1KMIZ

Crystal structure of an e.coli chemotaxis protein, chez
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
209
structure length
177
Chain Sequence
SIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLSQDQVDDLLDSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
pubmed rcsb
molecule tags Signaling protein
total genus 62
structure length 177
sequence length 209
ec nomenclature
pdb deposition date 2001-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF04344 CheZ Chemotaxis phosphatase, CheZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.500 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1kmiZ02
1.20.5.590 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kmiZ01
1KMIZ
chains in the Genus database with same CATH superfamily
4NVPA 1MSWD 2N1TA 2GTSA 3MHVA 3C3SA 3MUDA 1NTMH 1BHAA 1K97A 4YIPA 4QMAA 2EBOA 2EX3A 2Z5IA 1Y74A 4PV1C 4GKKB 1EZVE 2C2AA 3P3PA 3OA7A 1X0TA 3KXDA 1BL8A 3L75H 3RGUA 2NPSD 1L1FA 3ZMVA 3RYCA 3L72J 3J81N 3K5OA 1CXZB 1JEKA 4EI2A 4GDOA 3O6QA 2JEXA 1EDJA 3SJCC 3JD3A 4D7TA 1KKDA 3ZN1A 2QGNA 4IL6E 2K1EA 1JQ0A 2YIUC 5DJUB 1SRYA 3CXHH 1VQ9P 2Y0PA 1KU9A 4DV4O 3H1HE 5EYPB 1ZL8A 3O65A 1US6A 4PD4F 2RH0A 2RDCA 2ZT9B 3CC2P 2C9LY 1EFRG 3H1IJ 3NFQA 3OR7C 5KLIC 1JY2O 2KZJA 1GL2D 1M7LA 2Q9LA 1T3JA 2FYUG 1YF2A 3RVZA 2E3CA 1SQXK 3PLNA 5CCHD 1R6NA 1R8EA 4K0KO 5TISE 3D3QA 3HUSB 4O2AB 2AZ2A 3G6BA 5DECA 3B4SA 1X59A 5LA6A 4U3FE 1R3IC 4H44C 1WNSA 3NMDA 2UUBB 4O4JB 4UCTA 1RF0A 4Y99C 1PGPA 5KKZB 2P1JA 3T97B 1BGYH 5B3SB 2MKVA 1OFCX 4JYYA 1ZP0C 1NU1E 1OJHA 2ZXWC 2FB5A 2LFSA 2WSSH 3CE2A 3ZHVA 5EFWB 1JCCA 4LF9O 2JEUA 3VBBA 4FVMA 3RGBA 4JAVA 3AEGC 4LF7O 5EYPA 4R4LA 5KLVJ 4O4IB 3TSIA 1S77D 3T4ZA 1OZHA 3LDEA 2J59M 1M57C 1GU4A 1OCRC 5LGUA 1AV1A 3CWBG 4OPAA 5IJ0A 5JJJB 2EIKB 2WSFH 3O9OA 1WB8A 3RWRD 2W6IG 1M1KQ 4HH2A 3ZX6A 4LFAO 1K9MW 1SKVA 4X62O 2XUMA 4GLXA 3K5LA 3WUUA 3HUSA 4O2AA 4C7NA 2QM4A 2YI8A 1HNWO 3QH9A 2VQFB 1LR1A 1EZJA 3K04A 3CX5D 1VP7A 4I0XB 3AK2A 3FX7A 2YMKA 4O4JA 5AW3B 2WPRA 1SQBJ 2E43A 3T97A 5LMNO 1Y76B 4BAYA 1P84I 2X7RB 2J58A 2OCHA 4OWFA 4KJMA 3ZMTA 1KBHA 1B04A 1RM1B 2WITA 3OJAB 1YTFB 1LTAC 2IBZI 5CBHA 2V7QG 3MDSA 2D2CD 1NTKJ 3U1CA 1N34B 2QWNB 1QL2A 4O4IA 1Q86W 1HR0O 3ZEDA 4OGQB 4MW8A 1N7SC 3K0GA 2YDEA 4D6TH 3MD0A 1NVOA 4P2ZA 1PP9J 4PJ0Z 1F7YA 1AR4A 4Z2WA 1N0JA 5BU8B 4IGGA 4GT1A 1KILC 3X2QC 3LW5H 3M0AA 3MTUE 5AVTB 4LGDE 3SYPA 1QLEB 3WB0A 1W0KG 1BCCJ 3KDPB 1K34A 3L36A 4WY4C 3KCXA 2PUSA 2L6LA 2EZOA 4FFBA 1URQC 4WVZA 3V4WA 1VF5C 1THZA 4I0XA 2HVJC 4LF6O 1SQVD 3H1JD 4GOEA 1J1DC 1JA8A 3K08A 1DD4A 5E79H 4YHHB 2N74A 1IXMA 3SDLA 3GF7A 1Y76A 3HE5B 3P3NA 2KK7A 4FLYA 1NTZK 4KL1A 3NR7A 2KIKA 1K5SA 3RN4A 1OCZB 1EQ7A 3RK3B 2WLLA 3QF7A 5DEDA 5L3BA 4XDLA 4FK5C 1IZ3A 2KZIA 1VMGA 3CWBE 1XTGB 1KP2A 4LBEC 1NVPD 2ITAA 2XASA 3CYOA 3L74D 3JYCA 4JV5B 3P8CE 3JATB 2ZNJA 3V2PA 2WZ7A 3V5BA 2XAJA 4DV7O 2PY5A 4C7RA 3ZRWB 1N7LA 2IFMA 2AXTE 1CPYA 2BSKA 1XNRB 1NJIQ 1RPOA 1NT2B 1YBKA 1WA8B 2H94A 2QRXA 1F4NA 1CZQA 1VQLV 4KHXA 3HE5A 4Q20A 1Q2NA 1BQZA 2LO1A 2OWOA 2XV5A 3W68A 3RK2B 3UM7A 2N05A 5GTIE 1XNQB 5KUKA 5F2VO 1XMOB 4PD4I 1J1EC 3V4QA 3CB2A 3JAMN 1FOSE 1VQNV 4K8XA 2CTWA 1HNXO 1SQXD 3AECC 3L73E 4CH5A 2M7WA 1Y9BA 2DYSB 4UCUA 2E5YA 4UVBA 1FZCB 1Q90D 3SPGA 1JY3P 2R3SA 3L72G 4WBAA 5IDJA 5B1BB 1SQQH 3OMNB 1J5EO 1SQPJ 3AG2B 4UCRA 2OCCC 1FJKA 4DW1A 3OEEG 3ZRWA 3SFDC 1ZRTE 2WA3A 4DT0A 5LL6Y 1LTSC 1ZW0A 3U10A 2EJRA 3J7AU 3VQXA 3IGAC 5TISZ 2ZR2A 3H1IG 2R5DA 5EK0A 1PFIA 4UB8H 1XHZA 3KPEA 1FFXB 1MG1A 2WSEJ 3HPLC 2Z4EA 3H1KH 3ETQA 4D7SA 2WLKA 1GRJA 3ZJZA 3CPWU 2Q3EA 3L71H 3U0ZA 4H44D 3VQWA 1FZCA 1IXBA 2HYNA 3D6YA 2BEZF 1Q82Q 4X65B 5AW8B 1H2GA 5JVDB 4OPHA 4DV6O 2QM8A 2BCCD 2E74C 2P06A 2K9PA 2M3EA 3BASA 1RF1B 1DTOA 4X89A 3DGEA 5KAIH 2WSFJ 3CCLV 3CCVP 2R70A 1ZSPA 5B66H 2G3AA 1L0NK 3AE7C 1JJ2U 3B40A 3TCUA 1OMIA 5KLVG 1FZGA 1W2EA 1VF6C 3AE9C 2ATKC 4J11A 2Q6QA 1Q8IA 5H9CA 4XA4A 5KX5B 3OUFA 1MMMA 3OR6C 3A0BH 2X6AA 1GAXA 5CCGC 2A45I 1UPGA 2LXBA 2NPSA 3OD4A 1OCOB 1E79G 1N33O 4K35A 1BT8A 2FY8A 1FFXA 4WFFA 3WB2A 2P90A 3WFVA 4JI4O 1F23A 1H2SB 3EVKA 5AW0B 1VQ8V 4H13C 1JY3N 2OQQA 1M93A 5B1AC 1UIXA 1HGVA 5GTHH 2Y48A 1M1KW 3JASB 5JH7A 3GWKC 3L72E 5L8RJ 1KTMA 1KV4A 1MABG 1SQBG 1K5QA 3M8AA 2KKWA 5JVDA 3T1HB 3QO7A 3K9AA 2XOKG 1SLQA 4DUYB 3L9DA 3T1YO 3L75D 1S9KE 5APXA 1HBWA 2AHYA 4DR1O 1GW3A 2XNDG 1GL2A 1MZFA 3FWNA 1NTZD 3BA9A 4JF3A 2PTMA 1NTKG 2YKOA 2CTRA 5CCHA 1D7MA 3N2KB 3HRNA 2A45G 3BCCD 2QG4A 1Q6HA 3K0DA 3GW6A 4ZIBA 3K06A 4I1LA 3NTNA 1M56D 3IAOA 1PP9G 1VF7A 1MNGA 3SFEC 2WLNA 1A02F 2DYRC 2YEVB 3QTCA 1NU1J 4DV1B 1NO4A 2YIAA 1QVGO 3STZC 1LWUC 4I7ZB 5IE9A 1KP3A 3V2NA 2QJPB 2RJZA 2Y69B 4X8AA 4GIFA 1B6QA 2FBWC 3GMAA 1A02J 1CP9A 2F43G 4MVSA 3KZIE 5JJEB 1BCCG 4N78E 1KQSU 3PTZA 4TUYA 1URQD 1VF5D 3CSXA 1J95A 5ITZB 1FXHA 4JI7O 1T3UA 2D2CB 5CJ0A 4TQDA 2LFRA 2YSUB 3RBXA 4JYAO 2YKPA 1KB9F 4HYOA 1FXVA 3HE4B 1A32A 4WWIA 4WFHA 1OZ0A 3VMZA 5KLVE 3PJSK 2Q7CA 3TXSA 1RE4C 1R6KA 3I56V 3CMEV 1KECA 2H89C 1BGYD 2P10A 2FYUK 5LBQA 3N2KA 1GZLA 1SFCC 3APOA 1YI2P 3B5NC 5AVYB 5CA1B 4JGSA 1JMBA 3W7TA 3A2FA 4B3RO 1BE3E 3VP9A 3H9VA 2AXTZ 1FXKC 4NXMB 2YEVA 3BFRA 1FAFA 4YPCA 3WMM0 1H38A 3T4DA 1DLBA 2XZRA 3ABLB 3E8BA 4LC1A 2W83C 4DR3O 2XHBA 2A06D 2W8ZA 3L70D 2XTAA 1KYOF 3M0DC 3Q1MA 2H7HA 1SA0A 1SQBE 3S3WA 5ITZA 2NRGA 1GK9A 4CZZA 2OTLV 3AEEC 2JGDA 2PF4E 3H1JH 1AI5A 1AP6A 1VDFA 3HE4A 1KQSO 2KNCB 1R73A 3K57A 1NTKE 3LNMB 4MVOA 1IBMO 2Q7EA 2IZ1A 2PYLA 4DR4B 3IFMA 3OTOO 1QCEA 4JZ2A 1YXBA 5CA1A 3VTPC 1Y8AA 2ZM6B 3CMEP 3TGUJ 4GKJO 4JYBA 2EZPA 3FB8C 3K3WA 1NH2D 2B1IA 4GCZA 1JOCA 3SYCA 1QLNA 4PDVA 3AE1C 3ZBHA 1GM7A 1M1JB 2KLUA 3B09A 1TUBB 1SQPG 1S1CX 1N86A 4LF5B 1BCCE 1N73C 1G8MA 4TT3G 3SYQA 5EIBC 3Q5RA 3QO8A 4FLWA 2WLIA 4PD4H 4LNUB 2P4VA 3JC22 4W4LA 1AQ5A 1IBLB 2OGUA 1WT6A 5J2TB 3T1CA 3CLQA 3D36C 4JI3O 4AILC 1JFFB 2QJYC 3IF4A 1SS1A 2YUAA 1EZVI 1L0ND 4JF7A 2L5GB 2Q1KA 4X64B 3WU2H 1IURA 1K05A 3VMXA 1FDMA 1IK7A 2OTLP 1JY2P 3E86A 4JPRA 3ITKA 2KXPB 2I1JA 4AHCA 3AEFC 1ZUQA 4IL6X 1YCIA 4C46A 4MTGA 3CJHB 3CRQA 3HD7C 5LP6C 4JI0B 3BRTB 3ABKC 1S5HC 2F4VB 3WUTA 4LWSB 3AEAC 2OYHC 1QLED 3H1LJ 2UUAO 3SJAC 1UIIA 2EIJC 2GV9A 1SQFA 3CRAA 1EXJA 1NR1A 4DJGA 1M1JA 2VWKA 1TUBA 1WB7A 1AR1B 5KLIB 1WP7A 1PL0A 3ABMC 1I94O 3H32B 3S9OA 2O1JA 4LNUA 1U7MA 2IX7C 3L73J 2XKMA 2UXDO 3JCUE 5KA5A 1N36B 1V55B 1JFFA 3AEIA 1H89A 2P58A 1RE3C 1DGSA 3FKSG 4H44B 4I9QA 3L35A 2Z5UA 3SPCA 5LHGA 2Q8VA 4MT8A 4QJFB 2B9BA 2I1KA 4Y99B 2G8YA 1P7GA 4JTDB 2LP7A 1SF9A 3E35A 1S4XA 4NTWA 3G80A 3CJHA 2K1AA 3M9HA 4H13D 3KCYA 1N0NA 2ZXWB 1WAZA 1XDCA 1LTJB 4DUZB 1XMQO 1IFIA 4JBZA 4ZBMA 1HNZO 1P49A 4GX0A 4LWSA 3C3TA 2EILC 1WN7A 3OT7A 4B86A 1ZX3A 3E8FA 4A5UB 1SQPE 2QIWA 1USEA 1IK9A 1M57B 5APVA 1OCRB 4EEQA 3HTKB 4G28B 1ROPA 2M6YA 2BCCH 1L4AC 2HHHB 3CXCU 4HYTB 5BXZA 3UT5B 3H32A 1KC8Q 2M5AB 1OHHG 4JI6O 2OYOA 2PYJA 1GU5A 3E89A 1QVFU 2CTQA 1SQQD 2LXCB 1S5LX 4NPEA 1JY2N 3CX5F 1KB9I 1VQ9V 3WU2Z 3SPHA 2ZAEB 2DQ0A 2P7TC 1NU1G 2FYUD 4ZHQB 1FFTB 2YXYA 3CC2V 4B3TO 5C93A 1LUWA 1QR9A 1HP8A 3JAKA 2R44A 1GH6A 4TQFA 1EDLA 4WF9V 3TF5A 4DR7B 3I5DA 1LTJA 4BXLA 2PAJA 1P7BA 2QE7G 2JP3A 2M3BA 4FLVA 2Q5UA 2RQ6A 1RQVA 3OUSA 1M90Q 5GONB 2JJ2G 1GO3F 3H1KD 2YXHA 2RN9A 4JI2O 4DV2B 1H8AA 2XT9A 3HTKA 3L71D 2H8PC 5BR8O 1I08A 1M56B 1EN6A 5KMGB 1HWTC 3LUTB 3E8GA 4O4HB 3UIAA 2DWEC 1KYOI 5AW1B 3UT5A 1L0LJ 2B1GA 2M5AA 2WLHA 4ZOLB 3ABTA 1KILB 2CGNA 3X2QB 1NS1A 2YIDA 1SFCD 1NTZH 2BTQB 4ABMA 2FYNC 2JO1A 4IIJB 1WP8A 1ZAUA 3CD6V 4WY4B 1UJWB 1ENVA 3BCCH 2KB7P 1URQB 4FMTA 4JPZB 1VF5B 4BWNA 1BSMA 5KJ7C 4ZHQA 2FFDC 3A2AA 2EJ7A 5C8YA 1SQVJ 3P8CD 4JI5B 1ZV8A 2WPQA 3C1LA 1JVMA 5B5EE 