1KMIZ

Crystal structure of an e.coli chemotaxis protein, chez
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
209
structure length
177
Chain Sequence
SIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLSQDQVDDLLDSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
pubmed rcsb
total genus 62
structure length 177
sequence length 209
ec nomenclature
pdb deposition date 2001-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF04344 CheZ Chemotaxis phosphatase, CheZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.500 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1kmiZ02
1.20.5.590 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kmiZ01
1KMIZ
chains in the Genus database with same CATH superfamily
1HR0O 2HJDA 2OYQA 5APSA 4U3FG 1RP3B 2BCCJ 2W90A 4LWSA 2AZ2A 5TISH 2F1MA 4X1KA 2Z3YA 1ZAUA 5LMUO 4LFBB 5FNVA 3H1HH 4WFAV 4NXMO 2PI4A 1HNZO 2XNDH 4D6TD 4OGQC 3RN4A 5AVZB 3W7XA 3LW5H 1KB9I 3TNUA 1KFNA 1ZRTD 2Z0AA 1L4AA 2B88A 3APOA 1TVKB 5IE9A 3L71E 2Q5ZA 4O4LA 3R4YA 1TA8A 1ZR2A 4NYKA 1RE4C 2IJHA 2VWKA 3JAWB 3MHHC 3JAKB 3A0BH 5CBGA 3H1KJ 3CXHI 4DUZB 1N36O 1DEBA 1PL0A 5LP6A 2XV5A 4IOIH 1VQPP 3M0DA 1XTGB 2IFMA 3EWKA 1Q6HA 4GIFA 2WWWA 3TGUJ 1TUEB 1SQXH 3JD1A 2FYNC 4KHXA 5IJ0B 1AP6A 1QHTA 2PF4E 2ZT9C 2DYRB 3OFNG 3IAYA 1XL6A 2VQEB 4NPFX 4YJ3B 1VQKV 3JD3A 4EOTA 5B1OA 1ZTEA 1IURA 3G6EP 2MKVA 1P7GA 2WLJA 2V7QH 1BHBA 2M6YA 1P7BA 4KXRA 3ZMVA 1XNQB 4DO2A 5FPOA 4JF7A 1FFTB 3EXAA 5CCHD 1Y74B 2HP8A 1WJZA 2A06H 1N7LA 3NFQA 3WUVA 3HD7C 3ZN0A 1S9KD 2E76D 2GBOA 3CCVP 4B86A 1R6NA 2E76B 2WT7A 5H5NA 2RKLA 3HTKB 1UIIA 3JSNA 2ZM6B 1ENVA 3G71V 2A45H 2CGOA 2AXTH 4LFCB 4DRXB 4YY3O 3ABMC 5AVTB 1JEKA 1YIJV 1PPJD 2Y69C 2WLIB 3AG4B 4JASA 2P67A 2ZXWB 2O01N 1U7MA 1M4UA 2FYUG 2F23A 1G2CA 1VQ8P 3KHUA 3QG5A 4YXWG 4H13B 1XDCA 4TV8A 4JI6B 1V54B 2GUZB 1VQNV 5EYPB 1KUQA 2R5DA 2JIZG 4MTXA 1GL2C 1BS3A 3I5CA 4U7JA 1GW3A 3Q3DA 3A2FA 1AJYA 4DR6B 2KZJA 2HG5D 2CPBA 3PTZA 4P9PA 3ZCCA 3L75E 2H43A 2OTLV 4DV0O 2FY8A 1I5XA 3II6A 3HKBA 1IFNA 2LR2A 1L2PA 1ZN5A 2ZE6A 3P32A 1IZ3A 3HR0A 2Y4TA 4Z1MG 2P4VA 1BCCD 2K3RA 4X8AA 3D36C 1JA8A 3CL3D 4JAVA 3N7NA 1SQPD 4FFBB 1U7JA 5EBLC 2YKQA 1U97A 1IDSA 4UB6H 3Q4HA 4JYAB 1ZL8A 1ZMEC 4GCZA 5LMNO 2EINC 2YXYA 1NTME 3B09A 3RK2C 1FZBA 1SQPK 3CX5H 2WLKA 4MS2A 1FKAO 3MD0A 1T2KC 3ETEA 1FDMA 4PA9A 4LFAO 4WWIA 2HVJC 1J1EC 5CA0A 4IFDK 4RQEA 2M7WA 3FGAD 3AG1C 5L3EA 1BE3D 2ZYDA 2KG7B 3CRMA 4QJFB 2PI5A 2R9IA 3H1IH 1JY3N 3CX5F 1X8YA 3AG3C 3N4XA 5APWA 3OE7G 2R9RB 1OHHG 1OMIA 4FZ0A 1SQBH 3H1LG 4DJGA 3V4QA 3Q5PA 3I5DA 2K9JB 4G27B 4JI0B 1KP3A 5LXTA 1N8RW 3CI9A 1X59A 1I08A 3HKEB 3H1JJ 2WPQA 3HE4A 3L37A 3G9RA 2O3JA 5AW7B 3L73H 2XNXA 5KMGB 1FS0E 3W67A 3QO5A 3J80N 2WLLB 2JRIA 2Q3EA 2ZNIA 3AEAC 3CWBE 4JYYA 1NTZH 4PHZA 3HB3B 1AI4A 2E5YA 4X89A 3JD2A 3SDLA 1WRGA 2ZJSE 4FPPA 4LNUB 1ZLZA 3T97B 2JWAA 1SQQG 1GM7A 2Q7HA 2DW4A 3ASNB 1NVPD 1SQXJ 3SR2C 5AW4B 3W68A 3AK2A 3QVNA 1NVPB 2WPDG 1K5QA 4CS4A 3F5HA 1TUBB 2K1EA 2NPSD 1JFFB 3S1KA 2ZE5A 3M9BA 2NPSB 4ZMDA 3EVKA 1AR1B 3MIWA 4GOEA 1H2MA 2HR3A 4ZKUA 1YI2V 1ROPA 1GN2A 1YJ9V 3VYIA 4JTCB 3CCEV 4JI8O 4AUWA 5ITZA 1VEWA 4YJ2B 3OTFA 2IBZE 5J2UB 3CPWO 5KKZB 2WSCH 4GOFA 1URQA 5DECA 4FLVA 1FXKA 1SQVG 2AHYA 4D6TH 3JCUH 2Q9LA 4O2AA 4JAUA 3RYHA 4PDRA 1KFMA 4CS3A 4X66B 1DK1A 1HNXO 4MVRA 1KILE 3LNMB 3E8FA 4NXNB 2GTSA 3N2KA 1MG1A 5JJJB 1LWUC 4L76A 5GONA 4CC6A 3KZIE 3K08A 3BCCJ 2QEXV 2E75C 3BRCA 3RYIA 4HH2A 4WY4C 4X9QA 5KLIC 4JI1B 5F2VO 3GHGC 4DZOA 5B5EH 5K5GB 4K3AA 1EDKA 2M0BA 3ZMTA 3ZHTA 2JJ1G 2ZVNB 1GZLA 3SYQA 1N33O 5DM6V 2ITCC 2N05A 4LH6A 1SERA 3JC22 1AVYA 3CB2A 1EN6A 3M9QA 1L0NE 2KSDA 5H2FE 1GU4A 3E22A 1XMOB 2WPRA 4N6JA 4XDJA 1PFIA 1JY3O 1J5EB 1HNXB 1OCZB 2Q73A 3D71A 2CH7A 2F4VB 3CC4P 3VOPA 3D6YA 2ADQB 3KKYA 3AE5C 4U3FE 3L75D 3JD0A 1SESA 1JOYA 2QWRB 1J1DB 1D5AA 3SWYA 4N78D 5B66E 2LFSA 3CSXA 5EC1C 4MT8A 1AP5A 3M8AA 4DW1A 1S2EA 1PPJH 3CRCA 3V6IA 1M1JB 2IU0A 5E79H 2DYRC 1MZ9A 3FB6C 3I55V 3L4FA 2CTPA 1Q6IA 1NTMD 2HYNA 4O4IA 4W7YA 2QM8A 1Q81W 2Q69A 1N34B 1RE3C 2ZXEB 2BTQB 1H88A 4I4TB 1DEEG 4X1IA 2JEXA 4PD4E 3L72E 5M1BA 1LUVA 5EIBD 3V2QA 4BW5A 1PP9G 4JV5B 4QE7A 4O4JB 1IC2A 5CCHC 2BE3A 3T1HB 2B89A 1SA0A 1UPGA 1H0TA 4DV2B 2E76C 3A8TA 3AK1A 3L70J 4JYCA 2KKWA 2E74D 3CCLP 4UB8E 1G6UA 3D3QA 1BCCH 4G2KA 4B3RB 3CCQP 4FVMA 1P84E 3A0HH 2GUVA 4WFBV 3PRJA 5JQGB 1L0LJ 2KYVA 1ZR4A 2A79B 3OR6C 4JI5B 1N73B 3AG4C 1VDFA 4DV7B 3UKMA 2UU9O 3OTOO 1IBKO 3B8EB 1HJBA 3CWBD 3BA8A 1RFYA 2Q7GA 3E8GA 3A0BZ 3BEHA 3FKSG 5IT9N 1LT9B 1YIJP 2EJ7A 3QH9A 4TUYA 1FOSF 4ZKPA 4OVNF 5TJHA 1V54C 1QGKB 4TSFG 1VQ5V 2ZFCA 2HFED 2WPSA 4O9BA 4KHPO 1EDIA 1FXVA 4I0XB 3BRVB 2F95B 3CS5A 1R1BA 2FYUE 3L71G 1KKDA 3AEIA 1KYOD 4PA7A 1PGOA 2HG5C 3B8MA 1NTKD 4O2BB 1VQNP 3A5TA 3OMNB 3CCRV 1RE4A 4LBEC 3KYQA 1LJ2A 1SZTA 2JEUA 1YITP 2XDJA 4LR3A 4H44D 3FX0A 1NTKK 3U10A 1IBKB 1G1XB 1DF5A 3FYIB 2IBZD 4YPCA 2OYIB 1M57B 5KAFE 3PJSK 1JOCA 3VQXA 2I8DA 2RMKB 1ZP0C 4TT3H 2OIEA 1AQ5A 4KFMA 1QVGU 4B7EA 5CB4B 1S72P 1KILD 2AW9A 1RQUA 1YXBA 1KILB 3ZHQA 3JD4A 5H9CA 3AK3A 4MVSA 3N27A 3HD7A 4WVZA 2WLNA 4ZHQA 3B40A 1DLBA 1XHXA 4PJ0E 2A45I 4RAIA 1XEQA 2ODMA 1WLEA 2AZ0A 3APQA 2DE0X 3FX7A 4BRYB 3JALB 3OUFA 4JF3A 5BMVA 5GTHZ 5IWAO 3JASB 4JZGA 4U3JA 1MABG 1F7YA 3H1LE 1BHAA 4I6MC 2KB7P 3RYFB 3ABUA 1NQTA 2AEFA 3G3ZA 3B71A 3O6QA 3RGBA 1N32O 2VQFO 4GODA 1QLEB 4U3FD 3SWKA 5GTIE 1GTOA 3G4SV 1H38A 3UO3A 4DV6O 1LGHB 2O57A 5A9GA 1GL2A 3K9SA 1K92A 3ASNC 2BCCG 3P8CE 4ZNCA 3VP9A 2IW5A 4FMTA 1NS1A 1UJWB 1BMFG 1IBLO 5KAIE 2IZ0A 5LHHA 4WFFA 3B2EE 2CTRA 3MUDC 1SQQE 2NPSC 3V4WA 3K0GA 1JJ2U 1RF1B 5FPRA 2DWDC 4EDFA 2YIUB 3EHBB 2WSFH 3D36A 2B5UA 2L35A 3D3IA 2Y9YA 2WTYA 3H1KG 1WAZA 1K05A 1GK9A 1BGYE 1NKNA 3U0ZA 1VARA 3LDCA 4MVMA 4TOIA 1N32B 4PD4D 3FXDA 4EB6A 3CX5I 4L87A 1WT6A 3SPJA 1KQGB 5KKZC 3TGUG 2YI8A 1FXHA 2XOKG 1HWYA 1YI2P 3L75H 4C7NB 1MZFA 4DV6B 4OWFA 1LTBC 3DXRA 2JKVA 1KKCA 1FYJA 1Z5VA 3JARB 4NPEA 4GUNA 1OWAA 1WPXA 3AE1C 2Z4EA 3CJHB 1SQPJ 2LP7A 1S5HC 4QGPA 3PLNA 5EZYB 1SQVE 2M8RA 2H7HA 4RWUA 4TWKA 2WQYC 4B3SO 5LA6A 1YTZT 1Q90D 2G3AA 1GN3A 3UIAA 1EZVE 5EK0A 1N0JA 4FM2A 1NTMH 2Q67A 3OGIB 1Q8IA 1Y76A 1J95A 1BE3J 1X0TA 2QEXP 4LF5B 2PP6A 1F23A 2PUSA 3C1LA 2P6JA 3D8CA 4CC5A 1CI6A 2FXPA 2KLVA 2QJPB 3RL0D 4OXSA 4BW9A 3BRTB 3RL0B 1HTLC 1JVMA 1SRYA 1OCZC 2Y4UA 1NU1E 1U57A 4DV5B 3P30A 4K0KB 5IYDO 1BSNA 2FYUD 4GKKB 1IK7A 1J1DC 4B3SB 2BSKA 1CPYA 3VQWA 1PGQA 4XA4A 2OGUA 3UT5B 1TU3F 2FYUK 3T4DA 2RQ6A 4PV1D 1HNWB 3HUSB 4IFMA 4XBFA 1RY3A 1OW7A 4PV1B 2FFDB 1DH3A 1VQLP 2N9YB 4JI2B 4TV9A 5H6RA 1M1JC 3GMAA 1GN4A 2MW2B 2XAJA 3E8BA 2VRZA 1JMBA 1Q5OA 3CWBH 2Z5UA 1KZUB 1CEZA 2H89C 2OYHB 1PNKA 3FWLA 5CHXA 2G38A 5B3SC 3CXHE 2KNCB 1YTFD 1OVUA 2Q1KA 2YXQB 2L6LA 3ABTA 3HE5B 5KX5B 1YTFB 1EQ7A 3EFGA 5IYBO 3H32A 1TAEA 5B5EZ 3K0DA 1WN7A 5EIBC 2XKMA 3WUTA 3E35A 4I55B 1KYOH 4QPKA 1L8DA 1H2LA 2ZIMA 3SGIA 4FLTA 2YEVB 1ZUQA 3GVMA 1FZEA 3FD9A 5IYZB 3N2GB 3W7WA 2UWJE 4WBNB 3RK3E 1VQ9V 3ETQA 1AILA 1LWUA 2AHZA 1OCCB 3BABA 1VQ4V 2P5OA 1PP9E 4Y28J 3R66A 1QVFO 1KYOF 5D5QA 1H8HG 1K9MW 3STZC 2KQXA 4CS2A 3DGEA 4ZI7B 4WY4A 3CCJV 1PGJA 2FBWC 3GHGA 3H1LD 2IBZH 1EDLA 1BDDA 1HGZA 1K04A 4WY4D 1H2SB 2FYZA 4UVCA 2NR5A 4W4LA 3KCYA 4IFFA 3BATA 3SPCA 4DUYO 1L0NG 3CCSP 1R6TA 4DUZO 3CMAP 3F89A 1IK9A 1GK6A 4PDLA 2KZIA 3H1JG 5KTBA 2M5AB 3OUSA 2QE7H 3ZRXA 2F66C 2GV9A 2VQEO 4Q20A 2OQQA 1LP1B 3KZIH 3P8CD 1YJWP 2HFEC 3HRNA 2KS1B 1VL2A 4EIJA 3I56V 1T3UA 1GU5A 1FJKA 1A02F 3SFEC 2C2AA 1TVKA 3TXSA 2YC0A 1JX9A 1XNQO 2Q5UA 3JAWA 3JAKA 4FLWA 1WA8B 4DR3O 4MVOA 1JY2P 3L74G 4CBCA 3V2PA 1XL4A 5CA3A 2W6JH 2EIMB 3CE2A 1QL1A 3IFMA 2JDIH 4H44C 1DX7A 3VBBA 4DUYB 