3IFMA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ifmA00
1IFNA 2KSJA 2IFMA 4IFMA 3IFMA 1ZN5A 1PFIA 1QL2A 2XKMA 2KLVA 1QL1A 2IFNA 1IFMA
chains in the Genus database with same CATH superfamily
3AE4C 3Q5PA 1XTGB 2E75C 1UIXA 2JR8A 2E74D 4GDOA 3SWFA 1ZR2A 1JY2P 1KYOI 5KAFE 2IBZI 1VQLP 5KLVE 1HBWA 1H0TB 2YIUB 3AE7C 3T97A 1LT9B 3CCLP 1R5SA 2E75B 2NPSB 3HD7D 2P10A 2AXCA 3BRTB 2ZXEB 3JC22 2WTYA 1AVOA 2A45H 2J59M 3MZWB 1AA0A 2M3BA 2KI7B 1KYOE 3RL0D 2QA4P 3L71J 5CCGA 1PP9E 2HG5D 2WWWA 4I7ZC 1YQ4C 1QX8A 2XKMA 1N7LA 1AQTA 3BCCD 4OVNF 2W6JH 4U7JA 1K05A 3RL0g 2FBWC 3RK2C 5H2FH 3V6IA 1NTZJ 2B87B 1QLED 1YIJP 3C9IA 5AW2B 1KFNA 1K9MQ 4H0LD 1KV4A 3GF3A 4I2LC 4JPZB 3CCUP 2KLVA 4U3FE 1OW8A 1K04A 3HUSA 3H1LE 5K5GB 1GU5A 2BEQD 1OFCX 2I1KA 1P84H 2QM7A 4WY4A 3V2RA 1DIPA 1RH5B 2D2CD 1GDTA 1KYOD 1QL2A 3I56P 1KQLA 1AFOA 1M7LA 4IFMA 1YYCA 1S72P 3CXHE 1L0NK 2E76B 3H1KG 3H1ID 5GTIE 1GL2A 1YHQP 3L70G 2AEMA 3CCEP 3CX5E 1KQFB 2H43A 3A0HH 3M06A 3L74D 5AW1B 1MUUA 1IFIA 1JEKA 1OX3A 3L75D 1HGVA 1S5LH 2XV5A 1NTZD 1L4AC 3RBZA 4IFFA 1YTZI 1NTKE 3B5ND 3EFFK 4O9BA 5APQA 3TF5A 1IK9A 3A5TA 1SQXD 3RL0C 2BCCG 1PPJD 3KDPB 3MUDA 2QE7H 3CXHD 2WT7B 4HKZH 4LGDE 4ASVA 5B66E 1GL2B 2GUVA 2W8ZA 3CX5H 4WBAA 4Z1MH 1MZ9A 1ZLLA 2IZ0A 5AVTB 2OYIC 1ZMEC 2N1TB 2RH0A 1PV3A 2ZAEB 1YQ3C 2FKWB 1GK6A 2K37A 1EDJA 3BATA 2V7QH 3HE5B 3P8CE 3I55P 1KN7A 4H44C 3AE5C 1SLQA 2L5GB 5APYA 3U1CA 3L74J 1JY3P 1RE3A 2WSEH 1UIIA 3P8MC 5AVZB 5E79E 3TNUB 4UB6H 2ZVOB 2KOGA 4ZMDA 2IPPA 3R2PA 3L4FA 1EZVD 2KXPB 1LT9A 3CXHH 3P32A 3H25A 1FU1A 2XNDH 1NH4A 2Y9YA 1FZCA 2YXRB 5KLVJ 3L37A 1FZFA 3VMYA 5BVZA 5AVUB 1IFDA 3FWNA 1E5WA 4DCKA 4HJGH 4UB8H 1Q86Q 1NTMJ 4EYYQ 4ASWA 4KT0J 4WWIA 1SS1A 2E76D 3TDKA 4JYBA 3VMXA 1LTIC 2ZXXA 2E5TA 3GG2A 3H32A 3RL0B 4IFDK 4XA4A 3TNUA 4JQ0D 3MGNA 2M8RA 4N78E 3NTNA 3SWKA 4AYCA 4DT0A 5KJ7C 2ZYDA 3QH9A 3R4YA 4YXWH 1X22A 2MKVA 1X8YA 3SWYA 4PJ0H 3CPWO 1IFNA 2OYHA 4AUWA 3D71A 3H1LJ 1RF1A 1IZNB 3SSUA 2MJZA 3CWBG 2I1JA 1ZV8A 2L91A 1DD3A 2WITA 3ABVC 4HYTB 5CJ4A 1S2EA 3A7OA 3MUDC 1L4AD 1OZHA 4YPCA 1IJDB 3V2PA 2JEEA 1K8AQ 3VP8A 3F89A 1T2KD 1M1KQ 2HFED 1T3JA 1OIPA 1N73B 3H32B 1LT9C 3CC2P 1MFTA 3S4RA 1PP9D 3L70D 3N4XA 1HH0A 1T3UA 3GHGB 1JB0J 1FAVA 2K1AA 3K5BA 1HVVA 2P2UA 1G2CA 2N1TC 4AQRD 1YITP 2E43A 3H1LG 4L74A 1KC8Q 3CWBJ 1NAFA 4I1LA 3L75G 3CMAP 2G8YA 1VPCA 1OXZA 4RKUJ 1CW5A 4WY4C 3H1IJ 1NU1K 2Z5IA 1USDA 2XU6A 4L73A 4EOTA 3EWKA 1EQ7A 4H44D 3V2NA 2Z4EA 2OYIA 3CCVP 1CI6A 3L71E 1R5LA 3E7KA 3VYIA 5CCGC 2FYUJ 1LTBC 1NTKJ 3OJAB 2W83C 3HRNA 2WSFJ 2Y0DA 2GA1A 4RJTA 1M56D 3AE2C 2H89C 1KILD 3LW5H 3W68A 2Y9ZA 4D6TE 3O6QA 1NU1D 2UWJE 2BCCE 1RE4A 1MFZA 1USEA 5AVWB 2NZ2A 3C1LA 1DEEG 3L73J 1EC5A 5TISE 2C9LY 2NPSC 3TGUD 2B9BA 2XDJA 2ZYGA 1H8AA 1NTZE 3PLNA 1HUCA 4RO0A 2OYHB 3AE3C 3TSIA 1CI6B 1FDIA 1SQXK 4L75A 2R5DA 4RESB 2RKLA 4ZKUA 2QIWA 3V4WA 1BDCA 2C9NY 5CCHD 2WSEJ 2FYNB 2GM4A 1ZOYC 2JJLA 1BDDA 1J1EB 3USSA 1NGMB 3L71G 3H1JG 3CI9A 3L73G 1RF1B 1T6AA 3SFDC 1BCCG 2FYNC 3OA7A 4NPEA 4R4MA 3VN0A 4B86A 1K73Q 5CCHA 1Z56A 2OYHC 2R5BA 3CC7P 1XTCC 1SQVJ 1W5CE 1N73A 4U3FD 3PRJA 5BU8B 1L0LJ 2NRGA 2E42A 2IZ1A 1PGJA 2WQYC 2JWDA 4XE5B 2KSEA 1NHLA 4ZKPA 1FC2C 1RY3A 3L73D 1KILC 2WSCJ 4XFJA 3B5NB 5AW4B 1EDLA 1BGYG 1AVYA 1BE3E 4HB1A 1AJYA 3EFGA 1GW3A 2AXTE 1JTHA 1MKMA 3G6EP 4R4LA 1X79B 1TU3F 3FXDA 2OQQA 4M3LA 1FS0E 1HTLC 1SQPJ 2N9BA 4LC1A 5EFWB 2E76C 2ZVNB 1FE6A 1ZP0C 3H1JE 2K3RA 1RHZB 2FY8A 3O8ZA 1FJKA 1ZRTE 2YNYA 3LW5J 4HH2A 4W7ZA 5C39A 3WU2E 3Q5SA 3H1HD 2YIUC 3CCMP 3L36A 4MN4C 1VQKP 2E74B 1S9KD 1RF0C 3KXDA 3G9RA 1LTJB 1PPJE 2N1TA 1Q82Q 1KILB 1NYHA 2OTKE 2BASA 2QEXP 1VQPP 2FYZA 2HPCB 5APSA 1PFIA 1SQQG 5KAFH 2A06G 2NPSD 3HD7B 1LTTC 3GHGC 5B5EE 2M5AB 3RK2B 5L8RJ 1YI2P 1T2KC 1KQGB 3L70E 1GW4A 1IFMA 2O3JA 3RK3B 