3KZIE

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
b'RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3kziE00
5GTHE 3JCUE 5GTIE 2AXTE 5KAFE 1W5CE 4IL6E 5B66E 3KZIE 3A0BE 5KAIE 5E79E 5TISE 1S5LE 3WU2E 4UB8E 4UB6E 3A0HE 4PJ0E 5H2FE 5B5EE
chains in the Genus database with same CATH superfamily
3KHUA 1L0LG 1NGMB 4ZKUA 2Q7CA 3RGUA 1RQVA 3AECC 3L74D 3L75D 3CXHH 1IFIA 3GW6A 3NFQA 1EQ7A 2FYUJ 1NAFA 3PRJA 3VMYA 2PGDA 1SQXE 2H88C 1VDFA 1DIPA 1Y8AA 2HR3A 1AQ5A 3GHGB 1HWTC 1DH3A 4BRYA 3EFFK 1AV1A 5KLIB 4WVZA 1U57A 3QWOC 2K9JA 2QA4P 5B66E 1LP1B 3B71A 1QVGO 2CPBA 3SFEC 1NTKG 3WU2E 2YXRB 3MUDC 4C7NA 5KJ7C 1FBMA 1VQ7P 3BVHA 1NTMD 3NTNA 1NKZB 3H25A 3H1HE 3VP9A 4IFMA 2IBZG 3BCCG 3AEEC 1HGVA 4D6TD 3EFGA 2ZXEB 1LTBC 1LT1A 3V2QA 3ITKA 1RF0A 2POHA 1BGYD 1FAVA 4ASVA 1RY3A 1BE3G 2E74C 1BCCD 2M5AB 1L2PA 1NTMK 2J58A 2IFNA 2KIKA 3AE6C 1OZHA 1RE4C 2GA1A 1IK7A 3CCSP 3L71J 1HF9A 5TISE 4OGQB 5APQA 3MD0A 3C9IA 2W6JH 1PPJG 2JO1A 1SVFA 1FU1A 3V2RA 5KJ7D 4EDFA 3R4YA 5KAIE 5AW0B 3CMAP 3PP5A 1W2BO 1EDLA 2KXPB 2IFMA 4PD4H 3I55P 3RL0g 2YXQB 2KYVA 1L0NE 3L70J 1M1JC 1T8ZA 2ZJSE 2K3RA 2XZRA 2YKPA 2CK3H 3E1IA 2J5UA 3H1KJ 2RKLA 5APVA 1YJ9P 1IC2A 3GMAA 3JC22 2E74D 1JY3O 4H0LC 4OGQC 1H0TA 4LC1A 4UB6E 1PGPA 1RF1B 3CWBD 3HTKA 1AVYA 3I5CA 2FKWB 3BRTB 3RL0B 2GUVA 3KQGA 4YXWH 1Q2NA 3G6EP 3L73J 2M8RA 1KQLA 1S72P 1PIXA 1SFCB 3L72J 4JQ0D 2H8PD 3TF5A 1OVRA 1JO5A 5AVYB 2W27A 4OVNF 3A2AA 3TGUG 3H1LE 2XDJA 2FYUG 3PLNA 3H1JE 4GOEA 2M0BA 4H44B 1L4AB 1K8AQ 4KHXA 1SQQG 2BCCD 1URQB 4H0LD 3VYIA 4OGQD 3V6IA 5CCGC 1LTGC 3CC7P 1SQPG 1YJWP 3FX0A 2JEEA 4IFFA 1NTZE 1J1DC 1KD1Q 1DEBA 4WWIA 5KJ7A 1GU5A 1JM0A 1OW7A 1VPCA 4NPDA 1OIPA 1T2KD 3L74E 4NPFX 1JMBA 2E5TA 3L75E 2LKMA 3A0HE 1L4AC 5AVUB 1SQQK 3KXDA 4BWNA 2AXTE 1SQPK 1VF5B 3C8VA 3CD6P 1QL2A 3KZIE 3AE9C 1LWUB 2HPCB 1RE4A 1M8OB 1Z56A 1SQXD 4QMAA 1HUCA 2K9YA 2G8YA 1WRGA 1YQ4C 2J59M 5CJ0A 2FYNC 1VQKP 4HB1A 3SFDC 2Z4EA 2YKOA 5B66H 4AQRD 1NAYA 1Q82Q 2JP3A 3M0AA 1Q81Q 4ZKPA 2FFDC 3WU2H 3VN0A 1SQXK 3Q3DA 3V2PA 1NTME 1AVOA 3AE2C 5EFWB 1MUUA 2C9LY 1M1JA 4BRYB 1L4AD 1LWUC 1ZRTD 4D6TE 3S9OA 2R3CA 4WBAA 3IN6A 2K9JB 1BGYE 2LR2A 3L70G 1GZLA 3H1HD 3H32A 3R2PA 4R4LA 1KQFB 5CMZA 4AYCA 1GL2C 3M9QA 4C7NB 5KLVG 1ZV8A 5AVWB 2K1AA 1HJBA 4EI2A 4PJ0E 1RH5B 2P10A 3AEAC 3SWFA 4U3FG 1Q86Q 1EZVD 4ZMDA 3L73G 1R5LA 3II6A 2PAJA 1A02J 1NTKJ 5KAIH 1FC2C 1VF5D 1LTIC 1JY2N 2GUSA 3MIWA 3BCCJ 1NKNA 4M3LA 3P7KA 1FZBA 3Q2YA 2ZAEB 3V2NA 1YYCA 3M06A 2WPRA 5CCGA 1ZR4A 2BEQD 4K35A 1OX3A 2IPPA 2KNCA 2KSJA 4L73A 3Q1MA 3BATA 1YQ3C 3CCJP 1BE3J 4UB6H 1GL2D 2OTKE 2IX7C 3AE7C 1LJ2A 1S9KE 2O1JA 3CC4P 1SS1A 1DD3A 1OWAA 2KSEA 4GOFA 1K73Q 1KYOD 1NU1D 1IZNB 1GDTA 5AVTB 2ZVNB 1L0NK 3M9HA 5GTIE 3GLMA 2NRGA 2E76B 