1S5LZ 5IJ0A 4B08A 5AW6B 1F4MA 2OYIC 3HKDA 1K97A 5AVSB 1PM9A 5LOVB 4YJ3A 1K5SA 2QWPB 2M3EA 4LF8B 2GTAA 2OCHA 2ZM6O 1WP7A 4U3FH 2QA4V 1JB0J 1O9GA 3UQ8A 1M7LA 1RE3A 1PV0A 3L72G 2XZRA 4LFCO 4DK0A 3K59A 3CXCU 2R9AA 3S3WA 3ZMUA 4ZBMA 2I1KA 5APQA 1NJIQ 1KILC 1JR9A 2M3BA 1P49A 1VF7A 1EXIA 2QRXA 5CCHA 3WB0A 2YS8A 2RJZA 3R65A 1L4AB 4HNAB 4ABMA 2QKSA 4O4LB 5AW5B 3K79A 4TQFA 4DR3B 2V4HA 5EC2C 4JI6O 1UIXA 3C8VA 2K9PA 3HTKA 1W59A 3MDSA 4P30A 3SFDC 3P3NA 2PFXA 4DR6O 4DRXA 2LGWA 3HPLC 4YIPA 3ZS8C 3H25A 3CRAA 3FB5C 2B1GA 4PD4H 1AVMA 2WLIA 3BCCG 3SPIA 3WU2Z 5C8YB 2K1AA 3AG2B 4IL6Z 1CZQA 2WSSG 3E86A 2LJ2A 4PD4F 3S4RA 3LSSA 1RHZB 1Q7YQ 3AE4C 3VOUA 2GUZA 1RM1B 4JYAO 3E1IA 4UB8H 2R32A 2GHYA 4H13D 4IYIA 1P84H 4HB1A 4B3TB 1G1IA 3X2QC 1JCCA 3G4SP 5L3GA 3VQYA 4LF9B 1XMQB 4QMAA 2CK3G 1NKDA 3ABKB 4NB5A 3U11A 3VMXA 2W27A 1OW6A 3AEEC 5AW9B 3CCMV 2BCCE 2JGDB 2PGGA 3H6PA 1COWG 2X7RB 3GF7A 2OTJP 1AFOA 1QR9A 1S5JA 3S3XA 4FFBA 4H37A 1YHQV 2W6IG 2CE4A 4WB4A 4JI0O 5KLVJ 1NTKJ 3NXSA 3OMIB 1FAVA 4WFEA 2FYUH 5CA1B 2IYOA 1OVRA 3CCUP 1VF6A 2EX3A 4DW0A 4YXWH 1UFIA 4PELA 2IX7C 3H1KE 3RK3D 4ZOLA 2YSUB 2Q0OC 2P22C 2QTOA 1IFIA 3RK3B 2N74A 3JSLA 5AW3B 2GM4A 2CK3H 1PP9D 3TGUE 2JJ2G 1WP8A 2KG7A 5JVDB 1IBMO 2E5LB 3TETA 1K4CC 1K8AQ 1Q6UA 3RWRD 3THOA 5L3CA 5K1XA 2UXCB 3HKBB 1TGOA 5KAFH 2K9JA 3OM3B 3K9AA 1PKXA 2AEMA 5IY5B 2C9LY 2NZ2A 1R3JC 2DYSB 2Y0IA 3HKEA 4B3MB 3CPWU 2YXHA 1JCDA 4Z1MH 4FLZA 1A02J 4JI4B 1N7SD 4IGGA 1M1KQ 5KMGA 1N7SB 3A3YB 3KXDA 4NR1A 2WLLA 2QJPC 3GG2A 4DT0A 3JCZA 2XHBA 4LF4O 1M90Q 3H1HJ 5IJ9A 3RL0C 1JO5A 5APTA 1AJQA 3RGUA 4DR1B 5AVUB 1Q86W 1OCRB 3AE9C 1R3IC 2IM9A 3LW5J 1B6QA 3UM7A 1IBMB 1K4DC 1FD9A 4LNUA 3T97A 2FKWB 4RJTA 2BEZF 4UCSA 3ZRVA 1SC5B 2B87B 1G8MA 3K5MA 3HUSC 1ZW0A 2ZXXA 3H1LH 3L71D 4PV1C 3W7UA 1NT2B 4LCUC 2FFDC 3BFRA 4X66O 1TUBA 2C9NY 4U3FJ 1JFFA 5JWPA 3MUDA 4NXNO 4DV1O 2NPSA 5AW0B 1YCIA 1YSCA 3RVZA 1R6KA 1ZLLA 3DC6A 1BGYG 1FE6A 4BWAA 1FZAA 5GTIH 5APVA 4I2LC 1AVOA 2AGAA 1AI7A 4LF4B 3C3TA 1R3LC 4QPJA 4YJ2A 2V7QJ 2Q9IA 1XQ8A 1YYCA 2N1TD 4JI1O 2IJKA 5J2UA 2N1TB 2RNBA 4O4HB 1JMKC 2RN9A 4H33A 4LC1A 3CD6V 5CBNA 4PDMA 1E1RG 2NNUA 3NTNA 2P06A 1QCEA 1SQQH 4HBNA 2CUGA 2X0LA 2ZCEA 4BR6A 1ZX3A 1XMOO 2P58A 2P1JA 2W0XA 3DSQA 4DV4B 1J5EO 1EZVG 2F4VO 2YKOA 4DV1B 4QNHB 2PYJA 1K3EA 2D2CD 1VQ9P 2D2CB 5BXZA 4ZKIA 1YVWA 4JI3O 3WG7B 5KHIA 4P9OA 3USSA 5APXA 3FAVB 3ZMSA 1H2KA 4J9ZB 2XT9A 2W6BA 1J2JB 4TLFA 1NU1G 1VF5D 5B1AB 4J80A 3AE8C 1SQVH 2GUSA 4UCOA 1OXZA 1VF5B 4O2AB 3FB8C 2QG4A 3CMEV 1I7FA 5BVZA 1SETA 2HPCB 1N34O 1ZSPA 2JVDA 4U7NA 4ASUG 2ZYGA 3H1JE 1M5IA 1ZWIC 1VIBA 3QO7A 2BCCD 4AYCA 4IHJA 4JV5O 4OH8B 2GDSA 4K35A 4RUFA 5KHJA 2EIMC 3T1HO 4JI3B 3VMAA 1M1JA 2FYUJ 2X6AA 4DV2O 3M9HA 2QWNB 3RL0g 3A0BE 1NU1H 3MZWB 3L74E 1MUUA 1AR5A 4B3RO 3OJAB 2BTQA 1QL2A 3H1KD 3AEFC 3LSUA 1S5LX 3GWOA 4I4TA 4FM0A 1EN5A 1KU9A 1HWTC 2R3SA 2PTMA 4JI5O 4F6EA 1FJGB 1KYOI 2CH7B 3SPHA 3JATB 2HODB 4DV7O 4LF7O 2ZVOB 4NPDA 5AVYB 3TGUD 4AQYB 3H1IJ 4O4JA 3ZRWB 1ZOYC 3U1AA 3HKCB 3CHXA 3F7VC 1NTMK 4EFBA 1Q82W 4X64B 1AJPA 1SQBJ 1T8ZA 1VQKP 3K3WA 3A2AA 5IDJA 1NAFA 4Q6GA 2J5UA 2ZR3A 2W6AA 1O9HA 1VQMV 3MGNA 2IBZI 3BAAA 2A06E 3A0RA 4YXDC 3L73J 1JY2N 3B8NA 5L3DA 3ZIAG 1SFCD 3CXHH 3EQ2A 3GF3A 1SFCB 5JQGA 5LHIA 1QNMA 3M7MX 2IJIA 5TISZ 1K73W 2EIJB 3BHPA 4DR7B 4O4IB 2CGNA 2DN9A 3AG2C 5AW2B 1N8RQ 3L36A 3RBZA 1JPXA 1JQ0A 1NTZJ 3CRRA 3ZEDA 4LF7B 1AR4A 1HW7A 1N4CA 2ZXWC 1NZ6A 3ZHRA 1LT9A 3G71P 4D7SA 1BE3G 3BCCE 5JJNB 1PP9H 3TYYA 3H01A 4MVUA 3WUUA 1KD1W 4HJGH 2ETNA 2X6BA 4IL6X 2WSEH 3WMM0 2EBOA 1WPBA 2QIWA 4H13C 2DQ3A 1YZBA 3B5NB 2IJJA 4CZZA 4IYHA 1X9VA 3OEHG 1HF9A 3SJQC 2QJKB 4O2BA 2P7TC 3E7KA 4CH6A 2OTKE 3ABKC 5GTHE 1KQSU 1VQ6V 3KPEA 4CPGA 3UO2A 4FM1A 1S4XA 1F4NA 4BXLA 3ZX6A 4X62O 2OYIA 1KMIZ 1AB3A 3SYPA 2WSCJ 5KJ7D 4NVPA 2QKAA 3IFXA 2OTLP 4D6TJ 1M57D 4N23A 1H89A 2GSMB 4A5UB 4X65B 4TUYB 4MTGA 2P10A 1OJHA 3K5LA 3QF7A 5CB4A 1OVVA 4BIZA 2WVRA 1LTGC 2KOGA 1M56D 4YIOA 2LGQA 1QEXA 1QX8A 3IAOA 3RK3C 1KILA 2JR8A 1FC2C 3WB1A 1M56B 1VF6C 1PNLA 4OGQB 1IO4A 1VQPV 3L71H 1SVFA 5KA6A 2AXTZ 2OYOA 4L75A 4C46A 1GKFA 4HZ3A 3TJTA 1FZCB 2KUBA 4X20A 4HAMA 5IY5C 4WF9V 3PH0A 4X62B 2XAHA 4BRYA 2XAQA 4PD4I 3F5TA 3JALA 5KUMA 3VN0A 2UUBB 1M8OB 4LF6B 2ZT9B 2QVAA 1GMJA 1N7SC 1GMGA 2YI9A 3ASOB 1URFA 3KCXA 2YIBA 2YMKA 1KP2A 2EZPA 4HKZH 3C90A 1L0ND 3ZHSA 1WNSA 2YIBD 1OCRC 1KQSO 3L70E 3CCVV 1NAYA 3H1JD 3OEEG 2W83C 2OARA 1QLED 3ML0A 1XNRB 1L0NK 1JY2O 5JH7B 1L0LE 1LTAC 2J59M 4OX9O 4WCEV 5AW8B 2KIKA 3AE7C 4JAAA 4UB6Z 5BR8B 3K5BA 4UCTA 5BU8B 1DD3A 1FFXB 2B9ZA 2WMMA 2B9BA 2IH3C 3ABMB 4X88A 3L74D 1FPOA 2EULA 1AJNA 1VQ8V 3OW2O 3TXQA 2OWOA 3F7YC 5KHGA 1HBWA 1Z5WA 4I5SA 3OR7C 1LTJB 2KXPB 5KUKA 1Z2GA 1Z56A 4C7UA 3MP7B 2N1TC 4IIJB 2H3OA 2O01H 1IFJA 2FKXA 5CBHA 4LP8A 1BT8A 5AW1B 4C7NA 1Q43A 1Q81Q 3L72D 5APYA 1RPRA 2IDBA 4LF5O 2N04A 1I5YA 1CXZB 2QJ1A 1PIXA 4MVZA 1YJ9P 3CJHA 4OX9B 2BCCH 3P8MC 3CCEP 1BDCA 1DGSA 5EZYA 3PP5A 3TK1A 4UV9A 1BCCJ 2Q6QA 4DV5O 4K0KO 3OA7A 5CBFA 4DR2B 4GKKO 1B04A 3AEGC 3RFRA 2D2CC 2YXLA 2V4DA 3ICXA 4L74A 1P84D 1FZFA 3T1YO 3Q2YA 2YDEA 3WG7C 1H8AA 2Y0DA 3ETGA 2KSEA 1HNWO 3H1KH 4Z1VA 1NOHA 1E1QG 4JI2O 2WSEJ 5B5EE 4UCUA 4MTOA 4XDLA 3GB7C 1OX3A 4DXWA 5B1AC 3TGUH 5LYJB 2ZAEB 5J2TA 3RK2B 5KHKA 1VF5C 2ZE8A 4R4MA 1MFZA 3DXRB 2DJVA 5LGUA 3B4SA 3E83A 2UUCB 2ARHA 4FLUA 1J1EB 1RQVA 2L91A 1QVFU 1X79B 5AVRB 2YKPA 1DD4A 1OFCX 3VMZA 1XILA 2WA4A 3OAAG 1SQFA 4F6RB 4GX2A 3UT5A 4CH5A 1VQ7V 5LA6B 3HUSA 3K5OA 1GM8A 1W0JG 2KB1A 1N0NA 1D7MA 1SS1A 2FFDA 2KLUA 3T1YB 1JM0A 1GDTA 2VS0A 3MHVA 4JGSA 3JCUZ 2OYHA 1QLNA 4DK1A 2PAJA 3DTUB 1BL8A 4GKGA 2NN4A 1R73A 2ZQMA 1KB9E 3OT7A 1EXJA 5CMUA 1RSOB 3L71J 3HE5A 5KX5A 4JI7B 1GM9A 1SP4A 2YO3A 5L3BA 3GW6A 3FB7C 2UXXA 4FK5C 4I55A 1M9NA 3TCUA 5A2QN 5CCGD 5KLVG 3I55P 1R5LA 2YEVA 4ZIBA 5IYZA 3N2GA 4WBNA 1E79G 4GYCB 4GX0A 2XASA 2WPVB 2ZR2A 2F93B 1JMMA 1AI5A 4KJMA 1S5LE 2QKCA 1XTCC 4D7TA 4ZI7A 1US6A 3RYCA 4I7ZB 1P4RA 1PV3A 2ILMA 1SFCC 1I0HA 1RF0C 2EIJC 5L3FA 2LQTA 1LTIC 3E89A 5AG2A 3OAKA 2RN0A 2HHHB 1Q3EA 5FL7G 1SQPE 1N73C 2Y48A 2QJYB 4UVBA 4AQRD 1PGPA 2UXBB 3CC7V 1FOSE 3J7AU 2M5AA 3H32B 4JPRA 3PHLA 1W2BO 2Y0PA 5DJTB 1G4YB 1LP1A 2XTAA 4LF8O 1CW5A 1LT9C 2KS1A 4MN4C 2A7WA 2PY5A 1NKZB 1R5SA 4X1YB 4UV8A 3H1HG 3D6ZA 1NH2D 2LXBA 2BOCC 2QJKC 4BIUA 1BE3E 1LWUB 5E79Z 1NH2B 2JGUA 1KORA 2JS5A 4JPZB 1WA8A 3K58A 3ZHVA 3GHGB 4J11A 2WSFJ 1VQ5P 1NYHA 3WU2E 1SQQD 1JTHB 4I50B 2PYLA 4L73A 3QO8A 4IL6E 4ICGA 5APUA 1KN7A 4MSWC 1VQ6P 1L0NH 4IT5A 5LOVA 3CC4V 2E43A 5H2FH 1SQXG 3PN1A 1BGYD 1SQQK 5KJ7C 3L75J 3FFQA 5AVQB 4UUJC 1LUWA 2C0XA 3CCRP 3H1JH 2KSJA 1M57C 1FDIA 4PA4A 2EILB 2HEPA 1CSBA 1GW4A 1M56C 4LWSB 2V7QG 1G1JA 4X1KB 4RO2A 1SS3A 5EFWB 5B66H 5FNVB 3A0HZ 4HNAA 1AROP 1NO4A 3T1CA 1SKVA 1Y74A 3H9VA 1SQVD 2QWOB 1L4AD 2R70A 2A06G 3TNUB 4J42A 1MKMA 1WB8A 5BZBA 1OW8A 1KQFB 1FZCC 1YJNV 3L74H 1NTMJ 2QDOA 1W5CE 1EZVD 2QWQB 4EYYQ 1YEWA 1XI1A 4K8XA 4LLHA 4B3TO 1SQVK 1HR0B 1HDJA 4LF9O 5LP6B 3HKDB 1XMQO 3ASOC 2A45G 5C8YA 2MJZA 2R5BA 1XREA 2QTSA 4MVQA 2K88A 2YXRB 2OCCB 5LMUB 4CH4A 3L72H 4NXMB 1GRJA 4JTAB 3CLQA 4W80A 3OMAB 1HNZB 3LIEA 3QNEA 3QTCA 1NU1D 4F4LA 3CCLV 1NVOA 1LTTC 4R8CA 2QM7A 1QLEC 3CCQV 4K8ZA 3V2RA 2P90A 3RT3C 3KDPB 4MTFA 5EYPA 1N36B 1KECA 1NU1K 1YDXA 1LTSC 2ZD9A 2HLDG 3UCSC 1Y47A 2WT7B 3CWBJ 2JGDA 3U1CA 2F43G 2E5LO 4GX1A 3JAMN 1KB9D 3FWNA 4J7JA 1DF4A 5E1AC 1P84F 3BCCH 2UXCO 4WBAA 1RF1C 1KV4A 3LIDA 3SWFA 1LTJC 1MFTA 2YIUC 2FTKA 3CXHD 1DTOA 3LSQA 4EFEA 4B3MO 5CA1A 2WSSH 1Y67A 1GH6A 2DMXA 1IVSA 1Y66A 1Y6XA 4JI4O 1H2GA 2VRSA 5GTHH 2Y0EA 3CYOA 1G2CB 2XAGA 2LFRA 1VQOV 2JWDA 1MNGA 4TV8B 1YITV 1H8EG 5JVDA 2FL4A 2H8PD 4JBZA 4DR1O 