3KZIE

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
77
structure length
77
Chain Sequence
RPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
total genus 23
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 3kziE00
4UB6E 5E79E 5GTHE 1S5LE 4IL6E 4UB8E 3KZIE 5TISE 3A0HE 4PJ0E 5KAIE 3JCUE 1W5CE 5B5EE 2AXTE 5KAFE 5B66E 5H2FE 3WU2E 5GTIE 3A0BE
chains in the Genus database with same CATH superfamily
1PGQA 3MIWA 2N9BA 2E74D 3P8CE 3CCMP 1PPJG 2IBZE 3AE2C 2J58A 2RMZA 3AE4C 1VQNP 3GG2A 2WSCH 4D6TG 5CBOA 1KV4A 4JPZB 3MD0A 3CCVP 2IDBA 1KILA 4M3LA 3RK3D 3CCUP 3PJSK 3JCUE 2Z4EA 1NTZJ 1QLED 2WPQA 3HRNA 5BU5A 1BCCG 2A45I 3IN6A 3EWKA 3HE4A 2A45H 2CK3H 1R5SA 1JY2N 1URQD 2R44A 1N73A 5GTHH 4NPFX 1YYCA 1L0NJ 1WMKA 1GL2A 4H0LB 3FWNA 2HR3A 3A2AA 2E75C 1L4AD 5B66H 4XE5B 1G2CA 3OAKA 2Y0CA 2B89A 3CX5I 3U59A 3CX5H 3AE6C 1PV3A 1X9VA 1YQ3C 1PPJD 3HUSC 1KQSO 1SQBK 4WY4B 3AEFC 1FDOA 1SQPG 3L4FA 2YKPA 1H88A 5KKZB 4D6TD 1KB9E 1BE3G 1ZN5A 4ASWA 2YKQA 2KNCB 1Y9BA 1N7LA 3L74G 4UB8H 2G3AA 3GHGB 5DJUB 2YIUB 1BCCD 2NRGA 3S1KA 5KAIE 1Y8AA 1JNMA 1JY3O 3S9OA 4Y99C 2OYIA 1K8AQ 1S1CX 1KYOI 1KYOH 2IYOA 4BRYA 1S5LE 5CCHD 2B88A 1AVOA 2JR8A 2J59M 4I6MC 1NAFA 1JM0A 1T3UA 1M56D 1MV8A 3A0BH 2AXTE 2B9BA 3EFFK 1YHQP 2XU6A 3CD6P 3L71J 2OTKE 1E5WA 1KFMA 2QIWA 3EFGA 3L35A 1BE3D 4GDOA 2M0BA 5KAFH 1AV1A 3BCCE 1FOSE 4H0LD 1RQUA 3L74D 4DOJA 2HPCB 4GT1A 2Q3EA 1FZBA 2E76C 2QA4P 1SQBD 5KJ7D 4W80A 1PZQA 2LXBA 4N3YB 1ZR4A 1PIXA 4C7NA 1OFCX 2K88A 5KLIB 2LXCB 2ZJSE 4WY4D 1JUNA 2M5AB 2K9JA 5AVVB 3UIAA 3D6YA 2Q3IA 3WUVA 1IFJA 5KLVK 3V6IA 2O01N 2FFDC 1BDDA 1N7SA 2H88C 1HGVA 1PP9G 1U7MA 3V2QA 3O8ZA 4R4MA 2K37A 1EZVG 1T6AA 1VQLP 1RF1B 1LT9A 2N1TC 2E74C 4L73A 2L5GB 1NTKG 1NU1J 1VF5B 1QEXA 4NPDA 5CCGD 2JKVA 5H2FH 1IFIA 1SQVJ 5KLVG 3T97B 1NAYA 3VN0A 1NTMK 1LTBC 3L70E 5AVYB 2N9YB 4AQRD 2XDJA 3L75G 3RK3C 4GKGA 1RE4C 3Q1MA 1XTGB 3TGUG 4AUWA 4HKZH 1S72P 3CCRP 3KDPB 1XTCC 5B66E 1URQC 2L91A 1P84D 2YMYA 3CX5E 3H1JG 1NGMB 2NPSA 5KTBA 3CXHD 1PP9D 1NTMG 1OIPA 1L4AC 3V2NA 1EZVD 2UWJE 1S9KD 2P7JA 1RF0C 5BVZA 3MHVA 4IFDK 1FDIA 1LWUB 1NHLA 4CPGA 1FBMA 3CI9A 1HJ0A 1SFCB 1H89A 3H1HE 2QM8A 2K9YA 4UB8E 3LIDA 4Y99B 1KQGB 3V4QA 1K05A 4W7ZA 1NTZK 1IFPA 1QVFO 3L75D 1FDMA 3NFQA 1LJ2A 1L0NK 4O9BA 1EDIA 1KYOE 1SQXE 3OJAB 3H1LE 4K35A 1Y47A 3VTPC 3D6ZA 2QRXA 1RH5B 3H1JD 1VF5D 4OH8B 2YO2A 1EC5A 1NTMD 1NTZG 3HD7C 3I5CA 2C0XA 4QMAA 1H0TB 2WSEH 1L0NG 3HE5B 2E76B 1OW6A 2OYHA 1MFZA 2M8RA 3BATA 3LIEA 2BCCE 2FYUE 3F5HA 4JYBA 2CPBA 1HUCA 3V2PA 2ZAEB 1LTIC 1WT6A 4GODA 2W27A 2PRRA 4NPEA 2WVRA 1T8ZA 3RBZA 1BGYG 2IPPA 1NKNA 2RH0A 2FXOA 1DEBA 1AQ5A 2WQYC 1SFCD 3VP8A 1GMJA 2N1TB 4HYTB 1JTHA 1NTZD 1RE3C 2HG5D 1FE6A 1FZAA 1YIJP 1FZCC 5KKZC 3TSIA 4YPCA 1L0ND 1GK4A 