1L0NG 3H1HE 1KB9D 1JM0A 2WVRA 3HD7A 1NTZK 3MHVA 1KQSO 1RF1C 1YBKA 2M3EA 5H2FE 1LTJA 1OWAA 5CJ0A 2Y0CA 3B71A 1SQQK 1YJ9P 1SQBK 3KYQA 1BSHA 5CMZA 2CPSA 1KZUB 2O01N 3RK3D 1FZBA 3V5BA 3CWBD 1VL2A 2PAJA 1PPJG 3PTZA 1JY2O 2A06D 3G4SP 1VQ8P 3A2AA 5KLIB 1LGHB 1NTZG 2VRSA 3M0AA 2AEFA 2QJPB 3IF4A 4JBZA 1M90Q 2QJKC 3CMEP 2O01J 2QJYC 2H7HA 1DD4A 2YO2A 1WMKA 2IBZD 3HUSC 4YTPC 1VF5C 1FZCC 1SQBG 3G3ZA 1KB9H 2JKVA 2QSIA 3TK1A 1L0NE 1EZVI 4L76A 3MIWA 2FFDB 2C0XA 3CLQA 4CPGA 1PIXA 1OW6A 4EI2A 4H13D 4C7NB 1E79H 1QVFO 2KNCB 3H1LD 3M91A 1HF9A 1SQQE 1JY3O 1KYOH 3AE6C 1BE3J 1PGPA 2H88C 2W27A 3U1AA 3PJSK 4U3FJ 5CCHC 1PZQA 3H1JJ 3PH0A 2K9YA 2WSFH 1ZRTD 1FZAA 1NOHA 3H1KE 1R8EA 2Q6QA 1NTMG 3H1HG 1N8RQ 2J58A 3D6YA 2N9YB 1URQA 2YKOA 2V7QJ 4PD4E 1NJIQ 1L0LG 2A45I 1U7JA 2IFMA 2W6BA 2YMKA 1SQQD 2P58A 4IOIH 4WB4A 4BRYA 4Y99C 1H0TA 3BCCE 1EDIA 1LT1A 1CZQA 2P67A 4PV1B 4A7PA 1SP4A 1N7SA 3FGAD 1FOSE 2XZRA 2JDIH 1VF5D 2IX7C 2OARA 1CSBA 1NTMK 1VF5B 3LIDA 5AVQB 3A0HE 5KKZB 1RE4C 4TT3H 4UB8E 3CCSP 2FFDC 3RK3C 1YJNP 1L0LD 2Z5HA 4Y28J 5AW0B 5AW9B 1S5LE 1HJBA 5KLIC 4GKGA 1PGQA 1PL5A 3L72J 1Y9BA 2XNXA 3W67A 3RK3E 1HWTC 3MP7B 2SPZA 2QRXA 2Q3IA 1LTAC 1FDOA 4OGQB 2R44A 4OWFA 1BCCD 5KJ7D 3VMAA 3HE4B 3CX5D 1LWUB 2WPVB 1S9KE 1FDMA 1NVOA 1N86A 1JCDA 2P7JA 3B4SA 1EZVG 2KB7P 1S4XA 1ZW0A 4JF7A 4BWNA 1PP9G 3AEFC 3GHGA 4W7YA 1LWUA 1P84E 1GU4A 3I5CA 3CD6P 2Q1KA 1G1IA 4PD4H 3WUVA 2K9JB 1L0NJ 4IL6E 1W2EA 2QM8A 1J1EC 4GOFA 5E79H 4K3AA 2WT7A 1BCCE 2HR3A 1BSNA 1GL2D 3A0BE 2G3AA 2R32A 4N3YB 3Q5RA 2OTJP 1S3JA 1H88A 3Q3DA 5AVRB 1LTJC 1WRGA 1ZN5A 3P8CD 3L72E 1JTHB 2O01H 2YXQB 3AE9C 3KHUA 4I6MC 4KJMA 4PV1C 1SQBD 2FYUE 3MD0A 1SFCC 2FXOA 3HD7C 3RBXA 4C46A 1SQXG 4DOJA 4N6JA 3B5NA 2Q9IA 1VQ4P 5KAIH 1JCCA 2HODB 3KQGA 1L2PA 3KZIE 5AW8B 1M1JA 5AW5B 2P1JA 1J1DB 1LP1B 2W6AA 3VTPC 1W2BO 3JCUE 1EZVE 3L75J 4KHXA 1ZR4A 2ZFCA 1M1JC 3HE5A 3S1KA 3CCQP 3HE4A 4H44B 1URQB 1SQVD 2IBZE 5GTHE 3O6QB 1X9VA 4PJ0E 3RK2D 2W90A 1SFCA 4IL6X 1QL1A 1KFMA 3FWLA 2K88A 1IFPA 2KNCA 4H0LC 4BRYB 3QWOC 1A02F 2FYUD 2ZT9C 1VQ5P 3L70J 1JMMA 1VQNP 2O1KA 2IDBA 1N7SB 4QMAA 5APXA 4ZNCA 1LTGC 1VQMP 4GOEA 1LP1A 3PP5A 4IL6H 4H13C 2C0WA 4N78D 1BE3G 4UB6E 2HYNA 1J1DC 1S1CX 3A0BH 1QEXA 2LXCB 2D2CB 3L72G 4W80A 5AW3B 1SQXE 5KLVK 5AW6B 3GW6A 2FYUG 1N7SD 3T97B 3OAKA 1KB9E 1JY3N 3BCCG 4DJGA 1IC2A 3L35A 1FZEA 4I7ZB 1LJ2A 1RE3C 2LXBA 2KP8A 1IK7A 2O1JA 2PGDA 2YO3A 4D6TG 4YXDC 1U7MA 5AVYB 1WT6A 2PP6A 2QJPC 3KZIH 5DJUB 3IAOA 5KLVG 3B8EB 1P84D 1RQUA 5AW7B 3FXEA 3F5HA 1IFJA 3HUSB 3L74G 2A45G 2FYUK 2A06E 3KPEA 1N73C 2OYIB 1L4AB 1VQ9P 5CBNA 5DJTB 2QG4A 3H1IG 2Q3EA 2WSCH 4NPDA 1S5LX 4PV1D 5BU5A 1DEBA 3CL3D 3H6PA 3WUTA 2FFDA 2CPBA 3L71D 3LIEA 1NWQA 1BCCJ 4DZOA 1Q2NA 2B89A 3MTUE 4NPFX 3AE1C 3GF7A 1BGYJ 2HPCA 4LLHA 3WU2H 1KD1Q 4H13B 2WMMA 1ZXGA 1NAYA 1KORA 1FJPA 3CCJP 1FBMA 2BCCD 2M5AA 1OVRA 2R3SA 2RMZA 2WPSA 1OVUA 3M9QA 1KILE 1EDKA 2B87A 1LWUC 2E5YA 2KLUA 2KUBA 2LKMA 3CX5I 4D6TD 2ZYAA 1DX7A 3SFEC 5AVVB 3NXSA 1SQVE 1LTSC 3CCRP 3H1JD 4GIFA 1A02J 4K35A 4EDFA 5TJHA 4OGQC 4WVZA 1BGYE 2NPSA 4WY4B 3E1RA 2WSSH 3H1IE 3N7NA 1URQC 3GMAA 5M1BA 3BVHA 4OGQD 2V4HA 3U59A 1X0TA 1PGOA 5KKZC 1MV8A 2KZJA 5APUA 2KZIA 3C8VA 3CXHI 1Y8AA 3VP9A 1FZGA 3AEGC 3TGUG 5AVSB 4WY4D 1JOCA 5TISH 3JSVC 1EXJA 2AXTH 2IBZG 3WUUA 1VQ6P 1SQXJ 2BCCJ 1GTWA 2QJYB 2KS1A 1SFCD 1QGKB 3A3YB 1YJWP 1EXIA 4GT1A 2JWAA 2Q7CA 1NTME 3EQ2A 2IYOA 3GLMA 1GD2E 2K9JA 3CC4P 1AQ5A 1NU1E 2ITAA 2OGUA 3II6A 2YKPA 3UIAA 5APWA 3Q1MA 2H8PD 2KYVA 2QJKB 2N1TD 1NO4A 3AE8C 4C7RA 1T8ZA 1AV1A 5GTIH 3D70A 3H1KD 3VOPA 3TYYA 1JO5A 2JP3A 2KIKA 3NFQA 3OW2O 2BEZF 2Y0EA 3AEDC 1FOSF 5CHXA 2CK3H 2JO1A 1J2JB 1NKNA 2ZT9D 4BXLA 5B5EH 1L0LK 2ZT9B 5KJ7A 1NU1J 2D2CC 5KAIE 1Y47A 4GODA 3ZDMA 3TGUE 3RGUA 1M8OB 3JCUH 2WPRA 2IYPA 3CWBE 