1KMIZ

Crystal structure of an e.coli chemotaxis protein, chez
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
209
structure length
177
Chain Sequence
SIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLSQDQVDDLLDSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.
pubmed rcsb
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 62
structure length 177
sequence length 209
ec nomenclature
pdb deposition date 2001-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF04344 CheZ Chemotaxis phosphatase, CheZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.500 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 1kmiZ02
1.20.5.590 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kmiZ01
1KMIZ
chains in the Genus database with same CATH superfamily
1MG1A 3IGAC 2KK7A 3L36A 3CRRA 4GX2A 3P8MC 4EEQA 2YIBD 3P3NA 1YIJV 1HVVA 1KD1W 4IFMA 1J95A 3AG4C 3RYFB 1TAEA 1K04A 1L1FA 5LMNB 1G2CB 1Y47A 1AJNA 3PHLA 4K8ZA 1LTJB 4ZNCA 4WFBV 2KOGA 5IT9N 1Q5OA 1QVGU 1Q90D 2XAQA 2YS8A 2UXCB 2IH3C 1MZ9A 3FXDA 3L72D 3TDKA 2FYNB 2B5UA 5APXA 1VQ5V 3CWBJ 5KAIE 2Y48A 4TT3G 3H32B 3KZIZ 4I0XA 1BL8A 4EYYQ 1PIXA 4IL6Z 2JGDA 3BY6A 1YF2A 2GTAA 5LGUA 3PRJA 1RF1C 4WFEA 4QPKA 3KQGA 3M0DC 3CCUP 4PDMA 1JPXA 3MTUE 1GMGA 1ROPA 3UIAA 2QA4P 3ZHSA 1NTZE 1V9PA 4J42A 4F6EA 2XOKG 2ATKC 2X7RB 1JFFB 2WSFH 1IZNB 1GL2A 4TV9B 1M56D 1JJOA 3M99B 1AVOA 3AEEC 4LLHA 2LKMA 4ZKIA 3ZEDA 1DX7A 3BA9A 4H37A 5M1BA 3O6QB 1HJBA 2IH1C 1P7BA 1G1IA 1R5SA 4DV2B 3CWBD 1NR1A 2AHYA 3JATA 1YJWV 5KLVK 2A45H 5D5QA 1NH4A 3BCCE 2Y9YA 5IJ9A 5IYBO 2X6BA 4U3FH 2P7JA 4R50A 4RAIA 4E2LA 3HKEA 3PH0A 3CCUV 1IFIA 1BGYD 3N2KB 1WN7A 5CCHC 1FOSE 3BAAA 3N2GA 4LFBO 1KILC 2KI7B 1IZ3A 5HFLA 5J2TB 2AEJA 3ZX6A 1LR1A 1E79G 1GL2D 3ABLC 2QA4V 3BCCH 3G67A 1N7SB 4JQ0D 5EC2C 4DUZO 1FPOA 3G4SV 4FMTA 4TLFA 1SQXG 