1VQ9P 4Y28J 2IFMA 3P8MC 2JO1A 2HLOA 1ZMEC 2YIUC 2XZRA 5H2FE 5AVQB 1P84I 3B5NA 3H1IE 1NTKJ 1G1IA 2OTLP 2A06D 5K5GB 4C46A 2GA1A 1PPJE 4KJMA 3N7NA 4PD4I 2QJPC 4AYCA 4PD4H 1N73B 3H6PA 5APXA 3L71G 5CCGC 2JEEA 3IFMA 1RHZB 3TF5A 1AVYA 2E76D 2V7QJ 3BCCJ 4N78E 2LKMA 1PGPA 2KOGA 4EI2A 1IK9A 1QL2A 3BRVB 1HBWA 2FYNC 3NTNA 1YJNP 2P10A 4L74A 2OGUA 3Q5SA 1NU1K 2C9LY 2FKWB 1SQVK 2JDIH 5KLIC 3L71D 4RKUJ 2N1TD 4WWIA 2OYIB 4BRYB 3CCEP 1IFMA 1X8YA 1BE3E 4I7ZB 3HD7B 4U7JA 1NU1G 4C7RA 2WSCJ 1S2EA 4RESB 1ZR2A 1SQVG 3AECC 2YNYA 1OWAA 4WBAA 4U3FE 1RF1C 1SQBE 2Y0DA 1U57A 3L70J 3AEDC 1VF5C 2PAJA 1VDFA 1DD4A 3V5BA 1SQPK 1YQ4C 1W2EA 3TNUA 1GU4A 1NWQA 4R4LA 2IFNA 3CMAP 1X22A 2I1JA 3AE8C 2YXRB 3GF7A 3AEBC 2YXQB 2KUBA 2GM4A 1L0LE 3M0DA 4BWNA 2FY8A 2D2CC 1LTJA 2K9JB 2V4HA 1CI6A 3G9RA 3JSVC 4H13B 1NU1D 3FWLA 1FZCB 4DT0A 1J1DB 1SQVD 4HH2A 3H1HJ 1BGYJ 1N7SB 3H1KE 1UIIA 1T2KD 3H32A 1YJWP 3CMEP 4H44B 2XNXA 2H8PD 2AEMA 1LT9B 1LWUC 3L37A 2IBZG 2B87A 4RO0A 1SFCC 4W7YA 3K5BA 4YXWH 5B5EE 1YI2P 2O1KA 3IF4A 2QJPB 4EDFA 3HTKA 1SQXJ 3PP5A 3GLMA 1P84E 3HD7D 5AW0B 4IL6E 1N2DC 1M57D 4PD4E 3G6EP 1TU3F 1G1JA 3PHLA 4OVNF 1SLQA 1SQPD 5CCHA 5AVZB 3L72E 2OARA 2SPZA 3BVHA 4IOIH 5BU8B 2FYNB 3CWBE 2ZVNB 3RL0g 3A5TA 2WT7B 3BRTB 2QEXP 2BCCJ 2FYUJ 3F89A 4HJGH 5AW9B 3P8CD 3ITKA 3IAOA 1OZHA 2KLVA 2ZYAA 1N86A 5GTIH 1X0TA 3TYYA 3TK1A 4TT3H 4H13D 3H1JE 1NTKK 1M1JA 1VPCA 3FX0A 5KJ7A 1N7SD 1LNQA 1USDA 1DEEG 3QWOC 4H44D 1IZNB 5APSA 2K3RA 4WY4A 2H7HA 4KT0J 2G8YA 2R5DA 1Q86Q 4DCKA 1KZUB 3H1IJ 1JMMA 3USSA 1FZGA 3VMYA 3QH9A 2KSEA 3GHGA 4MN4C 1D7MA 2ZXXA 3VMZA 1KILC 3M0AA 1CSBA 1K73Q 3SWYA 1Q7YQ 2OYHB 3MUDA 1KB9D 2WTYA 1HWTC 2KP8A 1JY3P 4RJTA 1KQFB 3BCCG 2XKMA 2D2CB 1N73C 1EQ7A 3IR9A 1OVRA 4YXDC 1SS1A 3WMM0 3C1LA 1GL2C 1JEKA 1ZRTD 1GW4A 3Q5RA 1VQ7P 2HODB 5AW8B 1BSHA 3P7KA 1ZP0C 2E5YA 2ITAA 2O01J 3M9BA 3V2RA 1NTKD 1JTHB 1OX3A 2O01H 1OVVA 1VQ4P 2A06E 1Q81Q 1LP1A 1E79H 2R3CA 5KLVD 4OGQB 1SQQE 3VMAA 2C0WA 4UB6H 1FU1A 2C9NY 1LT1A 3MZWB 3CC2P 1T2KC 5M1BA 2HYNA 1VQMP 1GK6A 3TGUD 1USEA 4JF7A 1SVFA 3LW5H 3L73E 1HGZA 1ZOYC 2E42A 2POHA 3BCCD 2FBWC 2HFED 2IZ0A 3GMAA 4IFMA 5AVXB 1NVOA 2OYIC 3JC22 1S4XA 1IO4A 4U3FJ 2BEQD 2WPVB 2A45G 3NMDA 3L70G 4I7ZC 1MUUA 1FJKA 2ZT9B 2WSEJ 2GUSA 1K04A 3VP9A 3U1AA 3PRJA 5AW2B 2Z5HA 1JY2O 5AW4B 1OXZA 3II6A 2D2CD 4JYCA 2Q1KA 1WRGA 4IL6X 3CLQA 1T3JA 5AVSB 1BDCA 3B4SA 3AE5C 3M9HA 1L0LJ 3S4RA 2R3SA 2KYVA 4KHXA 5GTIE 2KXPB 3VYIA 1KC8Q 1QL1A 1IFNA 1J2JB 1R5LA 3CPWO 3KHUA 5CMZA 3HUSA 3H1HG 2Q7CA 2JJLA 3RK3E 5APVA 2YMKA 3H1KJ 2KS1A 4B86A 3TDKA 3CCLP 4H13C 3WU2E 2E5TA 2IX7C 2QVAA 4OGQD 4L76A 3SFEC 4DZOA 5CHXA 1J1DC 3SWFA 1GW3A 3AE9C 1LTAC 1N7SC 2JWDA 2KLUA 5B5EH 2PP6A 4TLFA 1SQXG 3H1LG 4PV1D 4H44C 1KILB 3C9IA 2OTJP 1LT9C 2FYUK 