3ITKA 3PHLA 3IFMA 3M0DC 5APTA 3WMM0 5KTBA 1IO4A 3IR9A 5GTHH 5B66H 1L0ND 1NTKK 2FXMA 2J5UA 2RN0A 3HTKA 1DH3A 3FX0A 2E75D 3Q2YA 2ZJSE 1QVGO 1Q90D 1SQPK 2IFNA 3L74E 4H0LB 1KMIZ 2KK7A 1P84I 2E74C 2PFXA 3E1IA 1NU1G 1Q7YQ 3L75E 1URQD 5AVXB 3AEBC 2HODA 3S9OA 1OVVA 3L73E 1M1JB 4C7NA 3M9BA 1SQBE 1RF0A 2QVAA 2OTLP 1GL2C 1YTZT 2LR2A 1JNMA 1NTKG 1KTMA 1GK4A 1HGZA 3V2QA 1VQOP 1SFCB 3HTKB 2I8DA 4JYCA 1SQPG 2AEJA 5APVA 4PD4D 1U57A 1H89A 2GUSA 1HJ0A 1VDFA 3BRVB 2DW3A 1BE3D 1G2CB 3P7KA 1NKZB 1G1JA 3H1KJ 2KS1B 1Q81Q 3H1HJ 1RQVA 2HLOA 1N2DC 3AEAC 5CCGD 1SQVK 5CBOA 4EIJA 1SQPD 1NTMD 1SQQJ 2OYOA 1SQBJ 1L0LE 1L4AA 2POHA 3M0DA 1KILA 1GMJA 1KB9I 3L72D 2FXPA 4OH8B 3AEEC 1NTKD 1OW7A 2PRRA 3M9HA 3V4QA 1VQ7P 1D7MA 3IN6A 1JUNA 2R3CA 2YMYA 1OMIA 1BGYD 1JMBA 1GZLA 3AECC 4Y99B 5KLVD 1M57D 3D6ZA 3BCCJ 1FZCB 3B5NC 4PD4I 3VMZA 1JY2N 2Q5UA 1SQVG 1LNQA 2YKQA 2KSJA 2M0BA 4D6TJ 3G71P 4U3FG 1SQPE 3BASA 2WZ7A 1SVFA 1N7SC 4TLFA 1PP9J 3TGUJ 2WPQA 3NMDA 2B88A
chains in the Genus database with same CATH topology
1XTGB 3SWFA 1ZR2A 1HBWA 1JY2P 1LT9B 2WTYA 2NPSB 3HD7D 3BRTB 2ZXEB 2A45H 2J59M 2M3BA 3RL0D 5CCGA 2HG5D 2WWWA 2XKMA 1N7LA 3RK2C 3C9IA 5AW2B 1KFNA 4I2LC 2KLVA 3HUSA 1GU5A 2I1KA 2QM7A 4WY4A 3V2RA 1GDTA 1QL2A 1KQLA 1AFOA 1M7LA 4IFMA 1YYCA 1L0NK 1GL2A 2H43A 5AW1B 3M06A 1MUUA 1IFIA 1HGVA 2XV5A 1L4AC 4IFFA 1YTZI 5APQA 3B5ND 4O9BA 1IK9A 3A5TA 3RL0C 3MUDA 3KDPB 2WT7B 4LGDE 1GL2B 2GUVA 4WBAA 1MZ9A 1ZLLA 5AVTB 2OYIC 2N1TB 2FKWB 1GK6A 3BATA 3P8CE 3HE5B 1SLQA 2L5GB 5APYA 3U1CA 1JY3P 1RE3A 2WSEH 3P8MC 5AVZB 3TNUB 2KOGA 2IPPA 3R2PA 3L4FA 1LT9A 3P32A 1FU1A 1NH4A 1FZCA 3L37A 1FZFA 3VMYA 5BVZA 5AVUB 1IFDA 1E5WA 4JYBA 3VMXA 1LTIC 3RL0B 3H32A 4IFDK 4XA4A 3TNUA 5KJ7C 3MGNA 2M8RA 4N78E 3NTNA 4AYCA 3SWYA 1X8YA 1IFNA 2OYHA 4AUWA 1RF1A 2MJZA 2I1JA 1ZV8A 2WITA 4HYTB 5CJ4A 3A7OA 1L4AD 1IJDB 3V2PA 2JEEA 3VP8A 1T2KD 1N73B 2HFED 1T3JA 3H32B 1LT9C 3N4XA 1HH0A 1T3UA 3GHGB 1FAVA 4AQRD 1HVVA 2P2UA 1G2CA 2N1TC 2E43A 1NAFA 4I1LA 1CW5A 1VPCA 1OXZA 4WY4C 1NU1K 2Z5IA 2XU6A 4EOTA 1EQ7A 3V2NA 2Z4EA 2OYIA 1CI6A 3VYIA 5CCGC 1LTBC 3OJAB 3HRNA 1KILD 3LW5H 1RE4A 1MFZA 2C9LY 2NPSC 2XDJA 1H8AA 1HUCA 3TSIA 1CI6B 1SQXK 2R5DA 4RESB 4ZKUA 3V4WA 2C9NY 5CCHD 2GM4A 2JJLA 1J1EB 3CI9A 1RF1B 3OA7A 3VN0A 5CCHA 1Z56A 2R5BA 1XTCC 1N73A 5BU8B 2E42A 4XE5B 1NHLA 4ZKPA 1RY3A 1KILC 5AW4B 3B5NB 3EFGA 1GW3A 1JTHA 1X79B 4M3LA 1HTLC 2N9BA 4LC1A 4B86A 3O8ZA 1FJKA 2YNYA 4HH2A 4W7ZA 3L36A 1S9KD 1RF0C 1LTJB 2N1TA 1KILB 2HPCB 1PFIA 2BASA 2FYZA 5APSA 2WPQA 2NPSD 3HD7B 1LTTC 3GHGC 3RK2B 1T2KC 3RK3B 1GW4A 1IFMA 3HD7A 1NTZK 1RF1C 1LTJA 1OWAA 5CJ0A 1SQQK 1SQBK 3KYQA 5CMZA 2CPSA 1KZUB 3RK3D 1FZBA 3V5BA 2PAJA 1JY2O 3A2AA 1LGHB 2VRSA 3M0AA 2H7HA 2YO2A 1FZCC 3HUSC 3G3ZA 3TK1A 3MIWA 2FFDB 2C0XA 3CLQA 4C7NB 3M91A 1JY3O 2W27A 3U1AA 5CCHC 2WSFH 1FZAA 1NOHA 2J58A 1URQA 2YKOA 2A45I 2IFMA 2W6BA 4WB4A 4Y99C 1CZQA 2P67A 1SP4A 1N7SA 1FOSE 2XZRA 2OARA 2IX7C 3LIDA 5AVQB 1CSBA 1NTMK 1RE4C 2FFDC 3RK3C 5AW0B 5AW9B 1HJBA 4GKGA 2XNXA 1HWTC 2Q3IA 1LTAC 1S9KE 5KJ7D 1FDMA 3HE4B 1LWUB 1N86A 1JCDA 2P7JA 2KB7P 4JF7A 3GHGA 4W7YA 1LWUA 3I5CA 1G1IA 1W2EA 2QM8A 1J1EC 1GL2D 2R32A 4N3YB 1H88A 5AVRB 1LTJC 1WRGA 1ZN5A 3P8CD 4I6MC 1JTHB 2O01H 5AVWB 5BU5A 2OYHC 2WT7A 3MD0A 1SFCC 3HD7C 4C46A 4DOJA 4N6JA 3B5NA 2Q9IA 1JCCA 2HODB 3KQGA 5AW8B 1M1JA 5AW5B 2P1JA 1J1DB 2W6AA 3VTPC 1GU4A 4KHXA 1ZR4A 3HE5A 1M1JC 2ZFCA 3HE4A 1URQB 1X9VA 3RK2D 1SFCA 1QL1A 1KFMA 1A02F 1JMMA 2O1KA 1N7SB 5APXA 1LTGC 4N78D 3PP5A 2C0WA 2HYNA 1J1DC 5KLVK 4W80A 5AW3B 5AW6B 1N7SD 3OAKA 1JY3N 1IC2A 3L35A 1FZEA 1RE3C 2KP8A 2O1JA 2YO3A 5AVYB 1WT6A 2PP6A 3B8EB 5AW7B 3HUSB 1IFJA 2A45G 2FYUK 3KPEA 1N73C 2OYIB 1L4AB 2WSCH 1DEBA 3CL3D 3H6PA 2FFDA 2CPBA 3LIEA 1NWQA 4DZOA 3MTUE 2HPCA 4LLHA 1FJPA 1FBMA 