1KMIZ

Crystal structure of an e.coli chemotaxis protein, chez
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
209
structure length
177
Chain Sequence
SIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLSQDQVDDLLDSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
pubmed rcsb
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 62
structure length 177
sequence length 209
ec nomenclature
pdb deposition date 2001-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF04344 CheZ Chemotaxis phosphatase, CheZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.500 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1kmiZ02
1.20.5.590 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kmiZ01
1KMIZ
chains in the Genus database with same CATH superfamily
1SQFA 5IJ9A 3L72J 1EXJA 2K9PA 3A0BZ 1RPOA 4DUYO 2Y69C 4JTDB 1KBHA 3ABLC 3CCLV 1IURA 2QJKB 1QQCA 3RN4A 3H1JD 2M3EA 1BGYH 4EB6A 4ZI7A 4DR5B 4X62B 2BTOA 1JMMA 4D7SA 4NKGB 5KKZC 2Q5UA 2LR2A 1ZW0A 3C9IA 2IBZH 3OA7A 5IYZA 2Y4TA 4PA7A 1N73B 3TYYA 1GN3A 2IU0A 1FC2C 1LTJC 3QNEA 4PA3A 1K9MW 4RAIA 2UXCB 5TISE 1XEQA 5L3CA 2QJPB 4AILC 3RK2D 3CSXA 2QKSA 1NKNA 4PJ0H 4X64O 3WU2Z 5LGTA 3AEEC 4J80A 1VDFA 1VQKV 1U7MA 3DC6A 4ZHQA 3BY6A 3CC4V 3RYIB 1PP9J 3T1HO 1SFCB 2ADQB 4UUJC 2ILMA 2Q3IA 2W6JG 1DGSA 1WP7A 2KZIA 1BGYE 3I55V 3LDDA 3BCCH 1OCCB 1URQD 1QBZA 3A7OA 4TLFA 3WB0A 2H94A 4MTXA 1NTZG 4EIJA 2XAFA 3A0BE 3ZHUA 2UXXA 2UU9B 3HKEA 2DJVA 3OMAB 2P5OA 2BOCC 2Q68A 3HD7D 2JWDA 3CXHF 5KJ7C 3OUFA 1BDCA 1BZKA 1SQXE 3LDCA 4MS2A 2E76D 2MJZA 3USSA 4IIJB 2BEZF 4I55A 3UO2A 1L4AB 1JM0A 4B7EA 1YIJV 3LSSA 1P84D 5LHGA 2R70A 1KP2A 3ASOC 1YITV 5KLVK 1GU5A 3CRRA 4OGQC 3HKDB 4RUEA 1J2JB 2EIMB 1U97A 3PLNA 2H7HA 4WBAA 1EZVE 4PV1C 1QLED 1V9PA 5FNVA 5TISZ 2RN0A 5IWAB 3QWOC 3J80N 2DW3A 1JY3P 4JAAA 2ATKC 1S4XA 1KZUB 3F7VC 3H1LH 3BA8A 2AEFA 2YXQB 1NR1A 1JR9A 3RL0g 4DV6O 3G3ZA 4RQFA 1NTMH 2YEVA 1BT8A 5HFMA 3E22A 4WF9V 2W6BA 2FYUH 4UCRA 4LBEC 2B9BA 3L70H 2P22C 3AK1A 4I4TA 2PTMA 4MTGA 2CH7B 1SVFA 1I0HA 4WFHA 4FLYA 4QE7A 5HFLA 5KLVJ 1NVOA 3UT5A 1OVUA 5KHHA 1S5LX 1GK4A 1ZUQA 5H2FH 3IC7A 3VQXA 2KXPB 4A5UB 5LOVA 4EOTA 2OYIA 3FYEB 3N2KA 1HNWO 3U1CA 2P7TC 1I5XA 4B3RO 3ZRXA 1X9VA 1BSHA 3S9OA 4B3SO 3H1JH 1HJBA 2ZE5A 4UCOA 1SZTA 5E79H 3E89A 1QVGU 1DD3A 4ASUG 1KQFB 1WA8A 3B5NC 3BRCA 2YIBD 2QJ1A 5EZYB 1HGZA 4RKUJ 1YQ4C 3RL0D 3LIEA 3QG5A 4WY4A 1M90W 4IIJA 3SFDC 1OCZC 1X8YA 3U59A 2OTLP 5B5EE 3WFVA 4UFZA 3HB3B 4LFCB 1S9KE 1MV8A 1YF2A 2WA3A 4PI2A 4XE5B 1SFCD 1PIXA 1Q81Q 3FFQA 4X20A 2XAJA 3BVOA 4YJ2B 5H5NA 2WLNA 3C3SA 3AE5C 3S1KA 4JBZA 3A0HZ 3ZMVA 3M8AA 1RE4C 3NFQA 2WSFH 4LF4B 4R7CA 1AI5A 2H43A 2JDIH 3L73D 4DR3O 1Q81W 4B3TO 1PP9H 2YO3A 3M0DA 2WLJA 5LL6Y 3JD3A 5J2UB 5KLVG 3ZIAG 1L0LE 2YMKA 2WTYA 4UB6H 5IJ0A 3AEDC 3IFMA 3JD1A 5KMGA 1FZEA 1RM1C 1FZCA 3ABMB 1RE3A 2RNBA 4LCUC 4JAUA 1KYOI 5AW5B 1Q3EA 3IR9A 2UUCB 4QPJA 3RYCB 5EBMC 4H13C 1LR1A 4HNAA 3GHGB 1VF5C 2RMKB 2P7JA 1FZGA 5IY5B 3TNUA 4GIFA 2ZCEA 4FFBB 4CC5A 4I7ZC 5E1AC 5KKZB 1ZOYC 1QLEC 3ETQA 5EK0A 1NTZK 3R4YA 3F5TA 3WG7B 1NAYA 4I55B 2QA4V 3CCSP 1JX9A 1YIJP 2BCCH 1XHXA 4WFAV 3QO7A 2IH1C 1LT1A 3BFRA 2ZT9C 3CS5A 5AW7B 3RK2C 2HR3A 2WPQA 1NTKD 2W6AA 3L37A 3OAAG 4UV8A 1H2MA 3L75E 2POHA 3OEHG 3G4SV 3VMAA 4Y28J 2IBZD 1MMMA 1AB3A 2KSJA 4CPGA 1NKZB 5CA1A 1VF5B 1Y76B 1Z5WA 2R32A 4DV3O 4F6RA 1YCIA 2FFDB 3BRVB 3AG1C 1NVPB 3RBXA 3CCRP 3CCVV 3O65A 3ML0A 5ITZA 3ABMC 4X89A 5B5EZ 1NTZJ 1P84E 2FXPA 3FWLA 4F4LA 1RM1B 4N23A 3L71H 4K35A 1K33A 5GONA 3GLMA 1AVOA 4LH6A 4X88A 5JJJB 4YHHO 1WMKA 1AJNA 4DR1O 2L35A 1F4NA 1LJ2A 1PP9G 2N74A 5AVTB 3OR6C 2A45G 3FKSG 3ITKA 4HNAB 3UO3A 3GHGA 3WU2H 1KFMA 4MVRA 2FB5A 2OYHA 4MVSA 4X1YB 4ICGA 3F89A 4WVZA 3H1JE 5KLVD 3AK2A 2KI7B 5APQA 1YJ9P 3JATA 5CCGC 1EFRG 3U1AA 2O1KA 2Y48A 3TXSA 2D2CB 1A32A 5J2UA 1O9GA 2FMLA 2P4VA 4WFGA 2I8DA 2KOGA 5AW9B 1CP9A 4PV1D 1R6TA 1PL0A 1QR9A 1OCZB 3CP1A 5IE9A 2E5YA 4FLXA 2VS0A 1KV4A 1XNQO 3CRCA 3HUSA 2HFED 3FGAD 2LXBA 1UPGA 1QVGO 1QEXA 1EDLA 2RCVA 3R65A 1IBMB 3L72G 5LYJA 2AZ0A 3ZX6A 2KG7A 2AW9A 4DR4O 3ZMZA 2WLLB 3E83A 3M0AA 2JIZG 4J42A 1LT9C 5BZBA 1EQ7A 2GV9A 3A0HH 1HWYA 4X8AA 4DV4O 3VQVA 3H1JG 2RKLA 3BASA 4MVUA 1RQVA 5B3SB 5AW1B 1Y67A 1JCHA 3SYOA 4IFMA 2UXBB 2M6YA 2BEQD 1NQTA 1XTCC 2IJJA 4DV6B 2E75B 3B4SA 1IO4A 1VP7A 1F4MA 4MTFA 2I1JA 1VQ4P 1HF9A 3GG2A 4Y99B 3TGUD 3L70D 4LF6O 1MSDA 4Q20A 3JCUE 2QWNB 2GBOA 1OHHG 1MFZA 2RJZA 5CCHA 1NAFA 2ZR2A 4JV5B 5IYBO 4W80A 1JJ2U 1M57B 4MT8A 2XAHA 2N1TD 1LWUA 2O1JA 3OTOO 1FU1A 2N04A 1RF1B 2Q7EA 2AXTH 3G6EP 5LBQA 1H8AA 3STLC 3HRNA 1LTJB 2Y0EA 1VMGA 2A45H 3L36A 3SWYA 3G9RA 1FD9A 1WNSA 1N2DC 3VMXA 4O2AB 2EIMC 1DH3A 3CXHE 1KFNA 3D6ZA 1KQSO 2BCCJ 3HD7C 1URFA 3BCCJ 3RK2B 2M5AA 3JCZA 2P90A 3H32B 2DN9A 1FDMA 2ZT9B 1SP4A 1O9HA 2DYRB 3OGCC 3M0DC 1OZ0A 3ABLB 1N34O 1YTFD 2Y69B 2Q6QA 5KAIZ 3DXRA 3WG7C 1XTGB 1MUUA 1N32O 4DCKA 2X6AA 2C0XA 1KKCA 3G80A 4DXWA 5LHIA 1HNXB 3HE4B 2ZYDA 3JARB 2AXTE 1KECA 1WAZA 2Z5UA 2YSUB 1NTKK 3PN1A 2XV5A 1SQQE 1X79B 1H0TB 5TJHA 1Y6XA 1Y47A 4UVBA 2ZXWB 3RFRA 1Q43A 1S5JA 2IBZE 1FKAO 2UXCO 4DV2O 3L71J 4DR4B 5EBWC 4Y99C 3A2FA 1R6NA 4JYBA 1ZX3A 2DOSA 2F43G 2W6JH 2E74D 4O4IA 1SQVE 3GMAA 1I5YA 2O57A 4P2ZA 4J7KA 1RFYA 5D5QA 1YTFB 2EILC 5IYCO 2NPSA 2Q69A 2NPSB 4AYCA 2J58A 2W27A 4UB6E 5KA5A 3E8FA 3H1ID 3HKEB 3V2PA 3CCJP 3P3PA 5D5PA 1SQVD 2DYRC 2ZQMA 1J5EB 1YJ9V 2KP8A 2E74C 2BSKA 2E76B 3RL0B 5BY1A 4H44B 2JEEA 2IDBA 1K7DA 3L72E 4H33A 2WWWA 2ODMA 1T6AA 2G8YA 2IBZG 5GTHE 4NPEA 2AGAA 2K88A 5AVXB 1SA0A 5KA6A 3VP9A 3EVKA 4LWSB 1M56C 2GUZB 3FB8C 1TVKB 1M5IA 1T8ZA 1WRGA 1NHLA 1NJIQ 2A3QA 2HYNA 3MHVA 1VQKP 5LMNO 4JI5B 2H8PC 1B06A 2QWRB 2EZPA 3S3XA 2F93B 3EFFK 4A7PA 1S76D 1COWG 2IFMA 1EZVD 3RYCA 3ZRWA 5JQGA 2CPSA 3D3IA 3P30A 1T2KC 4MW8A 1JO5A 1JQ0A 1N7LA 3ABUA 1NO4A 2R9AA 4BRYB 4QIWF 3N2GA 4ZOLB 5B1OA 1LUWA 1AV1A 1X22A 3RWRD 1YBKA 3HKBA 2RDCA 2KB7P 3V6IA 1OVVA 1EN4A 3K5OA 4O2AA 1H2LA 2HJDA 1L0LD 1NTMK 3CCQP 2H8PD 3W68A 4DUZB 5FPOA 3K3WA 1AP6A 3V4QA 5KMGB 2XKMA 3T97A 2QSIA 1B04A 3U10A 4K8ZA 1M8OB 1W2BO 1YZBA 2P10A 2L91A 1IVSA 4O4LA 3OTFA 2A7WA 3G71V 3B8EB 1FOSE 3PHLA 3CC4P 3H01A 2KB1A 4JI2O 2KZJA 1AVYA 3H1HG 3OMNB 1N8RW 4B3MO 3KZIZ 3RYHA 2FFDC 4TWKA 4UCVA 3K5NA 3Q4HB 4LR3A 1IK7A 4IYHA 4P9OA 5L3GA 1NTZD 3L75D 3KZIH 5CA3A 1YYCA 3C3TA 3SYCA 2WSSH 3CE2A 1WN7A 2DE0X 3T2MA 5L3EA 3TGUE 1VQ6V 4X66O 2O01N 4XDKA 2WT7A 5AW0B 1BE3E 4K0KB 4ZKUA 1YJNV 1M56B 2QTOA 2JKVA 4PDLA 1YITP 5EZYA 5BMVB 2UXBO 4WFFA 1GL2A 1KB9E 1PP9E 3L70G 1H88A 3CMAP 1S5LE 2FYUG 1ORQC 3E8GA 5IY5C 1NTMG 2Z5HA 4F6EA 3LW5J 2GTAA 4AHCA 5CMZA 3CC2P 4F6RB 1P7GA 1PV0A 3H1LG 1K4DC 4X62O 2N1TB 4LF7O 2F23A 1M9NA 1Q2NA 3UKMA 5LMUO 3A0HE 3FX0A 4PHZA 3WUUA 3F5HA 2JP3A 2VRZA 3MHSC 4PD4H 4IL6Z 1TA8A 1K73Q 1XNRO 4N3YB 2EIJC 1SS1A 2V7QJ 3AG2C 2FXMA 3QF7A 1HNZB 2RQ6A 4OXSA 2YNYA 1H2KA 4FLTA 3BAAA 4L76A 4FFBA 3J81N 4BWNA 4J9YB 5KHJA 3HKDA 2R5DA 4TQDA 1NTKG 3VQYA 3JALA 1FXKB 4LFBB 3CLQA 1N36O 4DR6O 3I5DA 3VYIA 1ZLLA 1BCCH 3V2RA 3QVNA 1BQZA 1BE3J 4IL6H 3ZHQA 5JCOC 3ICXA 5KAFZ 4DR2O 3CXHH 1TVKA 1NTZH 2N05A 1T3UA 1S5HC 5GONB 3AG3B 3I5CA 3I56P 3X2QB 1NR7A 3RGUA 2ZDIC 1AJYA 3D70A 1LNQA 1QLEB 3P32A 4GKJO 4C7NB 2ZD9A 1G1XB 5APSA 1SQXD 2K1EA 4YJ2A 1SQBK 2ZAEB 3FAVB 2GTSA 4FLWA 1GL2D 1U57A 1U7JA 4I1LA 2E3CA 1L1FA 2HKOA 1AFOA 1FXHA 4IL6E 2A0LA 1VEWA 5F2VO 1OWAA 3HTKA 1S3JA 3JSNA 2YO2A 2OTLV 3HE4A 1PGPA 2AXTZ 2GHYA 1FOSF 1YHQV 4JI1B 2IJIA 3R2PA 4PI0A 2OIGA 3CCUV 2M0BA 3BATA 1M57C 1UIXA 2OCCC 3MHHC 1F51A 1BGYG 3L72D 3W67A 4GX0A 3Q4HA 4OX9O 5LGNA 1Q6IA 4Z2WA 3C90A 4DR7O 1BMFG 3LSUA 3O9OA 4GODA 5KX5B 2E75C 3SFEC 4O4HA 2IZ0A 1Q82Q 4BWAA 1HBWA 4FZ1A 3JSLA 