK 1GTWA 1RF1C 1GK6A 1LWUA 5KLVK 4HH2A 3EQ2A 2Z5IA 1SQXK 1M1JB 2WT7B 1DH3A 2HG5D 1NKZB 1URQA 1VPCA 2HPCA 1H89A 2J59M 3RK2B 1J1EB 5CCHA 5AW9B 1T2KC 2C0WA 2XZRA 2O1JA 3V4QA 1NH4A 1JY2P 1ZR4A 1LTBC 5AW7B 3HE5A 1NTKK 1OXZA 1LWUC 3I5CA 1JCCA 5AW2B 3T97A 4JF7A 1JY3N 3MD0A 1N73B 1FAVA 1URQC 1ZV8A 4RESB 5APUA 1URQD 2PP6A 5CCHC 2OYIB 3L37A 1DEBA 5CCHD 1W2EA 2CPSA 2IX7C 3EFGA 4DOJA 2WWWA 1MV8A 2OYHB 4C46A 1SLQA 2VRSA 1NU1K 4O9BA 2XKMA 4Y99C 3M0AA 3P8MC 2KB7P 2P2UA 1IC2A 1ZLLA 3M9BA 1IFIA 3BRVB 1T3UA 2HODA 2P7JA 3RK3C 2GUSA 1PFIA 3TK1A 1CI6A 3OA7A 1FZCB 3RK3D 1KFNA 2HFED 3M0DA 1A02J 2WZ7A 3E1IA 2N1TA 1H8AA 2POHA 1AQ5A 3A3YB 1J1DB 2H8PD 3B5NA 3P7KA 1GK4A 4XE5B 1X8YA 3VOPA 1T3JA 2YNYA 1LTJA 2YKQA 4EOTA 1FZAA 3TNUA 3MUDA 2N1TC 5APVA 2N1TD 2I1JA 3GHGA 3CLQA 5CHXA 3B5NC 2ZFCA 3II6A 2W6AA 3B5ND 2YO2A 1N7SB 3BRTB 3HUSA 2FYUK 5CJ0A 5AW0B 1FZGA 4WBAA 5CCGA 4LC1A 1X79B 1GL2B 3VYIA 4KHXA 3H6PA 1SVFA 3IFMA 1RE4A 2O1KA 4IFDK 1NOHA 2FXMA 4ZKUA 1KILA 1E5WA 3C9IA 3GHGC 4N78E 5APXA 1YTZT 3HD7A 1GW4A 3HTKA 4AYCA 1ZR2A 4WY4B 3VMZA 3M9HA 2WSCH 3LIDA 1HGZA 1SQVK 3HUSC 3A7OA 3LIEA 4IFMA 5CCGC 1T2KD 1HWTC 2E43A 2R5BA 3SWFA 3L4FA 1JUNA 1HTLC 3H32B 1FOSE 2KP8A 2YO3A 1RE4C 3HRNA 5AW8B 3L35A 5APTA 1RE3A 1KILC 3VN0A 3RL0C 2FFDA 1KILD 1G2CA 3HD7C 5KJ7C 3U1CA 3L36A 1HH0A 2IFNA 1LT9B 3RL0D 3HD7D 1GZLA 3HE4B 2O01H 2M8RA 1VDFA 1NTMK 1L4AB 1A02F 1LTJB 3NXSA 1RF1B 2JEEA 1ZN5A 4I6MC 2W6BA 4DZOA 1S9KE 2H7HA 2XDJA 1IFNA 2Q5UA 3WMM0 1SP4A 4M3LA 1RE3C 3M91A 4GIFA 2QM7A 2XV5A 4C7NA 2FFDC 3OAKA 3V4WA 1FZEA 4LGDE 1IO4A 1GDTA 4B86A 1FJKA 2MJZA 2CPBA 5AVRB 4GKGA 1G1IA 2WPQA 5APQA 2YMYA 2YKOA 1LWUB 3P8CE 5AVTB 1RF0C 3M06A 4I2LC 1HBWA 1SQQK 1URQB 2NPSA 2ZXEB 2C0XA 2HPCB 1NKNA 5BU8B 5BVZA 4WB4A 1QL2A 1M1JA 1SFCC 2WT7A 4XA4A 1JY3O 1Z56A 3HE5B 1FZFA 2C9NY 1NAFA 3TSIA 1HVVA 1JO5A 2WSEH 5AVWB 2R3CA 1JNMA 1XTGB 1N7LA 1L0LK 1X9VA 1XTCC 1MUUA 4Y99B 1IJDB 1IFDA 1YYCA 1OWAA 2NPSC 2BASA 2WPRA 5AVZB 1LTIC 4HYTB 5APYA 2KSJA 4W7ZA 4W7YA 1M1JC 3RK3B 4N6JA 1N73A 4N78D 3V2PA 2E42A 4AUWA 2Q9IA 1NTZK 3U1AA 2Q3IA 2R32A 5AVUB 3KDPB 3RK2C 1J1EC 2OYIA 1JY2N 1FZBA 5AW5B 1H88A 3A5TA 2Z5HA 2W27A 1JTHA 3KPEA 2OYHA 3CI9A 3U59A 2A45I 2HODB 3V2NA 5KJ7A 3G3ZA 1GU4A 2I1KA 2PAJA 4N3YB 5KTBA 1LTAC 1CI6B 1N73C 3BASA 1HGVA 3KYQA 2OYIC 5CCGD 3UIAA 1KZUB 1MFZA 1IFMA 2LKMA 1JOCA 2N1TB 5AVXB 3KQGA 1FZCA 2HYNA 3O8ZA 4IFFA 2OYHC 4ZKPA 3B5NB 1S9KD 2L5GB 1MZ9A 5AVVB 1YTZI 4W80A 3MIWA 5AVQB 5KJ7D 5AW3B 1JCDA 1M7LA 3BVHA 2FYZA 1DX7A 2JJLA 2IFMA 3TNUB 4OH8B 2A45G 2R5DA 2H43A 1GW3A 4JYBA 1JY2O 1FZCC 1RF0A 1WRGA 2Z4EA 3GHGB 1LTSC 1IK9A 1JMMA 2IPPA 3NTNA 3P8CD 1HJBA 3CL3D 3HUSB 