5C8YA 2QVAA 1M56C 4KFMA 1O9GA 4DV1B 2CGOA 3CWBG 2V1DA 3EVKA 4OX9O 3ZMTA 4KUMA 1TUBB 2XNDH 3T2MA 3E35A 4UVCA 3V5BA 4JI5B 2BTOA 1L0LD 4FZ1A 5DEDA 3AK1A 3CL3D 1FBMA 1QR8A 2OIEA 4X1IB 3SYCA 2G38A 1SQBG 1IFMA 2KSEA 1IXMA 5APTA 4YXDC 2Y0IA 1KYOI 1HNZB 1MA1A 2BCCG 1LWUC 3AG7A 3BHPA 3MD0A 1NKNA 1XILA 2RN9A 3N27A 2C0WA 5LMUB 4CH6A 1KZUB 2QSIA 3JSVC 1GKFA 1NU1K 3CPWU 3H1HD 3SWKA 1S5LX 1S5LZ 2KG7B 2FKXA 4QNHB 2UXBO 1BZKA 3JCUE 1H89A 2NLJC 4K0KO 3K04A 4BWAA 1KTMA 2KIKA 1H0TA 1SQBE 4WY4B 1YSCA 5LA6A 1HGVA 4Y28J 4H13B 1NVPD 1MUUA 1LUVA 4JF7A 4I1LA 1F4MA 3E22A 2B87A 4H33A 1XDCA 1NGMB 2IX7C 4CH5A 3CX5F 2ZNJA 1S72V 4LF7O 4DT0A 2K9PA 2OCHA 5APWA 3SSUA 5JQGA 1JNMA 3RYFA 3K5LA 3RVZA 2HHHB 1JMMA 3K03A 3BPZA 3R65A 3W68A 3TSIA 1NKDA 4DR5B 1NVOA 4HKZH 3HUSB 2QTOA 4Q20A 3FAVA 3SYOA 2NPSD 4NPEA 2B88A 2KYVA 2GUZB 3A0HH 5JCOA 1RM1C 2ZKOA 2JJ1G 5A9GA 1N34B 4OX9B 1NTME 5KAIZ 4X64O 4MVZA 4L8JA 1UJWB 1NTKG 2OGUA 5AVXB 3D70A 1N36B 2EILC 1BDDA 3CLQA 2HVJC 3V6IA 1JJ2U 4MVOA 3B8MA 3K06A 1VPCA 1SRYA 5IE9A 3OA7A 2P58A 1M1JC 1HW7A 3JD3A 4B7KA 2JVDA 1YJWP 3U1CA 2KB1A 3V2PA 1OVUA 5GONA 3STZC 3E8GA 5EFWB 2YKPA 5FPRA 5CN0A 4O4HA 3A0HZ 3CCMP 1RFYA 1LTJC 1YCIA 1N32B 3H1IJ 2ZVOB 4DW0A 1AILA 1I5XA 3R66A 4DOJA 3G9RA 1VQMP 3M0AA 1H2LA 3ZRXA 2IJKA 4ZKUA 1DEEG 4C7NA 2Q6AA 3ASNC 2NPSC 1NQTA 3JCUZ 4YTPC 3ML0A 3WB1A 3B09A 1L0LH 2P4KA 3WUUA 5H2FH 1ORQC 5EYPB 3CC4P 2Q68A 5LHGA 3ZRVA 2HR3A 3E8FA 4GUNA 4JI8B 3IN6A 4IL6E 5JJEB 5AVVB 1FJGB 2BSKA 3AEAC 4IL6H 3JAKA 2WSFJ 3P8CE 2W83C 4FVMA 4JYCA 1W2BO 3RK3E 2POHA 3CXCU 4MT8A 3ETGA 4PHZA 4O2BB 1UPGA 2VQEB 2W8ZA 3L73J 3C8VA 2R9IA 1YIJP 2GV9A 2WLMA 2QKCA 2GTSA 4UCUA 4FJCC 1N8RW 5JJJB 5FLXN 2FB5A 3A2AA 5DJTB 3M06A 3T1HO 1JCDA 5B1AB 2ETNA 2EZOA 2AEMA 2ADQB 2OYIA 1BHBA 2P67A 5H6RA 1PNMA 1FFXB 3TGUH 3DXRB 4BIZA 3ZDMA 2OWOA 4LFCO 3RYIB 5KA5A 4GODA 