1OW6A 2NR5A 3AG4C 1Y66A 4ZHQB 5B3SC 3LSQA 2IYOA 3ZHRA 2R44A 1FFTB 5GTIZ 1VQ9P 4EFBA 2HODA 2A06G 2OYIB 1BHAA 2UWJE 1WB7A 2W90A 3A3YB 1EDIA 2W0XA 4LF4O 1A02F 3ABVC 2ARHA 2VQFB 3SPGA 2A79B 3W7UA 2B89A 3VOPA 4MVMA 5CBNA 4IT5A 1MA1A 4EKWA 3H1KE 1E5WA 2WMMA 5H2FZ 4CH4A 3CWBH 3E8BA 4BRYA 3ZS8C 3K5BA 2R9IA 5APWA 4TT3G 5LMNB 4OWFA 2DYSC 2R5BA 2YEVB 5L3FA 2ZM6O 1JTHA 4FFKA 3OTOB 1GL2B 1K05A 3OD4A 2LKMA 1H2GA 3BHPA 3LW5H 1VQ9V 1G4YB 4JI5O 4FM1A 2Q8VA 1KB9I 4LFCO 4DZOA 5EYPA 1L0NG 4D6TD 5GTIE 4OX9B 1PV3A 4DV2B 2QDOA 5E79Z 2ZT9D 2YS8A 1IFIA 1IBKB 3Q5PA 4LWSA 2A06D 3KQGA 4QPKA 2PFXA 4LF9B 4AUWA 4JGSA 2FYUE 5LP6B 3CX5E 1X59A 2UUBO 1RE4A 4DV5B 5H2FE 2QEXP 4ZKPA 1KQSU 4QMAA 3UCSC 2V4HA 2QE7G 2X7RB 1IBKO 4WFBV 2WLIB 2WSCJ 2IH3C 4NXNO 2FXOA 1H8HG 4I50A 3N2KB 2PGDA 3H9VA 4B3RB 1HNWB 2JEXA 3CCLP 1WPXA 2AEMA 1NWQA 3CRQA 4X1IA 1M56D 2P58A 3MP7B 1N8RQ 3HE5B 2CAZC 3IAOA 3JC22 1K8AQ 2CDYA 3HKBB 1W5CE 4R4LA 1BE3H 1SQXG 3U11A 1EZVG 1OCRB 2VQEO 4JPZB 3SWKA 3CYOA 3ETDA 4GDOA 4W4LA 3E22B 1FS0G 2E42A 3T97B 2HODB 2R3CA 3X2QC 3KYQA 2WPVB 3IJ4A 2HG5D 1YEWA 4P9PA 5AVYB 4B7KA 1N4CA 1R3IC 5FNVB 1NU1D 4I0XB 2LGQA 1Q90D 1E79G 3N2GB 4ZOLA 3ZMSA 4CS4A 4PDRA 3K79A 2KSDA 1IZNB 4HB1A 2OYHB 1VF6C 4LP8A 3H6PA 3WMM0 3H32A 3W7XA 2LGWA 3H1IG 1RSOA 3RL0C 5B66E 1CI6A 1L0NK 3CI9A 3GHGC 3ABKB 5IYZB 1BHBA 1SQVG 3B2EE 1G1IA 1OFCX 4DO2A 3QH9A 3DC5A 2B1IA 1Y8AA 5CA1B 2EIKB 1NJIW 1Y74A 4GZRB 1B6QA 5FPRA 3OW2O 1OW8A 1XL4A 2OYOA 1OIPA 4DJGA 3B77A 1N0JA 4MSWC 1NI8A 2CGNA 2B87A 5AVZB 1JY2P 2K3RA 3IC9A 2XNDG 2K9JB 3C1LA 1AQ5A 1WP8A 1ZLZA 4KP4A 2FKXA 1CPYA 1JMKC 3S4RA 1QCEA 4O2BB 2Q67A 2O3JA 5KAFE 1EN6A 1SQPG 3E1IA 4TV9A 2QSAA 4TV8B 2E43A 3JD4A 1G1JA 4R50A 4I50B 1SFCA 3GWKC 3VMZA 5CHXA 1HJ0A 1KC8W 4HJGH 4YTPC 2M8RA 2EINB 3KPEA 4W7YA 2QGNA 1OCOC 3QO5A 4R4MA 1GK9A 4DR2B 1FZBA 1X0TA 1T2KD 5KUKA 4TOIA 1R5SA 2Z5IA 1EZJA 3M99B 3CWBE 2ZIOA 4IHJB 5CB4B 1HR0O 2UUCO 4JI0B 2JJLA 3TSIA 1YTZT 2M3BA 3EXAA 2JJ1G 1F7YA 1OW7A 1PL5A 1BGYD 5KAFH 3ZJZA 1YVWA 3RK3C 4DYLA 5CCHC 3JARA 4ZNCA 1RQUA 1KB9F 5APUA 2YICA 1E1QG 1GW4A 2K37A 1GW3A 2ADPA 4OGQD 2X0LA 5LOVB 2C9LY 3OEEG 3HKCA 4ASVA 4JI7B 2IZ1A 5APYA 1B3QA 3M9BA 4IL6X 5KJ7A 2F4VB 5KLIB 1VQ8P 1IK9A 3SWFA 1SZXA 2XAGA 5IT9N 1GO3F 2W0FC 5JVDB 3ZHSA 1FS0E 1NU1G 4PA9A 1G2CA 2HLDG 4DOJA 5BXZA 4LF5O 1KN7A 2JRIA 3OR7C 3KCXA 1YQ3C 2K1AA 3T4ZA 1G8MA 3TGUG 4X20B 4DR7B 4JI0O 4LF7B 5LP6C 3WU2E 3SPHA 1KB9H 1HVVA 1MZEA 4H0LC 4GOFA 2H3OA 2GUSA 1JPXA 3CPWU 3P7KA 1GMJA 4MW3A 4U7OA 4L74A 1H89A 1KQLA 4KT0J 5APXA 2V7QH 4JI1O 4LF8B 4OH8B 3JASB 2CK3H 4O4JA 2EX3A 5LA6B 4DW0A 5A9GA 1HTLC 1N7SD 4JI7O 4JASA 3OAKA 2Q6AA 1DEBA 1W0JG 3CCUP 5BR8B 1GKFA 1Z5VA 3NXSA 3CX5D 1VARA 5B1BB 4O2BA 1YJWP 4H13D 4L75A 2A9HA 4U3FG 4WB4A 1GTWA 3B5NA 2OGUA 1U96A 1G2CB 3JAMN 1LT9A 3V4WA 2KS1B 2Q73A 1NOHA 5JCOA 3SSUA 4GCZA 1UIIA 3KKYA 1BCCJ 1SQPE 3T1YO 1AQTA 4JI6O 1IDSA 2QKCA 3H1KJ 3JATB 2WSEH 2QWPB 3L73G 4FIPC 1MKMA 3BCCD 1NTMD 1LTSC 1Y4MA 1NU1E 4RQEA 1FZAA 5B5EH 3TETA 2LO1A 1YDXA 1Q86W 4IFDK 5A2QN 3PJSK 1TGOA 3Q5RA 4BR6A 2KS1A 2VWKA 3HTKB 3G71P 2LP7A 1LP1A 4YIPA 2ZE7A 2JGDA 4XFJA 3ZEDA 2X6CA 1YI2P 2GA1A 4H37A 4JTCB 4TV9B 1R5LA 5C93A 2QJYC 4B3TB 4JF7A 1JA8A 3L74E 1Y76A 4P30A 1FJKA 3OGIB 1UFIA 4DV3B 1F23A 3AECC 4PDVA 2AEJA 1MFTA 5AW3B 2IBZI 2Q9IA 1SLQA 3JASA 4OPHA 1SQBH 1OMIA 2QG4A 3L71E 4B86A 4C7UA 2HHHO 3P8CE 3AG3C 2UU9O 3K5LA 4FM2A 1IBLB 2DMXA 2LQTA 4TUYB 4JV5O 3B5ND 3H1LD 1ZR4A 1DF5A 3V2NA 2PUSA 2EZOA 1HUCA 3N7NA 1KMIZ 2YIUC 2IJHA 4HAMA 1I7FA 5CN0A 3M9HA 4X1KB 1CEZA 1CXZB 1S2EA 3L75G 1FXKC 5CMUA 1W0KG 1XQ8A 1K3EA 4H0LD 4L8JA 4QNHB 2OTJV 5C39A 1LTTC 1ROPA 3CWBJ 5JVDA 2IM9A 1ZL8B 3SJQC 3JSVC 2QEXV 5KJ7D 3A5TA 1FZCB 3W7SA 1RP3B 1XI1A 4B3SB 2WVRA 1K73W 4KHXA 3A0BH 3AEBC 3CCMP 5AG2A 3GB7C 1IBMO 3L74G 1ZR2A 1XMQO 3KZIE 4NXNB 2QM4A 1JEKA 1EBOA 3AE8C 3ABKC 3BPZA 4EYYQ 2HG5C 1LUVA 1SQXK 3EHBB 1S5LZ 1XUQA 2YKOA 2ZR3A 4HZ3A 1Y9BA 4EDFA 3CX5H 4AI8A 3E2EA 5APVA 2IW5A 4WY4C 3K06A 3RK3D 1GRJA 3ZRWB 5JQGB 1N0NA 1SQQJ 3JAKA 3FXDA 1JOYA 4DT0A 2LW7A 1R73A 4LH7A 5KLVE 1FZFA 1L0LG 2DQ3A 1EZVI 2HP8A 2WSCH 1VF5D 2DYSB 1R3JC 3ZN1A 3SR2C 1GD2E 1NKDA 3E86A 5LHHA 3UM7A 2JO1A 3BA9A 3B5NB 1PL4A 1Q5OA 4R8CA 2GDSA 4YXWG 2OIEA 1R1BA 2FYUD 3C8VA 1PPJH 1XBLA 2WA4A 1JVMA 4MVQA 4UB8H 4TSFG 1SERA 5GW7A 4AQRD 1QL1A 2V4DA 3F7YC 4RO2A 4XA4A 4Z1MH 3JAWA 3AG4B 2ZNJA 1BQ0A 3NTNA 4UB6Z 1NT2B 3TF5A 5H9CA 3IF4A 1Q6HA 1WPBA 2WLLA 4BIUA 4DV4B 1QHTA 3A0RA 2ZM6B 2GUVA 2JVDA 2C9NY 3RYHB 4D6TJ 4X65B 1KU9A 3AE7C 4I2LC 1TUBA 2JWAA 5AW2B 4NTXA 1HW7A 5AW8B 1AR1B 1VPCA 3A8TA 1JY2O 1A02J 1DIPA 4KJMA 1AJQA 2NN4A 5GTIH 2JGDB 1QX8A 4EEQA 3CXCU 5L3BA 3D36A 5CJ4A 2E75D 1RPRA 1SQBG 1GM9A 2BCCD 2UUBB 2PP6A 2P67A 4J10A 1XILA 2JR8A 3DXRB 3UIAA 1N32B 3TNUB 2VRSA 1FAFA 4LFBO 4IFFA 2CH7A 4GOEA 3OFNG 1PKXA 1VQ6P 2GM4A 1SQBJ 4JAVA 4CS2A 1VQNP 2PRRA 2BTQA 3FYIB 2HHHB 1JCDA 3AEAC 3G6EV 2EBOA 4Q6GA 5J2TA 2FBWC 2J5UA 1JNMA 5J9PC 3CCEV 2YC0A 2X6BA 2OYIC 5C8YB 1YTZI 2R3SA 3L71D 1L0ND 4D6TG 1YXBA 2GUZA 2MW2B 5AVVB 2HLOA 1Q8IA 5CCHD 4HYOA 1SC5B 3LNNA 3RVYA 2WLIA 2ZXEB 1L8DA 4ZIBA 5CBOA 4GLXA 5L8RJ 2N1TA 1GU4A 2BSKB 4GKKO 1L0LK 4J9ZB 3L73H 2PAJA 2G38A 1IFMA 1QGKB 2MKVA 1WT6A 3G67A 1PP9D 3KCYA 4X1IB 1GMGA 2WZ7A 4XBFA 2XUMA 1H2NA 4GKJB 3OUSA 1VQOP 3KG2A 3ZRSA 3ZHTA 3P8CD 1KYOF 3PRJA 1J1DB 2E5LB 1PFIA 2Q9LA 3STZC 1AROP 3BEHA 1USDA 2YXLA 2ZE8A 1FJGO 1NTZE 2KIKA 3GWOA 1FJGB 2JGUA 3HD7B 4DRXA 3BCCE 5KTBA 1JJOA 3Q5SA 2KG7B 2QE7H 1AR5A 3ZCCA 4G28B 2WLHA 1VQ7V 2JK5C 4DR6B 1L0LJ 5AVUB 2CTQA 1GM8A 2CGOA 2JS5A 1KYOD 2IX7C 1SQQG 1YHQP 3ZBHA 1URQB 4X65O 4O4LB 1W59A 4CS3A 4EI2A 1XNQB 4WY4D 1Q86Q 1EDJA 5IJ0B 4EB6B 4ZI7B 2ZYGA 1IX9A 4I9WA 4C46A 2ZNIA 2B9ZA 4EFEA 2L6LA 3CCJV 2KK7A 1KILD 4DV1O 1PPJE 1M1KW 2NRGA 2N9BA 5IYDO 4NR1A 4M3LA 4H0LB 3IGAC 5B1AB 4H44D 2PF4E 1DEEG 1KORA 2O01H 3LDEA 3L74J 3B09A 3TGUH 2Q0OC 3RBZA 3KDPB 1FE6A 2QVAA 1L4AD 3OJAB 2LW1A 3TK1A 3O6QB 1K8AW 4I9QA 1GAXA 1LTIC 2QKAA 3CWBG 4FM0A 3CCQV 2ITAA 1VQLV 1VQMP 3L75J 3M06A 4JI2B 1D5AA 1J1EB 3V5BA 1J95A 4NPFX 1JUNA 2HPCB 4IGGA 2KYVA 3FAVA 4JQ0D 1EM1A 1HNZO 3CD6V 1LT9B 2FY8A 1IFDA 3CXHI 3H1KH 4FPPA 1QU7A 1VQPP 2WSEJ 5B1NA 5CA0A 3AK3A 3G4SP 3MZWB 4C7NA 3DSQA 1AI4A 4TUYA 5LA6A 2EINC 2YUAA 2AXCA 4JYAB 2QWOB 5KUMA 1PGOA 2YIBA 4HKZH 3M7MX 1AA0A 2YMYA 5DJTB 5LXTB 1US6A 3T4DA 3JAKB 3DTUB 1JY2N 1IFPA 1S1CX 4D7TA 2JS3A 1DD4A 3CD6P 3MDSA 1TUEB 1GM7A 4UV9A 4CH3A 1BCCE 4UB8E 1HR0B 1ZP0C 4BW9A 3E1RA 4BAYA 1SS3A 1SQQD 2BE3A 3FD9A 3MD0A 4HBNA 3T1HB 4LF8O 4DW1A 1KILA 3Q2YA 5JH7B 4K0KO 1HNXO 1K97A 2R72A 5BU5A 2XNDH 2EILB 1SFCC 1SKVA 4WBNA 5IWAO 4WBNB 3MIWA 1AI7A 4CBCA 4NXMB 2BCCE 1P7BA 2LJ2A 3K9AA 3L73J 3JCUZ 3TXQA 3K0GA 1MZ9A 3H1KG 4Z1MG 3Q1MA 1DTOA 1SQVH 4L87A 4KHPO 4LGDE 5JJNB 4JTAB 1PD3A 1TUBB 2CE4A 2ETNA 3AG1B 5K5GB 4YPCA 1BCCG 4X1KA 4IYIA 2YXYA 2IYPA 1PPJG 3MUDA 1S9KD 5B1AC 3G6BA 1MG1A 3RYFB 1E79H 3GW6A 1QVFU 1LTJA 3K5MA 5TISH 1FFXB 1M1JC 4GT1A 4MN4C 2XNXA 1KYOH 1RY3A 1NTKH 2HPCA 5L3DA 4U3FJ 5CBGA 4U7JA 3VQWA 4XDLA 4AQYO 3L9DA 2OQQA 2N9YB 1YJWV 1IFJA 3ETEA 2YI8A 1EN5A 2FFDA 1JFFA 3OM3B 3AG7A 5FLXN 1KUQA 4CH5A 3K04A 3RVZA 1EZVH 1OCRC 3IAYA 4JI8O 2QM7A 3EQ2A 3MUDC 5E79E 3CHXA 3HUSC 2WPDG 4HH2A 2QJYB 4NTWA 3CL3D 1WA8B 2YI9A 3ZN0A 4H13B 2XTAA 1RHZB 1GZLA 3QO8A 5DECA 1R3KC 4JF3A 2UUAB 1HGVA 1NTKE 4GX5A 1SQQK 3PP5A 4X9QA 4X64B 4E2LA 2O01J 5EYPB 3N27A 2K9JA 4GKGA 1SQQH 3TGUJ 4FLZA 1KC8Q 3HKCB 2PYJA 3FB6C 1BDDA 2ZYAA 1M1KQ 2IPPA 1XHZA 2OYQA 3T1YB 1NU1J 3AG2B 1NS1A 2HJFC 3O6QA 4ZMDA 5J2TB 5LYJB 1VF6A 1J5EO 3MTUE 3F5WC 1SQVK 2Y9YA 1Q7YQ 1TAEA 1WLEA 2ZXWC 4K3AA 3L75H 3L73E 3SPCA 3APOA 3ABTA 2YIUB 5AW6B 3WB1A 3AE1C 3GF3A 3P8MC 