1LTTC 3VTPC 1KFMA 1LTGC 5AVSB 1SFCA 5BU5A 3N7NA 1J1DC 4JYCA 3VP8A 2KYVA 3TYYA 1JTHB 3B8EB 5APSA 1N7SA 3V2QA 1NHLA 4GT1A 1GL2A 1KILB 3NMDA 3VMYA 3RL0B 3HD7B 3OJAB 2WSFH 2WPSA 3HTKB 3R2PA 2P1JA 1JY3P 3A2AA 2C9LY 1G1JA 5AW1B 2QM8A 3M9QA 1EQ7A 2J58A 1SFCD 4WY4A 5CMZA 1N7SC 1T8ZA 1N7SD 1N2DC 2HLOA 1FDMA 1IFJA 1N86A 1GL2C 2XU6A 2GUVA 3LW5H 3BATA 1J2JB 2FFDB 1GL2D 1G2CB 2N9BA 2XNXA 1LGHB 2YKPA 4LLHA 1AFOA 2FKWB 3H32A 2GM4A 1SQBK 2P67A 3NFQA 1HUCA 2NPSD 2M3BA 1NO4A 2OARA 1FBMA 1LT9A 3SWYA 4WY4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFI A;  1QL2 A;  1IFN A;  2IFM A;  3IFM A;  2KLV A;  1QL1 A;  4IFM A;  2IFN A;  1ZN5 A;  2XKM A;  1IFM A;  2KSJ A; 
#chains in the Genus database with same CATH topology
 2XND H;  4WY4 D;  4D6T J;  2KSE A;  3L75 J;  2WTY A;  4OGQ C;  3MGN A;  1FU1 A;  3VMA A;  1SFC B;  4TLF A;  1QL1 A;  3CC7 P;  1LNQ A;  1GD2 E;  3V5B A;  1SQP K;  2D2C D;  1CSB A;  1LTJ C;  2NPS B;  1SQB E;  1RF1 C;  4UB8 E;  3L71 D;  3R4Y A;  1OW7 A;  5B5E E;  3EQ2 A;  1M1J B;  1DH3 A;  2HPC A;  2J59 M;  1NTZ J;  2XZR A;  3V4Q A;  3CXH E;  4H44 D;  3CCR P;  2A06 G;  1LWU C;  5AW2 B;  3FX0 A;  3T97 A;  3MD0 A;  1ZV8 A;  5APU A;  5CCH C;  1Q82 Q;  1KYO H;  2JP3 A;  4A7P A;  3EFG A;  1KB9 E;  2V7Q J;  2WWW A;  1SQX E;  1PPJ E;  4PD4 H;  4O9B A;  2XKM A;  4Y99 C;  3P8M C;  1QVF O;  2KB7 P;  2A06 D;  1ZLL A;  3Q5R A;  2QA4 P;  1K73 Q;  1D7M A;  3M9B A;  1Y9B A;  3CC4 P;  4H0L C;  1PGO A;  3SFE C;  1PP9 E;  1PFI A;  1FZC B;  3I56 P;  1N8R Q;  3JCU H;  2H89 C;  3M0D A;  1SQB G;  2W8Z A;  3CD6 P;  2BEQ D;  1H8A A;  3WUT A;  2JKV A;  2K9J A;  1VQO P;  3RK3 E;  3JSV C;  3CMA P;  1JEK A;  1T3J A;  3T97 B;  1PGP A;  2YKQ A;  1FZA A;  3MUD A;  2N1T C;  2PRR A;  5APV A;  1SQB D;  1R5S A;  5CHX A;  2ZFC A;  5CJ0 A;  3BRT B;  3HUS A;  3AEF C;  3SWK A;  3CCJ P;  1FZG A;  5CCG A;  1SQX G;  1SVF A;  3H1J E;  1U7J A;  2E5T A;  4N78 E;  2QE7 H;  1Q7Y Q;  1ZR2 A;  3VMZ A;  4JQ0 D;  4U7J A;  1SQV K;  1MFT A;  3LIE A;  2E43 A;  1AV1 A;  1FOS E;  5K5G B;  2YO3 A;  1OVU A;  5AW8 B;  1KB9 D;  1KQS O;  1RE3 A;  1SQX D;  2K9J B;  1VQN P;  1PPJ D;  4BWN A;  3HD7 C;  3RL0 D;  2BCC E;  2M8R A;  1SQP J;  1L4A B;  2KNC B;  1A02 F;  4H13 C;  3NXS A;  2IBZ E;  1AVY A;  2E75 D;  1ZN5 A;  1PP9 D;  1Q86 Q;  4GIF A;  1S4X A;  2QM7 A;  1U57 A;  2XV5 A;  3TF5 A;  1GDT A;  1DD4 A;  4B86 A;  3L73 J;  3LW5 J;  4TT3 H;  4GKG A;  2WPQ A;  3B71 A;  5APQ A;  1WMK A;  3H1I E;  2YKO A;  3AE4 C;  3M06 A;  1S5L H;  1HBW A;  1W5C E;  3F5H A;  4WB4 A;  2E74 D;  2V7Q H;  1BE3 E;  5KLI B;  2KI7 B;  1NAF A;  3WU2 H;  2WSE H;  2IYO