1H2LA 1ZWIC 3TK1A 4R50A 1SQGA 2AZ0A 4R6ZA 4CS2A 5HFMA 3EFFK 2QEXV 2O3JA 1M4UA 3VMYA 1JTHB 3JSNA 5BY1A 1FE6A 2GA1A 4I4TB 2W27A 3M91A 5BMVA 4AQYB 1LT9C 2AHZA 4PJ0H 4ZI7B 4BIUA 5IJ9B 4D6TE 3B8MA 4J10A 4RQEA 3KYQA 2JDIG 2Y4UA 4CH6A 2ZIOA 1XEQA 5KMGA 4O4HA 2ZXXA 1NKZB 2Q69A 3ZRVA 3L74J 4ZOLA 1K33A 3ZHQA 1LTTC 2Y0DA 4NXNB 4FZ0A 1K4DC 2GM4A 4YJ3B 5J9PC 4O9BA 4YY3B 2A79B 3KG2A 1FDOA 4IIJA 3JALB 3OFNG 4DR5B 2CE4A 3TGUG 3ZMZA 2WPDG 3ETEA 5EZYB 1URQA 5E79E 3P30A 3A0RA 2RNBA 3CD6P 3DC6A 3W7UA 2IJKA 2ITCC 4GX1A 1MA1A 3CCEV 4W7YA 1SQBK 1VQ6V 1F4MA 4F4LA 3A0HE 1P84D 1SZXA 2A06H 3L70H 1JTHA 5LMUB 3FB6C 2PFXA 4GKKO 3V6IA 4I4TA 5IT9N 2OYIC 1BE3J 4X1IB 1J1EB 4ZI7A 5IJ9A 2QEXP 4MVMA 2IBZD 1NTKK 3H25A 1R6TA 4DR6B 3GLMA 1FDIA 3D71A 2WSCJ 1SQXJ 5KAFE 2X6BA 3CCJP 1HH0A 1KB9E 3B2EE 1S5LE 3RK3E 2EINC 1NH2B 1SP4A 4RAIA 1K8AW 3MUDC 3ML0A 4HBNA 3HD7D 2QWPB 2OCCB 2W6JG 4YJ3A 5BZBA 2R3CA 2YNYA 1V54C 1JO5A 4UCVA 3CRCA 3QO5A 3H1LG 3D3IA 1EZVH 2ADQB 1MUUA 2Y4TA 1TVKB 5EZYA 4FLUA 1COWG 4UFZA 2QSAA 2VS0A 1OW8A 3E22B 4PA3A 2O01N 4GKGA 4LF8B 3JCUZ 3LIDA 2KSJA 1DK1A 2I8DA 3VOPA 1H0TB 4JAAA 1KUQA 5AW4B 4MVUA 5CBGA 2E42A 4GZRB 2ADPA 1OVRA 2KB1A 4EYYQ 4WFBV 4MTXA 4RO2A 1YIJV 3ZHRA 4ASUG 3AE5C 3L73G 4K3AA 3CCEP 4O2BB 1VQ6P 5KHKA 4X1IA 1KYOE 2CPBA 4WCEV 1KFNA 4BW9A 2JEEA 2UUBO 3RL0C 1NI8A 5CB4B 3G3ZA 1L0NH 4ZKIA 5GW7A 2VWJA 2O1KA 5IYDO 3BRCA 1FD9A 2B5UA 1NYHA 3BRVB 1EDIA 3DSQA 3OM3B 4WBNB 2K3RA 4J42A 2OIEA 3BAAA 4UB6E 3AE6C 5LYJB 4FLZA 3TGUE 1YJNP 4TV8B 1EM1A 4MW3A 1NKNA 5TISH 2B88A 3LSQA 1AI4A 5KHJA 5B1NA 1Q7YQ 1RF0C 4W4KA 2Q7HA 4U3FH 4DV5B 4KXRA 3SWKA 5BU5A 1LUVA 4G27B 1W59A 3BVHA 2ZINA 2JR8A 4CS4A 3O8ZA 1VQOV 1YZBA 1L4AD 1GKFA 2AEJA 1FYJA 2KSEA 1GTWA 2QKAA 1XOUA 3UO2A 2KOGA 1ZLLA 1YYCA 1YIJP 2A9HA 2OT5A 2VQFO 4H13B 2DE0X 2YXLA 4Z1MG 3H1ID 2ZT9C 2CK3H 5B1AB 4PD4D 4FJCC 1VQKP 2ZIMA 1YTZT 3SJBC 1WPXA 2V4HA 4WBNA 5KAIE 1PGQA 1NTMJ 1R3JC 3STLC 5JJNB 4YXWG 5LYJA 3K5MA 5B66E 1N34O 3H1LE 1XL4A 4TV8A 5EBMC 1SQPK 4OXSA 4B3SB 3L75J 4W80A 2DW3A 3SSUA 2HKOA 1Z2GA 4MTFA 1NTZJ 5KKZC 4NTXA 4KFMA 3CXHF 3A0BE 4Z1VA 2H8PD 2K9YA 1OXZA 3ASNC 4PV1D 2R32A 3BCCJ 2Q4PA 3CCMP 2DYRB 4P9OA 4CS3A 3J80N 4X66B 2XAGA 4IL6Z 1L0LG 1LWUB 2WMMA 2B89A 1VQOP 3L37A 1GK6A 3CCVV 1RHZB 2YXQB 4KUMA 3I5CA 3IFXA 2AW9A 5B5EZ 2N9YB 1EXIA 4DRXB 1RH5B 3JATA 4FLXA 4QNHB 1IBKB 5AVUB 4ZMDA 3BVOA 4YHHO 4U7JA 1K4CC 2W6AA 1AROP 2FYUH 3ZCCA 2Y0EA 4EFBA 2GUZB 1YDXA 1FBMA 2CDYA 1SQVG 3CCRP 2KUBA 5AVSB 2LW1A 3BY6A 2RN0A 5H6RA 1WA8A 1Q81Q 4QPJA 1KQGB 2QKSA 2ZJSE 5K5GB 2Y9YA 2KS1B 2MK3A 5H2FE 1NKDA 5APSA 1SFCB 1B06A 1BGYJ 2VQEB 5CMUA 4MS2A 3A3YB 4DV3B 4JV5O 2H3OA 1FXKB 1OCCC 2MJZA 3M06A 2HLOA 4PDMA 1I0HA 2C9NY 1NTKD 1OX3A 3L74G 1LWUA 1H2MA 3ZIAG 4HJGH 1ZXGA 1PV0A 3THOA 2OTJV 1FZEA 1XNRO 1YSCA 4DRXA 1MV8A 4IFMA 4OGQC 1PP9D 3A0HZ 3EWKA 3JD2A 3CWBH 5EBWC 1SC5B 4A7PA 4DV0B 3CX5E 3E1RA 2KLVA 3N7NA 3QG5A 2PP6A 1Y66A 1ZLZA 4J7JA 4B3MB 2GUZA 1IFDA 3MGNA 2FXPA 1SESA 2NLJC 2E5LB 1GN2A 4JASA 1M57D 1J2JB 1IJDB 1XNQO 5KAFZ 1HJ0A 1RE4A 4PI0A 1S5LZ 2ILMA 1BE3G 2AXTH 2KS1A 3F5HA 1MZ9A 4WB4A 1YHQP 3R65A 1K92A 3ZS8C 3CL3D 2ZDIA 1SFCA 4NYKA 1EBOA 1HVVA 2BE3A 3CCSV 4LF4B 4AYCA 3OMAB 1SQXG 1FXKA 1L0LE 3FFQA 5KHHA 1QX8A 2UXBB 2VRSA 3E83A 4PHZA 1PPJG 2V7QH 1NU1K 3RK3C 4O4LB 2WLMA 4NPDA 3Q4HB 2K37A 3OMIB 4X1YB 2W90A 3R4YA 1DF4A 3AG3C 1RF1A 4D6TJ 4BW5A 2UU9B 4HNAB 3D8CA 3CPWO 4JZGA 2OTJP 3L4FA 2UUCB 1BDDA 1SQVE 4GODA 1YI2V 3CRRA 2MW2B 2QJYB 2VRZA 1VQ7P 1HWYA 3LW5J 1I7FA 4KHPB 1N7SD 5IYCO 1L0NJ 3OAKA 1DH3A 3R2PA 5KX5A 3LNNA 3RYFB 4JI1B 2IU3A 1P84H 1U96A 2P22C 4ZKUA 3HD7B 4UB6Z 5LP6B 1KILD 4JI8B 1WMKA 5IYZB 1NAYA 3I55V 3ABKB 5IY5C 3OW2U 4P30A 4X65O 2IBZH 4UCSA 2H88C 4I50B 3WB1A 1S3JA 2HPCB 3L74E 1I5YA 4L76A 4WY4D 2HG5C 2BEQD 4IYHA 1RPRA 3RK2C 1YEWA 4OVNF 3JASA 5M1BA 3CCSP 1BZKA 2Q6AA 3B77A 4O4LA 1P4RA 3IC9A 5FPOA 1K73Q 2UXNA 4FM2A 4X1YA 1KFMA 3ABMB 5AVXB 2DYSC 2N9BA 4CC5A 3AE2C 3D36A 3AE8C 2KG7B 5B1BC 2QM7A 4KP4A 1X79B 5L3EA 3AG2C 3WUVA 1IFMA 1Q7YW 1IVSA 3RYFA 1EDKA 1GW4A 5EC2C 4MVQA 3QWOC 4NTYA 4RQFA 2QWOB 2R9IA 2IU0A 4DR2B 3UCSC 5AVWB 2LJ2A 3HD7A 5LP6A 3TETA 5IYZA 2OTKE 1SQXE 3CXHI 2UXCB 3Q5PA 5FPRA 1Z56A 3ASOC 2XU6A 2EILB 4ZKPA 2HPCA 3T1HO 3C9IA 5D5PA 1N32B 2AGAA 2P4KA 3CCUV 1PPJE 4DUYO 2NPSC 3PH0A 4UUJC 3I55P 4JTAB 3HKEB 2ZYGA 2LR2A 1PL4A 1VPCA 3F7YC 1NTMG 5GTIZ 2RMKB 3VN0A 4MN4C 1XILA 2ZYDA 1L4AB 4TOIA 2IPPA 2E75C 1Y67A 4EB6B 5KHGA 3KKYA 4K8ZA 1T2KC 3L75G 4CPGA 1NJIW 2ETNA 4YTPC 1JR9A 2HEPA 1XL6A 1NTZG 4M3LA 3KHUA 3L72H 4QE7A 1MKMA 2KG7A 1VIBA 1SQQJ 4DV1O 3GB7C 3BCCG 3ZMSA 4DZOA 1GDTA 1EZVD 2JJLA 4L8JA 1NZ6A 1GL2C 3RVYA 1IFPA 3K5BA 5CHXA 2ZYAA 5CBNA 5APTA 3OGIB 2ZE5A 3CHXA 1FJGB 1AVMA 5AW7B 4Q6GA 4OX9B 3AG4C 4XBFA 5APYA 4L87A 3RFRA 3H1IH 4IHJB 3K9SA 2QVAA 1S2EA 5H2FZ 3HKEA 2WTYA 3AG7A 5IYBO 1HW7A 3M7MX 3H1HD 2X6CA 5CBOA 1AILA 3H1KJ 1D5AA 4HKZH 1ORQC 1L4AA 4PV1B 2FYZA 3CCUP 4BIZA 4EB6A 3L71J 3ZDMA 3F5WC 4JYCA 3CCQV 2DW4A 2KNCA 3JAWB 1SVFA 5IWAB 5JQGB 1BGYG 4NXMO 2P5OA 2GSMB 3U59A 1NQTA 1S5JA 2Q73A 4EKWA 2AXCA 1D5NA 2WSSG 1FC2C 5APUA 2IM9A 1I5XA 2B87B 2YIUB 1LNQA 2K88A 2FFDB 2Q68A 3K5NA 1YJ9P 4U3FD 2GBOA 1BSHA 3UQ8A 5KLVH 4U3JB 2AEMA 3JD4A 4LP8A 4IT5A 2YS8A 2E74D 1PV3A 3BEHA 3FAVB 1KORA 4LFCB 1NU1D 1FKAO 1KN7A 4IHJA 1Q82W 1LT9B 1S72P 4LH7A 4ZNCA 1GMJA 1NTME 2HFEC 1JB0J 1NH4A 1E79H 3G4SV 3TDKA 2Y69C 5J2TA 3BATA 3W7XA 4DR4O 3L75E 1VQPP 3HKBB 3MP7B 1NR7A 3SYAA 1HTLC 5L3CA 4HAMA 5CCGD 1OWAA 1NTZE 1W5CE 2WVRA 4W7ZA 2ZM6O 1SQBH 4UVAA 1DIPA 2P67A 4LFBB 3IAYA 3BCCE 4H0LC 2JWDA 5FL7G 5LXTB 3CCQP 2M8RA 3G67A 3CXHE 1KB9D 2B87A 4LF5O 5LHIA 2FFDA 3UKMA 2XNDH 1PM9A 3AK3A 1NTKH 2IH3C 4U3JA 1EN4A 3ZRXA 2HODB 4MSWC 1IBLO 2E76C 2A45H 4D6TG 1Q3EA 4UCOA 1R5SA 1JCHA 1LP1B 3U1AA 1MZEA 1PP9H 4I5SA 2OYIB 2ZKOA 2DN9A 5APQA 3TNUB 4X64O 1LT9A 2BOBC 1Q6UA 2R9RB 3FB5C 4P9PA 3GHGC 4YXDC 2CTPA 2FKXA 2X0LA 3N4XA 2BASA 1L0NG 4TWKA 4L74A 3HKBA 1PKXA 2LGWA 3KZIZ 4DV4B 1FS0G 5AVRB 2EINB 3G4SP 4JI0O 1XUQA 2DOSA 2F4VO 1BGYE 1U57A 1KYOD 3C90A 1OW6A 3SWYA 1L0LK 2CAZC 5CA0B 1V54B 5LXTA 1AP5A 3OE7G 1RQUA 2DMXA 2PGDA 4EFEA 5EBLC 2WA4A 3ZRSA 1FAVA 1G1JA 3ABVC 4K0KB 1E1QG 3AG1C 1F51A 4UXNA 2YIBD 1X8YA 1Q5OA 3UO3A 1LTGC 2L91A 2A06E 1N7SB 2HODA 5AG2A 1R1BA 4FPPA 4DO2A 3APQA 3CMAV 4IFFA 1AJYA 3SJQC 1DD3A 2OYIA 2CPSA 3RL0g 1UFIA 1ZL8B 1K73W 1RSOB 2R5BA 3N2GB 4AQRD 3BHPA 1FU1A 1AJPA 1IZNB 4CC6A 4LF9B 2ARHA 4TSFG 3B5ND 1PGOA 2AEFA 3CWBD 1N8RQ 2N04A 2V1DA 2IH1C 4LF7B 1LTIC 1AJQA 4FZ1A 3F89A 5DN6G 5FLXN 4DUZO 3ZHTA 3FYIB 2FXOA 1J1DB 3SR2C 3ICXA 4GX2A 1PIXA 1QVFO 2K9JB 2HJDA 3H1JJ 3EXAA 5CA0A 3JCUH 3G71P 5LA6B 1XREA 5D5QA 2LKMA 2KYVA 3ZMUA 2IJIA 1DEBA 3HKCB 4LFAB 5JCOC 2HHHO 4X62B 1JX9A 3H01A 1IC2A 1U97A 5GONA 3CCJV 3M9QA 1ZOYC 4C7UA 1HNWB 2E75D 3AE4C 3FX0A 1N7SA 1GM8A 4N6JA 1WJZA 4MVRA 1T2KD 2J5UA 3H1LD 5KLVK 3M9BA 2P6JA 1PZQA 5HFLA 2FL4A 1Y6XA 4GX5A 4I6MC 5LMNB 1WPBA 2L35A 1KKCA 3QVNA 1RSOA 4TLFA 1SQQG 3N2GA 1Q43A 1L0NE 4I55B 1KILA 3CMAP 1SQPH 2Q67A 2QA4P 3BABA 4X1KB 2D3OW 1QEXA 5IJ0B 2BTQA 2GUSA 4TT3H 1FS0E 3K59A 1XHXA 1G1XB 3L73D 1HF9A 1NAFA 4GYCB 4J9ZB 3K79A 4WY4A 4DR7O 1HR0B 4BWAA 3W67A 5KUMA 2Q7GA 3MHSC 4I2LC 4U7OA 1HDJA 1V55C 2IYPA 2K9JA 2QDOA 4C7NB 1LTBC 1ZN5A 5EIBD 3GG2A 2P2UA 2QTSA 1MOFA 3HKCA 3OTFA 4MTOA 3CC7V 4DV2O 3E8HA 3CI9A 1ZRTD 2IJJA 3JARB 2EIMC 4EOTA 3ASNB 2WSEH 2W0FC 1H2NA 4F6RB 1JPXA 3H1KG 1QNMA 1CI6B 1LTJC 4RWUA 3L71G 2XDJA 4NB5A 4LF6B 2QJKC 4DOJA 2ZE8A 3WG7C 1YJNV 2N1TC 3LSSA 3D70A 2F93B 1VQ5V 2WPVB 2RMZA 4I55A 3EFGA 5EC1C 4X1KA 4JI5O 1USDA 3JALA 2ZE6A 4UV9A 3RYIB 1G1IA 2FKWB 1DX7A 3RBZA 1JNMA 4CBCA 1H8EG 3CS5A 4AQYO 5JWPA 2GHYA 3LIEA 2W0XA 