4XFJA 2QJKC 1X8YA 1H0TB 2KLUA 1PP9D 2QJPC 3HTKB 3CX5E 2XV5A 2Z5IA 2WPQA 1HJ0A 2Q6QA 2YKQA 1ZMEC 5AVSB 3H1JG 1N7SC 3O8ZA 1G1IA 3H1LD 1HVVA 2QEXP 1DEEG 1SP4A 1S4XA 2QRXA 3CCLP 3JCUE 2FFDA 2E76C 2WSCH 1NTZG 3B4SA 3A5TA 4HYTB 2W8ZA 3B5NC 2KOGA 5APYA 1EDKA 2O01H 3AEDC 2K88A 1BDCA 3L74G 1W2EA 1JMMA 5L8RJ 3BASA 2HG5D 1NHLA 1X22A 1PFIA 1OFCX 3TGUJ 5E79E 1GL2A 2IYOA 1QVFO 1UIIA 4DJGA 1XTCC 5AVQB 1NTZK 1D7MA 3S4RA 5CBNA 1SQQJ 1FDIA 1L0LD 3AEFC 2QVAA 4EOTA 1SQPJ 1KFMA 5M1BA 4I1LA 4ASWA 2W83C 3NMDA 2E76D 3FXDA 1KB9E 1WMKA 1Y9BA 2E74B 5TJHA 1HH0A 2WSSH 3AE3C 3OJAB 5CBOA 1LTAC 1W5CE 4CPGA 2PFXA 3Q5PA 1NTMG 1ZOYC 4TLFA 4RO0A 2LXBA 3BRVB 3WMM0 1ZRTE 4HKZH 2FY8A 1HTLC 5APTA 1AQTA 4D6TG 3L71E 2YMYA 3F5HA 3OAKA 1BGYG 1JY2P 1U7JA 2BEZF 3Q5SA 1SQXJ 2ZYDA 1BCCG 3O6QA 3D70A 1U7MA 3H1ID 1FZAA 4WY4A 2Q3IA 1J2JB 4PJ0H 1M1JB 3M9BA 1PGQA 1KQGB 1GW4A 2Q1KA 1N2DC 1EZVE 1LTSC 1MV8A 4H0LB 3H1KE 5AVVB 5APXA 3CCRP 3H32B 1VQ4P 2KI7B 2KP8A 3S1KA 1JNMA 2A06E 1NH4A 2OQQA 3VTPC 3FWNA 1N7SA 2B9BA 2OYOA 1FOSF 2RMZA 1JOCA 3H6PA 2KK7A 4OWFA 5DJTB 3L72E 1BSHA 3CWBG 3CCUP 1KILC 4LLHA 1JY3N 1LGHB 3TYYA 5KLVJ 2WT7A 3B5NA 3CC2P 1KYOE 1NU1E 1S9KD 2KLVA 4U3FJ 1YHQP 5GTIH 3RK3C 2MKVA 1OXZA 2QJYC 3LW5H 1IFJA 2FBWC 2KNCB 4YTPC 1PP9E 1VQLP 1J1DB 2PRRA 2QM8A 1SQVD 1P84E 1CZQA 4EYYQ 2M3BA 1L0NJ 1NVOA 3AEGC 2E5YA 3G3ZA 3CX5D 1KQSO 1S5LE 1SQBD 2BCCG 3HE5A 3U1CA 2ZT9C 1KILD 4TT3H 1OW6A 2I1JA 2O01N 3AE1C 2WZ7A 1DX7A 3D71A 4JBZA 2D2CB 3W68A 1ZW0A 2Z5HA 1LTJA 4GKGA 3P8CD 1GK4A 2ZFCA 4MN4C 2V7QH 3VMXA 1UIXA 3PTZA 1H89A 3RK3D 1VQ5P 2H89C 2FYUD 3U1AA 1QLED 2FYNB 1MFTA 3VMZA 2E42A 4A7PA 4NPEA 3U59A 4EIJA 3TNUB 1VQ6P 1R5SA 2FFDB 3AE4C 3PJSK 3RBZA 1OVUA 1MFZA 3USSA 3RK2B 3H1JJ 2D2CC 1SQXG 1ZLLA 3CCVP 2B87A 1L0LE 2ZT9D 1KMIZ 1OW8A 5AVXB 3GF7A 5BU8B 3N4XA 5CCGD 2O1KA 1NTZJ 4GIFA 1CI6A 3IFMA 1GL2B 2WSCJ 3L35A 3HD7C 1M57D 2XNDH 1KB9D 5KKZC 1YIJP 5CHXA 2QG4A 2OYHC 2O01J 2R3SA 1BSNA 3L74J 3RK2C 3L75J 4I2LC 2IZ0A 5CJ4A 4L75A 1JB0J 2H7HA 3TSIA 2GM4A 1RHZB 3H1HG 3A0BE 3CLQA 3CPWO 1KILA 3L71D 1EXJA 2D2CD 3H1IE 1Q7YQ 4DT0A 1J1EC 1NTKE 2OYIC 1USEA 1ZR2A 2Q3EA 1N7LA 3TDKA 3A7OA 4I7ZB 1JY3P 2IBZE 2B88A 2N1TC 5TISH 1FS0E 3MGNA 4L74A 1ZXGA 2HFED 3HD7D 3L70D 2WQYC 4JF7A 2WTYA 2P2UA 3O6QB 3H1KD 3LIEA 3P8MC 1NTMJ 1OVVA 3RK2D 1GD2E 1IJDB 2A06D 3M0DC 5AW9B 3VOPA 2L91A 4D6TJ 1CSBA 3WUUA 3QH9A 2R5BA 1L0NG 1BGYJ 2QJKB 2ITAA 1G2CA 4N3YB 2AEFA 1BCCJ 3CX5I 2QJPB 4I7ZC 1JY2O 1KYOH 2JWAA 3L72D 2RH0A 1N7SB 3B8EB 5AW3B 1A02F 3FGAD 4PD4E 2N1TD 1ZP0C 4WY4C 3HUSC 1VQ8P 4U7JA 5APWA 1T6AA 5AW6B 1XTGB 2H43A 1M56D 2N9YB 1PP9G 1SQVE 1X9VA 2YNYA 2WT7B 3B5NB 2K37A 1KFNA 3FXEA 2NPSA 1SQBE 3H1LG 1NU1K 2IYPA 1P84D 2AEMA 2PP6A 2XNXA 1KILE 1VL2A 4RKUJ 3CWBJ 