1KMIZ

Crystal structure of an e.coli chemotaxis protein, chez
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
209
structure length
177
Chain Sequence
b'SIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLSQDQVDDLLDSLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
pubmed rcsb
molecule tags Signaling protein
total genus 62
structure length 177
sequence length 209
ec nomenclature
pdb deposition date 2001-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF04344 CheZ Chemotaxis phosphatase, CheZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.500 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1kmiZ02
1.20.5.590 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kmiZ01
1KMIZ
chains in the Genus database with same CATH superfamily
1L4AC 1VQMV 3DXRB 3OGIB 4JI2O 4X65O 3LUTB 4BW5A 1FOSE 5IY5C 3HKEA 3ABLC 3FX7A 1NU1J 1HR0O 3D3IA 5H5NA 3AECC 4UB8E 1AI5A 3HKEB 4CH3A 3BFRA 2A79B 3HRNA 3THOA 2CTRA 5AG2A 4R4MA 5KAFE 1T3UA 2UXDO 1ZX3A 4UUJC 3AEBC 2WLJA 5B5EZ 1I5XA 1HDJA 4H33A 1W0KG 1Z5VA 2EIMB 4JI6B 2C9NY 3GB7C 1L0ND 3CRCA 1JMMA 3FB5C 5APSA 3CX5D 3B5NC 1KKCA 5CMUA 2YO3A 4DJGA 3ABMB 2N05A 2EIKC 3KYQA 1KQGB 4JPRA 5CCGC 2MJZA 5CBOA 4L75A 2IYOA 2QDOA 1SQVJ 3GMAA 3SWKA 1VPCA 1BE3D 2K3RA 2JJLA 3B40A 3H1KH 3D6YA 2FYUG 1TU3F 1VQ5P 1PFIA 3D70A 4H37A 1URFA 3CCSV 4H13C 4TQFA 3O9OA 5B1OA 3L70G 5AW6B 1NTKH 4NTYA 4DXWA 1KN7A 1K73W 3FB8C 3ZMUA 4WBNA 2O1KA 2NPSC 2Y0CA 3QO5A 4JBZA 1R3KC 2R70A 4WBNB 4DR5B 2DW3A 1GN6A 1UIIA 3CX5F 3HKBA 2W6BA 2MK3A 4XDKA 3PJSK 1H2SB 4JQ0D 1VQPV 3JSVC 5AW7B 2AXTZ 1B06A 4YY3O 2UXCB 1IJDB 3HKBB 1R5SA 2CK3G 4X1KA 4X1YA 3B8NA 1SRYA 4X1KB 4LFBB 3CL3D 4FZ1A 2V7QG 4X1YB 1M56D 5CJ0A 4GKKB 4MVMA 2BCCJ 2IH1C 3OD4A 1IDSA 2WSSH 1NGMB 1JVMA 2W8ZA 4QPJA 2Q9IA 3NR7A 4RJTA 2FTKA 4J7ZA 3ZCCA 3S3WA 1PGJA 3F5WC 4DR4B 1L0LE 1N8RW 1K4DC 1Q81W 5AW5B 3ASNB 5E79Z 5DM6V 2PYLA 1I7FA 5EBLC 1AVYA 4YPCA 1NR7A 2KSDA 1VP7A 5B1AB 3KHUA 1HUCA 3T4DA 3H1IE 1RE4C 3OA7A 4Y99C 4IYIA 2DW4A 5GW7A 2IBZI 1FKAO 3SYCA 1M8OB 1NTZJ 3CWBG 3SFDC 4ICGA 4RWUA 3H1JE 1VQ8P 3H1HH 5L3GA 2IH3C 4IOIH 2GV9A 2BSKA 3AG3C 4DR3O 5LMUB 2AZ2A 2HHHO 1A32A 2BSKB 2ZNJA 3C9IA 3JSLA 2R32A 3MUDA 3E8HA 5BVZA 1FS0E 2QJPB 1OCCC 2DJVA 4DUZB 2P7JA 1SQVG 1NTKJ 1ZRTE 1SS1A 3W7XA 4L73A 3LSSA 3L74D 1KZUB 3JCUE 2E42A 1R6TA 4YJ3A 4QMAA 1X59A 1S72P 1M4UA 2OYHA 3B77A 3D36A 3E89A 4YJ3B 4XA4A 4JF7A 1Z2GA 2OYHB 1RM1C 3OFNG 1URQA 3E86A 4YHHB 1BGYE 1PKXA 1W2BU 3FD9A 4JV5O 2O01N 5APUA 1K4CC 1URQB 4L87A 4QE9A 1ZXGA 2WA4A 3KPEA 4IL6H 3K3WA 3I56P 3ZRVA 2B87A 2R9RB 5B1NA 3M0DC 1QR8A 1KD1Q 4UCVA 4F6RA 3C90A 2B87B 1ZN5A 1X8YA 1KC8W 3CI9A 2CTWA 5KAFZ 3KZIH 3LIDA 1ZUQA 1Q82Q 1DK1A 4F6RB 1FXVA 3BRTB 1K05A 3FB7C 2E76C 3BCCE 4JI0B 1YTZT 2VQEO 1K5SA 3WB0A 4PA6A 2WITA 4GOEA 4LF8O 1U96A 3K5NA 1S2EA 1N73C 3F7YC 4OXSA 3WB2A 4FLWA 1KP3A 2W6IG 3RVZA 3MAQA 3SPHA 3DSQA 3BABA 5BXZA 1PL4A 2H43A 3CMEP 5EK0A 5H2FZ 1LT1A 2B5UA 1KTMA 4WB4A 1H2GA 3RW0A 4OVNF 1IFIA 2MKVA 2ZD9A 2RMKB 4JYBA 4JI7O 5APTA 1JOCA 2YIBA 1URQD 2HJFC 1GN4A 3EFGA 1LR1A 2E5LO 4B7KA 4JYYA 4X66B 2PUSA 3R2PA 4R50A 1GO3F 1AB3A 2OTLV 3CCQP 4KJMA 1AR1B 2W6JH 3H1KG 3H9VA 3L75H 1N2DC 5FPRA 5GTIH 3G6EV 1YJ9P 4I50A 3LDEA 4WY4C 2QM7A 2NN4A 1GM9A 4WCEV 2QVAA 3KXDA 4I50B 1L0NE 3JALA 5AW0B 3L35A 4QNHB 4QIWF 4OWFA 3JALB 3JAMN 2P10A 1PGOA 3U10A 3ZRWA 5L3BA 1NS1A 4JI8B 3CC7V 2PGDA 1H2MA 3CCMV 1KFMA 3L9DA 3ZRWB 5KHGA 1J2JB 3RFRA 3RBZA 2FYZA 3LSQA 1BE3E 1VIBA 1SZXA 2YIAA 2YIBD 3OE7G 4EOTA 2XT9A 4AQRD 3HR0A 5DECA 1NU1E 3GF7A 2XU6A 3CSXA 1CZQA 5J9PC 3D71A 3L72J 1P84D 1L0NK 2L35A 3C3SA 3FYEB 4DCKA 1JO5A 2WSSG 2EX3A 5TISH 5CBGA 4FM0A 1JUNA 5KLIC 2DN9A 2P4KA 3V2QA 1KUQA 5D5PA 2FYNB 3S9OA 3SPGA 4UCUA 4DT0A 3SGIA 2Y69C 5JJNB 3VYIA 5H6RA 2W6AA 3GW6A 3BVOA 3WMM0 2OCCB 1JR9A 5APVA 1X22A 4UV8A 4R6ZA 4WF9V 4ABMA 2F95B 4EEQA 2A45H 1GN2A 1XEQA 1IFJA 1EN6A 2ZAEB 2N04A 1FBMA 1CEZA 2ZT9B 1Y67A 3ZMSA 3CCVV 1ZL8A 2JGDB 2QR4A 3JCUZ 2ZM6O 3H1HG 3STLC 1NR1A 1SESA 2ZR3A 1P84F 1ZL8B 1K34A 2LO1A 4FLZA 3OW2U 1YIJP 5IYBO 1Q2NA 1QL2A 2CPBA 3T4ZA 1OJHA 1YZBA 4WFGA 1Q3EA 3QVNA 1SQQD 4IYHA 4QE7A 3JCZA 2Z5IA 1PGQA 1UFIA 4PD4I 2V4DA 4KFMA 5K1PA 3P7KA 2R3SA 5IT9N 4H0LC 4UB8H 1IFNA 1GRJA 3AEIA 3JARA 1OCOB 2HODA 4WVZA 2V1DA 2V4HA 2OTJV 2QKSA 3JARB 4IT5A 1N0JA 2HODB 1DX7A 2R44A 5KAIE 1OHHG 2ZT9D 5EC1C 1J1EC 4JGSA 3CCLV 1SVFA 1TUBA 3O6QA 1AVMA 2NR5A 3L74E 1TUBB 2WLKA 2Q9LA 4X62O 2E3CA 4CH4A 1KKDA 3O6QB 3CD6V 3WU2E 1MG1A 3ZN1A 3RK3C 2ZVNB 3AK3A 1KYOI 2FKXA 2DE0X 4XFJA 4MVUA 1GK6A 1GM7A 5IYDO 3CCUV 4ZBMA 1Q6UA 1GMJA 2WSFJ 1USDA 4BWNA 4Z1MH 2J5UA 3ETGA 3MHHC 4I9QA 4HNAA 1NO4A 1KYOF 3AEGC 1VDFA 2EJRA 4HNAB 4UCSA 5L3FA 3FWNA 4I7ZB 2IDBA 4OGQB 3K5OA 3H1LD 1T3JA 3A0HZ 4EKWA 1DF4A 1EM1A 1QEXA 3RL0g 2OGUA 3RYIA 4LH7A 1V54C 3F5TA 1WRGA 3B2EE 3P3NA 1S3JA 2W6JG 1SQPH 1ZMEC 3H32A 3RYIB 2M3BA 1MOFA 3L75G 3OEHG 2IJJA 3CS5A 3H32B 2IJHA 3K04A 3ABVC 2JJ2G 2ETNA 1NT2B 3MHSC 2ZDIA 1WP7A 3OAKA 2W83C 4YIPA 3AE3C 5B66H 2OARA 4NVPA 2ZQMA 2XZRA 5CCHC 1KV4A 4NTWA 3N4XA 4AYCA 1JNMA 3Q1MA 2AW9A 1K7DA 1L0LH 2H89C 2JO1A 1M57B 4DR1B 3VQYA 1VQLV 5AW3B 4RQEA 1HNZB 1KU9A 1AI4A 2FFDA 3APOA 4XE5B 1RF1C 4GOFA 3Q5PA 1LUWA 1JFFA 5H9CA 2JRIA 4U3FD 3CXCU 4LFAO 2FFDB 3N2GA 2VRZA 1Z56A 1H0TA 4OGQD 2JGUA 1JFFB 1SERA 1H2NA 1VQKP 3N2GB 4WWIA 5KLVD 3ZHQA 1H0TB 2N9BA 2QWNB 2W0FC 4IFDK 3CRQA 4CS3A 1Z5WA 1PNKA 5KA6A 1NTMD 4AQYB 2YXQB 3L73D 1QNMA 4DV4O 2QA4V 5LBQA 1GN3A 2C0XA 2ZYDA 3RL0D 4LF7B 2WZ7A 1OZ0A 2JVDA 3TGUD 2BASA 1M57D 1OWAA 4W80A 2R9AA 2A45G 1VQ9P 1F51A 4OX9O 3ZIAG 3ZMTA 1RP3B 1OCRB 1A02J 5CA0A 1YTFB 1RF0C 1BGYH 3JAKA 1P84E 5CA0B 2E74B 5CN0A 4TSFG 3CC4V 3JAKB 1NBMG 1FJGB 2LXCB 2FXOA 3M9QA 2F1MA 1HNWO 3TCUA 5HFMA 2B9BA 4Z1VA 2QWRB 1ZLZA 1NAYA 2OYQA 1EXJA 3ZBHA 4OH8B 2EIJB 1HW7A 1Q6HA 1ROPA 3K58A 1IFPA 3B4SA 4K8ZA 3T97A 2X7RB 1Y9BA 3GHGA 1T2KD 4JTCB 4PV1D 2RCVA 3T97B 4DZOA 2QJYC 3GHGB 1FZCA 1EN5A 3ZHSA 1M1JC 1M7LA 1ZAUA 1FZCB 1F4MA 3H1IJ 1FFXA 2LXBA 1RE3A 2FB5A 5F2VO 2QWPB 2GUSA 2ODMA 1FFXB 1YTFD 3OTOO 3ZS8C 5EZYA 2Q6AA 5LYJA 1R3IC 3H1JJ 1KQSU 2YS8A 1SQQE 5EZYB 5LYJB 1GW4A 2LKMA 2R9IA 2HVKC 1EFRG 3JC22 1KQLA 3G80A 2YNYA 3B71A 4LLHA 1QBZA 1NVPB 1J1DC 2NRGA 2QEXP 2KZJA 1N36B 1S5HC 5IJ0B 3JD0A 2M6YA 1YTZI 2F4VO 2WQYC 1GDTA 3K0DA 1YITV 2N9YB 4MN4C 2JWAA 1BQ0A 2M7WA 1BSNA 3SJAC 1N0NA 3P8CD 1G4YB 1I0HA 4HAMA 1R5LA 2P5OA 1MV8A 1FAVA 4XBFA 2PTMA 1SQQK 2YDEA 1PM9A 4Z1MG 1L0NH 1BGYJ 1KYOE 4DR6B 3CC2V 4MTOA 5CHXA 2Y0PA 3MIWA 1ORQC 1JB0J 4WBAA 3IGAC 4NKGB 5LMNB 1IBMO 2FBWC 3IR9A 5LGNA 2HP8A 4IIJA 1VQNV 3IF4A 2F43G 1XUQA 2KQXA 2WAMA 4IIJB 4DRXA 1BE3H 3N7NA 3CCEP 1SQPG 1IFMA 2QWOB 1NU1H 1QVFO 1KB9D 2HYNA 3BCCJ 1VQPP 2XAHA 3D6ZA 1S5LZ 1BL8A 1VL2A 4R4LA 3ICXA 4DV6O 2R3CA 3SJQC 2LFRA 5AVRB 3GG2A 2WSCJ 4QPKA 2AGAA 4J41A 3LSUA 3SPJA 4X89A 1YEWA 4LF5O 1L0LG 2PF4E 3G4SP 5E79E 2LGWA 1QLED 2K1AA 3MD0A 3H1LE 2X6CA 3ZHUA 2I8DA 1FZCC 5M1BA 2MW2B 2A7WA 1SQBG 4DV5O 1KBHA 5AVYB 5EIBC 2ZXWC 4PJ0H 5GTHZ 4FZ0A 4LH6A 3UO2A 2J59M 4PA3A 3K5MA 4GKJO 3U59A 1X4TA 3ZJZA 2YXHA 1RQUA 3NTNA 4D6TD 2Z0AA 3TNUA 3KKYA 1DEBA 4D7SA 3TNUB 1XMQB 2IBZH 2OWOA 3A5TA 4DK0A 1LTSC 1YQ3C 2W90A 2CTQA 4DV3O 1WP8A 1L0NJ 3M06A 1ZR4A 1UIXA 3HD7A 3BA8A 3CHXA 1DF5A 2PRRA 2EULA 1S9KD 4U3FE 3HD7B 1IX9A 1XDCA 3CMAV 3AE6C 1EZVD 2JS3A 4NTXA 2LFSA 1BGYG 5KLVE 4TQDA 5J2TA 1XL6A 2ZINA 1G8MA 4G28B 2AHZA 3T1HO 4O2BA 3VOPA 3Q5SA 1BE3J 5AVXB 2QKCA 2BCCH 5J2TB 1NTME 2DWDC 3M91A 3L73E 4O2BB 5LHGA 5KAIH 3B5ND 1JCHA 1EZVI 3CJHA 3FWLA 1EN4A 4ASVA 3CJHB 3CRMA 3L74H 3AEDC 2KI7B 1SETA 1P4RA 3UM7A 2FYUD 2PAJA 1O9HA 4MVRA 3GF3A 3V6IA 5CCGD 3WU2H 5BR8B 2RN0A 3FX0A 3G71V 5KLVK 3X2QB 