3BA8A 4FFBB 1YVWA 2OIGA 4PDLA 3E2EA 2HFED 1MSDA 4PA6A 2IYOA 4PA7A 4DV7B 3ABUA 4IL6H 3JARA 1E1RG 1VQKV 3DTUB 4F6RA 3OGCC 5B5EH 3CC7P 3H1HH 1OCCB 1BMFG 2BOCC 1CI6A 3CP1A 1FPOA 4NXNO 1JOYA 5LGNA 4DXWA 2ODMA 5AVVB 2DQ3A 4YY3O 4WFAV 1IDSA 2WLLB 1RY3A 4L73A 1SQQE 3A8TA 4DR5O 4H0LD 1S76D 2YXRB 2QKCA 2E74B 2O01H 3D6ZA 3SPIA 3USSA 2BCCJ 2FYUE 4J9YB 1M56C 5A2QN 1L0LD 3CX5I 1VQ5P 1L8DA 2XNXA 3CC4V 2CGOA 3RYIA 1TVKA 3L72D 1HNXB 5LOVB 3CCMV 2E76D 4DCKA 2Z3YA 1B3QA 3A5TA 5LMUO 1YQ3C 1NWQA 3E22A 4DYLA 5K1PA 3ZHSA 1H0TA 1NTMK 1OW7A 2Z5HA 1OVVA 4UB8E 5C39A 2BSKB 1R3LC 1JUNA 4XDJA 2A3QA 4YIOA 1NU1H 1J5EB 4DR6O 1S9KD 2Q0OC 5DJTB 4OH8B 5AW5B 1JM0A 2KP8A 3H1KE 4O2BA 1HJBA 1AQTA 2IBZG 3L71E 4TV9B 2YKQA 5CN0A 2Z0AA 3S3XA 1KZUB 1KC8W 3CCRV 3FGAD 2R72A 4PDRA 5CB4A 3NXSA 2ZFCA 3A0HH 3N27A 2QE7H 5KHIA 1LT1A 3PN1A 5AVZB 2ZQMA 3G9RA 2Q3IA 3AG3B 3FWLA 3B71A 3JD0A 1Z5VA 4LF8O 3HUSC 1QU7A 2ZR3A 1VQ4V 1M8OB 4N78D 4JAUA 1QGKB 5KAFH 3ZHUA 1KB9H 1T8ZA 2YC0A 3VMAA 3P8MC 1S5LH 5LOVA 1VF6A 3P32A 3ETGA 1RFYA 5B3SC 4J80A 3CC4P 1M90W 3OEHG 2YMYA 2JGUA 2H43A 5CCGA 4DV6B 1YITV 2OYQA 1LJ2A 3FB7C 1QL1A 1BHBA 5KLVD 1E5WA 4FFKA 3B8NA 2IZ0A 5IY5B 2GTAA 4TV9A 1G6UA 2CUGA 2QR4A 5H6QA 5GTHE 2JVDA 5E1AC 2Q5ZA 2OARA 3JD1A 1BE3D 5KJ7D 2QWQB 1AJNA 3F7VC 2EIKC 4UV8A 1YJWV 2WT7B 4RO0A 1BDCA 1GTOA 2F66C 1GN3A 1N8RW 5CBFA 3H1JG 1KYOH 4DV5O 2JDIH 3RYHB 1YHQV 3W7WA 2YO3A 1K04A 2R9AA 5AVQB 3CEIA 1N33B 4B08A 1PPJD 4JI4B 1BQ0A 2W6BA 3Q2YA 2B9ZA 4N21A 2ZE7A 1SQBD 2JKVA 3W7SA 5CA3A 4H37A 1VQ4P 4UB6H 4BR6A 3B5NB 2ZNIA 1OIPA 4GOFA 1P84E 4LCUC 2JRIA 3LSUA 2WAMA 5KTBA 3SYOA 3TGUH 4DK0A 2KSDA 1RM1C 3JSLA 4RJTA 1H88A 1Y4MA 1EN5A 5E79Z 2IBZE 1PNMA 3T1YB 3AEDC 1PNLA 4GUNA 2HLDG 3HKDB 4DR1B 1YITP 1SS3A 1VQMV 3ASOB 3JSVC 1TUEB 2NNUA 1VQ7V 1VQLP 4FM0A 2NPSB 1FZBA 4B7KA 3QNEA 3L70J 2YO2A 3VOUA 2HJFC 2Y9ZA 1AI7A 1O9GA 4JTCB 4X9QA 1SETA 1KQLA 2WT7A 1NGMB 4B3SO 1PGJA 2YIBA 2HVKC 2E75B 2PGGA 3FYEB 3VQYA 3RYHA 1BCCD 1YJWP 4DW0A 1M5IA 4B7EA 5JH7B 2WPSA 4HB1A 1QLEC 4QIWF 1XMOO 1VQNP 4H33A 2ZCEA 1X9VA 4X66O 1BSNA 2C0WA 2LQTA 4XDKA 1AB3A 4FLTA 1TU3F 1EC5A 4LH6A 2W6JH 3B5NA 3B8EB 4JI7B 4KT0J 3HR0A 2JS5A 1GL2B 3IJ4A 2XAFA 3H1LH 2N1TD 1QVGU 4JYAB 1IBKO 5FNVB 1PL5A 1URFA 4ASWA 1JCDA 4NKGB 1OCZC 3MAQA 4EDFA 1GM9A 3AG4B 2EULA 5GTIH 1N73B 4J7ZA 3HKDA 1AFOA 4EIJA 3K03A 1JMMA 3MZWB 3PRJA 3M0DA 2ZXEB 1W2BU 3L73H 2G38A 1FJPA 3E7KA 2LGQA 3JCZA 3H1JE 1VQMP 5LHHA 1CEZA 4B3RB 4CH4A 1YTZI 5H5NA 3H1HJ 4BIOA 3II6A 5A9GA 5B1OA 5AW2B 2F23A 1GN6A 4NR1A 4TUYB 3FXEA 1MFZA 3T2MA 1ZR2A 3E1IA 2VQEO 4DV3O 4DR3B 1NTMD 1VARA 2O01J 5AW6B 4MVZA 3CRMA 2IDBA 4FIPC 3RL0D 1RP3B 3R66A 4IOIH 3U11A 2OYHB 4QGPA 1XBLA 1G2CB 3Q5SA 2EIJB 3LDDA 2QSIA 4WFEA 4U3FJ 5FNVA 3CCLP 1NHLA 4UVCA 3DXRB 4DV0O 2WQYC 2UWJE 1AI6A 3RT3C 1SZTA 2JIZG 3H1IE 5H2FH 4B3MO 1OVUA 1N73A 4PD4E 4XFJA 3Q4HA 1IBMB 2BCCG 4Y28J 4DK1A 2IJHA 4UB8Z 1PNKA 3CXHD 3OTOB 2E5LO 2F95B 4HNAA 4PA4A 1H2KA 5K1XA 3PP5A 3F5TA 1KD1Q 1FZCC 5CJ4A 1SQPD 5L3FA 3WU2E 4GKJB 2IW5A 5APWA 3Q3DA 4Z1MH 1CSBA 1Q6IA 4R4MA 2LW7A 1SA0B 5L3GA 1KQFB 4BRYB 1Z5WA 1VQ8P 1W2BO 1VL2A 4LF4O 2JGDB 3CX5H 4H0LB 1GK4A 2UXBO 5KAIZ 4AI8A 3S4RA 2ZT9D 4YXWH 1SQQK 3M99B 4J7KA 2YICA 5B66Z 1M9NA 3AEBC 3EQ2A 3P7KA 2OYHA 1QR8A 4JI3B 4I50A 1G2CA 3FD9A 1JY3O 5BVZA 2QWRB 2UU9O 2Q9IA 1H8HG 3PHLA 2E76B 3DXRA 2ZDIC 1IX9A 3V2RA 2UUCO 1L2PA 1NBMG 2KI7B 2QJ1A 1PD3A 3A0BZ 3OW2O 1IFNA 4L75A 4KHPO 2ZVNB 1L0LH 3GHGB 2A0LA 4JI1O 1GN4A 4RUEA 2UUAB 3GWOA 1YJ9V 1OV9A 2WLIB 1RE3A 1YQ4C 1RF1C 1WLEA 1S0VA 2XAHA 5GTHZ 1NOHA 1BS3A 4JI8O 3A7OA 4PI2A 2HR3A 2F1MA 1FZAA 4NPFX 4BRYA 3SGIA 2FYUJ 3LDCA 1SQVH 2FXMA 3SWFA 2RKLA 1I94B 4WFGA 5CCHC 1AVOA 2KQXA 1S72V 4IYIA 4G2KA 1NVPB 2P7JA 5KA6A 5AW9B 2UXDB 4QE9A 3AG1B 3BPZA 1JMKC 2Q0AA 1VQPV 4PELA 1OCOC 1N2DC 1PP9E 2BCCE 2NZ2A 3H6PA 3I56P 1XI1A 3IC7A 2PI5A 3KZIH 3L74H 3GHGA 1XMQB 2PI4A 4N23A 4LLHA 2JS3A 3S1KA 1HNZB 1QQCA 2QTOA 1Q81W 5L3DA 3EHBB 4X88A 4ICGA 3IR9A 4D6TD 2FYNB 4DR2O 2YI9A 4X20B 1CW5A 3CWBJ 4PA9A 1K9MQ 1YTFD 2UXCO 3FXDA 2NR5A 3G6EV 5CMZA 1JJOA 1MFTA 5J2UB 1N32O 1K8AQ 1R5LA 4OGQD 1XQ8A 1ZMEC 4I9WA 4JI6B 1V9PA 2A06G 3L70G 2NN4A 2Y0CA 1BE3H 1AVYA 2DWDC 4I7ZC 1HGZA 3VQVA 3TXQA 2JJ1G 4HZ3A 1D2DA 2ZD9A 2QJPC 1X22A 2WSCH 1SQXH 5DM6V 4B3TB 1Q86Q 4RUFA 2WWWA 3ZN0A 3GF3A 1T6AA 1N4CA 3SPJA 4U7NA 1X4TA 3C8VA 1FOSF 2V7QJ 1PPJH 1K3EA 1KMIZ 4FM1A 1XTCC 2ZVOB 3JAWA 1W0JG 1WRGA 2D2CC 2SPZA 5JQGA 3TJTA 1FZFA 2POHA 1O9HA 4X20A 4ASVA 1TA8A 1FJGO 4LR3A 2GDSA 1EZVG 1K7DA 4OX9O 5KJ7A 1IO4A 2FTKA 2WLJA 4JI2B 4RKUJ 1Y47A 1KILE 3RK3D 3OAAG 5BR8B 2A7WA 5J2UA 1DF5A 1P84F 3GVMA 1HUCA 2C0XA 1U7JA 4CH3A 3TYYA 3FAVA 1IFJA 2CH7B 3G6EP 1QHTA 1QBZA 4PJ0E 5JCOA 2EIMB 4R8CA 3ETDA 4R7CA 3KQGA 4YJ2B 3JAKB 3IN6A 3MIWA 3K58A 3H1HG 2PZSA 3ABLC 2QJKB 3HB3B 2BTOA 5IWAO 5LGTA 1GD2E 1G4YB 1TGOA 1LGHB 2M0BA 2ITDC 1BCCH 5TJHA 4J41A 3WG7B 1ZTEA 2N1TB 4F6EA 3G71V 4JQ0D 3VYIA 3AE3C 2RCVA 1ZR4A 2DJVA 1Y74B 2IFNA 1DEEG 2XAQA 2HG5D 2JK5C 3RK2D 1GMGA 2JWAA 2FMLA 4U3FG 3MHHC 1VEWA 2V4DA 3RYCB 4LFCO 4XE5B 3VP8A 1AR5A 3RW0A 3O6QB 3AK1A 4E4EA 4IFDK 2PRRA 3L70E 1SQVK 3TGUD 1T5EA 2O57A 2CH7A 2HP8A 1LP1A 1N36O 2QA4V 5C8YB 2UXXA 2E5TA 1AA0A 1SERA 4YJ2A 3TNUA 3DC5A 4E2LA 4AUWA 4QPKA 1R3KC 1M1JC 2GUVA 4RESB 3RL0B 2CK3G 4N3YB 1TAEA 1KD1W 4LFBO 2Y0IA 3V2QA 5BMVB
chains in the Genus database with same CATH topology
4NVPA 4PI0A 3RYIA 1TVKA 1HNXB 5LOVB 3AE1C 2E76D 3ZS8C 1TUBB 1YQ3C 1S1CX 3E22A 2EX3A 5K1PA 4LF5B 4PV1C 4LF4B 4GKKB 1OW7A 5EIBC 3Q5RA 4FLWA 3FFQA 5KHHA 2UXBB 4LNUB 1J5EB 4PHZA 1IBLB 3RYCA 5J2TB 4O4LB 3K5OA 4O2BA 4AILC 1JFFB 2QJYC 4X1YB 4TV9B 3O6QA 3R4YA 4GDOA 3SJCC 4X64B 4D7TA 1K05A 2UU9B 3FGAD 4HNAB 2R72A 1IK7A 5CB4A 2YIUC 5KHIA 2UUCB 3PN1A 1KU9A 4AHCA 3AEFC 5EYPB 3G9RA 4IL6X 3LW5J 1I7FA 4KHPB 5LP6C 4JI0B 2ZT9B 3B71A 1Z5VA 5KX5A 3LNNA 3RYFB 2F4VB 3AEAC 4JI1B 5KLIC 3SJAC 2GV9A 1SQFA 2E3CA 1EXJA 2P22C 5LOVA 5LP6B 1R8EA 4JI8B 2VWKA 1TUBA 5IYZB 1WMKA 4UCSA 4O2AB 2H88C 4I50B 3WB1A 5LA6A 2JGUA 3S9OA 2BEQD 4LNUA 4DV6B 2OYQA 1WNSA 4H44C 1YEWA 2UUBB 4O4JB 4UCTA 3JASA 5M1BA 4O4LA 3T97B 2MKVA 1N36B 5FPOA 1JFFA 1ZP0C 4FM2A 4X1YA 4TV9A 1DGSA 1G6UA 2JVDA 4I9QA 4H44B 4CC5A 3AE2C 2G8YA 4FVMA 3RGBA 2F66C 3AE8C 3AEGC 5EYPA 4R4LA 4O4IB 4H13D 3RYHB 4DUZB 1K04A 2R9AA 1P49A 3RYFA 1N33B 5IJ0A 5JJJB 4B08A 4JI4B 3RWRD 1WN7A 3Q2YA 4DR2B 2QIWA 5LP6A 5IYZA 4EEQA 1SKVA 2ZNIA 2UXCB 4GLXA 3K5LA 3Q5PA 4O2AA 5FPRA 2QM4A 2HHHB 2YI8A 3UT5B 5D5PA 4DK0A 1N32B 2VQFB 3JSLA 3HKEB 2YMKA 4O4JA 2PYJA 3T1YB 3AEDC 1S5LX 3HKDB 4DR1B 4TOIA 2E75C 5KHGA 4EB6B 1B04A 4K8ZA 4FM0A 4YTPC 4ZHQB 2HEPA 1O9GA 2D2CD 1NGMB 1MKMA 1N34B 2YIBA 3JAKA 4TQFA 4O4IA 2E75B 2PGGA 3ZEDA 4OGQB 4DR7B 3VQYA 3RYHA 1M5IA 5JH7B 4L8JA 2JP3A 4FLVA 2RQ6A 1RQVA 2ZCEA 5GONB 1FJGB 3CHXA 4FLTA 1TU3F 4Q6GA 4LH6A 4DV2B 4OX9B 3WB0A 3RFRA 4JI7B 4KT0J 5KMGB 2JS5A 4O4HB 4IHJB 3UT5A 2PUSA 4JYAB 4FFBA 5FNVB 1VF5C 4ZOLB 1PL5A 3HKEA 3MAQA 1HW7A 3M7MX 1DD4A 4YHHB 3GF7A 2BTQB 1D5AA 3HKDA 2FYNC 2JO1A 4PV1B 4IIJB 4FLYA 1ZAUA 4EB6A 4KL1A 1VF5B 4ZHQA 3JAWB 3QF7A 5C8YA 5IWAB 5JQGB 4JI5B 4B3RB 4CH4A 2P5OA 1SQGA 1S5JA 4CS2A 4TUYB 1M4UA 2IM9A 3JSNA 3K5NA 4I4TB 5BMVA 4DR3B 4AQYB 3UQ8A 4ZI7B 4U3JB 5IJ9B 4JV5B 3JATB 2O01J 2ZNJA 2E74D 1PV3A 2IDBA 2PY5A 4CH6A 1KORA 2ZIOA 4LFCB 3U11A 5KMGA 4O4HA 4IHJA 3Q5SA 1XNRB 4LH7A 2QSIA 1GMJA 5FNVA 1JB0J 1NT2B 4ZOLA 4NXNB 2WQYC 4YJ3B 5J2TA 4YY3B 4XFJA 1FDOA 4Y28J 1IBMB 3HKBB 4IIJA 4DK1A 3JALB 4DR5B 2OWOA 3OTOB 5EZYB 2F95B 4HNAA 5K1XA 1DIPA 1XNQB 4LFBB 3IAYA 4H0LC 1XMOB 4GKJB 3CB2A 5LXTB 3Q3DA 4Z1MH 4K8XA 3AECC 4R4MA 4CH5A 1Y9BA 1SA0B 4UCUA 1KQFB 1Z5WA 5LMUB 1Q90D 1VL2A 4I4TA 4X1IB 4H0LB 4ZI7A 