2KSEA 3SPIA 4JYAO 4YIOA 2H88C 4UVCA 3I55P 3CCRV 4DR5O 2A06E 2KUBA 5EIBC 3LUTB 4JYCA 4FVMA 4J7JA 3H1HH 1CW5A 3VMYA 1GTOA 1SA0B 1URQA 3ASNB 3CXHD 4U3JA 4PDMA 3CJHB 3THOA 5JJEB 2W83C 2ZINA 1M1JB 1S72P 4RJTA 1PM9A 4N6JA 5GTHH 3LNMB 4G27B 2UXNA 4D6TH 1K5SA 3HD7A 1QR8A 3D8CA 5H6RA 2QA4P 3JYCA 1USEA 1S0VA 2A06H 4LFAO 4J7ZA 2XHBA 4XDJA 1SQPJ 5JWPA 4LNUA 1NH2B 4DV7O 4ZKIA 3GVMA 2Y0CA 2WT7B 1YI2V 5CBFA 1VQ5V 1VQNV 3H1HE 3CCEP 3HPLC 1RF1C 2KNCB 5ITZB 3CCMV 3BVHA 3AEFC 2E5TA 2F4VO 4LLHA 1FJPA 4CH6A 1NTME 2OCHA 3JD2A 4DV1B 2RMZA 2RN9A 2Q7HA 4NB5A 3T1CA 2VQFO 1V55B 5CA0B 4FLVA 3D6YA 5LP6A 2FYNB 1MABG 1V55C 1AR4A 1H0TA 1AJPA 2XU6A 1E1RG 4BW5A 1QLNA 1DF4A 2YIAA 4QGPA 4OVNF 3PH0A 1YSCA 4WFEA 5KLIC 3CC7V 1XMOB 4DV0B 1SQVJ 3ZHVA 3K59A 3J7AU 1P84I 1IZ3A 3H1IJ 4DV5O 1XREA 2P06A 5APTA 1N33B 2IFNA 4LF6B 1JY3O 4PV1B 2BTQB 2E5LO 3H1KD 1K9MQ 1GDTA 1JOCA 1RSOB 1S77D 1ZTEA 4NYKA 2B88A 4RUFA 1L2PA 3BRTB 3ASNC 2EJ7A 4TQFA 1IBLO 1AILA 3ASOB 4JI4B 3HE5A 4CZZA 2E76C 2Z3YA 2PZSA 1HWTC 1OCOB 4I0XA 4DV0O 4PD4F 3AE6C 3I56V 3OW2U 1L4AC 5LXTA 1SQXJ 2CK3G 4QE9A 3ETGA 4JPRA 1FXVA 1J1DC 1WJZA 2D3OW 1PGJA 1R3LC 2OTKE 3CPWO 2NPSC 2ZVNB 2A45I 5KAIH 3KHUA 4YXWH 3V2QA 3JAWB 2ZDIA 4LF5B 4TV8A 3CEIA 2ZKOA 1KP3A 3R66A 1IXMA 1VQMV 1XDCA 2P2UA 4FLUA 3EFGA 3NMDA 2M7WA 3FB7C 4PD4D 2ZE6A 4UCTA 1AP5A 1G6UA 1V54B 1L0LH 5LGUA 1XL6A 2LXCB 3MAQA 1H38A 1LWUC 1ENVA 1XOUA 2UXDB 2KQXA 5IDJA 3WB2A 1IJDB 4YY3B 4RO0A 1K5QA 1Q82W 2B87B 1N36B 3M9QA 3B8NA 4DR1B 4N21A 2NZ2A 1DK1A 3WUTA 2H89C 2Y4UA 5KHKA 1ZRTE 1JB0J 1N7SB 2OT5A 3H1HD 1Y74B 3E8HA 2BOBC 5B66Z 1L0NJ 2QWQB 2QM8A 3L74H 5CBHA 1CI6B 2BASA 3K08A 3HUSB 3D71A 4MVOA 1N73A 2P6JA 1BCCD 1R6KA 1H8EG 4KUMA 2ITDC 1MOFA 1BE3D 3ZMTA 3LIDA 2QTSA 2WLKA 5AW4B 2ZFCA 5H6QA 2AHZA 2QJKC 2JEUA 4K8XA 3VOUA 1S72V 5CCGD 3AEIA 2PI5A 2WSSG 4LC1A 4UCSA 1SQBE 5AVRB 3M91A 5AVQB 3CB2A 4U7NA 3B71A 1NZ6A 1ZL8A 4I7ZB 2YKQA 4DUZO 1FXKA 4DR3B 2OWOA 2XDJA 3DGEA 3SJCC 1SESA 2FTKA 3BABA 2EJRA 1W2BU 4R6ZA 2LFSA 2P4KA 4X1YA 3FWNA 3L72H 1ZXGA 1VL2A 4PA6A 2FKWB 2LFRA 2PY5A 2Z0AA 2UUAO 2L5GB 3CRAA 1BGYJ 2HVJC 2XT9A 3RGBA 1EC5A 1LWUB 3CCVP 1EDKA 1SETA 2EIJB 5KX5A 1T3JA 3GF7A 2FL4A 3K9SA 4B3MB 1FFXA 4WCEV 3K58A 5DJUB 4ZBMA 1VQOV 5EC1C 1PNKA 1HDJA 4DK1A 3H1LE 4PELA 2DWEC 1NGMB 1P84F 4UCUA 1GK6A 2Q5ZA 3H1IH 4GKKB 2HEPA 2J59M 2B5UA 2PGGA 3VTPC 1CSBA 3AE4C 4HYTB 1LP1B 4KFMA 2G3AA 1AVMA 2Y0IA 2Q1KA 2JJ2G 1KILE 2I1KA 3H25A 5BU8B 2VQEB 4JYYA 1KQGB 3N4XA 1IFNA 1VQ7P 1P49A 3E35A 4FK5C 4O4IB 4I6MC 2Y9ZA 3FXEA 4WWIA 5M1BA 1IXBA 1THZA 3AEGC 3H1IE 1SQXH 1SF9A 2CTWA 1BE3G 4FJCC 1BSNA 1M1JA 5KAIE 2YIDA 3CX5I 3S3WA 3Q3DA 2F66C 2D2CD 3EWKA 3CMEV 1M93A 3CJHA 4U3FD 3W7WA 5DM6V 1OVRA 2ZXXA 2FYUK 2WITA 1VQLP 1NTKJ 4U3FH 4CC6A 1GN2A 3ZRVA 3APQA 3SGIA 4O4HB 2YXRB 1ZAUA 2GSMB 1KILB 1RF0C 1I08A 1YJNP 2F1MA 1OCCC 2FYNC 1BS3A 4JI8B 2KKWA 4PJ0Z 1XMQB 3HR0A 1VQPV 2V7QG 1SQPD 1S5LH 3OT7A 3CMEP 5DEDA 2WAMA 3D36C 1SRYA 4N78E 3JD0A 3K0DA 1TU3F 1HP8A 4O4JB 2VWJA 1N7SA 1HH0A 4FMTA 3ZMUA 3H1LJ 2QRXA 2QJPC 5EFWB 2DWDC 3FB5C 3SJBC 5KHIA 3MGNA 1URQC 3II6A 2HVKC 1NTMJ 2B1GA 1RF0A 2FYUJ 3VBBA 1GL2C 4JI3B 5BVZA 3L70J 4G2KA 4GX2A 1FDOA 2WQYC 3CC2V 4MVZA 4OGQB 1RH5B 3RW0A 1NU1H 2Y0DA 4WY4B 5KLVH 2Q7GA 2NPSD 1MZFA 4TT3H 1OJHA 4E4EA 3SJAC 3QTCA 1LTGC 4H44C 1LGHB 2WPRA 1T5EA 2E74B 1QVFO 1N34B 2YKPA 3RT3C 5CCGA 1FPOA 1N7SC 2AZ2A 4J11A 1KKDA 1OX3A 2UXDO 1L0NE 4YHHB 4UVAA 4JI3O 2Y0PA 2FYZA 1JTHB 3SYPA 5EC2C 1BL8A 3H1HJ 1KYOE 3OE7G 4GUNA 1ZMEC 2R9RB 3UT5B 1NYHA 4PJ0E 1NH2D 1V54C 2MK3A 3RYFA 3JALB 5GTHZ 3TCUA 4U3JB 4I4TB 4JI6B 3P3NA 1NH4A 5LMUB 1QL2A 1FYJA 1D7MA 1VQ8V 2CUGA 1SQGA 1KD1W 1Z56A 4KHPB 4D6TE 1QNMA 1ZSPA 4DK0A 2ITCC 1CZQA 1N86A 2Q7CA 1ZN5A 1AI6A 3AE2C 1PNLA 1SQPH 5K1PA 1LTBC 3ZDMA 2Q4PA 5IJ9B 2EIKC 4UXNA 3IN6A 4GX1A 5AVWB 1M90Q 2XOKG 3B8MA 4DUYB 1JY3N 4LF9O 1W2EA 1P84H 2N1TC 5CJ0A 2WSFJ 3NR7A 3L74D 2C0WA 4DRXB 3CRMA 2DQ0A 1LTAC 1ZRTD 2ZIMA 4JZ2A 2QR4A 5DN6G 1WB8A 1ZWIC 1L4AA 4IHJA 5CB4A 3SYAA 3UQ8A 1NVPD 1GN6A 5BMVA 3SDLA 3VP8A 1Q7YW 4YXDC 1VQ5P 4N78D 3OMIB 1MNGA 2Z4EA 3U0ZA 4GYCB 1RF1A 4FZ0A 2K9YA 4AQYB 1VQ4V 1FAVA 2CTPA 1VIBA 5C8YA 1M4UA 2WPSA 4W4KA 2SPZA 3E7KA 4O9BA 1PGQA 2RH0A 4PD4E 4BXLA 4B08A 1OZHA 3O8ZA 1H2SB 3L35A 1I94B 5FL7G 4YJ3A 2PYLA 3L70E 4PD4I 2EULA 4NTYA 2XASA 1VF7A 1ZV8A 1JMBA 1KILC 3SPJA 3TDKA 2KNCA 1K4CC 1FDIA 4DV7B 4BIZA 2XZRA 1KB9D 2DW4A 1FBMA 3L71G 1EXIA 4LNUB 1P4RA 3W7TA 3K57A 3L4FA 4IOIH 2AHYA 3KXDA 1KD1Q 3WUVA 4NXMO 2V1DA 1D2DA 4YY3O 2YXHA 3B40A 4UB8Z 4JI4O 1GH6A 1NBMG 1X4TA 4PA4A 1PZQA 3RK3B 3VN0A 4JZGA 2XAQA 3FX7A 1OXZA 2ZJSE 5B1BC 1M7LA 2NLJC 1K92A 1IC2A 4OPAA 1D5NA 3CCSV 4KXRA 4MTOA 2KLUA 1DX7A 1I94O 4X66B 4NVPA 3BCCG 1XMOO 1UJWB 1SQBD 1XNRB 2BCCG 3JCUH 1K34A 5EBLC 2D2CC 3CMAV 3CWBD 3D3QA 2NNUA 2CPBA 5JH7A 4I5SA 2IJKA 4L73A 1R8EA 2WLMA 2OARA 2M5AB 3AE9C 5BR8O 3K03A 2QIWA 4YJ3B 5KHGA 1OV9A 1L0NH 1SQPK 2HFEC 1JCCA 1Q6UA 2IU3A 3PTZA 3CX5F 1GN4A 4KL1A 1J1EC 1PPJD 2W8ZA 1MSWD 5AVSB 2ZVOB 2C2AA 1JFFB 4NPDA 1DLBA 4LFAB 3CC7P 1N33O 4ABMA 1K04A 5K1XA 1FZCC 3RK3E 1NU1K 4U3FE 4ASWA 2JDIG 4J41A 1KTMA 3TJTA 2F95B 4BIOA 1Z2GA 1RE3C 5EIBD 2KLVA 2OTJP 4W7ZA 4RWUA 4C7RA 2OCCB 1M57D 2P1JA 4Z1VA 2W6IG 4RESB 2Q0AA 1N73C 3SYQA 3H1JJ 3AE3C 2Q3EA 2PI4A 2YDEA 3A2AA 5B66H 1BSMA 2OYHC 4QJFB 1PNMA 3RYIA 3IFXA 2CTRA
chains in the Genus database with same CATH topology
3N2GA 1SQFA 4ZOLB 4TV9B 5IJ9A 1EXJA 3RWRD 3HKBA 2QJYC 5ITZB 3K5OA 4O2AA 4B3TB 3AEFC 4CH6A 4DV1B 1QQCA 2Q7HA 4DUZB 4DV3B 5FPOA 3AECC 4EB6A 4ZI7A 5KMGB 5CA0B 4FLVA 4DR5B 4X62B 2QSIA 3D6YA 5LP6A 1B04A 2BTOA 3U10A 4K8ZA 4D7SA 5KKZC 2P10A 3JASA 4O4LA 3OTFA 1OMIA 2YIAA 5IYZA 3K5LA 4FM2A 1IBLB 5KLIC 1XMOB 3RYHA 4TUYB 4UCVA 3K5NA 4DV0B 3K59A 4LR3A 2UXCB 2PUSA 1IK7A 4AILC 1KMIZ 2YIUC 3CSXA 1I7FA 4X1KB 3AEEC 1N33B 4LF6B 1WN7A 4PV1B 2BTQB 4ZHQA 1XQ8A 4H0LD 4L8JA 3RYIB 5JVDA 4K0KB 2IM9A 5EZYA 1DGSA 5BMVB 4TQFA 4JI4B 1XI1A 4B3SB 2PZSA 2E76C 3AEBC 3AE6C 3WB0A 3LW5J 4AHCA 4F6RB 5LXTA 2UU9B 3HKEA 4NXNB 2QM4A 2P5OA 4PHZA 2JP3A 3AE8C 3JAWB 3BPZA 1TA8A 4LF5B 4TV8A 2E76D 4IIJB 2BEZF 4I55A 1Y9BA 2V7QJ 4FLUA 3QF7A 1HNZB 2RQ6A 4UCTA 5JQGB 3JAKA 1G6UA 2R70A 4LH7A 3MAQA 4FLTA 3BAAA 4FFBA 2UXDB 1VF5D 3WB2A 5KHJA 3HKDA 4OGQC 3HKDB 4TQDA 4YY3B 3VQYA 3SR2C 3JALA 1N36B 2JO1A 3BA9A 4DR1B 2NZ2A 4PV1C 4LFBB 1Q5OA 2H89C 1V9PA 5FNVA 5KHKA 5IWAB 1ZRTE 1JB0J 3C8VA 3BA8A 5JCOC 3ICXA 2V4DA 3RL0g 1TVKA 3E22A 5GONB 3Q3DA 3D71A 4UCRA 4Z1MH 2P22C 3JAWA 4I4TA 2ZNJA 2PTMA 1NT2B 1AJYA 3D70A 4FLYA 3UT5A 5KHHA 1WPBA 1S5LX 2QJKC 4K8XA 3VQXA 4DV4B 1QHTA 2ZM6B 5LOVA 2JVDA 4UCSA 4YJ2A 3RYHB 3N2KA 3CB2A 4X65B 1KU9A 4FLWA 1U57A 3AE7C 3B71A 1TUBA 4I7ZB 2E3CA 1HW7A 1DIPA 3S9OA 4DR3B 2OWOA 3JSNA 3SJCC 4EEQA 3BABA 4UCOA 2E75D 4X1YA 4JI1B 1DD3A 4PI0A 1VL2A 1KQFB 2UUBB 1UIXA 3BRCA 2YIBD 2PY5A 2QJ1A 5EZYB 1N32B 4RKUJ 1YQ4C 3QG5A 3RGBA 4IIJA 3SFDC 5KX5A 3SFEC 5KX5B 2E75C 3GF7A 4O4HA 4UFZA 4CS2A 4B3MB 4LFCB 4BWAA 3JSLA 1FFXA 1OW6A 3K58A 2BTQA 4PI2A 4ZHQB 2HHHB 3AEAC 4DK1A 1PIXA 4Q6GA 3FFQA 5J2TA 4X20A 4EFBA 2FBWC 4UCUA 4YJ2B 2J5UA 3AE5C 4GKKB 2HEPA 5C8YB 2PGGA 3ABVC 2VQFB 3AE4C 4LF4B 2G3AA 1Q8IA 1KILE 3LNNA 3H25A 1L8DA 4CH4A 4ZIBA 2VQEB 1KQGB 3ZS8C 4GLXA 5L8RJ 1P49A 4O4IB 5J2UB 5LMNB 2YMKA 5IJ0A 2MKVA 3AEDC 5KMGA 4X1IB 5M1BA 3OTOB 1K05A 3BHPA 4FM1A 4GKJB 3AEGC 5EYPA 4OX9B 1PV3A 4DV2B 1Q3EA 2UUCB 3RYCB 2ZT9D 2F66C 2E5LB 2D2CD 3EWKA 4H13C 4HNAA 1IBKB 1M93A 3Q5PA 1VF5C 1NGMB 4LF9B 2ZCEA 2YXLA 4FFBB 4CC5A 4I7ZC 5LP6B 1ZOYC 3ETQA 3R4YA 4CC6A 1FJGB 2JGUA 4I55B 4DRXA 4DV5B 1JJOA 3Q5SA 3SGIA 4O4HB 1XHXA 1ZAUA 4DR6B 2ZT9C 2F1MA 2FYNC 2JS5A 4JI8B 2WSCJ 2KKWA 1XMQB 4I50A 4O4LB 3N2KB 4B3RB 