3CX5D 1P84H 4GOFA 1FOSF 1LTSC 1GU5A 4IL6H 3CXHI 3CXHH 3HE4B 4GIFA 3BASA 4LLHA 1YITP 1EZVI 2ZT9D 1JO5A 1GL2B 1Q2NA 3TNUB 1EXIA 2K1AA 1KQLA 2WSFH 4D6TE 1U7JA 3L72J 1G2CB 1BGYD 3FXEA 1Q90D 2BCCG 2FYUG 1NH4A 3CWBJ 3CCQP 1FS0E 1LTJB 1BCCE 1CI6B 2AEFA 2FXMA 2FYZA 1BSNA 2NPSC 3M06A 1OMIA 1M8OB 1KYOD 1QGKB 3D70A 1RQVA 1FAVA 2LR2A 3HE5A 3E1RA 3H32B 1W5CE 4ZKUA 1IFDA 3I55P 2B87B 2P58A 2XNDH 2QJYB 4UB6E 3L36A 4PJ0H 4K3AA 1FC2C 2OQQA 3O6QA 4EYYQ 1SQPE 1VL2A 3GW6A 3Q2YA 2WSSH 2FFDA 2BCCD 2FYUD 4A7PA 3H1IG 3L74E 3WUTA 1KILD 3MGNA 3SSUA 2N1TA 1EDJA 1YJ9P 3AE1C 1JOCA 4JQ0D 2Y9ZA 1NKZB 3PH0A 2W8ZA 2QE7H 1GL2D 3V4WA 4IFFA 3CCSP 1NOHA 1RE4A 2KK7A 2OYHC 1QX8A 5AVTB 4C7NB 5TJHA 1URQA 3A0HH 2W90A 1DX7A 1M1JB 2W83C 2KZIA 3H1ID 2Z5IA 1GTWA 1L4AA 5AW5B 3EQ2A 1RF0A 5E79H 4Z1MH 2I8DA 1SQQJ 4EIJA 1IC2A 2W6AA 2H89C 1YTZI 1J1EB 3L73J 2M3BA 4N78D 4OGQC 3RK2B 3RL0B 3VMXA 3Q3DA 2PFXA 3H1LJ 1ZRTE 1KMIZ 4DJGA 4U3FG 2ZFCA 3CXHE 1SQBG 2P67A 1FJPA 2QG4A 1PP9E 4I2LC 4PV1C 1QVGO 1L0LK 2J5UA 3B5NC 5APUA 1DH3A 2Y0EA 2OYOA 1EZVE 1S9KE 1OVUA 5AVUB 2AEJA 1ZLLA 5AW7B 2KIKA 3PTZA 1NTKE 2AXCA 3HD7A 5TISE 1X79B 2GUVA 2NPSB 2ZT9C 3KPEA 5KLVE 2RN0A 3AEAC 5APQA 2PGDA 3CC7P 1EXJA 1L0LG 3OW2O 2IBZD 3L75E 3SWKA 3G71P 3TGUE 1H8AA 1MZ9A 1DD3A 2WPRA 4LGDE 1FZFA 2QSIA 3SFDC 3CCJP 2ZYDA 3AEGC 1LP1B 3Q5PA 3U1CA 1JB0J 2WPSA 3H1KG 4U3FD 1GZLA 1NTME 1S3JA 5AW6B 3KZIE 3R4YA 4PJ0E 3C8VA 3W68A 3NXSA 1JCCA 3WU2H 2KB7P 1RE3A 1FZCA 3H25A 1Z56A 1GDTA 1EDKA 3RK2D 2KNCA 3VOPA 3RL0D 1HVVA 1NO4A 4ZKPA 3G3ZA 1L0LD 4OWFA 1HF9A 5AW3B 1UIXA 5CBNA 2NZ2A 5AVRB 3L72G 2H43A 2M3EA 2ZXEB 4D6TJ 5APYA 4EOTA 1DIPA 2Q5UA 5CCGA 4YTPC 1NJIQ 1CZQA 3CWBG 1M90Q 3H1KD 2VRSA 2WMMA 1KN7A 2NPSD 1NTZE 1SP4A 1KFNA 2E75B 5AW1B 5GTHE 1L2PA 1BCCJ 3MP7B 3A0HE 1L0NE 3HUSB 1R8EA 4GOEA 2MJZA 3M0DC 1KORA 1LTJC 1W2BO 2KS1B 4LC1A 5E79E 3ZDMA 2WT7A 4PD4D 3P32A 3RBXA 3KYQA 3N4XA 2HPCA 3PLNA 4HB1A 2I1KA 2BASA 5C39A 2WZ7A 2MKVA 1LGHB 4JBZA 1SQPJ 1M7LA 2QM7A 3L72D 3WUUA 3LW5J 4PV1B 1BGYE 2W6BA 2QJKC 3B5NB 1BE3J 1KD1Q 2M5AA 2W6JH 3CWBD 4ASVA 2QJYC 1NYHA 5L8RJ 1LTGC 2YO3A 3L74J 2ZVOB 2E43A 1PGJA 1YBKA 1JY3N 1OW7A 1JMBA 1AA0A 2IBZI 1SQBJ 1GD2E 1AFOA 1VQ8P 5APTA 3AE3C 3M91A 2R32A 1RF1A 5DJTB 2Q6QA 1PFIA 3A0BE 2O1JA 3M9QA 4N6JA 5CCHC 3CL3D 1HTLC 3G4SP 3JCUH 1SQQK 3L71E 1KTMA 3T97A 3AEEC 3W67A 3KQGA 2E75D 1FZEA 5KAFE 2KZJA 2RKLA 3AE7C 1VQKP 1HJBA 5CJ0A 2WWWA 2KSJA 2JWAA 3OA7A 1S5LX 1SQXK 1ZW0A 2A06G 1KILE 1N8RQ 1ZV8A 2WITA 4H0LC 1SQQG 1ZXGA 3O6QB 3A3YB 2HODA 2BEZF 3RGUA 3L70D 1M1JC 2P1JA 2FFDB 3GF3A 4WB4A 5KJ7C 3E7KA 4ZMDA 2DW3A 3L73G 1KB9I 1KB9H 1LWUA 4WY4C 1VQOP 3KXDA 2E74B 1AJYA 1SFCA 3B5ND 4I1LA 2Q9IA 1PGOA 1PL5A 3I56P 4BXLA 4L75A 1PP9J 1HH0A 5KAIH 5EFWB 1J1EC 2JP3A 2O3JA 5CJ4A 