2WPSA 2OYHB 3M9QA 1DX7A 1LWUC 2LKMA 5AVVB 3NXSA 1LTSC 1A02J 4GIFA 2NPSA 4WY4B 3N7NA 1URQC 3BVHA 3U59A 1MV8A 5APUA 1FZGA 3VP9A 5AVSB 4WY4D 1JOCA 1GTWA 1SFCD 3A3YB 4GT1A 2Q7CA 3EQ2A 1GD2E 1AQ5A 3II6A 2YKPA 3UIAA 5APWA 2H8PD 2KYVA 2N1TD 1NO4A 4C7RA 1T8ZA 3VOPA 3TYYA 1JO5A 3NFQA 1FOSF 1J2JB 1NKNA 1L0LK 5KJ7A 2WPRA 3WMM0 5APTA 5KTBA 3IFMA 3M0DC 1IO4A 3IR9A 1NTKK 2FXMA 3HTKA 1DH3A 1SQPK 2IFNA 3E1IA 1URQD 5AVXB 2HODA 1M1JB 4C7NA 3M9BA 1RF0A 1GL2C 1YTZT 1JNMA 1GK4A 1HGZA 3V2QA 1SFCB 3HTKB 4JYCA 5APVA 1H89A 2GUSA 1VDFA 3BRVB 3P7KA 1G2CB 1NKZB 1G1JA 2HLOA 1N2DC 5CCGD 1SQVK 4EIJA 2POHA 1L4AA 3T97A 3M0DA 1KILA 4OH8B 3V4QA 3M9HA 1JUNA 2R3CA 2YMYA 1GZLA 4Y99B 1FZCB 3B5NC 3VMZA 1JY2N 2Q5UA 2YKQA 2KSJA 3BASA 2WZ7A 1SVFA 1N7SC 5CHXA 2Z5HA 3NMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFN A;  2KSJ A;  2IFM A;  4IFM A;  3IFM A;  1ZN5 A;  1PFI A;  1QL2 A;  2XKM A;  2KLV A;  1QL1 A;  2IFN A;  1IFM A; 
#chains in the Genus database with same CATH topology
 3AE4 C;  3Q5P A;  1XTG B;  2E75 C;  1UIX A;  2JR8 A;  2E74 D;  4GDO A;  3SWF A;  1ZR2 A;  1JY2 P;  1KYO I;  5KAF E;  2IBZ I;  1VQL P;  5KLV E;  1HBW A;  1H0T B;  2YIU B;  3AE7 C;  3T97 A;  1LT9 B;  3CCL P;  1R5S A;  2E75 B;  2NPS B;  3HD7 D;  2P10 A;  2AXC A;  3BRT B;  2ZXE B;  3JC2 2;  2WTY A;  1AVO A;  2A45 H;  2J59 M;  3MZW B;  1AA0 A;  2M3B A;  2KI7 B;  1KYO E;  3RL0 D;  2QA4 P;  3L71 J;  5CCG A;  1PP9 E;  2HG5 D;  2WWW A;  4I7Z C;  1YQ4 C;  1QX8 A;  2XKM A;  1N7L A;  1AQT A;  3BCC D;  4OVN F;  2W6J H;  4U7J A;  1K05 A;  3RL0 g;  2FBW C;  3RK2 C;  5H2F H;  3V6I A;  1NTZ J;  2B87 B;  1QLE D;  1YIJ P;  3C9I A;  5AW2 B;  1KFN A;  1K9M Q;  4H0L D;  1KV4 A;  3GF3 A;  4I2L C;  4JPZ B;  3CCU P;  2KLV A;  4U3F E;  1OW8 A;  1K04 A;  3HUS A;  3H1L E;  5K5G B;  1GU5 A;  2BEQ D;  1OFC X;  2I1K A;  1P84 H;  2QM7 A;  4WY4 A;  3V2R A;  1DIP A;  1RH5 B;  2D2C D;  1GDT A;  1KYO D;  1QL2 A;  3I56 P;  1KQL A;  1AFO A;  1M7L A;  4IFM A;  1YYC A;  1S72 P;  3CXH E;  1L0N K;  2E76 B;  3H1K G;  3H1I D;  5GTI E;  1GL2 A;  1YHQ P;  3L70 G;  2AEM A;  3CCE P;  3CX5 E;  1KQF B;  2H43 A;  3A0H H;  3M06 A;  3L74 D;  5AW1 B;  1MUU A;  1IFI A;  1JEK A;  1OX3 A;  3L75 D;  1HGV A;  1S5L H;  2XV5 A;  1NTZ D;  1L4A C;  3RBZ A;  4IFF A;  1YTZ I;  1NTK E;  3B5N D;  3EFF K;  4O9B A;  5APQ A;  3TF5 A;  1IK9 A;  3A5T A;  1SQX D;  3RL0 C;  2BCC G;  1PPJ D;  3KDP B;  3MUD A;  2QE7 H;  3CXH D;  2WT7 B;  4HKZ H;  4LGD E;  4ASV A;  5B66 E;  1GL2 B;  2GUV A;  2W8Z A;  3CX5 H;  4WBA A;  4Z1M H;  1MZ9 A;  1ZLL A;  2IZ0 A;  5AVT B;  2OYI C;  1ZME C;  2N1T B;  2RH0 A;  1PV3 A;  2ZAE B;  1YQ3 C;  2FKW B;  1GK6 A;  2K37 A;  1EDJ A;  3BAT A;  2V7Q H;  3HE5 B;  3P8C E;  3I55 P;  1KN7 A;  4H44 C;  3AE5 C;  1SLQ A;  2L5G B;  5APY A;  3U1C A;  3L74 J;  1JY3 P;  1RE3 A;  2WSE H;  1UII A;  3P8M C;  5AVZ B;  5E79 E;  3TNU B;  4UB6 H;  2ZVO B;  2KOG A;  4ZMD A;  2IPP A;  3R2P A;  3L4F A;  1EZV D;  2KXP B;  1LT9 A;  3CXH H;  3P32 A;  3H25 A;  1FU1 A;  2XND H;  1NH4 A;  2Y9Y A;  1FZC A;  2YXR B;  5KLV J;  3L37 A;  1FZF A;  3VMY A;  5BVZ A;  5AVU B;  1IFD A;  3FWN A;  1E5W A;  4DCK A;  4HJG H;  4UB8 H;  1Q86 Q;  1NTM J;  4EYY Q;  4ASW A;  4KT0 J;  4WWI A;  1SS1 A;  2E76 D;  3TDK A;  4JYB A;  3VMX A;  1LTI C;  2ZXX A;  2E5T A;  3GG2 A;  3H32 A;  3RL0 B;  4IFD K;  4XA4 A;  3TNU A;  4JQ0 D;  3MGN A;  2M8R A;  4N78 E;  3NTN A;  3SWK A;  4AYC A;  4DT0 A;  5KJ7 C;  2ZYD A;  3QH9 A;  3R4Y A;  4YXW H;  1X22 A;  2MKV A;  1X8Y A;  3SWY A;  4PJ0 H;  3CPW O;  1IFN A;  2OYH A;  4AUW A;  3D71 A;  3H1L J;  1RF1 A;  1IZN B;  3SSU A;  2MJZ A;  3CWB G;  2I1J A;  1ZV8 A;  2L91 A;  1DD3 A;  2WIT A;  3ABV C;  4HYT B;  5CJ4 A;  1S2E A;  3A7O A;  3MUD