4PV1B 3AEBC 4Y99C 1VQPP 2IDBA 1BDDA 4N6JA 1NOHA 1KORA 1JTHA 3P8CE 2ZVOB 1LTTC 3HD7A 2QIWA 3AE5C 4IOIH 3RK3E 2OYHA 4WY4D 2FYUE 2WWWA 4IL6E 3A3YB 2N9BA 2AEJA 2SPZA 4UB8E 1S1CX 3LW5J 4C7RA 3G71P 1KB9I 2Y0EA 3AE8C 1KZUB 2Y9ZA 3UIAA 3A0HH 3L75G 2WSFH 4AUWA 1IFPA 1LTJB 2AXTH 4PV1C 1R8EA 4RJTA 2OYIA 1JEKA 1VQOP 1NJIQ 3KZIH 2BCCJ 1N7SD 1PGJA 4K3AA 4W7YA 5CCHA 1LT9C 2DW3A 2N1TA 2W6BA 2IZ1A 3V4QA 4XA4A 1Y47A 1JUNA 4H13C 1FZEA 2O3JA 2G3AA 2QM7A 2XKMA 1JCDA 3SWYA 2V7QJ 5H2FE 4GT1A 3CXHD 3B5ND 3M0DA 2B87B 4IFDK 1LTJC 1YITP 1FZFA 1FOSE 1EZVI 1GW3A 1FZCC 1L0LK 3A0BH 4B86A 4R4MA 1GU4A 4N78E 5GTHE 4PV1D 1CI6B 3H1IG 2R32A 3MHVA 1RE3A 3HE4A 1CW5A 1N8RQ 3E1RA 2P7JA 2FXMA 3V4WA 1WT6A 1H8AA 2JR8A 3HUSA 2C9NY 1NTKD 1YBKA 2Q9IA 4C46A 2C0XA 4H13D 4JPZB 2KUBA 3GHGC 3L70E 1KILB 2IBZD 3T97A 3EQ2A 1YI2P 3BCCD 5KLIC 1N73A 3PH0A 1KYOI 4IL6X 2E75B 5KTBA 3M91A 1USDA 4GODA 1FJKA 2M3EA 5KLVE 1AFOA 1HBWA 1BE3D 1NTKK 2Y0CA 3SSUA 4W7ZA 3RK3B 2FXPA 2QJYB 4DZOA 3H1HJ 3MTUE 3F89A 4Z1MH 4U3FE 3JSVC 2WSEH 3L73E 1P84I 1PZQA 2KS1A 1GTWA 5AVRB 1PPJD 2L5GB 1GK6A 2E75C 4YPCA 1RQUA 2ZT9B 5KAFE 1SLQA 1G2CB 4PD4D 5AW1B 5K5GB 4Y28J 3CL3D 3FWLA 3GG2A 3TK1A 1SQVG 2JKVA 2QE7H 3KDPB 2KZIA 2WITA 3CX5H 1EC5A 2AXCA 2BASA 2A45I 3OA7A 1LT9A 1SQBG 5AW7B 3ZDMA 1MZ9A 3VMAA 4XE5B 1T2KC 3E7KA 2Y0DA 3MP7B 2LXCB 4JYCA 3JCUH 2P1JA 1NU1J 2WPSA 1SQVK 4DOJA 1VQNP 1NYHA 4IL6H 2E75D 1RF1C 2NPSB 2HODA 2OTLP 5BVZA 4UB8H 3TGUD 1FZCA 3RL0C 3SWKA 3NXSA 1SQBK 3Q5RA 2P67A 3CXHI 1PP9J 3VP8A 4OH8B 4HH2A 1SQQD 3L4FA 1JTHB 1SFCC 3HD7B 2VRSA 3P32A 5E79H 4KJMA 4O9BA 5KKZB 1SQPD 3MUDA 5B5EE 2OYHB 3H1LJ 2CPSA 1YJNP 2FYUK 3RBXA 3EWKA 2WPVB 1M90Q 2XU6A 2NPSC 1Q90D 2P58A 3GHGA 4H44C 2I8DA 2HLOA 2WMMA 1URQC 5DJUB 1J1EB 1KB9H 5H2FH 3CXHE 2OYIB 1QGKB 1VQMP 2I1KA 3KPEA 3RL0D 1LP1A 2IBZI 3L37A 1DD4A 1EDJA 1KN7A 2N1TB 5AW5B 2KZJA 2YO3A 1X79B 2YO2A 1FDOA 5GTHH 4WB4A 1TU3F 4KT0J 2R5DA 1SFCD 2E43A 2JWDA 1M1KQ 3L71G 2YMKA 4W80A 1E79H 2WSFJ 2NZ2A 1M7LA 2Y9YA 1IO4A 4N78D 2QSIA 3C1LA 1L0LJ 2JJLA 3W67A 1FE6A 1VF5C 1S5LX 2M5AA 1T3UA 5C39A 1S2EA 2NPSD 1E5WA 4H44D 3WUTA 1QX8A 2R44A 1N86A 1URQD 3ABVC 5CCHC 3BCCE 2OARA 2OTJP 1EZVG 1BCCE 3H1KG 1K04A 2WVRA 3HE4B 1GMJA 3WUVA 3V5BA 4PD4I 1BE3E 2A06G 4WY4B 1LNQA 3HUSB 2Q5UA 1IK9A 1EXIA 1FZGA 2MJZA 5KLVD 2FXOA 1OMIA 5AW2B 3H1IJ 3T97B 2ZXXA 4GDOA 1KTMA 4BXLA 4U3FD 5APSA 1G1JA 1N73B 3L72G 1PPJE 4L76A 1MKMA 1NWQA 3LIDA 2UWJE 3L73D 1RF1A 5BU5A 4DCKA 3MZWB 1RE3C 2HYNA 1EDIA 5KLVK 3N7NA 1NU1G 5KAFH 3CCMP 5CCHD 1HGZA 2OGUA 4Y99B 5AW8B 1L0ND 2ZYGA 3G4SP 1PL5A 1NO4A 3IR9A 2C0WA 3CWBE 1SFCA 4ZNCA 1IFNA 3D6YA 2KB7P 2KS1B 2V4HA 1JCCA 1RF0C 5APUA 3HRNA 1PV3A 1P84H 1N73C 3OW2O 4RESB 1T3JA 3CI9A 3IF4A 1H88A 1QEXA 1S5LH 3CCEP 3K5BA 