1VQ6P 3MTUE 3RK2C 3RL0C 2YKOA 3GHGC 1NU1E 2WSFJ 1LTTC 3RK3B 2R5BA 2FXPA 1S5LH 2IZ1A 1SQVE 3MUDC 3ABVC 3H1HD 5TISH 5KLVJ 1SQQD 3B71A 1URQB 2AXTH 1Q82Q 1EDLA 4WVZA 2P2UA 1OW8A 2ZYGA 4XFJA 1A02F 3L75J 1AQTA 3TGUJ 5APWA 4XA4A 1H0TA 3L73D 1L4AB 1IJDB 1SQXD 3B8EB 2V7QH 3H1LD 1MKMA 1VQ5P 3FGAD 1JY2P 3H1JJ 1VQPP 5AVWB 2Y9YA 1NTMJ 3A7OA 2QJKB 1IK7A 1A02J 1YTZT 1CW5A 3KZIH 2XV5A 3E1IA 2CPSA 1MFTA 1M1KQ 3FXDA 1K9MQ 3HTKB 3R2PA 3D71A 4ZNCA 2IYPA 3CC4P 1RY3A 1JCDA 2KI7B
chains in the Genus database with same CATH topology
4UB6E 5E79E 5GTHE 1S5LE 4IL6E 4UB8E 3KZIE 5TISE 3A0HE 4PJ0E 5KAIE 3JCUE 1W5CE 5B5EE 2AXTE 5KAFE 5B66E 5H2FE 3WU2E 5GTIE 3A0BE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 E;  5E79 E;  5GTH E;  1S5L E;  4IL6 E;  4UB8 E;  3KZI E;  5TIS E;  3A0H E;  4PJ0 E;  5KAI E;  3JCU E;  1W5C E;  5B5E E;  2AXT E;  5KAF E;  5B66 E;  5H2F E;  3WU2 E;  5GTI E;  3A0B E; 
#chains in the Genus database with same CATH topology
 1PGQ A;  3MIW A;  2N9B A;  2E74 D;  3P8C E;  3CCM P;  1PPJ G;  2IBZ E;  3AE2 C;  2J58 A;  2RMZ A;  3AE4 C;  1VQN P;  3GG2 A;  2WSC H;  4D6T G;  5CBO A;  1KV4 A;  4JPZ B;  3MD0 A;  3CCV P;  2IDB A;  1KIL A;  4M3L A;  3RK3 D;  3CCU P;  3PJS K;  3JCU E;  2Z4E A;  1NTZ J;  1QLE D;  2WPQ A;  3HRN A;  5BU5 A;  1BCC G;  2A45 I;  3IN6 A;  3EWK A;  3HE4 A;  2A45 H;  2CK3 H;  1R5S A;  1JY2 N;  1URQ D;  2R44 A;  1N73 A;  5GTH H;  4NPF X;  1YYC A;  1L0N J;  1WMK A;  1GL2 A;  4H0L B;  3FWN A;  2HR3 A;  3A2A A;  2E75 C;  1L4A D;  5B66 H;  4XE5 B;  1G2C A;  3OAK A;  2Y0C A;  2B89 A;  3CX5 I;  3U59 A;  3CX5 H;  3AE6 C;  1PV3 A;  1X9V A;  1YQ3 C;  1PPJ D;  3HUS C;  1KQS O;  1SQB K;  4WY4 B;  3AEF C;  1FDO A;  1SQP G;  3L4F A;  2YKP A;  1H88 A;  5KKZ B;  4D6T D;  1KB9 E;  1BE3 G;  1ZN5 A;  4ASW A;  2YKQ A;  2KNC B;  1Y9B A;  1N7L A;  3L74 G;  4UB8 H;  2G3A A;  3GHG B;  5DJU B;  2YIU B;  1BCC D;  2NRG A;  3S1K A;  5KAI E;  1Y8A A;  1JNM A;  1JY3 O;  3S9O A;  4Y99 C;  2OYI A;  1K8A Q;  1S1C X;  1KYO I;  1KYO H;  2IYO A;  4BRY A;  1S5L E;  5CCH D;  2B88 A;  1AVO A;  2JR8 A;  2J59 M;  4I6M C;  1NAF A;  1JM0 A;  1T3U A;  1M56 D;  1MV8 A;  3A0B H;  2AXT E;  2B9B A;  3EFF K;  1YHQ P;  2XU6 A;  3CD6 P;  3L71 J;  2OTK E;  1E5W A;  1KFM A;  2QIW A;  3EFG A;  3L35 A;  1BE3 D;  4GDO A;  2M0B A;  5KAF H;  1AV1 A;  3BCC E;  1FOS E;  4H0L D;  1RQU A;  3L74 D;  4DOJ A;  2HPC B;  4GT1 A;  2Q3E A;  1FZB A;  2E76 C;  2QA4 P;  1SQB D;  5KJ7 D;  4W80 A;  1PZQ A;  2LXB A;  4N3Y B;  1ZR4 A;  1PIX A;  4C7N A;  1OFC X;  2K88 A;  5KLI B;  2LXC B;  2ZJS E;  4WY4 D;  1JUN A;  2M5A B;  2K9J A;  5AVV B;  3UIA A;  3D6Y A;  2Q3I A;  3WUV A;  1IFJ A;  5KLV K;  3V6I A;  2O01 N;  2FFD C;  1BDD A;  1N7S A;  2H88 C;  1HGV A;  1PP9 G;  1U7M A;  3V2Q A;  3O8Z A;  4R4M A;  2K37 A;  1EZV G;  1T6A A;  1VQL P;  1RF1 B;  1LT9 A;  2N1T C;  2E74 C;  4L73 A;  2L5G B;  1NTK G;  1NU1 J;  1VF5 B;  1QEX A;  4NPD A;  5CCG D;  2JKV A;  5H2F H;  1IFI A;  1SQV J;  5KLV G;  3T97 B;  1NAY A;  3VN0 A;  1NTM K;  1LTB C;  3L70 E;  5AVY B;  2N9Y B;  4AQR D;  2XDJ A;  3L75 G;  3RK3 C;  4GKG A;  1RE4 C;  3Q1M A;  1XTG B;  3TGU G;  4AUW A;  4HKZ H;  1S72 P;  3CCR P;  3KDP B;  1XTC C;  5B66 E;  1URQ C;  2L91 A;  1P84 D;  2YMY A;  3CX5 E;  3H1J G;  1NGM B;  2NPS A;  5KTB A;  3CXH D;  1PP9 D;  1NTM G;  1OIP A;  1L4A C;  3V2N A;  1EZV D;  2UWJ E;  1S9K D;  2P7J A;  1RF0 C;  5BVZ A;  3MHV A;  4IFD K;  1FDI A;  1LWU B;  1NHL A;  4CPG A;  1FBM A;  3CI9 A;  1HJ0 A;  1SFC B;  1H89 A;  3H1H E;  2QM8 A;  2K9Y A;  4UB8 E;  3LID A;  4Y99 B;  1KQG B;  3V4Q A;  1K05 A;  4W7Z A;  1NTZ K;  1IFP A;  1QVF O;  3L75 D;  1FDM A;  3NFQ A;  1LJ2 A;  1L0N K;  4O9B A;  1EDI A;  1KYO E;  1SQX E;  3OJA B;  3H1L E;  4K35 A;  1Y47 A;  3VTP C;  3D6Z A;  2QRX A;  1RH5 B;  3H1J D;  1VF5 D;  4OH8 B;  2YO2 A;  1EC5 A;  1NTM D;  1NTZ G;  3HD7 C;  3I5C A;  2C0X A;  4QMA A;  1H0T B;  2WSE H;  1L0N G;  3HE5 B;  2E76 B;  1OW6 A;  2OYH A;  1MFZ A;  2M8R A;  3BAT A;  3LIE A;  2BCC E;  2FYU E;  3F5H A;  4JYB A;  2CPB A;  1HUC A;  3V2P A;  2ZAE B;  1LTI C;  1WT6 A;  4GOD A;  2W27 A;  2PRR A;  4NPE A;  2WVR A;  1T8Z A;  3RBZ A;  1BGY G;  2IPP A;  1NKN A;  2RH0 A;  2FXO A;  1DEB A;  1AQ5 A;  2WQY C;  1SFC D;  3VP8 A;  1GMJ A;  2N1T B;  4HYT B;  1JTH A;  1NTZ D;  1RE3 C;  2HG5 D;  1FE6 A;  1FZA A;  1YIJ P;  1FZC C;  5KKZ C;  3TSI A;  4YPC A;  1L0N D;  1GK4 A;  1VQ9 P;  4Y28 J;  2IFM A;  3P8M C;  2JO1 A;  2HLO A;  1ZME C;  2YIU C;  2XZR A;  5H2F E;  5AVQ B;  1P84 I;  3B5N A;  3H1I E;  1NTK J;  1G1I A;  2OTL P;  2A06 D;  5K5G B;  4C46 A;  2GA1 A;  1PPJ E;  4KJM A;  3N7N A;  4PD4 I;  2QJP C;  4AYC A;  4PD4 H;  1N73 B;  3H6P A;  5APX A;  3L71 G;  5CCG C;  2JEE A;  3IFM A;  1RHZ B;  3TF5 A;  1AVY A;  2E76 D;  2V7Q J;  3BCC J;  4N78 E;  2LKM A;  1PGP A;  2KOG A;  4EI2 A;  1IK9 A;  1QL2 A;  3BRV B;  1HBW A;  2FYN C;  3NTN A;  1YJN P;  2P10 A;  4L74 A;  2OGU A;  3Q5S A;  1NU1 K;  2C9L Y;  2FKW B;  1SQV K;  2JDI H;  5KLI C;  3L71 D;  4RKU J;  2N1T D;  4WWI A;  2OYI B;  4BRY B;  3CCE P;  1IFM A;  1X8Y A;  1BE3 E;  4I7Z B;  3HD7 B;  4U7J A;  1NU1 G;  4C7R A;  2WSC J;  1S2E A;  4RES B;  1ZR2 A;  1SQV G;  3AEC C;  2YNY A;  1OWA A;  4WBA A;  4U3F E;  1RF1 C;  1SQB E;  2Y0D A;  1U57 A;  3L70 J;  3AED C;  1VF5 C;  2PAJ A;  1VDF A;  1DD4 A;  3V5B A;  1SQP K;  1YQ4 C;  1W2E A;  3TNU A;  1GU4 A;  1NWQ A;  4R4L A;  2IFN A;  3CMA P;  1X22 A;  2I1J A;  