A;  1JNM A;  3D6Y A;  1L0L K;  1NU1 E;  4PV1 D;  5GTI H;  1IJD B;  2M0B A;  3CME P;  1OWA A;  2NRG A;  2WPR A;  5AVZ B;  1VQ9 P;  3AE9 C;  4YXD C;  3CPW O;  2ZVO B;  5APY A;  2ZYA A;  3H1J D;  1VQL P;  3RK3 B;  2BCC G;  3OW2 O;  4N78 D;  3U1A A;  2Q3I A;  2R32 A;  2B89 A;  2IBZ G;  3KZI H;  1K9M Q;  1FDI A;  1JTH A;  2OYH A;  3CI9 A;  3EWK A;  3U59 A;  2HOD B;  3V2N A;  3G3Z A;  4N3Y B;  5KTB A;  1CI6 B;  4XFJ A;  3USS A;  4L75 A;  3KYQ A;  3QH9 A;  3CX5 I;  2BCC D;  3H1H E;  2RKL A;  3H1I G;  1KZU B;  1MFZ A;  1IFM A;  5AVX B;  2IBZ D;  3O8Z A;  3D6Z A;  3L74 J;  3B5N B;  2B9B A;  2FYU E;  1NTZ E;  2R3S A;  1S1C X;  3MIW A;  1ZP0 C;  2IZ0 A;  1BE3 G;  1OZH A;  3A0H E;  1M7L A;  2WSF J;  2JJL A;  3D70 A;  3AEA C;  4OH8 B;  1NU1 G;  3TGU G;  1JY2 O;  2ZT9 B;  1BDC A;  2Z4E A;  3H1I D;  3GHG B;  3GMA A;  1TU3 F;  2YMK A;  1SQV J;  3VTP C;  2H88 C;  3AE7 C;  1KFM A;  5AVS B;  2Q1K A;  2PFX A;  5BU5 A;  3N7N A;  1J1D C;  4D6T G;  3TYY A;  1BE3 D;  1JTH B;  1VQ6 P;  5C39 A;  3L75 G;  1GL2 A;  3VMY A;  1NU1 D;  1H0T B;  4U3F E;  1JY3 P;  1NTM E;  3M9Q A;  1EQ7 A;  1Q2N A;  1N7S C;  1T8Z A;  4D6T D;  1N2D C;  4HKZ H;  3FWL A;  1EZV I;  1IFJ A;  4ZMD A;  2GUV A;  3LW5 H;  3MHV A;  2AXT E;  1GL2 D;  2YKP A;  1AFO A;  5GTH E;  3W67 A;  1RQU A;  3H1L E;  2P67 A;  3NFQ A;  1BCC J;  2M3B A;  2OAR A;  1R8E A;  1NTZ G;  1X22 A;  3HE4 A;  1CW5 A;  5AW6 B;  3RK2 D;  4NPD A;  4I7Z C;  1KQL A;  1ZXG A;  1RF1 A;  3H1H D;  1IZN B;  2Q7C A;  4OGQ D;  5AW4 B;  2KLV A;  1QVG O;  2A45 H;  3VMX A;  3IAO A;  4I1L A;  2AEM A;  2FYU D;  1NTZ D;  1L0L J;  1YQ4 C;  2Y0C A;  1NWQ A;  1KD1 Q;  2QSI A;  1UIX A;  1L0N K;  1GTW A;  1GK6 A;  5B66 E;  1LWU A;  5KLV K;  4HH2 A;  2QRX A;  1KC8 Q;  4U3F G;  5TIS H;  1W2B O;  2HG5 D;  1NKZ B;  4YXW H;  3RK2 B;  1J1E B;  1OIP A;  5AW9 B;  5CCH A;  1T2K C;  3RBZ A;  3A0B H;  3G71 P;  1NH4 A;  1ZR4 A;  3HE5 A;  1NTK K;  1OXZ A;  3L72 J;  2J5U A;  1PZQ A;  1N73 B;  1FAV A;  1URQ C;  1SQP E;  4U3F D;  2PP6 A;  2OYI B;  1DEB A;  1AA0 A;  5CCH D;  1BSN A;  4HJG H;  1SLQ A;  2FYN B;  2JR8 A;  3M0A A;  3BCC E;  3L73 E;  3RL0 g;  1VF5 D;  3CXH H;  1M90 Q;  3BRV B;  3H1L D;  1T3U A;  1Y8A A;  4H0L D;  3FWN A;  1PL5 A;  2GUS A;  3RGU A;  2HFE D;  5KKZ C;  1A02 J;  3E1I A;  3CC2 P;  2N1T A;  1VQ7 P;  1AQ5 A;  1EXI A;  3P7K A;  1IFP A;  3EFF K;  1GK4 A;  1PGJ A;  1NAY A;  4XE5 B;  3Q5P A;  3WUV A;  2YNY A;  2KS1 B;  1VF5 B;  2KK7 A;  3C1L A;  2N1T D;  1VL2 A;  3CLQ A;  1ZME C;  1P84 E;  3II6 A;  1SQP G;  2W6A A;  2YO2 A;  3S9O A;  5AW0 B;  4LC1 A;  1X79 B;  4IL6 X;  3VYI A;  1U7M