1MZFA 2YMKA 2Q7CA 3VMYA 1W0JG 3TXSA 4IL6Z 2UXBB 1DTOA 1NTMK 1YYCA 3AG4C 3E8BA 1NTZH 1NH4A 4H13D 1NKNA 4TLFA 1M56B 1FDOA 3JD1A 4U7OA 5H2FE 1BHAA 3HD7D 5AVWB 1GK4A 4JI1B 1AILA 3KQGA 2YIUC 3M9HA 1OW8A 4KP4A 1LTAC 2E75B 3CX5I 5JWPA 3SWFA 4CC6A 1RHZB 4C7RA 2JWDA 5BMVA 1GD2E 3WB1A 2VRSA 1OVVA 3ABKC 4MT8A 5BMVB 5LXTA 4EFBA 1M9NA 2LW7A 1IBLB 1HNZO 2PGGA 2JK5C 2Q7GA 3F7VC 5LXTB 2P7TC 4N3YB 3IN6A 1WT6A 1ZV8A 4RO2A 1YF2A 4LF6B 1I94B 5CBHA 2DYSB 1ZLLA 4LFCB 4CS4A 1W59A 2RH0A 3CCRV 5AVQB 3QG5A 3CCRP 1G6UA 2JKVA 1L0NG 4AQYO 4UCTA 2A9HA 3VQVA 1MNGA 4JYAB 1YJNP 4TWKA 2K9PA 3G6EP 3D8CA 3VP9A 1KD1W 4LF7O 3CWBD 2E75D 3TYYA 4DK1A 1NZ6A 1LTGC 3E83A 3PHLA 3WUVA 5LP6B 3ASOB 3E2EA 1BE3G 1OVRA 3L74J 3P8CE 3BATA 1IBKB 1AQTA 1LTIC 2Q68A 1NU1G 1F7YA 2XV5A 1JM0A 4K0KB 3W68A 2F23A 4J7JA 1SQGA 3LIEA 2Y48A 3KCYA 2UU9B 1VQ7V 1BT8A 1JY2O 4B3SB 4MVSA 1WPBA 4RQFA 2EIMC 1SF9A 4J10A 1BSMA 2K1EA 3AE9C 3QTCA 2HVJC 1D7MA 5APQA 1Q86Q 3ABMC 5KJ7A 2WPSA 2E43A 2YEVA 5IWAO 1GL2A 1G1JA 1OZHA 2AEMA 5KJ7C 2A06E 3JYCA 2X6AA 1VQ4P 2YEVB 1GL2B 4JI3B 1YHQP 4UB6H 3SYOA 1P84H 2ZFCA 2KP8A 1JCCA 1KP2A 5B1BB 4X88A 2FMLA 1SP4A 4FM2A 4DR2O 3ZHRA 3W7UA 4B3RB 2IBZG 4X8AA 2J58A 5AVZB 1VQOV 5APYA 4NXNO 3IJ4A 2Z5HA 1WAZA 3ZN0A 3L36A 2GUZA 1P7GA 1BDDA 3FYIB 2ATKC 1SLQA 2GUZB 1FDMA 3CE2A 4WFFA 3OT7A 4FLVA 4D6TE 2IPPA 1BCCD 5B5EH 2BCCG 1QX8A 5KJ7D 3L72H 1GL2D 4JI4B 2JIZG 2H94A 4PD4H 1DGSA 5K5GB 1YI2P 2UUAO 4B3MB 4CZZA 3MZWB 4WFEA 4ZHQA 3OAAG 2M0BA 1SQQH 1L1FA 1PD3A 4CH6A 3L74G 4ZHQB 3ASNC 3H1KD 2GTAA 2O01J 1WA8A 1T6AA 4I6MC 1S9KE 3AEAC 1KQFB 5B1AC 3CCLP 1WA8B 3ZRXA 3VMZA 1PL5A 2WLIA 4O4JA 1EZVE 4AI8A 2GTSA 1XNQB 1N8RQ 1U57A 1PL0A 3FAVA 2WLIB 4O4JB 4LF4O 1XNRB 1NTZG 2N1TA 3CD6P 3S3XA 4WY4D 4ZKUA 1ZP0C 1K5QA 2XOKG 3CLQA 2N1TB 3FAVB 3RGBA 4JTAB 4GLXA 1HNXO 1TUEB 4DOJA 1LP1A 3SWYA 4I55A 1EC5A 3PRJA 1KYOH 5BU8B 4YIOA 5EBWC 1AJNA 3CCUP 1LP1B 3SYQA 1LTJA 4I55B 1XOUA 4J9YB 5JH7A 1PPJH 2QJPC 3M9BA 1AVOA 3T1CA 3MUDC 1BHBA 2FYUE 1LTJB 2YXRB 5JH7B 2UUBO 1NTKG 2AXTH 2CAZC 3EVKA 3A0HE 4JI5B 3C3TA 3L71D 4DUYB 1IK7A 4NR1A 3G6BA 2YI8A 3CX5E 3USSA 4H44B 3TK1A 4HH2A 1R1BA 5AW2B 2OYHC 2UUCO 3D36C 2KSEA 1ZR2A 4CC5A 2ZYAA 1N33O 2CE4A 3H6PA 1YQ4C 4GODA 1URQC 4MVZA 4DV0O 1IZNB 3AG7A 2NPSA 3HUSA 2FYUK 1F23A 1FZAA 1J5EB 2ITCC 4KHPB 1MUUA 2ZR2A 2NPSB 3HUSB 2N1TD 5E79H 3V4QA 1NWQA 4OPAA 4TOIA 1EDKA 2CGOA 2QJKB 5C39A 1LT9A 4YXWH 3SSUA 3H1HD 2RMZA 1SQQJ 4PA4A 4FVMA 4P9OA 3EHBB 1LT9B 1AI6A 3K03A 3K5LA 1NHLA 4DV1O 4I1LA 2HR3A 3VBBA 1P84I 2Q0AA 2KZIA 3A0RA 2ITDC 1F4NA 1HF9A 1YDXA 4H44D 1MA1A 5JCOA 4ZNCA 1L2PA 1BMFG 3BEHA 1VQ8V 1MZEA 4TV9A 3CRAA 4DW0A 3F89A 1S1CX 2WSFH 2O3JA 2JGDA 3E22A 5AVUB 1Q7YQ 4TV9B 1XTCC 4RAIA 3TETA 1RSOA 5DJUB 3E22B 1OW7A 4DV7B 5BY1A 3CWBE 1NYHA 1RSOB 3V4WA 2DYRB 3FKSG 3ITKA 4JI6O 2NPSD 3AG2B 4HBNA 4H0LD 2LW1A 2M5AB 2FXPA 1S72V 3FXDA 4W7YA 2OCHA 2GSMB 4CBCA 3E1RA 5AVVB 5AVSB 2XAQA 3ETEA 1UPGA 1HWYA 5KKZB 2Q5UA 4BR6A 1NTMH 4GIFA 1HGZA 1NI8A 4B3TB 4NPEA 4DV1B 3PTZA 1NH2B 4WFHA 2SPZA 3R65A 5KAFH 5CJ4A 3I56V 3P8MC 2LJ2A 1VF6A 2K9JA 4ASUG 3I5CA 1FD9A 2KB1A 2EILB 2K9JB 5DEDA 1FFTB 4L8JA 3H1LJ 1HBWA 4DR5O 3QO7A 4LC1A 3ZMVA 1WMKA 4FK5C 5KTBA 3CCJP 4AHCA 4GZRB 4LF9B 2Q3EA 2YKQA 5H2FH 4BIUA 4BXLA 4CPGA 2WLHA 2UXCO 3L72G 1N7LA 1JX9A 2D2CB 3OR6C 2PZSA 4JF3A 3ABTA 1XREA 2P67A 3T1YB 1T8ZA 2VS0A 3CMEV 4LFBO 2FYNC 1XILA 1E79H 1SQQG 1OCZB 1QU7A 5HFLA 1LGHB 4O4LA 4GKKO 2N74A 1YJWP 3K79A 2JP3A 1N86A 2R72A 2KOGA 2WVRA 2EINB 4Q20A 4O4LB 4UVBA 1Y47A 2RNBA 3L75D 4NPFX 2OCCC 4A7PA 2BOBC 1NH2D 1XHXA 1N7SA 4NXMB 1N4CA 4DR4O 2P58A 1N7SB 2M3EA 2WPDG 5E1AC 3CCQV 3DC6A 2ZT9C 1J95A 2YC0A 3H25A 1BCCE 3SPCA 4JZGA 1KORA 4U3FJ 4JI2B 1FXKA 1EDJA 4X65B 5D5QA 5CCHD 5LA6A 1FXKB 4NB5A 3Q3DA 5KLVJ 3CRRA 1US6A 1DEEG 1HR0B 5LA6B 3RK2B 4OPHA 2H8PC 1PPJG 2IYPA 4J7KA 1SZTA 1FJKA 1NTMJ 2HG5D 3C1LA 2D2CD 3H1KE 3W7WA 3L73J 2W27A 3RL0B 5FNVA 2UXDB 5LMUO 3K0GA 1XQ8A 2ZKOA 5FNVB 3RBXA 1PV3A 2KS1A 4JI3O 2HFEC 4MTXA 4DUZO 1NVOA 1CP9A 3IFMA 1VQNP 2KS1B 3APQA 2DQ0A 3DC5A 1LWUA 1S5LE 3TGUJ 1EDLA 3U0ZA 1OCOC 1HP8A 2WWWA 3HE4A 2EBOA 5EYPA 1LWUB 3H1IH 1N7SD 1BZKA 2QGNA 1FAFA 3AE4C 3HE4B 5EYPB 1Q6IA 3ML0A 4BW9A 4PA7A 2H88C 4YHHO 3H1JH 3PLNA 3BAAA 4ZI7A 4BWAA 3QNEA 2P2UA 2AXCA 4KL1A 1XTGB 4PDMA 4ZI7B 2YI9A 2YMYA 5IYCO 3L71E 2P90A 4YXWG 3VMAA 3A0BZ 1H38A 3RK2D 5GTHE 2A06H 1COWG 5LGTA 1N34B 4PV1B 2QSIA 3PP5A 2QJ1A 1NJIW 3JCUH 4FIPC 1D5NA 1AA0A 1FZFA 4QGPA 2ARHA 4JI0O 4RUFA 2JDIH 4YY3B 3UCSC 5J2UA 1VQ6P 1H2LA 3IC9A 4GX2A 5J2UB 4J9ZB 3O65A 4EB6A 1JOYA 1JCDA 2F93B 1OV9A 1PP9D 4EB6B 4I7ZC 4O4IA 1JJ2U 3OMAB 4OGQC 2WA3A 2Q7EA 3RYFA 4MVOA 3UO3A 5KHIA 2OYIA 4O4IB 2CPSA 5AW8B 1ENVA 3RYFB 2OYIB 1S77D 1SFCA 5KHKA 4PHZA 4QJFB 1GTOA 3LW5H 3U11A 1QVGU 2IZ1A 2OTKE 1SFCB 1JQ0A 4X66O 4D6TH 4FLYA 3BCCH 4WFBV 2A0LA 1NTMG 4JTDB 3SYPA 2PYJA 3UQ8A 3PH0A 1V55B 2GHYA 1VQMP 1AV1A 3VOUA 2WSCH 2ZDIC 1RPRA 3ETQA 4LWSA 3P30A 3EQ2A 3Q5RA 1M57C 1VEWA 1SA0B 1OFCX 2C2AA 4LWSB 1KILA 2I1JA 2WLLA 1EQ7A 4DR3B 2HHHB 1HTLC 1KILB 1JMKC 1YXBA 2WLLB 4IL6E 1EZVH 4I9WA 2FFDC 2O57A 2ILMA 2BEZF 4Z2WA 2PY5A 5IJ0A 3V2PA 1AP5A 3G71P 4JI8O 1E1RG 1VF5B 4TT3H 3Q2YA 4N21A 3CXHD 5KUKA 1WB8A 3J80N 1LTBC 1PNLA 1SFCD 1E79G 1J5EO 4TV8A 5A9GA 2KNCA 2O1JA 1T2KC 1GAXA 1SQPD 4JV5B 4HB1A 4TV8B 1THZA 3A2FA 2KNCB 1QLEB 5K1XA 3A0HH 2XKMA 2HKOA 4I2LC 3I55V 1RY3A 1VF7A 2H3OA 5B3SB 3CX5H 2AEJA 1LNQA 3CCSP 3AG1B 3CPWO 1KQSO 1OCRC 4U7NA 2DQ3A 1MABG 3BVHA 4I0XA 5JVDA 2VQFB 3KDPB 3VTPC 2IW5A 4MTGA 1QVFU 1L0LD 2XAGA 1KILD 2E74C 4EDFA 3SPIA 1FE6A 4I0XB 5JVDB 2HJDA 3LNNA 4LCUC 3LW5J 2VQEB 1H8EG 3L4FA 3SJCC 1L4AA 3CXHF 1SQBD 1SQXD 1DIPA 4D6TJ 4LF8B 1E5WA 2QIWA 1ZSPA 1L4AB 1AJYA 1VF5D 3B8EB 4IFFA 2XAFA 2EIJC 4KUMA 3L75E 4JASA 2RDCA 2LP7A 4YXDC 3B09A 2IX7C 5IY5B 1MSWD 1R73A 3ABLB 3E8GA 5C8YA 1K8AQ 1IO4A 3SDLA 3EFFK 1MSDA 1H8AA 1KB9I 3GHGC 4JI7B 2JEXA 5C8YB 3LNMB 5TJHA 2M8RA 3K9SA 2E5LB 3MTUE 2P1JA 4C46A 1JY2P 4Q6GA 1ZRTD 2Y9ZA 4DW1A 3FB6C 4P9PA 2Y4UA 2P22C 4WFAV 3H1IG 1K9MQ 4L74A 3NXSA 3B5NA 3V2NA 1RE3C 2IFNA 1FYJA 1CXZB 2AZ0A 3OGCC 3H1JG 2JR8A 3J7AU 3B5NB 5BZBA 3OMIB 1KB9F 1K97A 2GDSA 5CCGA 2EIKB 2KK7A 4MS2A 4FFKA 2ZCEA 2YKOA 3BRCA 1QLNA 5JJEB 2XHBA 2A06G 4U3JA 1EDIA 1L4AD 2ZNIA 1FS0G 2YO2A 2FYUJ 2IU3A 4U3JB 3AEEC 3WFVA 1FU1A 4X20A 1IFDA 1JJOA 1VQ9V 4ZKIA 4H13B 4X20B 2JDIG 1M93A 3TJTA 2IFMA 5CBFA 3RYHA 4B7EA 1GTWA 2XNDH 1XMOB 2WT7A 3RYHB 2KYVA 2HPCA 4K8XA 2BTQB 2WT7B 2HPCB 1KECA 3DGEA 1QL1A 1I5YA 5KHJA 1M5IA 2DOSA 2GBOA 3GVMA 3JAWA 5APWA 3S4RA 2Y9YA 2Q7HA 3UT5A 3N2KA 2P4VA 3JAWB 1S5LX 1UJWB 1M1KQ 4BIOA 3A2AA 3G67A 4JYCA 3UT5B 3N2KB 4D6TG 4UVAA 1M90Q 3P3PA 4MW3A 3BCCG 1AI7A 5LGUA 3TGUE 4N78D 3L70D 1Q43A 2C9LY 4DYLA 4GKGA 1ZWIC 2IZ0A 3U1CA 5CB4A 1PP9E 3AEFC 5L3CA 2ZM6B 3KZIZ 5CB4B 1RE4A 3M8AA 2LQTA 1MKMA 1SC5B 1FC2C 2K37A 1Q86W 5A2QN 1HJ0A 2Q1KA 4Y99B 2PP6A 1PNMA 1EZVG 5FPOA 2CH7A 2QEXV 3CWBJ 2YKPA 1PZQA 4DR1O 2Q3IA 2ZJSE 2CH7B 1BCCH 2XAJA 3AG3B 4CS2A 2YSUB 4TT3G 4HJGH 2UXXA 1R3JC 1WB7A 5IJ9A 4G27B 4I5SA 4CH5A 2L5GB 1CW5A 1OXZA 1OCCB 5IJ9B 2Z4EA 2OTLP 1NU1D 3D3QA 1N32B 1BQZA 1GMGA 3VMXA 4FMTA 1U7MA 1N34O 1RM1B 4RUEA 2WLNA 3J81N 3HD7C 1YCIA 3TDKA 1BDCA 1S5LH 5GONA 5LP6A 3PN1A 4X9QA 4PDRA 3CCEV 1Q82W 4X62B 5GTIZ 1VMGA 3CXHE 2C0WA 4UXNA 5GONB 3OUSA 3M0DA 3M99B 3HKDA 3BHPA 4UFZA 5KUMA 5CA3A 3CC7P 3HKDB 3CCMP 4FFBA 1NQTA 2F66C 1SQPE 3U1AA 2EZOA 4D7TA 3RN4A 1SQVD 3MGNA 4FFBB 1FJGO 4A5UB 2E76B 3L71H 2ZXEB 3G4SV 1GU5A 1S4XA 1Y4MA 2O01H 3L37A 4IL6X 1N73A 5GTHH 2KB7P 3WG7B 3X2QC 1AFOA 4JAUA 3CYOA 5B66E 1N73B 1HWTC 4G2KA 1P49A 4C7UA 2IBZD 1FDIA 3K5BA 1KILE 2BTOA 1JY3P 1M56C 2KIKA 3HTKA 2OIEA 1Y76A 4GYCB 5BU5A 5TISZ 