3BVOA 2G8YA 5BY1A 2CTWA 3IC7A 4RO0A 4N78E 3TDKA 3H1IG 2YUAA 4YY3B 2OT5A 2WA3A 5CN0A 1SQBG 4GDOA 3VQVA 2ZDIC 4NKGB 1X4TA 2HJFC 3BPZA 4HYOA 1S72V 2PGDA 3JSVC 4KT0J 1K9MQ 1PL4A 1FU1A 1N7SA 2JEEA 2EJRA 3KG2A 1OZ0A 5HFMA 3L73G 3ZDMA 2IPPA 3L70G 2K37A 3Q4HB 1ZL8B 3WB2A 3AG7A 4ZOLB 3S9OA 1MOFA 4EEQA 1E5WA 5LGNA 1L0LG 2R44A 5IYCO 4ASWA 4W4KA 1XUQA 4R7CA 1NTZG 3M91A 3K06A 3G80A 5CA0B 4DV0B 3AEBC 2B87A 3SYAA 4PJ0H 1L0NJ 5LGTA 1X22A 1HGVA 3L35A 1NHLA 1IFDA 1VQ7P 2KI7B 4DV4O 2DWEC 5LMNB 3L70H 1NR1A 1JJOA 5JCOC 1T6AA 2LXCB 1FDOA 1W0KG 5LXTB 4ASVA 2YNYA 3HE4B 1OIPA 2CDYA 1MSWD 4GT1A 3SJBC 2OYHC 1K34A 4DR5O 4LFAB 3VMYA 4KP4A 3SYCA 5IJ9B 2N1TA 1L0LH 3O8ZA 5CJ0A 4O4HA 2XU6A 2ADPA 1Y4MA 4QIWF 4R6ZA 3P3PA 4E2LA 3L74J 3VTPC 2ZIOA 2E3CA 5CCGC 3K57A 2VWJA 3ITKA 4D6TG 1V55B 4Z2WA 2LW7A 1AQTA 3LDDA 4R50A 2YIAA 1XBLA 3LNNA 5KAIH 1KYOE 1AV1A 4PA3A 5KLVE 2A9HA 4GKJO 1NTKE 4I7ZC 1OCCC 2RMZA 3L72J 2RDCA 3U59A 4N3YB 4C7RA 1BGYH 1GN6A 4JQ0D 2H94A 3FAVA 4DR5B 1VQ4P 2QJYC 5CBOA 5B1BB 4KL1A 1MZEA 4J7ZA 5ITZB 1HVVA 1VMGA 3CC2V 3CCJP 1ZXGA 1URQD 1FJPA 2Z5HA 2HPCA 1URQB 1FXKB 2Q7EA 1JCHA 4MW3A 3F5WC 4UXNA 2O1JA 3CC7P 1XOUA 4OPHA 3RYHB 4FLXA 3V5BA 3K5NA 1WB7A 1EN4A 1FJGO 4GKJB 1EZVH 3ETDA 4RKUJ 1KTMA 1FBMA 2EIKB 5TISE 4AQYO 3N2KB 1KC8W 1MV8A 2PRRA 4X64O 1IX9A 5GONB 3H1HE 2UUAO 4JI8B 4LGDE 2XAFA 2Q4PA 3RYIB 4I9WA 4MW8A 1PPJG 3I56P 1LR1A 2CAZC 2FB5A 3T2MA 3IC9A 1OZHA 4Y99B 4DV3O 1PL5A 4UFZA 1PD3A 4J41A 2WLHA 4P2ZA 2ZYAA 2XUMA 1YQ4C 1EBOA 2EILC 2W0FC 2IH1C 2HODA 3JATA 4DR7O 1EFRG 3BASA 4HYTB 2SPZA 3E22B 1SQXE 4NTXA 3V2NA 4U7OA 3ZRWA 4PI0A 1VQLV 4H0LD 2P4KA 3HKCA 4GLXA 1SQGA 1GK4A 2C0WA 4H0LB 3R2PA 5LHGA 2QA4P 1PNMA 2GA1A 4IHJB 3CRQA 1L4AC 1F51A 2UUAB 1KB9H 1IJDB 3SPGA 3FXEA 4A7PA 1N33B 1OCOB 3BY6A 2JP3A 1SFCA 5L8RJ 1BCCG 2ZE7A 1MSDA 5LP6C 2H88C 1RF0A 2KK7A 5BU5A 1EDJA 3M0DC 4DV3B 2J58A 1K33A 5LBQA 1SQPG 1YJNP 4E4EA 2Q7CA 3KZIZ 1KB9F 5B3SB 2LKMA 1SLQA 4WFHA 2OCCC 4EKWA 2Y0CA 1N73A 3ZMZA 3G6BA 1EZJA 2ZNJA 3CXHF 3SJCC 2JS3A 3DC5A 4L8JA 2AXTE 2BTOA 1T3JA 1A32A 2X6CA 2AEJA 3CP1A 4JZ2A 1S5LH 4X1IB 3K04A 1Q86Q 3B5NA 4NTWA 4UCVA 4X65O 1RM1C 1Y9BA 2ITDC 4J10A 5H2FZ 3SYOA 4AI8A 2N9BA 3VP8A 1R3KC 4I0XA 3OD4A 3B5ND 3LUTB 1SA0B 2E74B 4DR4O 2Q68A 4AHCA 3CCSV 2Z5IA 1H0TB 1WMKA 1SQPH 3CMAV 2WAMA 1KBHA 5C39A 4PI2A 1GAXA 3FYEB 4J9YB 3Q1MA 2FMLA 1QU7A 5B66Z 2POHA 2Q0AA 2IU3A 1LT1A 2LO1A 3ABLB 2RCVA 1YJWV 2R72A 4DCKA 2Q8VA 4B7KA 2YIDA 3T4ZA 3MTUE 5KJ7A 2WLMA 3L9DA 4PA6A 1YQ3C 2UUBO 2QM4A 4XE5B 4LF6O 1N86A 3Q5SA 3CCMP 1BE3H 1VP7A 2AXCA 2NLJC 1SQQJ 4JYBA 3SSUA 4TT3G 3ZRSA 4YTPC 1YHQP 2Q3IA 5KHHA 5DJUB 4M3LA 4XFJA 4UB6E 3WU2H 3NR7A 2H8PC 5KLVD 4OGQD 5GW7A 4DR4B 1BGYJ 4IL6H 5DN6G 2A0LA 3OW2U 1FZCA 1NBMG 1VQOP 3CX5E 2JJLA 1XNRO 2K9YA 3J81N 2I1JA 5KLVK 2QSIA 2HLOA 2YMYA 1N2DC 3JYCA 2UU9B 4H44B 3OTOB 1GTWA 2FXMA 2MK3A 1SF9A 5EBWC 1S3JA 2DYSC 1HUCA 2W8ZA 3H1IE 5BR8O 4UB8Z 3G6EV 2ZT9D 4I1LA 1SQVJ 3JASA 2FYNB 1SQBE 1KQLA 1THZA 1FAFA 4KHPB 2DQ0A 1QR8A 2OIGA 3RYFA 3STLC 3RW0A 2WZ7A 3L73E 1YBKA 3M06A 1GO3F 5JH7A 3TF5A 4BAYA 4RQFA 3AECC 1P84I 3E1RA 1IXBA 1BZKA 2FXOA 3HD7D 1S77D 2BASA 3H1HD 3HD7B 4X20B 3E8HA 3ABVC 3QWOC 2QR4A 5H6QA 3C9IA 1NTZE 1KC8Q 1FFXA 3Q5RA 1NU1J 4ZHQB 3ZHUA 1Y8AA 1IZNB 2DW3A 1QBZA 1USEA 2HKOA 3O9OA 4J7KA 1RF1A 3BA9A 4DR2O 5BMVB 2YICA 1LTJA 1ORQC 1U96A 4U3JB 5KA5A 1BSMA 1T5EA 1NGMB 1ZV8A 4IIJA 1M93A 2Y69B 2UXDO 4FIPC 1SQXD 1USDA 5CMZA 4FFKA 3AEDC 1RPOA 4XDKA 5D5PA 3TSIA 5AVWB 3O6QB 3H1LJ 4EI2A 2CPSA 5KAFZ 1EC5A 2QSAA 1V55C 2PZSA 1D5NA 3L75G 1SQXK 2ZINA 1Q2NA 1I94O 5JJEB 4UCRA 1RH5B 5EBMC 2JK5C 3X2QB 1SZXA 1HJ0A 1GL2D 3JARA 1GD2E 3RVYA 5FLXN 3W7SA 1XHZA 2UUCO 3EFFK 4GZRB 2OTJV 1GL2B 1D2DA 1IFPA 1JY3P 3BVHA 1QVGO 2ATKC 3KQGA 1Q82Q 5IWAB 3JCUE 4D6TE 3O65A 3CD6P 1MA1A 2A06D 3AE3C 1ZRTE 2IYPA 1YF2A 5LL6Y 3CCUV 2O1KA 4DOJA 2ZDIA 1VPCA 4I9QA 4YHHO 1R8EA 3IR9A 2QGNA 5J9PC 2BOBC 1NTMG 5AVVB 2UXDB 3NMDA 3C3SA 3RBXA 2BEQD 4PJ0Z 2VQFB 2JO1A 1NR7A 5B1BC 1K73Q 1DIPA 3LDEA 5LYJA 1PP9J 3ZJZA 1NJIW 3AE2C 2EINB 3M0AA 3RK2D 4EB6B 1URQC 1PZQA 3BCCD 1FXKC 4DYLA 1T2KD 4LH7A 4PDVA 1I94B 2ITAA 3WFVA 4JI7O 2KP8A 3CC2P 1IBLB 4F6RA 1W2EA 5CJ4A 1KD1Q 2D3OW 1AI6A 5GTIZ 3AG1B 2EIKC 2UXNA 4KUMA 2A3QA 3AG3B 3P7KA 4BIOA 3CMEP 3MHSC 1NI8A 4TQDA 5DEDA 3SJAC 4YHHB 1S9KE 5HFLA 1FS0G 1IXMA 1W2BU 3IJ4A 5JCOA 1HH0A 1HP8A 4QE9A 4Y99C 2RH0A 5KAIZ 3CWBG 3IF4A 1RSOA 1Y76B 4N21A 4NTYA 5J2TB 3GLMA 1Q7YW 4WFGA 2LW1A 3AE6C 4OPAA 3IN6A 1BQ0A 1PPJE 1CI6B 1K7DA 2DOSA 2KNCA 2E5TA 1NH4A 2HHHO 1JUNA 3M99B 5E79E 1LNQA 3B77A 4H0LC 5CCGA 1BQZA 2UXBO 3W7TA 3CX5D 1NTKG 2BSKB 1BSHA 2R3CA 1S1CX 1OCOC 4RUEA 2V1DA 3H1ID 2L5GB 2EZOA 2YO2A 1QQCA 3G67A 1B06A 1V9PA 4TV9B 3ZN1A 1IFMA 1SQBD 4W7ZA 2IBZG 3CEIA 1L1FA 4BWNA 1OV9A 1AA0A 2Q6AA 5AVXB 1VQMP 4UVAA 1BCCE 1EM1A 1SQBK 3L73D 2WITA 3A0HE 3L70D 2P7JA 4FLYA 4FJCC 2Y9ZA 3GWKC 2B1IA 5KLVH 1NTKH 2HVKC 2QE7G 1B3QA 1YTZI 4X1YA 1K8AW 3IGAC 4GX5A 1E79H 1EZVI 4R4LA 5C93A 3ZBHA 1L0LD 4FZ1A 4CH3A 4LFBO 2CTQA 4RESB 1NTZD 2E74C 3B5NC 1S0VA 5K1PA 3RYCB 1H2NA 3E2EA 2XNDG 4G28B 2IFNA 1CP9A 3MAQA 5B1NA 2IZ1A 1L0LK 2E42A 3A7OA 2E75D 1JTHA 1MMMA 1NWQA 4I50A 1NTZK 3OGCC 2E75B 1M1KW 4WY4B 5KLIB 3D70A 2W6JG 3ABLC 1FZGA 1JNMA 2JDIG 3K03A 2O01J 1M90W 1S76D 2P2UA 2NRGA 4AILC 4JTDB 2ZKOA
chains in the Genus database with same CATH topology
3S9OA 4EEQA 4Q6GA 5FPRA 2J5UA 2OYQA 1O9HA 5CA0B 4DV0B 3AEBC 3BAAA 4YXDC 1K05A 2F1MA 4X1KA 1ZAUA 3U0ZA 3GF3A 5JQGA 4TOIA 3M7MX 5FNVA 4LFBB 1N32B 4EB6A 5KKZC 3BHPA 1KQGB 2YI8A 4DR7B 4O4IB 4OGQC 4DV6B 5LMNB 5JCOC 1JJOA 1TVKB 4O4LA 1Z5VA 3JARB 3ZEDA 5LXTB 1TA8A 1HW7A 4LF7B 1FDOA 3AE1C 3R4YA 2VWKA 3JAWB 3JAKB 4D7SA 3SJBC 5JJNB 4DUZB 5EZYB 5LP6A 4LFAB 5IJ9B 2WQYC 4IL6X 3EWKA 1WPBA 5LA6A 2QIWA 1Q90D 4O4HA 4H13C 2G3AA 2FYNC 5IJ0B 1QHTA 2ZT9C 3IAYA 1HF9A 2VQEB 4FM2A 2ZIOA 4O2BA 2E3CA 4YJ3B 4CH6A 3K57A 2VWJA 1Q8IA 2MKVA 2YIAA 4FM1A 3LNNA 4LF5B 2PUSA 1XNQB 4CC5A 2FXPA 5FPOA 4I7ZC 4BW9A 1KMIZ 2WSCJ 1U57A 4NVPA 4DV5B 4K0KB 2E76D 4GKKB 2E76B 4X65B 1IK7A 4TUYB 4DR5B 2P10A 3K5LA 3QF7A 5CB4A 4B3SB 3VQWA 3JSNA 2QJYC 3IAOA 2ZM6B 4KL1A 3UT5B 3WB1A 1TU3F 2RQ6A 5ITZB 4PV1D 4OGQB 4LFCB 4DRXB 1HNWB 1OW7A 4PV1B 4JI2B 4TV9A 3GMAA 2Q7EA 3RYHB 1Q5OA 4FLXA 4X20A 3K5NA 2H89C 1M4UA 4X62B 4GKJB 3QG5A 3JALA 4H13B 4RKUJ 4TV8A 2UUBB 4JI6B 1KTMA 4LF6B 2ZT9B 5EYPB 3N2KB 5KX5B 1GMJA 2YI9A 5GONB 4JI8B 4U7JA 3Q3DA 1TAEA 3A2FA 2YIBA 2YMKA 1AJYA 3RYIB 4DR6B 1WN7A 5EIBC 4I55B 1L8DA 2ZIMA 1WNSA 2CAZC 2YIBD 3SGIA 4FLTA 3RK3E 5IYZB 3N2GB 4WBNB 3HKBA 1PL5A 4UFZA 3ETQA 1XNRB 3BABA 1YQ4C 2P5OA 4Y28J 5D5QA 5JH7B 3JATA 4CS2A 4ZI7B 4FFBB 3E22B 2FBWC 4PI0A 4JYAB 4H0LD 1ZMEC 3HKCA 4GLXA 3AE7C 1SQGA 1K04A 4H0LB 1H2SB 5BR8B 4UCTA 1DD3A 1FFXB 4IHJB 5CA0A 2UUAB 2OWOA 5KHGA 1N33B 3FGAD 1Z5WA 2JP3A 2F66C 5L8RJ 2GV9A 5LP6C 2H88C 2OQQA 4IIJB 4DV3B 1OMIA 1VL2A 3Q5PA 1Q43A 2IDBA 3SFEC 4JI0B 1TVKA 5LXTA 2QJ1A 3HKEB 1PIXA 4OX9B 3JAWA 2ZNJA 3G9RA 3JAKA 4FLWA 3SJCC 1DGSA 4L8JA 5EZYA 2BTOA 5KMGB 4X1IB 4H44C 4DUYB 5IJ0A 4DR2B 1B04A 4UCVA 4B08A 1Y9BA 3RFRA 3AEGC 3HKDA 2ZNIA 3AEAC 2D2CC 2YXLA 2V4DA 3ICXA 5LOVB 4YJ3A 4LF8B 1JB0J 1O9GA 1SA0B 4PHZA 3UQ8A 2E74B 3Q2YA 4AHCA 1WMKA 4DK0A 3K59A 4LNUB 3T97B 2WSEJ 2R9AA 4UCUA 2Q7HA 4PI2A 3SR2C 3Q1MA 5LYJB 1P49A 1VF7A 2Q0AA 5KHKA 5J2TA 1EXIA 1VF5C 3WB0A 2RJZA 2R72A 4R4MA 4CS4A 4HNAB 1TUBB 2UUCB 1RQVA 4FLUA 1JFFB 4O4LB 4TQFA 4DR3B 1YQ3C 3C8VA 1UIXA 2QM4A 1DD4A 3Q5SA 1SQFA 4F6RB 3SFDC 3UT5A 4CH5A 5LA6B 4YTPC 5ITZA 4DRXA 4YJ2B 3ZS8C 3H25A 3K5OA 5KHHA 3OTFA 4XFJA 5J2UB 4OGQD 3T1YB 4DR4B 5C8YB 4FLVA 4O2AA 3RYHA 4CS3A 2K9YA 4X66B 4DK1A 1KILE 2QSIA 4NXNB 1EXJA 2UU9B 3AE4C 4H44B 