4H13D 4GKJO 3OM3B 5C39A 4IHJB 4DR2B 5LL6Y 5CBHA 5BXZA 2O01J 4DV3B 4X1YB 1T8ZA 3AE6C 1VQ5P 1QLED 1P7GA 1W0KG 3DTUB 2N1TC 2OIGA 1LJ2A 4ZKPA 3FWLA 1OV9A 4N78D 2VQFB 2AZ2A 2PYLA 2OYIB 2YXQB 1W2BU 1BGYH 4JI2B 1HNWB 3SFDC 4JZGA 5J2UB 3TXSA 1PGQA 3FB6C 1PGPA 1LP1B 1G6UA 2NN4A 1ZRTE 3GWKC 1L0NG 2K88A 2DW3A 1W2EA 1IFJA 4PELA 3PJSK 5DN6G 3GMAA 4RQEA 3E2EA 1IDSA 3HE4A 3CE2A 3VQWA 1SF9A 2IYOA 1T3UA 2XAJA 3OUFA 2R5DA 3FXEA 3ABMC 1QX8A 5GTIE 3U10A 4WBNA 4ZBMA 1UIIA 2E42A 4DK0A 3PN1A 1IXBA 2PZSA 4MVSA 2FYUK 4KL1A 2JS3A 1VQ4V 2P1JA 5E1AC 1L0LK 5CBFA 2UXCO 4CS2A 4X89A 1GM9A 4CH3A 2FXOA 2PRRA 4WVZA 2A45G 1KP2A 1KMIZ 2QWNB 3H9VA 1XMQB 3KXDA 4OGQC 5BZBA 2Z4EA 1Q6UA 1SQXJ 3BATA 2N9BA 1KB9H 1Q6IA 5LYJB 4XDKA 3W7WA 3AG2C 4D7TA 3X2QC 3AEFC 1RP3B 4GLXA 1Q82W 4LFCB 4QE7A 1WAZA 4NXMB 3DC5A 4LF6B 2CTQA 4LWSA 4PJ0E 3G6BA 1WT6A 2CH7B 3RYCB 2HODA 2HPCB 3JSNA 4MVRA 3GW6A 1QL2A 3FX0A 1XBLA 3LNNA 2BE3A 1J1DB 3HKCB 5KTBA 1YHQV 2O01N 1NS1A 4WFFA 4BIOA 2UUCB 4TV9A 1VF5C 1PZQA 3CRMA 4PJ0Z 2WSCH 5KLVD 3QF7A 2ZDIC 2JJ2G 4ICGA 4ZHQA 3OGCC 2ZIOA 2J59M 2W90A 1EM1A 1S1CX 5CCHA 1QU7A 1YXBA 5LMUO 4AHCA 2M0BA 4CC6A 3P3PA 1M90W 5EYPA 2SPZA 3B77A 1VF5D 5AW3B 1OW8A 2QIWA 4UVAA 3FKSG 1J5EB 4DXWA 3HKEB 1NTZD 1ZR4A 3N2GB 2WA4A 1JUNA 2JP3A 1BS3A 1SQXK 3K08A 2WLIB 4WY4A 3HKDB 2D2CC 1RE4C 5LOVB 3N4XA 2F23A 1NBMG 1BSMA 1FXVA 1H2MA 4WFGA 2A06H 1KFNA 3OUSA 3E22B 3RBZA 3ETQA 2D2CD 4MW3A 1VQ6V 1KKDA 1K34A 5EIBD 1L4AD 1RE4A 2LGQA 1K92A 5AW1B 5GTHZ 5JH7B 3HD7C 2GA1A 1Y66A 4JAVA 1N73C 4AILC 1IBKB 2JDIG 1KC8W 4BWNA 4N6JA 1GM8A 3TYYA 1M57C 3CMEV 2XHBA 1WPXA 3M0DA 1HWTC 4NKGB 2YIUB 3K3WA 2ZVNB 1DF4A 4FFBB 2HPCA 2A7WA 2E76D 1GW3A 1NH2B 3HUSA 4JI0O 1X8YA 3B40A 2E3CA 2QJKC 4JAAA 4TSFG 3M9HA 5AW2B 3G80A 2VQEO 4PI0A 2O01H 2Z3YA 4A5UB 1G1JA 1K9MQ 1M56B 4R8CA 1F7YA 3ZBHA 4RUEA 1WJZA 2QKSA 1L0ND 2WMMA 