1SQPK 1SQBE 3HTKB 1SQXE 2E75C 1Y76B 3ZX6A 3EXAA 1KB9E 4M3LA 1K3EA 1BCCJ 2KKWA 1H89A 1LUVA 3BRVB 4ZMDA 3NFQA 4EYYQ 4O9BA 2L91A 2ZE6A 3W7SA 5AW9B 2NLJC 3HKCA 1ZW0A 2BCCD 1TGOA 4FLTA 1L0LK 1JMBA 3H1KJ 2QE7H 3CCVP 2Z3YA 3VQXA 3HKCB 3RGUA 2UXNA 2E76D 4WY4A 2Y0IA 3VP8A 4UCOA 1SQBK 1SQXK 1ZTEA 2DYSC 3IFXA 4WY4B 1K73Q 1N36O 2IJKA 4N23A 1DD3A 4NPDA 2XNDG 2Q6QA 4LFAB 2POHA 3K08A 3HB3B 2FL4A 4BAYA 1X0TA 1LJ2A 2VWKA 3FFQA 1NTZD 2B89A 2G38A 2G3AA 4C7NA 3OJAB 4DR6O 5LP6C 3ASOC 4C7NB 1W2BO 1XHZA 3OM3B 4DV4B 2OTJP 1IXMA 4UB8Z 2LR2A 3JATA 5LMNO 3L71J 4FM1A 2WTYA 4X64B 5KMGA 2B1IA 1HVVA 2VQFO 1T5EA 3JATB 4EI2A 4DV2B 1HH0A 5KMGB 1X9VA 5KLIB 1NTKD 1JEKA 1R8EA 4IGGA 2YICA 3KG2A 3WG7C 4OX9B 1Q81Q 2Y69B 1W2EA 4JAVA 3AK1A 1Q7YW 1IURA 5CA1A 4KT0J 1CPYA 3ETDA 1DH3A 1VQ5V 5CA1B 3E35A 2CTPA 1Y8AA 3IAOA 2OT5A 3MP7B 1IXBA 1B3QA 1PV0A 2YIDA 1GL2C 1HNWB 1K04A 2NZ2A 4RKUJ 4YJ2A 4ZIBA 3H1HJ 3JASA 1PIXA 3BY6A 4YJ2B 1B6QA 4GX0A 1BCCG 1HGVA 1QCEA 2RJZA 3JASB 5B1BC 3L70E 4N78E 5DJTB 3ZHVA 4F4LA 3ZDMA 3STZC 1OVUA 2QG4A 3DTUB 1AQ5A 2WPRA 1Y66A 3CB2A 2I1KA 2ZE5A 2WSEH 1YJNV 1EBOA 1W5CE 2AHYA 3E1IA 3OTOB 1XMQO 4H0LB 2B9ZA 1H88A 1NOHA 3H1LH 3SFEC 1GK9A 3M7MX 1EXIA 1D2DA 2F4VB 5B66Z 1TVKA 1J1EB 1VQLP 4W7ZA 5FL7G 3K59A 1KC8Q 4JZ2A 1XMOO 5CBNA 1TVKB 4HZ3A 1JY3O 4MW8A 2RN9A 3LDDA 1E1QG 1X79B 4DO2A 3A0BE 3UKMA 3L71G 5L8RJ 1RH5B 2L6LA 3RK3B 4DR7B 5KA5A 1QQCA 3P32A 2OYOA 3AE5C 2GA1A 4UVCA 1TAEA 4PDVA 3A8TA 3AE8C 1Y74A 3E8FA 3H01A 1IBMB 1VQ4V 1YHQV 2M5AA 1Y74B 5BR8O 4R8CA 2N1TC 2QA4P 2E5YA 4U3FH 2UWJE 3C8VA 1WLEA 5IYZA 2Q0OC 1NU1K 4PJ0E 1K33A 2UXBO 4JAAA 5KLVH 1IC2A 2YXYA 5IYZB 3F5HA 5CMZA 1SQVE 2DMXA 4IHJA 2KSJA 1LTJC 3R66A 4JI1O 1QGKB 3L73H 4I4TA 3K57A 1FZBA 3FXEA 4IHJB 4DV6B 1GU4A 3OR7C 1V54B 3L72D 4I4TB 2QE7G 1DD4A 1VARA 4H44C 4PD4D 3CC4P 3L75J 4FLXA 2IBZE 2WSEJ 4LF5B 3WUUA 3RK3D 3TXQA 4W4KA 4BIZA 1IBLO 3TGUH 1XL4A 2LGQA 3II6A 5CCHA 3OW2O 2HLDG 3S1KA 4DV5B 2ZE7A 1Q8IA 1SQVK 2K9YA 4PELA 1AJPA 1IK9A 5AW1B 4PA9A 4LP8A 2Q8VA 4AILC 1GH6A 1R6KA 2QM4A 3JD4A 4B08A 1PP9H 2BE3A 4LF6O 1I94O 1YI2V 4GKJB 2K88A 3HUSC 1RF1A 2IJIA 1NKZB 4LFCO 4HYTB 1WJZA 4P2ZA 1N32O 4X1IA 2QJKC 1RF1B 1P7BA 2BCCE 4X1IB 4P30A 1GW3A 1LT9C 4GDOA 4GX1A 1SKVA 4K35A 4PI2A 1H2KA 4JYAO 1K92A 1KYOD 2QM8A 1MMMA 4PD4F 3SYAA 4DV3B 3FGAD 1PPJD 4RESB 1NAFA 2Y0DA 1CI6A 1S0VA 1JPXA 2R5DA 3VQWA 2H8PD 5JCOC 3OTFA 1IBKO 5LHIA 1CI6B 2R5BA 1S76D 3CEIA 4K0KO 3ZHTA 2UU9O 1NTZE 3T1HB 1YITP 2KLVA 4B3SO 3UIAA 2DYRC 4TUYA 3AE1C 3AG2C 1YJ9V 1RF0A 2HFED 4MSWC 4LBEC 4TUYB 1L8DA 2Q69A 3KCXA 3BPZA 4K3AA 2WMMA 3I5DA 2OQQA 3ABUA 1FZGA 1G1XB 3I55P 1D5AA 5KKZC 3TSIA 2RQ6A 1HJBA 3CC2P 3CXHH 5KX5A 3QWOC 3IAYA 3IC7A 1NTKE 3A7OA 4N6JA 5H6QA 2XDJA 3SR2C 2RKLA 3AE2C 1XBLA 5KX5B 2FXMA 2HLOA 2FY8A 1KMIZ 5AW4B 1NTZK 1SQFA 3G9RA 2B88A 1OMIA 4O2AA 1RQVA 3JSNA 5L3DA 3MDSA 4O2AB 2KXPB 2ZXXA 3CP1A 1RPOA 2IM9A 1AJQA 2EJ7A 4PDLA 1M1JA 1VF6C 4B3RO 2EILC 1PP9J 1Y6XA 4XDJA 2QJYB 1U7JA 3RWRD 2KG7A 3QO8A 1M1JB 2E5TA 2Y4TA 1YBKA 1NTKK 3H1LG 2GUVA 2KG7B 3GWKC 1YSCA 1USEA 2XNXA 1BS3A 2Z5UA 2HG5C 5IE9A 2D2CC 1S5JA 2Q67A 3Q4HA 3K06A 2XUMA 3RT3C 3G3ZA 1SQBH 3GLMA 1SQXH 2YXLA 4F6EA 2D3OW 2A45I 1KB9H 4BRYB 3Q4HB 2QTOA 2ZIMA 1OCZC 2CUGA 3OMNB 2P6JA 2EINC 1I08A 1J1DB 4JI4O 2HEPA 5IDJA 1JY2N 4B3MO 4PJ0Z 5JQGA 5LOVA 3BASA 4IFMA 1N7SC 4UV9A 1YIJV 5JQGB 1R6NA 5LOVB 4X64O 3H1HE 1RFYA 2Q4PA 2DWEC 4ZKPA 4DV2O 4U3FG 4Y28J 3GWOA 1FJPA 1AR4A 1FXKC 3HPLC 4R7CA 1XNQO 5KLVG 4J42A 3RK2C 1XNRO 5APXA 2B1GA 4UB6E 2QTSA 3W7TA 3V5BA 3RL0C 3CMAP 3L73G 4GX5A 2AEFA 1SQPJ 1SA0A 3WUTA 2EZPA 1GM8A 5FLXN 1K8AW 1QHTA 4GT1A 4U7JA 3T2MA 1FOSF 5AVTB 1U97A 3VN0A 2ZVOB 1JTHA 3TGUG 1YVWA 3ZEDA 4JI5O 1DLBA 1LWUC 3ZRSA 4DUYO 2KUBA 1JTHB 5IWAB 4MTFA 4UCRA 3CCJV 4YTPC 3K9AA 1MZ9A 3JD2A 5EBMC 1L0LJ 5KAIZ 2QRXA 4L76A 1K9MW 3A3YB 2XASA 1TA8A 1QVGO 1PP9G 2PI4A 2KLUA 5L3EA 4FJCC 3KZIE 1SQBJ 1SQXJ 1KFNA 2ITAA 3OUFA 2FKWB 5B5EE 1AP6A 3WU2Z 1YJWV 2VWJA 2JEEA 2ZXWB 3L72E 3QH9A 4EIJA 5JJJB 2QWQB 4J11A 3R4YA 4PD4E 4LR3A 4DR2B 4PV1C 4KHPO 2X0LA 2ZIOA 2BOCC 4E4EA 2Q73A 3AK2A 2ADPA 2FYUH 2E74D 1XI1A 4ZOLA 4E2LA 4W4LA 3CPWU 4KHXA 3RK3E 4NXNB 2CDYA 1FPOA 3V2RA 2H7HA 3CXHI 3HE5A 4ZOLB 3W67A 3OEEG 1LTTC 1JA8A 3L70H 2WPVB 4AUWA 1GKFA 1MFTA 3HE5B 2P06A 3E7KA 1WN7A 1BSHA 5C93A 2IU0A 1NJIQ 1AROP 5DN6G 4KXRA 3MHVA 1A02F 4J80A 1ZOYC 4DR7O 1EZJA 2CK3H 2UUAB 1FZEA 3H1ID 2OYIC 1G1IA 4B86A 3JD3A 4DV7O 2CGNA 2ZE8A 2V7QH 1PPJE 4GCZA 5EIBD 1M1KW 2ZYGA 2QSAA 4MVQA 1SFCC 3H1JD 4O4HA 5GTIE 4LGDE 1GZLA 4RO0A 1M90W 3RYCA 1H8HG 2AXTE 4O4HB 3QF7A 1V55C 4GUNA 3RYCB 5ITZA 4ASWA 1OW6A 2A06D 2XTAA 4DRXB 1WNSA 3B8MA 1Q5OA 5ITZB 4LF4B 1NVPD 3AE7C 2JEUA 4LNUA 2G8YA 2OIGA 1VQKV 3A0BH 2YUAA 1CSBA 1OX3A 3M0AA 1HNXB 1NKDA 2A3QA 4LNUB 1PGPA 4B3TO 1KILC 2WLMA 3NMDA 4HYOA 4BRYA 4XDLA 2WPQA 3ZMZA 1AR5A 1VQ7P 3AG4B 3CWBH 1BGYD 2X6BA 2UUBB 4HKZH 5EFWB 2NNUA 4FPPA 1QR9A 2YIUB 1VF5C 5TISE 1FXHA 1G2CA 1SQXG 1V9PA 1B04A 1G2CB 1OIPA 3ABKB 5KHHA 2UUCB 1VQ6V 3L70J 1SQVH 4PI0A 5EC2C 4EFEA 2BEQD 3TF5A 2JS5A 1N33B 4LF9O 1IZ3A 1QLEC 1MFZA 1SS3A 2PFXA 1JY3N 4DV0B 2PI5A 1O9GA 1IVSA 3T1YO 3BCCD 5LHHA 2JJ1G 2BTQA 1R3LC 2W0XA 3RVYA 3SJBC 5B3SC 2Q5ZA 3AG1C 3EWKA 3O8ZA 4NYKA 4UB6Z 1WPXA 2GM4A 3BA9A 2ADQB 3LDCA 4JPZB 1VQOP 5LL6Y 4NXMO 2V7QJ 2Y0EA 4FLUA 2QKAA 3N27A 3DXRA 1Q90D
chains in the Genus database with same CATH topology
1HW7A 2VWKA 3K58A 3FFQA 4K8ZA 1Y9BA 2G3AA 4PV1D 3HKEA 5LP6C 3T97B 4L8JA 2QJYC 3AECC 1XHZA 4DV4B 3HKEB 1WMKA 3JATA 4CH3A 4FM1A 1ZAUA 4X64B 3THOA 5KMGA 4R4MA 4AHCA 1T5EA 1FFXA 3JATB 4LF9B 3AEBC 4DV2B 5KMGB 2D2CB 2PZSA 1FFXB 4JI6B 3T1YB 1Z5VA 3ZS8C 5EZYA 5LYJA 1R8EA 4OX9B 2FYNC 5EZYB 5LYJB 4O4LA 4KT0J 5CA1A 2JP3A 2R72A 3B71A 4O4LB 1KQGB 5CA1B 1XHXA 1N36B 5IJ0B 2WQYC 3IAOA 4NXMB 3GMAA 4RKUJ 1K04A 1HNWB 2NZ2A 4YJ2A 3D6YA 3SJAC 4ZIBA 1TU3F 3JASA 1PIXA 2ZT9C 4YJ2B 3H25A 3D70A 1KORA 2P5OA 4JI2B 2RJZA 3JASB 4TQFA 4X65B 4H13C 2PTMA 5D5QA 5LA6A 4WBNA 3Q3DA 4DR6B 1HR0B 2R70A 5LA6B 4WBNB 4DR5B 1JB0J 5LMNB 2FBWC 2D2CD 3CB2A 3HKBA 5FNVA 4IIJA 1H2SB 2UXDB 2UXCB 1XQ8A 3HKBB 5FNVB 4IIJB 4DRXA 4X1KA 1PV3A 3OTOB 4X1YA 4H0LB 4X1KB 4LFBB 4X1YB 3SFEC 4GKKB 3D6ZA 3U0ZA 1VL2A 3M7MX 4R4LA 3ICXA 5EYPA 1NGMB 1EXIA 2WSCJ 3AE4C 5EYPB 2F4VB 1TVKA 4BW9A 1YEWA 3K59A 2H88C 4DR4B 3BAAA 4ZI7A 1TVKB 4BWAA 2PYLA 1I7FA 4KL1A 4ZI7B 2YI9A 5M1BA 5L8RJ 4DR7B 5EIBC 1QQCA 1N34B 3AE5C 4LH6A 2QSIA 4PV1B 1TAEA 2QJ1A 3K5MA 3AE8C 3SFDC 1X4TA 1IBMB 1RQUA 2GV9A 5LMUB 4YY3B 5J2UA 4D7SA 3C8VA 2ZNJA 5IYZA 3JSLA 1XMQB 2OWOA 5J2UB 4DK0A 4EB6A 1YQ3C 5IYZB 4DUZB 2F93B 1ZRTE 4IHJA 4EB6B 4I7ZC 4O4IA 4YJ3A 4OGQC 4I4TA 1UIXA 3K57A 1M4UA 3BA8A 3CHXA 4IHJB 2Q7EA 3RYFA 5KHIA 4DV6B 4O4IB 4YJ3B 4I4TB 1DD4A 3RYFB 4H44C 3AE6C 5KHKA 4PHZA 4FLXA 2WSEJ 4YHHB 3U11A 4LF5B 4TQDA 5J2TA 4FLYA 2ZINA 3Q5SA 4O2BA 5J2TB 2PYJA 4DV5B 4O2BB 3UQ8A 2K9YA 1Q8IA 4AILC 2QM4A 3ETQA 4B08A 4UCVA 4F6RA 4GKJB 3Q5RA 3AEDC 1SA0B 3GF3A 1O9HA 4F6RB 4X1IA 1K05A 2QJKC 5BR8B 2E76C 4JI0B 4DR3B 2HHHB 1JMKC 3WB0A 4X1IB 2YMKA 4GDOA 1SKVA 4PI2A 3K5NA 3WB2A 4FLWA 2UXBB 2BEZF 4DV3B 2PY5A 4H13D 5IJ0A 3MAQA 3DSQA 3BABA 3FGAD 1FDOA 4JI1B 1VF5B 4TT3H 3Q2YA 1KTMA 2YIUC 1OW8A 3VQWA 2E75B 2MKVA 5JCOC 4CC6A 3OTFA 2YIBA 5BMVA 4TV8A 3WB1A 4JV5B 5BMVB 4TV8B 4EFBA 3A2FA 5LXTA 4X66B 2PUSA 3T1HB 5K1XA 1IBLB 2PGGA 2Q7GA 5LXTB 4TUYA 3AE1C 1VF7A 4TUYB 3IN6A 1L8DA 3BPZA 2OQQA 4LF6B 1I94B 5FPRA 5JVDA 2VQFB 1D5AA 5KKZC 2E74C 2RQ6A 4LFCB 4CS4A 4I50A 5JVDB 5KX5A 3IAYA 3LNNA 3QG5A 3LW5J 1G6UA 2VQEB 3SR2C 4I50B 3SJCC 3AE2C 4UCTA 5KX5B 1KMIZ 3JALA 3VQVA 1DIPA 4LF8B 2QIWA 1SQFA 4JYAB 3G9RA 1OMIA 4O2AA 1AJYA 3JALB 1RQVA 1VF5D 3JSNA 2P10A 3U10A 4O2AB 