3KYQA 2JDIH 1L4AA 1YTZI 4JYBA 1VQ9P 2WSEJ 2YIUB 1AJYA 1URQA 3CMEP 2FYZA 4I6MC 2ZYAA 3G9RA 3I56P 2W6AA 1IFDA 1PGOA 1LT9B 3TGUE 3L36A 2B89A 1FJPA 1KV4A 2BCCE 1YTZT 1FDMA 2A45H 2W90A 3IAOA 1ZN5A 1IFMA 5AVZB 4YXDC 3H1JD 2A45G 1KC8Q 1X0TA 1SQVJ 1K9MQ 4HJGH 4H13B 3HE5B 1SQQE 3TNUA 5AW4B 3D6ZA 1QL1A 3GF3A 1S3JA 1SQPE 5B5EH 2YIUC 1SQBJ 1K05A 4LGDE 2RN0A 2HODB 1NTZD 1LWUA 1FZCB 2HPCA 3PHLA 3CCQP 1AA0A
chains in the Genus database with same CATH topology
5GTHE 3JCUE 5GTIE 2AXTE 5KAFE 1W5CE 4IL6E 5B66E 3KZIE 3A0BE 5KAIE 5E79E 5TISE 1S5LE 3WU2E 4UB8E 4UB6E 3A0HE 4PJ0E 5H2FE 5B5EE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTH E;  3JCU E;  5GTI E;  2AXT E;  5KAF E;  1W5C E;  4IL6 E;  5B66 E;  3KZI E;  3A0B E;  5KAI E;  5E79 E;  5TIS E;  1S5L E;  3WU2 E;  4UB8 E;  4UB6 E;  3A0H E;  4PJ0 E;  5H2F E;  5B5E E; 
#chains in the Genus database with same CATH topology
 3KHU A;  1L0L G;  1NGM B;  4ZKU A;  2Q7C A;  3RGU A;  1RQV A;  3AEC C;  3L74 D;  3L75 D;  3CXH H;  1IFI A;  3GW6 A;  3NFQ A;  1EQ7 A;  2FYU J;  1NAF A;  3PRJ A;  3VMY A;  2PGD A;  1SQX E;  2H88 C;  1VDF A;  1DIP A;  1Y8A A;  2HR3 A;  1AQ5 A;  3GHG B;  1HWT C;  1DH3 A;  4BRY A;  3EFF K;  1AV1 A;  5KLI B;  4WVZ A;  1U57 A;  3QWO C;  2K9J A;  2QA4 P;  5B66 E;  1LP1 B;  3B71 A;  1QVG O;  2CPB A;  3SFE C;  1NTK G;  3WU2 E;  2YXR B;  3MUD C;  4C7N A;  5KJ7 C;  1FBM A;  1VQ7 P;  3BVH A;  1NTM D;  3NTN A;  1NKZ B;  3H25 A;  3H1H E;  3VP9 A;  4IFM A;  2IBZ G;  3BCC G;  3AEE C;  1HGV A;  4D6T D;  3EFG A;  2ZXE B;  1LTB C;  1LT1 A;  3V2Q A;  3ITK A;  1RF0 A;  2POH A;  1BGY D;  1FAV A;  4ASV A;  1RY3 A;  1BE3 G;  2E74 C;  1BCC D;  2M5A B;  1L2P A;  1NTM K;  2J58 A;  2IFN A;  2KIK A;  3AE6 C;  1OZH A;  1RE4 C;  2GA1 A;  1IK7 A;  3CCS P;  3L71 J;  1HF9 A;  5TIS E;  4OGQ B;  5APQ A;  3MD0 A;  3C9I A;  2W6J H;  1PPJ G;  2JO1 A;  1SVF A;  1FU1 A;  3V2R A;  5KJ7 D;  4EDF A;  3R4Y A;  5KAI E;  5AW0 B;  3CMA P;  3PP5 A;  1W2B O;  1EDL A;  2KXP B;  2IFM A;  4PD4 H;  3I55 P;  3RL0 g;  2YXQ B;  2KYV A;  1L0N E;  3L70 J;  1M1J C;  1T8Z A;  2ZJS E;  2K3R A;  2XZR A;  2YKP A;  2CK3 H;  3E1I A;  2J5U A;  3H1K J;  2RKL A;  5APV A;  1YJ9 P;  1IC2 A;  3GMA A;  3JC2 2;  2E74 D;  1JY3 O;  4H0L C;  4OGQ C;  1H0T A;  4LC1 A;  4UB6 E;  1PGP A;  1RF1 B;  3CWB D;  3HTK A;  1AVY A;  3I5C A;  2FKW B;  3BRT B;  3RL0 B;  2GUV A;  3KQG A;  4YXW H;  1Q2N A;  3G6E P;  3L73 J;  2M8R A;  1KQL A;  1S72 P;  1PIX A;  1SFC B;  3L72 J;  4JQ0 D;  2H8P D;  3TF5 A;  1OVR A;  1JO5 A;  5AVY B;  2W27 A;  4OVN F;  3A2A A;  3TGU G;  3H1L E;  2XDJ A;  2FYU G;  3PLN A;  3H1J E;  4GOE A;  2M0B A;  4H44 B;  1L4A B;  1K8A Q;  4KHX A;  1SQQ G;  2BCC D;  1URQ B;  