1X4TA 2Y0DA 4O2AA 1SVFA 1T2KC 2X6CA 5J9PC 4NXNO 5APQA 1P84H 4BW9A 3AG4B 3WG7B 5LA6B 1V55B 3VQYA 4TUYA 3NFQA 1JTHA 2EILB 4JI7B 4PA6A 2FYUH 1EFRG 4NTWA 5LXTA 4X62B 3I56V 2FY8A 4X66O 1SQGA 3CXHE 3QH9A 1FDIA 3SR2C 1SA0B 1KECA 3PLNA 3AE8C 4F6RB 1BCCJ 1FFXA 5AW4B 1HTLC 4JI1O 2Y0CA 2FYNC 3L4FA 1QR9A 2Q69A 1JX9A 4B7EA 4OH8B 4NVPA 2IZ0A 2K3RA 1DTOA 4FLUA 1R5LA 3ZHTA 5ITZB 3MDSA 1OW7A 2KKWA 1YTFD 1SS1A 5DM6V 2NR5A 1J1EC 1SQVH 3ZJZA 2XDJA 3CJHA 1GRJA 1XMOB 1SQPJ 2HYNA 2KXPB 1SA0A 2GUZA 1BCCE 1YVWA 1EBOA 1NJIQ 1SQFA 3CP1A 1VEWA 1ZLLA 3RGBA 1JY2N 1L2PA 3P8CD 1FAFA 1IK7A 3RYHB 4L75A 2P22C 3JD0A 4JBZA 2YUAA 3Q2YA 5LHIA 3H1JD 1M93A 1FJGO 4DYLA 3CCEP 2O1JA 5KLVJ 3H25A 2WPVB 1NTZH 2EIJB 3B2EE 1N32O 4I50A 1NHLA 2CTRA 2H3OA 3SPHA 4QJFB 4IT5A 1FZGA 4ASVA 3L37A 1LWUB 2E5TA 3SDLA 3SWYA 3N2KA 4YXWH 2Z5IA 3ABKC 4GT1A 2CGNA 4NYKA 1BE3G 1FZBA 1KC8Q 2GUSA 3VMAA 4MS2A 4I55B 4H44B 1TU3F 3P32A 2OYHC 2HHHO 3BRTB 1Q8IA 4B3TO 3BASA 4NR1A 1NU1E 3EWKA 3ZIAG 3MUDC 3OTOO 4K3AA 3WU2Z 2W6JH 4YIPA 2IZ1A 1EZVE 2IPPA 1BDCA 2YICA 2DYSB 4N21A 3LDDA 3ABLB 1N7SC 3JASA 2Y4TA 1M9NA 2Z0AA 1SFCA 1GL2B 2JRIA 1AR4A 4DR4O 4W80A 2WSCJ 3JAKB 2QWQB 2NZ2A 3K5OA 1XL6A 2VS0A 1GAXA 2WLJA 5AW0B 1Q81Q 1URQC 3G3ZA 1IK9A 2E74C 1X79B 3HKDA 1N36O 4CPGA 1B06A 4ZI7A 1HBWA 4MTXA 1FDMA 1K97A 1JMBA 3FAVB 1NOHA 2Q1KA 1JCHA 2QJPB 1ZR2A 1FC2C 1BGYG 5CCGC 3CEIA 4MVQA 3H1HE 5AVYB 2GBOA 2ZR3A 1VMGA 4DV5B 4UCSA 3FYIB 4NTYA 4DV3O 4N3YB 4J7JA 3DXRA 4KP4A 4LP8A 5KHKA 2KS1B 1DIPA 3APQA 1YEWA 2PGGA 3CSXA 3N7NA 3RK2C 3RYHA 1SQVE 1H2GA 3S4RA 3EFFK 3K5NA 2W6BA 1V54B 1AVMA 4FFBA 2VQFO 3QG5A 4J41A 4LF4O 1N0NA 2ITCC 3AG2B 3K0GA 3VN0A 4JI5O 3J80N 1T3JA 1JB0J 1S76D 2HLOA 2B1IA 5AW5B 3UO2A 1Y76B 2WT7A 1LUWA 1CSBA 1P49A 1FFTB 2Q7GA 3UCSC 1BHAA 2IFMA 1K5SA 3JAMN 4PD4D 4EFBA 1HNZO 3B71A 4EOTA 1KFMA 1LT9A 2WPRA 1Q86W 