A;  3CX5 H;  1PGQ A;  2OQQ A;  1RQV A;  2G3A A;  3IFM A;  5KAF H;  2O1K A;  3MZW B;  4ZKU A;  2FXM A;  1E5W A;  3BCC G;  3C9I A;  2QIW A;  3CCS P;  3HD7 A;  3L73 G;  3HTK A;  4WY4 B;  3M9H A;  3B4S A;  3SFD C;  1EDJ A;  3A7O A;  1SQP D;  1OW6 A;  2YIU B;  1HWT C;  2M3E A;  4L74 A;  4PJ0 E;  2R5B A;  1JUN A;  3H32 B;  3GF3 A;  1RE4 C;  2QJY C;  3HRN A;  5APT A;  1KIL C;  2D2C B;  1HH0 A;  3L36 A;  1LT9 B;  1ZOY C;  3HD7 D;  2O01 N;  2WPV B;  3BCC D;  3L73 D;  1E79 H;  5KAI E;  2FXP A;  4H13 D;  1L0N J;  2W6B A;  2H7H A;  4CPG A;  5KLV J;  1IFN A;  3WMM 0;  1VQM P;  3M91 A;  4C7N A;  2WSE J;  2FFD C;  3OAK A;  4LGD E;  1FJK A;  5AVR B;  1M57 D;  4H44 B;  5H2F E;  1G1I A;  1NTK J;  2YMY A;  3KXD A;  2OTJ P;  2HPC B;  4L73 A;  1RH5 B;  1SFC C;  2FY8 A;  2WT7 A;  1FZF A;  3PLN A;  2C9N Y;  3PJS K;  3TSI A;  1JO5 A;  2LR2 A;  1P84 D;  1BGY J;  1XTG B;  1X9V A;  3Q5S A;  1OW8 A;  3S1K A;  4GOE A;  1BSH A;  3L74 G;  2NPS C;  1LTI C;  4HYT B;  4BXL A;  4W7Y A;  1M1J C;  2B87 A;  3V2P A;  2Q9I A;  1JY2 N;  3A5T A;  2Z5H A;  3V6I A;  4DT0 A;  2YXQ B;  1SQV G;  2A45 I;  3RBX A;  5KJ7 A;  1L0L E;  1HGV A;  4K35 A;  2UWJ E;  1OVR A;  5CCG D;  1DEE G;  1KYO E;  3K5B A;  1BDD A;  4ZKP A;  1QEX A;  4RJT A;  1MZ9 A;  5AVV B;  3KHU A;  4PD4 E;  5EFW B;  5AVQ B;  5KJ7 D;  2Y9Z A;  3CCE P;  3BVH A;  1VQP P;  3L71 J;  2OYO A;  1GW3 A;  1OMI A;  1FZC C;  1FC2 C;  1RF0 A;  1LTS C;  1IK9 A;  2IPP A;  3NTN A;  1BCC G;  3JCU E;  1Y47 A;  3HUS B;  3IF4 A;  1LTG C;  1VQ5 P;  2KYV A;  3B8E B;  2QG4 A;  1N7S A;  1NHL A;  3NMD A;  1MKM A;  3RL0 B;  2G8Y A;  2WPS A;  2ZXX A;  3A2A A;  2C9L Y;  3CXH I;  2QM8 A;  3CCU P;  2E75 B;  2J58 A;  4R4L A;  1L0L G;  3Q2Y A;  1N7S D;  3TGU E;  2HLO A;  3QWO C;  1N86 A;  2N9B A;  2GM4 A;  3AEE C;  3O6Q A;  3FGA D;  1KB9 I;  3H25 A;  2NZ2 A;  2QJP B;  2QVA A;  4D6T E;  1USD A;  2O3J A;  1GU5 A;  1RY3 A;  1L0L D;  3M0D C;  4GOF A;  3L75 E;  3Q3D A;  4EIJ A;  1YJN P;  2SPZ A;  5CJ4 A;  3L72 G;  2E74 B;  1KYO D;  3P32 A;  4C7R A;  4L76 A;  1PV3 A;  5APW A;  3V2R A;  3VP9 A;  1CZQ A;  1EZV G;  2V4H A;  5AVY B;  4PV1 B;  2WIT A;  3MTU E;  4PD4 D;  3N4X A;  1L4A C;  2KZJ A;  1PIX A;  3MUD C;  2E76 D;  4GDO A;  2Z5I A;  4EDF A;  4ZNC A;  1URQ A;  2Q3E A;  2K3R A;  4DCK A;  1QGK B;  1JY2 P;  1EZV D;  5AW7 B;  4QMA A;  2E5Y A;  3H1K J;  2K37 A;  4JF7 A;  2R44 A;  1S5L E;  4RES B;  2IZ1 A;  1URQ D;  2K1A A;  1W2E A;  5KLI C;  2E76 B;  1L0N E;  4UB6 H;  3ABV C;  3GF7 A;  1MV8 A;  2OYH B;  2RMZ A;  1SQX J;  1YJW P;  1KIL E;  1NU1 K;  3WU2 E;  2K88 A;  3TDK A;  3TGU D;  2P2U A;  