4H0L D;  3VYI A;  4OGQ D;  3V6I A;  5CCG C;  1LTG C;  3CC7 P;  1SQP G;  1YJW P;  3FX0 A;  2JEE A;  4IFF A;  1NTZ E;  1J1D C;  1KD1 Q;  1DEB A;  4WWI A;  5KJ7 A;  1GU5 A;  1JM0 A;  1OW7 A;  1VPC A;  4NPD A;  1OIP A;  1T2K D;  3L74 E;  4NPF X;  1JMB A;  2E5T A;  3L75 E;  2LKM A;  3A0H E;  1L4A C;  5AVU B;  1SQQ K;  3KXD A;  4BWN A;  2AXT E;  1SQP K;  1VF5 B;  3C8V A;  3CD6 P;  1QL2 A;  3KZI E;  3AE9 C;  1LWU B;  2HPC B;  1RE4 A;  1M8O B;  1Z56 A;  1SQX D;  4QMA A;  1HUC A;  2K9Y A;  2G8Y A;  1WRG A;  1YQ4 C;  2J59 M;  5CJ0 A;  2FYN C;  1VQK P;  4HB1 A;  3SFD C;  2Z4E A;  2YKO A;  5B66 H;  4AQR D;  1NAY A;  1Q82 Q;  2JP3 A;  3M0A A;  1Q81 Q;  4ZKP A;  2FFD C;  3WU2 H;  3VN0 A;  1SQX K;  3Q3D A;  3V2P A;  1NTM E;  1AVO A;  3AE2 C;  5EFW B;  1MUU A;  2C9L Y;  1M1J A;  4BRY B;  1L4A D;  1LWU C;  1ZRT D;  4D6T E;  3S9O A;  2R3C A;  4WBA A;  3IN6 A;  2K9J B;  1BGY E;  2LR2 A;  3L70 G;  1GZL A;  3H1H D;  3H32 A;  3R2P A;  4R4L A;  1KQF B;  5CMZ A;  4AYC A;  1GL2 C;  3M9Q A;  4C7N B;  5KLV G;  1ZV8 A;  5AVW B;  2K1A A;  1HJB A;  4EI2 A;  4PJ0 E;  1RH5 B;  2P10 A;  3AEA C;  3SWF A;  4U3F G;  1Q86 Q;  1EZV D;  4ZMD A;  3L73 G;  1R5L A;  3II6 A;  2PAJ A;  1A02 J;  1NTK J;  5KAI H;  1FC2 C;  1VF5 D;  1LTI C;  1JY2 N;  2GUS A;  3MIW A;  3BCC J;  1NKN A;  4M3L A;  3P7K A;  1FZB A;  3Q2Y A;  2ZAE B;  3V2N A;  1YYC A;  3M06 A;  2WPR A;  5CCG A;  1ZR4 A;  2BEQ D;  4K35 A;  1OX3 A;  2IPP A;  2KNC A;  2KSJ A;  4L73 A;  3Q1M A;  3BAT A;  1YQ3 C;  3CCJ P;  1BE3 J;  4UB6 H;  1GL2 D;  2OTK E;  2IX7 C;  3AE7 C;  1LJ2 A;  1S9K E;  2O1J A;  3CC4 P;  1SS1 A;  1DD3 A;  1OWA A;  2KSE A;  4GOF A;  1K73 Q;  1KYO D;  1NU1 D;  1IZN B;  1GDT A;  5AVT B;  2ZVN B;  1L0N K;  3M9H A;  5GTI E;  3GLM A;  2NRG A;  2E76 B;  4XFJ A;  2QJK C;  1X8Y A;  1H0T B;  2KLU A;  1PP9 D;  2QJP C;  3HTK B;  3CX5 E;  2XV5 A;  2Z5I A;  2WPQ A;  1HJ0 A;  2Q6Q A;  2YKQ A;  1ZME C;  5AVS B;  3H1J G;  1N7S C;  3O8Z A;  1G1I A;  3H1L D;  1HVV A;  2QEX P;  1DEE G;  1SP4 A;  1S4X A;  2QRX A;  3CCL P;  3JCU E;  2FFD A;  2E76 C;  2WSC H;  1NTZ G;  3B4S A;  3A5T A;  4HYT B;  2W8Z A;  3B5N C;  2KOG A;  5APY A;  1EDK A;  2O01 H;  3AED C;  2K88 A;  1BDC A;  3L74 G;  1W2E A;  1JMM A;  5L8R J;  3BAS A;  2HG5 D;  1NHL A;  1X22 A;  1PFI A;  1OFC X;  3TGU J;  5E79 E;  1GL2 A;  2IYO A;  1QVF O;  1UII A;  4DJG A;  1XTC C;  5AVQ B;  1NTZ K;  1D7M A;  3S4R A;  5CBN A;  1SQQ J;  1FDI A;  1L0L D;  3AEF C;  2QVA A;  4EOT A;  1SQP J;  1KFM A;  5M1B A;  4I1L A;  4ASW A;  2W83 C;  3NMD A;  2E76 D;  3FXD A;  1KB9 E;  1WMK A;  1Y9B A;  2E74 B;  5TJH A;  1HH0 A;  2WSS H;  3AE3 C;  3OJA B;  5CBO A;  1LTA C;  1W5C E;  4CPG A;  2PFX A;  3Q5P