4CS3A 1XNQB 1HNWB 5IJ0B 4Y28J 4EB6B 4ZI7B 5CA1A 2ZNIA 4EFEA 4X1IA 1Z5WA 1VF5B 3IAOA 2CAZC 4F6RA 1TU3F 4O4JB 2VWJA 4H0LB 3HKBB 4R4LA 4H44D 1KORA 5ITZA 3U11A 2QJPC 3SJBC 5KHIA 2FXPA 4GDOA 4JI3B 3E22B 5GONA 3GLMA 2WQYC 1FDOA 4I9QA 3T97B 4OGQB 4LH6A 5JJJB 2Q7GA 4TT3H 1WMKA 2WPVB 4FM0A 3SJAC 1YEWA 3QTCA 4H44C 1T5EA 5FNVB 2E74B 4HNAB 4CS4A 3N2GB 4ZOLA 1Q90D 4JI2B 1N34B 4X1YB 1D5AA 1RSOA 4YHHB 5IYZB 3B2EE 3JATA 5CA1B 5FPRA 2WSEJ 1OW8A 2D2CB 1ZMEC 5J2UA 1O9GA 5CA0A 3UT5B 1NYHA 4PV1D 3RYFA 3JALB 4FLXA 4U3JB 3DSQA 4I4TB 4TUYA 5LA6A 4JI6B 4JYAB 5LMUB 2YIBA 3FGAD 1SQGA 3M7MX 4KHPB 5LXTB 3JAKB 1IBMB 1JMKC 4O2BB 5LYJA 4DK0A 1S1CX 4D7TA 1DD4A 3AE2C 5K1PA 2GV9A 3VQVA 4TV9A 4CH3A 5IJ9B 1HR0B 4TV8B 1RQVA 1ZP0C 3IN6A 4BW9A 4DUYB 2UXBB 2BEQD 4I50B 4DV6B 4HBNA 3T1HB 2E75B 3Q2YA 5JH7B 2WSFJ 1HJ0A 4DRXB 1HF9A 4YTPC 2R72A 2ZIMA 1SKVA 4WBNA 4WBNB 4R4MA 4DR2B 4NXMB 4TOIA 2RJZA 4IHJA 5CB4B 2ZIOA 4IHJB 5CB4A 4JI0B 3UQ8A 5BMVA 4JV5B 1OW7A 1PL5A 4YXDC 3Q1MA 3U0ZA 4GYCB 3JARA 2Q7EA 1RQUA 5JJNB 4AQYB 2K9YA 1TUBB 5C8YA 1M4UA 4X1KA 4B08A 4OGQD 3RYFB 1H2SB 5LOVB 3HKCA 3K5MA 1I94B 1FFXB 4JI7B 4YJ3A 2PYLA 3G9RA 1WNSA 4IL6X 2F4VB 4O2AB 1VF7A 4U7JA 5JVDB 3VQWA 3D6ZA 1FDIA 4DV7B 2OQQA 1EXIA 4LNUB 1YQ3C 2YI8A 3K57A 1JFFA 2ZT9B 4X20B 4DR7B 1O9HA 4CH5A 3IAYA 4LF7B 5LP6C 4H0LC 3CHXA 2YI9A 1GMJA 4H13B 1HNXB 3JARB 1X4TA 4KT0J 2UUAB 3PN1A 4LF8B 3JASB 2O01J 4X64B 4O4JA 2EX3A 5EYPB 5LA6B 3RFRA 1Q43A 1S5JA 4FLZA 4X66B 4NVPA 3HKCB 5BR8B 4DR4B 1Z5VA 1XHZA 3A2FA 2OYQA 1XNRB 3T1YB 3O6QA 5J2TB 2D2CC 4O2BA 5LYJB 4H13D 2E74D 4O4IA 3GMAA 5JH7A 1R8EA 5D5QA 1TAEA 5JCOA 3AE9C 2QIWA 3HKEB 4YJ3B 5KHGA 3WB1A 3AE1C 5D5PA 3GF3A 1J5EB 2H88C 2E74C 2E76B 4H44B 5EIBC 2IDBA 4KL1A 3JATB 4FVMA 2G8YA 1JFFB 4LFAB 1SA0B 1SA0A 1MKMA 4U3JA 1K04A 5K1XA 3RK3E 1TVKB 3THOA 5JJEB 2ZINA 1M5IA 1KTMA 2F95B 5EIBD 4JI5B 2F93B 3RYCA 2Q0AA 5JQGA 1TGOA 3Q5RA 2XHBA 3AE3C 2VWKA 4LNUA 4XFJA 2R9AA 3RYIA 2PYJA 3ZEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMI Z; 
#chains in the Genus database with same CATH topology
 1SQF A;  5IJ9 A;  3L72 J;  1EXJ A;  2K9P A;  3A0B Z;  1RPO A;  4DUY O;  2Y69 C;  4JTD B;  1KBH A;  3ABL C;  3CCL V;  1IUR A;  2QJK B;  1QQC A;  3RN4 A;  3H1J D;  2M3E A;  1BGY H;  4EB6 A;  4ZI7 A;  4DR5 B;  4X62 B;  2BTO A;  1JMM A;  4D7S A;  4NKG B;  5KKZ C;  2Q5U A;  2LR2 A;  1ZW0 A;  3C9I A;  2IBZ H;  3OA7 A;  5IYZ A;  2Y4T A;  4PA7 A;  1N73 B;  3TYY A;  1GN3 A;  2IU0 A;  1FC2 C;  1LTJ C;  3QNE A;  4PA3 A;  1K9M W;  4RAI A;  2UXC B;  5TIS E;  1XEQ A;  5L3C A;  2QJP B;  4AIL C;  3RK2 D;  3CSX A;  2QKS A;  1NKN A;  4PJ0 H;  4X64 O;  3WU2 Z;  5LGT A;  3AEE C;  4J80 A;  1VDF A;  1VQK V;  1U7M A;  3DC6 A;  4ZHQ A;  3BY6 A;  3CC4 V;  3RYI B;  1PP9 J;  3T1H O;  1SFC B;  2ADQ B;  4UUJ C;  2ILM A;  2Q3I A;  2W6J G;  1DGS A;  1WP7 A;  2KZI A;  1BGY E;  3I55 V;  3LDD A;  3BCC H;  1OCC B;  1URQ D;  1QBZ A;  3A7O A;  4TLF A;  3WB0 A;  2H94 A;  4MTX A;  1NTZ G;  4EIJ A;  2XAF A;  3A0B E;  3ZHU A;  2UXX A;  2UU9 B;  3HKE A;  2DJV A;  3OMA B;  2P5O A;  2BOC C;  2Q68 A;  3HD7 D;  2JWD A;  3CXH F;  5KJ7 C;  3OUF A;  1BDC A;  1BZK A;  1SQX E;  3LDC A;  4MS2 A;  2E76 D;  2MJZ A;  3USS A;  4IIJ B;  2BEZ F;  4I55 A;  3UO2 A;  1L4A B;  1JM0 A;  4B7E A;  1YIJ V;  3LSS A;  1P84 D;  5LHG A;  2R70 A;  1KP2 A;  3ASO C;  1YIT V;  5KLV K;  1GU5 A;  3CRR A;  4OGQ C;  3HKD B;  4RUE A;  1J2J B;  2EIM B;  1U97 A;  3PLN A;  2H7H A;  4WBA A;  1EZV E;  4PV1 C;  1QLE D;  1V9P A;  5FNV A;  5TIS Z;  2RN0 A;  5IWA B;  3QWO C;  3J80 N;  2DW3 A;  1JY3 P;  4JAA A;  2ATK C;  1S4X A;  1KZU B;  3F7V C;  3H1L H;  3BA8 A;  2AEF A;  2YXQ B;  1NR1 A;  1JR9 A;  3RL0 g;  4DV6 O;  3G3Z A;  4RQF A;  1NTM H;  2YEV A;  1BT8 A;  5HFM A;  3E22 A;  4WF9 V;  2W6B A;  2FYU H;  4UCR A;  4LBE C;  2B9B A;  3L70 H;  2P22 C;  3AK1 A;  4I4T A;  2PTM A;  4MTG A;  2CH7 B;  1SVF A;  1I0H A;  4WFH A;  4FLY A;  4QE7 A;  5HFL A;  5KLV J;  1NVO A;  3UT5 A;  1OVU A;  5KHH A;  1S5L X;  1GK4 A;  1ZUQ A;  5H2F H;  3IC7 A;  3VQX A;  2KXP B;  4A5U B;  5LOV A;  4EOT A;  2OYI A;  3FYE B;  3N2K A;  1HNW O;  3U1C A;  2P7T C;  1I5X A;  4B3R O;  3ZRX A;  1X9V A;  1BSH A;  3S9O A;  4B3S O;  3H1J H;  1HJB A;  2ZE5 A;  4UCO A;  1SZT A;  5E79 H;  3E89 A;  1QVG U;  1DD3 A;  4ASU G;  1KQF B;  1WA8 A;  3B5N C;  3BRC A;  2YIB D;  2QJ1 A;  5EZY B;  1HGZ A;  4RKU J;  1YQ4 C;  3RL0 D;  3LIE A;  3QG5 A;  4WY4 A;  1M90 W;  4IIJ A;  3SFD C;  1OCZ C;  1X8Y A;  3U59 A;  2OTL P;  5B5E E;  3WFV A;  4UFZ A;  3HB3 B;  4LFC B;  1S9K E;  1MV8 A;  1YF2 A;  2WA3 A;  4PI2 A;  4XE5 B;  1SFC D;  1PIX A;  1Q81 Q;  3FFQ A;  4X20 A;  2XAJ A;  3BVO A;  4YJ2 B;  5H5N A;  2WLN A;  3C3S A;  3AE5 C;  3S1K A;  4JBZ A;  3A0H Z;  3ZMV A;  3M8A A;  1RE4 C;  3NFQ A;  2WSF H;  4LF4 B;  4R7C A;  1AI5 A;  2H43 A;  2JDI H;  3L73 D;  4DR3 O;  1Q81 W;  4B3T O;  1PP9 H;  2YO3 A;  3M0D A;  2WLJ A;  5LL6 Y;  3JD3 A;  5J2U B;  5KLV G;  3ZIA G;  1L0L E;  2YMK A;  2WTY A;  4UB6 H;  5IJ0 A;  3AED C;  3IFM A;  3JD1 A;  5KMG A;  1FZE A;  1RM1 C;  1FZC A;  3ABM B;  1RE3 A;  2RNB A;  4LCU C;  4JAU A;  1KYO I;  5AW5 B;  1Q3E A;  3IR9 A;  2UUC B;  4QPJ A;  3RYC B;  5EBM C;  4H13 C;  1LR1 A;  4HNA A;  3GHG B;  1VF5 C;  2RMK B;  2P7J A;  1FZG A;  5IY5 B;  3TNU A;  4GIF A;  2ZCE A;  4FFB B;  4CC5 A;  4I7Z C;  5E1A C;  5KKZ B;  1ZOY C;  1QLE C;  3ETQ A;  5EK0 A;  1NTZ K;  3R4Y A;  3F5T A;  3WG7 B;  1NAY A;  4I55 B;  2QA4 V;  3CCS P;  1JX9 A;  1YIJ P;  2BCC H;  1XHX A;  4WFA V;  3QO7 A;  2IH1 C;  1LT1 A;  3BFR A;  2ZT9 C;  3CS5 A;  5AW7 B;  3RK2 C;  2HR3 A;  2WPQ A;  1NTK D;  2W6A A;  3L37 A;  3OAA G;  4UV8 A;  1H2M A;  3L75 E;  2POH A;  3OEH G;  3G4S V;  3VMA A;  4Y28 J;  2IBZ D;  1MMM A;  1AB3 A;  2KSJ A;  4CPG A;  1NKZ B;  5CA1 A;  1VF5 B;  1Y76 B;  1Z5W A;  2R32 A;  4DV3 O;  4F6R A;  1YCI A;  2FFD B;  3BRV B;  3AG1 C;  1NVP B;  3RBX A;  3CCR P;  3CCV V;  3O65 A;  3ML0 A;  5ITZ A;  3ABM C;  4X89 A;  5B5E Z;  1NTZ J;  1P84 E;  2FXP A;  3FWL A;  4F4L A;  1RM1 B;  4N23 A;  3L71 H;  4K35 A;  1K33 A;  5GON A;  3GLM A;  1AVO A;  4LH6 A;  4X88 A;  5JJJ B;  4YHH O;  1WMK A;  1AJN A;  4DR1 O;  2L35 A;  1F4N A;  1LJ2 A;  1PP9 G;  2N74 A;  5AVT B;  3OR6 C;  2A45 G;  3FKS G;  3ITK A;  4HNA B;  3UO3 A;  3GHG A;  3WU2 H;  1KFM A;  4MVR A;  2FB5 A;  2OYH A;  4MVS A;  4X1Y B;  4ICG A;  3F89 A;  4WVZ A;  3H1J E;  5KLV D;  3AK2 A;  2KI7 B;  5APQ A;  1YJ9 P;  3JAT A;  5CCG C;  1EFR G;  3U1A A;  2O1K A;  2Y48 A;  3TXS A;  2D2C B;  1A32 A;  5J2U A;  1O9G A;  2FML A;  2P4V A;  4WFG A;  2I8D A;  2KOG A;  5AW9 B;  1CP9 A;  4PV1 D;  1R6T A;  1PL0 A;  1QR9 A;  1OCZ B;  3CP1 A;  5IE9 A;  2E5Y A;  4FLX A;  2VS0 A;  1KV4 A;  1XNQ O;  3CRC A;  3HUS A;  2HFE D;  3FGA D;  2LXB A;  1UPG A;  1QVG O;  1QEX A;  1EDL A;  2RCV A;  3R65 A;  1IBM B;  3L72 G;  5LYJ A;  2AZ0 A;  3ZX6 A;  2KG7 A;  2AW9 A;  4DR4 O;  3ZMZ A;  2WLL B;  3E83 A;  3M0A A;  2JIZ G;  4J42 A;  1LT9 C;  5BZB A;  1EQ7 A;  2GV9 A;  3A0H H;  1HWY A;  4X8A A;  4DV4 O;  3VQV A;  3H1J G;  2RKL A;  3BAS A;  4MVU A;  1RQV A;  5B3S B;  5AW1 B;  1Y67 A;  1JCH A;  3SYO A;  4IFM A;  2UXB B;  2M6Y A;  2BEQ D;  1NQT A;  1XTC C;  2IJJ A;  4DV6 B;  2E75 B;  3B4S A;  1IO4 A;  1VP7 A;  1F4M A;  4MTF A;  2I1J A;  1VQ4 P;  1HF9 A;  3GG2 A;  4Y99 B;  3TGU D;  3L70 D;  4LF6 O;  1MSD A;  4Q20 A;  3JCU E;  2QWN B;  2GBO A;  1OHH G;  1MFZ A;  2RJZ A;  5CCH A;  1NAF A;  2ZR2 A;  4JV5 B;  5IYB O;  4W80 A;  1JJ2 U;  1M57 B;  4MT8 A;  2XAH A;  2N1T D;  1LWU A;  2O1J A;  3OTO O;  1FU1 A;  2N04 A;  1RF1 