C;  1L4A D;  1OZH A;  4YPC A;  1IJD B;  3V2P A;  2JEE A;  1K8A Q;  3VP8 A;  3F89 A;  1T2K D;  1M1K Q;  2HFE D;  1T3J A;  1OIP A;  1N73 B;  3H32 B;  1LT9 C;  3CC2 P;  1MFT A;  3S4R A;  1PP9 D;  3L70 D;  3N4X A;  1HH0 A;  1T3U A;  3GHG B;  1JB0 J;  1FAV A;  2K1A A;  3K5B A;  1HVV A;  2P2U A;  1G2C A;  2N1T C;  4AQR D;  1YIT P;  2E43 A;  3H1L G;  4L74 A;  1KC8 Q;  3CWB J;  1NAF A;  4I1L A;  3L75 G;  3CMA P;  2G8Y A;  1VPC A;  1OXZ A;  4RKU J;  1CW5 A;  4WY4 C;  3H1I J;  1NU1 K;  2Z5I A;  1USD A;  2XU6 A;  4L73 A;  4EOT A;  3EWK A;  1EQ7 A;  4H44 D;  3V2N A;  2Z4E A;  2OYI A;  3CCV P;  1CI6 A;  3L71 E;  1R5L A;  3E7K A;  3VYI A;  5CCG C;  2FYU J;  1LTB C;  1NTK J;  3OJA B;  2W83 C;  3HRN A;  2WSF J;  2Y0D A;  2GA1 A;  4RJT A;  1M56 D;  3AE2 C;  2H89 C;  1KIL D;  3LW5 H;  3W68 A;  2Y9Z A;  4D6T E;  3O6Q A;  1NU1 D;  2UWJ E;  2BCC E;  1RE4 A;  1MFZ A;  1USE A;  5AVW B;  2NZ2 A;  3C1L A;  1DEE G;  3L73 J;  1EC5 A;  5TIS E;  2C9L Y;  2NPS C;  3TGU D;  2B9B A;  2XDJ A;  2ZYG A;  1H8A A;  1NTZ E;  3PLN A;  1HUC A;  4RO0 A;  2OYH B;  3AE3 C;  3TSI A;  1CI6 B;  1FDI A;  1SQX K;  4L75 A;  2R5D A;  4RES B;  2RKL A;  4ZKU A;  2QIW A;  3V4W A;  1BDC A;  2C9N Y;  5CCH D;  2WSE J;  2FYN B;  2GM4 A;  1ZOY C;  2JJL A;  1BDD A;  1J1E B;  3USS A;  1NGM B;  3L71 G;  3H1J G;  3CI9 A;  3L73 G;  1RF1 B;  1T6A A;  3SFD C;  1BCC G;  2FYN C;  3OA7 A;  4NPE A;  4R4M A;  3VN0 A;  4B86 A;  1K73 Q;  5CCH A;  1Z56 A;  2OYH C;  2R5B A;  3CC7 P;  1XTC C;  1SQV J;  1W5C E;  1N73 A;  4U3F D;  3PRJ A;  5BU8 B;  1L0L J;  2NRG A;  2E42 A;  2IZ1 A;  1PGJ A;  2WQY C;  2JWD A;  4XE5 B;  2KSE A;  1NHL A;  4ZKP A;  1FC2 C;  1RY3 A;  3L73 D;  1KIL C;  2WSC J;  4XFJ A;  3B5N B;  5AW4 B;  1EDL A;  1BGY G;  1AVY A;  1BE3 E;  4HB1 A;  1AJY A;  3EFG A;  1GW3 A;  2AXT E;  1JTH A;  1MKM A;  3G6E P;  4R4L A;  1X79 B;  1TU3 F;  3FXD A;  2OQQ A;  4M3L A;  1FS0 E;  1HTL C;  1SQP J;  2N9B A;  4LC1 A;  5EFW B;  2E76 C;  2ZVN B;  1FE6 A;  1ZP0 C;  3H1J E;  2K3R A;  1RHZ B;  2FY8 A;  3O8Z A;  1FJK A;  1ZRT E;  2YNY A;  3LW5 J;  4HH2 A;  4W7Z A;  5C39 A;  3WU2 E;  3Q5S A;  3H1H D;  2YIU C;  3CCM P;  3L36 A;  4MN4 C;  1VQK P;  2E74 B;  1S9K D;  1RF0 C;  3KXD A;  3G9R A;  1LTJ B;  1PPJ E;  2N1T A;  1Q82 Q;  1KIL B;  1NYH A;  2OTK E;  2BAS A;  2QEX P;  1VQP P;  2FYZ A;  2HPC B;  5APS A;  1PFI A;  1SQQ G;  5KAF H;  2A06 G;  2NPS D;  3HD7 B;  1LTT C;  3GHG C;  5B5E E;  2M5A B;  3RK2 B;  5L8R J;  1YI2 P;  1T2K C;  1KQG B;  3L70 E;  1GW4 A;  1IFM A;  2O3J A;  3RK3 B;  1L0N G;  3H1H E;  1KB9 D;  1JM0 A;  2WVR A;  3HD7 A;  1NTZ K;  3MHV A;  1KQS O;  1RF1 C;  1YBK A;  2M3E A;  5H2F E;  1LTJ A;  1OWA A;  5CJ0 A;  2Y0C A;  3B71 A;  1SQQ K;  1YJ9 P;  1SQB K;  3KYQ A;  1BSH A;  5CMZ A;  2CPS A;  1KZU B;  2O01 N;  3RK3 D;  1FZB A;  3V5B A;  3CWB D;  1VL2 A;  2PAJ A;  1PPJ G;  3PTZ A;  1JY2 O;  2A06 D;  3G4S P;  1VQ8 P;  3A2A A;  5KLI B;  1LGH B;  1NTZ G;  2VRS A;  3M0A A;  2AEF A;  2QJP B;  3IF4 A;  4JBZ A;  1M90 Q;  2QJK C;  3CME P;  2O01 J;  2QJY C;  2H7H A;  1DD4 A;  2YO2 A;  1WMK A;  2IBZ D;  3HUS C;  4YTP C;  1VF5 C;  1FZC C;  1SQB G;  3G3Z A;  1KB9 H;  2JKV A;  2QSI A;  3TK1 A;  1L0N E;  1EZV I;  4L76 A;  3MIW A;  2FFD B;  2C0X A;  3CLQ A;  4CPG A;  1PIX A;  1OW6 A;  4EI2 A;  4H13 D;  4C7N B;  1E79 H;  1QVF O;  2KNC B;  3H1L D;  3M91 A;  1HF9 A;  1SQQ E;  1JY3 O;  1KYO H;  3AE6 C;  1BE3 J;  1PGP A;  2H88 C;  2W27 A;  3U1A A;  3PJS K;  4U3F J;  5CCH C;  1PZQ A;  3H1J J;  3PH0 A;  2K9Y A;  2WSF H;  1ZRT D;  1FZA A;  1NOH A;  3H1K E;  1R8E A;  2Q6Q A;  1NTM G;  3H1H G;  1N8R Q;  2J58 A;  3D6Y A;  2N9Y B;  1URQ A;  2YKO A;  2V7Q J;  4PD4 E;  1NJI Q;  1L0L G;  2A45 I;  1U7J A;  2IFM