A;  1NTM G;  1ZOY C;  4TLF A;  4RO0 A;  2LXB A;  3BRV B;  3WMM 0;  1ZRT E;  4HKZ H;  2FY8 A;  1HTL C;  5APT A;  1AQT A;  4D6T G;  3L71 E;  2YMY A;  3F5H A;  3OAK A;  1BGY G;  1JY2 P;  1U7J A;  2BEZ F;  3Q5S A;  1SQX J;  2ZYD A;  1BCC G;  3O6Q A;  3D70 A;  1U7M A;  3H1I D;  1FZA A;  4WY4 A;  2Q3I A;  1J2J B;  4PJ0 H;  1M1J B;  3M9B A;  1PGQ A;  1KQG B;  1GW4 A;  2Q1K A;  1N2D C;  1EZV E;  1LTS C;  1MV8 A;  4H0L B;  3H1K E;  5AVV B;  5APX A;  3CCR P;  3H32 B;  1VQ4 P;  2KI7 B;  2KP8 A;  3S1K A;  1JNM A;  2A06 E;  1NH4 A;  2OQQ A;  3VTP C;  3FWN A;  1N7S A;  2B9B A;  2OYO A;  1FOS F;  2RMZ A;  1JOC A;  3H6P A;  2KK7 A;  4OWF A;  5DJT B;  3L72 E;  1BSH A;  3CWB G;  3CCU P;  1KIL C;  4LLH A;  1JY3 N;  1LGH B;  3TYY A;  5KLV J;  2WT7 A;  3B5N A;  3CC2 P;  1KYO E;  1NU1 E;  1S9K D;  2KLV A;  4U3F J;  1YHQ P;  5GTI H;  3RK3 C;  2MKV A;  1OXZ A;  2QJY C;  3LW5 H;  1IFJ A;  2FBW C;  2KNC B;  4YTP C;  1PP9 E;  1VQL P;  1J1D B;  2PRR A;  2QM8 A;  1SQV D;  1P84 E;  1CZQ A;  4EYY Q;  2M3B A;  1L0N J;  1NVO A;  3AEG C;  2E5Y A;  3G3Z A;  3CX5 D;  1KQS O;  1S5L E;  1SQB D;  2BCC G;  3HE5 A;  3U1C A;  2ZT9 C;  1KIL D;  4TT3 H;  1OW6 A;  2I1J A;  2O01 N;  3AE1 C;  2WZ7 A;  1DX7 A;  3D71 A;  4JBZ A;  2D2C B;  3W68 A;  1ZW0 A;  2Z5H A;  1LTJ A;  4GKG A;  3P8C D;  1GK4 A;  2ZFC A;  4MN4 C;  2V7Q H;  3VMX A;  1UIX A;  3PTZ A;  1H89 A;  3RK3 D;  1VQ5 P;  2H89 C;  2FYU D;  3U1A A;  1QLE D;  2FYN B;  1MFT A;  3VMZ A;  2E42 A;  4A7P A;  4NPE A;  3U59 A;  4EIJ A;  3TNU B;  1VQ6 P;  1R5S A;  2FFD B;  3AE4 C;  3PJS K;  3RBZ A;  1OVU A;  1MFZ A;  3USS A;  3RK2 B;  3H1J J;  2D2C C;  1SQX G;  1ZLL A;  3CCV P;  2B87 A;  1L0L E;  2ZT9 D;  1KMI Z;  1OW8 A;  5AVX B;  3GF7 A;  5BU8 B;  3N4X A;  5CCG D;  2O1K A;  1NTZ J;  4GIF A;  1CI6 A;  3IFM A;  1GL2 B;  2WSC J;  3L35 A;  3HD7 C;  1M57 D;  2XND H;  1KB9 D;  5KKZ C;  1YIJ P;  5CHX A;  2QG4 A;  2OYH C;  2O01 J;  2R3S A;  1BSN A;  3L74 J;  3RK2 C;  3L75 J;  4I2L C;  2IZ0 A;  5CJ4 A;  4L75 A;  1JB0 J;  2H7H A;  3TSI A;  2GM4 A;  1RHZ B;  3H1H G;  3A0B E;  3CLQ A;  3CPW O;  1KIL A;  3L71 D;  1EXJ A;  2D2C D;  3H1I E;  1Q7Y Q;  4DT0 A;  1J1E C;  1NTK E;  2OYI C;  1USE A;  1ZR2 A;  2Q3E A;  1N7L A;  3TDK A;  3A7O A;  4I7Z B;  1JY3 P;  2IBZ E;  2B88 A;  2N1T C;  5TIS H;  1FS0 E;  3MGN A;  4L74 A;  1ZXG A;  2HFE D;  3HD7 D;  3L70 D;  2WQY C;  4JF7 A;  2WTY A;  2P2U A;  3O6Q B;  3H1K D;  3LIE A;  3P8M C;  1NTM J;  1OVV A;  3RK2 D;  1GD2 E;  1IJD B;  2A06 D;  3M0D C;  5AW9 B;  3VOP A;  2L91 A;  4D6T J;  1CSB A;  3WUU A;  3QH9 A;  2R5B A;  1L0N G;  1BGY J;  2QJK B;  2ITA A;  1G2C A;  4N3Y B;  2AEF A;  1BCC J;  3CX5 I;  2QJP B;  4I7Z C;  1JY2 O;  