3AE8 C;  2YXR B;  3GF7 A;  3AEB C;  2YXQ B;  2KUB A;  2GM4 A;  1L0L E;  3M0D A;  4BWN A;  2FY8 A;  2D2C C;  1LTJ A;  2K9J B;  2V4H A;  1CI6 A;  3G9R A;  3JSV C;  4H13 B;  1NU1 D;  3FWL A;  1FZC B;  4DT0 A;  1J1D B;  1SQV D;  4HH2 A;  3H1H J;  1BGY J;  1N7S B;  3H1K E;  1UII A;  1T2K D;  3H32 A;  1YJW P;  3CME P;  4H44 B;  2XNX A;  2H8P D;  2AEM A;  1LT9 B;  1LWU C;  3L37 A;  2IBZ G;  2B87 A;  4RO0 A;  1SFC C;  4W7Y A;  3K5B A;  4YXW H;  5B5E E;  1YI2 P;  2O1K A;  3IF4 A;  2QJP B;  4EDF A;  3HTK A;  1SQX J;  3PP5 A;  3GLM A;  1P84 E;  3HD7 D;  5AW0 B;  4IL6 E;  1N2D C;  1M57 D;  4PD4 E;  3G6E P;  1TU3 F;  1G1J A;  3PHL A;  4OVN F;  1SLQ A;  1SQP D;  5CCH A;  5AVZ B;  3L72 E;  2OAR A;  2SPZ A;  3BVH A;  4IOI H;  5BU8 B;  2FYN B;  3CWB E;  2ZVN B;  3RL0 g;  3A5T A;  2WT7 B;  3BRT B;  2QEX P;  2BCC J;  2FYU J;  3F89 A;  4HJG H;  5AW9 B;  3P8C D;  3ITK A;  3IAO A;  1OZH A;  2KLV A;  2ZYA A;  1N86 A;  5GTI H;  1X0T A;  3TYY A;  3TK1 A;  4TT3 H;  4H13 D;  3H1J E;  1NTK K;  1M1J A;  1VPC A;  3FX0 A;  5KJ7 A;  1N7S D;  1LNQ A;  1USD A;  1DEE G;  3QWO C;  4H44 D;  1IZN B;  5APS A;  2K3R A;  4WY4 A;  2H7H A;  4KT0 J;  2G8Y A;  2R5D A;  1Q86 Q;  4DCK A;  1KZU B;  3H1I J;  1JMM A;  3USS A;  1FZG A;  3VMY A;  3QH9 A;  2KSE A;  3GHG A;  4MN4 C;  1D7M A;  2ZXX A;  3VMZ A;  1KIL C;  3M0A A;  1CSB A;  1K73 Q;  3SWY A;  1Q7Y Q;  2OYH B;  3MUD A;  1KB9 D;  2WTY A;  1HWT C;  2KP8 A;  1JY3 P;  4RJT A;  1KQF B;  3BCC G;  2XKM A;  2D2C B;  1N73 C;  1EQ7 A;  3IR9 A;  1OVR A;  4YXD C;  1SS1 A;  3WMM 0;  3C1L A;  1GL2 C;  1JEK A;  1ZRT D;  1GW4 A;  3Q5R A;  1VQ7 P;  2HOD B;  5AW8 B;  1BSH A;  3P7K A;  1ZP0 C;  2E5Y A;  2ITA A;  2O01 J;  3M9B A;  3V2R A;  1NTK D;  1JTH B;  1OX3 A;  2O01 H;  1OVV A;  1VQ4 P;  2A06 E;  1Q81 Q;  1LP1 A;  1E79 H;  2R3C A;  5KLV D;  4OGQ B;  1SQQ E;  3VMA A;  2C0W A;  4UB6 H;  1FU1 A;  2C9N Y;  1LT1 A;  3MZW B;  3CC2 P;  1T2K C;  5M1B A;  2HYN A;  1VQM P;  1GK6 A;  3TGU D;  1USE A;  4JF7 A;  1SVF A;  3LW5 H;  3L73 E;  1HGZ A;  1ZOY C;  2E42 A;  2POH A;  3BCC D;  2FBW C;  2HFE D;  2IZ0 A;  3GMA A;  4IFM A;  5AVX B;  1NVO A;  2OYI C;  3JC2 2;  1S4X A;  1IO4 A;  4U3F J;  2BEQ D;  2WPV B;  2A45 G;  3NMD A;  3L70 G;  4I7Z C;  1MUU A;  1FJK A;  2ZT9 B;  2WSE J;  2GUS A;  1K04 A;  3VP9 A;  3U1A A;  3PRJ A;  5AW2 B;  2Z5H A;  1JY2 O;  5AW4 B;  1OXZ A;  3II6 A;  2D2C D;  4JYC A;  2Q1K A;  1WRG A;  4IL6 X;  3CLQ A;  1T3J A;  5AVS B;  1BDC A;  3B4S A;  3AE5 C;  3M9H A;  1L0L J;  3S4R A;  2R3S A;  2KYV A;  4KHX A;  5GTI E;  2KXP B;  3VYI A;  1KC8 Q;  1QL1 A;  1IFN A;  1J2J B;  1R5L A;  3CPW O;  3KHU A;  5CMZ A;  3HUS A;  3H1H G;  2Q7C A;  2JJL A;  3RK3 E;  5APV A;  2YMK A;  