3OTOB 3N2KA 5KX5A 5JJJB 4JI7B 4H13D 5GONA 4CC6A 2ZT9D 2E75C 3BRCA 3JASA 3RYIA 4B3TB 5KLIC 4I55A 4JI1B 3VQYA 4LF9B 1XMQB 4KHPB 3RYFA 4ZIBA 5IYZA 3N2GA 3U11A 4WBNA 1OW6A 4GYCB 3AEEC 2PGGA 4LH6A 3CB2A 2WPVB 2F93B 3GF7A 5JH7A 4D7TA 1S5JA 4ZI7A 3RYCA 4FFBA 3E22A 1XMOB 3AECC 1PV3A 4I7ZB 1J5EB 1HNXB 3D71A 4X20B 2F4VB 3D6YA 3ABVC 5CA1B 3AE5C 1FFXA 3Q5RA 2EX3A 2HHHB 1Q3EA 4ZHQB 1D5AA 4ZOLA 2P22C 3CSXA 2UXBB 3JSLA 3BA9A 5BMVB 4U3JB 5JVDB 1T5EA 1NGMB 2E5LB 4IIJA 1M93A 3RWRD 3THOA 5K1XA 2PY5A 2UXCB 3HKBB 4X1YB 1TGOA 3AEDC 3D6ZA 5D5PA 2QJKC 2NZ2A 2JGUA 4O4IA 1KORA 3HKEA 4B3MB 2PZSA 2JS5A 4Z1MH 1N34B 4FLZA 3K58A 2BTQB 2ZINA 4JI4B 5JJEB 4UCRA 4I4TB 1HJ0A 2WSFJ 5KMGA 3JARA 4X1IA 1NYHA 1XHZA 5M1BA 4I50B 5EIBD 2PYLA 2QJPC 4JV5B 2XHBA 5IWAB 5IJ9A 4O4JB 3AE3C 5LOVA 4DR1B 1ZRTE 3AE9C 3T1HB 3PN1A 2IM9A 1SA0A 3LW5J 3FFQA 4DV2B 4I9QA 2E76C 1R8EA 1IBMB 1FDIA 4LNUA 2KKWA 2E74D 2UXDB 1G6UA 2BEQD 2JO1A 2VQFB 2BEZF 4UCSA 2HEPA 1DIPA 4B3RB 5LYJA 4FVMA 3K5MA 4X1KB 4PV1C 5JQGB 1NT2B 3AE2C 5FNVB 4HNAA 1TUBA 4EB6B 4JI5B 1JFFA 1SKVA 4DV7B 4LH7A 1I94B 2R70A 1MKMA 1OW8A 1KQFB 3BA8A 2Q7GA 4BWAA 1IBLB 4F6RA 1YEWA 1XI1A 4K8XA 4TUYA 4LF4B 4YJ2A 1HR0B 2V7QJ 1XQ8A 5LP6B 3HKDB 5J2UA 5C8YA 2F95B 1JMKC 4O4HB 4TQDA 3SJAC 4YHHB 5LMUB 4CH4A 5JCOA 4NXMB 4O2BB 1HNZB 4HBNA 2ZCEA 3QTCA 1RSOA 5J2TB 3DSQA 4DV4B 3GLMA 4LR3A 4H44D 3AE6C 3IN6A 4DV1B 2PYJA 4K8ZA 3U10A 1IBKB 2D2CD 5EYPA 1N36B 2D2CB 3VQXA 4H0LC 1ZP0C 5KHIA 4TT3H 5CB4B 1RQUA 1S1CX 1VF5D 3AE8C 4UCOA 1VF5B 4O2AB 2YIUC 1I7FA 1QQCA 1V9PA 4TV9B 4EFEA 5CA1A 2JVDA 4ZHQA 1XHXA 1M5IA 3JALB 4IHJA 5BMVA 4TV8B 3JASB 4U3JA 5JVDA 4FLYA 5KHJA 2G8YA 4JI3B 3RYFB 4X1YA 4YY3B 3B71A 3RL0g 4R4LA 3O6QA 4CH3A 3RGBA 4GDOA 3VQVA 2E74C 5K1PA 2BTQA 1X4TA 3RYCB 3BPZA 3AEFC 1S5LX 4KT0J 4I4TA 4FM0A 3MAQA 1KU9A 2E75D 2PTMA 1FJGB 4I50A 3JATB 2E75B 3D70A 4AQYB 4O4JA 1ZOYC 3HKCB 3CHXA 4EFBA 3WB2A 2O01J 4X64B 4ZOLB 3B2EE 4AILC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMI Z; 
#chains in the Genus database with same CATH topology
 1HR0 O;  2HJD A;  2OYQ A;  5APS A;  4U3F G;  1RP3 B;  2BCC J;  2W90 A;  4LWS A;  2AZ2 A;  5TIS H;  2F1M A;  4X1K A;  2Z3Y A;  1ZAU A;  5LMU O;  4LFB B;  5FNV A;  3H1H H;  4WFA V;  4NXM O;  2PI4 A;  1HNZ O;  2XND H;  4D6T D;  4OGQ C;  3RN4 A;  5AVZ B;  3W7X A;  3LW5 H;  1KB9 I;  3TNU A;  1KFN A;  1ZRT D;  2Z0A A;  1L4A A;  2B88 A;  3APO A;  1TVK B;  5IE9 A;  3L71 E;  2Q5Z A;  4O4L A;  3R4Y A;  1TA8 A;  1ZR2 A;  4NYK A;  1RE4 C;  2IJH A;  2VWK A;  3JAW B;  3MHH C;  3JAK B;  3A0B H;  5CBG A;  3H1K J;  3CXH I;  4DUZ B;  1N36 O;  1DEB A;  1PL0 A;  5LP6 A;  2XV5 A;  4IOI H;  1VQP P;  3M0D A;  1XTG B;  2IFM A;  3EWK A;  1Q6H A;  4GIF A;  2WWW A;  3TGU J;  1TUE B;  1SQX H;  3JD1 A;  2FYN C;  4KHX A;  5IJ0 B;  1AP6 A;  1QHT A;  2PF4 E;  2ZT9 C;  2DYR B;  3OFN G;  3IAY A;  1XL6 A;  2VQE B;  4NPF X;  4YJ3 B;  1VQK V;  3JD3 A;  4EOT A;  5B1O A;  1ZTE A;  1IUR A;  3G6E P;  2MKV A;  1P7G A;  2WLJ A;  2V7Q H;  1BHB A;  2M6Y A;  1P7B A;  4KXR A;  3ZMV A;  1XNQ B;  4DO2 A;  5FPO A;  4JF7 A;  1FFT B;  3EXA A;  5CCH D;  1Y74 B;  2HP8 A;  1WJZ A;  2A06 H;  1N7L A;  3NFQ A;  3WUV A;  3HD7 C;  3ZN0 A;  1S9K D;  2E76 D;  2GBO A;  3CCV P;  4B86 A;  1R6N A;  2E76 B;  2WT7 A;  5H5N A;  2RKL A;  3HTK B;  1UII A;  3JSN A;  2ZM6 B;  1ENV A;  3G71 V;  2A45 H;  2CGO A;  2AXT H;  4LFC B;  4DRX B;  4YY3 O;  3ABM C;  5AVT B;  1JEK A;  1YIJ V;  1PPJ D;  2Y69 C;  2WLI B;  3AG4 B;  4JAS A;  2P67 A;  2ZXW B;  2O01 N;  1U7M A;  1M4U A;  2FYU G;  2F23 A;  1G2C A;  1VQ8 P;  3KHU A;  3QG5 A;  4YXW G;  4H13 B;  1XDC A;  4TV8 A;  4JI6 B;  1V54 B;  2GUZ B;  1VQN V;  5EYP B;  1KUQ A;  2R5D A;  2JIZ G;  4MTX A;  1GL2 C;  1BS3 A;  3I5C A;  4U7J A;  1GW3 A;  3Q3D A;  3A2F A;  1AJY A;  4DR6 B;  2KZJ A;  2HG5 D;  2CPB A;  3PTZ A;  4P9P A;  3ZCC A;  3L75 E;  2H43 A;  2OTL V;  4DV0 O;  2FY8 A;  1I5X A;  3II6 A;  3HKB A;  1IFN A;  2LR2 A;  1L2P A;  1ZN5 A;  2ZE6 A;  3P32 A;  1IZ3 A;  3HR0 A;  2Y4T A;  4Z1M G;  2P4V A;  1BCC D;  2K3R A;  4X8A A;  3D36 C;  1JA8 A;  3CL3 D;  4JAV A;  3N7N A;  1SQP D;  4FFB B;  1U7J A;  5EBL C;  2YKQ A;  1U97 A;  1IDS A;  4UB6 H;  3Q4H A;  4JYA B;  1ZL8 A;  1ZME C;  4GCZ A;  5LMN O;  2EIN C;  2YXY A;  1NTM E;  3B09 A;  3RK2 C;  1FZB A;  1SQP K;  3CX5 H;  2WLK A;  4MS2 A;  1FKA O;  3MD0 A;  1T2K C;  3ETE A;  1FDM A;  4PA9 A;  4LFA O;  4WWI A;  2HVJ C;  1J1E C;  5CA0 A;  4IFD K;  4RQE A;  2M7W A;  3FGA D;  3AG1 C;  5L3E A;  1BE3 D;  2ZYD A;  2KG7 B;  3CRM A;  4QJF B;  2PI5 A;  2R9I A;  3H1I H;  1JY3 N;  3CX5 F;  1X8Y A;  3AG3 C;  3N4X A;  5APW A;  3OE7 G;  2R9R B;  1OHH G;  1OMI A;  4FZ0 A;  1SQB H;  3H1L G;  4DJG A;  3V4Q A;  3Q5P A;  3I5D A;  2K9J B;  4G27 B;  4JI0 B;  1KP3 A;  5LXT A;  1N8R W;  3CI9 A;  1X59 A;  1I08 A;  3HKE B;  3H1J J;  2WPQ A;  3HE4 A;  3L37 A;  3G9R A;  2O3J A;  5AW7 B;  3L73 H;  2XNX A;  5KMG B;  1FS0 E;  3W67 A;  3QO5 A;  3J80 N;  2WLL B;  2JRI A;  2Q3E A;  2ZNI A;  3AEA C;  3CWB E;  4JYY A;  1NTZ H;  4PHZ A;  3HB3 B;  1AI4 A;  2E5Y A;  4X89 A;  3JD2 A;  3SDL A;  1WRG A;  2ZJS E;  4FPP A;  4LNU B;  1ZLZ A;  3T97 B;  2JWA A;  1SQQ G;  1GM7 A;  2Q7H A;  2DW4 A;  3ASN B;  1NVP D;  1SQX J;  3SR2 C;  5AW4 B;  3W68 A;  3AK2 A;  3QVN A;  1NVP B;  2WPD G;  1K5Q A;  4CS4 A;  3F5H A;  1TUB B;  2K1E A;  2NPS D;  1JFF B;  3S1K A;  2ZE5 A;  3M9B A;  2NPS B;  4ZMD A;  3EVK A;  1AR1 B;  3MIW A;  4GOE A;  1H2M A;  2HR3 A;  4ZKU A;  1YI2 V;  1ROP A;  1GN2 A;  1YJ9 V;  3VYI A;  4JTC B;  3CCE V;  4JI8 O;  4AUW A;  5ITZ A;  1VEW A;  4YJ2 B;  3OTF A;  2IBZ E;  5J2U B;  3CPW O;  5KKZ B;  2WSC H;  4GOF A;  1URQ A;  5DEC A;  4FLV A;  1FXK A;  1SQV G;  2AHY A;  4D6T H;  3JCU H;  2Q9L A;  4O2A A;  4JAU A;  3RYH A;  4PDR A;  1KFM A;  4CS3 A;  4X66 B;  1DK1 A;  1HNX O;  4MVR A;  1KIL E;  3LNM B;  3E8F A;  4NXN B;  2GTS A;  3N2K A;  1MG1 A;  5JJJ B;  1LWU C;  4L76 A;  5GON A;  4CC6 A;  3KZI E;  3K08 A;  3BCC J;  2QEX V;  2E75 C;  3BRC A;  3RYI A;  4HH2 A;  4WY4 C;  4X9Q A;  5KLI C;  4JI1 B;  5F2V O;  3GHG C;  4DZO A;  5B5E H;  5K5G B;  4K3A A;  1EDK A;  2M0B A;  3ZMT A;  3ZHT A;  2JJ1 G;  2ZVN B;  1GZL A;  3SYQ A;  1N33 O;  5DM6 V;  2ITC C;  2N05 A;  4LH6 A;  1SER A;  3JC2 2;  1AVY A;  3CB2 A;  1EN6 A;  3M9Q A;  1L0N E;  2KSD A;  5H2F E;  1GU4 A;  3E22 A;  1XMO B;  2WPR A;  4N6J A;  4XDJ A;  1PFI A;  1JY3 O;  1J5E B;  1HNX B;  1OCZ B;  2Q73 A;  3D71 A;  2CH7 A;  2F4V B;  3CC4 P;  3VOP A;  3D6Y A;  2ADQ B;  3KKY A;  3AE5 C;  4U3F E;  3L75 D;  3JD0 A;  1SES A;  1JOY A;  2QWR B;  1J1D B;  1D5A A;  3SWY A;  4N78 D;  5B66 E;  2LFS A;  3CSX A;  5EC1 C;  4MT8 A;  1AP5 A;  3M8A A;  4DW1 A;  1S2E A;  1PPJ H;  3CRC A;  3V6I A;  1M1J B;  2IU0 A;  5E79 H;  2DYR C;  1MZ9 A;  3FB6 C;  3I55 V;  3L4F A;  2CTP A;  1Q6I A;  1NTM D;  2HYN A;  4O4I A;  4W7Y A;  2QM8 A;  1Q81 W;  2Q69 A;  1N34 B;  1RE3 C;  2ZXE B;  2BTQ B;  1H88 A;  4I4T B;  1DEE G;  4X1I A;  2JEX A;  4PD4 E;  3L72 E;  5M1B A;  1LUV A;  5EIB D;  3V2Q A;  4BW5 A;  1PP9 G;  4JV5 B;  4QE7 A;  4O4J B;  1IC2 A;  5CCH C;  2BE3 A;  3T1H B;  2B89 A;  1SA0 A;  1UPG A;  1H0T A;  4DV2 B;  2E76 C;  3A8T A;  3AK1 A;  3L70 J;  4JYC A;  2KKW A;  2E74 D;  3CCL P;  4UB8 E;  1G6U A;  3D3Q A;  1BCC H;  4G2K A;  4B3R B;  3CCQ P;  4FVM A;  1P84 E;  3A0H H;  2GUV A;  4WFB V;  3PRJ A;  5JQG B;  1L0L J;  2KYV A;  1ZR4 A;  2A79 B;  3OR6 C;  4JI5 B;  1N73 B;  3AG4 C;  1VDF A;  4DV7 B;  3UKM A;  2UU9 O;  3OTO O;  1IBK O;  3B8E B;  1HJB A;  3CWB D;  3BA8 A;  1RFY A;  2Q7G A;  3E8G A;  3A0B