A;  2W6B A;  2YMK A;  1SQQ D;  2P58 A;  4IOI H;  4WB4 A;  4BRY A;  4Y99 C;  1H0T A;  3BCC E;  1EDI A;  1LT1 A;  1CZQ A;  2P67 A;  4PV1 B;  4A7P A;  1SP4 A;  1N7S A;  3FGA D;  1FOS E;  2XZR A;  2JDI H;  1VF5 D;  2IX7 C;  2OAR A;  1CSB A;  1NTM K;  1VF5 B;  3LID A;  5AVQ B;  3A0H E;  5KKZ B;  1RE4 C;  4TT3 H;  4UB8 E;  3CCS P;  2FFD C;  3RK3 C;  1YJN P;  1L0L D;  2Z5H A;  4Y28 J;  5AW0 B;  5AW9 B;  1S5L E;  1HJB A;  5KLI C;  4GKG A;  1PGQ A;  1PL5 A;  3L72 J;  1Y9B A;  2XNX A;  3W67 A;  3RK3 E;  1HWT C;  3MP7 B;  2SPZ A;  2QRX A;  2Q3I A;  1LTA C;  1FDO A;  4OGQ B;  2R44 A;  4OWF A;  1BCC D;  5KJ7 D;  3VMA A;  3HE4 B;  3CX5 D;  1LWU B;  2WPV B;  1S9K E;  1FDM A;  1NVO A;  1N86 A;  1JCD A;  2P7J A;  3B4S A;  1EZV G;  2KB7 P;  1S4X A;  1ZW0 A;  4JF7 A;  4BWN A;  1PP9 G;  3AEF C;  3GHG A;  4W7Y A;  1LWU A;  1P84 E;  1GU4 A;  3I5C A;  3CD6 P;  2Q1K A;  1G1I A;  4PD4 H;  3WUV A;  2K9J B;  1L0N J;  4IL6 E;  1W2E A;  2QM8 A;  1J1E C;  4GOF A;  5E79 H;  4K3A A;  2WT7 A;  1BCC E;  2HR3 A;  1BSN A;  1GL2 D;  3A0B E;  2G3A A;  2R32 A;  4N3Y B;  3Q5R A;  2OTJ P;  1S3J A;  1H88 A;  3Q3D A;  5AVR B;  1LTJ C;  1WRG A;  1ZN5 A;  3P8C D;  3L72 E;  1JTH B;  2O01 H;  2YXQ B;  3AE9 C;  3KHU A;  4I6M C;  4KJM A;  4PV1 C;  1SQB D;  2FYU E;  3MD0 A;  1SFC C;  2FXO A;  3HD7 C;  3RBX A;  4C46 A;  1SQX G;  4DOJ A;  4N6J A;  3B5N A;  2Q9I A;  1VQ4 P;  5KAI H;  1JCC A;  2HOD B;  3KQG A;  1L2P A;  3KZI E;  5AW8 B;  1M1J A;  5AW5 B;  2P1J A;  1J1D B;  1LP1 B;  2W6A A;  3VTP C;  1W2B O;  3JCU E;  1EZV E;  3L75 J;  4KHX A;  1ZR4 A;  2ZFC A;  1M1J C;  3HE5 A;  3S1K A;  3CCQ P;  3HE4 A;  4H44 B;  1URQ B;  1SQV D;  2IBZ E;  5GTH E;  3O6Q B;  1X9V A;  4PJ0 E;  3RK2 D;  2W90 A;  1SFC A;  4IL6 X;  1QL1 A;  1KFM A;  3FWL A;  2K88 A;  1IFP A;  2KNC A;  4H0L C;  4BRY B;  3QWO C;  1A02 F;  2FYU D;  2ZT9 C;  1VQ5 P;  3L70 J;  1JMM A;  1VQN P;  2O1K A;  2IDB A;  1N7S B;  4QMA A;  5APX A;  4ZNC A;  1LTG C;  1VQM P;  4GOE A;  1LP1 A;  3PP5 A;  4IL6 H;  4H13 C;  2C0W A;  4N78 D;  1BE3 G;  4UB6 E;  2HYN A;  1J1D C;  1S1C X;  3A0B H;  1QEX A;  2LXC B;  2D2C B;  3L72 G;  4W80 A;  5AW3 B;  1SQX E;  5KLV K;  5AW6 B;  3GW6 A;  2FYU G;  1N7S D;  3T97 B;  3OAK A;  1KB9 E;  1JY3 N;  3BCC G;  4DJG A;  1IC2 A;  3L35 A;  1FZE A;  4I7Z B;  1LJ2 A;  1RE3 C;  2LXB A;  2KP8 A;  1IK7 A;  2O1J A;  2PGD A;  2YO3 A;  4D6T G;  4YXD C;  1U7M A;  5AVY B;  1WT6 A;  2PP6 A;  2QJP C;  3KZI H;  5DJU B;  3IAO A;  5KLV G;  3B8E B;  1P84 D;  1RQU A;  5AW7 B;  3FXE A;  3F5H A;  1IFJ A;  3HUS B;  3L74 G;  2A45 G;  2FYU K;  2A06 E;  3KPE A;  1N73 C;  2OYI B;  1L4A B;  1VQ9 P;  5CBN A;  5DJT B;  2QG4 A;  3H1I G;  2Q3E A;  2WSC H;  4NPD A;  1S5L X;  4PV1 D;  5BU5 A;  1DEB A;  3CL3 D;  3H6P A;  3WUT A;  2FFD A;  2CPB A;  3L71 D;  3LIE A;  1NWQ A;  1BCC J;  4DZO A;  1Q2N A;  2B89 A;  3MTU E;  4NPF X;  3AE1 C;  3GF7 A;  1BGY J;  2HPC A;  4LLH A;  3WU2 H;  1KD1 Q;  4H13 B;  2WMM A;  1ZXG A;  1NAY A;  1KOR A;  1FJP A;  3CCJ P;  1FBM A;  2BCC D;  2M5A A;  1OVR A;  2R3S A;  2RMZ A;  2WPS A;  1OVU A;  3M9Q A;  1KIL E;  1EDK A;  2B87 A;  1LWU C;  2E5Y A;  2KLU A;  2KUB A;  2LKM A;  3CX5 I;  4D6T D;  2ZYA A;  1DX7 A;  3SFE C;  5AVV B;  3NXS A;  1SQV E;  1LTS C;  3CCR P;  3H1J D;  4GIF A;  1A02 J;  4K35 A;  4EDF A;  5TJH A;  4OGQ C;  4WVZ A;  1BGY E;  2NPS A;  4WY4 B;  3E1R A;  2WSS H;  3H1I E;  3N7N A;  1URQ C;  3GMA A;  5M1B A;  3BVH A;  4OGQ D;  2V4H A;  3U59 A;  1X0T A;  1PGO A;  5KKZ C;  1MV8 A;  2KZJ A;  5APU A;  2KZI A;  3C8V A;  3CXH I;  1Y8A A;  3VP9 A;  1FZG A;  3AEG C;  3TGU G;  5AVS B;  4WY4 D;  1JOC A;  5TIS H;  3JSV C;  1EXJ A;  2AXT H;  2IBZ G;  3WUU A;  1VQ6 P;  1SQX J;  2BCC J;  1GTW