4U3JA 5IJ9A 2E76C 4UCRA 3H25A 2ZT9D 4DR6B 3GLMA 1FDIA 3D71A 1Q3EA 4UCOA 2WSCJ 3AEBC 3SFDC 4JI3B 1ZRTE 3B2EE 4I50A 3RK3E 4YXDC 4HBNA 2E76B 4YJ3A 3U10A 3VQXA 2QJ1A 3HKBA 4UCVA 4DV4B 1TVKB 5EZYA 4FLUA 1XHZA 4UFZA 1U57A 1OW8A 1OW6A 3E22B 1FFXB 2CAZC 4LF8B 2WSEJ 5CA0B 3ETQA 4D7SA 5LXTA 2UUAB 1YQ4C 1RQUA 3U0ZA 4H44D 4EFEA 3VQWA 4PI2A 2F1MA 3ABVC 4K0KB 3AE5C 3SGIA 3D6YA 2BEZF 4O2BB 5KHKA 4X1IA 4X65B 2YIBD 1Q5OA 5JVDB 1I94B 2E74C 4BW9A 5CB4B 2WSFJ 2VWJA 1AJYA 3BRCA 2R70A 2UXDB 1DD3A 3BPZA 2G3AA 3AE7C 3RL0g 1NYHA 1JMKC 3DSQA 1OMIA 4WBNB 2Q0AA 3BAAA 3N2GB 3AE9C 3BHPA 1Q8IA 3AE6C 5KX5B 4CC6A 5LYJB 4FLZA 4LF9B 2NZ2A 4TV8B 1XI1A 4LF7B 5KHJA 2Q7HA 4DV5B 1XMQB 3SR2C 1FFXA 1QQCA 2ZINA 3ICXA 3WB2A 1HNZB 4CS4A 1PIXA 1H2SB 5CA0A 2YI9A 4X20B 4H13C 5LA6B 5D5QA 2OQQA 1M93A 3HKCB 1UIXA 3JASB 5JH7A 5L8RJ 1KTMA 4LFAB 5JCOC 4X62B 1JJOA 5GONA 5J2UB 2KKWA 5JVDA 1ZOYC 2E75D 1HNWB 3AE4C 2YXLA 1XQ8A 3T1HB 4H13B 4OGQD 1ZMEC 2ZT9C 5BMVB 4DUYB 2J5UA 4JI6B 1V9PA 2ZIMA 5LMNB 1WPBA 3SJBC 3BA9A 1RSOA 2PTMA 4WBNA 3N2GA 1Q43A 4I55B 4I7ZC 5JJNB 3N2KB 3VQVA 3BABA 4X1KB 5LYJA 3K5MA 2QJPC 4ZIBA 5IJ0B 2BTQA 4TT3H 4TV8A 3K59A 4B3TB 3IAOA 1XHXA 1VF7A 1HF9A 4B3SB 3SFEC 4GYCB 3QTCA 3GF3A 1HR0B 4DV1B 4BWAA 2YIAA 1X4TA 3C8VA 2V7QJ 4I7ZB 1KMIZ 2Q7GA 4FM1A 3JAWA 5KKZC 2D2CC 2RJZA 3GMAA 5JQGA 2FBWC 2K9YA 4PV1D 1O9HA 4X20A 5EIBD 1TA8A 5JJEB 4LR3A 4CS3A 4TUYA 4X66B 3HKCA 3OTFA 1VF5D 3CSXA 5ITZB 4JI2B 4RKUJ 3JARB 1KILE 2D2CB 4TQDA 5BR8B 1EXIA 5J2UA 4DRXB 4F6RB 3JATA 4FLXA 1IBKB 4CH3A 4LF6B 2QJKC 4U7JA 1QHTA 5JCOA 4YJ2B 3JAKB 4EFBA 3IN6A 3D70A 2F93B 2H89C 2P10A 2WPVB 3K58A 4I55A 3N2KA 2PZSA 4X1KA 5CA1B 2BTOA 1KQGB 3A2FA 1TGOA 4NXMB 3JALA 3RYIB 3AE3C 2VQEB 1HJ0A 2XHBA 4DV3B 3BA8A 4FFBB 3Q1MA 1SA0A 2V4DA 5ITZA 3RYCB 4DV7B 3JARA 3AEEC 3THOA 4DRXA 4F6RA 4OGQC 3EWKA 1T5EA 4DV0B 3K57A 3QG5A 5C8YB 2Q7EA 4B3MB 4YJ2A 2PYLA 4H0LD 4DR4B 2FXPA 2E74B 2E5LB 3D6ZA 5CA1A 1TAEA 2ZM6B 1L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMI Z; 
#chains in the Genus database with same CATH topology
 4NVP A;  1MSW D;  2N1T A;  2GTS A;  3MHV A;  3C3S A;  3MUD A;  1NTM H;  1BHA A;  1K97 A;  4YIP A;  4QMA A;  2EBO A;  2EX3 A;  2Z5I A;  1Y74 A;  4PV1 C;  4GKK B;  1EZV E;  2C2A A;  3P3P A;  3OA7 A;  1X0T A;  3KXD A;  1BL8 A;  3L75 H;  3RGU A;  2NPS D;  1L1F A;  3ZMV A;  3RYC A;  3L72 J;  3J81 N;  3K5O A;  1CXZ B;  1JEK A;  4EI2 A;  4GDO A;  3O6Q A;  2JEX A;  1EDJ A;  3SJC C;  3JD3 A;  4D7T A;  1KKD A;  3ZN1 A;  2QGN A;  4IL6 E;  2K1E A;  1JQ0 A;  2YIU C;  5DJU B;  1SRY A;  3CXH H;  1VQ9 P;  2Y0P A;  1KU9 A;  4DV4 O;  3H1H E;  5EYP B;  1ZL8 A;  3O65 A;  1US6 A;  4PD4 F;  2RH0 A;  2RDC A;  2ZT9 B;  3CC2 P;  2C9L Y;  1EFR G;  3H1I J;  3NFQ A;  3OR7 C;  5KLI C;  1JY2 O;  2KZJ A;  1GL2 D;  1M7L A;  2Q9L A;  1T3J A;  2FYU G;  1YF2 A;  3RVZ A;  2E3C A;  1SQX K;  3PLN A;  5CCH D;  1R6N A;  1R8E A;  4K0K O;  5TIS E;  3D3Q A;  3HUS B;  4O2A B;  2AZ2 A;  3G6B A;  5DEC A;  3B4S A;  1X59 A;  5LA6 A;  4U3F E;  1R3I C;  4H44 C;  1WNS A;  3NMD A;  2UUB B;  4O4J B;  4UCT A;  1RF0 A;  4Y99 C;  1PGP A;  5KKZ B;  2P1J A;  3T97 B;  1BGY H;  5B3S B;  2MKV A;  1OFC X;  4JYY A;  1ZP0 C;  1NU1 E;  1OJH A;  2ZXW C;  2FB5 A;  2LFS A;  2WSS H;  3CE2 A;  3ZHV A;  5EFW B;  1JCC A;  4LF9 O;  2JEU A;  3VBB A;  4FVM A;  3RGB A;  4JAV A;  3AEG C;  4LF7 O;  5EYP A;  4R4L A;  5KLV J;  4O4I B;  3TSI A;  1S77 D;  3T4Z A;  1OZH A;  3LDE A;  2J59 M;  1M57 C;  1GU4 A;  1OCR C;  5LGU A;  1AV1 A;  3CWB G;  4OPA A;  5IJ0 A;  5JJJ B;  2EIK B;  2WSF H;  3O9O A;  1WB8 A;  3RWR D;  2W6I G;  1M1K Q;  4HH2 A;  3ZX6 A;  4LFA O;  1K9M W;  1SKV A;  4X62 O;  2XUM A;  4GLX A;  3K5L A;  3WUU A;  3HUS A;  4O2A A;  4C7N A;  2QM4 A;  2YI8 A;  1HNW O;  3QH9 A;  2VQF B;  1LR1 A;  1EZJ A;  3K04 A;  3CX5 D;  1VP7 A;  4I0X B;  3AK2 A;  3FX7 A;  2YMK A;  4O4J A;  5AW3 B;  2WPR A;  1SQB J;  2E43 A;  3T97 A;  5LMN O;  1Y76 B;  4BAY A;  1P84 I;  2X7R B;  2J58 A;  2OCH A;  4OWF A;  4KJM A;  3ZMT A;  1KBH A;  1B04 A;  1RM1 B;  2WIT A;  3OJA B;  1YTF B;  1LTA C;  2IBZ I;  5CBH A;  2V7Q G;  3MDS A;  2D2C D;  1NTK J;  3U1C A;  1N34 B;  2QWN B;  1QL2 A;  4O4I A;  1Q86 W;  1HR0 O;  3ZED A;  4OGQ B;  4MW8 A;  1N7S C;  3K0G A;  2YDE A;  4D6T H;  3MD0 A;  1NVO A;  4P2Z A;  1PP9 J;  4PJ0 Z;  1F7Y A;  1AR4 A;  4Z2W A;  1N0J A;  5BU8 B;  4IGG A;  4GT1 A;  1KIL C;  3X2Q C;  3LW5 H;  3M0A A;  3MTU E;  5AVT B;  4LGD E;  3SYP A;  1QLE B;  3WB0 A;  1W0K G;  1BCC J;  3KDP B;  1K34 A;  3L36 A;  4WY4 C;  3KCX A;  2PUS A;  2L6L A;  2EZO A;  4FFB A;  1URQ C;  4WVZ A;  3V4W A;  1VF5 C;  1THZ A;  4I0X A;  2HVJ C;  4LF6 O;  1SQV D;  3H1J D;  4GOE A;  1J1D C;  1JA8 A;  3K08 A;  1DD4 A;  5E79 H;  4YHH B;  2N74 A;  1IXM A;  3SDL A;  3GF7 A;  1Y76 A;  3HE5 B;  3P3N A;  2KK7 A;  4FLY A;  1NTZ K;  4KL1 A;  3NR7 A;  2KIK A;  1K5S A;  3RN4 A;  1OCZ B;  1EQ7 A;  3RK3 B;  2WLL A;  3QF7 A;  5DED A;  5L3B A;  4XDL A;  4FK5 C;  1IZ3 A;  2KZI A;  1VMG A;  3CWB E;  1XTG B;  1KP2 A;  4LBE C;  1NVP D;  2ITA A;  2XAS A;  3CYO A;  3L74 D;  3JYC A;  4JV5 B;  3P8C E;  3JAT B;  2ZNJ A;  3V2P A;  2WZ7 A;  3V5B A;  2XAJ A;  4DV7 O;  2PY5 A;  4C7R A;  3ZRW B;  1N7L A;  2IFM A;  2AXT E;  1CPY A;  2BSK A;  1XNR B;  1NJI Q;  1RPO A;  1NT2 B;  1YBK A;  1WA8 B;  2H94 A;  2QRX A;  1F4N A;  1CZQ A;  1VQL V;  4KHX A;  3HE5 A;  4Q20 A;  1Q2N A;  1BQZ A;  2LO1 A;  2OWO A;  2XV5 A;  3W68 A;  3RK2 B;  3UM7 A;  2N05 A;  5GTI E;  1XNQ B;  5KUK A;  5F2V O;  1XMO B;  4PD4 I;  1J1E C;  3V4Q A;  3CB2 A;  3JAM N;  1FOS E;  1VQN V;  4K8X A;  2CTW A;  1HNX O;  1SQX D;  3AEC C;  3L73 E;  4CH5 A;  2M7W A;  1Y9B A;  2DYS B;  4UCU A;  2E5Y A;  4UVB A;  1FZC B;  1Q90 D;  3SPG A;  1JY3 P;  2R3S A;  3L72 G;  4WBA A;  5IDJ A;  5B1B B;  1SQQ H;  3OMN B;  1J5E O;  1SQP J;  3AG2 B;  4UCR A;  2OCC C;  1FJK A;  4DW1 A;  3OEE G;  3ZRW A;  3SFD C;  1ZRT E;  2WA3 A;  4DT0 A;  5LL6 Y;  1LTS C;  1ZW0 A;  3U10 A;  2EJR A;  3J7A U;  3VQX A;  3IGA C;  5TIS Z;  2ZR2 A;  3H1I G;  2R5D A;  5EK0 A;  1PFI A;  4UB8 H;  1XHZ A;  3KPE A;  1FFX B;  1MG1 A;  2WSE J;  3HPL C;  2Z4E A;  3H1K H;  3ETQ A;  4D7S A;  2WLK A;  1GRJ A;  3ZJZ A;  3CPW U;  2Q3E A;  3L71 H;  3U0Z A;  4H44 D;  3VQW A;  1FZC A;  1IXB A;  2HYN A;  3D6Y A;  2BEZ F;  1Q82 Q;  4X65 B;  5AW8 B;  1H2G A;  5JVD B;  4OPH A;  4DV6 O;  2QM8 A;  2BCC D;  2E74 C;  2P06 A;  2K9P A;  2M3E A;  3BAS A;  1RF1 B;  1DTO A;  4X89 A;  3DGE A;  5KAI H;  2WSF J;  3CCL V;  3CCV P;  2R70 A;  1ZSP A;  5B66 H;  2G3A A;  1L0N K;  3AE7 C;  1JJ2 U;  3B40 A;  3TCU A;  1OMI A;  5KLV G;  1FZG A;  1W2E A;  1VF6 C;  3AE9 C;  2ATK C;  4J11 A;  2Q6Q A;  1Q8I A;  5H9C A;  4XA4 A;  5KX5 B;  3OUF A;  1MMM A;  3OR6 C;  3A0B H;  2X6A A;  1GAX A;  5CCG C;  2A45 I;  1UPG A;  2LXB A;  2NPS A;  3OD4 A;  1OCO B;  1E79 G;  1N33 O;  4K35 A;  1BT8 A;  2FY8 A;  1FFX A;  4WFF A;  3WB2 A;  2P90 A;  3WFV A;  4JI4 O;  1F23 A;  1H2S B;  3EVK A;  5AW0 B;  1VQ8 V;  4H13 C;  1JY3 N;  2OQQ A;  1M93 A;  5B1A C;  1UIX A;  1HGV A;  5GTH H;  2Y48 A;  1M1K W;  3JAS B;  5JH7 A;  3GWK C;  3L72 E;  5L8R J;  1KTM A;  1KV4 A;  1MAB G;  1SQB G;  1K5Q A;  3M8A A;  2KKW A;  5JVD A;  3T1H B;  3QO7 A;  3K9A A;  2XOK G;  1SLQ A;  4DUY B;  3L9D A;  3T1Y O;  3L75 D;  1S9K E;  5APX A;  1HBW A;  2AHY A;  4DR1 O;  1GW3 A;  2XND G;  1GL2 A;  1MZF A;  3FWN A;  1NTZ D;  3BA9 A;  4JF3 A;  2PTM A;  1NTK G;  2YKO A;  2CTR A;  5CCH A;  1D7M A;  3N2K B;  3HRN A;  2A45 G;  3BCC D;  2QG4 A;  1Q6H A;  3K0D A;  3GW6 A;  4ZIB A;  3K06 A;  4I1L A;  3NTN A;  