Z;  3BEH A;  3FKS G;  5IT9 N;  1LT9 B;  1YIJ P;  2EJ7 A;  3QH9 A;  4TUY A;  1FOS F;  4ZKP A;  4OVN F;  5TJH A;  1V54 C;  1QGK B;  4TSF G;  1VQ5 V;  2ZFC A;  2HFE D;  2WPS A;  4O9B A;  4KHP O;  1EDI A;  1FXV A;  4I0X B;  3BRV B;  2F95 B;  3CS5 A;  1R1B A;  2FYU E;  3L71 G;  1KKD A;  3AEI A;  1KYO D;  4PA7 A;  1PGO A;  2HG5 C;  3B8M A;  1NTK D;  4O2B B;  1VQN P;  3A5T A;  3OMN B;  3CCR V;  1RE4 A;  4LBE C;  3KYQ A;  1LJ2 A;  1SZT A;  2JEU A;  1YIT P;  2XDJ A;  4LR3 A;  4H44 D;  3FX0 A;  1NTK K;  3U10 A;  1IBK B;  1G1X B;  1DF5 A;  3FYI B;  2IBZ D;  4YPC A;  2OYI B;  1M57 B;  5KAF E;  3PJS K;  1JOC A;  3VQX A;  2I8D A;  2RMK B;  1ZP0 C;  4TT3 H;  2OIE A;  1AQ5 A;  4KFM A;  1QVG U;  4B7E A;  5CB4 B;  1S72 P;  1KIL D;  2AW9 A;  1RQU A;  1YXB A;  1KIL B;  3ZHQ A;  3JD4 A;  5H9C A;  3AK3 A;  4MVS A;  3N27 A;  3HD7 A;  4WVZ A;  2WLN A;  4ZHQ A;  3B40 A;  1DLB A;  1XHX A;  4PJ0 E;  2A45 I;  4RAI A;  1XEQ A;  2ODM A;  1WLE A;  2AZ0 A;  3APQ A;  2DE0 X;  3FX7 A;  4BRY B;  3JAL B;  3OUF A;  4JF3 A;  5BMV A;  5GTH Z;  5IWA O;  3JAS B;  4JZG A;  4U3J A;  1MAB G;  1F7Y A;  3H1L E;  1BHA A;  4I6M C;  2KB7 P;  3RYF B;  3ABU A;  1NQT A;  2AEF A;  3G3Z A;  3B71 A;  3O6Q A;  3RGB A;  1N32 O;  2VQF O;  4GOD A;  1QLE B;  4U3F D;  3SWK A;  5GTI E;  1GTO A;  3G4S V;  1H38 A;  3UO3 A;  4DV6 O;  1LGH B;  2O57 A;  5A9G A;  1GL2 A;  3K9S A;  1K92 A;  3ASN C;  2BCC G;  3P8C E;  4ZNC A;  3VP9 A;  2IW5 A;  4FMT A;  1NS1 A;  1UJW B;  1BMF G;  1IBL O;  5KAI E;  2IZ0 A;  5LHH A;  4WFF A;  3B2E E;  2CTR A;  3MUD C;  1SQQ E;  2NPS C;  3V4W A;  3K0G A;  1JJ2 U;  1RF1 B;  5FPR A;  2DWD C;  4EDF A;  2YIU B;  3EHB B;  2WSF H;  3D36 A;  2B5U A;  2L35 A;  3D3I A;  2Y9Y A;  2WTY A;  3H1K G;  1WAZ A;  1K05 A;  1GK9 A;  1BGY E;  1NKN A;  3U0Z A;  1VAR A;  3LDC A;  4MVM A;  4TOI A;  1N32 B;  4PD4 D;  3FXD A;  4EB6 A;  3CX5 I;  4L87 A;  1WT6 A;  3SPJ A;  1KQG B;  5KKZ C;  3TGU G;  2YI8 A;  1FXH A;  2XOK G;  1HWY A;  1YI2 P;  3L75 H;  4C7N B;  1MZF A;  4DV6 B;  4OWF A;  1LTB C;  3DXR A;  2JKV A;  1KKC A;  1FYJ A;  1Z5V A;  3JAR B;  4NPE A;  4GUN A;  1OWA A;  1WPX A;  3AE1 C;  2Z4E A;  3CJH B;  1SQP J;  2LP7 A;  1S5H C;  4QGP A;  3PLN A;  5EZY B;  1SQV E;  2M8R A;  2H7H A;  4RWU A;  4TWK A;  2WQY C;  4B3S O;  5LA6 A;  1YTZ T;  1Q90 D;  2G3A A;  1GN3 A;  3UIA A;  1EZV E;  5EK0 A;  1N0J A;  4FM2 A;  1NTM H;  2Q67 A;  3OGI B;  1Q8I A;  1Y76 A;  1J95 A;  1BE3 J;  1X0T A;  2QEX P;  4LF5 B;  2PP6 A;  1F23 A;  2PUS A;  3C1L A;  2P6J A;  3D8C A;  4CC5 A;  1CI6 A;  2FXP A;  2KLV A;  2QJP B;  3RL0 D;  4OXS A;  4BW9 A;  3BRT B;  3RL0 B;  1HTL C;  1JVM A;  1SRY A;  1OCZ C;  2Y4U A;  1NU1 E;  1U57 A;  4DV5 B;  3P30 A;  4K0K B;  5IYD O;  1BSN A;  2FYU D;  4GKK B;  1IK7 A;  1J1D C;  4B3S B;  2BSK A;  1CPY A;  3VQW A;  1PGQ A;  4XA4 A;  2OGU A;  3UT5 B;  1TU3 F;  2FYU K;  3T4D A;  2RQ6 A;  4PV1 D;  1HNW B;  3HUS B;  4IFM A;  4XBF A;  1RY3 A;  1OW7 A;  4PV1 B;  2FFD B;  1DH3 A;  1VQL P;  2N9Y B;  4JI2 B;  4TV9 A;  5H6R A;  1M1J C;  3GMA A;  1GN4 A;  2MW2 B;  2XAJ A;  3E8B A;  2VRZ A;  1JMB A;  1Q5O A;  3CWB H;  2Z5U A;  1KZU B;  1CEZ A;  2H89 C;  2OYH B;  1PNK A;  3FWL A;  5CHX A;  2G38 A;  5B3S C;  3CXH E;  2KNC B;  1YTF D;  1OVU A;  2Q1K A;  2YXQ B;  2L6L A;  3ABT A;  3HE5 B;  5KX5 B;  1YTF B;  1EQ7 A;  3EFG A;  5IYB O;  3H32 A;  1TAE A;  5B5E Z;  3K0D A;  1WN7 A;  5EIB C;  2XKM A;  3WUT A;  3E35 A;  4I55 B;  1KYO H;  4QPK A;  1L8D A;  1H2L A;  2ZIM A;  3SGI A;  4FLT A;  2YEV B;  1ZUQ A;  3GVM A;  1FZE A;  3FD9 A;  5IYZ B;  3N2G B;  3W7W A;  2UWJ E;  4WBN B;  3RK3 E;  1VQ9 V;  3ETQ A;  1AIL A;  1LWU A;  2AHZ A;  1OCC B;  3BAB A;  1VQ4 V;  2P5O A;  1PP9 E;  4Y28 J;  3R66 A;  1QVF O;  1KYO F;  5D5Q A;  1H8H G;  1K9M W;  3STZ C;  2KQX A;  4CS2 A;  3DGE A;  4ZI7 B;  4WY4 A;  3CCJ V;  1PGJ A;  2FBW C;  3GHG A;  3H1L D;  2IBZ H;  1EDL A;  1BDD A;  1HGZ A;  1K04 A;  4WY4 D;  1H2S B;  2FYZ A;  4UVC A;  2NR5 A;  4W4L A;  3KCY A;  4IFF A;  3BAT A;  3SPC A;  4DUY O;  1L0N G;  3CCS P;  1R6T A;  4DUZ O;  3CMA P;  3F89 A;  1IK9 A;  1GK6 A;  4PDL A;  2KZI A;  3H1J G;  5KTB A;  2M5A B;  3OUS A;  2QE7 H;  3ZRX A;  2F66 C;  2GV9 A;  2VQE O;  4Q20 A;  2OQQ A;  1LP1 B;  3KZI H;  3P8C D;  1YJW P;  2HFE C;  3HRN A;  2KS1 B;  1VL2 A;  4EIJ A;  3I56 V;  1T3U A;  1GU5 A;  1FJK A;  1A02 F;  3SFE C;  2C2A A;  1TVK A;  3TXS A;  2YC0 A;  1JX9 A;  1XNQ O;  2Q5U A;  3JAW A;  3JAK A;  4FLW A;  1WA8 B;  4DR3 O;  4MVO A;  1JY2 P;  3L74 G;  4CBC A;  3V2P A;  1XL4 A;  5CA3 A;  2W6J H;  2EIM B;  3CE2 A;  1QL1 A;  3IFM A;  2JDI H;  4H44 C;  1DX7 A;  3VBB A;  4DUY B;  1S5L Z;  5IJ0 A;  4B08 A;  5AW6 B;  1F4M A;  2OYI C;  3HKD A;  1K97 A;  5AVS B;  1PM9 A;  5LOV B;  4YJ3 A;  1K5S A;  2QWP B;  2M3E A;  4LF8 B;  2GTA A;  2OCH A;  2ZM6 O;  1WP7 A;  4U3F H;  2QA4 V;  1JB0 J;  1O9G A;  3UQ8 A;  1M7L A;  1RE3 A;  1PV0 A;  3L72 G;  2XZR A;  4LFC O;  4DK0 A;  3K59 A;  3CXC U;  2R9A A;  3S3W A;  3ZMU A;  4ZBM A;  2I1K A;  5APQ A;  1NJI Q;  1KIL C;  1JR9 A;  2M3B A;  1P49 A;  1VF7 A;  1EXI A;  2QRX A;  5CCH A;  3WB0 A;  2YS8 A;  2RJZ A;  3R65 A;  1L4A B;  4HNA B;  4ABM A;  2QKS A;  4O4L B;  5AW5 B;  3K79 A;  4TQF A;  4DR3 B;  2V4H A;  5EC2 C;  4JI6 O;  1UIX A;  3C8V A;  2K9P A;  3HTK A;  1W59 A;  3MDS A;  4P30 A;  3SFD C;  3P3N A;  2PFX A;  4DR6 O;  4DRX A;  2LGW A;  3HPL C;  4YIP A;  3ZS8 C;  3H25 A;  3CRA A;  3FB5 C;  2B1G A;  4PD4 H;  1AVM A;  2WLI A;  3BCC G;  3SPI A;  3WU2 Z;  5C8Y B;  2K1A A;  3AG2 B;  4IL6 Z;  1CZQ A;  2WSS G;  3E86 A;  2LJ2 A;  4PD4 F;  3S4R A;  3LSS A;  1RHZ B;  1Q7Y Q;  3AE4 C;  3VOU A;  2GUZ A;  1RM1 B;  4JYA O;  3E1I A;  4UB8 H;  2R32 A;  2GHY A;  4H13 D;  4IYI A;  1P84 H;  4HB1 A;  4B3T B;  1G1I A;  3X2Q C;  1JCC A;  3G4S P;  5L3G A;  3VQY A;  4LF9 B;  1XMQ B;  4QMA A;  2CK3 G;  1NKD A;  3ABK B;  4NB5 A;  3U11 A;  3VMX A;  2W27 A;  1OW6 A;  3AEE C;  5AW9 B;  3CCM V;  2BCC E;  2JGD B;  2PGG A;  3H6P A;  1COW G;  2X7R B;  3GF7 A;  2OTJ P;  1AFO A;  1QR9 A;  1S5J A;  3S3X A;  4FFB A;  4H37 A;  1YHQ V;  2W6I G;  2CE4 A;  4WB4 A;  4JI0 O;  5KLV J;  1NTK J;  3NXS A;  3OMI B;  1FAV A;  4WFE A;  2FYU H;  5CA1 B;  2IYO A;  1OVR A;  3CCU P;  1VF6 A;  2EX3 A;  4DW0 A;  4YXW H;  1UFI A;  4PEL A;  2IX7 C;  3H1K E;  3RK3 D;  4ZOL A;  2YSU B;  2Q0O C;  2P22 C;  2QTO A;  1IFI A;  3RK3 B;  2N74 A;  3JSL A;  5AW3 B;  2GM4 A;  2CK3 H;  1PP9 D;  3TGU E;  2JJ2 G;  1WP8 A;  2KG7 A;  5JVD B;  1IBM O;  2E5L B;  3TET A;  1K4C C;  1K8A Q;  1Q6U A;  3RWR D;  3THO A;  5L3C A;  5K1X A;  2UXC B;  3HKB B;  1TGO A;  5KAF H;  2K9J A;  3OM3 B;  3K9A A;  1PKX A;  2AEM A;  5IY5 B;  2C9L Y;  2NZ2 A;  1R3J C;  2DYS B;  2Y0I A;  3HKE A;  4B3M B;  3CPW U;  2YXH A;  1JCD A;  4Z1M H;  4FLZ A;  1A02 J;  4JI4 B;  1N7S D;  4IGG A;  1M1K Q;  5KMG A;  1N7S B;  3A3Y B;  3KXD A;  4NR1 A;  2WLL A;  2QJP C;  3GG2 A;  4DT0 A;  3JCZ A;  2XHB A;  4LF4 O;  1M90 Q;  3H1H J;  5IJ9 A;  3RL0 C;  1JO5 A;  5APT A;  1AJQ A;  3RGU A;  4DR1 B;  5AVU B;  1Q86 W;  1OCR B;  3AE9 C;  1R3I C;  2IM9 A;  3LW5 J;  1B6Q A;  3UM7 A;  1IBM B;  1K4D C;  1FD9 A;  4LNU A;  3T97 A;  2FKW B;  4RJT A;  2BEZ F;  4UCS A;  3ZRV A;  1SC5 B;  2B87 B;  1G8M A;  3K5M A;  3HUS C;  1ZW0 A;  2ZXX A;  3H1L H;  3L71 D;  4PV1 C;  3W7U A;  1NT2 B;  4LCU C;  2FFD C;  3BFR A;  4X66 O;  1TUB A;  2C9N Y;  4U3F J;  1JFF A;  5JWP A;  3MUD A;  4NXN O;  4DV1 O;  2NPS A;  5AW0 B;  1YCI A;  1YSC A;  3RVZ A;  1R6K A;  1ZLL A;  3DC6 A;  1BGY G;  1FE6 A;  4BWA A;  1FZA A;  