1KYO H;  2JWA A;  3L72 D;  2RH0 A;  1N7S B;  3B8E B;  5AW3 B;  1A02 F;  3FGA D;  4PD4 E;  2N1T D;  1ZP0 C;  4WY4 C;  3HUS C;  1VQ8 P;  4U7J A;  5APW A;  1T6A A;  5AW6 B;  1XTG B;  2H43 A;  1M56 D;  2N9Y B;  1PP9 G;  1SQV E;  1X9V A;  2YNY A;  2WT7 B;  3B5N B;  2K37 A;  1KFN A;  3FXE A;  2NPS A;  1SQB E;  3H1L G;  1NU1 K;  2IYP A;  1P84 D;  2AEM A;  2PP6 A;  2XNX A;  1KIL E;  1VL2 A;  4RKU J;  3CWB J;  4PV1 B;  3AEB C;  4Y99 C;  1VQP P;  2IDB A;  1BDD A;  4N6J A;  1NOH A;  1KOR A;  1JTH A;  3P8C E;  2ZVO B;  1LTT C;  3HD7 A;  2QIW A;  3AE5 C;  4IOI H;  3RK3 E;  2OYH A;  4WY4 D;  2FYU E;  2WWW A;  4IL6 E;  3A3Y B;  2N9B A;  2AEJ A;  2SPZ A;  4UB8 E;  1S1C X;  3LW5 J;  4C7R A;  3G71 P;  1KB9 I;  2Y0E A;  3AE8 C;  1KZU B;  2Y9Z A;  3UIA A;  3A0H H;  3L75 G;  2WSF H;  4AUW A;  1IFP A;  1LTJ B;  2AXT H;  4PV1 C;  1R8E A;  4RJT A;  2OYI A;  1JEK A;  1VQO P;  1NJI Q;  3KZI H;  2BCC J;  1N7S D;  1PGJ A;  4K3A A;  4W7Y A;  5CCH A;  1LT9 C;  2DW3 A;  2N1T A;  2W6B A;  2IZ1 A;  3V4Q A;  4XA4 A;  1Y47 A;  1JUN A;  4H13 C;  1FZE A;  2O3J A;  2G3A A;  2QM7 A;  2XKM A;  1JCD A;  3SWY A;  2V7Q J;  5H2F E;  4GT1 A;  3CXH D;  3B5N D;  3M0D A;  2B87 B;  4IFD K;  1LTJ C;  1YIT P;  1FZF A;  1FOS E;  1EZV I;  1GW3 A;  1FZC C;  1L0L K;  3A0B H;  4B86 A;  4R4M A;  1GU4 A;  4N78 E;  5GTH E;  4PV1 D;  1CI6 B;  3H1I G;  2R32 A;  3MHV A;  1RE3 A;  3HE4 A;  1CW5 A;  1N8R Q;  3E1R A;  2P7J A;  2FXM A;  3V4W A;  1WT6 A;  1H8A A;  2JR8 A;  3HUS A;  2C9N Y;  1NTK D;  1YBK A;  2Q9I A;  4C46 A;  2C0X A;  4H13 D;  4JPZ B;  2KUB A;  3GHG C;  3L70 E;  1KIL B;  2IBZ D;  3T97 A;  3EQ2 A;  1YI2 P;  3BCC D;  5KLI C;  1N73 A;  3PH0 A;  1KYO I;  4IL6 X;  2E75 B;  5KTB A;  3M91 A;  1USD A;  4GOD A;  1FJK A;  2M3E A;  5KLV E;  1AFO A;  1HBW A;  1BE3 D;  1NTK K;  2Y0C A;  3SSU A;  4W7Z A;  3RK3 B;  2FXP A;  2QJY B;  4DZO A;  3H1H J;  3MTU E;  3F89 A;  4Z1M H;  4U3F E;  3JSV C;  2WSE H;  3L73 E;  1P84 I;  1PZQ A;  2KS1 A;  1GTW A;  5AVR B;  1PPJ D;  2L5G B;  1GK6 A;  2E75 C;  4YPC A;  1RQU A;  2ZT9 B;  5KAF E;  1SLQ A;  1G2C B;  4PD4 D;  5AW1 B;  5K5G B;  4Y28 J;  3CL3 D;  3FWL A;  3GG2 A;  3TK1 A;  1SQV G;  2JKV A;  2QE7 H;  3KDP B;  2KZI A;  2WIT A;  3CX5 H;  1EC5 A;  2AXC A;  2BAS A;  2A45 I;  3OA7 A;  1LT9 A;  1SQB G;  5AW7 B;  3ZDM A;  1MZ9 A;  3VMA A;  4XE5 B;  1T2K C;  3E7K A;  2Y0D A;  3MP7 B;  2LXC B;  4JYC A;  3JCU H;  2P1J A;  1NU1 J;  2WPS A;  1SQV K;  4DOJ A;  1VQN P;  1NYH A;  4IL6 H;  2E75 D;  1RF1 C;  2NPS B;  2HOD A;  2OTL P;  5BVZ A;  4UB8 H;  3TGU D;  1FZC A;  3RL0 C;  3SWK A;  3NXS A;  1SQB K;  3Q5R A;  2P67 A;  3CXH I;  1PP9 J;  3VP8 A;  4OH8 B;  4HH2 A;  1SQQ D;  3L4F A;  1JTH