1M56 D;  3IAO A;  1PP9 G;  1VF7 A;  1MNG A;  3SFE C;  2WLN A;  1A02 F;  2DYR C;  2YEV B;  3QTC A;  1NU1 J;  4DV1 B;  1NO4 A;  2YIA A;  1QVG O;  3STZ C;  1LWU C;  4I7Z B;  5IE9 A;  1KP3 A;  3V2N A;  2QJP B;  2RJZ A;  2Y69 B;  4X8A A;  4GIF A;  1B6Q A;  2FBW C;  3GMA A;  1A02 J;  1CP9 A;  2F43 G;  4MVS A;  3KZI E;  5JJE B;  1BCC G;  4N78 E;  1KQS U;  3PTZ A;  4TUY A;  1URQ D;  1VF5 D;  3CSX A;  1J95 A;  5ITZ B;  1FXH A;  4JI7 O;  1T3U A;  2D2C B;  5CJ0 A;  4TQD A;  2LFR A;  2YSU B;  3RBX A;  4JYA O;  2YKP A;  1KB9 F;  4HYO A;  1FXV A;  3HE4 B;  1A32 A;  4WWI A;  4WFH A;  1OZ0 A;  3VMZ A;  5KLV E;  3PJS K;  2Q7C A;  3TXS A;  1RE4 C;  1R6K A;  3I56 V;  3CME V;  1KEC A;  2H89 C;  1BGY D;  2P10 A;  2FYU K;  5LBQ A;  3N2K A;  1GZL A;  1SFC C;  3APO A;  1YI2 P;  3B5N C;  5AVY B;  5CA1 B;  4JGS A;  1JMB A;  3W7T A;  3A2F A;  4B3R O;  1BE3 E;  3VP9 A;  3H9V A;  2AXT Z;  1FXK C;  4NXM B;  2YEV A;  3BFR A;  1FAF A;  4YPC A;  3WMM 0;  1H38 A;  3T4D A;  1DLB A;  2XZR A;  3ABL B;  3E8B A;  4LC1 A;  2W83 C;  4DR3 O;  2XHB A;  2A06 D;  2W8Z A;  3L70 D;  2XTA A;  1KYO F;  3M0D C;  3Q1M A;  2H7H A;  1SA0 A;  1SQB E;  3S3W A;  5ITZ A;  2NRG A;  1GK9 A;  4CZZ A;  2OTL V;  3AEE C;  2JGD A;  2PF4 E;  3H1J H;  1AI5 A;  1AP6 A;  1VDF A;  3HE4 A;  1KQS O;  2KNC B;  1R73 A;  3K57 A;  1NTK E;  3LNM B;  4MVO A;  1IBM O;  2Q7E A;  2IZ1 A;  2PYL A;  4DR4 B;  3IFM A;  3OTO O;  1QCE A;  4JZ2 A;  1YXB A;  5CA1 A;  3VTP C;  1Y8A A;  2ZM6 B;  3CME P;  3TGU J;  4GKJ O;  4JYB A;  2EZP A;  3FB8 C;  3K3W A;  1NH2 D;  2B1I A;  4GCZ A;  1JOC A;  3SYC A;  1QLN A;  4PDV A;  3AE1 C;  3ZBH A;  1GM7 A;  1M1J B;  2KLU A;  3B09 A;  1TUB B;  1SQP G;  1S1C X;  1N86 A;  4LF5 B;  1BCC E;  1N73 C;  1G8M A;  4TT3 G;  3SYQ A;  5EIB C;  3Q5R A;  3QO8 A;  4FLW A;  2WLI A;  4PD4 H;  4LNU B;  2P4V A;  3JC2 2;  4W4L A;  1AQ5 A;  1IBL B;  2OGU A;  1WT6 A;  5J2T B;  3T1C A;  3CLQ A;  3D36 C;  4JI3 O;  4AIL C;  1JFF B;  2QJY C;  3IF4 A;  1SS1 A;  2YUA A;  1EZV I;  1L0N D;  4JF7 A;  2L5G B;  2Q1K A;  4X64 B;  3WU2 H;  1IUR A;  1K05 A;  3VMX A;  1FDM A;  1IK7 A;  2OTL P;  1JY2 P;  3E86 A;  4JPR A;  3ITK A;  2KXP B;  2I1J A;  4AHC A;  3AEF C;  1ZUQ A;  4IL6 X;  1YCI A;  4C46 A;  4MTG A;  3CJH B;  3CRQ A;  3HD7 C;  5LP6 C;  4JI0 B;  3BRT B;  3ABK C;  1S5H C;  2F4V B;  3WUT A;  4LWS B;  3AEA C;  2OYH C;  1QLE D;  3H1L J;  2UUA O;  3SJA C;  1UII A;  2EIJ C;  2GV9 A;  1SQF A;  3CRA A;  1EXJ A;  1NR1 A;  4DJG A;  1M1J A;  2VWK A;  1TUB A;  1WB7 A;  1AR1 B;  5KLI B;  1WP7 A;  1PL0 A;  3ABM C;  1I94 O;  3H32 B;  3S9O A;  2O1J A;  4LNU A;  1U7M A;  2IX7 C;  3L73 J;  2XKM A;  2UXD O;  3JCU E;  5KA5 A;  1N36 B;  1V55 B;  1JFF A;  3AEI A;  1H89 A;  2P58 A;  1RE3 C;  1DGS A;  3FKS G;  4H44 B;  4I9Q A;  3L35 A;  2Z5U A;  3SPC A;  5LHG A;  2Q8V A;  4MT8 A;  4QJF B;  2B9B A;  2I1K A;  4Y99 B;  2G8Y A;  1P7G A;  4JTD B;  2LP7 A;  1SF9 A;  3E35 A;  1S4X A;  4NTW A;  3G80 A;  3CJH A;  2K1A A;  3M9H A;  4H13 D;  3KCY A;  1N0N A;  2ZXW B;  1WAZ A;  1XDC A;  1LTJ B;  4DUZ B;  1XMQ O;  1IFI A;  4JBZ A;  4ZBM A;  1HNZ O;  1P49 A;  4GX0 A;  4LWS A;  3C3T A;  2EIL C;  1WN7 A;  3OT7 A;  4B86 A;  1ZX3 A;  3E8F A;  4A5U B;  1SQP E;  2QIW A;  1USE A;  1IK9 A;  1M57 B;  5APV A;  1OCR B;  4EEQ A;  3HTK B;  4G28 B;  1ROP A;  2M6Y A;  2BCC H;  1L4A C;  2HHH B;  3CXC U;  4HYT B;  5BXZ A;  3UT5 B;  3H32 A;  1KC8 Q;  2M5A B;  1OHH G;  4JI6 O;  2OYO A;  2PYJ A;  1GU5 A;  3E89 A;  1QVF U;  2CTQ A;  1SQQ D;  2LXC B;  1S5L X;  4NPE A;  1JY2 N;  3CX5 F;  1KB9 I;  1VQ9 V;  3WU2 Z;  3SPH A;  2ZAE B;  2DQ0 A;  2P7T C;  1NU1 G;  2FYU D;  4ZHQ B;  1FFT B;  2YXY A;  3CC2 V;  4B3T O;  5C93 A;  1LUW A;  1QR9 A;  1HP8 A;  3JAK A;  2R44 A;  1GH6 A;  4TQF A;  1EDL A;  4WF9 V;  3TF5 A;  4DR7 B;  3I5D A;  1LTJ A;  4BXL A;  2PAJ A;  1P7B A;  2QE7 G;  2JP3 A;  2M3B A;  4FLV A;  2Q5U A;  2RQ6 A;  1RQV A;  3OUS A;  1M90 Q;  5GON B;  2JJ2 G;  1GO3 F;  3H1K D;  2YXH A;  2RN9 A;  4JI2 O;  4DV2 B;  1H8A A;  2XT9 A;  3HTK A;  3L71 D;  2H8P C;  5BR8 O;  1I08 A;  1M56 B;  1EN6 A;  5KMG B;  1HWT C;  3LUT B;  3E8G A;  4O4H B;  3UIA A;  2DWE C;  1KYO I;  5AW1 B;  3UT5 A;  1L0L J;  2B1G A;  2M5A A;  2WLH A;  4ZOL B;  3ABT A;  1KIL B;  2CGN A;  3X2Q B;  1NS1 A;  2YID A;  1SFC D;  1NTZ H;  2BTQ B;  4ABM A;  2FYN C;  2JO1 A;  4IIJ B;  1WP8 A;  1ZAU A;  3CD6 V;  4WY4 B;  1UJW B;  1ENV A;  3BCC H;  2KB7 P;  1URQ B;  4FMT A;  4JPZ B;  1VF5 B;  4BWN A;  1BSM A;  5KJ7 C;  4ZHQ A;  2FFD C;  3A2A A;  2EJ7 A;  5C8Y A;  1SQV J;  3P8C D;  4JI5 B;  1ZV8 A;  2WPQ A;  3C1L A;  1JVM A;  5B5E E;  1H2L A;  1ZWI C;  3TK1 A;  4R50 A;  1SQG A;  2AZ0 A;  4R6Z A;  4CS2 A;  5HFM A;  3EFF K;  2QEX V;  2O3J A;  1M4U A;  3VMY A;  1JTH B;  3JSN A;  5BY1 A;  1FE6 A;  2GA1 A;  4I4T B;  2W27 A;  3M91 A;  5BMV A;  4AQY B;  1LT9 C;  2AHZ A;  4PJ0 H;  4ZI7 B;  4BIU A;  5IJ9 B;  4D6T E;  3B8M A;  4J10 A;  4RQE A;  3KYQ A;  2JDI G;  2Y4U A;  4CH6 A;  2ZIO A;  1XEQ A;  5KMG A;  4O4H A;  2ZXX A;  1NKZ B;  2Q69 A;  3ZRV A;  3L74 J;  4ZOL A;  1K33 A;  3ZHQ A;  1LTT C;  2Y0D A;  4NXN B;  4FZ0 A;  1K4D C;  2GM4 A;  4YJ3 B;  5J9P C;  4O9B A;  4YY3 B;  2A79 B;  3KG2 A;  1FDO A;  4IIJ A;  3JAL B;  3OFN G;  4DR5 B;  2CE4 A;  3TGU G;  3ZMZ A;  2WPD G;  3ETE A;  5EZY B;  1URQ A;  5E79 E;  3P30 A;  3A0R A;  2RNB A;  3CD6 P;  3DC6 A;  3W7U A;  2IJK A;  2ITC C;  4GX1 A;  1MA1 A;  3CCE V;  4W7Y A;  1SQB K;  1VQ6 V;  1F4M A;  4F4L A;  3A0H E;  1P84 D;  1SZX A;  2A06 H;  3L70 H;  1JTH A;  5LMU B;  3FB6 C;  2PFX A;  4GKK O;  3V6I A;  4I4T A;  5IT9 N;  2OYI C;  1BE3 J;  4X1I B;  1J1E B;  4ZI7 A;  5IJ9 A;  2QEX P;  4MVM A;  2IBZ D;  1NTK K;  3H25 A;  1R6T A;  4DR6 B;  3GLM A;  1FDI A;  3D71 A;  2WSC J;  1SQX J;  5KAF E;  2X6B A;  3CCJ P;  1HH0 A;  1KB9 E;  3B2E E;  1S5L E;  3RK3 E;  2EIN C;  1NH2 B;  1SP4 A;  4RAI A;  1K8A W;  3MUD C;  3ML0 A;  4HBN A;  3HD7 D;  2QWP B;  2OCC B;  2W6J G;  4YJ3 A;  5BZB A;  2R3C A;  2YNY A;  1V54 C;  1JO5 A;  4UCV A;  3CRC A;  3QO5 A;  3H1L G;  3D3I A;  1EZV H;  2ADQ B;  1MUU A;  2Y4T A;  1TVK B;  5EZY A;  4FLU A;  1COW G;  4UFZ A;  2QSA A;  2VS0 A;  1OW8 A;  3E22 B;  4PA3 A;  2O01 N;  4GKG A;  4LF8 B;  3JCU Z;  3LID A;  2KSJ A;  1DK1 A;  2I8D A;  3VOP A;  1H0T B;  4JAA A;  1KUQ A;  5AW4 B;  4MVU A;  5CBG A;  2E42 A;  4GZR B;  2ADP A;  1OVR A;  2KB1 A;  4EYY Q;  4WFB V;  4MTX A;  4RO2 A;  1YIJ V;  3ZHR A;  4ASU G;  3AE5 C;  3L73 G;  4K3A A;  3CCE P;  4O2B B;  1VQ6 P;  5KHK A;  4X1I A;  1KYO E;  2CPB A;  4WCE V;  1KFN A;  4BW9 A;  2JEE A;  2UUB O;  3RL0 C;  1NI8 A;  5CB4 B;  3G3Z A;  1L0N H;  4ZKI A;  5GW7 A;  2VWJ A;  2O1K A;  5IYD O;  3BRC A;  1FD9 A;  2B5U A;  1NYH A;  3BRV B;  1EDI A;  3DSQ A;  3OM3 B;  4WBN B;  2K3R A;  4J42 A;  2OIE A;  3BAA A;  4UB6 E;  3AE6 C;  5LYJ B;  4FLZ A;  3TGU E;  1YJN P;  4TV8 B;  1EM1 A;  4MW3 A;  1NKN A;  5TIS H;  2B88 A;  3LSQ A;  1AI4 A;  5KHJ A;  5B1N A;  1Q7Y Q;  1RF0 C;  4W4K A;  2Q7H A;  4U3F H;  4DV5 B;  4KXR A;  3SWK A;  5BU5 A;  1LUV A;  4G27 B;  1W59 A;  3BVH A;  2ZIN A;  2JR8 A;  4CS4 A;  3O8Z A;  1VQO V;  1YZB A;  1L4A D;  1GKF A;  2AEJ A;  1FYJ A;  2KSE A;  1GTW A;  2QKA A;  1XOU A;  3UO2 A;  2KOG A;  1ZLL A;  1YYC A;  1YIJ P;  2A9H A;  2OT5 A;  2VQF O;  4H13 B;  2DE0 X;  2YXL A;  4Z1M G;  3H1I D;  2ZT9 C;  2CK3 H;  5B1A B;  4PD4 D;  4FJC C;  1VQK P;  2ZIM A;  1YTZ T;  3SJB C;  1WPX A;  2V4H A;  4WBN A;  5KAI E;  1PGQ A;  1NTM J;  1R3J C;  3STL C;  5JJN B;  4YXW G;  5LYJ A;  3K5M A;  5B66 E;  1N34 