2E75D 4JI8B 4DK1A 4YXDC 5KHGA 2IM9A 3RFRA 5LP6B 5C8YA 2YIAA 2YIBD 3RWRD 4JI7B 1IBKB 5C8YB 3GF7A 3CSXA 4K0KB 2E5LB 3D71A 1SQGA 2UU9B 4Q6GA 2EX3A 2P22C 4FM0A 4B3SB 1S5JA 2D2CC 5KLIC 1WPBA 3GLMA 2YXLA 5D5PA 3S9OA 4UCUA 3AE9C 2ZIMA 3QTCA 3SGIA 5JJNB 2ZCEA 2HEPA 3BRCA 5JJEB 2XHBA 4U3JA 2F95B 2ZNIA 4EEQA 5JQGA 4JI3B 5LOVA 4U3JB 3AEEC 5JQGB 4X20A 5LOVB 2ZT9B 1JJOA 4H13B 4X20B 4Y28J 1M93A 4FM2A 3RYHA 4FLZA 4B3RB 1XMOB 3RYHB 4K8XA 1Q3EA 2BTQB 5KHJA 1M5IA 2V4DA 3JAWA 5K1PA 1SA0A 2Q7HA 3UT5A 3N2KA 3JAWB 1S5LX 4H0LC 1QHTA 4U7JA 3UT5B 3N2KB 3JARA 4FLVA 3ZEDA 3JARB 4JI4B 1Q43A 5IWAB 1DGSA 4UCRA 4YTPC 4B3MB 2ZT9D 1TA8A 4ZHQA 1TUBA 5CB4A 4CH6A 3AEFC 3O6QA 4ZHQB 1TUBB 2ZM6B 5CB4B 2O01J 2E3CA 4CH4A 1MKMA 3AEAC 1KQFB 2VWJA 1HJ0A 5JJJB 3R4YA 4LR3A 4DR2B 1PL5A 4O4JA 5FPOA 4XFJA 4PV1C 2ZIOA 1XNQB 1U57A 2E74D 1XI1A 4ZOLA 1XNRB 4O4JB 3RK3E 4NXNB 1ZP0C 4ZOLB 3RGBA 4CS2A 2WPVB 4GLXA 1GMJA 2WSFJ 5IJ9A 4I55A 4Z1MH 1WN7A 2J5UA 4CH5A 4I9QA 4HNAA 5IJ9B 4I55B 5JH7A 2QJPC 3AEGC 4HNAB 4UCSA 4I7ZB 5JH7B 2IDBA 1N32B 4OGQB 3K5OA 2CAZC 4JI5B 4DUYB 1IK7A 3RL0g 1ZOYC 3RYIA 2YI8A 4LH7A 2UUAB 4H44B 3B2EE 1ZMEC 3RYIB 4CC5A 5EIBD 5GONA 5LP6A 3PN1A 1YQ4C 4O4HA 4X62B 3ABVC 3RYCA 1NT2B 5GONB 4O4HB 3AE3C 3HKDA 3BHPA 3QF7A 4UFZA 4NVPA 5ITZA 3RYCB 1OW6A 1J5EB 4KHPB 3Q1MA 2JO1A 3HKDB 2H89C 4FFBA 2F66C 1WNSA 4DRXB 1Q5OA 5ITZB 4DR1B 4LF4B 3VQYA 4D7TA 3AE7C 4TOIA 1Q90D 4FFBB 1HNZB 4LNUA 2G8YA 2E76B 1KU9A 1HNXB 4IL6X 4LNUB 3Q5PA 4FVMA 1JFFA 3N2GA 3K5LA 1P49A 4OGQD 2JGUA 1JFFB 2Q0AA 3N2GB 1FDIA 1KILE 2BTOA 2UUBB 1HF9A 4H44D 5JCOA 4CS3A 4GYCB 1Z5WA 1VF5C 4TV9A 4AQYB 1V9PA 1S1CX 2E75C 3E22A 1B04A 4TV9B 2KKWA 5KHHA 2UUCB 1RSOA 3E22B 1OW7A 4PI0A 4EFEA 4DV7B 2BEQD 2JS5A 4LF7B 1N33B 1NYHA 2JVDA 4DV0B 1O9GA 3HKCA 4HBNA 4H0LD 1TGOA 4FLTA 2BTQA 2R9AA 2FXPA 3SJBC 3VQXA 3HKCB 5CA0A 3EWKA 3JAKA 2E76D 4UCOA 5CA0B 3BA9A 2E74B 3JAKB 1FJGB 1DD3A 4B3TB 2F1MA 2V7QJ 4FLUA 4LFAB 4DV1B 2OYQA 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMI Z; 
#chains in the Genus database with same CATH topology
 1L4A C;  1VQM V;  3DXR B;  3OGI B;  4JI2 O;  4X65 O;  3LUT B;  4BW5 A;  1FOS E;  5IY5 C;  3HKE A;  3ABL C;  3FX7 A;  1NU1 J;  1HR0 O;  3D3I A;  5H5N A;  3AEC C;  4UB8 E;  1AI5 A;  3HKE B;  4CH3 A;  3BFR A;  2A79 B;  3HRN A;  3THO A;  2CTR A;  5AG2 A;  4R4M A;  5KAF E;  1T3U A;  2UXD O;  1ZX3 A;  4UUJ C;  3AEB C;  2WLJ A;  5B5E Z;  1I5X A;  1HDJ A;  4H33 A;  1W0K G;  1Z5V A;  2EIM B;  4JI6 B;  2C9N Y;  3GB7 C;  1L0N D;  3CRC A;  1JMM A;  3FB5 C;  5APS A;  3CX5 D;  3B5N C;  1KKC A;  5CMU A;  2YO3 A;  4DJG A;  3ABM B;  2N05 A;  2EIK C;  3KYQ A;  1KQG B;  4JPR A;  5CCG C;  2MJZ A;  5CBO A;  4L75 A;  2IYO A;  2QDO A;  1SQV J;  3GMA A;  3SWK A;  1VPC A;  1BE3 D;  2K3R A;  2JJL A;  3B40 A;  3H1K H;  3D6Y A;  2FYU G;  1TU3 F;  1VQ5 P;  1PFI A;  3D70 A;  4H37 A;  1URF A;  3CCS V;  4H13 C;  4TQF A;  3O9O A;  5B1O A;  3L70 G;  5AW6 B;  1NTK H;  4NTY A;  4DXW A;  1KN7 A;  1K73 W;  3FB8 C;  3ZMU A;  4WBN A;  2O1K A;  2NPS C;  2Y0C A;  3QO5 A;  4JBZ A;  1R3K C;  2R70 A;  4WBN B;  4DR5 B;  2DW3 A;  1GN6 A;  1UII A;  3CX5 F;  3HKB A;  2W6B A;  2MK3 A;  4XDK A;  3PJS K;  1H2S B;  4JQ0 D;  1VQP V;  3JSV C;  5AW7 B;  2AXT Z;  1B06 A;  4YY3 O;  2UXC B;  1IJD B;  3HKB B;  1R5S A;  2CK3 G;  4X1K A;  4X1Y A;  3B8N A;  1SRY A;  4X1K B;  4LFB B;  3CL3 D;  4FZ1 A;  2V7Q G;  4X1Y B;  1M56 D;  5CJ0 A;  4GKK B;  4MVM A;  2BCC J;  2IH1 C;  3OD4 A;  1IDS A;  2WSS H;  1NGM B;  1JVM A;  2W8Z A;  4QPJ A;  2Q9I A;  3NR7 A;  4RJT A;  2FTK A;  4J7Z A;  3ZCC A;  3S3W A;  1PGJ A;  3F5W C;  4DR4 B;  1L0L E;  1N8R W;  1K4D C;  1Q81 W;  5AW5 B;  3ASN B;  5E79 Z;  5DM6 V;  2PYL A;  1I7F A;  5EBL C;  1AVY A;  4YPC A;  1NR7 A;  2KSD A;  1VP7 A;  5B1A B;  3KHU A;  1HUC A;  3T4D A;  3H1I E;  1RE4 C;  3OA7 A;  4Y99 C;  4IYI A;  2DW4 A;  5GW7 A;  2IBZ I;  1FKA O;  3SYC A;  1M8O B;  1NTZ J;  3CWB G;  3SFD C;  4ICG A;  4RWU A;  3H1J E;  1VQ8 P;  3H1H H;  5L3G A;  2IH3 C;  4IOI H;  2GV9 A;  2BSK A;  3AG3 C;  4DR3 O;  5LMU B;  2AZ2 A;  2HHH O;  1A32 A;  2BSK B;  2ZNJ A;  3C9I A;  3JSL A;  2R32 A;  3MUD A;  3E8H A;  5BVZ A;  1FS0 E;  2QJP B;  1OCC C;  2DJV A;  4DUZ B;  2P7J A;  1SQV G;  1NTK J;  1ZRT E;  1SS1 A;  3W7X A;  4L73 A;  3LSS A;  3L74 D;  1KZU B;  3JCU E;  2E42 A;  1R6T A;  4YJ3 A;  4QMA A;  1X59 A;  1S72 P;  1M4U A;  2OYH A;  3B77 A;  3D36 A;  3E89 A;  4YJ3 B;  4XA4 A;  4JF7 A;  1Z2G A;  2OYH B;  1RM1 C;  3OFN G;  1URQ A;  3E86 A;  4YHH B;  1BGY E;  1PKX A;  1W2B U;  3FD9 A;  4JV5 O;  2O01 N;  5APU A;  1K4C C;  1URQ B;  4L87 A;  4QE9 A;  1ZXG A;  2WA4 A;  3KPE A;  4IL6 H;  3K3W A;  3I56 P;  3ZRV A;  2B87 A;  2R9R B;  5B1N A;  3M0D C;  1QR8 A;  1KD1 Q;  4UCV A;  4F6R A;  3C90 A;  2B87 B;  1ZN5 A;  1X8Y A;  1KC8 W;  3CI9 A;  2CTW A;  5KAF Z;  3KZI H;  3LID A;  1ZUQ A;  1Q82 Q;  1DK1 A;  4F6R B;  1FXV A;  3BRT B;  1K05 A;  3FB7 C;  2E76 C;  3BCC E;  4JI0 B;  1YTZ T;  2VQE O;  1K5S A;  3WB0 A;  4PA6 A;  2WIT A;  4GOE A;  4LF8 O;  1U96 A;  3K5N A;  1S2E A;  1N73 C;  3F7Y C;  4OXS A;  3WB2 A;  4FLW A;  1KP3 A;  2W6I G;  3RVZ A;  3MAQ A;  3SPH A;  3DSQ A;  3BAB A;  5BXZ A;  1PL4 A;  2H43 A;  3CME P;  5EK0 A;  5H2F Z;  1LT1 A;  2B5U A;  1KTM A;  4WB4 A;  1H2G A;  3RW0 A;  4OVN F;  1IFI A;  2MKV A;  2ZD9 A;  2RMK B;  4JYB A;  4JI7 O;  5APT A;  1JOC A;  2YIB A;  1URQ D;  2HJF C;  1GN4 A;  3EFG A;  1LR1 A;  2E5L O;  4B7K A;  4JYY A;  4X66 B;  2PUS A;  3R2P A;  4R50 A;  1GO3 F;  1AB3 A;  2OTL V;  3CCQ P;  4KJM A;  1AR1 B;  2W6J H;  3H1K G;  3H9V A;  3L75 H;  1N2D C;  5FPR A;  5GTI H;  3G6E V;  1YJ9 P;  4I50 A;  3LDE A;  4WY4 C;  2QM7 A;  2NN4 A;  1GM9 A;  4WCE V;  2QVA A;  3KXD A;  4I50 B;  1L0N E;  3JAL A;  5AW0 B;  3L35 A;  4QNH B;  4QIW F;  4OWF A;  3JAL B;  3JAM N;  2P10 A;  1PGO A;  3U10 A;  3ZRW A;  5L3B A;  1NS1 A;  4JI8 B;  3CC7 V;  2PGD A;  1H2M A;  3CCM V;  1KFM A;  3L9D A;  3ZRW B;  5KHG A;  1J2J B;  3RFR A;  3RBZ A;  2FYZ A;  3LSQ A;  1BE3 E;  1VIB A;  1SZX A;  2YIA A;  2YIB D;  3OE7 G;  4EOT A;  2XT9 A;  4AQR D;  3HR0 A;  5DEC A;  1NU1 E;  3GF7 A;  2XU6 A;  3CSX A;  1CZQ A;  5J9P C;  3D71 A;  3L72 J;  1P84 D;  1L0N K;  2L35 A;  3C3S A;  3FYE B;  4DCK A;  1JO5 A;  2WSS G;  2EX3 A;  5TIS H;  5CBG A;  4FM0 A;  1JUN A;  5KLI C;  2DN9 A;  2P4K A;  3V2Q A;  1KUQ A;  5D5P A;  2FYN B;  3S9O A;  3SPG A;  4UCU A;  4DT0 A;  3SGI A;  2Y69 C;  5JJN B;  3VYI A;  5H6R A;  2W6A A;  3GW6 A;  3BVO A;  3WMM 0;  2OCC B;  1JR9 A;  5APV A;  1X22 A;  4UV8 A;  4R6Z A;  4WF9 V;  4ABM A;  2F95 B;  4EEQ A;  2A45 H;  1GN2 A;  1XEQ A;  1IFJ A;  1EN6 A;  2ZAE B;  2N04 A;  1FBM A;  1CEZ A;  2ZT9 B;  1Y67 A;  3ZMS A;  3CCV V;  1ZL8 A;  2JGD B;  2QR4 A;  3JCU Z;  2ZM6 O;  3H1H G;  3STL C;  1NR1 A;  1SES A;  2ZR3 A;  1P84 F;  1ZL8 B;  1K34 A;  2LO1 A;  4FLZ A;  3OW2 U;  1YIJ P;  5IYB O;  1Q2N A;  1QL2 A;  2CPB A;  3T4Z A;  1OJH A;  1YZB A;  4WFG A;  1Q3E A;  3QVN A;  1SQQ D;  4IYH A;  4QE7 A;  3JCZ A;  2Z5I A;  1PGQ A;  1UFI A;  4PD4 I;  2V4D A;  4KFM A;  5K1P A;  3P7K A;  2R3S A;  5IT9 N;  4H0L C;  4UB8 H;  1IFN A;  1GRJ A;  3AEI A;  3JAR A;  1OCO B;  2HOD A;  4WVZ A;  2V1D A;  2V4H A;  2OTJ V;  2QKS A;  3JAR B;  4IT5 A;  1N0J A;  2HOD B;  1DX7 A;  2R44 A;  5KAI E;  1OHH G;  2ZT9 D;  5EC1 C;  1J1E C;  4JGS A;  3CCL V;  1SVF A;  1TUB A;  3O6Q A;  1AVM A;  2NR5 A;  3L74 E;  1TUB B;  2WLK A;  2Q9L A;  4X62 O;  2E3C A;  4CH4 A;  1KKD A;  3O6Q B;  3CD6 V;  3WU2 E;  1MG1 A;  3ZN1 A;  3RK3 C;  2ZVN B;  3AK3 A;  1KYO I;  2FKX A;  2DE0 X;  4XFJ A;  4MVU A;  1GK6 A;  1GM7 A;  5IYD O;  3CCU V;  4ZBM A;  1Q6U A;  1GMJ A;  2WSF J;  1USD A;  4BWN A;  4Z1M H;  2J5U A;  3ETG A;  3MHH C;  4I9Q A;  4HNA A;  1NO4 A;  1KYO F;  3AEG C;  1VDF A;  2EJR A;  4HNA B;  4UCS A;  5L3F A;  3FWN A;  4I7Z B;  2IDB A;  4OGQ B;  3K5O A;  3H1L D;  1T3J A;  3A0H Z;  4EKW A;  1DF4 A;  1EM1 A;  1QEX A;  3RL0 g;  2OGU A;  3RYI A;  4LH7 A;  1V54 C;  3F5T A;  1WRG A;  3B2E E;  3P3N A;  1S3J A;  2W6J G;  1SQP H;  1ZME C;  3H32 A;  3RYI B;  2M3B A;  1MOF A;  3L75 G;  3OEH G;  2IJJ A;  3CS5 A;  3H32 B;  2IJH A;  3K04 A;  3ABV C;  2JJ2 G;  2ETN A;  1NT2 B;  3MHS C;  2ZDI A;  1WP7 A;  3OAK A;  2W83 C;  4YIP A;  3AE3 C;  5B66 H;  2OAR A;  4NVP A;  2ZQM A;  2XZR A;  5CCH C;  1KV4 A;  4NTW A;  3N4X A;  4AYC A;  1JNM A;  3Q1M A;  2AW9 A;  1K7D A;  1L0L H;  2H89 C;  2JO1 A;  1M57 B;  4DR1 B;  3VQY A;  1VQL V;  5AW3 B;  4RQE A;  1HNZ B;  1KU9 A;  1AI4 A;  2FFD A;  3APO A;  4XE5 B;  1RF1 C;  4GOF A;  3Q5P A;  1LUW A;  1JFF A;  5H9C A;  2JRI A;  4U3F D;  3CXC U;  4LFA O;  2FFD B;  3N2G A;  2VRZ A;  1Z56 A;  1H0T A;  4OGQ D;  2JGU A;  1JFF B;  1SER A;  1H2N A;  1VQK P;  3N2G B;  4WWI A;  5KLV D;  3ZHQ A;  1H0T B;  2N9B A;  2QWN B;  2W0F C;  4IFD K;  3CRQ A;  4CS3 A;  1Z5W A;  1PNK A;  5KA6 A;  1NTM D;  4AQY B;  2YXQ B;  3L73 D;  1QNM A;  4DV4 O;  2QA4 V;  5LBQ A;  1GN3 A;  2C0X A;  2ZYD A;  3RL0 D;  4LF7 B;  2WZ7 A;  1OZ0 A;  2JVD A;  3TGU D;  2BAS A;  1M57 D;  1OWA A;  4W80 A;  2R9A A;  2A45 G;  1VQ9 P;  1F51 A;  4OX9 O;  3ZIA G;  3ZMT A;  1RP3 B;  1OCR B;  1A02 J;  5CA0 A;  1YTF B;  1RF0 C;  1BGY H;  3JAK A;  1P84 E;  5CA0 B;  2E74 B;  5CN0 A;  4TSF G;  3CC4 V;  3JAK B;  1NBM G;  1FJG B;  2LXC B;  2FXO A;  3M9Q A;  2F1M A;  1HNW O;  3TCU A;  5HFM A;  2B9B A;  4Z1V A;  2QWR B;  1ZLZ A;  1NAY A;  2OYQ A;  1EXJ A;  3ZBH A;  4OH8 B;  2EIJ B;  1HW7 A;  1Q6H A;  1ROP A;  3K58 A;  1IFP A;  3B4S A;  4K8Z A;  3T97 A;  2X7R B;  1Y9B A;  3GHG A;  1T2K D;  4JTC B;  4PV1 D;  2RCV A;  3T97 B;  4DZO A;  2QJY C;  3GHG B;  1FZC A;  1EN5 A;  3ZHS A;  1M1J C;  1M7L A;  1ZAU A;  1FZC B;  1F4M A;  3H1I J;  1FFX A;  2LXB A;  1RE3 A;  2FB5 A;  5F2V O;  2QWP B;  2GUS A;  2ODM A;  1FFX B;  1YTF D;  3OTO O;  3ZS8 C;  5EZY A;  2Q6A A;  5LYJ A;  1R3I C;  3H1J J;  1KQS U;  2YS8 A;  1SQQ E;  5EZY B;  5LYJ B;  1GW4 A;  2LKM A;  2R9I A;  2HVK C;  1EFR G;  3JC2 2;  1KQL A;  3G80 A;  2YNY A;  3B71 A;  4LLH A;  1QBZ A;  1NVP B;  1J1D C;  2NRG A;  2QEX P;  2KZJ A;  1N36 B;  1S5H C;  5IJ0 B;  3JD0 A;  2M6Y A;  1YTZ I;  2F4V O;  2WQY C;  1GDT A;  3K0D A;  1YIT V;  2N9Y B;  4MN4 C;  2JWA A;  1BQ0 A;  2M7W A;  1BSN A;  3SJA C;  1N0N A;  3P8C D;  1G4Y B;  1I0H A;  4HAM A;  1R5L A;  2P5O A;  1MV8 A;  1FAV A;  4XBF A;  2PTM A;  1SQQ K;  2YDE A;  1PM9 A;  4Z1M G;  1L0N H;  1BGY J;  1KYO E;  4DR6 B;  3CC2 V;  4MTO A;  5CHX A;  2Y0P A;  3MIW A;  1ORQ C;  1JB0 J;  4WBA A;  3IGA C;  4NKG B;  5LMN B;  1IBM O;  2FBW C;  3IR9 A;  5LGN A;  2HP8 A;  4IIJ A;  1VQN V;  3IF4 A;  2F43 G;  1XUQ A;  2KQX A;  2WAM A;  4IIJ B;  4DRX A;  1BE3 H;  3N7N A;  3CCE P;  1SQP G;  1IFM A;  2QWO B;  1NU1 H;  1QVF O;  1KB9 D;  2HYN A;  3BCC J;  1VQP P;  2XAH A;  3D6Z A;  1S5L Z;  1BL8 A;  1VL2 A;  4R4L A;  3ICX A;  4DV6 O;  2R3C A;  3SJQ C;  2LFR A;  5AVR B;  3GG2 A;  2WSC J;  4QPK A;  2AGA A;  4J41 A;  3LSU A;  3SPJ A;  4X89 A;  1YEW A;  4LF5 O;  1L0L G;  2PF4 E;  3G4S P;  5E79 E;  2LGW A;  1QLE D;  2K1A A;  3MD0 A;  3H1L E;  2X6C A;  3ZHU A;  2I8D A;  1FZC C;  5M1B A;  2MW2 B;  2A7W A;  1SQB G;  4DV5 O;  1KBH A;  5AVY B;  5EIB C;  2ZXW C;  4PJ0 H;  5GTH Z;  4FZ0 A;  4LH6 A;  3UO2 A;  2J59 M;  4PA3 A;  3K5M A;  4GKJ O;  3U59 A;  1X4T A;  3ZJZ A;  2YXH A;  1RQU A;  3NTN A;  4D6T D;  2Z0A A;  3TNU A;  3KKY A;  1DEB A;  4D7S A;  3TNU B;  1XMQ B;  2IBZ H;  2OWO A;  3A5T A;  4DK0 A;  1LTS C;  1YQ3 C;  2W90 A;  2CTQ A;  4DV3 O;  1WP8 A;  1L0N J;  3M06 A;  1ZR4 A;  1UIX A;  3HD7 A;  3BA8 A;  3CHX A;  1DF5 A;  2PRR A;  2EUL A;  1S9K D;  4U3F E;  3HD7 B;  1IX9 A;  1XDC A;  3CMA V;  3AE6 C;  1EZV D;  2JS3 A;  4NTX A;  2LFS A;  1BGY G;  5KLV E;  4TQD A;  5J2T A;  1XL6 A;  2ZIN A;  1G8M A;  4G28 B;  2AHZ A;  3T1H O;  4O2B A;  3VOP A;  3Q5S A;  1BE3 J;  5AVX B;  2QKC A;  2BCC H;  5J2T B;  1NTM E;  2DWD C;  3M91 A;  3L73 E;  4O2B B;  5LHG A;  5KAI H;  3B5N D;  1JCH A;  1EZV I;  3CJH A;  3FWL A;  1EN4 A;  4ASV A;  3CJH B;  3CRM A;  3L74 H;  3AED C;  2KI7 B;  1SET A;  1P4R A;  3UM7 A;  2FYU D;  2PAJ A;  1O9H A;  4MVR A;  3GF3 A;  3V6I A;  5CCG D;  3WU2 H;  5BR8 B;  2RN0 A;  3FX0 A;  3G71 V;  5KLV K;  3X2Q B;  1MZF A;  2YMK A;  2Q7C A;  3VMY A;  1W0J G;  3TXS A;  4IL6 Z;  2UXB B;  1DTO A;  1NTM K;  1YYC A;  3AG4 C;  3E8B A;  1NTZ H;  1NH4 A;  4H13 D;  1NKN A;  4TLF A;  1M56 B;  1FDO A;  3JD1 A;  4U7O A;  5H2F E;  1BHA A;  3HD7 D;  5AVW B;  1GK4 A;  4JI1 B;  1AIL A;  3KQG A;  2YIU C;  3M9H A;  1OW8 A;  4KP4 A;  1LTA C;  2E75 B;  3CX5 I;  5JWP A;  3SWF A;  4CC6 A;  1RHZ B;  4C7R A;  2JWD A;  5BMV A;  1GD2 E;  3WB1 A;  2VRS A;  1OVV A;  3ABK C;  4MT8 A;  5BMV B;  5LXT A;  4EFB A;  1M9N A;  2LW7 A;  1IBL B;  1HNZ O;  2PGG A;  2JK5 C;  2Q7G A;  3F7V C;  5LXT B;  2P7T C;  4N3Y B;  3IN6 A;  1WT6 A;  1ZV8 A;  4RO2 A;  1YF2 A;  4LF6 B;  1I94 B;  5CBH A;  2DYS B;  1ZLL A;  4LFC B;  4CS4 A;  1W59 A;  2RH0 A;  3CCR V;  5AVQ B;  3QG5 A;  3CCR P;  1G6U A;  2JKV A;  1L0N G;  4AQY O;  4UCT A;  2A9H A;  3VQV A;  1MNG A;  4JYA B;  1YJN P;  4TWK A;  2K9P A;  3G6E P;  3D8C A;  3VP9 A;  1KD1 W;  4LF7 O;  3CWB D;  2E75 D;  3TYY A;  4DK1 A;  1NZ6 A;  1LTG C;  3E83 A;  3PHL A;  3WUV A;  5LP6 B;  3ASO B;  3E2E A;  1BE3 G;  1OVR A;  3L74 J;  3P8C E;  3BAT A;  1IBK B;  1AQT A;  1LTI C;  2Q68 A;  1NU1 G;  1F7Y A;  2XV5 A;  1JM0 A;  4K0K B;  3W68 A;  2F23 A;  4J7J A;  1SQG A;  3LIE A;  2Y48 A;  3KCY A;  2UU9 B;  1VQ7 V;  1BT8 A;  1JY2 O;  4B3S B;  4MVS A;  1WPB A;  4RQF A;  2EIM C;  1SF9 A;  4J10 A;  1BSM A;  2K1E A;  3AE9 C;  3QTC A;  2HVJ C;  1D7M A;  5APQ A;  1Q86 Q;  3ABM C;  5KJ7 A;  2WPS A;  2E43 A;  2YEV A;  5IWA O;  1GL2 A;  1G1J A;  1OZH A;  2AEM A;  5KJ7 C;  2A06 E;  3JYC A;  2X6A A;  1VQ4 P;  2YEV B;  1GL2 B;  4JI3 B;  1YHQ P;  4UB6 H;  3SYO A;  1P84 H;  2ZFC A;  2KP8 A;  1JCC A;  1KP2 A;  5B1B B;  4X88 A;  2FML A;  1SP4 A;  4FM2 A;  4DR2 O;  3ZHR A;  3W7U A;  4B3R B;  2IBZ G;  4X8A A;  2J58 A;  5AVZ B;  1VQO V;  5APY A;  4NXN O;  3IJ4 A;  2Z5H A;  1WAZ A;  3ZN0 A;  3L36 A;  2GUZ A;  1P7G A;  1BDD A;  3FYI B;  2ATK C;  1SLQ A;  2GUZ B;  1FDM A;  3CE2 A;  4WFF A;  3OT7 A;  4FLV A;  4D6T E;  2IPP A;  1BCC D;  5B5E H;  2BCC G;  1QX8 A;  5KJ7 D;  3L72 H;  1GL2 D;  4JI4 B;  2JIZ G;  2H94 A;  4PD4 H;  1DGS A;  5K5G B;  1YI2 P;  2UUA O;  4B3M B;  4CZZ A;  3MZW B;  4WFE A;  4ZHQ A;  3OAA G;  2M0B A;  1SQQ H;  1L1F A;  1PD3 A;  4CH6 A;  3L74 G;  4ZHQ B;  3ASN C;  3H1K D;  2GTA A;  2O01 J;  1WA8 A;  1T6A A;  4I6M C;  1S9K E;  3AEA C;  1KQF B;  5B1A C;  3CCL P;  1WA8 B;  3ZRX A;  3VMZ A;  1PL5 A;  2WLI A;  4O4J A;  1EZV E;  4AI8 A;  2GTS A;  1XNQ B;  1N8R Q;  1U57 A;  1PL0 A;  3FAV A;  2WLI B;  4O4J B;  4LF4 O;  1XNR B;  1NTZ G;  2N1T A;  3CD6 P;  3S3X A;  4WY4 D;  4ZKU A;  1ZP0 C;  1K5Q A;  2XOK G;  3CLQ A;  2N1T B;  3FAV B;  3RGB A;  4JTA B;  4GLX A;  1HNX O;  1TUE B;  4DOJ A;  1LP1 A;  3SWY A;  4I55 A;  1EC5 A;  3PRJ A;  1KYO H;  5BU8 B;  4YIO A;  5EBW C;  1AJN A;  3CCU P;  1LP1 B;  3SYQ A;  1LTJ A;  4I55 B;  1XOU A;  4J9Y B;  5JH7 A;  1PPJ H;  2QJP C;  3M9B A;  1AVO A;  3T1C A;  