B;  2Q7E A;  2AXT H;  3G6E P;  5LBQ A;  1H8A A;  3STL C;  3HRN A;  1LTJ B;  2Y0E A;  1VMG A;  2A45 H;  3L36 A;  3SWY A;  3G9R A;  1FD9 A;  1WNS A;  1N2D C;  3VMX A;  4O2A B;  2EIM C;  1DH3 A;  3CXH E;  1KFN A;  3D6Z A;  1KQS O;  2BCC J;  3HD7 C;  1URF A;  3BCC J;  3RK2 B;  2M5A A;  3JCZ A;  2P90 A;  3H32 B;  2DN9 A;  1FDM A;  2ZT9 B;  1SP4 A;  1O9H A;  2DYR B;  3OGC C;  3M0D C;  1OZ0 A;  3ABL B;  1N34 O;  1YTF D;  2Y69 B;  2Q6Q A;  5KAI Z;  3DXR A;  3WG7 C;  1XTG B;  1MUU A;  1N32 O;  4DCK A;  2X6A A;  2C0X A;  1KKC A;  3G80 A;  4DXW A;  5LHI A;  1HNX B;  3HE4 B;  2ZYD A;  3JAR B;  2AXT E;  1KEC A;  1WAZ A;  2Z5U A;  2YSU B;  1NTK K;  3PN1 A;  2XV5 A;  1SQQ E;  1X79 B;  1H0T B;  5TJH A;  1Y6X A;  1Y47 A;  4UVB A;  2ZXW B;  3RFR A;  1Q43 A;  1S5J A;  2IBZ E;  1FKA O;  2UXC O;  4DV2 O;  3L71 J;  4DR4 B;  5EBW C;  4Y99 C;  3A2F A;  1R6N A;  4JYB A;  1ZX3 A;  2DOS A;  2F43 G;  2W6J H;  2E74 D;  4O4I A;  1SQV E;  3GMA A;  1I5Y A;  2O57 A;  4P2Z A;  4J7K A;  1RFY A;  5D5Q A;  1YTF B;  2EIL C;  5IYC O;  2NPS A;  2Q69 A;  2NPS B;  4AYC A;  2J58 A;  2W27 A;  4UB6 E;  5KA5 A;  3E8F A;  3H1I D;  3HKE B;  3V2P A;  3CCJ P;  3P3P A;  5D5P A;  1SQV D;  2DYR C;  2ZQM A;  1J5E B;  1YJ9 V;  2KP8 A;  2E74 C;  2BSK A;  2E76 B;  3RL0 B;  5BY1 A;  4H44 B;  2JEE A;  2IDB A;  1K7D A;  3L72 E;  4H33 A;  2WWW A;  2ODM A;  1T6A A;  2G8Y A;  2IBZ G;  5GTH E;  4NPE A;  2AGA A;  2K88 A;  5AVX B;  1SA0 A;  5KA6 A;  3VP9 A;  3EVK A;  4LWS B;  1M56 C;  2GUZ B;  3FB8 C;  1TVK B;  1M5I A;  1T8Z A;  1WRG A;  1NHL A;  1NJI Q;  2A3Q A;  2HYN A;  3MHV A;  1VQK P;  5LMN O;  4JI5 B;  2H8P C;  1B06 A;  2QWR B;  2EZP A;  3S3X A;  2F93 B;  3EFF K;  4A7P A;  1S76 D;  1COW G;  2IFM A;  1EZV D;  3RYC A;  3ZRW A;  5JQG A;  2CPS A;  3D3I A;  3P30 A;  1T2K C;  4MW8 A;  1JO5 A;  1JQ0 A;  1N7L A;  3ABU A;  1NO4 A;  2R9A A;  4BRY B;  4QIW F;  3N2G A;  4ZOL B;  5B1O A;  1LUW A;  1AV1 A;  1X22 A;  3RWR D;  1YBK A;  3HKB A;  2RDC A;  2KB7 P;  3V6I A;  1OVV A;  1EN4 A;  3K5O A;  4O2A A;  1H2L A;  2HJD A;  1L0L D;  1NTM K;  3CCQ P;  2H8P D;  3W68 A;  4DUZ B;  5FPO A;  3K3W A;  1AP6 A;  3V4Q A;  5KMG B;  2XKM A;  3T97 A;  2QSI A;  1B04 A;  3U10 A;  4K8Z A;  1M8O B;  1W2B O;  1YZB A;  2P10 A;  2L91 A;  1IVS A;  4O4L A;  3OTF A;  2A7W A;  3G71 V;  3B8E B;  1FOS E;  3PHL A;  3CC4 P;  3H01 A;  2KB1 A;  4JI2 O;  2KZJ A;  1AVY A;  3H1H G;  3OMN B;  1N8R W;  4B3M O;  3KZI Z;  3RYH A;  2FFD C;  4TWK A;  4UCV A;  3K5N A;  3Q4H B;  4LR3 A;  1IK7 A;  4IYH A;  4P9O A;  5L3G A;  1NTZ D;  3L75 D;  3KZI H;  5CA3 A;  1YYC A;  3C3T A;  3SYC A;  2WSS H;  3CE2 A;  1WN7 A;  2DE0 X;  3T2M A;  5L3E A;  3TGU E;  1VQ6 V;  4X66 O;  2O01 N;  4XDK A;  2WT7 A;  5AW0 B;  1BE3 E;  4K0K B;  4ZKU A;  1YJN V;  1M56 B;  2QTO A;  2JKV A;  4PDL A;  1YIT P;  5EZY A;  5BMV B;  2UXB O;  4WFF A;  1GL2 A;  1KB9 E;  1PP9 E;  3L70 G;  1H88 A;  3CMA P;  1S5L E;  2FYU G;  1ORQ C;  3E8G A;  5IY5 C;  1NTM G;  2Z5H A;  4F6E A;  3LW5 J;  2GTA A;  4AHC A;  5CMZ A;  3CC2 P;  4F6R B;  1P7G A;  1PV0 A;  3H1L G;  1K4D C;  4X62 O;  2N1T B;  4LF7 O;  2F23 A;  1M9N A;  1Q2N A;  3UKM A;  5LMU O;  3A0H E;  3FX0 A;  4PHZ A;  3WUU A;  3F5H A;  2JP3 A;  2VRZ A;  3MHS C;  4PD4 H;  4IL6 Z;  1TA8 A;  1K73 Q;  1XNR O;  4N3Y B;  2EIJ C;  1SS1 A;  2V7Q J;  3AG2 C;  2FXM A;  3QF7 A;  1HNZ B;  2RQ6 A;  4OXS A;  2YNY A;  1H2K A;  4FLT A;  3BAA A;  4L76 A;  4FFB A;  3J81 N;  4BWN A;  4J9Y B;  5KHJ A;  3HKD A;  2R5D A;  4TQD A;  1NTK G;  3VQY A;  3JAL A;  1FXK B;  4LFB B;  3CLQ A;  1N36 O;  4DR6 O;  3I5D A;  3VYI A;  1ZLL A;  1BCC H;  3V2R A;  3QVN A;  1BQZ A;  1BE3 J;  4IL6 H;  3ZHQ A;  5JCO C;  3ICX A;  5KAF Z;  4DR2 O;  3CXH H;  1TVK A;  1NTZ H;  2N05 A;  1T3U A;  1S5H C;  5GON B;  3AG3 B;  3I5C A;  3I56 P;  3X2Q B;  1NR7 A;  3RGU A;  2ZDI C;  1AJY A;  3D70 A;  1LNQ A;  1QLE B;  3P32 A;  4GKJ O;  4C7N B;  2ZD9 A;  1G1X B;  5APS A;  1SQX D;  2K1E A;  4YJ2 A;  1SQB K;  2ZAE B;  3FAV B;  2GTS A;  4FLW A;  1GL2 D;  1U57 A;  1U7J A;  4I1L A;  2E3C A;  1L1F A;  2HKO A;  1AFO A;  1FXH A;  4IL6 E;  2A0L A;  1VEW A;  5F2V O;  1OWA A;  3HTK A;  1S3J A;  3JSN A;  2YO2 A;  2OTL V;  3HE4 A;  1PGP A;  2AXT Z;  2GHY A;  1FOS F;  1YHQ V;  4JI1 B;  2IJI A;  3R2P A;  4PI0 A;  2OIG A;  3CCU V;  2M0B A;  3BAT A;  1M57 C;  1UIX A;  2OCC C;  3MHH C;  1F51 A;  1BGY G;  3L72 D;  3W67 A;  4GX0 A;  3Q4H A;  4OX9 O;  5LGN A;  1Q6I A;  4Z2W A;  3C90 A;  4DR7 O;  1BMF G;  3LSU A;  3O9O A;  4GOD A;  5KX5 B;  2E75 C;  3SFE C;  4O4H A;  2IZ0 A;  1Q82 Q;  4BWA A;  1HBW A;  4FZ1 A;  3JSL A;  1OW6 A;  2NR5 A;  3AG4 C;  1Y66 A;  4ZHQ B;  5B3S C;  3LSQ A;  2IYO A;  3ZHR A;  2R44 A;  1FFT B;  5GTI Z;  1VQ9 P;  4EFB A;  2HOD A;  2A06 G;  2OYI B;  1BHA A;  2UWJ E;  1WB7 A;  2W90 A;  3A3Y B;  1EDI A;  2W0X A;  4LF4 O;  1A02 F;  3ABV C;  2ARH A;  2VQF B;  3SPG A;  2A79 B;  3W7U A;  2B89 A;  3VOP A;  4MVM A;  5CBN A;  4IT5 A;  1MA1 A;  4EKW A;  3H1K E;  1E5W A;  2WMM A;  5H2F Z;  4CH4 A;  3CWB H;  3E8B A;  4BRY A;  3ZS8 C;  3K5B A;  2R9I A;  5APW A;  4TT3 G;  5LMN B;  4OWF A;  2DYS C;  2R5B A;  2YEV B;  5L3F A;  2ZM6 O;  1JTH A;  4FFK A;  3OTO B;  1GL2 B;  1K05 A;  3OD4 A;  2LKM A;  1H2G A;  3BHP A;  3LW5 H;  1VQ9 V;  1G4Y B;  4JI5 O;  4FM1 A;  2Q8V A;  1KB9 I;  4LFC O;  4DZO A;  5EYP A;  1L0N G;  4D6T D;  5GTI E;  4OX9 B;  1PV3 A;  4DV2 B;  2QDO A;  5E79 Z;  2ZT9 D;  2YS8 A;  1IFI A;  1IBK B;  3Q5P A;  4LWS A;  2A06 D;  3KQG A;  4QPK A;  2PFX A;  4LF9 B;  4AUW A;  4JGS A;  2FYU E;  5LP6 B;  3CX5 E;  1X59 A;  2UUB O;  1RE4 A;  4DV5 B;  5H2F E;  2QEX P;  4ZKP A;  1KQS U;  4QMA A;  3UCS C;  2V4H A;  2QE7 G;  2X7R B;  1IBK O;  4WFB V;  2WLI B;  2WSC J;  2IH3 C;  4NXN O;  2FXO A;  1H8H G;  4I50 A;  3N2K B;  2PGD A;  3H9V A;  4B3R B;  1HNW B;  2JEX A;  3CCL P;  1WPX A;  2AEM A;  1NWQ A;  3CRQ A;  4X1I A;  1M56 D;  2P58 A;  3MP7 B;  1N8R Q;  3HE5 B;  2CAZ C;  3IAO A;  3JC2 2;  1K8A Q;  2CDY A;  3HKB B;  1W5C E;  4R4L A;  1BE3 H;  1SQX G;  3U11 A;  1EZV G;  1OCR B;  2VQE O;  4JPZ B;  3SWK A;  3CYO A;  3ETD A;  4GDO A;  4W4L A;  3E22 B;  1FS0 G;  2E42 A;  3T97 B;  2HOD B;  2R3C A;  3X2Q C;  3KYQ A;  2WPV B;  3IJ4 A;  2HG5 D;  1YEW A;  4P9P A;  5AVY B;  4B7K A;  1N4C A;  1R3I C;  5FNV B;  1NU1 D;  4I0X B;  2LGQ A;  1Q90 D;  1E79 G;  3N2G B;  4ZOL A;  3ZMS A;  4CS4 A;  4PDR A;  3K79 A;  2KSD A;  1IZN B;  4HB1 A;  2OYH B;  1VF6 C;  4LP8 A;  3H6P A;  3WMM 0;  3H32 A;  3W7X A;  2LGW A;  3H1I G;  1RSO A;  3RL0 C;  5B66 E;  1CI6 A;  1L0N K;  3CI9 A;  3GHG C;  3ABK B;  5IYZ B;  1BHB A;  1SQV G;  3B2E E;  1G1I A;  1OFC X;  4DO2 A;  3QH9 A;  3DC5 A;  2B1I A;  1Y8A A;  5CA1 B;  2EIK B;  1NJI W;  1Y74 A;  4GZR B;  1B6Q A;  5FPR A;  3OW2 O;  1OW8 A;  1XL4 A;  2OYO A;  1OIP A;  4DJG A;  3B77 A;  1N0J A;  4MSW C;  1NI8 A;  2CGN A;  2B87 A;  5AVZ B;  1JY2 P;  2K3R A;  3IC9 A;  2XND G;  2K9J B;  3C1L A;  1AQ5 A;  1WP8 A;  1ZLZ A;  4KP4 A;  2FKX A;  1CPY A;  1JMK C;  3S4R A;  1QCE A;  4O2B B;  2Q67 A;  2O3J A;  5KAF E;  1EN6 A;  1SQP G;  3E1I A;  4TV9 A;  2QSA A;  4TV8 B;  2E43 A;  3JD4 A;  1G1J A;  4R50 A;  4I50 B;  1SFC A;  3GWK C;  3VMZ A;  5CHX A;  1HJ0 A;  1KC8 W;  4HJG H;  4YTP C;  2M8R A;  2EIN B;  3KPE A;  4W7Y A;  2QGN A;  1OCO C;  3QO5 A;  4R4M A;  1GK9 A;  4DR2 B;  1FZB A;  1X0T A;  1T2K D;  5KUK A;  4TOI A;  1R5S A;  2Z5I A;  1EZJ A;  3M99 B;  3CWB E;  2ZIO A;  4IHJ B;  5CB4 B;  1HR0 O;  2UUC O;  4JI0 B;  2JJL A;  3TSI A;  1YTZ T;  2M3B A;  3EXA A;  2JJ1 G;  1F7Y A;  