A;  2QJY B;  2KS1 A;  1SFC D;  1QGK B;  3A3Y B;  1YJW P;  1EXI A;  4GT1 A;  2JWA A;  2Q7C A;  1NTM E;  3EQ2 A;  2IYO A;  3GLM A;  1GD2 E;  2K9J A;  3CC4 P;  1AQ5 A;  1NU1 E;  2ITA A;  2OGU A;  3II6 A;  2YKP A;  3UIA A;  5APW A;  3Q1M A;  2H8P D;  2KYV A;  2QJK B;  2N1T D;  1NO4 A;  3AE8 C;  4C7R A;  1T8Z A;  1AV1 A;  5GTI H;  3D70 A;  3H1K D;  3VOP A;  3TYY A;  1JO5 A;  2JP3 A;  2KIK A;  3NFQ A;  3OW2 O;  2BEZ F;  2Y0E A;  3AED C;  1FOS F;  5CHX A;  2CK3 H;  2JO1 A;  1J2J B;  1NKN A;  2ZT9 D;  4BXL A;  5B5E H;  1L0L K;  2ZT9 B;  5KJ7 A;  1NU1 J;  2D2C C;  5KAI E;  1Y47 A;  4GOD A;  3ZDM A;  3TGU E;  3RGU A;  1M8O B;  3JCU H;  2WPR A;  2IYP A;  3CWB E;  3ITK A;  3PHL A;  3IFM A;  3M0D C;  5APT A;  3WMM 0;  5KTB A;  1IO4 A;  3IR9 A;  5GTH H;  5B66 H;  1L0N D;  1NTK K;  2FXM A;  2J5U A;  2RN0 A;  3HTK A;  1DH3 A;  3FX0 A;  2E75 D;  3Q2Y A;  2ZJS E;  1QVG O;  1Q90 D;  1SQP K;  2IFN A;  3L74 E;  4H0L B;  1KMI Z;  2KK7 A;  1P84 I;  2E74 C;  2PFX A;  3E1I A;  1NU1 G;  1Q7Y Q;  3L75 E;  1URQ D;  5AVX B;  3AEB C;  2HOD A;  3S9O A;  1OVV A;  3L73 E;  1M1J B;  4C7N A;  3M9B A;  1SQB E;  1RF0 A;  2QVA A;  2OTL P;  1GL2 C;  1YTZ T;  2LR2 A;  1JNM A;  1NTK G;  1KTM A;  1GK4 A;  1HGZ A;  3V2Q A;  1VQO P;  1SFC B;  3HTK B;  2I8D A;  4JYC A;  1SQP G;  2AEJ A;  5APV A;  4PD4 D;  1U57 A;  1H89 A;  2GUS A;  1HJ0 A;  1VDF A;  3BRV B;  2DW3 A;  1BE3 D;  1G2C B;  3P7K A;  1NKZ B;  1G1J A;  3H1K J;  2KS1 B;  1Q81 Q;  3H1H J;  1RQV A;  2HLO A;  1N2D C;  3AEA C;  5CCG D;  1SQV K;  5CBO A;  4EIJ A;  1SQP D;  1NTM D;  1SQQ J;  2OYO A;  1SQB J;  1L0L E;  1L4A A;  2POH A;  3M0D A;  1KIL A;  1GMJ A;  1KB9 I;  3L72 D;  2FXP A;  4OH8 B;  3AEE C;  1NTK D;  1OW7 A;  2PRR A;  3M9H A;  3V4Q A;  1VQ7 P;  1D7M A;  3IN6 A;  1JUN A;  2R3C A;  2YMY A;  1OMI A;  1BGY D;  1JMB A;  1GZL A;  3AEC C;  4Y99 B;  5KLV D;  1M57 D;  3D6Z A;  3BCC J;  1FZC B;  3B5N C;  4PD4 I;  3VMZ A;  1JY2 N;  2Q5U A;  1SQV G;  1LNQ A;  2YKQ A;  2KSJ A;  2M0B A;  4D6T J;  3G71 P;  4U3F G;  1SQP E;  3BAS A;  2WZ7 A;  1SVF A;  1N7S C;  4TLF A;  1PP9 J;  3TGU J;  2WPQ A;  3NMD A;  2B88 A; 
#chains in the Genus database with same CATH homology
 1XTG B;  3SWF A;  1ZR2 A;  1HBW A;  1JY2 P;  1LT9 B;  2WTY A;  2NPS B;  3HD7 D;  3BRT B;  2ZXE B;  2A45 H;  2J59 M;  2M3B A;  3RL0 D;  5CCG A;  2HG5 D;  2WWW A;  2XKM A;  1N7L A;  3RK2 C;  3C9I A;  5AW2 B;  1KFN A;  4I2L C;  2KLV A;  3HUS A;  1GU5 A;  2I1K A;  2QM7 A;  4WY4 A;  3V2R A;  1GDT A;  1QL2 A;  1KQL A;  1AFO A;  1M7L A;  4IFM A;  1YYC A;  1L0N K;  1GL2 A;  2H43 A;  5AW1 B;  3M06 A;  1MUU A;  1IFI A;  1HGV A;  2XV5 A;  1L4A C;  4IFF A;  1YTZ I;  5APQ A;  3B5N D;  4O9B A;  1IK9 A;  3A5T A;  3RL0 C;  3MUD A;  3KDP B;  2WT7 B;  4LGD E;  1GL2 B;  2GUV A;  4WBA A;  1MZ9 A;  1ZLL A;  5AVT B;  2OYI C;  2N1T B;  2FKW B;  1GK6 A;  3BAT A;  3P8C E;  3HE5 B;  1SLQ A;  2L5G B;  5APY A;  3U1C A;  1JY3 P;  1RE3 A;  2WSE H;  3P8M C;  5AVZ B;  3TNU B;  2KOG A;  2IPP A;  3R2P A;  3L4F A;  1LT9 A;  3P32 A;  1FU1 A;  1NH4 A;  1FZC A;  3L37 A;  1FZF A;  3VMY A;  5BVZ A;  5AVU B;  1IFD A;  1E5W A;  4JYB A;  3VMX A;  1LTI C;  3RL0 B;  3H32 A;  4IFD K;  4XA4 A;  3TNU A;  5KJ7 C;  3MGN A;  2M8R A;  4N78 E;  3NTN A;  4AYC A;  3SWY A;  1X8Y A;  1IFN A;  2OYH A;  4AUW A;  1RF1 A;  2MJZ A;  2I1J A;  1ZV8 A;  2WIT A;  4HYT B;  5CJ4 A;  3A7O A;  1L4A D;  1IJD B;  3V2P A;  2JEE A;  3VP8 A;  1T2K D;  1N73 B;  2HFE D;  1T3J A;  3H32 B;  1LT9 C;  3N4X A;  1HH0 A;  1T3U A;  3GHG B;  1FAV A;  4AQR D;  1HVV A;  2P2U A;  1G2C A;  2N1T C;  2E43 A;  1NAF A;  4I1L A;  1CW5 A;  1VPC A;  1OXZ A;  4WY4 C;  1NU1 K;  2Z5I A;  2XU6 A;  4EOT A;  1EQ7 A;  3V2N A;  2Z4E A;  2OYI