5GTI H;  5APV A;  4I2L C;  1AVO A;  2AGA A;  1AI7 A;  4LF4 B;  3C3T A;  1R3L C;  4QPJ A;  4YJ2 A;  2V7Q J;  2Q9I A;  1XQ8 A;  1YYC A;  2N1T D;  4JI1 O;  2IJK A;  5J2U A;  2N1T B;  2RNB A;  4O4H B;  1JMK C;  2RN9 A;  4H33 A;  4LC1 A;  3CD6 V;  5CBN A;  4PDM A;  1E1R G;  2NNU A;  3NTN A;  2P06 A;  1QCE A;  1SQQ H;  4HBN A;  2CUG A;  2X0L A;  2ZCE A;  4BR6 A;  1ZX3 A;  1XMO O;  2P58 A;  2P1J A;  2W0X A;  3DSQ A;  4DV4 B;  1J5E O;  1EZV G;  2F4V O;  2YKO A;  4DV1 B;  4QNH B;  2PYJ A;  1K3E A;  2D2C D;  1VQ9 P;  2D2C B;  5BXZ A;  4ZKI A;  1YVW A;  4JI3 O;  3WG7 B;  5KHI A;  4P9O A;  3USS A;  5APX A;  3FAV B;  3ZMS A;  1H2K A;  4J9Z B;  2XT9 A;  2W6B A;  1J2J B;  4TLF A;  1NU1 G;  1VF5 D;  5B1A B;  4J80 A;  3AE8 C;  1SQV H;  2GUS A;  4UCO A;  1OXZ A;  1VF5 B;  4O2A B;  3FB8 C;  2QG4 A;  3CME V;  1I7F A;  5BVZ A;  1SET A;  2HPC B;  1N34 O;  1ZSP A;  2JVD A;  4U7N A;  4ASU G;  2ZYG A;  3H1J E;  1M5I A;  1ZWI C;  1VIB A;  3QO7 A;  2BCC D;  4AYC A;  4IHJ A;  4JV5 O;  4OH8 B;  2GDS A;  4K35 A;  4RUF A;  5KHJ A;  2EIM C;  3T1H O;  4JI3 B;  3VMA A;  1M1J A;  2FYU J;  2X6A A;  4DV2 O;  3M9H A;  2QWN B;  3RL0 g;  3A0B E;  1NU1 H;  3MZW B;  3L74 E;  1MUU A;  1AR5 A;  4B3R O;  3OJA B;  2BTQ A;  1QL2 A;  3H1K D;  3AEF C;  3LSU A;  1S5L X;  3GWO A;  4I4T A;  4FM0 A;  1EN5 A;  1KU9 A;  1HWT C;  2R3S A;  2PTM A;  4JI5 O;  4F6E A;  1FJG B;  1KYO I;  2CH7 B;  3SPH A;  3JAT B;  2HOD B;  4DV7 O;  4LF7 O;  2ZVO B;  4NPD A;  5AVY B;  3TGU D;  4AQY B;  3H1I J;  4O4J A;  3ZRW B;  1ZOY C;  3U1A A;  3HKC B;  3CHX A;  3F7V C;  1NTM K;  4EFB A;  1Q82 W;  4X64 B;  1AJP A;  1SQB J;  1T8Z A;  1VQK P;  3K3W A;  3A2A A;  5IDJ A;  1NAF A;  4Q6G A;  2J5U A;  2ZR3 A;  2W6A A;  1O9H A;  1VQM V;  3MGN A;  2IBZ I;  3BAA A;  2A06 E;  3A0R A;  4YXD C;  3L73 J;  1JY2 N;  3B8N A;  5L3D A;  3ZIA G;  1SFC D;  3CXH H;  3EQ2 A;  3GF3 A;  1SFC B;  5JQG A;  5LHI A;  1QNM A;  3M7M X;  2IJI A;  5TIS Z;  1K73 W;  2EIJ B;  3BHP A;  4DR7 B;  4O4I B;  2CGN A;  2DN9 A;  3AG2 C;  5AW2 B;  1N8R Q;  3L36 A;  3RBZ A;  1JPX A;  1JQ0 A;  1NTZ J;  3CRR A;  3ZED A;  4LF7 B;  1AR4 A;  1HW7 A;  1N4C A;  2ZXW C;  1NZ6 A;  3ZHR A;  1LT9 A;  3G71 P;  4D7S A;  1BE3 G;  3BCC E;  5JJN B;  1PP9 H;  3TYY A;  3H01 A;  4MVU A;  3WUU A;  1KD1 W;  4HJG H;  2ETN A;  2X6B A;  4IL6 X;  2WSE H;  3WMM 0;  2EBO A;  1WPB A;  2QIW A;  4H13 C;  2DQ3 A;  1YZB A;  3B5N B;  2IJJ A;  4CZZ A;  4IYH A;  1X9V A;  3OEH G;  1HF9 A;  3SJQ C;  2QJK B;  4O2B A;  2P7T C;  3E7K A;  4CH6 A;  2OTK E;  3ABK C;  5GTH E;  1KQS U;  1VQ6 V;  3KPE A;  4CPG A;  3UO2 A;  4FM1 A;  1S4X A;  1F4N A;  4BXL A;  3ZX6 A;  4X62 O;  2OYI A;  1KMI Z;  1AB3 A;  3SYP A;  2WSC J;  5KJ7 D;  4NVP A;  2QKA A;  3IFX A;  2OTL P;  4D6T J;  1M57 D;  4N23 A;  1H89 A;  2GSM B;  4A5U B;  4X65 B;  4TUY B;  4MTG A;  2P10 A;  1OJH A;  3K5L A;  3QF7 A;  5CB4 A;  1OVV A;  4BIZ A;  2WVR A;  1LTG C;  2KOG A;  1M56 D;  4YIO A;  2LGQ A;  1QEX A;  1QX8 A;  3IAO A;  3RK3 C;  1KIL A;  2JR8 A;  1FC2 C;  3WB1 A;  1M56 B;  1VF6 C;  1PNL A;  4OGQ B;  1IO4 A;  1VQP V;  3L71 H;  1SVF A;  5KA6 A;  2AXT Z;  2OYO A;  4L75 A;  4C46 A;  1GKF A;  4HZ3 A;  3TJT A;  1FZC B;  2KUB A;  4X20 A;  4HAM A;  5IY5 C;  4WF9 V;  3PH0 A;  4X62 B;  2XAH A;  4BRY A;  2XAQ A;  4PD4 I;  3F5T A;  3JAL A;  5KUM A;  3VN0 A;  2UUB B;  1M8O B;  4LF6 B;  2ZT9 B;  2QVA A;  1GMJ A;  1N7S C;  1GMG A;  2YI9 A;  3ASO B;  1URF A;  3KCX A;  2YIB A;  2YMK A;  1KP2 A;  2EZP A;  4HKZ H;  3C90 A;  1L0N D;  3ZHS A;  1WNS A;  2YIB D;  1OCR C;  1KQS O;  3L70 E;  3CCV V;  1NAY A;  3H1J D;  3OEE G;  2W83 C;  2OAR A;  1QLE D;  3ML0 A;  1XNR B;  1L0N K;  1JY2 O;  5JH7 B;  1L0L E;  1LTA C;  2J59 M;  4OX9 O;  4WCE V;  5AW8 B;  2KIK A;  3AE7 C;  4JAA A;  4UB6 Z;  5BR8 B;  3K5B A;  4UCT A;  5BU8 B;  1DD3 A;  1FFX B;  2B9Z A;  2WMM A;  2B9B A;  2IH3 C;  3ABM B;  4X88 A;  3L74 D;  1FPO A;  2EUL A;  1AJN A;  1VQ8 V;  3OW2 O;  3TXQ A;  2OWO A;  3F7Y C;  5KHG A;  1HBW A;  1Z5W A;  4I5S A;  3OR7 C;  1LTJ B;  2KXP B;  5KUK A;  1Z2G A;  1Z56 A;  4C7U A;  3MP7 B;  2N1T C;  4IIJ B;  2H3O A;  2O01 H;  1IFJ A;  2FKX A;  5CBH A;  4LP8 A;  1BT8 A;  5AW1 B;  4C7N A;  1Q43 A;  1Q81 Q;  3L72 D;  5APY A;  1RPR A;  2IDB A;  4LF5 O;  2N04 A;  1I5Y A;  1CXZ B;  2QJ1 A;  1PIX A;  4MVZ A;  1YJ9 P;  3CJH A;  4OX9 B;  2BCC H;  3P8M C;  3CCE P;  1BDC A;  1DGS A;  5EZY A;  3PP5 A;  3TK1 A;  4UV9 A;  1BCC J;  2Q6Q A;  4DV5 O;  4K0K O;  3OA7 A;  5CBF A;  4DR2 B;  4GKK O;  1B04 A;  3AEG C;  3RFR A;  2D2C C;  2YXL A;  2V4D A;  3ICX A;  4L74 A;  1P84 D;  1FZF A;  3T1Y O;  3Q2Y A;  2YDE A;  3WG7 C;  1H8A A;  2Y0D A;  3ETG A;  2KSE A;  1HNW O;  3H1K H;  4Z1V A;  1NOH A;  1E1Q G;  4JI2 O;  2WSE J;  5B5E E;  4UCU A;  4MTO A;  4XDL A;  3GB7 C;  1OX3 A;  4DXW A;  5B1A C;  3TGU H;  5LYJ B;  2ZAE B;  5J2T A;  3RK2 B;  5KHK A;  1VF5 C;  2ZE8 A;  4R4M A;  1MFZ A;  3DXR B;  2DJV A;  5LGU A;  3B4S A;  3E83 A;  2UUC B;  2ARH A;  4FLU A;  1J1E B;  1RQV A;  2L91 A;  1QVF U;  1X79 B;  5AVR B;  2YKP A;  1DD4 A;  1OFC X;  3VMZ A;  1XIL A;  2WA4 A;  3OAA G;  1SQF A;  4F6R B;  4GX2 A;  3UT5 A;  4CH5 A;  1VQ7 V;  5LA6 B;  3HUS A;  3K5O A;  1GM8 A;  1W0J G;  2KB1 A;  1N0N A;  1D7M A;  1SS1 A;  2FFD A;  2KLU A;  3T1Y B;  1JM0 A;  1GDT A;  2VS0 A;  3MHV A;  4JGS A;  3JCU Z;  2OYH A;  1QLN A;  4DK1 A;  2PAJ A;  3DTU B;  1BL8 A;  4GKG A;  2NN4 A;  1R73 A;  2ZQM A;  1KB9 E;  3OT7 A;  1EXJ A;  5CMU A;  1RSO B;  3L71 J;  3HE5 A;  5KX5 A;  4JI7 B;  1GM9 A;  1SP4 A;  2YO3 A;  5L3B A;  3GW6 A;  3FB7 C;  2UXX A;  4FK5 C;  4I55 A;  1M9N A;  3TCU A;  5A2Q N;  5CCG D;  5KLV G;  3I55 P;  1R5L A;  2YEV A;  4ZIB A;  5IYZ A;  3N2G A;  4WBN A;  1E79 G;  4GYC B;  4GX0 A;  2XAS A;  2WPV B;  2ZR2 A;  2F93 B;  1JMM A;  1AI5 A;  4KJM A;  1S5L E;  2QKC A;  1XTC C;  4D7T A;  4ZI7 A;  1US6 A;  3RYC A;  4I7Z B;  1P4R A;  1PV3 A;  2ILM A;  1SFC C;  1I0H A;  1RF0 C;  2EIJ C;  5L3F A;  2LQT A;  1LTI C;  3E89 A;  5AG2 A;  3OAK A;  2RN0 A;  2HHH B;  1Q3E A;  5FL7 G;  1SQP E;  1N73 C;  2Y48 A;  2QJY B;  4UVB A;  4AQR D;  1PGP A;  2UXB B;  3CC7 V;  1FOS E;  3J7A U;  2M5A A;  3H32 B;  4JPR A;  3PHL A;  1W2B O;  2Y0P A;  5DJT B;  1G4Y B;  1LP1 A;  2XTA A;  4LF8 O;  1CW5 A;  1LT9 C;  2KS1 A;  4MN4 C;  2A7W A;  2PY5 A;  1NKZ B;  1R5S A;  4X1Y B;  4UV8 A;  3H1H G;  3D6Z A;  1NH2 D;  2LXB A;  2BOC C;  2QJK C;  4BIU A;  1BE3 E;  1LWU B;  5E79 Z;  1NH2 B;  2JGU A;  1KOR A;  2JS5 A;  4JPZ B;  1WA8 A;  3K58 A;  3ZHV A;  3GHG B;  4J11 A;  2WSF J;  1VQ5 P;  1NYH A;  3WU2 E;  1SQQ D;  1JTH B;  4I50 B;  2PYL A;  4L73 A;  3QO8 A;  4IL6 E;  4ICG A;  5APU A;  1KN7 A;  4MSW C;  1VQ6 P;  1L0N H;  4IT5 A;  5LOV A;  3CC4 V;  2E43 A;  5H2F H;  1SQX G;  3PN1 A;  1BGY D;  1SQQ K;  5KJ7 C;  3L75 J;  3FFQ A;  5AVQ B;  4UUJ C;  1LUW A;  2C0X A;  3CCR P;  3H1J H;  2KSJ A;  1M57 C;  1FDI A;  4PA4 A;  2EIL B;  2HEP A;  1CSB A;  1GW4 A;  1M56 C;  4LWS B;  2V7Q G;  1G1J A;  4X1K B;  4RO2 A;  1SS3 A;  5EFW B;  5B66 H;  5FNV B;  3A0H Z;  4HNA A;  1ARO P;  1NO4 A;  3T1C A;  1SKV A;  1Y74 A;  3H9V A;  1SQV D;  2QWO B;  1L4A D;  2R70 A;  2A06 G;  3TNU B;  4J42 A;  1MKM A;  1WB8 A;  5BZB A;  1OW8 A;  1KQF B;  1FZC C;  1YJN V;  3L74 H;  1NTM J;  2QDO A;  1W5C E;  1EZV D;  2QWQ B;  4EYY Q;  1YEW A;  1XI1 A;  4K8X A;  4LLH A;  4B3T O;  1SQV K;  1HR0 B;  1HDJ A;  4LF9 O;  5LP6 B;  3HKD B;  1XMQ O;  3ASO C;  2A45 G;  5C8Y A;  2MJZ A;  2R5B A;  1XRE A;  2QTS A;  4MVQ A;  2K88 A;  2YXR B;  2OCC B;  5LMU B;  4CH4 A;  