3H1K J;  2KS1 A;  4B86 A;  3TDK A;  3CCL P;  4H13 C;  3WU2 E;  2E5T A;  2IX7 C;  2QVA A;  4OGQ D;  4L76 A;  3SFE C;  4DZO A;  5CHX A;  1J1D C;  3SWF A;  1GW3 A;  3AE9 C;  1LTA C;  1N7S C;  2JWD A;  2KLU A;  5B5E H;  2PP6 A;  4TLF A;  1SQX G;  3H1L G;  4PV1 D;  4H44 C;  1KIL B;  3C9I A;  2OTJ P;  1LT9 C;  2FYU K;  3CX5 D;  1P84 H;  4GOF A;  1FOS F;  1LTS C;  1GU5 A;  4IL6 H;  3CXH I;  3CXH H;  3HE4 B;  4GIF A;  3BAS A;  4LLH A;  1YIT P;  1EZV I;  2ZT9 D;  1JO5 A;  1GL2 B;  1Q2N A;  3TNU B;  1EXI A;  2K1A A;  1KQL A;  2WSF H;  4D6T E;  1U7J A;  3L72 J;  1G2C B;  1BGY D;  3FXE A;  1Q90 D;  2BCC G;  2FYU G;  1NH4 A;  3CWB J;  3CCQ P;  1FS0 E;  1LTJ B;  1BCC E;  1CI6 B;  2AEF A;  2FXM A;  2FYZ A;  1BSN A;  2NPS C;  3M06 A;  1OMI A;  1M8O B;  1KYO D;  1QGK B;  3D70 A;  1RQV A;  1FAV A;  2LR2 A;  3HE5 A;  3E1R A;  3H32 B;  1W5C E;  4ZKU A;  1IFD A;  3I55 P;  2B87 B;  2P58 A;  2XND H;  2QJY B;  4UB6 E;  3L36 A;  4PJ0 H;  4K3A A;  1FC2 C;  2OQQ A;  3O6Q A;  4EYY Q;  1SQP E;  1VL2 A;  3GW6 A;  3Q2Y A;  2WSS H;  2FFD A;  2BCC D;  2FYU D;  4A7P A;  3H1I G;  3L74 E;  3WUT A;  1KIL D;  3MGN A;  3SSU A;  2N1T A;  1EDJ A;  1YJ9 P;  3AE1 C;  1JOC A;  4JQ0 D;  2Y9Z A;  1NKZ B;  3PH0 A;  2W8Z A;  2QE7 H;  1GL2 D;  3V4W A;  4IFF A;  3CCS P;  1NOH A;  1RE4 A;  2KK7 A;  2OYH C;  1QX8 A;  5AVT B;  4C7N B;  5TJH A;  1URQ A;  3A0H H;  2W90 A;  1DX7 A;  1M1J B;  2W83 C;  2KZI A;  3H1I D;  2Z5I A;  1GTW A;  1L4A A;  5AW5 B;  3EQ2 A;  1RF0 A;  5E79 H;  4Z1M H;  2I8D A;  1SQQ J;  4EIJ A;  1IC2 A;  2W6A A;  2H89 C;  1YTZ I;  1J1E B;  3L73 J;  2M3B A;  4N78 D;  4OGQ C;  3RK2 B;  3RL0 B;  3VMX A;  3Q3D A;  2PFX A;  3H1L J;  1ZRT E;  1KMI Z;  4DJG A;  4U3F G;  2ZFC A;  3CXH E;  1SQB G;  2P67 A;  1FJP A;  2QG4 A;  1PP9 E;  4I2L C;  4PV1 C;  1QVG O;  1L0L K;  2J5U A;  3B5N C;  5APU A;  1DH3 A;  2Y0E A;  2OYO A;  1EZV E;  1S9K E;  1OVU A;  5AVU B;  2AEJ A;  1ZLL A;  5AW7 B;  2KIK A;  3PTZ A;  1NTK E;  2AXC A;  3HD7 A;  5TIS E;  1X79 B;  2GUV A;  2NPS B;  2ZT9 C;  3KPE A;  5KLV E;  2RN0 A;  3AEA C;  5APQ A;  2PGD A;  3CC7 P;  1EXJ A;  1L0L G;  3OW2 O;  2IBZ D;  3L75 E;  3SWK A;  3G71 P;  3TGU E;  1H8A A;  1MZ9 A;  1DD3 A;  2WPR A;  4LGD E;  1FZF A;  2QSI A;  3SFD C;  3CCJ P;  2ZYD A;  3AEG C;  1LP1 B;  3Q5P A;  3U1C A;  1JB0 J;  2WPS A;  3H1K G;  4U3F D;  1GZL A;  1NTM E;  1S3J A;  5AW6 B;  3KZI E;  3R4Y A;  4PJ0 E;  3C8V A;  3W68 A;  3NXS A;  1JCC A;  3WU2 H;  2KB7 P;  1RE3 A;  1FZC A;  3H25 A;  1Z56 A;  1GDT A;  1EDK A;  3RK2 D;  2KNC A;  3VOP A;  3RL0 D;  1HVV A;  1NO4 A;  4ZKP A;  3G3Z A;  1L0L D;  4OWF A;  1HF9 A;  5AW3 B;  1UIX A;  5CBN A;  2NZ2 A;  5AVR B;  3L72 G;  2H43 A;  2M3E A;  2ZXE B;  