3MUD C;  1BHB A;  2FYU E;  1LTJ B;  2YXR B;  5JH7 B;  2UUB O;  1NTK G;  2AXT H;  2CAZ C;  3EVK A;  3A0H E;  4JI5 B;  3C3T A;  3L71 D;  4DUY B;  1IK7 A;  4NR1 A;  3G6B A;  2YI8 A;  3CX5 E;  3USS A;  4H44 B;  3TK1 A;  4HH2 A;  1R1B A;  5AW2 B;  2OYH C;  2UUC O;  3D36 C;  2KSE A;  1ZR2 A;  4CC5 A;  2ZYA A;  1N33 O;  2CE4 A;  3H6P A;  1YQ4 C;  4GOD A;  1URQ C;  4MVZ A;  4DV0 O;  1IZN B;  3AG7 A;  2NPS A;  3HUS A;  2FYU K;  1F23 A;  1FZA A;  1J5E B;  2ITC C;  4KHP B;  1MUU A;  2ZR2 A;  2NPS B;  3HUS B;  2N1T D;  5E79 H;  3V4Q A;  1NWQ A;  4OPA A;  4TOI A;  1EDK A;  2CGO A;  2QJK B;  5C39 A;  1LT9 A;  4YXW H;  3SSU A;  3H1H D;  2RMZ A;  1SQQ J;  4PA4 A;  4FVM A;  4P9O A;  3EHB B;  1LT9 B;  1AI6 A;  3K03 A;  3K5L A;  1NHL A;  4DV1 O;  4I1L A;  2HR3 A;  3VBB A;  1P84 I;  2Q0A A;  2KZI A;  3A0R A;  2ITD C;  1F4N A;  1HF9 A;  1YDX A;  4H44 D;  1MA1 A;  5JCO A;  4ZNC A;  1L2P A;  1BMF G;  3BEH A;  1VQ8 V;  1MZE A;  4TV9 A;  3CRA A;  4DW0 A;  3F89 A;  1S1C X;  2WSF H;  2O3J A;  2JGD A;  3E22 A;  5AVU B;  1Q7Y Q;  4TV9 B;  1XTC C;  4RAI A;  3TET A;  1RSO A;  5DJU B;  3E22 B;  1OW7 A;  4DV7 B;  5BY1 A;  3CWB E;  1NYH A;  1RSO B;  3V4W A;  2DYR B;  3FKS G;  3ITK A;  4JI6 O;  2NPS D;  3AG2 B;  4HBN A;  4H0L D;  2LW1 A;  2M5A B;  2FXP A;  1S72 V;  3FXD A;  4W7Y A;  2OCH A;  2GSM B;  4CBC A;  3E1R A;  5AVV B;  5AVS B;  2XAQ A;  3ETE A;  1UPG A;  1HWY A;  5KKZ B;  2Q5U A;  4BR6 A;  1NTM H;  4GIF A;  1HGZ A;  1NI8 A;  4B3T B;  4NPE A;  4DV1 B;  3PTZ A;  1NH2 B;  4WFH A;  2SPZ A;  3R65 A;  5KAF H;  5CJ4 A;  3I56 V;  3P8M C;  2LJ2 A;  1VF6 A;  2K9J A;  4ASU G;  3I5C A;  1FD9 A;  2KB1 A;  2EIL B;  2K9J B;  5DED A;  1FFT B;  4L8J A;  3H1L J;  1HBW A;  4DR5 O;  3QO7 A;  4LC1 A;  3ZMV A;  1WMK A;  4FK5 C;  5KTB A;  3CCJ P;  4AHC A;  4GZR B;  4LF9 B;  2Q3E A;  2YKQ A;  5H2F H;  4BIU A;  4BXL A;  4CPG A;  2WLH A;  2UXC O;  3L72 G;  1N7L A;  1JX9 A;  2D2C B;  3OR6 C;  2PZS A;  4JF3 A;  3ABT A;  1XRE A;  2P67 A;  3T1Y B;  1T8Z A;  2VS0 A;  3CME V;  4LFB O;  2FYN C;  1XIL A;  1E79 H;  1SQQ G;  1OCZ B;  1QU7 A;  5HFL A;  1LGH B;  4O4L A;  4GKK O;  2N74 A;  1YJW P;  3K79 A;  2JP3 A;  1N86 A;  2R72 A;  2KOG A;  2WVR A;  2EIN B;  4Q20 A;  4O4L B;  4UVB A;  1Y47 A;  2RNB A;  3L75 D;  4NPF X;  2OCC C;  4A7P A;  2BOB C;  1NH2 D;  1XHX A;  1N7S A;  4NXM B;  1N4C A;  4DR4 O;  2P58 A;  1N7S B;  2M3E A;  2WPD G;  5E1A C;  3CCQ V;  3DC6 A;  2ZT9 C;  1J95 A;  2YC0 A;  3H25 A;  1BCC E;  3SPC A;  4JZG A;  1KOR A;  4U3F J;  4JI2 B;  1FXK A;  1EDJ A;  4X65 B;  5D5Q A;  5CCH D;  5LA6 A;  1FXK B;  4NB5 A;  3Q3D A;  5KLV J;  3CRR A;  1US6 A;  1DEE G;  1HR0 B;  5LA6 B;  3RK2 B;  4OPH A;  2H8P C;  1PPJ G;  2IYP A;  4J7K A;  1SZT A;  1FJK A;  1NTM J;  2HG5 D;  3C1L A;  2D2C D;  3H1K E;  3W7W A;  3L73 J;  2W27 A;  3RL0 B;  5FNV A;  2UXD B;  5LMU O;  3K0G A;  1XQ8 A;  2ZKO A;  5FNV B;  3RBX A;  1PV3 A;  2KS1 A;  4JI3 O;  2HFE C;  4MTX A;  4DUZ O;  1NVO A;  1CP9 A;  3IFM A;  1VQN P;  2KS1 B;  3APQ A;  2DQ0 A;  3DC5 A;  1LWU A;  1S5L E;  3TGU J;  1EDL A;  3U0Z A;  1OCO C;  1HP8 A;  2WWW A;  3HE4 A;  2EBO A;  5EYP A;  1LWU B;  3H1I H;  1N7S D;  1BZK A;  2QGN A;  1FAF A;  3AE4 C;  3HE4 B;  5EYP B;  1Q6I A;  3ML0 A;  4BW9 A;  4PA7 A;  2H88 C;  4YHH O;  3H1J H;  3PLN A;  3BAA A;  4ZI7 A;  4BWA A;  3QNE A;  2P2U A;  2AXC A;  4KL1 A;  1XTG B;  4PDM A;  4ZI7 B;  2YI9 A;  2YMY A;  5IYC O;  3L71 E;  2P90 A;  4YXW G;  3VMA A;  3A0B Z;  1H38 A;  3RK2 D;  5GTH E;  2A06 H;  1COW G;  5LGT A;  1N34 B;  4PV1 B;  2QSI A;  3PP5 A;  2QJ1 A;  1NJI W;  3JCU H;  4FIP C;  1D5N A;  1AA0 A;  1FZF A;  4QGP A;  2ARH A;  4JI0 O;  4RUF A;  2JDI H;  4YY3 B;  3UCS C;  5J2U A;  1VQ6 P;  1H2L A;  3IC9 A;  4GX2 A;  5J2U B;  4J9Z B;  3O65 A;  4EB6 A;  1JOY A;  1JCD A;  2F93 B;  1OV9 A;  1PP9 D;  4EB6 B;  4I7Z C;  4O4I A;  1JJ2 U;  3OMA B;  4OGQ C;  2WA3 A;  2Q7E A;  3RYF A;  4MVO A;  3UO3 A;  5KHI A;  2OYI A;  4O4I B;  2CPS A;  5AW8 B;  1ENV A;  3RYF B;  2OYI B;  1S77 D;  1SFC A;  5KHK A;  4PHZ A;  4QJF B;  1GTO A;  3LW5 H;  3U11 A;  1QVG U;  2IZ1 A;  2OTK E;  1SFC B;  1JQ0 A;  4X66 O;  4D6T H;  4FLY A;  3BCC H;  4WFB V;  2A0L A;  1NTM G;  4JTD B;  3SYP A;  2PYJ A;  3UQ8 A;  3PH0 A;  1V55 B;  2GHY A;  1VQM P;  1AV1 A;  3VOU A;  2WSC H;  2ZDI C;  1RPR A;  3ETQ A;  4LWS A;  3P30 A;  3EQ2 A;  3Q5R A;  1M57 C;  1VEW A;  1SA0 B;  1OFC X;  2C2A A;  4LWS B;  1KIL A;  2I1J A;  2WLL A;  1EQ7 A;  4DR3 B;  2HHH B;  1HTL C;  1KIL B;  1JMK C;  1YXB A;  2WLL B;  4IL6 E;  1EZV H;  4I9W A;  2FFD C;  2O57 A;  2ILM A;  2BEZ F;  4Z2W A;  2PY5 A;  5IJ0 A;  3V2P A;  1AP5 A;  3G71 P;  4JI8 O;  1E1R G;  1VF5 B;  4TT3 H;  3Q2Y A;  4N21 A;  3CXH D;  5KUK A;  1WB8 A;  3J80 N;  1LTB C;  1PNL A;  1SFC D;  1E79 G;  1J5E O;  4TV8 A;  5A9G A;  2KNC A;  2O1J A;  1T2K C;  1GAX A;  1SQP D;  4JV5 B;  4HB1 A;  4TV8 B;  1THZ A;  3A2F A;  2KNC B;  1QLE B;  5K1X A;  3A0H H;  2XKM A;  2HKO A;  4I2L C;  3I55 V;  1RY3 A;  1VF7 A;  2H3O A;  5B3S B;  3CX5 H;  2AEJ A;  1LNQ A;  3CCS P;  3AG1 B;  3CPW O;  1KQS O;  1OCR C;  4U7N A;  2DQ3 A;  1MAB G;  3BVH A;  4I0X A;  5JVD A;  2VQF B;  3KDP B;  3VTP C;  2IW5 A;  4MTG A;  1QVF U;  1L0L D;  2XAG A;  1KIL D;  2E74 C;  4EDF A;  3SPI A;  1FE6 A;  4I0X B;  5JVD B;  2HJD A;  3LNN A;  4LCU C;  3LW5 J;  2VQE B;  1H8E G;  3L4F A;  3SJC C;  1L4A A;  3CXH F;  1SQB D;  1SQX D;  1DIP A;  4D6T J;  4LF8 B;  1E5W A;  2QIW A;  1ZSP A;  1L4A B;  1AJY A;  1VF5 D;  3B8E B;  4IFF A;  2XAF A;  2EIJ C;  4KUM A;  3L75 E;  4JAS A;  2RDC A;  2LP7 A;  4YXD C;  3B09 A;  2IX7 C;  5IY5 B;  1MSW D;  1R73 A;  3ABL B;  3E8G A;  5C8Y A;  1K8A Q;  1IO4 A;  3SDL A;  3EFF K;  1MSD A;  1H8A A;  1KB9 I;  3GHG C;  4JI7 B;  2JEX A;  5C8Y B;  3LNM B;  5TJH A;  2M8R A;  3K9S A;  2E5L B;  3MTU E;  2P1J A;  4C46 A;  1JY2 P;  4Q6G A;  1ZRT D;  2Y9Z A;  4DW1 A;  3FB6 C;  4P9P A;  2Y4U A;  2P22 C;  4WFA V;  3H1I G;  1K9M Q;  4L74 A;  3NXS A;  3B5N A;  3V2N A;  1RE3 C;  2IFN A;  1FYJ A;  1CXZ B;  2AZ0 A;  3OGC C;  3H1J G;  2JR8 A;  3J7A U;  3B5N B;  5BZB A;  3OMI B;  1KB9 F;  1K97 A;  2GDS A;  5CCG A;  2EIK B;  2KK7 A;  4MS2 A;  4FFK A;  2ZCE A;  2YKO A;  3BRC A;  1QLN A;  5JJE B;  2XHB A;  2A06 G;  4U3J A;  1EDI A;  1L4A D;  2ZNI A;  1FS0 G;  2YO2 A;  2FYU J;  2IU3 A;  4U3J B;  3AEE C;  3WFV A;  1FU1 A;  4X20 A;  1IFD A;  1JJO A;  1VQ9 V;  4ZKI A;  4H13 B;  4X20 B;  2JDI G;  1M93 A;  3TJT A;  2IFM A;  5CBF A;  3RYH A;  4B7E A;  1GTW A;  2XND H;  1XMO B;  2WT7 A;  3RYH B;  2KYV A;  2HPC A;  4K8X A;  2BTQ B;  2WT7 B;  2HPC B;  1KEC A;  3DGE A;  1QL1 A;  1I5Y A;  5KHJ A;  1M5I A;  2DOS A;  2GBO A;  3GVM A;  3JAW A;  5APW A;  3S4R A;  2Y9Y A;  2Q7H A;  3UT5 A;  3N2K A;  2P4V A;  3JAW B;  1S5L X;  1UJW B;  1M1K Q;  4BIO A;  3A2A A;  3G67 A;  4JYC A;  3UT5 B;  3N2K B;  4D6T G;  4UVA A;  1M90 Q;  3P3P A;  4MW3 A;  3BCC G;  1AI7 A;  5LGU A;  3TGU E;  4N78 D;  3L70 D;  1Q43 A;  2C9L Y;  4DYL A;  4GKG A;  1ZWI C;  2IZ0 A;  3U1C A;  5CB4 A;  1PP9 E;  3AEF C;  5L3C A;  2ZM6 B;  3KZI Z;  5CB4 B;  1RE4 A;  3M8A A;  2LQT A;  1MKM A;  1SC5 B;  1FC2 C;  2K37 A;  1Q86 W;  5A2Q N;  1HJ0 A;  2Q1K A;  4Y99 B;  2PP6 A;  1PNM A;  1EZV G;  5FPO A;  2CH7 A;  2QEX V;  3CWB J;  2YKP A;  1PZQ A;  4DR1 O;  2Q3I A;  2ZJS E;  2CH7 B;  1BCC H;  2XAJ A;  3AG3 B;  4CS2 A;  2YSU B;  4TT3 G;  4HJG H;  2UXX A;  1R3J C;  1WB7 A;  5IJ9 A;  4G27 B;  4I5S A;  4CH5 A;  2L5G B;  1CW5 A;  1OXZ A;  1OCC B;  5IJ9 B;  2Z4E A;  2OTL P;  1NU1 D;  3D3Q A;  1N32 B;  1BQZ A;  