1OW7 A;  1PL5 A;  1BGY D;  5KAF H;  3ZJZ A;  1YVW A;  3RK3 C;  4DYL A;  5CCH C;  3JAR A;  4ZNC A;  1RQU A;  1KB9 F;  5APU A;  2YIC A;  1E1Q G;  1GW4 A;  2K37 A;  1GW3 A;  2ADP A;  4OGQ D;  2X0L A;  5LOV B;  2C9L Y;  3OEE G;  3HKC A;  4ASV A;  4JI7 B;  2IZ1 A;  5APY A;  1B3Q A;  3M9B A;  4IL6 X;  5KJ7 A;  2F4V B;  5KLI B;  1VQ8 P;  1IK9 A;  3SWF A;  1SZX A;  2XAG A;  5IT9 N;  1GO3 F;  2W0F C;  5JVD B;  3ZHS A;  1FS0 E;  1NU1 G;  4PA9 A;  1G2C A;  2HLD G;  4DOJ A;  5BXZ A;  4LF5 O;  1KN7 A;  2JRI A;  3OR7 C;  3KCX A;  1YQ3 C;  2K1A A;  3T4Z A;  1G8M A;  3TGU G;  4X20 B;  4DR7 B;  4JI0 O;  4LF7 B;  5LP6 C;  3WU2 E;  3SPH A;  1KB9 H;  1HVV A;  1MZE A;  4H0L C;  4GOF A;  2H3O A;  2GUS A;  1JPX A;  3CPW U;  3P7K A;  1GMJ A;  4MW3 A;  4U7O A;  4L74 A;  1H89 A;  1KQL A;  4KT0 J;  5APX A;  2V7Q H;  4JI1 O;  4LF8 B;  4OH8 B;  3JAS B;  2CK3 H;  4O4J A;  2EX3 A;  5LA6 B;  4DW0 A;  5A9G A;  1HTL C;  1N7S D;  4JI7 O;  4JAS A;  3OAK A;  2Q6A A;  1DEB A;  1W0J G;  3CCU P;  5BR8 B;  1GKF A;  1Z5V A;  3NXS A;  3CX5 D;  1VAR A;  5B1B B;  4O2B A;  1YJW P;  4H13 D;  4L75 A;  2A9H A;  4U3F G;  4WB4 A;  1GTW A;  3B5N A;  2OGU A;  1U96 A;  1G2C B;  3JAM N;  1LT9 A;  3V4W A;  2KS1 B;  2Q73 A;  1NOH A;  5JCO A;  3SSU A;  4GCZ A;  1UII A;  3KKY A;  1BCC J;  1SQP E;  3T1Y O;  1AQT A;  4JI6 O;  1IDS A;  2QKC A;  3H1K J;  3JAT B;  2WSE H;  2QWP B;  3L73 G;  4FIP C;  1MKM A;  3BCC D;  1NTM D;  1LTS C;  1Y4M A;  1NU1 E;  4RQE A;  1FZA A;  5B5E H;  3TET A;  2LO1 A;  1YDX A;  1Q86 W;  4IFD K;  5A2Q N;  3PJS K;  1TGO A;  3Q5R A;  4BR6 A;  2KS1 A;  2VWK A;  3HTK B;  3G71 P;  2LP7 A;  1LP1 A;  4YIP A;  2ZE7 A;  2JGD A;  4XFJ A;  3ZED A;  2X6C A;  1YI2 P;  2GA1 A;  4H37 A;  4JTC B;  4TV9 B;  1R5L A;  5C93 A;  2QJY C;  4B3T B;  4JF7 A;  1JA8 A;  3L74 E;  1Y76 A;  4P30 A;  1FJK A;  3OGI B;  1UFI A;  4DV3 B;  1F23 A;  3AEC C;  4PDV A;  2AEJ A;  1MFT A;  5AW3 B;  2IBZ I;  2Q9I A;  1SLQ A;  3JAS A;  4OPH A;  1SQB H;  1OMI A;  2QG4 A;  3L71 E;  4B86 A;  4C7U A;  2HHH O;  3P8C E;  3AG3 C;  2UU9 O;  3K5L A;  4FM2 A;  1IBL B;  2DMX A;  2LQT A;  4TUY B;  4JV5 O;  3B5N D;  3H1L D;  1ZR4 A;  1DF5 A;  3V2N A;  2PUS A;  2EZO A;  1HUC A;  3N7N A;  1KMI Z;  2YIU C;  2IJH A;  4HAM A;  1I7F A;  5CN0 A;  3M9H A;  4X1K B;  1CEZ A;  1CXZ B;  1S2E A;  3L75 G;  1FXK C;  5CMU A;  1W0K G;  1XQ8 A;  1K3E A;  4H0L D;  4L8J A;  4QNH B;  2OTJ V;  5C39 A;  1LTT C;  1ROP A;  3CWB J;  5JVD A;  2IM9 A;  1ZL8 B;  3SJQ C;  3JSV C;  2QEX V;  5KJ7 D;  3A5T A;  1FZC B;  3W7S A;  1RP3 B;  1XI1 A;  4B3S B;  2WVR A;  1K73 W;  4KHX A;  3A0B H;  3AEB C;  3CCM P;  5AG2 A;  3GB7 C;  1IBM O;  3L74 G;  1ZR2 A;  1XMQ O;  3KZI E;  4NXN B;  2QM4 A;  1JEK A;  1EBO A;  3AE8 C;  3ABK C;  3BPZ A;  4EYY Q;  2HG5 C;  1LUV A;  1SQX K;  3EHB B;  1S5L Z;  1XUQ A;  2YKO A;  2ZR3 A;  4HZ3 A;  1Y9B A;  4EDF A;  3CX5 H;  4AI8 A;  3E2E A;  5APV A;  2IW5 A;  4WY4 C;  3K06 A;  3RK3 D;  1GRJ A;  3ZRW B;  5JQG B;  1N0N A;  1SQQ J;  3JAK A;  3FXD A;  1JOY A;  4DT0 A;  2LW7 A;  1R73 A;  4LH7 A;  5KLV E;  1FZF A;  1L0L G;  2DQ3 A;  1EZV I;  2HP8 A;  2WSC H;  1VF5 D;  2DYS B;  1R3J C;  3ZN1 A;  3SR2 C;  1GD2 E;  1NKD A;  3E86 A;  5LHH A;  3UM7 A;  2JO1 A;  3BA9 A;  3B5N B;  1PL4 A;  1Q5O A;  4R8C A;  2GDS A;  4YXW G;  2OIE A;  1R1B A;  2FYU D;  3C8V A;  1PPJ H;  1XBL A;  2WA4 A;  1JVM A;  4MVQ A;  4UB8 H;  4TSF G;  1SER A;  5GW7 A;  4AQR D;  1QL1 A;  2V4D A;  3F7Y C;  4RO2 A;  4XA4 A;  4Z1M H;  3JAW A;  3AG4 B;  2ZNJ A;  1BQ0 A;  3NTN A;  4UB6 Z;  1NT2 B;  3TF5 A;  5H9C A;  3IF4 A;  1Q6H A;  1WPB A;  2WLL A;  4BIU A;  4DV4 B;  1QHT A;  3A0R A;  2ZM6 B;  2GUV A;  2JVD A;  2C9N Y;  3RYH B;  4D6T J;  4X65 B;  1KU9 A;  3AE7 C;  4I2L C;  1TUB A;  2JWA A;  5AW2 B;  4NTX A;  1HW7 A;  5AW8 B;  1AR1 B;  1VPC A;  3A8T A;  1JY2 O;  1A02 J;  1DIP A;  4KJM A;  1AJQ A;  2NN4 A;  5GTI H;  2JGD B;  1QX8 A;  4EEQ A;  3CXC U;  5L3B A;  3D36 A;  5CJ4 A;  2E75 D;  1RPR A;  1SQB G;  1GM9 A;  2BCC D;  2UUB B;  2PP6 A;  2P67 A;  4J10 A;  1XIL A;  2JR8 A;  3DXR B;  3UIA A;  1N32 B;  3TNU B;  2VRS A;  1FAF A;  4LFB O;  4IFF A;  2CH7 A;  4GOE A;  3OFN G;  1PKX A;  1VQ6 P;  2GM4 A;  1SQB J;  4JAV A;  4CS2 A;  1VQN P;  2PRR A;  2BTQ A;  3FYI B;  2HHH B;  1JCD A;  3AEA C;  3G6E V;  2EBO A;  4Q6G A;  5J2T A;  2FBW C;  2J5U A;  1JNM A;  5J9P C;  3CCE V;  2YC0 A;  2X6B A;  2OYI C;  5C8Y B;  1YTZ I;  2R3S A;  3L71 D;  1L0N D;  4D6T G;  1YXB A;  2GUZ A;  2MW2 B;  5AVV B;  2HLO A;  1Q8I A;  5CCH D;  4HYO A;  1SC5 B;  3LNN A;  3RVY A;  2WLI A;  2ZXE B;  1L8D A;  4ZIB A;  5CBO A;  4GLX A;  5L8R J;  2N1T A;  1GU4 A;  2BSK B;  4GKK O;  1L0L K;  4J9Z B;  3L73 H;  2PAJ A;  2G38 A;  1IFM A;  1QGK B;  2MKV A;  1WT6 A;  3G67 A;  1PP9 D;  3KCY A;  4X1I B;  1GMG A;  2WZ7 A;  4XBF A;  2XUM A;  1H2N A;  4GKJ B;  3OUS A;  1VQO P;  3KG2 A;  3ZRS A;  3ZHT A;  3P8C D;  1KYO F;  3PRJ A;  1J1D B;  2E5L B;  1PFI A;  2Q9L A;  3STZ C;  1ARO P;  3BEH A;  1USD A;  2YXL A;  2ZE8 A;  1FJG O;  1NTZ E;  2KIK A;  3GWO A;  1FJG B;  2JGU A;  3HD7 B;  4DRX A;  3BCC E;  5KTB A;  1JJO A;  3Q5S A;  2KG7 B;  2QE7 H;  1AR5 A;  3ZCC A;  4G28 B;  2WLH A;  1VQ7 V;  2JK5 C;  4DR6 B;  1L0L J;  5AVU B;  2CTQ A;  1GM8 A;  2CGO A;  2JS5 A;  1KYO D;  2IX7 C;  1SQQ G;  1YHQ P;  3ZBH A;  1URQ B;  4X65 O;  4O4L B;  1W59 A;  4CS3 A;  4EI2 A;  1XNQ B;  4WY4 D;  1Q86 Q;  1EDJ A;  5IJ0 B;  4EB6 B;  4ZI7 B;  2ZYG A;  1IX9 A;  4I9W A;  4C46 A;  2ZNI A;  2B9Z A;  4EFE A;  2L6L A;  3CCJ V;  2KK7 A;  1KIL D;  4DV1 O;  1PPJ E;  1M1K W;  2NRG A;  2N9B A;  5IYD O;  4NR1 A;  4M3L A;  4H0L B;  3IGA C;  5B1A B;  4H44 D;  2PF4 E;  1DEE G;  1KOR A;  2O01 H;  3LDE A;  3L74 J;  3B09 A;  3TGU H;  2Q0O C;  3RBZ A;  3KDP B;  1FE6 A;  2QVA A;  1L4A D;  3OJA B;  2LW1 A;  3TK1 A;  3O6Q B;  1K8A W;  4I9Q A;  1GAX A;  1LTI C;  2QKA A;  3CWB G;  4FM0 A;  3CCQ V;  2ITA A;  1VQL V;  1VQM P;  3L75 J;  3M06 A;  4JI2 B;  1D5A A;  1J1E B;  3V5B A;  1J95 A;  4NPF X;  1JUN A;  2HPC B;  4IGG A;  2KYV A;  3FAV A;  4JQ0 D;  1EM1 A;  1HNZ O;  3CD6 V;  1LT9 B;  2FY8 A;  1IFD A;  3CXH I;  3H1K H;  4FPP A;  1QU7 A;  1VQP P;  2WSE J;  5B1N A;  5CA0 A;  3AK3 A;  3G4S P;  3MZW B;  4C7N A;  3DSQ A;  1AI4 A;  4TUY A;  5LA6 A;  2EIN C;  2YUA A;  2AXC A;  4JYA B;  2QWO B;  5KUM A;  1PGO A;  2YIB A;  4HKZ H;  3M7M X;  1AA0 A;  2YMY A;  5DJT B;  5LXT B;  1US6 A;  3T4D A;  3JAK B;  3DTU B;  1JY2 N;  1IFP A;  1S1C X;  4D7T A;  2JS3 A;  1DD4 A;  3CD6 P;  3MDS A;  1TUE B;  1GM7 A;  4UV9 A;  4CH3 A;  1BCC E;  4UB8 E;  1HR0 B;  1ZP0 C;  4BW9 A;  3E1R A;  4BAY A;  1SS3 A;  1SQQ D;  2BE3 A;  3FD9 A;  3MD0 A;  4HBN A;  3T1H B;  4LF8 O;  4DW1 A;  1KIL A;  3Q2Y A;  5JH7 B;  4K0K O;  1HNX O;  1K97 A;  2R72 A;  5BU5 A;  2XND H;  2EIL B;  1SFC C;  1SKV A;  4WBN A;  5IWA O;  4WBN B;  3MIW A;  1AI7 A;  4CBC A;  4NXM B;  2BCC E;  1P7B A;  2LJ2 A;  3K9A A;  3L73 J;  3JCU Z;  3TXQ A;  3K0G A;  1MZ9 A;  3H1K G;  4Z1M G;  3Q1M A;  1DTO A;  1SQV H;  4L87 A;  4KHP O;  4LGD E;  5JJN B;  4JTA B;  1PD3 A;  1TUB B;  2CE4 A;  2ETN A;  3AG1 B;  5K5G B;  4YPC A;  1BCC G;  4X1K A;  4IYI A;  2YXY A;  2IYP A;  1PPJ G;  3MUD A;  1S9K D;  5B1A C;  3G6B A;  1MG1 A;  3RYF B;  1E79 H;  3GW6 A;  1QVF U;  1LTJ A;  3K5M A;  5TIS H;  1FFX B;  1M1J C;  4GT1 A;  4MN4 C;  2XNX A;  1KYO H;  1RY3 A;  1NTK H;  2HPC A;  5L3D A;  4U3F J;  5CBG A;  4U7J A;  3VQW A;  4XDL A;  4AQY O;  3L9D A;  2OQQ A;  2N9Y B;  1YJW V;  1IFJ A;  3ETE A;  2YI8 A;  1EN5 A;  2FFD A;  1JFF A;  3OM3 B;  