1RHZ B;  5GTI E;  3CCL P;  1EDK A;  2M5A A;  3AE5 C;  1NYH A;  1NTK E;  2P7J A;  3RK3 C;  1PP9 J;  4OVN F;  1DD3 A;  1K04 A;  4KJM A;  1YJ9 P;  2WZ7 A;  3L70 J;  1AVO A;  3L75 D;  2GA1 A;  3GG2 A;  2IBZ I;  3KZI E;  1Q90 D;  1FDO A;  3A3Y B;  2RN0 A;  1KMI Z;  1LT1 A;  1ZW0 A;  3VOP A;  5E79 H;  1LTJ A;  4IL6 H;  3TNU A;  4HB1 A;  1ZRT E;  2I1J A;  4YPC A;  3B5N C;  2FYU K;  4WBA A;  2OTL P;  2QJK B;  2N9Y B;  1L0N G;  1GL2 B;  5KLV G;  1RE4 A;  3PHL A;  4IFD K;  3IN6 A;  2ZT9 C;  1KIL A;  3H1J J;  3GHG C;  1YTZ T;  1GW4 A;  1FS0 E;  2AEF A;  3S4R A;  2WSC H;  2IYP A;  1NTK G;  4IFM A;  1QLE D;  1X0T A;  1HF9 A;  4OGQ B;  1KN7 A;  1L0N D;  3L35 A;  1Q81 Q;  5KLV D;  3AEB C;  1KQF B;  2FFD A;  1KIL D;  1G2C A;  1M1K Q;  3HE4 B;  3MP7 B;  1VDF A;  1NTM K;  4UB8 H;  3AEC C;  2ITA A;  1LTJ B;  4GOD A;  5B5E H;  1RF1 B;  1NTK D;  4YTP C;  2Q5U A;  2I8D A;  3GLM A;  4DJG A;  1FZE A;  1IO4 A;  2IDB A;  2CPB A;  4WWI A;  3ZDM A;  1LWU B;  3P8C E;  5AVT B;  1S2E A;  4OWF A;  1SQQ K;  2KLU A;  3F89 A;  4MN4 C;  2NPS A;  2ZXE B;  2C0X A;  2LXB A;  2MKV A;  1KB9 H;  2WQY C;  1ZRT D;  1M1J A;  1Z56 A;  3HE5 B;  1SS1 A;  2WMM A;  3CWB J;  1N7L A;  1XTC C;  1MUU A;  4Y99 B;  1NU1 J;  1K8A Q;  4JPZ B;  1YYC A;  1USE A;  3E7K A;  1R5L A;  4ASV A;  5CBO A;  3SSU A;  4Z1M H;  4H0L B;  4KT0 J;  4W7Z A;  4RO0 A;  2ZYD A;  2WSS H;  2KZI A;  1OVV A;  5TIS E;  5AVU B;  3RK2 C;  1J1E C;  3L71 G;  1H88 A;  2W27 A;  3A0B E;  1VQK P;  3KPE A;  2KUB A;  1NVO A;  2I1K A;  1EC5 A;  2PAJ A;  2Y9Y A;  1N73 C;  2OYI C;  3UIA A;  3H1H J;  5TJH A;  2OTK E;  2N1T B;  3CCV P;  1FZC A;  3G4S P;  2HYN A;  4IFF A;  1JM0 A;  3L74 E;  2FYN C;  2L5G B;  1KQG B;  4W80 A;  2FYU J;  1JCD A;  2HR3 A;  1IK7 A;  1DX7 A;  3PH0 A;  2A45 G;  4BRY A;  2H43 A;  3H1K E;  1WRG A;  3I55 P;  1JMM A;  3P8C D;  1SQV E;  2L91 A;  3GW6 A;  3VP8 A;  5APS A;  1AJY A;  4GT1 A;  1EDL A;  3HD7 B;  3HTK B;  2P1J A;  1VF5 C;  1G1J A;  4U3F J;  2P10 A;  5AW1 B;  1NTM J;  4H13 B;  5CMZ A;  2K9Y A;  3AE6 C;  1YHQ P;  1FDM A;  2P58 A;  2XU6 A;  1YQ3 C;  3BAT A;  3L70 E;  1J2J B;  2XNX A;  2FKW B;  1BCC E;  1SQB K;  3CX5 E;  1QX8 A;  3H1L J;  5KAF E;  1AQT A;  2Q6Q A;  5M1B A;  3SWY A;  4BRY B;  4WY4 C;  1FOS F;  1L4A A;  1EXJ A;  2KNC A;  2YIU C;  3IR9 A;  2KOG A;  1SQQ J;  2B88 A;  4C7N B;  3H1K G;  1S72 P;  1FJP A;  4AQR D;  3L74 D;  2WVR A;  3PP5 A;  1M8O B;  4EYY Q;  2D2C C;  3FXD A;  1LT9 C;  4EI2 A;  4IOI H;  3C8V A;  1WT6 A;  3W68 A;  1L4A D;  5CBN A;  2O01 J;  2AXC A;  1PPJ G;  3CXH D;  1OFC X;  1SQX K;  2FXO A;  3H1K D;  2WT7 B;  1L2P