4D6T J;  5APY A;  4EOT A;  1DIP A;  2Q5U A;  5CCG A;  4YTP C;  1NJI Q;  1CZQ A;  3CWB G;  1M90 Q;  3H1K D;  2VRS A;  2WMM A;  1KN7 A;  2NPS D;  1NTZ E;  1SP4 A;  1KFN A;  2E75 B;  5AW1 B;  5GTH E;  1L2P A;  1BCC J;  3MP7 B;  3A0H E;  1L0N E;  3HUS B;  1R8E A;  4GOE A;  2MJZ A;  3M0D C;  1KOR A;  1LTJ C;  1W2B O;  2KS1 B;  4LC1 A;  5E79 E;  3ZDM A;  2WT7 A;  4PD4 D;  3P32 A;  3RBX A;  3KYQ A;  3N4X A;  2HPC A;  3PLN A;  4HB1 A;  2I1K A;  2BAS A;  5C39 A;  2WZ7 A;  2MKV A;  1LGH B;  4JBZ A;  1SQP J;  1M7L A;  2QM7 A;  3L72 D;  3WUU A;  3LW5 J;  4PV1 B;  1BGY E;  2W6B A;  2QJK C;  3B5N B;  1BE3 J;  1KD1 Q;  2M5A A;  2W6J H;  3CWB D;  4ASV A;  2QJY C;  1NYH A;  5L8R J;  1LTG C;  2YO3 A;  3L74 J;  2ZVO B;  2E43 A;  1PGJ A;  1YBK A;  1JY3 N;  1OW7 A;  1JMB A;  1AA0 A;  2IBZ I;  1SQB J;  1GD2 E;  1AFO A;  1VQ8 P;  5APT A;  3AE3 C;  3M91 A;  2R32 A;  1RF1 A;  5DJT B;  2Q6Q A;  1PFI A;  3A0B E;  2O1J A;  3M9Q A;  4N6J A;  5CCH C;  3CL3 D;  1HTL C;  3G4S P;  3JCU H;  1SQQ K;  3L71 E;  1KTM A;  3T97 A;  3AEE C;  3W67 A;  3KQG A;  2E75 D;  1FZE A;  5KAF E;  2KZJ A;  2RKL A;  3AE7 C;  1VQK P;  1HJB A;  5CJ0 A;  2WWW A;  2KSJ A;  2JWA A;  3OA7 A;  1S5L X;  1SQX K;  1ZW0 A;  2A06 G;  1KIL E;  1N8R Q;  1ZV8 A;  2WIT A;  4H0L C;  1SQQ G;  1ZXG A;  3O6Q B;  3A3Y B;  2HOD A;  2BEZ F;  3RGU A;  3L70 D;  1M1J C;  2P1J A;  2FFD B;  3GF3 A;  4WB4 A;  5KJ7 C;  3E7K A;  4ZMD A;  2DW3 A;  3L73 G;  1KB9 I;  1KB9 H;  1LWU A;  4WY4 C;  1VQO P;  3KXD A;  2E74 B;  1AJY A;  1SFC A;  3B5N D;  4I1L A;  2Q9I A;  1PGO A;  1PL5 A;  3I56 P;  4BXL A;  4L75 A;  1PP9 J;  1HH0 A;  5KAI H;  5EFW B;  1J1E C;  2JP3 A;  2O3J A;  5CJ4 A;  1VQ6 P;  3MTU E;  3RK2 C;  3RL0 C;  2YKO A;  3GHG C;  1NU1 E;  2WSF J;  1LTT C;  3RK3 B;  2R5B A;  2FXP A;  1S5L H;  2IZ1 A;  1SQV E;  3MUD C;  3ABV C;  3H1H D;  5TIS H;  5KLV J;  1SQQ D;  3B71 A;  1URQ B;  2AXT H;  1Q82 Q;  1EDL A;  4WVZ A;  2P2U A;  1OW8 A;  2ZYG A;  4XFJ A;  1A02 F;  3L75 J;  1AQT A;  3TGU J;  5APW A;  4XA4 A;  1H0T A;  3L73 D;  1L4A B;  1IJD B;  1SQX D;  3B8E B;  2V7Q H;  3H1L D;  1MKM A;  1VQ5 P;  3FGA D;  1JY2 P;  3H1J J;  1VQP P;  5AVW B;  2Y9Y A;  1NTM J;  3A7O A;  2QJK B;  1IK7 A;  1A02 J;  1YTZ T;  1CW5 A;  3KZI H;  2XV5 A;  3E1I A;  2CPS A;  1MFT A;  1M1K Q;  3FXD A;  1K9M Q;  3HTK B;  3R2P A;  3D71 A;  4ZNC A;  2IYP A;  3CC4 P;  1RY3 A;  1JCD A;  2KI7 B; 
#chains in the Genus database with same CATH homology
 4UB6 E;  5E79 E;  5GTH E;  1S5L E;  4IL6 E;  4UB8 E;  3KZI E;  5TIS E;  3A0H E;  4PJ0 E;  5KAI E;  3JCU E;  1W5C E;  5B5E E;  2AXT E;  5KAF E;  5B66 E;  5H2F E;  3WU2 E;  5GTI E;  3A0B E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...