1FYJA 4LF9B 3EFGA 1R6KA 3MAQA 1KYOH 1NTKH 2LXBA 2E43A 4BAYA 3B8EB 3L35A 2XAHA 3D3QA 5AW7B 5IJ0A 1DD3A 2XV5A 2MK3A 5LOVA 1RHZB 3OE7G 2QM4A 3VBBA 1YJ9V 3W67A 4HJGH 5FPOA 1Q6HA 2P10A 1RH5B 2N1TB 3CYOA 4BXLA 1QQCA 2YXHA 4TQFA 1SQXD 3E89A 1VQ8P 3FB8C 1COWG 3H1JH 4F6RA 2X6AA 3I55V 1JY2O 4JPRA 4YHHO 4PV1C 4JYAB 2W6AA 4O4LA 4N78E 3RK3B 1VQ7P 1AI5A 1H0TB 5J2TA 3Q5PA 4EB6B 4I5SA 1GM7A 3VQVA 1VQMV 2R9AA 3GHGC 1XNRO 2XASA 2R44A 4JYYA 1SQPE 1YI2P 1T6AA 5GONB 1LTBC 3VTPC 2UUBB 1N4CA 4F4LA 3ETEA 2H7HA 2EJRA 1X22A 3GWOA 2Y0EA 3L71H 2EX3A 3SJBC 1AV1A 3RK3C 3SWFA 2N04A 3L73G 1DD4A 1FXKB 2UWJE 1GZLA 1FE6A 3A3YB 1FZFA 1AP5A 4YJ3B 1Y4MA 4J11A 2WPDG 1EZVD 3FGAD 1N33O 2QM8A 1VQ8V 5CA1A 3Q4HA 5KLVE 4FLVA 3FB7C 1K73W 2CH7A 3RYCA 1S72P 5E79Z 4U3FD 3JAWB 5BMVB 4Z1MH 1Y74A 1BCCD 1R3JC 4KXRA 1TA8A 5APUA 1AA0A 2P5OA 1BE3J 2YXRB 4UV9A 1X59A 1OX3A 2CK3H 4AQRD 1FZCC 4WFAV 1FXKC 4JI6O 1JY2P 4PA9A 1K7DA 2R3SA 3K9AA 1PP9H 3ZRWB 5CJ0A 3OAKA 3O6QA 5F2VO 3G71V 2XUMA 4KJMA 3VQXA 1AJPA 1ENVA 4C7RA 5KHJA 1U7MA 5KLIB 1BE3E 2KLVA 5K1PA 5IDJA 4MN4C 4GOEA 5B5EE 3ZS8C 5BU5A 4TV8B 2FYUD 4LF7B 4GOFA 1R6NA 4IYHA 2KUBA 4X88A 5L3DA 2YIAA 3F7YC 5JCOC 1H8EG 2KNCB 3E7KA 3GF3A 1B6QA 2UXBB 4DV0O 1QVFU 1E1RG 3THOA 4A7PA 2YKOA 1CP9A 4HBNA 3I5CA 1IBLB 1M7LA 1L0NH 4DUYO 2Q0AA 3FB5C 5AG2A 1Y9BA 1PV0A 3IAYA 3U11A 1GDTA 4LFAO 3MHSC 2L6LA 4MVUA 3O65A 2B1GA 1VQLV 1MFZA 3VMYA 1W0JG 5BU8B 1AROP 4UV8A 2WPSA 1FU1A 2LW7A 2E75B 3AEDC 3V2RA 3B5ND 4QIWF 3JARA 4X62O 4DR3O 1U97A 1R3IC 3H1LJ 1K9MW 1H38A 2XZRA 2FFDA 1WA8A 2N9YB 1RE3C 2NPSB 1VDFA 3ITKA 4M3LA 1BT8A 2E5YA 3PTZA 1OCRC 2KZJA 1SQVG 5A2QN 4O9BA 2IJHA 4LF8B 5APSA 4PI2A 3SPIA 2FYZA 4TOIA 5BY1A 2L35A 2IJJA 2F95B 5EK0A 1AI4A 4KHPO 2CPSA 5B1OA 3BVOA 3RYIA 2LQTA 4I0XB 4WF9V 4WCEV 4WBAA 2H43A 1SQPD 3H1LE 2XNXA 2EINC 3SPCA 3WUVA 3G6EV 2VRZA 4UCTA 1D5AA 