A;  1VPC A;  2KIK A;  1H89 A;  2C0W A;  1SQV D;  2O1J A;  1PP9 G;  1LTB C;  4H44 C;  1P84 I;  3L70 G;  3L72 E;  3I5C A;  1JCC A;  2W90 A;  1UII A;  2B87 B;  1JY3 N;  3FXE A;  1EZV E;  3L37 A;  2CPS A;  2IX7 C;  2Y0D A;  4DOJ A;  4NPE A;  2JDI H;  4C46 A;  2VRS A;  1YIJ P;  3A0H H;  2ZVN B;  1IC2 A;  3BCC J;  3L70 D;  2JWA A;  1IFI A;  1BCC D;  3CX5 D;  2HOD A;  3TK1 A;  1CI6 A;  3OA7 A;  3RK3 D;  1KFN A;  1K05 A;  1YI2 P;  5DJU B;  3H1J G;  2POH A;  3G6E P;  1J1D B;  2H8P D;  3B5N A;  1NGM B;  1X8Y A;  3CWB E;  3CCQ P;  2WSC J;  4EOT A;  3GHG A;  1DIP A;  3B5N D;  1N7S B;  2AXT H;  3JC2 2;  4JBZ A;  5GTH H;  4KHX A;  3H6P A;  1YBK A;  1SQB J;  1NOH A;  1S3J A;  1M56 D;  2ZT9 D;  5APX A;  3L72 D;  4WVZ A;  2KXP B;  4AYC A;  1H0T A;  1LJ2 A;  3LID A;  1HGZ A;  3HUS C;  5CCG C;  1T2K D;  4I7Z B;  2JWD A;  3SWF A;  3L4F A;  1HTL C;  2KP8 A;  3O6Q B;  1EDI A;  1LP1 A;  2LXC B;  3VN0 A;  3RL0 C;  5KJ7 C;  3U1C A;  2IFN A;  2CK3 H;  1GZL A;  2O01 H;  4K3A A;  5B66 H;  2E75 C;  3CWB G;  2JEE A;  2JO1 A;  4I6M C;  5KLV E;  4DZO A;  1S9K E;  2BEZ F;  2XDJ A;  1SP4 A;  4M3L A;  1RE3 C;  3V4W A;  1HJ0 A;  2ZAE B;  1KYO I;  2MJZ A;  3E1R A;  2QJP C;  4PD4 I;  3CWB D;  1RF0 C;  4I2L C;  1URQ B;  1FE6 A;  1NKN A;  5BU8 B;  2E74 C;  5BVZ A;  1JB0 J;  1QL2 A;  3PTZ A;  4XA4 A;  1JY3 O;  1HVV A;  1BGY E;  1S5L X;  5AVW B;  2R3C A;  1LP1 B;  3AED C;  3H1H G;  3AE1 C;  4PV1 C;  1KOR A;  1OX3 A;  2OGU A;  1IFD A;  1GMJ A;  2BAS A;  2FYU G;  2KSJ A;  2DW3 A;  4N6J A;  1N73 A;  2E42 A;  4AUW A;  1NTZ K;  2PGD A;  3KDP B;  5KKZ B;  2OYI A;  3G9R A;  1FZB A;  1SQQ E;  5AW5 B;  2AEJ A;  3AE8 C;  5L8R J;  3AE3 C;  3Q1M A;  4NPF X;  2M5A B;  1NJI Q;  3AE2 C;  1GU4 A;  1LTA C;  3BAS A;  2W6J H;  1YIT P;  1KTM A;  2YXR B;  2E76 C;  2LKM A;  4Y28 J;  1JOC A;  3KQG A;  3CCM P;  1P84 H;  4RKU J;  2OYH C;  4UB6 E;  1S9K D;  1YTZ I;  1NTM G;  5AW3 B;  2BCC J;  2FYZ A;  1KV4 A;  1BGY G;  3L71 E;  2IFM A;  3TNU B;  2R5D A;  4JYB A;  2W83 C;  2KS1 A;  3H1L G;  1HJB A;  3CL3 D;  1LTT C;  1JMB A;  4PJ0 H;  2RH0 A;  1SFC A;  1NTM D;  2Y0E A;  4R4M A;  1VQ4 P;  4JYC A;  1VQ8 P;  2ZJS E;  3V2Q A;  2ZYG A;  2QJY B;  1SQQ G;  3H1I J;  1BGY D;  1KIL B;  3D71 A;  3OJA B;  2WSF H;  3WUU A;  3R2P A;  1T6A A;  2FBW C;  5KAI H;  5E79 E;  4ASW A;  4IL6 E;  1BE3 J;  1SFC D;  4WY4 A;  2QEX P;  5DJT B;  3ITK A;  2QJK C;  3PRJ A;  2A06 E;  1GL2 C;  3TGU J;  2FFD B;  1G2C B;  1LGH B;  1SQQ D;  4LLH A;  3H32 A;  5H2F H;  1HUC A;  2NPS D;  1NO4 A;  1FBM A;  1LT9 A;  3AEG C; 
#chains in the Genus database with same CATH homology