1GMG A;  3VMX A;  4FMT A;  1U7M A;  1N34 O;  1RM1 B;  4RUE A;  2WLN A;  3J81 N;  3HD7 C;  1YCI A;  3TDK A;  1BDC A;  1S5L H;  5GON A;  5LP6 A;  3PN1 A;  4X9Q A;  4PDR A;  3CCE V;  1Q82 W;  4X62 B;  5GTI Z;  1VMG A;  3CXH E;  2C0W A;  4UXN A;  5GON B;  3OUS A;  3M0D A;  3M99 B;  3HKD A;  3BHP A;  4UFZ A;  5KUM A;  5CA3 A;  3CC7 P;  3HKD B;  3CCM P;  4FFB A;  1NQT A;  2F66 C;  1SQP E;  3U1A A;  2EZO A;  4D7T A;  3RN4 A;  1SQV D;  3MGN A;  4FFB B;  1FJG O;  4A5U B;  2E76 B;  3L71 H;  2ZXE B;  3G4S V;  1GU5 A;  1S4X A;  1Y4M A;  2O01 H;  3L37 A;  4IL6 X;  1N73 A;  5GTH H;  2KB7 P;  3WG7 B;  3X2Q C;  1AFO A;  4JAU A;  3CYO A;  5B66 E;  1N73 B;  1HWT C;  4G2K A;  1P49 A;  4C7U A;  2IBZ D;  1FDI A;  3K5B A;  1KIL E;  2BTO A;  1JY3 P;  1M56 C;  2KIK A;  3HTK A;  2OIE A;  1Y76 A;  4GYC B;  5BU5 A;  5TIS Z;  1SQP K;  1SQB E;  3HTK B;  1SQX E;  2E75 C;  1Y76 B;  3ZX6 A;  3EXA A;  1KB9 E;  4M3L A;  1K3E A;  1BCC J;  2KKW A;  1H89 A;  1LUV A;  3BRV B;  4ZMD A;  3NFQ A;  4EYY Q;  4O9B A;  2L91 A;  2ZE6 A;  3W7S A;  5AW9 B;  2NLJ C;  3HKC A;  1ZW0 A;  2BCC D;  1TGO A;  4FLT A;  1L0L K;  1JMB A;  3H1K J;  2QE7 H;  3CCV P;  2Z3Y A;  3VQX A;  3HKC B;  3RGU A;  2UXN A;  2E76 D;  4WY4 A;  2Y0I A;  3VP8 A;  4UCO A;  1SQB K;  1SQX K;  1ZTE A;  2DYS C;  3IFX A;  4WY4 B;  1K73 Q;  1N36 O;  2IJK A;  4N23 A;  1DD3 A;  4NPD A;  2XND G;  2Q6Q A;  4LFA B;  2POH A;  3K08 A;  3HB3 B;  2FL4 A;  4BAY A;  1X0T A;  1LJ2 A;  2VWK A;  3FFQ A;  1NTZ D;  2B89 A;  2G38 A;  2G3A A;  4C7N A;  3OJA B;  4DR6 O;  5LP6 C;  3ASO C;  4C7N B;  1W2B O;  1XHZ A;  3OM3 B;  4DV4 B;  2OTJ P;  1IXM A;  4UB8 Z;  2LR2 A;  3JAT A;  5LMN O;  3L71 J;  4FM1 A;  2WTY A;  4X64 B;  5KMG A;  2B1I A;  1HVV A;  2VQF O;  1T5E A;  3JAT B;  4EI2 A;  4DV2 B;  1HH0 A;  5KMG B;  1X9V A;  5KLI B;  1NTK D;  1JEK A;  1R8E A;  4IGG A;  2YIC A;  3KG2 A;  3WG7 C;  4OX9 B;  1Q81 Q;  2Y69 B;  1W2E A;  4JAV A;  3AK1 A;  1Q7Y W;  1IUR A;  5CA1 A;  4KT0 J;  1CPY A;  3ETD A;  1DH3 A;  1VQ5 V;  5CA1 B;  3E35 A;  2CTP A;  1Y8A A;  3IAO A;  2OT5 A;  3MP7 B;  1IXB A;  1B3Q A;  1PV0 A;  2YID A;  1GL2 C;  1HNW B;  1K04 A;  2NZ2 A;  4RKU J;  4YJ2 A;  4ZIB A;  3H1H J;  3JAS A;  1PIX A;  3BY6 A;  4YJ2 B;  1B6Q A;  4GX0 A;  1BCC G;  1HGV A;  1QCE A;  2RJZ A;  3JAS B;  5B1B C;  3L70 E;  4N78 E;  5DJT B;  3ZHV A;  4F4L A;  3ZDM A;  3STZ C;  1OVU A;  2QG4 A;  3DTU B;  1AQ5 A;  2WPR A;  1Y66 A;  3CB2 A;  2I1K A;  2ZE5 A;  2WSE H;  1YJN V;  1EBO A;  1W5C E;  2AHY A;  3E1I A;  3OTO B;  1XMQ O;  4H0L B;  2B9Z A;  1H88 A;  1NOH A;  3H1L H;  3SFE C;  1GK9 A;  3M7M X;  1EXI A;  1D2D A;  2F4V B;  5B66 Z;  1TVK A;  1J1E B;  1VQL P;  4W7Z A;  5FL7 G;  3K59 A;  1KC8 Q;  4JZ2 A;  1XMO O;  5CBN A;  1TVK B;  4HZ3 A;  1JY3 O;  4MW8 A;  2RN9 A;  3LDD A;  1E1Q G;  1X79 B;  4DO2 A;  3A0B E;  3UKM A;  3L71 G;  5L8R J;  1RH5 B;  2L6L A;  3RK3 B;  4DR7 B;  5KA5 A;  1QQC A;  3P32 A;  2OYO A;  3AE5 C;  2GA1 A;  4UVC A;  1TAE A;  4PDV A;  3A8T A;  3AE8 C;  1Y74 A;  3E8F A;  3H01 A;  1IBM B;  1VQ4 V;  1YHQ V;  2M5A A;  1Y74 B;  5BR8 O;  4R8C A;  2N1T C;  2QA4 P;  2E5Y A;  4U3F H;  2UWJ E;  3C8V A;  1WLE A;  5IYZ A;  2Q0O C;  1NU1 K;  4PJ0 E;  1K33 A;  2UXB O;  4JAA A;  5KLV H;  1IC2 A;  2YXY A;  5IYZ B;  3F5H A;  5CMZ A;  1SQV E;  2DMX A;  4IHJ A;  2KSJ A;  1LTJ C;  3R66 A;  4JI1 O;  1QGK B;  3L73 H;  4I4T A;  3K57 A;  1FZB A;  3FXE A;  4IHJ B;  4DV6 B;  1GU4 A;  3OR7 C;  1V54 B;  3L72 D;  4I4T B;  2QE7 G;  1DD4 A;  1VAR A;  4H44 C;  4PD4 D;  3CC4 P;  3L75 J;  4FLX A;  2IBZ E;  2WSE J;  4LF5 B;  3WUU A;  3RK3 D;  3TXQ A;  4W4K A;  4BIZ A;  1IBL O;  3TGU H;  1XL4 A;  2LGQ A;  3II6 A;  5CCH A;  3OW2 O;  2HLD G;  3S1K A;  4DV5 B;  2ZE7 A;  1Q8I A;  1SQV K;  2K9Y A;  4PEL A;  1AJP A;  1IK9 A;  5AW1 B;  4PA9 A;  4LP8 A;  2Q8V A;  4AIL C;  1GH6 A;  1R6K A;  2QM4 A;  3JD4 A;  4B08 A;  1PP9 H;  2BE3 A;  4LF6 O;  1I94 O;  1YI2 V;  4GKJ B;  2K88 A;  3HUS C;  1RF1 A;  2IJI A;  1NKZ B;  4LFC O;  4HYT B;  1WJZ A;  4P2Z A;  1N32 O;  4X1I A;  2QJK C;  1RF1 B;  1P7B A;  2BCC E;  4X1I B;  4P30 A;  1GW3 A;  1LT9 C;  4GDO A;  4GX1 A;  1SKV A;  4K35 A;  4PI2 A;  1H2K A;  4JYA O;  1K92 A;  1KYO D;  2QM8 A;  1MMM A;  4PD4 F;  3SYA A;  4DV3 B;  3FGA D;  1PPJ D;  4RES B;  1NAF A;  2Y0D A;  1CI6 A;  1S0V A;  1JPX A;  2R5D A;  3VQW A;  2H8P D;  5JCO C;  3OTF A;  1IBK O;  5LHI A;  1CI6 B;  2R5B A;  1S76 D;  3CEI A;  4K0K O;  3ZHT A;  2UU9 O;  1NTZ E;  3T1H B;  1YIT P;  2KLV A;  4B3S O;  3UIA A;  2DYR C;  4TUY A;  3AE1 C;  3AG2 C;  1YJ9 V;  1RF0 A;  2HFE D;  4MSW C;  4LBE C;  4TUY B;  1L8D A;  2Q69 A;  3KCX A;  3BPZ A;  4K3A A;  2WMM A;  3I5D A;  2OQQ A;  3ABU A;  1FZG A;  1G1X B;  3I55 P;  1D5A A;  5KKZ C;  3TSI A;  2RQ6 A;  1HJB A;  3CC2 P;  3CXH H;  5KX5 A;  3QWO C;  3IAY A;  3IC7 A;  1NTK E;  3A7O A;  4N6J A;  5H6Q A;  2XDJ A;  3SR2 C;  2RKL A;  3AE2 C;  1XBL A;  5KX5 B;  2FXM A;  2HLO A;  2FY8 A;  1KMI Z;  5AW4 B;  1NTZ K;  1SQF A;  3G9R A;  2B88 A;  1OMI A;  4O2A A;  1RQV A;  3JSN A;  5L3D A;  3MDS A;  4O2A B;  2KXP B;  2ZXX A;  3CP1 A;  1RPO A;  2IM9 A;  1AJQ A;  2EJ7 A;  4PDL A;  1M1J A;  1VF6 C;  4B3R O;  2EIL C;  1PP9 J;  1Y6X A;  4XDJ A;  2QJY B;  1U7J A;  3RWR D;  2KG7 A;  3QO8 A;  1M1J B;  2E5T A;  2Y4T A;  1YBK A;  1NTK K;  3H1L G;  2GUV A;  2KG7 B;  3GWK C;  1YSC A;  1USE A;  2XNX A;  1BS3 A;  2Z5U A;  2HG5 C;  5IE9 A;  2D2C C;  1S5J A;  2Q67 A;  3Q4H A;  3K06 A;  2XUM A;  3RT3 C;  3G3Z A;  1SQB H;  3GLM A;  1SQX H;  2YXL A;  4F6E A;  2D3O W;  2A45 I;  1KB9 H;  4BRY B;  3Q4H B;  2QTO A;  2ZIM A;  1OCZ C;  2CUG A;  3OMN B;  2P6J A;  2EIN C;  1I08 A;  1J1D B;  4JI4 O;  2HEP A;  5IDJ A;  1JY2 N;  4B3M O;  4PJ0 Z;  5JQG A;  5LOV A;  3BAS A;  4IFM A;  1N7S C;  4UV9 A;  1YIJ V;  5JQG B;  1R6N A;  5LOV B;  4X64 O;  3H1H E;  1RFY A;  2Q4P A;  2DWE C;  4ZKP A;  4DV2 O;  4U3F G;  4Y28 J;  3GWO A;  1FJP A;  1AR4 A;  1FXK C;  3HPL C;  4R7C A;  1XNQ O;  5KLV G;  4J42 A;  3RK2 C;  1XNR O;  5APX A;  2B1G A;  4UB6 E;  2QTS A;  3W7T A;  3V5B A;  3RL0 C;  3CMA P;  3L73 G;  4GX5 A;  2AEF A;  1SQP J;  1SA0 A;  3WUT A;  2EZP A;  1GM8 A;  5FLX N;  1K8A W;  1QHT A;  4GT1 A;  4U7J A;  3T2M A;  1FOS F;  5AVT B;  1U97 A;  3VN0 A;  2ZVO B;  1JTH A;  3TGU G;  1YVW A;  3ZED A;  4JI5 O;  1DLB A;  1LWU C;  3ZRS A;  4DUY O;  2KUB A;  1JTH B;  5IWA B;  4MTF A;  4UCR A;  3CCJ V;  4YTP C;  3K9A A;  1MZ9 A;  3JD2 A;  5EBM C;  1L0L J;  5KAI Z;  2QRX A;  4L76 A;  1K9M W;  3A3Y B;  2XAS A;  1TA8 A;  1QVG O;  1PP9 G;  2PI4 A;  2KLU A;  5L3E A;  4FJC C;  3KZI E;  1SQB J;  1SQX J;  1KFN A;  2ITA A;  3OUF A;  2FKW B;  5B5E E;  1AP6 A;  3WU2 Z;  1YJW V;  2VWJ A;  2JEE A;  2ZXW B;  3L72 E;  3QH9 A;  4EIJ A;  5JJJ B;  2QWQ B;  4J11 A;  3R4Y A;  4PD4 E;  4LR3 A;  4DR2 B;  4PV1 C;  4KHP O;  2X0L A;  2ZIO A;  2BOC C;  4E4E A;  2Q73 A;  3AK2 A;  2ADP A;  2FYU H;  2E74 D;  1XI1 A;  4ZOL A;  4E2L A;  4W4L A;  3CPW U;  4KHX A;  3RK3 E;  4NXN B;  2CDY A;  1FPO A;  3V2R A;  2H7H A;  3CXH I;  3HE5 A;  4ZOL B;  3W67 A;  3OEE G;  1LTT C;  1JA8 A;  3L70 H;  2WPV B;  4AUW A;  1GKF A;  1MFT A;  3HE5 B;  2P06 A;  3E7K A;  1WN7 A;  1BSH A;  5C93 A;  2IU0 A;  1NJI Q;  1ARO P;  5DN6 G;  4KXR A;  3MHV A;  1A02 F;  4J80 A;  1ZOY C;  4DR7 O;  1EZJ A;  2CK3 H;  2UUA B;  1FZE A;  3H1I D;  2OYI C;  1G1I A;  4B86 A;  3JD3 A;  4DV7 O;  2CGN A;  2ZE8 A;  2V7Q H;  1PPJ E;  4GCZ A;  5EIB D;  1M1K W;  2ZYG A;  2QSA A;  4MVQ A;  1SFC C;  3H1J D;  4O4H A;  5GTI E;  4LGD E;  1GZL A;  4RO0 A;  1M90 