5KJ7C 3A0RA 1XI1A 5IY5C 2AW9A 2N1TA 1H8AA 5CJ4A 4IL6X 2WLLB 3QO7A 2RKLA 4R4MA 1PGJA 1XHXA 1QL1A 3L72H 1WB7A 1X0TA 3H1KH 3H1KJ 3M91A 2BTQB 2RCVA 1US6A 3S3XA 4EDFA 1LP1A 1ZN5A 3OD4A 5CA0A 2F93B 5B1BB 4LWSB 5B5EZ 5IYCO 1CI6B 5AW6B 5BVZA 3Q3DA 1VF5B 1VQKV 4B08A 3C1LA 3AG1C 3IC9A 4BR6A 1XTGB 4Z2WA 1AJQA 4U3FG 2IU3A 2Q4PA 3CMAV 1KILA 3LW5H 2LJ2A 2QJ1A 4JYBA 2Q5UA 3H1KE 2DYRB 4IIJB 3K5MA 4OPHA 4YXWG 3L73D 5GTIZ 4L73A 5DECA 1S5LH 1VQPV 1PD3A 3M8AA 3ABVC 5JVDA 4HAMA 2E5LO 2JS5A 1DK1A 5IY5B 1TVKA 3J81N 4W7ZA 1SS3A 1GW4A 2YIDA 4U7NA 1F23A 2DWEC 5H2FZ 3ZMUA 2EIMC 5EZYB 4DR7B 2YO2A 4B3SB 2FFDB 4JTCB 3HD7A 3B8NA 1PL4A 4JI4B 2WSSG 4H13C 4FM1A 4PDVA 2I1JA 1PNLA 4I6MC 3A0HE 3CCLP 2P06A 1SQQK 3OJAB 2ZQMA 1XNRB 3A7OA 1VQ6P 2QG4A 5H2FE 1VQKP 1AR5A 2WA3A 4LF4B 3CB2A 1SQBH 4RO0A 4HNAA 1ZTEA 3TJTA 4OGQD 5GTIH 2DQ0A 1PPJG 3CMEP 4HB1A 2N05A 1KUQA 1SZTA 3IAOA 3OMNB 1XNQO 3JALB 4H0LD 4RQFA 4WB4A 4K35A 2PTMA 1NTMD 4JTDB 4AQYO 3CRAA 3VMXA 3AE3C 2Y9ZA 1OCOB 1I7FA 2FMLA 4ASWA 3B5NA 4B3RB 1BE3D 4DV7O 3KHUA 5AW9B 5AW8B 2WLHA 2XU6A 3L70G 1OCZC 1P84F 4DW1A 3U0ZA 2I8DA 4HYTB 3TGUJ 2R70A 1NT2B 2HJFC 2AXTE 2JK5C 2YXLA 2ZXWC 5LYJA 4AI8A 1M57D 3KZIE 4PA4A 2A3QA 1EQ7A 1Q3EA 3H1LG 2DOSA 2P4VA 2RMZA 1NU1D 2C9NY 3JARB 3L74E 5KLIC 1NTKE 3MHVA 1SETA 2D3OW 2E76C 3OAAG 2M3EA 4DR6B 3ASOC 1DGSA 2KP8A 2NPSA 3CX5H 3TGUE 2ZE5A 2PI5A 4XDJA 2JKVA 1HH0A 5KAFZ 1QLEB 2AXTZ 4OVNF 3G71P 2N74A 1JFFA 1NTMJ 3ABMB 3L71J 2BSKB 1L4AC 1NU1G 2QJYC 1M90Q 1FZCA 1FXKA 4ASUG 1MNGA 2J5UA 4K8XA 1ZL8A 4X1KB 3S3WA 4RJTA 4DR4B 2LFSA 1VQNV 1EDIA 5L8RJ 3WUTA 2W0FC 4D6TH 1HGZA 2QE7H 1OCCC 3H1IH 1V54C 4DRXA 1L0NK 1PV3A 1UIXA 1FS0G 3L75E 1Q86Q 2Q67A 1L4AB 2QJYB 3IFMA 3W7SA 3L71E 4DO2A 4J9ZB 3H1LD 4JI7O 3H32A 2OYOA 2UUCO 1AQTA 1EN4A 1KBHA 1ZL8B 5EC1C 3ASOB 3AE4C 5KLVH 3IFXA 1WA8B 3GHGA 1SKVA 3L75G 1XNQB 2Q3EA 