 3HE4 A;  4WY4 D;  1FOS F;  1CW5 A;  1GU5 A;  5AW6 B;  1L4A A;  1RY3 A;  3RK2 D;  3M0D C;  3IR9 A;  2KOG A;  1KQL A;  4EIJ A;  1RF1 A;  4C7N B;  2WTY A;  5CJ4 A;  3MGN A;  2Q7C A;  1FU1 A;  1FJP A;  5AW4 B;  3P32 A;  1SFC B;  4C7R A;  2KLV A;  5APW A;  1QL1 A;  4AQR D;  3V2R A;  3VP9 A;  1CZQ A;  2A45 H;  3PP5 A;  3VMX A;  1LT9 C;  3V5B A;  5AVY B;  1GD2 E;  4I1L A;  1SQP K;  2WIT A;  3MTU E;  1CSB A;  3N4X A;  1NWQ A;  1L4A C;  1WT6 A;  1L4A D;  1LTJ C;  2NPS B;  1L0N K;  1GTW A;  1RF1 C;  1GK6 A;  1LWU A;  5KLV K;  4HH2 A;  3EQ2 A;  2Z5I A;  1SQX K;  1M1J B;  2WT7 B;  1DH3 A;  2HG5 D;  1NKZ B;  1URQ A;  1VPC A;  2HPC A;  1H89 A;  2J59 M;  3RK2 B;  1J1E B;  5CCH A;  5AW9 B;  1T2K C;  2C0W A;  2XZR A;  2O1J A;  3V4Q A;  1NH4 A;  1JY2 P;  1ZR4 A;  1LTB C;  5AW7 B;  3HE5 A;  1NTK K;  1OXZ A;  1LWU C;  3I5C A;  1JCC A;  5AW2 B;  3T97 A;  4JF7 A;  1JY3 N;  3MD0 A;  1N73 B;  1FAV A;  1URQ C;  1ZV8 A;  4RES B;  5APU A;  1URQ D;  2PP6 A;  5CCH C;  2OYI B;  3L37 A;  1DEB A;  5CCH D;  1W2E A;  2CPS A;  2IX7 C;  3EFG A;  4DOJ A;  2WWW A;  1MV8 A;  2OYH B;  4C46 A;  1SLQ A;  2VRS A;  1NU1 K;  4O9B A;  2XKM A;  4Y99 C;  3M0A A;  3P8M C;  2KB7 P;  2P2U A;  1IC2 A;  1ZLL A;  3M9B A;  1IFI A;  3BRV B;  1T3U A;  2HOD A;  2P7J A;  3RK3 C;  2GUS A;  1PFI A;  3TK1 A;  1CI6 A;  3OA7 A;  1FZC B;  3RK3 D;  1KFN A;  2HFE D;  3M0D A;  1A02 J;  2WZ7 A;  3E1I A;  2N1T A;  1H8A A;  2POH A;  1AQ5 A;  3A3Y B;  1J1D B;  2H8P D;  3B5N A;  3P7K A;  1GK4 A;  4XE5 B;  1X8Y A;  3VOP A;  1T3J A;  2YNY A;  1LTJ A;  2YKQ A;  4EOT A;  1FZA A;  3TNU A;  3MUD A;  2N1T C;  5APV A;  2N1T D;  2I1J A;  3GHG A;  3CLQ A;  5CHX A;  3B5N C;  2ZFC A;  3II6 A;  2W6A A;  3B5N D;  2YO2 A;  1N7S B;  3BRT B;  3HUS A;  2FYU K;  5CJ0 A;  5AW0 B;  1FZG A;  4WBA A;  5CCG A;  4LC1 A;  1X79 B;  1GL2 B;  3VYI A;  4KHX A;  3H6P A;  1SVF A;  3IFM A;  1RE4 A;  2O1K A;  4IFD K;  1NOH A;  2FXM A;  4ZKU A;  1KIL A;  1E5W A;  3C9I A;  3GHG C;  4N78 E;  5APX A;  1YTZ T;  3HD7 A;  1GW4 A;  3HTK A;  4AYC A;  1ZR2 A;  4WY4 B;  3VMZ A;  3M9H A;  2WSC H;  3LID A;  1HGZ A;  1SQV K;  3HUS C;  3A7O A;  3LIE A;  4IFM A;  5CCG C;  1T2K D;  1HWT C;  2E43 A;  2R5B A;  3SWF A;  3L4F A;  1JUN A;  1HTL C;  3H32 B;  1FOS E;  2KP8 A;  2YO3 A;  1RE4 C;  3HRN A;  5AW8 B;  3L35 A;  5APT A;  1RE3 A;  1KIL C;  3VN0 A;  3RL0 C;  2FFD A;  1KIL D;  1G2C A;  3HD7 C;  5KJ7 C;  3U1C A;  3L36 A;  1HH0 A;  2IFN A;  1LT9 B;  3RL0 D;  3HD7 D;  1GZL A;  3HE4 B;  2O01 H;  2M8R A;  1VDF A;  1NTM K;  1L4A B;  1A02 F;  1LTJ B;  3NXS A;  1RF1 B;  2JEE A;  1ZN5 A;  4I6M C;  2W6B A;  