O;  3H1L E;  1XL4 A;  4TV8 A;  5EBM C;  1SQP K;  4OXS A;  4B3S B;  3L75 J;  4W80 A;  2DW3 A;  3SSU A;  2HKO A;  1Z2G A;  4MTF A;  1NTZ J;  5KKZ C;  4NTX A;  4KFM A;  3CXH F;  3A0B E;  4Z1V A;  2H8P D;  2K9Y A;  1OXZ A;  3ASN C;  4PV1 D;  2R32 A;  3BCC J;  2Q4P A;  3CCM P;  2DYR B;  4P9O A;  4CS3 A;  3J80 N;  4X66 B;  2XAG A;  4IL6 Z;  1L0L G;  1LWU B;  2WMM A;  2B89 A;  1VQO P;  3L37 A;  1GK6 A;  3CCV V;  1RHZ B;  2YXQ B;  4KUM A;  3I5C A;  3IFX A;  2AW9 A;  5B5E Z;  2N9Y B;  1EXI A;  4DRX B;  1RH5 B;  3JAT A;  4FLX A;  4QNH B;  1IBK B;  5AVU B;  4ZMD A;  3BVO A;  4YHH O;  4U7J A;  1K4C C;  2W6A A;  1ARO P;  2FYU H;  3ZCC A;  2Y0E A;  4EFB A;  2GUZ B;  1YDX A;  1FBM A;  2CDY A;  1SQV G;  3CCR P;  2KUB A;  5AVS B;  2LW1 A;  3BY6 A;  2RN0 A;  5H6R A;  1WA8 A;  1Q81 Q;  4QPJ A;  1KQG B;  2QKS A;  2ZJS E;  5K5G B;  2Y9Y A;  2KS1 B;  2MK3 A;  5H2F E;  1NKD A;  5APS A;  1SFC B;  1B06 A;  1BGY J;  2VQE B;  5CMU A;  4MS2 A;  3A3Y B;  4DV3 B;  4JV5 O;  2H3O A;  1FXK B;  1OCC C;  2MJZ A;  3M06 A;  2HLO A;  4PDM A;  1I0H A;  2C9N Y;  1NTK D;  1OX3 A;  3L74 G;  1LWU A;  1H2M A;  3ZIA G;  4HJG H;  1ZXG A;  1PV0 A;  3THO A;  2OTJ V;  1FZE A;  1XNR O;  1YSC A;  4DRX A;  1MV8 A;  4IFM A;  4OGQ C;  1PP9 D;  3A0H Z;  3EWK A;  3JD2 A;  3CWB H;  5EBW C;  1SC5 B;  4A7P A;  4DV0 B;  3CX5 E;  3E1R A;  2KLV A;  3N7N A;  3QG5 A;  2PP6 A;  1Y66 A;  1ZLZ A;  4J7J A;  4B3M B;  2GUZ A;  1IFD A;  3MGN A;  2FXP A;  1SES A;  2NLJ C;  2E5L B;  1GN2 A;  4JAS A;  1M57 D;  1J2J B;  1IJD B;  1XNQ O;  5KAF Z;  1HJ0 A;  1RE4 A;  4PI0 A;  1S5L Z;  2ILM A;  1BE3 G;  2AXT H;  2KS1 A;  3F5H A;  1MZ9 A;  4WB4 A;  1YHQ P;  3R65 A;  1K92 A;  3ZS8 C;  3CL3 D;  2ZDI A;  1SFC A;  4NYK A;  1EBO A;  1HVV A;  2BE3 A;  3CCS V;  4LF4 B;  4AYC A;  3OMA B;  1SQX G;  1FXK A;  1L0L E;  3FFQ A;  5KHH A;  1QX8 A;  2UXB B;  2VRS A;  3E83 A;  4PHZ A;  1PPJ G;  2V7Q H;  1NU1 K;  3RK3 C;  4O4L B;  2WLM A;  4NPD A;  3Q4H B;  2K37 A;  3OMI B;  4X1Y B;  2W90 A;  3R4Y A;  1DF4 A;  3AG3 C;  1RF1 A;  4D6T J;  4BW5 A;  2UU9 B;  4HNA B;  3D8C A;  3CPW O;  4JZG A;  2OTJ P;  3L4F A;  2UUC B;  1BDD A;  1SQV E;  4GOD A;  1YI2 V;  3CRR A;  2MW2 B;  2QJY B;  2VRZ A;  1VQ7 P;  1HWY A;  3LW5 J;  1I7F A;  4KHP B;  1N7S D;  5IYC O;  1L0N J;  3OAK A;  1DH3 A;  3R2P A;  5KX5 A;  3LNN A;  3RYF B;  4JI1 B;  2IU3 A;  1P84 H;  1U96 A;  2P22 C;  4ZKU A;  3HD7 B;  4UB6 Z;  5LP6 B;  1KIL D;  4JI8 B;  1WMK A;  5IYZ B;  1NAY A;  3I55 V;  3ABK B;  5IY5 C;  3OW2 U;  4P30 A;  4X65 O;  2IBZ H;  4UCS A;  2H88 C;  4I50 B;  3WB1 A;  1S3J A;  2HPC B;  3L74 E;  1I5Y A;  4L76 A;  4WY4 D;  2HG5 C;  2BEQ D;  4IYH A;  1RPR A;  3RK2 C;  1YEW A;  4OVN F;  3JAS A;  5M1B A;  3CCS P;  1BZK A;  2Q6A A;  3B77 A;  4O4L A;  1P4R A;  3IC9 A;  5FPO A;  1K73 Q;  2UXN A;  4FM2 A;  4X1Y A;  1KFM A;  3ABM B;  5AVX B;  2DYS C;  2N9B A;  4CC5 A;  3AE2 C;  3D36 A;  3AE8 C;  2KG7 B;  5B1B C;  2QM7 A;  4KP4 A;  1X79 B;  5L3E A;  3AG2 C;  3WUV A;  1IFM A;  1Q7Y W;  1IVS A;  3RYF A;  1EDK A;  1GW4 A;  5EC2 C;  4MVQ A;  3QWO C;  4NTY A;  4RQF A;  2QWO B;  2R9I A;  2IU0 A;  4DR2 B;  3UCS C;  5AVW B;  2LJ2 A;  3HD7 A;  5LP6 A;  3TET A;  5IYZ A;  2OTK E;  1SQX E;  3CXH I;  2UXC B;  3Q5P A;  5FPR A;  1Z56 A;  3ASO C;  2XU6 A;  2EIL B;  4ZKP A;  2HPC A;  3T1H O;  3C9I A;  5D5P A;  1N32 B;  2AGA A;  2P4K A;  3CCU V;  1PPJ E;  4DUY O;  2NPS C;  3PH0 A;  4UUJ C;  3I55 P;  4JTA B;  3HKE B;  2ZYG A;  2LR2 A;  1PL4 A;  1VPC A;  3F7Y C;  1NTM G;  5GTI Z;  2RMK B;  3VN0 A;  4MN4 C;  1XIL A;  2ZYD A;  1L4A B;  4TOI A;  2IPP A;  2E75 C;  1Y67 A;  4EB6 B;  5KHG A;  3KKY A;  4K8Z A;  1T2K C;  3L75 G;  4CPG A;  1NJI W;  2ETN A;  4YTP C;  1JR9 A;  2HEP A;  1XL6 A;  1NTZ G;  4M3L A;  3KHU A;  3L72 H;  4QE7 A;  1MKM A;  2KG7 A;  1VIB A;  1SQQ J;  4DV1 O;  3GB7 C;  3BCC G;  3ZMS A;  4DZO A;  1GDT A;  1EZV D;  2JJL A;  4L8J A;  1NZ6 A;  1GL2 C;  3RVY A;  1IFP A;  3K5B A;  5CHX A;  2ZYA A;  5CBN A;  5APT A;  3OGI B;  2ZE5 A;  3CHX A;  1FJG B;  1AVM A;  5AW7 B;  4Q6G A;  4OX9 B;  3AG4 C;  4XBF A;  5APY A;  4L87 A;  3RFR A;  3H1I H;  4IHJ B;  3K9S A;  2QVA A;  1S2E A;  5H2F Z;  3HKE A;  2WTY A;  3AG7 A;  5IYB O;  1HW7 A;  3M7M X;  3H1H D;  2X6C A;  5CBO A;  1AIL A;  3H1K J;  1D5A A;  4HKZ H;  1ORQ C;  1L4A A;  4PV1 B;  2FYZ A;  3CCU P;  4BIZ A;  4EB6 A;  3L71 J;  3ZDM A;  3F5W C;  4JYC A;  3CCQ V;  2DW4 A;  2KNC A;  3JAW B;  1SVF A;  5IWA B;  5JQG B;  1BGY G;  4NXM O;  2P5O A;  2GSM B;  3U59 A;  1NQT A;  1S5J A;  2Q73 A;  4EKW A;  2AXC A;  1D5N A;  2WSS G;  1FC2 C;  5APU A;  2IM9 A;  1I5X A;  2B87 B;  2YIU B;  1LNQ A;  2K88 A;  2FFD B;  2Q68 A;  3K5N A;  1YJ9 P;  4U3F D;  2GBO A;  1BSH A;  3UQ8 A;  5KLV H;  4U3J B;  2AEM A;  3JD4 A;  4LP8 A;  4IT5 A;  2YS8 A;  2E74 D;  1PV3 A;  3BEH A;  3FAV B;  1KOR A;  4LFC B;  1NU1 D;  1FKA O;  1KN7 A;  4IHJ A;  1Q82 W;  1LT9 B;  1S72 P;  4LH7 A;  4ZNC A;  1GMJ A;  1NTM E;  2HFE C;  1JB0 J;  1NH4 A;  1E79 H;  3G4S V;  3TDK A;  2Y69 C;  5J2T A;  3BAT A;  3W7X A;  4DR4 O;  3L75 E;  1VQP P;  3HKB B;  3MP7 B;  1NR7 A;  3SYA A;  1HTL C;  5L3C A;  4HAM A;  5CCG D;  1OWA A;  1NTZ E;  1W5C E;  2WVR A;  4W7Z A;  2ZM6 O;  1SQB H;  4UVA A;  1DIP A;  2P67 A;  4LFB B;  3IAY A;  3BCC E;  4H0L C;  2JWD A;  5FL7 G;  5LXT B;  3CCQ P;  2M8R A;  3G67 A;  3CXH E;  1KB9 D;  2B87 A;  4LF5 O;  5LHI A;  2FFD A;  3UKM A;  2XND H;  1PM9 A;  3AK3 A;  1NTK H;  2IH3 C;  4U3J A;  1EN4 A;  3ZRX A;  2HOD B;  4MSW C;  1IBL O;  2E76 C;  2A45 H;  4D6T G;  1Q3E A;  4UCO A;  1R5S A;  1JCH A;  1LP1 B;  3U1A A;  1MZE A;  1PP9 H;  4I5S A;  2OYI B;  2ZKO A;  2DN9 A;  5APQ A;  3TNU B;  4X64 O;  1LT9 A;  2BOB C;  1Q6U A;  2R9R B;  3FB5 C;  4P9P A;  3GHG C;  4YXD C;  2CTP A;  2FKX A;  2X0L A;  3N4X A;  2BAS A;  1L0N G;  4TWK A;  4L74 A;  3HKB A;  1PKX A;  2LGW A;  3KZI Z;  4DV4 B;  1FS0 G;  5AVR B;  2EIN B;  3G4S P;  4JI0 O;  1XUQ A;  2DOS A;  2F4V O;  1BGY E;  1U57 A;  1KYO D;  3C90 A;  1OW6 A;  3SWY A;  1L0L K;  2CAZ C;  5CA0 B;  1V54 B;  5LXT A;  1AP5 A;  3OE7 G;  1RQU A;  2DMX A;  2PGD A;  4EFE A;  5EBL C;  2WA4 A;  3ZRS A;  1FAV A;  1G1J A;  3ABV C;  4K0K B;  1E1Q G;  3AG1 C;  1F51 A;  4UXN A;  2YIB D;  1X8Y A;  1Q5O A;  3UO3 A;  1LTG C;  2L91 A;  2A06 E;  1N7S B;  2HOD A;  5AG2 A;  1R1B A;  4FPP A;  4DO2 A;  3APQ A;  3CMA V;  4IFF A;  1AJY A;  3SJQ C;  1DD3 A;  2OYI A;  2CPS A;  3RL0 g;  1UFI A;  1ZL8 B;  1K73 W;  1RSO B;  2R5B A;  3N2G B;  4AQR D;  3BHP A;  1FU1 A;  1AJP A;  1IZN B;  4CC6 A;  4LF9 B;  2ARH A;  4TSF G;  3B5N D;  1PGO A;  2AEF A;  3CWB D;  1N8R Q;  2N04 A;  2V1D A;  2IH1 C;  4LF7 B;  1LTI C;  1AJQ A;  4FZ1 A;  3F89 A;  5DN6 G;  5FLX N;  4DUZ O;  3ZHT A;  3FYI B;  2FXO A;  1J1D B;  3SR2 C;  3ICX A;  4GX2 A;  1PIX A;  1QVF O;  2K9J B;  2HJD A;  3H1J J;  3EXA A;  5CA0 A;  3JCU H;  3G71 P;  5LA6 B;  1XRE A;  5D5Q A;  2LKM A;  2KYV A;  3ZMU A;  2IJI A;  1DEB A;  3HKC B;  4LFA B;  5JCO C;  2HHH O;  4X62 B;  1JX9 A;  3H01 A;  1IC2 A;  1U97 A;  5GON A;  3CCJ V;  3M9Q A;  1ZOY C;  4C7U A;  1HNW B;  2E75 D;  3AE4 C;  3FX0 A;  1N7S A;  1GM8 A;  4N6J A;  1WJZ A;  4MVR A;  1T2K D;  2J5U A;  3H1L D;  5KLV K;  3M9B A;  2P6J A;  1PZQ A;  5HFL A;  2FL4 A;  1Y6X A;  4GX5 A;  4I6M C;  5LMN B;  1WPB A;  2L35 A;  1KKC A;  3QVN A;  1RSO A;  4TLF A;  1SQQ G;  3N2G A;  1Q43 A;  1L0N E;  4I55 B;  1KIL A;  3CMA P;  1SQP H;  2Q67 A;  2QA4 P;  3BAB A;  4X1K B;  2D3O W;  1QEX A;  5IJ0 B;  2BTQ A;  2GUS A;  4TT3 H;  1FS0 E;  3K59 A;  1XHX A;  1G1X B;  