2CTPA 3LSSA 3UQ8A 3CD6P 5KMGA 2JIZG 3AG3C 1DEBA 3APOA 2IU0A 4JI8O 1Q82Q 3K59A 4B3MO 3RGUA 2RDCA 1L4AA 2HJDA 3OR6C 2GUVA 2M5AB 1H2SB 2V7QG 4IIJA 4BRYB 4U3JA 4U7OA 1Z56A 5D5PA 1RE3A 1RF1A 2IBZD 2P6JA 1K3EA 1OCOC 1BSNA 4FLTA 1ZRTD 1P4RA 1IBLO 3TETA 2L91A 1JM0A 4O2BA 2HODB 3ZMVA 4X1IA 1NTZK 3QVNA 5EBMC 3KZIH 2FXMA 1YI2V 5KA6A 4LFAB 2O1KA 1KQLA 5KMGB 2K1AA 4FLYA 1YITV 1N2DC 3BCCG 1VQ9P 1EZVI 2Y69C 1RPRA 4IGGA 2JR8A 4TWKA 4QE9A 2AGAA 1N0JA 2RN0A 5CMUA 3Q5SA 4U7JA 1D5NA 2DMXA 1A32A 4O4JB 3ZMZA 1VARA 4IOIH 4EIJA 2ODMA 1WP8A 2IYPA 2XNDG 1J2JB 4IHJA 1GL2C 2L5GB 3AECC 4JYAO 4TQDA 3L74H 2WAMA 3A0BH 1T2KD 3SJCC 1KYOE 3USSA 4AYCA 3CS5A 2QEXP 3Q1MA 2X0LA 3JALA 1QLNA 4UCRA 3RW0A 4DV4O 4X64B 5JJNB 2BCCH 1SC5B 2ZJSE 2FXPA 1P84E 4UXNA 2AZ0A 3CX5I 2ZM6B 3TGUD 1QBZA 2JWAA 3ZHVA 2I1KA 2A0LA 1DH3A 3RL0B 2LO1A 5KUMA 3V2QA 5CCGA 2YXYA 5K1XA 1VQ9V 3HRNA 1GD2E 3LDEA 4LGDE 2CDYA 4PD4H 2QWPB 3ASNB 2FTKA 3HPLC 1O9HA 2M3BA 5EBWC 3HE4B 4GIFA 3BCCD 2F4VO 1NTKK 5B66Z 1NJIW 1KYOD 5CHXA 2WT7B 2QSAA 5KAFH 2FFDC 3H1HH 4I9WA 3L74J 3UM7A 3PP5A 3SFEC 2IW5A 3JC22 5LGNA 1JOYA 3M7MX 1OMIA 5DJUB 1PKXA 2OYHB 3F5WC 1XMQO 1HNXO 3L71D 3MUDA 1KILD 4AQYB 1BGYJ 3VYIA 1EZJA 4BW5A 1U57A 1N73A 1YJNV 4JAUA 1SQXE 1KYOF 1VQLP 1B3QA 1ZAUA 2Y0PA 1KILB 1LT9C 2E74B 4X65O 1PGOA 3RL0C 5B1AC 1RQUA 1H2KA 3LDCA 1I5YA 4DV6B 2R9RB 3ZRWA 2G8YA 2G3AA 2JWDA 5AVSB 3D8CA 4X1KA 3AE1C 3C90A 2KSDA 2FBWC 3JD2A 2ZFCA 3BRVB 4YJ2A 1RM1B 1PPJE 1EN6A 2H94A 3L72E 1JOCA 4I9QA 1SQVD 3JD4A 2ZXEB 1U96A 2AHZA 1KILE 3RWRD 2QWOB 4FZ0A 2IBZE 1D7MA 1QVGO 2MW2B 1XREA 4Z1MG 4DUYB 2CPBA 3K9SA 3JASB 3WFVA 4GX5A 2BTQA 4C7UA 1WPBA 2KNCA 1AVYA 4DZOA 1Y67A 1OW6A 3A8TA 3B4SA 1JY3P 3L72J 1YJNP 2EINB 1PPJH 4GCZA 4DK1A 2JGUA 1GK4A 4C46A 5IYZA 2Q6QA 2FKWB 2QE7G 5KJ7D 4L76A 2W0XA 3S9OA 4DR5O 2IJIA 1SQQH 1XUQA 3QTCA 3DC6A 2GDSA 