4DZO A;  1S9K E;  2H7H A;  2XDJ A;  1IFN A;  2Q5U A;  3WMM 0;  1SP4 A;  4M3L A;  1RE3 C;  3M91 A;  4GIF A;  2QM7 A;  2XV5 A;  4C7N A;  2FFD C;  3OAK A;  3V4W A;  1FZE A;  4LGD E;  1IO4 A;  1GDT A;  4B86 A;  1FJK A;  2MJZ A;  2CPB A;  5AVR B;  4GKG A;  1G1I A;  2WPQ A;  5APQ A;  2YMY A;  2YKO A;  1LWU B;  3P8C E;  5AVT B;  1RF0 C;  3M06 A;  4I2L C;  1HBW A;  1SQQ K;  1URQ B;  2NPS A;  2ZXE B;  2C0X A;  2HPC B;  1NKN A;  5BU8 B;  5BVZ A;  4WB4 A;  1QL2 A;  1M1J A;  1SFC C;  2WT7 A;  4XA4 A;  1JY3 O;  1Z56 A;  3HE5 B;  1FZF A;  2C9N Y;  1NAF A;  3TSI A;  1HVV A;  1JO5 A;  2WSE H;  5AVW B;  2R3C A;  1JNM A;  1XTG B;  1N7L A;  1L0L K;  1X9V A;  1XTC C;  1MUU A;  4Y99 B;  1IJD B;  1IFD A;  1YYC A;  1OWA A;  2NPS C;  2BAS A;  2WPR A;  5AVZ B;  1LTI C;  4HYT B;  5APY A;  2KSJ A;  4W7Z A;  4W7Y A;  1M1J C;  3RK3 B;  4N6J A;  1N73 A;  4N78 D;  3V2P A;  2E42 A;  4AUW A;  2Q9I A;  1NTZ K;  3U1A A;  2Q3I A;  2R32 A;  5AVU B;  3KDP B;  3RK2 C;  1J1E C;  2OYI A;  1JY2 N;  1FZB A;  5AW5 B;  1H88 A;  3A5T A;  2Z5H A;  2W27 A;  1JTH A;  3KPE A;  2OYH A;  3CI9 A;  3U59 A;  2A45 I;  2HOD B;  3V2N A;  5KJ7 A;  3G3Z A;  1GU4 A;  2I1K A;  2PAJ A;  4N3Y B;  5KTB A;  1LTA C;  1CI6 B;  1N73 C;  3BAS A;  1HGV A;  3KYQ A;  2OYI C;  5CCG D;  3UIA A;  1KZU B;  1MFZ A;  1IFM A;  2LKM A;  1JOC A;  2N1T B;  5AVX B;  3KQG A;  1FZC A;  2HYN A;  3O8Z A;  4IFF A;  2OYH C;  4ZKP A;  3B5N B;  1S9K D;  2L5G B;  1MZ9 A;  5AVV B;  1YTZ I;  4W80 A;  3MIW A;  5AVQ B;  5KJ7 D;  5AW3 B;  1JCD A;  1M7L A;  3BVH A;  2FYZ A;  1DX7 A;  2JJL A;  2IFM A;  3TNU B;  4OH8 B;  2A45 G;  2R5D A;  2H43 A;  1GW3 A;  4JYB A;  1JY2 O;  1FZC C;  1RF0 A;  1WRG A;  2Z4E A;  3GHG B;  1LTS C;  1IK9 A;  1JMM A;  2IPP A;  3NTN A;  3P8C D;  1HJB A;  3CL3 D;  3HUS B;  1LTT C;  3VTP C;  1KFM A;  1LTG C;  5AVS B;  1SFC A;  5BU5 A;  3N7N A;  1J1D C;  4JYC A;  3VP8 A;  2KYV A;  3TYY A;  1JTH B;  3B8E B;  5APS A;  1N7S A;  3V2Q A;  1NHL A;  4GT1 A;  1GL2 A;  1KIL B;  3NMD A;  3VMY A;  3RL0 B;  3HD7 B;  3OJA B;  2WSF H;  2WPS A;  3HTK B;  3R2P A;  2P1J A;  1JY3 P;  3A2A A;  2C9L Y;  1G1J A;  5AW1 B;  2QM8 A;  3M9Q A;  1EQ7 A;  2J58 A;  1SFC D;  4WY4 A;  5CMZ A;  1N7S C;  1T8Z A;  1N7S D;  1N2D C;  2HLO A;  1FDM A;  1IFJ A;  1N86 A;  1GL2 C;  2XU6 A;  2GUV A;  3LW5 H;  3BAT A;  1J2J B;  2FFD B;  1GL2 D;  1G2C B;  2N9B A;  2XNX A;  1LGH B;  2YKP A;  4LLH A;  1AFO A;  2FKW B;  3H32 A;  2GM4 A;  1SQB K;  2P67 A;  3NFQ A;  1HUC A;  2NPS D;  2M3B A;  1NO4 A;  2OAR A;  1FBM A;  1LT9 A;  3SWY A;  4WY4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...