W;  3RYC A;  1H8H G;  2AXT E;  4O4H B;  3QF7 A;  1V55 C;  4GUN A;  3RYC B;  5ITZ A;  4ASW A;  1OW6 A;  2A06 D;  2XTA A;  4DRX B;  1WNS A;  3B8M A;  1Q5O A;  5ITZ B;  4LF4 B;  1NVP D;  3AE7 C;  2JEU A;  4LNU A;  2G8Y A;  2OIG A;  1VQK V;  3A0B H;  2YUA A;  1CSB A;  1OX3 A;  3M0A A;  1HNX B;  1NKD A;  2A3Q A;  4LNU B;  1PGP A;  4B3T O;  1KIL C;  2WLM A;  3NMD A;  4HYO A;  4BRY A;  4XDL A;  2WPQ A;  3ZMZ A;  1AR5 A;  1VQ7 P;  3AG4 B;  3CWB H;  1BGY D;  2X6B A;  2UUB B;  4HKZ H;  5EFW B;  2NNU A;  4FPP A;  1QR9 A;  2YIU B;  1VF5 C;  5TIS E;  1FXH A;  1G2C A;  1SQX G;  1V9P A;  1B04 A;  1G2C B;  1OIP A;  3ABK B;  5KHH A;  2UUC B;  1VQ6 V;  3L70 J;  1SQV H;  4PI0 A;  5EC2 C;  4EFE A;  2BEQ D;  3TF5 A;  2JS5 A;  1N33 B;  4LF9 O;  1IZ3 A;  1QLE C;  1MFZ A;  1SS3 A;  2PFX A;  1JY3 N;  4DV0 B;  2PI5 A;  1O9G A;  1IVS A;  3T1Y O;  3BCC D;  5LHH A;  2JJ1 G;  2BTQ A;  1R3L C;  2W0X A;  3RVY A;  3SJB C;  5B3S C;  2Q5Z A;  3AG1 C;  3EWK A;  3O8Z A;  4NYK A;  4UB6 Z;  1WPX A;  2GM4 A;  3BA9 A;  2ADQ B;  3LDC A;  4JPZ B;  1VQO P;  5LL6 Y;  4NXM O;  2V7Q J;  2Y0E A;  4FLU A;  2QKA A;  3N27 A;  3DXR A;  1Q90 D; 
#chains in the Genus database with same CATH homology
 1HW7 A;  2VWK A;  3K58 A;  3FFQ A;  4K8Z A;  1Y9B A;  2G3A A;  4PV1 D;  3HKE A;  5LP6 C;  3T97 B;  4L8J A;  2QJY C;  3AEC C;  1XHZ A;  4DV4 B;  3HKE B;  1WMK A;  3JAT A;  4CH3 A;  4FM1 A;  1ZAU A;  4X64 B;  3THO A;  5KMG A;  4R4M A;  4AHC A;  1T5E A;  1FFX A;  3JAT B;  4LF9 B;  3AEB C;  4DV2 B;  5KMG B;  2D2C B;  2PZS A;  1FFX B;  4JI6 B;  3T1Y B;  1Z5V A;  3ZS8 C;  5EZY A;  5LYJ A;  1R8E A;  4OX9 B;  2FYN C;  5EZY B;  5LYJ B;  4O4L A;  4KT0 J;  5CA1 A;  2JP3 A;  2R72 A;  3B71 A;  4O4L B;  1KQG B;  5CA1 B;  1XHX A;  1N36 B;  5IJ0 B;  2WQY C;  3IAO A;  4NXM B;  3GMA A;  4RKU J;  1K04 A;  1HNW B;  2NZ2 A;  4YJ2 A;  3D6Y A;  3SJA C;  4ZIB A;  1TU3 F;  3JAS A;  1PIX A;  2ZT9 C;  4YJ2 B;  3H25 A;  3D70 A;  1KOR A;  2P5O A;  4JI2 B;  2RJZ A;  3JAS B;  4TQF A;  4X65 B;  4H13 C;  2PTM A;  5D5Q A;  5LA6 A;  4WBN A;  3Q3D A;  4DR6 B;  1HR0 B;  2R70 A;  5LA6 B;  4WBN B;  4DR5 B;  1JB0 J;  5LMN B;  2FBW C;  2D2C D;  3CB2 A;  3HKB A;  5FNV A;  4IIJ A;  1H2S B;  2UXD B;  2UXC B;  1XQ8 A;  3HKB B;  5FNV B;  4IIJ B;  4DRX A;  4X1K A;  1PV3 A;  3OTO B;  4X1Y A;  4H0L B;  4X1K B;  4LFB B;  4X1Y B;  3SFE C;  4GKK B;  3D6Z A;  3U0Z A;  1VL2 A;  3M7M X;  4R4L A;  3ICX A;  5EYP A;  1NGM B;  1EXI A;  2WSC J;  3AE4 C;  5EYP B;  2F4V B;  1TVK A;  4BW9 A;  1YEW A;  3K59 A;  2H88 C;  4DR4 B;  3BAA A;  4ZI7 A;  1TVK B;  4BWA A;  2PYL A;  1I7F A;  4KL1 A;  4ZI7 B;  2YI9 A;  5M1B A;  5L8R J;  4DR7 B;  5EIB C;  1QQC A;  1N34 B;  3AE5 C;  4LH6 A;  2QSI A;  4PV1 B;  1TAE A;  2QJ1 A;  3K5M A;  3AE8 C;  3SFD C;  1X4T A;  1IBM B;  1RQU A;  2GV9 A;  5LMU B;  4YY3 B;  5J2U A;  4D7S A;  3C8V A;  2ZNJ A;  5IYZ A;  3JSL A;  1XMQ B;  2OWO A;  5J2U B;  4DK0 A;  4EB6 A;  1YQ3 C;  5IYZ B;  4DUZ B;  2F93 B;  1ZRT E;  4IHJ A;  4EB6 B;  4I7Z C;  4O4I A;  4YJ3 A;  4OGQ C;  4I4T A;  1UIX A;  3K57 A;  1M4U A;  3BA8 A;  3CHX A;  4IHJ B;  2Q7E A;  3RYF A;  5KHI A;  4DV6 B;  4O4I B;  4YJ3 B;  4I4T B;  1DD4 A;  3RYF B;  4H44 C;  3AE6 C;  5KHK A;  4PHZ A;  4FLX A;  2WSE J;  4YHH B;  3U11 A;  4LF5 B;  4TQD A;  5J2T A;  4FLY A;  2ZIN A;  3Q5S A;  4O2B A;  5J2T B;  2PYJ A;  4DV5 B;  4O2B B;  3UQ8 A;  2K9Y A;  1Q8I A;  4AIL C;  2QM4 A;  3ETQ A;  4B08 A;  4UCV A;  4F6R A;  4GKJ B;  3Q5R A;  3AED C;  1SA0 B;  3GF3 A;  1O9H A;  4F6R B;  4X1I A;  1K05 A;  2QJK C;  5BR8 B;  2E76 C;  4JI0 B;  4DR3 B;  2HHH B;  1JMK C;  3WB0 A;  4X1I B;  2YMK A;  4GDO A;  1SKV A;  4PI2 A;  3K5N A;  3WB2 A;  4FLW A;  2UXB B;  2BEZ F;  4DV3 B;  2PY5 A;  4H13 D;  5IJ0 A;  3MAQ A;  3DSQ A;  3BAB A;  3FGA D;  1FDO A;  4JI1 B;  1VF5 B;  4TT3 H;  3Q2Y A;  1KTM A;  2YIU C;  1OW8 A;  3VQW A;  2E75 B;  2MKV A;  5JCO C;  4CC6 A;  3OTF A;  2YIB A;  5BMV A;  4TV8 A;  3WB1 A;  4JV5 B;  5BMV B;  4TV8 B;  4EFB A;  3A2F A;  5LXT A;  4X66 B;  2PUS A;  3T1H B;  5K1X A;  1IBL B;  2PGG A;  2Q7G A;  5LXT B;  4TUY A;  3AE1 C;  1VF7 A;  4TUY B;  3IN6 A;  1L8D A;  3BPZ A;  2OQQ A;  4LF6 B;  1I94 B;  5FPR A;  5JVD A;  2VQF B;  1D5A A;  5KKZ C;  2E74 C;  2RQ6 A;  4LFC B;  4CS4 A;  4I50 A;  5JVD B;  5KX5 A;  3IAY A;  3LNN A;  3QG5 A;  3LW5 J;  1G6U A;  2VQE B;  3SR2 C;  4I50 B;  3SJC C;  3AE2 C;  4UCT A;  5KX5 B;  1KMI Z;  3JAL A;  3VQV A;  1DIP A;  4LF8 B;  2QIW A;  1SQF A;  4JYA B;  3G9R A;  1OMI A;  4O2A A;  1AJY A;  3JAL B;  1RQV A;  1VF5 D;  3JSN A;  2P10 A;  3U10 A;  4O2A B;  2E75 D;  4JI8 B;  4DK1 A;  4YXD C;  5KHG A;  2IM9 A;  3RFR A;  5LP6 B;  5C8Y A;  2YIA A;  2YIB D;  3RWR D;  4JI7 B;  1IBK B;  5C8Y B;  3GF7 A;  3CSX A;  4K0K B;  2E5L B;  3D71 A;  1SQG A;  2UU9 B;  4Q6G A;  2EX3 A;  2P22 C;  4FM0 A;  4B3S B;  1S5J A;  2D2C C;  5KLI C;  1WPB A;  3GLM A;  2YXL A;  5D5P A;  3S9O A;  4UCU A;  3AE9 C;  2ZIM A;  3QTC A;  3SGI A;  5JJN B;  2ZCE A;  2HEP A;  3BRC A;  5JJE B;  2XHB A;  4U3J A;  2F95 B;  2ZNI A;  4EEQ A;  5JQG A;  4JI3 B;  5LOV A;  4U3J B;  3AEE C;  5JQG B;  4X20 A;  5LOV B;  2ZT9 B;  1JJO A;  4H13 B;  4X20 B;  4Y28 J;  1M93 A;  4FM2 A;  3RYH A;  4FLZ A;  4B3R B;  1XMO B;  3RYH B;  4K8X A;  1Q3E A;  2BTQ B;  5KHJ A;  1M5I A;  2V4D A;  3JAW A;  5K1P A;  1SA0 A;  2Q7H A;  3UT5 A;  3N2K A;  3JAW B;  1S5L X;  4H0L C;  1QHT A;  4U7J A;  3UT5 B;  3N2K B;  3JAR A;  4FLV A;  3ZED A;  3JAR B;  4JI4 B;  1Q43 A;  5IWA B;  1DGS A;  4UCR A;  4YTP C;  4B3M B;  2ZT9 D;  1TA8 A;  4ZHQ A;  1TUB A;  5CB4 A;  4CH6 A;  3AEF C;  3O6Q A;  4ZHQ B;  1TUB B;  2ZM6 B;  5CB4 B;  2O01 J;  2E3C A;  4CH4 A;  1MKM A;  3AEA C;  1KQF B;  2VWJ A;  1HJ0 A;  5JJJ B;  3R4Y A;  4LR3 A;  4DR2 B;  1PL5 A;  4O4J A;  5FPO A;  4XFJ A;  4PV1 C;  2ZIO A;  1XNQ B;  1U57 A;  2E74 D;  1XI1 A;  4ZOL A;  1XNR B;  4O4J B;  3RK3 E;  4NXN B;  1ZP0 C;  4ZOL B;  3RGB A;  4CS2 A;  2WPV B;  4GLX A;  1GMJ A;  2WSF J;  5IJ9 A;  4I55 A;  4Z1M H;  1WN7 A;  2J5U A;  4CH5 A;  4I9Q A;  4HNA A;  5IJ9 B;  4I55 B;  5JH7 A;  2QJP C;  3AEG C;  4HNA B;  4UCS A;  4I7Z B;  5JH7 B;  2IDB A;  1N32 B;  4OGQ B;  3K5O A;  2CAZ C;  4JI5 B;  4DUY B;  1IK7 A;  3RL0 g;  1ZOY C;  3RYI A;  2YI8 A;  4LH7 A;  2UUA B;  4H44 B;  3B2E E;  1ZME C;  3RYI B;  4CC5 A;  5EIB D;  5GON A;  5LP6 A;  3PN1 A;  1YQ4 C;  4O4H A;  4X62 B;  3ABV C;  3RYC A;  1NT2 B;  5GON B;  4O4H B;  3AE3 C;  3HKD A;  3BHP A;  3QF7 A;  4UFZ A;  4NVP A;  5ITZ A;  3RYC B;  1OW6 A;  1J5E B;  4KHP B;  3Q1M A;  2JO1 A;  3HKD B;  2H89 C;  4FFB A;  2F66 C;  1WNS A;  4DRX B;  1Q5O A;  5ITZ B;  4DR1 B;  4LF4 B;  3VQY A;  4D7T A;  3AE7 C;  4TOI A;  1Q90 D;  4FFB B;  1HNZ B;  4LNU A;  2G8Y A;  2E76 B;  1KU9 A;  1HNX B;  4IL6 X;  4LNU B;  3Q5P A;  4FVM A;  1JFF A;  3N2G A;  3K5L A;  1P49 A;  4OGQ D;  2JGU A;  1JFF B;  2Q0A A;  3N2G B;  1FDI A;  1KIL E;  2BTO A;  2UUB B;  1HF9 A;  4H44 D;  5JCO A;  4CS3 A;  4GYC B;  1Z5W A;  1VF5 C;  4TV9 A;  4AQY B;  1V9P A;  1S1C X;  2E75 C;  3E22 A;  1B04 A;  4TV9 B;  2KKW A;  5KHH A;  2UUC B;  1RSO A;  3E22 B;  1OW7 A;  4PI0 A;  4EFE A;  4DV7 B;  2BEQ D;  2JS5 A;  4LF7 B;  1N33 B;  1NYH A;  2JVD A;  4DV0 B;  1O9G A;  3HKC A;  4HBN A;  4H0L D;  1TGO A;  4FLT A;  2BTQ A;  2R9A A;  2FXP A;  3SJB C;  3VQX A;  3HKC B;  5CA0 A;  3EWK A;  3JAK A;  2E76 D;  4UCO A;  5CA0 B;  3BA9 A;  2E74 B;  3JAK B;  1FJG B;  1DD3 A;  4B3T B;  2F1M A;  2V7Q J;  4FLU A;  4LFA B;  4DV1 B;  2OYQ A;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...