3L72 H;  4NXM B;  1GRJ A;  4JTA B;  3CLQ A;  4W80 A;  3OMA B;  1HNZ B;  3LIE A;  3QNE A;  3QTC A;  1NU1 D;  4F4L A;  3CCL V;  1NVO A;  1LTT C;  4R8C A;  2QM7 A;  1QLE C;  3CCQ V;  4K8Z A;  3V2R A;  2P90 A;  3RT3 C;  3KDP B;  4MTF A;  5EYP A;  1N36 B;  1KEC A;  1NU1 K;  1YDX A;  1LTS C;  2ZD9 A;  2HLD G;  3UCS C;  1Y47 A;  2WT7 B;  3CWB J;  2JGD A;  3U1C A;  2F43 G;  2E5L O;  4GX1 A;  3JAM N;  1KB9 D;  3FWN A;  4J7J A;  1DF4 A;  5E1A C;  1P84 F;  3BCC H;  2UXC O;  4WBA A;  1RF1 C;  1KV4 A;  3LID A;  3SWF A;  1LTJ C;  1MFT A;  2YIU C;  2FTK A;  3CXH D;  1DTO A;  3LSQ A;  4EFE A;  4B3M O;  5CA1 A;  2WSS H;  1Y67 A;  1GH6 A;  2DMX A;  1IVS A;  1Y66 A;  1Y6X A;  4JI4 O;  1H2G A;  2VRS A;  5GTH H;  2Y0E A;  3CYO A;  1G2C B;  2XAG A;  2LFR A;  1VQO V;  2JWD A;  1MNG A;  4TV8 B;  1YIT V;  1H8E G;  5JVD A;  2FL4 A;  2H8P D;  4JBZ A;  4DR1 O;  3BVO A;  2G8Y A;  5BY1 A;  2CTW A;  3IC7 A;  4RO0 A;  4N78 E;  3TDK A;  3H1I G;  2YUA A;  4YY3 B;  2OT5 A;  2WA3 A;  5CN0 A;  1SQB G;  4GDO A;  3VQV A;  2ZDI C;  4NKG B;  1X4T A;  2HJF C;  3BPZ A;  4HYO A;  1S72 V;  2PGD A;  3JSV C;  4KT0 J;  1K9M Q;  1PL4 A;  1FU1 A;  1N7S A;  2JEE A;  2EJR A;  3KG2 A;  1OZ0 A;  5HFM A;  3L73 G;  3ZDM A;  2IPP A;  3L70 G;  2K37 A;  3Q4H B;  1ZL8 B;  3WB2 A;  3AG7 A;  4ZOL B;  3S9O A;  1MOF A;  4EEQ A;  1E5W A;  5LGN A;  1L0L G;  2R44 A;  5IYC O;  4ASW A;  4W4K A;  1XUQ A;  4R7C A;  1NTZ G;  3M91 A;  3K06 A;  3G80 A;  5CA0 B;  4DV0 B;  3AEB C;  2B87 A;  3SYA A;  4PJ0 H;  1L0N J;  5LGT A;  1X22 A;  1HGV A;  3L35 A;  1NHL A;  1IFD A;  1VQ7 P;  2KI7 B;  4DV4 O;  2DWE C;  5LMN B;  3L70 H;  1NR1 A;  1JJO A;  5JCO C;  1T6A A;  2LXC B;  1FDO A;  1W0K G;  5LXT B;  4ASV A;  2YNY A;  3HE4 B;  1OIP A;  2CDY A;  1MSW D;  4GT1 A;  3SJB C;  2OYH C;  1K34 A;  4DR5 O;  4LFA B;  3VMY A;  4KP4 A;  3SYC A;  5IJ9 B;  2N1T A;  1L0L H;  3O8Z A;  5CJ0 A;  4O4H A;  2XU6 A;  2ADP A;  1Y4M A;  4QIW F;  4R6Z A;  3P3P A;  4E2L A;  3L74 J;  3VTP C;  2ZIO A;  2E3C A;  5CCG C;  3K57 A;  2VWJ A;  3ITK A;  4D6T G;  1V55 B;  4Z2W A;  2LW7 A;  1AQT A;  3LDD A;  4R50 A;  2YIA A;  1XBL A;  3LNN A;  5KAI H;  1KYO E;  1AV1 A;  4PA3 A;  5KLV E;  2A9H A;  4GKJ O;  1NTK E;  4I7Z C;  1OCC C;  2RMZ A;  3L72 J;  2RDC A;  3U59 A;  4N3Y B;  4C7R A;  1BGY H;  1GN6 A;  4JQ0 D;  2H94 A;  3FAV A;  4DR5 B;  1VQ4 P;  2QJY C;  5CBO A;  5B1B B;  4KL1 A;  1MZE A;  4J7Z A;  5ITZ B;  1HVV A;  1VMG A;  3CC2 V;  3CCJ P;  1ZXG A;  1URQ D;  1FJP A;  2Z5H A;  2HPC A;  1URQ B;  1FXK B;  2Q7E A;  1JCH A;  4MW3 A;  3F5W C;  4UXN A;  2O1J A;  3CC7 P;  1XOU A;  4OPH A;  3RYH B;  4FLX A;  3V5B A;  3K5N A;  1WB7 A;  1EN4 A;  1FJG O;  4GKJ B;  1EZV H;  3ETD A;  4RKU J;  1KTM A;  1FBM A;  2EIK B;  5TIS E;  4AQY O;  3N2K B;  1KC8 W;  1MV8 A;  2PRR A;  4X64 O;  1IX9 A;  5GON B;  3H1H E;  2UUA O;  4JI8 B;  4LGD E;  2XAF A;  2Q4P A;  3RYI B;  4I9W A;  4MW8 A;  1PPJ G;  3I56 P;  1LR1 A;  2CAZ C;  2FB5 A;  3T2M A;  3IC9 A;  1OZH A;  4Y99 B;  4DV3 O;  1PL5 A;  4UFZ A;  1PD3 A;  4J41 A;  2WLH A;  4P2Z A;  2ZYA A;  2XUM A;  1YQ4 C;  1EBO A;  2EIL C;  2W0F C;  2IH1 C;  2HOD A;  3JAT A;  4DR7 O;  1EFR G;  3BAS A;  4HYT B;  2SPZ A;  3E22 B;  1SQX E;  4NTX A;  3V2N A;  4U7O A;  3ZRW A;  4PI0 A;  1VQL V;  4H0L D;  2P4K A;  3HKC A;  4GLX A;  1SQG A;  1GK4 A;  2C0W A;  4H0L B;  3R2P A;  5LHG A;  2QA4 P;  1PNM A;  2GA1 A;  4IHJ B;  3CRQ A;  1L4A C;  1F51 A;  2UUA B;  1KB9 H;  1IJD B;  3SPG A;  3FXE A;  4A7P A;  1N33 B;  1OCO B;  3BY6 A;  2JP3 A;  1SFC A;  5L8R J;  1BCC G;  2ZE7 A;  1MSD A;  5LP6 C;  2H88 C;  1RF0 A;  2KK7 A;  5BU5 A;  1EDJ A;  3M0D C;  4DV3 B;  2J58 A;  1K33 A;  5LBQ A;  1SQP G;  1YJN P;  4E4E A;  2Q7C A;  3KZI Z;  1KB9 F;  5B3S B;  2LKM A;  1SLQ A;  4WFH A;  2OCC C;  4EKW A;  2Y0C A;  1N73 A;  3ZMZ A;  3G6B A;  1EZJ A;  2ZNJ A;  3CXH F;  3SJC C;  2JS3 A;  3DC5 A;  4L8J A;  2AXT E;  2BTO A;  1T3J A;  1A32 A;  2X6C A;  2AEJ A;  3CP1 A;  4JZ2 A;  1S5L H;  4X1I B;  3K04 A;  1Q86 Q;  3B5N A;  4NTW A;  4UCV A;  4X65 O;  1RM1 C;  1Y9B A;  2ITD C;  4J10 A;  5H2F Z;  3SYO A;  4AI8 A;  2N9B A;  3VP8 A;  1R3K C;  4I0X A;  3OD4 A;  3B5N D;  3LUT B;  1SA0 B;  2E74 B;  4DR4 O;  2Q68 A;  4AHC A;  3CCS V;  2Z5I A;  1H0T B;  1WMK A;  1SQP H;  3CMA V;  2WAM A;  1KBH A;  5C39 A;  4PI2 A;  1GAX A;  3FYE B;  4J9Y B;  3Q1M A;  2FML A;  1QU7 A;  5B66 Z;  2POH A;  2Q0A A;  2IU3 A;  1LT1 A;  2LO1 A;  3ABL B;  2RCV A;  1YJW V;  2R72 A;  4DCK A;  2Q8V A;  4B7K A;  2YID A;  3T4Z A;  3MTU E;  5KJ7 A;  2WLM A;  3L9D A;  4PA6 A;  1YQ3 C;  2UUB O;  2QM4 A;  4XE5 B;  4LF6 O;  1N86 A;  3Q5S A;  3CCM P;  1BE3 H;  1VP7 A;  2AXC A;  2NLJ C;  1SQQ J;  4JYB A;  3SSU A;  4TT3 G;  3ZRS A;  4YTP C;  1YHQ P;  2Q3I A;  5KHH A;  5DJU B;  4M3L A;  4XFJ A;  4UB6 E;  3WU2 H;  3NR7 A;  2H8P C;  5KLV D;  4OGQ D;  5GW7 A;  4DR4 B;  1BGY J;  4IL6 H;  5DN6 G;  2A0L A;  3OW2 U;  1FZC A;  1NBM G;  1VQO P;  3CX5 E;  2JJL A;  1XNR O;  2K9Y A;  3J81 N;  2I1J A;  5KLV K;  2QSI A;  2HLO A;  2YMY A;  1N2D C;  3JYC A;  2UU9 B;  4H44 B;  3OTO B;  1GTW A;  2FXM A;  2MK3 A;  1SF9 A;  5EBW C;  1S3J A;  2DYS C;  1HUC A;  2W8Z A;  3H1I E;  5BR8 O;  4UB8 Z;  3G6E V;  2ZT9 D;  4I1L A;  1SQV J;  3JAS A;  2FYN B;  1SQB E;  1KQL A;  1THZ A;  1FAF A;  4KHP B;  2DQ0 A;  1QR8 A;  2OIG A;  3RYF A;  3STL C;  3RW0 A;  2WZ7 A;  3L73 E;  1YBK A;  3M06 A;  1GO3 F;  5JH7 A;  3TF5 A;  4BAY A;  4RQF A;  3AEC C;  1P84 I;  3E1R A;  1IXB A;  1BZK A;  2FXO A;  3HD7 D;  1S77 D;  2BAS A;  3H1H D;  3HD7 B;  4X20 B;  3E8H A;  3ABV C;  3QWO C;  2QR4 A;  5H6Q A;  3C9I A;  1NTZ E;  1KC8 Q;  1FFX A;  3Q5R A;  1NU1 J;  4ZHQ B;  3ZHU A;  1Y8A A;  1IZN B;  2DW3 A;  1QBZ A;  1USE A;  2HKO A;  3O9O A;  4J7K A;  1RF1 A;  3BA9 A;  4DR2 O;  5BMV B;  2YIC A;  1LTJ A;  1ORQ C;  1U96 A;  4U3J B;  5KA5 A;  1BSM A;  1T5E A;  1NGM B;  1ZV8 A;  4IIJ A;  1M93 A;  2Y69 B;  2UXD O;  4FIP C;  1SQX D;  1USD A;  5CMZ A;  4FFK A;  3AED C;  1RPO A;  4XDK A;  5D5P A;  3TSI A;  5AVW B;  3O6Q B;  3H1L J;  4EI2 A;  2CPS A;  5KAF Z;  1EC5 A;  2QSA A;  1V55 C;  2PZS A;  1D5N A;  3L75 G;  1SQX K;  2ZIN A;  1Q2N A;  1I94 O;  5JJE B;  4UCR A;  1RH5 B;  5EBM C;  2JK5 C;  3X2Q B;  1SZX A;  1HJ0 A;  1GL2 D;  3JAR A;  1GD2 E;  3RVY A;  5FLX N;  3W7S A;  1XHZ A;  2UUC O;  3EFF K;  4GZR B;  2OTJ V;  1GL2 B;  1D2D A;  1IFP A;  1JY3 P;  3BVH A;  1QVG O;  2ATK C;  3KQG A;  1Q82 Q;  5IWA B;  3JCU E;  4D6T E;  3O65 A;  3CD6 P;  1MA1 A;  2A06 D;  3AE3 C;  1ZRT E;  2IYP A;  1YF2 A;  5LL6 Y;  3CCU V;  2O1K A;  4DOJ A;  2ZDI A;  1VPC A;  4I9Q A;  4YHH O;  1R8E A;  3IR9 A;  2QGN A;  5J9P C;  2BOB C;  1NTM G;  5AVV B;  2UXD B;  3NMD A;  3C3S A;  3RBX A;  2BEQ D;  4PJ0 Z;  2VQF B;  2JO1 A;  1NR7 A;  5B1B C;  1K73 Q;  1DIP A;  3LDE A;  5LYJ A;  1PP9 J;  3ZJZ A;  1NJI W;  3AE2 C;  2EIN B;  3M0A A;  3RK2 D;  4EB6 B;  1URQ C;  1PZQ A;  3BCC D;  1FXK C;  4DYL A;  1T2K D;  4LH7 A;  4PDV A;  1I94 B;  2ITA A;  3WFV A;  4JI7 O;  2KP8 A;  3CC2 P;  1IBL B;  4F6R A;  1W2E A;  5CJ4 A;  1KD1 Q;  2D3O W;  1AI6 A;  5GTI Z;  3AG1 B;  2EIK C;  2UXN A;  4KUM A;  2A3Q A;  3AG3 B;  3P7K A;  4BIO A;  3CME P;  3MHS C;  1NI8 A;  4TQD A;  5DED A;  3SJA C;  4YHH B;  1S9K E;  5HFL A;  1FS0 G;  1IXM A;  1W2B U;  3IJ4 A;  5JCO A;  1HH0 A;  1HP8 A;  4QE9 A;  4Y99 C;  2RH0 A;  5KAI Z;  3CWB G;  3IF4 A;  1RSO A;  1Y76 B;  4N21 A;  4NTY A;  5J2T B;  3GLM A;  1Q7Y W;  4WFG A;  2LW1 A;  3AE6 C;  4OPA A;  3IN6 A;  1BQ0 A;  1PPJ E;  1CI6 B;  1K7D A;  2DOS A;  2KNC A;  2E5T