3L73 D;  1HF9 A;  1NAF A;  4GYC B;  4J9Z B;  3K79 A;  4WY4 A;  4DR7 O;  1HR0 B;  4BWA A;  3W67 A;  5KUM A;  2Q7G A;  3MHS C;  4I2L C;  4U7O A;  1HDJ A;  1V55 C;  2IYP A;  2K9J A;  2QDO A;  4C7N B;  1LTB C;  1ZN5 A;  5EIB D;  3GG2 A;  2P2U A;  2QTS A;  1MOF A;  3HKC A;  3OTF A;  4MTO A;  3CC7 V;  4DV2 O;  3E8H A;  3CI9 A;  1ZRT D;  2IJJ A;  3JAR B;  2EIM C;  4EOT A;  3ASN B;  2WSE H;  2W0F C;  1H2N A;  4F6R B;  1JPX A;  3H1K G;  1QNM A;  1CI6 B;  1LTJ C;  4RWU A;  3L71 G;  2XDJ A;  4NB5 A;  4LF6 B;  2QJK C;  4DOJ A;  2ZE8 A;  3WG7 C;  1YJN V;  2N1T C;  3LSS A;  3D70 A;  2F93 B;  1VQ5 V;  2WPV B;  2RMZ A;  4I55 A;  3EFG A;  5EC1 C;  4X1K A;  4JI5 O;  1USD A;  3JAL A;  2ZE6 A;  4UV9 A;  3RYI B;  1G1I A;  2FKW B;  1DX7 A;  3RBZ A;  1JNM A;  4CBC A;  1H8E G;  3CS5 A;  4AQY O;  5JWP A;  2GHY A;  3LIE A;  2W0X A;  3BA8 A;  4FFB B;  1YVW A;  2OIG A;  4PDL A;  3E2E A;  2HFE D;  1MSD A;  4PA6 A;  2IYO A;  4PA7 A;  4DV7 B;  3ABU A;  4IL6 H;  3JAR A;  1E1R G;  1VQK V;  3DTU B;  4F6R A;  3OGC C;  5B5E H;  3CC7 P;  3H1H H;  1OCC B;  1BMF G;  2BOC C;  1CI6 A;  3CP1 A;  1FPO A;  4NXN O;  1JOY A;  5LGN A;  4DXW A;  2ODM A;  5AVV B;  2DQ3 A;  4YY3 O;  4WFA V;  1IDS A;  2WLL B;  1RY3 A;  4L73 A;  1SQQ E;  3A8T A;  4DR5 O;  4H0L D;  1S76 D;  2YXR B;  2QKC A;  2E74 B;  2O01 H;  3D6Z A;  3SPI A;  3USS A;  2BCC J;  2FYU E;  4J9Y B;  1M56 C;  5A2Q N;  1L0L D;  3CX5 I;  1VQ5 P;  1L8D A;  2XNX A;  3CC4 V;  2CGO A;  3RYI A;  1TVK A;  3L72 D;  1HNX B;  5LOV B;  3CCM V;  2E76 D;  4DCK A;  2Z3Y A;  1B3Q A;  3A5T A;  5LMU O;  1YQ3 C;  1NWQ A;  3E22 A;  4DYL A;  5K1P A;  3ZHS A;  1H0T A;  1NTM K;  1OW7 A;  2Z5H A;  1OVV A;  4UB8 E;  5C39 A;  2BSK B;  1R3L C;  1JUN A;  4XDJ A;  2A3Q A;  4YIO A;  1NU1 H;  1J5E B;  4DR6 O;  1S9K D;  2Q0O C;  5DJT B;  4OH8 B;  5AW5 B;  1JM0 A;  2KP8 A;  3H1K E;  4O2B A;  1HJB A;  1AQT A;  2IBZ G;  3L71 E;  4TV9 B;  2YKQ A;  5CN0 A;  2Z0A A;  3S3X A;  1KZU B;  1KC8 W;  3CCR V;  3FGA D;  2R72 A;  4PDR A;  5CB4 A;  3NXS A;  2ZFC A;  3A0H H;  3N27 A;  2QE7 H;  5KHI A;  1LT1 A;  3PN1 A;  5AVZ B;  2ZQM A;  3G9R A;  2Q3I A;  3AG3 B;  3FWL A;  3B71 A;  3JD0 A;  1Z5V A;  4LF8 O;  3HUS C;  1QU7 A;  2ZR3 A;  1VQ4 V;  1M8O B;  4N78 D;  4JAU A;  1QGK B;  5KAF H;  3ZHU A;  1KB9 H;  1T8Z A;  2YC0 A;  3VMA A;  3P8M C;  1S5L H;  5LOV A;  1VF6 A;  3P32 A;  3ETG A;  1RFY A;  5B3S C;  4J80 A;  3CC4 P;  1M90 W;  3OEH G;  2YMY A;  2JGU A;  2H43 A;  5CCG A;  4DV6 B;  1YIT V;  2OYQ A;  1LJ2 A;  3FB7 C;  1QL1 A;  1BHB A;  5KLV D;  1E5W A;  4FFK A;  3B8N A;  2IZ0 A;  5IY5 B;  2GTA A;  4TV9 A;  1G6U A;  2CUG A;  2QR4 A;  5H6Q A;  5GTH E;  2JVD A;  5E1A C;  2Q5Z A;  2OAR A;  3JD1 A;  1BE3 D;  5KJ7 D;  2QWQ B;  1AJN A;  3F7V C;  2EIK C;  4UV8 A;  1YJW V;  2WT7 B;  4RO0 A;  1BDC A;  1GTO A;  2F66 C;  1GN3 A;  1N8R W;  5CBF A;  3H1J G;  1KYO H;  4DV5 O;  2JDI H;  3RYH B;  1YHQ V;  3W7W A;  2YO3 A;  1K04 A;  2R9A A;  5AVQ B;  3CEI A;  1N33 B;  4B08 A;  1PPJ D;  4JI4 B;  1BQ0 A;  2W6B A;  3Q2Y A;  2B9Z A;  4N21 A;  2ZE7 A;  1SQB D;  2JKV A;  3W7S A;  5CA3 A;  4H37 A;  1VQ4 P;  4UB6 H;  4BR6 A;  3B5N B;  2ZNI A;  1OIP A;  4GOF A;  1P84 E;  4LCU C;  2JRI A;  3LSU A;  2WAM A;  5KTB A;  3SYO A;  3TGU H;  4DK0 A;  2KSD A;  1RM1 C;  3JSL A;  4RJT A;  1H88 A;  1Y4M A;  1EN5 A;  5E79 Z;  2IBZ E;  1PNM A;  3T1Y B;  3AED C;  1PNL A;  4GUN A;  2HLD G;  3HKD B;  4DR1 B;  1YIT P;  1SS3 A;  1VQM V;  3ASO B;  3JSV C;  1TUE B;  2NNU A;  1VQ7 V;  1VQL P;  4FM0 A;  2NPS B;  1FZB A;  4B7K A;  3QNE A;  3L70 J;  2YO2 A;  3VOU A;  2HJF C;  2Y9Z A;  1AI7 A;  1O9G A;  4JTC B;  4X9Q A;  1SET A;  1KQL A;  2WT7 A;  1NGM B;  4B3S O;  1PGJ A;  2YIB A;  2HVK C;  2E75 B;  2PGG A;  3FYE B;  3VQY A;  3RYH A;  1BCC D;  1YJW P;  4DW0 A;  1M5I A;  4B7E A;  5JH7 B;  2WPS A;  4HB1 A;  1QLE C;  4QIW F;  1XMO O;  1VQN P;  4H33 A;  2ZCE A;  1X9V A;  4X66 O;  1BSN A;  2C0W A;  2LQT A;  4XDK A;  1AB3 A;  4FLT A;  1TU3 F;  1EC5 A;  4LH6 A;  2W6J H;  3B5N A;  3B8E B;  4JI7 B;  4KT0 J;  3HR0 A;  2JS5 A;  1GL2 B;  3IJ4 A;  2XAF A;  3H1L H;  2N1T D;  1QVG U;  4JYA B;  1IBK O;  5FNV B;  1PL5 A;  1URF A;  4ASW A;  1JCD A;  4NKG B;  1OCZ C;  3MAQ A;  4EDF A;  1GM9 A;  3AG4 B;  2EUL A;  5GTI H;  1N73 B;  4J7Z A;  3HKD A;  1AFO A;  4EIJ A;  3K03 A;  1JMM A;  3MZW B;  3PRJ A;  3M0D A;  2ZXE B;  1W2B U;  3L73 H;  2G38 A;  1FJP A;  3E7K A;  2LGQ A;  3JCZ A;  3H1J E;  1VQM P;  5LHH A;  1CEZ A;  4B3R B;  4CH4 A;  1YTZ I;  5H5N A;  3H1H J;  4BIO A;  3II6 A;  5A9G A;  5B1O A;  5AW2 B;  2F23 A;  1GN6 A;  4NR1 A;  4TUY B;  3FXE A;  1MFZ A;  3T2M A;  1ZR2 A;  3E1I A;  2VQE O;  4DV3 O;  4DR3 B;  1NTM D;  1VAR A;  2O01 J;  5AW6 B;  4MVZ A;  3CRM A;  2IDB A;  4FIP C;  3RL0 D;  1RP3 B;  3R66 A;  4IOI H;  3U11 A;  2OYH B;  4QGP A;  1XBL A;  1G2C B;  3Q5S A;  2EIJ B;  3LDD A;  2QSI A;  4WFE A;  4U3F J;  5FNV A;  3CCL P;  1NHL A;  4UVC A;  3DXR B;  4DV0 O;  2WQY C;  2UWJ E;  1AI6 A;  3RT3 C;  1SZT A;  2JIZ G;  3H1I E;  5H2F H;  4B3M O;  1OVU A;  1N73 A;  4PD4 E;  4XFJ A;  3Q4H A;  1IBM B;  2BCC G;  4Y28 J;  4DK1 A;  2IJH A;  4UB8 Z;  1PNK A;  3CXH D;  3OTO B;  2E5L O;  2F95 B;  4HNA A;  4PA4 A;  1H2K A;  5K1X A;  3PP5 A;  3F5T A;  1KD1 Q;  1FZC C;  5CJ4 A;  1SQP D;  5L3F A;  3WU2 E;  4GKJ B;  2IW5 A;  5APW A;  3Q3D A;  4Z1M H;  1CSB A;  1Q6I A;  4R4M A;  2LW7 A;  1SA0 B;  5L3G A;  1KQF B;  4BRY B;  1Z5W A;  1VQ8 P;  1W2B O;  1VL2 A;  4LF4 O;  2JGD B;  3CX5 H;  4H0L B;  1GK4 A;  2UXB O;  5KAI Z;  4AI8 A;  3S4R A;  2ZT9 D;  4YXW H;  1SQQ K;  3M99 B;  4J7K A;  2YIC A;  5B66 Z;  1M9N A;  3AEB C;  3EQ2 A;  3P7K A;  2OYH A;  1QR8 A;  4JI3 B;  4I50 A;  1G2C A;  3FD9 A;  1JY3 O;  5BVZ A;  2QWR B;  2UU9 O;  2Q9I A;  1H8H G;  3PHL A;  2E76 B;  3DXR A;  2ZDI C;  1IX9 A;  3V2R A;  2UUC O;  1L2P A;  1NBM G;  2KI7 B;  2QJ1 A;  1PD3 A;  3A0B Z;  3OW2 O;  1IFN A;  4L75 A;  4KHP O;  2ZVN B;  1L0L H;  3GHG B;  2A0L A;  4JI1 O;  1GN4 A;  4RUE A;  2UUA B;  3GWO A;  1YJ9 V;  1OV9 A;  2WLI B;  1RE3 A;  1YQ4 C;  1RF1 C;  1WLE A;  1S0V A;  2XAH A;  5GTH Z;  1NOH A;  1BS3 A;  4JI8 O;  3A7O A;  4PI2 A;  2HR3 A;  2F1M A;  1FZA A;  4NPF X;  4BRY A;  3SGI A;  2FYU J;  3LDC A;  1SQV H;  2FXM A;  3SWF A;  2RKL A;  1I94 B;  4WFG A;  5CCH C;  1AVO A;  2KQX A;  1S72 V;  4IYI A;  4G2K A;  1NVP B;  2P7J A;  5KA6 A;  5AW9 B;  2UXD B;  4QE9 A;  3AG1 B;  3BPZ A;  1JMK C;  2Q0A A;  1VQP V;  4PEL A;  1OCO C;  1N2D C;  1PP9 E;  2BCC E;  2NZ2 A;  3H6P A;  3I56 P;  1XI1 A;  3IC7 A;  2PI5 A;  3KZI H;  3L74 H;  3GHG A;  1XMQ B;  2PI4 A;  4N23 A;  4LLH A;  2JS3 A;  3S1K A;  1HNZ B;  1QQC A;  2QTO A;  1Q81 W;  5L3D A;  3EHB B;  4X88 A;  4ICG A;  3IR9 A;  4D6T D;  2FYN B;  4DR2 O;  2YI9 A;  4X20 B;  1CW5 A;  3CWB J;  4PA9 A;  1K9M Q;  1YTF D;  2UXC O;  3FXD A;  2NR5 A;  3G6E V;  5CMZ A;  1JJO A;  1MFT A;  5J2U B;  1N32 O;  1K8A Q;  1R5L A;  4OGQ D;  1XQ8 A;  1ZME C;  4I9W A;  4JI6 B;  1V9P A;  2A06 G;  3L70 G;  2NN4 A;  2Y0C A;  1BE3 H;  1AVY A;  2DWD C;  4I7Z C;  1HGZ A;  3VQV A;  3TXQ A;  2JJ1 G;  4HZ3 A;  1D2D A;  2ZD9 A;  2QJP C;  1X22 A;  2WSC H;  1SQX H;  5DM6 V;  4B3T B;  1Q86 Q;  4RUF A;  2WWW A;  3ZN0 A;  3GF3 A;  1T6A A;  1N4C A;  3SPJ A;  4U7N A;  1X4T A;  3C8V A;  1FOS F;  2V7Q J;  1PPJ H;  1K3E A;  1KMI Z;  4FM1 A;  1XTC C;  2ZVO B;  3JAW A;  1W0J G;  1WRG A;  2D2C C;  2SPZ A;  5JQG A;  3TJT A;  1FZF A;  2POH A;  1O9H A;  4X20 A;  4ASV A;  1TA8 A;  1FJG O;  4LR3 A;  2GDS A;  1EZV G;  1K7D A;  4OX9 O;  5KJ7 A;  1IO4 A;  2FTK A;  