A;  1CI6 A;  3VYI A;  5CCG C;  1LTB C;  3OJA B;  3HRN A;  1KIL D;  3LW5 H;  1RE4 A;  1MFZ A;  2C9L Y;  2NPS C;  2XDJ A;  1H8A A;  1HUC A;  3TSI A;  1CI6 B;  1SQX K;  2R5D A;  4RES B;  4ZKU A;  3V4W A;  2C9N Y;  5CCH D;  2GM4 A;  2JJL A;  1J1E B;  3CI9 A;  1RF1 B;  3OA7 A;  3VN0 A;  5CCH A;  1Z56 A;  2R5B A;  1XTC C;  1N73 A;  5BU8 B;  2E42 A;  4XE5 B;  1NHL A;  4ZKP A;  1RY3 A;  1KIL C;  5AW4 B;  3B5N B;  3EFG A;  1GW3 A;  1JTH A;  1X79 B;  4M3L A;  1HTL C;  2N9B A;  4LC1 A;  4B86 A;  3O8Z A;  1FJK A;  2YNY A;  4HH2 A;  4W7Z A;  3L36 A;  1S9K D;  1RF0 C;  1LTJ B;  2N1T A;  1KIL B;  2HPC B;  1PFI A;  2BAS A;  2FYZ A;  5APS A;  2WPQ A;  2NPS D;  3HD7 B;  1LTT C;  3GHG C;  3RK2 B;  1T2K C;  3RK3 B;  1GW4 A;  1IFM A;  3HD7 A;  1NTZ K;  1RF1 C;  1LTJ A;  1OWA A;  5CJ0 A;  1SQQ K;  1SQB K;  3KYQ A;  5CMZ A;  2CPS A;  1KZU B;  3RK3 D;  1FZB A;  3V5B A;  2PAJ A;  1JY2 O;  3A2A A;  1LGH B;  2VRS A;  3M0A A;  2H7H A;  2YO2 A;  1FZC C;  3HUS C;  3G3Z A;  3TK1 A;  3MIW A;  2FFD B;  2C0X A;  3CLQ A;  4C7N B;  3M91 A;  1JY3 O;  2W27 A;  3U1A A;  5CCH C;  2WSF H;  1FZA A;  1NOH A;  2J58 A;  1URQ A;  2YKO A;  2A45 I;  2IFM A;  2W6B A;  4WB4 A;  4Y99 C;  1CZQ A;  2P67 A;  1SP4 A;  1N7S A;  1FOS E;  2XZR A;  2OAR A;  2IX7 C;  3LID A;  5AVQ B;  1CSB A;  1NTM K;  1RE4 C;  2FFD C;  3RK3 C;  5AW0 B;  5AW9 B;  1HJB A;  4GKG A;  2XNX A;  1HWT C;  2Q3I A;  1LTA C;  1S9K E;  5KJ7 D;  1FDM A;  3HE4 B;  1LWU B;  1N86 A;  1JCD A;  2P7J A;  2KB7 P;  4JF7 A;  3GHG A;  4W7Y A;  1LWU A;  3I5C A;  1G1I A;  1W2E A;  2QM8 A;  1J1E C;  1GL2 D;  2R32 A;  4N3Y B;  1H88 A;  5AVR B;  1LTJ C;  1WRG A;  1ZN5 A;  3P8C D;  4I6M C;  1JTH B;  2O01 H;  5AVW B;  5BU5 A;  2OYH C;  2WT7 A;  3MD0 A;  1SFC C;  3HD7 C;  4C46 A;  4DOJ A;  4N6J A;  3B5N A;  2Q9I A;  1JCC A;  2HOD B;  3KQG A;  5AW8 B;  1M1J A;  5AW5 B;  2P1J A;  1J1D B;  2W6A A;  3VTP C;  1GU4 A;  4KHX A;  1ZR4 A;  3HE5 A;  1M1J C;  2ZFC A;  3HE4 A;  1URQ B;  1X9V A;  3RK2 D;  1SFC A;  1QL1 A;  1KFM A;  1A02 F;  1JMM A;  2O1K A;  1N7S B;  5APX A;  1LTG C;  4N78 D;  3PP5 A;  2C0W A;  2HYN A;  1J1D C;  5KLV K;  4W80 A;  5AW3 B;  5AW6 B;  1N7S D;  3OAK A;  1JY3 N;  1IC2 A;  3L35 A;  1FZE A;  1RE3 C;  2KP8 A;  2O1J A;  2YO3 A;  5AVY B;  1WT6 A;  2PP6 A;  3B8E B;  5AW7 B;  3HUS B;  1IFJ A;  2A45 G;  2FYU K;  3KPE A;  1N73 C;  2OYI B;  1L4A B;  2WSC H;  1DEB A;  3CL3 D;  3H6P A;  2FFD A;  2CPB A;  3LIE A;  1NWQ A;  4DZO A;  3MTU E;  2HPC A;  4LLH A;  1FJP A;  1FBM A;  2WPS A;  2OYH B;  3M9Q A;  1DX7 A;  1LWU C;  2LKM A;  5AVV B;  3NXS A;  1LTS C;  1A02 J;  4GIF A;  2NPS A;  4WY4 B;  3N7N A;  1URQ C;  3BVH A;  3U59 A;  1MV8 A;  5APU A;  1FZG A;  3VP9 A;  5AVS B;  4WY4 D;  1JOC A;  1GTW A;  1SFC D;  3A3Y B;  4GT1 A;  2Q7C A;  3EQ2 A;  1GD2 E;  1AQ5 A;  3II6 A;  2YKP A;  3UIA A;  5APW A;  2H8P D;  2KYV A;  2N1T D;  1NO4 A;  4C7R A;  1T8Z A;  3VOP A;  3TYY A;  1JO5 A;  3NFQ A;  1FOS F;  1J2J B;  1NKN A;  1L0L K;  5KJ7 A;  2WPR A;  3WMM 0;  5APT A;  5KTB A;  3IFM A;  3M0D C;  1IO4 A;  3IR9 A;  1NTK K;  2FXM A;  3HTK A;  1DH3 A;  1SQP K;  2IFN A;  3E1I A;  1URQ D;  5AVX B;  2HOD A;  1M1J B;  4C7N A;  3M9B A;  1RF0 A;  1GL2 C;  1YTZ T;  1JNM A;  1GK4 A;  1HGZ A;  3V2Q A;  1SFC B;  3HTK B;  4JYC A;  5APV A;  1H89 A;  2GUS A;  1VDF A;  3BRV B;  3P7K A;  1G2C B;  1NKZ B;  1G1J A;  2HLO A;  1N2D C;  5CCG D;  1SQV K;  4EIJ A;  2POH A;  1L4A A;  3T97 A;  3M0D A;  1KIL A;  4OH8 B;  3V4Q A;  3M9H A;  1JUN A;  2R3C A;  2YMY A;  1GZL A;  4Y99 B;  1FZC B;  3B5N C;  3VMZ A;  1JY2 N;  2Q5U A;  2YKQ A;  2KSJ A;  3BAS A;  2WZ7 A;  1SVF A;  1N7S C;  5CHX A;  2Z5H A;  3NMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...