3AG7 A;  5FLX N;  1KUQ A;  4CH5 A;  3K04 A;  3RVZ A;  1EZV H;  1OCR C;  3IAY A;  4JI8 O;  2QM7 A;  3EQ2 A;  3MUD C;  5E79 E;  3CHX A;  3HUS C;  2WPD G;  4HH2 A;  2QJY B;  4NTW A;  3CL3 D;  1WA8 B;  2YI9 A;  3ZN0 A;  4H13 B;  2XTA A;  1RHZ B;  1GZL A;  3QO8 A;  5DEC A;  1R3K C;  4JF3 A;  2UUA B;  1HGV A;  1NTK E;  4GX5 A;  1SQQ K;  3PP5 A;  4X9Q A;  4X64 B;  4E2L A;  2O01 J;  5EYP B;  3N27 A;  2K9J A;  4GKG A;  1SQQ H;  3TGU J;  4FLZ A;  1KC8 Q;  3HKC B;  2PYJ A;  3FB6 C;  1BDD A;  2ZYA A;  1M1K Q;  2IPP A;  1XHZ A;  2OYQ A;  3T1Y B;  1NU1 J;  3AG2 B;  1NS1 A;  2HJF C;  3O6Q A;  4ZMD A;  5J2T B;  5LYJ B;  1VF6 A;  1J5E O;  3MTU E;  3F5W C;  1SQV K;  2Y9Y A;  1Q7Y Q;  1TAE A;  1WLE A;  2ZXW C;  4K3A A;  3L75 H;  3L73 E;  3SPC A;  3APO A;  3ABT A;  2YIU B;  5AW6 B;  3WB1 A;  3AE1 C;  3GF3 A;  3P8M C;  2KSE A;  3SPI A;  4JYA O;  4YIO A;  2H88 C;  4UVC A;  3I55 P;  3CCR V;  4DR5 O;  2A06 E;  2KUB A;  5EIB C;  3LUT B;  4JYC A;  4FVM A;  4J7J A;  3H1H H;  1CW5 A;  3VMY A;  1GTO A;  1SA0 B;  1URQ A;  3ASN B;  3CXH D;  4U3J A;  4PDM A;  3CJH B;  3THO A;  5JJE B;  2W83 C;  2ZIN A;  1M1J B;  1S72 P;  4RJT A;  1PM9 A;  4N6J A;  5GTH H;  3LNM B;  4G27 B;  2UXN A;  4D6T H;  1K5S A;  3HD7 A;  1QR8 A;  3D8C A;  5H6R A;  2QA4 P;  3JYC A;  1USE A;  1S0V A;  2A06 H;  4LFA O;  4J7Z A;  2XHB A;  4XDJ A;  1SQP J;  5JWP A;  4LNU A;  1NH2 B;  4DV7 O;  4ZKI A;  3GVM A;  2Y0C A;  2WT7 B;  1YI2 V;  5CBF A;  1VQ5 V;  1VQN V;  3H1H E;  3CCE P;  3HPL C;  1RF1 C;  2KNC B;  5ITZ B;  3CCM V;  3BVH A;  3AEF C;  2E5T A;  2F4V O;  4LLH A;  1FJP A;  4CH6 A;  1NTM E;  2OCH A;  3JD2 A;  4DV1 B;  2RMZ A;  2RN9 A;  2Q7H A;  4NB5 A;  3T1C A;  2VQF O;  1V55 B;  5CA0 B;  4FLV A;  3D6Y A;  5LP6 A;  2FYN B;  1MAB G;  1V55 C;  1AR4 A;  1H0T A;  1AJP A;  2XU6 A;  1E1R G;  4BW5 A;  1QLN A;  1DF4 A;  2YIA A;  4QGP A;  4OVN F;  3PH0 A;  1YSC A;  4WFE A;  5KLI C;  3CC7 V;  1XMO B;  4DV0 B;  1SQV J;  3ZHV A;  3K59 A;  3J7A U;  1P84 I;  1IZ3 A;  3H1I J;  4DV5 O;  1XRE A;  2P06 A;  5APT A;  1N33 B;  2IFN A;  4LF6 B;  1JY3 O;  4PV1 B;  2BTQ B;  2E5L O;  3H1K D;  1K9M Q;  1GDT A;  1JOC A;  1RSO B;  1S77 D;  1ZTE A;  4NYK A;  2B88 A;  4RUF A;  1L2P A;  3BRT B;  3ASN C;  2EJ7 A;  4TQF A;  1IBL O;  1AIL A;  3ASO B;  4JI4 B;  3HE5 A;  4CZZ A;  2E76 C;  2Z3Y A;  2PZS A;  1HWT C;  1OCO B;  4I0X A;  4DV0 O;  4PD4 F;  3AE6 C;  3I56 V;  3OW2 U;  1L4A C;  5LXT A;  1SQX J;  2CK3 G;  4QE9 A;  3ETG A;  4JPR A;  1FXV A;  1J1D C;  1WJZ A;  2D3O W;  1PGJ A;  1R3L C;  2OTK E;  3CPW O;  2NPS C;  2ZVN B;  2A45 I;  5KAI H;  3KHU A;  4YXW H;  3V2Q A;  3JAW B;  2ZDI A;  4LF5 B;  4TV8 A;  3CEI A;  2ZKO A;  1KP3 A;  3R66 A;  1IXM A;  1VQM V;  1XDC A;  2P2U A;  4FLU A;  3EFG A;  3NMD A;  2M7W A;  3FB7 C;  4PD4 D;  2ZE6 A;  4UCT A;  1AP5 A;  1G6U A;  1V54 B;  1L0L H;  5LGU A;  1XL6 A;  2LXC B;  3MAQ A;  1H38 A;  1LWU C;  1ENV A;  1XOU A;  2UXD B;  2KQX A;  5IDJ A;  3WB2 A;  1IJD B;  4YY3 B;  4RO0 A;  1K5Q A;  1Q82 W;  2B87 B;  1N36 B;  3M9Q A;  3B8N A;  4DR1 B;  4N21 A;  2NZ2 A;  1DK1 A;  3WUT A;  2H89 C;  2Y4U A;  5KHK A;  1ZRT E;  1JB0 J;  1N7S B;  2OT5 A;  3H1H D;  1Y74 B;  3E8H A;  2BOB C;  5B66 Z;  1L0N J;  2QWQ B;  2QM8 A;  3L74 H;  5CBH A;  1CI6 B;  2BAS A;  3K08 A;  3HUS B;  3D71 A;  4MVO A;  1N73 A;  2P6J A;  1BCC D;  1R6K A;  1H8E G;  4KUM A;  2ITD C;  1MOF A;  1BE3 D;  3ZMT A;  3LID A;  2QTS A;  2WLK A;  5AW4 B;  2ZFC A;  5H6Q A;  2AHZ A;  2QJK C;  2JEU A;  4K8X A;  3VOU A;  1S72 V;  5CCG D;  3AEI A;  2PI5 A;  2WSS G;  4LC1 A;  4UCS A;  1SQB E;  5AVR B;  3M91 A;  5AVQ B;  3CB2 A;  4U7N A;  3B71 A;  1NZ6 A;  1ZL8 A;  4I7Z B;  2YKQ A;  4DUZ O;  1FXK A;  4DR3 B;  2OWO A;  2XDJ A;  3DGE A;  3SJC C;  1SES A;  2FTK A;  3BAB A;  2EJR A;  1W2B U;  4R6Z A;  2LFS A;  2P4K A;  4X1Y A;  3FWN A;  3L72 H;  1ZXG A;  1VL2 A;  4PA6 A;  2FKW B;  2LFR A;  2PY5 A;  2Z0A A;  2UUA O;  2L5G B;  3CRA A;  1BGY J;  2HVJ C;  2XT9 A;  3RGB A;  1EC5 A;  1LWU B;  3CCV P;  1EDK A;  1SET A;  2EIJ B;  5KX5 A;  1T3J A;  3GF7 A;  2FL4 A;  3K9S A;  4B3M B;  1FFX A;  4WCE V;  3K58 A;  5DJU B;  4ZBM A;  1VQO V;  5EC1 C;  1PNK A;  1HDJ A;  4DK1 A;  3H1L E;  4PEL A;  2DWE C;  1NGM B;  1P84 F;  4UCU A;  1GK6 A;  2Q5Z A;  3H1I H;  4GKK B;  2HEP A;  2J59 M;  2B5U A;  2PGG A;  3VTP C;  1CSB A;  3AE4 C;  4HYT B;  1LP1 B;  4KFM A;  2G3A A;  1AVM A;  2Y0I A;  2Q1K A;  2JJ2 G;  1KIL E;  2I1K A;  3H25 A;  5BU8 B;  2VQE B;  4JYY A;  1KQG B;  3N4X A;  1IFN A;  1VQ7 P;  1P49 A;  3E35 A;  4FK5 C;  4O4I B;  4I6M C;  2Y9Z A;  3FXE A;  4WWI A;  5M1B A;  1IXB A;  1THZ A;  3AEG C;  3H1I E;  1SQX H;  1SF9 A;  2CTW A;  1BE3 G;  4FJC C;  1BSN A;  1M1J A;  5KAI E;  2YID A;  3CX5 I;  3S3W A;  3Q3D A;  2F66 C;  2D2C D;  3EWK A;  3CME V;  1M93 A;  3CJH A;  4U3F D;  3W7W A;  5DM6 V;  1OVR A;  2ZXX A;  2FYU K;  2WIT A;  1VQL P;  1NTK J;  4U3F H;  4CC6 A;  1GN2 A;  3ZRV A;  3APQ A;  3SGI A;  4O4H B;  2YXR B;  1ZAU A;  2GSM B;  1KIL B;  1RF0 C;  1I08 A;  1YJN P;  2F1M A;  1OCC C;  2FYN C;  1BS3 A;  4JI8 B;  2KKW A;  4PJ0 Z;  1XMQ B;  3HR0 A;  1VQP V;  2V7Q G;  1SQP D;  1S5L H;  3OT7 A;  3CME P;  5DED A;  2WAM A;  3D36 C;  1SRY A;  4N78 E;  3JD0 A;  3K0D A;  1TU3 F;  1HP8 A;  4O4J B;  2VWJ A;  1N7S A;  1HH0 A;  4FMT A;  3ZMU A;  3H1L J;  2QRX A;  2QJP C;  5EFW B;  2DWD C;  3FB5 C;  3SJB C;  5KHI A;  3MGN A;  1URQ C;  3II6 A;  2HVK C;  1NTM J;  2B1G A;  1RF0 A;  2FYU J;  3VBB A;  1GL2 C;  4JI3 B;  5BVZ A;  3L70 J;  4G2K A;  4GX2 A;  1FDO A;  2WQY C;  3CC2 V;  4MVZ A;  4OGQ B;  1RH5 B;  3RW0 A;  1NU1 H;  2Y0D A;  4WY4 B;  5KLV H;  2Q7G A;  2NPS D;  1MZF A;  4TT3 H;  1OJH A;  4E4E A;  3SJA C;  3QTC A;  1LTG C;  4H44 C;  1LGH B;  2WPR A;  1T5E A;  2E74 B;  1QVF O;  1N34 B;  2YKP A;  3RT3 C;  5CCG A;  1FPO A;  1N7S C;  2AZ2 A;  4J11 A;  1KKD A;  1OX3 A;  2UXD O;  1L0N E;  4YHH B;  4UVA A;  4JI3 O;  2Y0P A;  2FYZ A;  1JTH B;  3SYP A;  5EC2 C;  1BL8 A;  3H1H J;  1KYO E;  3OE7 G;  4GUN A;  1ZME C;  2R9R B;  3UT5 B;  1NYH A;  4PJ0 E;  1NH2 D;  1V54 C;  2MK3 A;  3RYF A;  3JAL B;  5GTH Z;  3TCU A;  4U3J B;  4I4T B;  4JI6 B;  3P3N A;  1NH4 A;  5LMU B;  1QL2 A;  1FYJ A;  1D7M A;  1VQ8 V;  2CUG A;  1SQG A;  1KD1 W;  1Z56 A;  4KHP B;  4D6T E;  1QNM A;  1ZSP A;  4DK0 A;  2ITC C;  1CZQ A;  1N86 A;  2Q7C A;  1ZN5 A;  1AI6 A;  3AE2 C;  1PNL A;  1SQP H;  5K1P A;  1LTB C;  3ZDM A;  2Q4P A;  5IJ9 B;  2EIK C;  4UXN A;  3IN6 A;  4GX1 A;  5AVW B;  1M90 Q;  2XOK G;  3B8M A;  4DUY B;  1JY3 N;  4LF9 O;  1W2E A;  1P84 H;  2N1T C;  5CJ0 A;  2WSF J;  3NR7 A;  3L74 D;  2C0W A;  4DRX B;  3CRM A;  2DQ0 A;  1LTA C;  1ZRT D;  2ZIM A;  4JZ2 A;  2QR4 A;  5DN6 G;  1WB8 A;  1ZWI C;  1L4A A;  4IHJ A;  5CB4 A;  3SYA A;  3UQ8 A;  1NVP D;  1GN6 A;  5BMV A;  3SDL A;  3VP8 A;  1Q7Y W;  4YXD C;  1VQ5 P;  4N78 D;  3OMI B;  1MNG A;  2Z4E A;  3U0Z A;  4GYC B;  1RF1 A;  4FZ0 A;  2K9Y A;  4AQY B;  1VQ4 V;  1FAV A;  2CTP A;  1VIB A;  5C8Y A;  1M4U A;  2WPS A;  4W4K A;  2SPZ A;  3E7K A;  4O9B A;  1PGQ A;  2RH0 A;  4PD4 E;  4BXL A;  4B08 A;  1OZH A;  3O8Z A;  1H2S B;  3L35 A;  1I94 B;  5FL7 G;  4YJ3 A;  2PYL A;  3L70 E;  4PD4 I;  2EUL A;  4NTY A;  2XAS A;  1VF7 A;  1ZV8 A;  1JMB A;  1KIL C;  3SPJ A;  3TDK A;  2KNC A;  1K4C C;  1FDI A;  4DV7 B;  4BIZ A;  2XZR A;  1KB9 D;  2DW4 A;  1FBM A;  3L71 G;  1EXI A;  4LNU B;  1P4R A;  3W7T A;  3K57 A;  3L4F A;  4IOI H;  2AHY A;  3KXD A;  1KD1 Q;  3WUV A;  4NXM O;  2V1D A;  1D2D A;  4YY3 O;  2YXH A;  3B40 A;  4UB8 Z;  4JI4 O;  1GH6 A;  1NBM G;  