B;  1SFC C;  3HD7 B;  2VRS A;  3P32 A;  5E79 H;  4KJM A;  4O9B A;  5KKZ B;  1SQP D;  3MUD A;  5B5E E;  2OYH B;  3H1L J;  2CPS A;  1YJN P;  2FYU K;  3RBX A;  3EWK A;  2WPV B;  1M90 Q;  2XU6 A;  2NPS C;  1Q90 D;  2P58 A;  3GHG A;  4H44 C;  2I8D A;  2HLO A;  2WMM A;  1URQ C;  5DJU B;  1J1E B;  1KB9 H;  5H2F H;  3CXH E;  2OYI B;  1QGK B;  1VQM P;  2I1K A;  3KPE A;  3RL0 D;  1LP1 A;  2IBZ I;  3L37 A;  1DD4 A;  1EDJ A;  1KN7 A;  2N1T B;  5AW5 B;  2KZJ A;  2YO3 A;  1X79 B;  2YO2 A;  1FDO A;  5GTH H;  4WB4 A;  1TU3 F;  4KT0 J;  2R5D A;  1SFC D;  2E43 A;  2JWD A;  1M1K Q;  3L71 G;  2YMK A;  4W80 A;  1E79 H;  2WSF J;  2NZ2 A;  1M7L A;  2Y9Y A;  1IO4 A;  4N78 D;  2QSI A;  3C1L A;  1L0L J;  2JJL A;  3W67 A;  1FE6 A;  1VF5 C;  1S5L X;  2M5A A;  1T3U A;  5C39 A;  1S2E A;  2NPS D;  1E5W A;  4H44 D;  3WUT A;  1QX8 A;  2R44 A;  1N86 A;  1URQ D;  3ABV C;  5CCH C;  3BCC E;  2OAR A;  2OTJ P;  1EZV G;  1BCC E;  3H1K G;  1K04 A;  2WVR A;  3HE4 B;  1GMJ A;  3WUV A;  3V5B A;  4PD4 I;  1BE3 E;  2A06 G;  4WY4 B;  1LNQ A;  3HUS B;  2Q5U A;  1IK9 A;  1EXI A;  1FZG A;  2MJZ A;  5KLV D;  2FXO A;  1OMI A;  5AW2 B;  3H1I J;  3T97 B;  2ZXX A;  4GDO A;  1KTM A;  4BXL A;  4U3F D;  5APS A;  1G1J A;  1N73 B;  3L72 G;  1PPJ E;  4L76 A;  1MKM A;  1NWQ A;  3LID A;  2UWJ E;  3L73 D;  1RF1 A;  5BU5 A;  4DCK A;  3MZW B;  1RE3 C;  2HYN A;  1EDI A;  5KLV K;  3N7N A;  1NU1 G;  5KAF H;  3CCM P;  5CCH D;  1HGZ A;  2OGU A;  4Y99 B;  5AW8 B;  1L0N D;  2ZYG A;  3G4S P;  1PL5 A;  1NO4 A;  3IR9 A;  2C0W A;  3CWB E;  1SFC A;  4ZNC A;  1IFN A;  3D6Y A;  2KB7 P;  2KS1 B;  2V4H A;  1JCC A;  1RF0 C;  5APU A;  3HRN A;  1PV3 A;  1P84 H;  1N73 C;  3OW2 O;  4RES B;  1T3J A;  3CI9 A;  3IF4 A;  1H88 A;  1QEX A;  1S5L H;  3CCE P;  3K5B A;  3KYQ A;  2JDI H;  1L4A A;  1YTZ I;  4JYB A;  1VQ9 P;  2WSE J;  2YIU B;  1AJY A;  1URQ A;  3CME P;  2FYZ A;  4I6M C;  2ZYA A;  3G9R A;  3I56 P;  2W6A A;  1IFD A;  1PGO A;  1LT9 B;  3TGU E;  3L36 A;  2B89 A;  1FJP A;  1KV4 A;  2BCC E;  1YTZ T;  1FDM A;  2A45 H;  2W90 A;  3IAO A;  1ZN5 A;  1IFM A;  5AVZ B;  4YXD C;  3H1J D;  2A45 G;  1KC8 Q;  1X0T A;  1SQV J;  1K9M Q;  4HJG H;  4H13 B;  3HE5 B;  1SQQ E;  3TNU A;  5AW4 B;  3D6Z A;  1QL1 A;  3GF3 A;  1S3J A;  1SQP E;  5B5E H;  2YIU C;  1SQB J;  1K05 A;  4LGD E;  2RN0 A;  2HOD B;  1NTZ D;  1LWU A;  1FZC B;  2HPC A;  3PHL A;  3CCQ P;  1AA0 A; 
#chains in the Genus database with same CATH homology
 5GTH E;  3JCU E;  5GTI E;  2AXT E;  5KAF E;  1W5C E;  4IL6 E;  5B66 E;  3KZI E;  3A0B E;  5KAI E;  5E79 E;  5TIS E;  1S5L E;  3WU2 E;  4UB8 E;  4UB6 E;  3A0H E;  4PJ0 E;  5H2F E;  5B5E E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...