2WLJ A;  4JI2 B;  4RKU J;  1Y47 A;  1KIL E;  3RK3 D;  3OAA G;  5BR8 B;  2A7W A;  5J2U A;  1DF5 A;  1P84 F;  3GVM A;  1HUC A;  2C0X A;  1U7J A;  4CH3 A;  3TYY A;  3FAV A;  1IFJ A;  2CH7 B;  3G6E P;  1QHT A;  1QBZ A;  4PJ0 E;  5JCO A;  2EIM B;  4R8C A;  3ETD A;  4R7C A;  3KQG A;  4YJ2 B;  3JAK B;  3IN6 A;  3MIW A;  3K58 A;  3H1H G;  2PZS A;  3ABL C;  2QJK B;  3HB3 B;  2BTO A;  5IWA O;  5LGT A;  1GD2 E;  1G4Y B;  1TGO A;  1LGH B;  2M0B A;  2ITD C;  1BCC H;  5TJH A;  4J41 A;  3WG7 B;  1ZTE A;  2N1T B;  4F6E A;  3G71 V;  4JQ0 D;  3VYI A;  3AE3 C;  2RCV A;  1ZR4 A;  2DJV A;  1Y74 B;  2IFN A;  1DEE G;  2XAQ A;  2HG5 D;  2JK5 C;  3RK2 D;  1GMG A;  2JWA A;  2FML A;  4U3F G;  3MHH C;  1VEW A;  2V4D A;  3RYC B;  4LFC O;  4XE5 B;  3VP8 A;  1AR5 A;  3RW0 A;  3O6Q B;  3AK1 A;  4E4E A;  4IFD K;  2PRR A;  3L70 E;  1SQV K;  3TGU D;  1T5E A;  2O57 A;  2CH7 A;  2HP8 A;  1LP1 A;  1N36 O;  2QA4 V;  5C8Y B;  2UXX A;  2E5T A;  1AA0 A;  1SER A;  4YJ2 A;  3TNU A;  3DC5 A;  4E2L A;  4AUW A;  4QPK A;  1R3K C;  1M1J C;  2GUV A;  4RES B;  3RL0 B;  2CK3 G;  4N3Y B;  1TAE A;  1KD1 W;  4LFB O;  2Y0I A;  3V2Q A;  5BMV B; 
#chains in the Genus database with same CATH homology
 4NVP A;  4PI0 A;  3RYI A;  1TVK A;  1HNX B;  5LOV B;  3AE1 C;  2E76 D;  3ZS8 C;  1TUB B;  1YQ3 C;  1S1C X;  3E22 A;  2EX3 A;  5K1P A;  4LF5 B;  4PV1 C;  4LF4 B;  4GKK B;  1OW7 A;  5EIB C;  3Q5R A;  4FLW A;  3FFQ A;  5KHH A;  2UXB B;  4LNU B;  1J5E B;  4PHZ A;  1IBL B;  3RYC A;  5J2T B;  4O4L B;  3K5O A;  4O2B A;  4AIL C;  1JFF B;  2QJY C;  4X1Y B;  4TV9 B;  3O6Q A;  3R4Y A;  4GDO A;  3SJC C;  4X64 B;  4D7T A;  1K05 A;  2UU9 B;  3FGA D;  4HNA B;  2R72 A;  1IK7 A;  5CB4 A;  2YIU C;  5KHI A;  2UUC B;  3PN1 A;  1KU9 A;  4AHC A;  3AEF C;  5EYP B;  3G9R A;  4IL6 X;  3LW5 J;  1I7F A;  4KHP B;  5LP6 C;  4JI0 B;  2ZT9 B;  3B71 A;  1Z5V A;  5KX5 A;  3LNN A;  3RYF B;  2F4V B;  3AEA C;  4JI1 B;  5KLI C;  3SJA C;  2GV9 A;  1SQF A;  2E3C A;  1EXJ A;  2P22 C;  5LOV A;  5LP6 B;  1R8E A;  4JI8 B;  2VWK A;  1TUB A;  5IYZ B;  1WMK A;  4UCS A;  4O2A B;  2H88 C;  4I50 B;  3WB1 A;  5LA6 A;  2JGU A;  3S9O A;  2BEQ D;  4LNU A;  4DV6 B;  2OYQ A;  1WNS A;  4H44 C;  1YEW A;  2UUB B;  4O4J B;  4UCT A;  3JAS A;  5M1B A;  4O4L A;  3T97 B;  2MKV A;  1N36 B;  5FPO A;  1JFF A;  1ZP0 C;  4FM2 A;  4X1Y A;  4TV9 A;  1DGS A;  1G6U A;  2JVD A;  4I9Q A;  4H44 B;  4CC5 A;  3AE2 C;  2G8Y A;  4FVM A;  3RGB A;  2F66 C;  3AE8 C;  3AEG C;  5EYP A;  4R4L A;  4O4I B;  4H13 D;  3RYH B;  4DUZ B;  1K04 A;  2R9A A;  1P49 A;  3RYF A;  1N33 B;  5IJ0 A;  5JJJ B;  4B08 A;  4JI4 B;  3RWR D;  1WN7 A;  3Q2Y A;  4DR2 B;  2QIW A;  5LP6 A;  5IYZ A;  4EEQ A;  1SKV A;  2ZNI A;  2UXC B;  4GLX A;  3K5L A;  3Q5P A;  4O2A A;  5FPR A;  2QM4 A;  2HHH B;  2YI8 A;  3UT5 B;  5D5P A;  4DK0 A;  1N32 B;  2VQF B;  3JSL A;  3HKE B;  2YMK A;  4O4J A;  2PYJ A;  3T1Y B;  3AED C;  1S5L X;  3HKD B;  4DR1 B;  4TOI A;  2E75 C;  5KHG A;  4EB6 B;  1B04 A;  4K8Z A;  4FM0 A;  4YTP C;  4ZHQ B;  2HEP A;  1O9G A;  2D2C D;  1NGM B;  1MKM A;  1N34 B;  2YIB A;  3JAK A;  4TQF A;  4O4I A;  2E75 B;  2PGG A;  3ZED A;  4OGQ B;  4DR7 B;  3VQY A;  3RYH A;  1M5I A;  5JH7 B;  4L8J A;  2JP3 A;  4FLV A;  2RQ6 A;  1RQV A;  2ZCE A;  5GON B;  1FJG B;  3CHX A;  4FLT A;  1TU3 F;  4Q6G A;  4LH6 A;  4DV2 B;  4OX9 B;  3WB0 A;  3RFR A;  4JI7 B;  4KT0 J;  5KMG B;  2JS5 A;  4O4H B;  4IHJ B;  3UT5 A;  2PUS A;  4JYA B;  4FFB A;  5FNV B;  1VF5 C;  4ZOL B;  1PL5 A;  3HKE A;  3MAQ A;  1HW7 A;  3M7M X;  1DD4 A;  4YHH B;  3GF7 A;  2BTQ B;  1D5A A;  3HKD A;  2FYN C;  2JO1 A;  4PV1 B;  4IIJ B;  4FLY A;  1ZAU A;  4EB6 A;  4KL1 A;  1VF5 B;  4ZHQ A;  3JAW B;  3QF7 A;  5C8Y A;  5IWA B;  5JQG B;  4JI5 B;  4B3R B;  4CH4 A;  2P5O A;  1SQG A;  1S5J A;  4CS2 A;  4TUY B;  1M4U A;  2IM9 A;  3JSN A;  3K5N A;  4I4T B;  5BMV A;  4DR3 B;  4AQY B;  3UQ8 A;  4ZI7 B;  4U3J B;  5IJ9 B;  4JV5 B;  3JAT B;  2O01 J;  2ZNJ A;  2E74 D;  1PV3 A;  2IDB A;  2PY5 A;  4CH6 A;  1KOR A;  2ZIO A;  4LFC B;  3U11 A;  5KMG A;  4O4H A;  4IHJ A;  3Q5S A;  1XNR B;  4LH7 A;  2QSI A;  1GMJ A;  5FNV A;  1JB0 J;  1NT2 B;  4ZOL A;  4NXN B;  2WQY C;  4YJ3 B;  5J2T A;  4YY3 B;  4XFJ A;  1FDO A;  4Y28 J;  1IBM B;  3HKB B;  4IIJ A;  4DK1 A;  3JAL B;  4DR5 B;  2OWO A;  3OTO B;  5EZY B;  2F95 B;  4HNA A;  5K1X A;  1DIP A;  1XNQ B;  4LFB B;  3IAY A;  4H0L C;  1XMO B;  4GKJ B;  3CB2 A;  5LXT B;  3Q3D A;  4Z1M H;  4K8X A;  3AEC C;  4R4M A;  4CH5 A;  1Y9B A;  1SA0 B;  4UCU A;  1KQF B;  1Z5W A;  5LMU B;  1Q90 D;  1VL2 A;  4I4T A;  4X1I B;  4H0L B;  4ZI7 A;  4U3J A;  5IJ9 A;  2E76 C;  4UCR A;  3H25 A;  2ZT9 D;  4DR6 B;  3GLM A;  1FDI A;  3D71 A;  1Q3E A;  4UCO A;  2WSC J;  3AEB C;  3SFD C;  4JI3 B;  1ZRT E;  3B2E E;  4I50 A;  3RK3 E;  4YXD C;  4HBN A;  2E76 B;  4YJ3 A;  3U10 A;  3VQX A;  2QJ1 A;  3HKB A;  4UCV A;  4DV4 B;  1TVK B;  5EZY A;  4FLU A;  1XHZ A;  4UFZ A;  1U57 A;  1OW8 A;  1OW6 A;  3E22 B;  1FFX B;  2CAZ C;  4LF8 B;  2WSE J;  5CA0 B;  3ETQ A;  4D7S A;  5LXT A;  2UUA B;  1YQ4 C;  1RQU A;  3U0Z A;  4H44 D;  4EFE A;  3VQW A;  4PI2 A;  2F1M A;  3ABV C;  4K0K B;  3AE5 C;  3SGI A;  3D6Y A;  2BEZ F;  4O2B B;  5KHK A;  4X1I A;  4X65 B;  2YIB D;  1Q5O A;  5JVD B;  1I94 B;  2E74 C;  4BW9 A;  5CB4 B;  2WSF J;  2VWJ A;  1AJY A;  3BRC A;  2R70 A;  2UXD B;  1DD3 A;  3BPZ A;  2G3A A;  3AE7 C;  3RL0 g;  1NYH A;  1JMK C;  3DSQ A;  1OMI A;  4WBN B;  2Q0A A;  3BAA A;  3N2G B;  3AE9 C;  3BHP A;  1Q8I A;  3AE6 C;  5KX5 B;  4CC6 A;  5LYJ B;  4FLZ A;  4LF9 B;  2NZ2 A;  4TV8 B;  1XI1 A;  4LF7 B;  5KHJ A;  2Q7H A;  4DV5 B;  1XMQ B;  3SR2 C;  1FFX A;  1QQC A;  2ZIN A;  3ICX A;  3WB2 A;  1HNZ B;  4CS4 A;  1PIX A;  1H2S B;  5CA0 A;  2YI9 A;  4X20 B;  4H13 C;  5LA6 B;  5D5Q A;  2OQQ A;  1M93 A;  3HKC B;  1UIX A;  3JAS B;  5JH7 A;  5L8R J;  1KTM A;  4LFA B;  5JCO C;  4X62 B;  1JJO A;  5GON A;  5J2U B;  2KKW A;  5JVD A;  1ZOY C;  2E75 D;  1HNW B;  3AE4 C;  2YXL A;  1XQ8 A;  3T1H B;  4H13 B;  4OGQ D;  1ZME C;  2ZT9 C;  5BMV B;  4DUY B;  2J5U A;  4JI6 B;  1V9P A;  2ZIM A;  5LMN B;  1WPB A;  3SJB C;  3BA9 A;  1RSO A;  2PTM A;  4WBN A;  3N2G A;  1Q43 A;  4I55 B;  4I7Z C;  5JJN B;  3N2K B;  3VQV A;  3BAB A;  4X1K B;  5LYJ A;  3K5M A;  2QJP C;  4ZIB A;  5IJ0 B;  2BTQ A;  4TT3 H;  4TV8 A;  3K59 A;  4B3T B;  3IAO A;  1XHX A;  1VF7 A;  1HF9 A;  4B3S B;  3SFE C;  4GYC B;  3QTC A;  3GF3 A;  1HR0 B;  4DV1 B;  4BWA A;  2YIA A;  1X4T A;  3C8V A;  2V7Q J;  4I7Z B;  1KMI Z;  2Q7G A;  4FM1 A;  3JAW A;  5KKZ C;  2D2C C;  2RJZ A;  3GMA A;  5JQG A;  2FBW C;  2K9Y A;  4PV1 D;  1O9H A;  4X20 A;  5EIB D;  1TA8 A;  5JJE B;  4LR3 A;  4CS3 A;  4TUY A;  4X66 B;  3HKC A;  3OTF A;  1VF5 D;  3CSX A;  5ITZ B;  4JI2 B;  4RKU J;  3JAR B;  1KIL E;  2D2C B;  4TQD A;  5BR8 B;  1EXI A;  5J2U A;  4DRX B;  4F6R B;  3JAT A;  4FLX A;  1IBK B;  4CH3 A;  4LF6 B;  2QJK C;  4U7J A;  1QHT A;  5JCO A;  4YJ2 B;  3JAK B;  4EFB A;  3IN6 A;  3D70 A;  2F93 B;  2H89 C;  2P10 A;  2WPV B;  3K58 A;  4I55 A;  3N2K A;  2PZS A;  4X1K A;  5CA1 B;  2BTO A;  1KQG B;  3A2F A;  1TGO A;  4NXM B;  3JAL A;  3RYI B;  3AE3 C;  2VQE B;  1HJ0 A;  2XHB A;  4DV3 B;  3BA8 A;  4FFB B;  3Q1M A;  1SA0 A;  2V4D A;  5ITZ A;  3RYC B;  4DV7 B;  3JAR A;  3AEE C;  3THO A;  4DRX A;  4F6R A;  4OGQ C;  3EWK A;  1T5E A;  4DV0 B;  3K57 A;  3QG5 A;  5C8Y B;  2Q7E A;  4B3M B;  4YJ2 A;  2PYL A;  4H0L D;  4DR4 B;  2FXP A;  2E74 B;  2E5L B;  3D6Z A;  5CA1 A;  1TAE A;  2ZM6 B;  1L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...