A;  1NH4 A;  2HHH O;  1JUN A;  3M99 B;  5E79 E;  1LNQ A;  3B77 A;  4H0L C;  5CCG A;  1BQZ A;  2UXB O;  3W7T A;  3CX5 D;  1NTK G;  2BSK B;  1BSH A;  2R3C A;  1S1C X;  1OCO C;  4RUE A;  2V1D A;  3H1I D;  2L5G B;  2EZO A;  2YO2 A;  1QQC A;  3G67 A;  1B06 A;  1V9P A;  4TV9 B;  3ZN1 A;  1IFM A;  1SQB D;  4W7Z A;  2IBZ G;  3CEI A;  1L1F A;  4BWN A;  1OV9 A;  1AA0 A;  2Q6A A;  5AVX B;  1VQM P;  4UVA A;  1BCC E;  1EM1 A;  1SQB K;  3L73 D;  2WIT A;  3A0H E;  3L70 D;  2P7J A;  4FLY A;  4FJC C;  2Y9Z A;  3GWK C;  2B1I A;  5KLV H;  1NTK H;  2HVK C;  2QE7 G;  1B3Q A;  1YTZ I;  4X1Y A;  1K8A W;  3IGA C;  4GX5 A;  1E79 H;  1EZV I;  4R4L A;  5C93 A;  3ZBH A;  1L0L D;  4FZ1 A;  4CH3 A;  4LFB O;  2CTQ A;  4RES B;  1NTZ D;  2E74 C;  3B5N C;  1S0V A;  5K1P A;  3RYC B;  1H2N A;  3E2E A;  2XND G;  4G28 B;  2IFN A;  1CP9 A;  3MAQ A;  5B1N A;  2IZ1 A;  1L0L K;  2E42 A;  3A7O A;  2E75 D;  1JTH A;  1MMM A;  1NWQ A;  4I50 A;  1NTZ K;  3OGC C;  2E75 B;  1M1K W;  4WY4 B;  5KLI B;  3D70 A;  2W6J G;  3ABL C;  1FZG A;  1JNM A;  2JDI G;  3K03 A;  2O01 J;  1M90 W;  1S76 D;  2P2U A;  2NRG A;  4AIL C;  4JTD B;  2ZKO A; 
#chains in the Genus database with same CATH homology
 3S9O A;  4EEQ A;  4Q6G A;  5FPR A;  2J5U A;  2OYQ A;  1O9H A;  5CA0 B;  4DV0 B;  3AEB C;  3BAA A;  4YXD C;  1K05 A;  2F1M A;  4X1K A;  1ZAU A;  3U0Z A;  3GF3 A;  5JQG A;  4TOI A;  3M7M X;  5FNV A;  4LFB B;  1N32 B;  4EB6 A;  5KKZ C;  3BHP A;  1KQG B;  2YI8 A;  4DR7 B;  4O4I B;  4OGQ C;  4DV6 B;  5LMN B;  5JCO C;  1JJO A;  1TVK B;  4O4L A;  1Z5V A;  3JAR B;  3ZED A;  5LXT B;  1TA8 A;  1HW7 A;  4LF7 B;  1FDO A;  3AE1 C;  3R4Y A;  2VWK A;  3JAW B;  3JAK B;  4D7S A;  3SJB C;  5JJN B;  4DUZ B;  5EZY B;  5LP6 A;  4LFA B;  5IJ9 B;  2WQY C;  4IL6 X;  3EWK A;  1WPB A;  5LA6 A;  2QIW A;  1Q90 D;  4O4H A;  4H13 C;  2G3A A;  2FYN C;  5IJ0 B;  1QHT A;  2ZT9 C;  3IAY A;  1HF9 A;  2VQE B;  4FM2 A;  2ZIO A;  4O2B A;  2E3C A;  4YJ3 B;  4CH6 A;  3K57 A;  2VWJ A;  1Q8I A;  2MKV A;  2YIA A;  4FM1 A;  3LNN A;  4LF5 B;  2PUS A;  1XNQ B;  4CC5 A;  2FXP A;  5FPO A;  4I7Z C;  4BW9 A;  1KMI Z;  2WSC J;  1U57 A;  4NVP A;  4DV5 B;  4K0K B;  2E76 D;  4GKK B;  2E76 B;  4X65 B;  1IK7 A;  4TUY B;  4DR5 B;  2P10 A;  3K5L A;  3QF7 A;  5CB4 A;  4B3S B;  3VQW A;  3JSN A;  2QJY C;  3IAO A;  2ZM6 B;  4KL1 A;  3UT5 B;  3WB1 A;  1TU3 F;  2RQ6 A;  5ITZ B;  4PV1 D;  4OGQ B;  4LFC B;  4DRX B;  1HNW B;  1OW7 A;  4PV1 B;  4JI2 B;  4TV9 A;  3GMA A;  2Q7E A;  3RYH B;  1Q5O A;  4FLX A;  4X20 A;  3K5N A;  2H89 C;  1M4U A;  4X62 B;  4GKJ B;  3QG5 A;  3JAL A;  4H13 B;  4RKU J;  4TV8 A;  2UUB B;  4JI6 B;  1KTM A;  4LF6 B;  2ZT9 B;  5EYP B;  3N2K B;  5KX5 B;  1GMJ A;  2YI9 A;  5GON B;  4JI8 B;  4U7J A;  3Q3D A;  1TAE A;  3A2F A;  2YIB A;  2YMK A;  1AJY A;  3RYI B;  4DR6 B;  1WN7 A;  5EIB C;  4I55 B;  1L8D A;  2ZIM A;  1WNS A;  2CAZ C;  2YIB D;  3SGI A;  4FLT A;  3RK3 E;  5IYZ B;  3N2G B;  4WBN B;  3HKB A;  1PL5 A;  4UFZ A;  3ETQ A;  1XNR B;  3BAB A;  1YQ4 C;  2P5O A;  4Y28 J;  5D5Q A;  5JH7 B;  3JAT A;  4CS2 A;  4ZI7 B;  4FFB B;  3E22 B;  2FBW C;  4PI0 A;  4JYA B;  4H0L D;  1ZME C;  3HKC A;  4GLX A;  3AE7 C;  1SQG A;  1K04 A;  4H0L B;  1H2S B;  5BR8 B;  4UCT A;  1DD3 A;  1FFX B;  4IHJ B;  5CA0 A;  2UUA B;  2OWO A;  5KHG A;  1N33 B;  3FGA D;  1Z5W A;  2JP3 A;  2F66 C;  5L8R J;  2GV9 A;  5LP6 C;  2H88 C;  2OQQ A;  4IIJ B;  4DV3 B;  1OMI A;  1VL2 A;  3Q5P A;  1Q43 A;  2IDB A;  3SFE C;  4JI0 B;  1TVK A;  5LXT A;  2QJ1 A;  3HKE B;  1PIX A;  4OX9 B;  3JAW A;  2ZNJ A;  3G9R A;  3JAK A;  4FLW A;  3SJC C;  1DGS A;  4L8J A;  5EZY A;  2BTO A;  5KMG B;  4X1I B;  4H44 C;  4DUY B;  5IJ0 A;  4DR2 B;  1B04 A;  4UCV A;  4B08 A;  1Y9B A;  3RFR A;  3AEG C;  3HKD A;  2ZNI A;  3AEA C;  2D2C C;  2YXL A;  2V4D A;  3ICX A;  5LOV B;  4YJ3 A;  4LF8 B;  1JB0 J;  1O9G A;  1SA0 B;  4PHZ A;  3UQ8 A;  2E74 B;  3Q2Y A;  4AHC A;  1WMK A;  4DK0 A;  3K59 A;  4LNU B;  3T97 B;  2WSE J;  2R9A A;  4UCU A;  2Q7H A;  4PI2 A;  3SR2 C;  3Q1M A;  5LYJ B;  1P49 A;  1VF7 A;  2Q0A A;  5KHK A;  5J2T A;  1EXI A;  1VF5 C;  3WB0 A;  2RJZ A;  2R72 A;  4R4M A;  4CS4 A;  4HNA B;  1TUB B;  2UUC B;  1RQV A;  4FLU A;  1JFF B;  4O4L B;  4TQF A;  4DR3 B;  1YQ3 C;  3C8V A;  1UIX A;  2QM4 A;  1DD4 A;  3Q5S A;  1SQF A;  4F6R B;  3SFD C;  3UT5 A;  4CH5 A;  5LA6 B;  4YTP C;  5ITZ A;  4DRX A;  4YJ2 B;  3ZS8 C;  3H25 A;  3K5O A;  5KHH A;  3OTF A;  4XFJ A;  5J2U B;  4OGQ D;  3T1Y B;  4DR4 B;  5C8Y B;  4FLV A;  4O2A A;  3RYH A;  4CS3 A;  2K9Y A;  4X66 B;  4DK1 A;  1KIL E;  2QSI A;  4NXN B;  1EXJ A;  2UU9 B;  3AE4 C;  4H44 B;  3OTO B;  3N2K A;  5KX5 A;  5JJJ B;  4JI7 B;  4H13 D;  5GON A;  4CC6 A;  2ZT9 D;  2E75 C;  3BRC A;  3JAS A;  3RYI A;  4B3T B;  5KLI C;  4I55 A;  4JI1 B;  3VQY A;  4LF9 B;  1XMQ B;  4KHP B;  3RYF A;  4ZIB A;  5IYZ A;  3N2G A;  3U11 A;  4WBN A;  1OW6 A;  4GYC B;  3AEE C;  2PGG A;  4LH6 A;  3CB2 A;  2WPV B;  2F93 B;  3GF7 A;  5JH7 A;  4D7T A;  1S5J A;  4ZI7 A;  3RYC A;  4FFB A;  3E22 A;  1XMO B;  3AEC C;  1PV3 A;  4I7Z B;  1J5E B;  1HNX B;  3D71 A;  4X20 B;  2F4V B;  3D6Y A;  3ABV C;  5CA1 B;  3AE5 C;  1FFX A;  3Q5R A;  2EX3 A;  2HHH B;  1Q3E A;  4ZHQ B;  1D5A A;  4ZOL A;  2P22 C;  3CSX A;  2UXB B;  3JSL A;  3BA9 A;  5BMV B;  4U3J B;  5JVD B;  1T5E A;  1NGM B;  2E5L B;  4IIJ A;  1M93 A;  3RWR D;  3THO A;  5K1X A;  2PY5 A;  2UXC B;  3HKB B;  4X1Y B;  1TGO A;  3AED C;  3D6Z A;  5D5P A;  2QJK C;  2NZ2 A;  2JGU A;  4O4I A;  1KOR A;  3HKE A;  4B3M B;  2PZS A;  2JS5 A;  4Z1M H;  1N34 B;  4FLZ A;  3K58 A;  2BTQ B;  2ZIN A;  4JI4 B;  5JJE B;  4UCR A;  4I4T B;  1HJ0 A;  2WSF J;  5KMG A;  3JAR A;  4X1I A;  1NYH A;  1XHZ A;  5M1B A;  4I50 B;  5EIB D;  2PYL A;  2QJP C;  4JV5 B;  2XHB A;  5IWA B;  5IJ9 A;  4O4J B;  3AE3 C;  5LOV A;  4DR1 B;  1ZRT E;  3AE9 C;  3T1H B;  3PN1 A;  2IM9 A;  1SA0 A;  3LW5 J;  3FFQ A;  4DV2 B;  4I9Q A;  2E76 C;  1R8E A;  1IBM B;  1FDI A;  4LNU A;  2KKW A;  2E74 D;  2UXD B;  1G6U A;  2BEQ D;  2JO1 A;  2VQF B;  2BEZ F;  4UCS A;  2HEP A;  1DIP A;  4B3R B;  5LYJ A;  4FVM A;  3K5M A;  4X1K B;  4PV1 C;  5JQG B;  1NT2 B;  3AE2 C;  5FNV B;  4HNA A;  1TUB A;  4EB6 B;  4JI5 B;  1JFF A;  1SKV A;  4DV7 B;  4LH7 A;  1I94 B;  2R70 A;  1MKM A;  1OW8 A;  1KQF B;  3BA8 A;  2Q7G A;  4BWA A;  1IBL B;  4F6R A;  1YEW A;  1XI1 A;  4K8X A;  4TUY A;  4LF4 B;  4YJ2 A;  1HR0 B;  2V7Q J;  1XQ8 A;  5LP6 B;  3HKD B;  5J2U A;  5C8Y A;  2F95 B;  1JMK C;  4O4H B;  4TQD A;  3SJA C;  4YHH B;  5LMU B;  4CH4 A;  5JCO A;  4NXM B;  4O2B B;  1HNZ B;  4HBN A;  2ZCE A;  3QTC A;  1RSO A;  5J2T B;  3DSQ A;  4DV4 B;  3GLM A;  4LR3 A;  4H44 D;  3AE6 C;  3IN6 A;  4DV1 B;  2PYJ A;  4K8Z A;  3U10 A;  1IBK B;  2D2C D;  5EYP A;  1N36 B;  2D2C B;  3VQX A;  4H0L C;  1ZP0 C;  5KHI A;  4TT3 H;  5CB4 B;  1RQU A;  1S1C X;  1VF5 D;  3AE8 C;  4UCO A;  1VF5 B;  4O2A B;  2YIU C;  1I7F A;  1QQC A;  1V9P A;  4TV9 B;  4EFE A;  5CA1 A;  2JVD A;  4ZHQ A;  1XHX A;  1M5I A;  3JAL B;  4IHJ A;  5BMV A;  4TV8 B;  3JAS B;  4U3J A;  5JVD A;  4FLY A;  5KHJ A;  2G8Y A;  4JI3 B;  3RYF B;  4X1Y A;  4YY3 B;  3B71 A;  3RL0 g;  4R4L A;  3O6Q A;  4CH3 A;  3RGB A;  4GDO A;  3VQV A;  2E74 C;  5K1P A;  2BTQ A;  1X4T A;  3RYC B;  3BPZ A;  3AEF C;  1S5L X;  4KT0 J;  4I4T A;  4FM0 A;  3MAQ A;  1KU9 A;  2E75 D;  2PTM A;  1FJG B;  4I50 A;  3JAT B;  2E75 B;  3D70 A;  4AQY B;  4O4J A;  1ZOY C;  3HKC B;  3CHX A;  4EFB A;  3WB2 A;  2O01 J;  4X64 B;  4ZOL B;  3B2E E;  4AIL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...