1X4T A;  4PA4 A;  1PZQ A;  3RK3 B;  3VN0 A;  4JZG A;  2XAQ A;  3FX7 A;  1OXZ A;  2ZJS E;  5B1B C;  1M7L A;  2NLJ C;  1K92 A;  1IC2 A;  4OPA A;  1D5N A;  3CCS V;  4KXR A;  4MTO A;  2KLU A;  1DX7 A;  1I94 O;  4X66 B;  4NVP A;  3BCC G;  1XMO O;  1UJW B;  1SQB D;  1XNR B;  2BCC G;  3JCU H;  1K34 A;  5EBL C;  2D2C C;  3CMA V;  3CWB D;  3D3Q A;  2NNU A;  2CPB A;  5JH7 A;  4I5S A;  2IJK A;  4L73 A;  1R8E A;  2WLM A;  2OAR A;  2M5A B;  3AE9 C;  5BR8 O;  3K03 A;  2QIW A;  4YJ3 B;  5KHG A;  1OV9 A;  1L0N H;  1SQP K;  2HFE C;  1JCC A;  1Q6U A;  2IU3 A;  3PTZ A;  3CX5 F;  1GN4 A;  4KL1 A;  1J1E C;  1PPJ D;  2W8Z A;  1MSW D;  5AVS B;  2ZVO B;  2C2A A;  1JFF B;  4NPD A;  1DLB A;  4LFA B;  3CC7 P;  1N33 O;  4ABM A;  1K04 A;  5K1X A;  1FZC C;  3RK3 E;  1NU1 K;  4U3F E;  4ASW A;  2JDI G;  4J41 A;  1KTM A;  3TJT A;  2F95 B;  4BIO A;  1Z2G A;  1RE3 C;  5EIB D;  2KLV A;  2OTJ P;  4W7Z A;  4RWU A;  4C7R A;  2OCC B;  1M57 D;  2P1J A;  4Z1V A;  2W6I G;  4RES B;  2Q0A A;  1N73 C;  3SYQ A;  3H1J J;  3AE3 C;  2Q3E A;  2PI4 A;  2YDE A;  3A2A A;  5B66 H;  1BSM A;  2OYH C;  4QJF B;  1PNM A;  3RYI A;  3IFX A;  2CTR A; 
#chains in the Genus database with same CATH homology
 3N2G A;  1SQF A;  4ZOL B;  4TV9 B;  5IJ9 A;  1EXJ A;  3RWR D;  3HKB A;  2QJY C;  5ITZ B;  3K5O A;  4O2A A;  4B3T B;  3AEF C;  4CH6 A;  4DV1 B;  1QQC A;  2Q7H A;  4DUZ B;  4DV3 B;  5FPO A;  3AEC C;  4EB6 A;  4ZI7 A;  5KMG B;  5CA0 B;  4FLV A;  4DR5 B;  4X62 B;  2QSI A;  3D6Y A;  5LP6 A;  1B04 A;  2BTO A;  3U10 A;  4K8Z A;  4D7S A;  5KKZ C;  2P10 A;  3JAS A;  4O4L A;  3OTF A;  1OMI A;  2YIA A;  5IYZ A;  3K5L A;  4FM2 A;  1IBL B;  5KLI C;  1XMO B;  3RYH A;  4TUY B;  4UCV A;  3K5N A;  4DV0 B;  3K59 A;  4LR3 A;  2UXC B;  2PUS A;  1IK7 A;  4AIL C;  1KMI Z;  2YIU C;  3CSX A;  1I7F A;  4X1K B;  3AEE C;  1N33 B;  4LF6 B;  1WN7 A;  4PV1 B;  2BTQ B;  4ZHQ A;  1XQ8 A;  4H0L D;  4L8J A;  3RYI B;  5JVD A;  4K0K B;  2IM9 A;  5EZY A;  1DGS A;  5BMV B;  4TQF A;  4JI4 B;  1XI1 A;  4B3S B;  2PZS A;  2E76 C;  3AEB C;  3AE6 C;  3WB0 A;  3LW5 J;  4AHC A;  4F6R B;  5LXT A;  2UU9 B;  3HKE A;  4NXN B;  2QM4 A;  2P5O A;  4PHZ A;  2JP3 A;  3AE8 C;  3JAW B;  3BPZ A;  1TA8 A;  4LF5 B;  4TV8 A;  2E76 D;  4IIJ B;  2BEZ F;  4I55 A;  1Y9B A;  2V7Q J;  4FLU A;  3QF7 A;  1HNZ B;  2RQ6 A;  4UCT A;  5JQG B;  3JAK A;  1G6U A;  2R70 A;  4LH7 A;  3MAQ A;  4FLT A;  3BAA A;  4FFB A;  2UXD B;  1VF5 D;  3WB2 A;  5KHJ A;  3HKD A;  4OGQ C;  3HKD B;  4TQD A;  4YY3 B;  3VQY A;  3SR2 C;  3JAL A;  1N36 B;  2JO1 A;  3BA9 A;  4DR1 B;  2NZ2 A;  4PV1 C;  4LFB B;  1Q5O A;  2H89 C;  1V9P A;  5FNV A;  5KHK A;  5IWA B;  1ZRT E;  1JB0 J;  3C8V A;  3BA8 A;  5JCO C;  3ICX A;  2V4D A;  3RL0 g;  1TVK A;  3E22 A;  5GON B;  3Q3D A;  3D71 A;  4UCR A;  4Z1M H;  2P22 C;  3JAW A;  4I4T A;  2ZNJ A;  2PTM A;  1NT2 B;  1AJY A;  3D70 A;  4FLY A;  3UT5 A;  5KHH A;  1WPB A;  1S5L X;  2QJK C;  4K8X A;  3VQX A;  4DV4 B;  1QHT A;  2ZM6 B;  5LOV A;  2JVD A;  4UCS A;  4YJ2 A;  3RYH B;  3N2K A;  3CB2 A;  4X65 B;  1KU9 A;  4FLW A;  1U57 A;  3AE7 C;  3B71 A;  1TUB A;  4I7Z B;  2E3C A;  1HW7 A;  1DIP A;  3S9O A;  4DR3 B;  2OWO A;  3JSN A;  3SJC C;  4EEQ A;  3BAB A;  4UCO A;  2E75 D;  4X1Y A;  4JI1 B;  1DD3 A;  4PI0 A;  1VL2 A;  1KQF B;  2UUB B;  1UIX A;  3BRC A;  2YIB D;  2PY5 A;  2QJ1 A;  5EZY B;  1N32 B;  4RKU J;  1YQ4 C;  3QG5 A;  3RGB A;  4IIJ A;  3SFD C;  5KX5 A;  3SFE C;  5KX5 B;  2E75 C;  3GF7 A;  4O4H A;  4UFZ A;  4CS2 A;  4B3M B;  4LFC B;  4BWA A;  3JSL A;  1FFX A;  1OW6 A;  3K58 A;  2BTQ A;  4PI2 A;  4ZHQ B;  2HHH B;  3AEA C;  4DK1 A;  1PIX A;  4Q6G A;  3FFQ A;  5J2T A;  4X20 A;  4EFB A;  2FBW C;  4UCU A;  4YJ2 B;  2J5U A;  3AE5 C;  4GKK B;  2HEP A;  5C8Y B;  2PGG A;  3ABV C;  2VQF B;  3AE4 C;  4LF4 B;  2G3A A;  1Q8I A;  1KIL E;  3LNN A;  3H25 A;  1L8D A;  4CH4 A;  4ZIB A;  2VQE B;  1KQG B;  3ZS8 C;  4GLX A;  5L8R J;  1P49 A;  4O4I B;  5J2U B;  5LMN B;  2YMK A;  5IJ0 A;  2MKV A;  3AED C;  5KMG A;  4X1I B;  5M1B A;  3OTO B;  1K05 A;  3BHP A;  4FM1 A;  4GKJ B;  3AEG C;  5EYP A;  4OX9 B;  1PV3 A;  4DV2 B;  1Q3E A;  2UUC B;  3RYC B;  2ZT9 D;  2F66 C;  2E5L B;  2D2C D;  3EWK A;  4H13 C;  4HNA A;  1IBK B;  1M93 A;  3Q5P A;  1VF5 C;  1NGM B;  4LF9 B;  2ZCE A;  2YXL A;  4FFB B;  4CC5 A;  4I7Z C;  5LP6 B;  1ZOY C;  3ETQ A;  3R4Y A;  4CC6 A;  1FJG B;  2JGU A;  4I55 B;  4DRX A;  4DV5 B;  1JJO A;  3Q5S A;  3SGI A;  4O4H B;  1XHX A;  1ZAU A;  4DR6 B;  2ZT9 C;  2F1M A;  2FYN C;  2JS5 A;  4JI8 B;  2WSC J;  2KKW A;  1XMQ B;  4I50 A;  4O4L B;  3N2K B;  4B3R B;  4CS3 A;  1XNQ B;  1HNW B;  5IJ0 B;  4Y28 J;  4EB6 B;  4ZI7 B;  5CA1 A;  2ZNI A;  4EFE A;  4X1I A;  1Z5W A;  1VF5 B;  3IAO A;  2CAZ C;  4F6R A;  1TU3 F;  4O4J B;  2VWJ A;  4H0L B;  3HKB B;  4R4L A;  4H44 D;  1KOR A;  5ITZ A;  3U11 A;  2QJP C;  3SJB C;  5KHI A;  2FXP A;  4GDO A;  4JI3 B;  3E22 B;  5GON A;  3GLM A;  2WQY C;  1FDO A;  4I9Q A;  3T97 B;  4OGQ B;  4LH6 A;  5JJJ B;  2Q7G A;  4TT3 H;  1WMK A;  2WPV B;  4FM0 A;  3SJA C;  1YEW A;  3QTC A;  4H44 C;  1T5E A;  5FNV B;  2E74 B;  4HNA B;  4CS4 A;  3N2G B;  4ZOL A;  1Q90 D;  4JI2 B;  1N34 B;  4X1Y B;  1D5A A;  1RSO A;  4YHH B;  5IYZ B;  3B2E E;  3JAT A;  5CA1 B;  5FPR A;  2WSE J;  1OW8 A;  2D2C B;  1ZME C;  5J2U A;  1O9G A;  5CA0 A;  3UT5 B;  1NYH A;  4PV1 D;  3RYF A;  3JAL B;  4FLX A;  4U3J B;  3DSQ A;  4I4T B;  4TUY A;  5LA6 A;  4JI6 B;  4JYA B;  5LMU B;  2YIB A;  3FGA D;  1SQG A;  3M7M X;  4KHP B;  5LXT B;  3JAK B;  1IBM B;  1JMK C;  4O2B B;  5LYJ A;  4DK0 A;  1S1C X;  4D7T A;  1DD4 A;  3AE2 C;  5K1P A;  2GV9 A;  3VQV A;  4TV9 A;  4CH3 A;  5IJ9 B;  1HR0 B;  4TV8 B;  1RQV A;  1ZP0 C;  3IN6 A;  4BW9 A;  4DUY B;  2UXB B;  2BEQ D;  4I50 B;  4DV6 B;  4HBN A;  3T1H B;  2E75 B;  3Q2Y A;  5JH7 B;  2WSF J;  1HJ0 A;  4DRX B;  1HF9 A;  4YTP C;  2R72 A;  2ZIM A;  1SKV A;  4WBN A;  4WBN B;  4R4M A;  4DR2 B;  4NXM B;  4TOI A;  2RJZ A;  4IHJ A;  5CB4 B;  2ZIO A;  4IHJ B;  5CB4 A;  4JI0 B;  3UQ8 A;  5BMV A;  4JV5 B;  1OW7 A;  1PL5 A;  4YXD C;  3Q1M A;  3U0Z A;  4GYC B;  3JAR A;  2Q7E A;  1RQU A;  5JJN B;  4AQY B;  2K9Y A;  1TUB B;  5C8Y A;  1M4U A;  4X1K A;  4B08 A;  4OGQ D;  3RYF B;  1H2S B;  5LOV B;  3HKC A;  3K5M A;  1I94 B;  1FFX B;  4JI7 B;  4YJ3 A;  2PYL A;  3G9R A;  1WNS A;  4IL6 X;  2F4V B;  4O2A B;  1VF7 A;  4U7J A;  5JVD B;  3VQW A;  3D6Z A;  1FDI A;  4DV7 B;  2OQQ A;  1EXI A;  4LNU B;  1YQ3 C;  2YI8 A;  3K57 A;  1JFF A;  2ZT9 B;  4X20 B;  4DR7 B;  1O9H A;  4CH5 A;  3IAY A;  4LF7 B;  5LP6 C;  4H0L C;  3CHX A;  2YI9 A;  1GMJ A;  4H13 B;  1HNX B;  3JAR B;  1X4T A;  4KT0 J;  2UUA B;  3PN1 A;  4LF8 B;  3JAS B;  2O01 J;  4X64 B;  4O4J A;  2EX3 A;  5EYP B;  5LA6 B;  3RFR A;  1Q43 A;  1S5J A;  4FLZ A;  4X66 B;  4NVP A;  3HKC B;  5BR8 B;  4DR4 B;  1Z5V A;  1XHZ A;  3A2F A;  2OYQ A;  1XNR B;  3T1Y B;  3O6Q A;  5J2T B;  2D2C C;  4O2B A;  5LYJ B;  4H13 D;  2E74 D;  4O4I A;  3GMA A;  5JH7 A;  1R8E A;  5D5Q A;  1TAE A;  5JCO A;  3AE9 C;  2QIW A;  3HKE B;  4YJ3 B;  5KHG A;  3WB1 A;  3AE1 C;  5D5P A;  3GF3 A;  1J5E B;  2H88 C;  2E74 C;  2E76 B;  4H44 B;  5EIB C;  2IDB A;  4KL1 A;  3JAT B;  4FVM A;  2G8Y A;  1JFF B;  4LFA B;  1SA0 B;  1SA0 A;  1MKM A;  4U3J A;  1K04 A;  5K1X A;  3RK3 E;  1TVK B;  3THO A;  5JJE B;  2ZIN A;  1M5I A;  1KTM A;  2F95 B;  5EIB D;  4JI5 B;  2F93 B;  3RYC A;  2Q0A A;  5JQG A;  1TGO A;  3Q5R A;  2XHB A;  3AE3 C;  2VWK A;  4LNU A;  4XFJ A;  2R9A A;  3RYI A;  2PYJ A;  3ZED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...