4O4HB 4WY4C 1HR0B 1EC5A 1L0LG 1PFIA 2QJKB 4AUWA 1LTTC 3H1HJ 1CW5A 1YTZI 1FXHA 1FZCB 5JWPA 3AE5C 3T1YO 5CMZA 1I94B 5AVQB 3CC4V 1PM9A 1GK6A 3MHHC 4UCOA 2BCCD 2OYHA 4EI2A 1SQVJ 4LF5O 5LP6A 1HF9A 3CCSP 1BMFG 1DLBA 4OXSA 1NR7A 3TNUA 5K5GB 3TK1A 1QNMA 4DUZB 2LP7A 4ABMA 2RQ6A 4PA7A 1SQBK 3TF5A 1VQOV 1NAFA 1R3LC 3RN4A 3K58A 2WSEH 5J2UA 1VL2A 4RESB 2BASA 2QR4A 5GTHE 4NPFX 2ZAEB 1JY3O 1BCCG 1FJPA 3GHGB 3GLMA 1Z5WA 4HNAB 2OTJV 2PP6A 2Q7EA 5GW7A 1S77D 1MFTA 2A06D 4JV5B 1AI7A 2ZNIA 3R2PA 1RSOB 1I0HA 2YEVA 1NZ6A 3CX5D 3G4SP 4I7ZC 1KQSO 3K79A 3OW2O 4DR1B 1KV4A 3VMZA 1FZAA 5AVRB 3TGUG 2QKAA 3D71A 2PY5A 4P9OA 4LC1A 2JGDB 3VP9A 4LF9O 1QLEC 3D36A 3AEGC 3OTFA 2UU9O 5IYDO 1LT1A 4GZRB 1KU9A 1E5WA 1NAYA 5APVA 3E83A 3FYEB 2FYUG 1EDKA 4I50B 5CBNA 1UFIA 2IM9A 1NKZB 2GHYA 5B5EH 3K57A 2ZT9D 3AE7C 3L72G 4WWIA 1WNSA 4JGSA 3UT5A 1E1QG 3AG3B 4JI0B 3D6ZA 3IC7A 1YQ3C 2B9ZA 2UXNA 2OCCC 3F5HA 1GMJA 1YDXA 3ZN0A 3FX7A 4GKJB 1GTOA 2K1EA 3QWOC 1AFOA 3SYPA 3HD7D 1Y76A 3KYQA 5BR8B 1P84D 2GSMB 5CA3A 2PFXA 3AG1B 3H1KG 3NTNA 5L3EA 1CEZA 1S5LE 1URQA 2PGDA 1SQVK 2ZYAA 5LMNO 1L0LJ 3T4ZA 2Q7HA 2A9HA 3HTKA 4P9PA 3AK3A 1OFCX 1GTWA 3CRCA 3BEHA 3H1JE 1IO4A 2B87B 3MP7B 1QVFO 2KSJA 4JV5O 2LXCB 1FJKA 3KG2A 4JI1B 3LW5J 2EJ7A 2ITDC 3RFRA 4CC5A 1YYCA 3C3SA 4P30A 4DJGA 1FDOA 1S0VA 4JF3A 1S2EA 2BOBC 5B1NA 4JI6B 2E75D 3LNMB 5KHGA 1PPJD 1ZV8A 3RVYA 5EIBC 1NYHA 2ARHA 4UCVA 3HKBB 1G2CA 4ZIBA 2OYIC 3H1JJ 2Z5UA 3V2NA 2JO1A 4FLWA 3L74G 4MTGA 1IJDB 1G8MA 3WB0A 5LGTA 3CC2V 5H9CA 2ZYDA 2F66C 3CCRP 1CZQA 1K5QA 5HFMA 1P84I 4IFFA 5JH7A 2M5AA 3HUSC 4OWFA 4LCUC 1SFCB 2MJZA 3G6EP 4FM2A 3P30A 3EQ2A 5CCHD 5LBQA 1N8RQ 1XEQA 5H5NA 2H88C 1JY3N 1SQPK 1W59A 3WU2H 3O8ZA 4XA4A 5LP6B 4B3TB 2NRGA 2JEUA 3BVHA 1M5IA 2Z5HA 5KAIH 4CS3A 4X66B 4NPDA 1KD1Q 2LFRA 2QM7A 1KB9D 2K9JA 4XFJA 2VRSA 4CH4A 2Q9LA 1OHHG 4JI3B 3D36C 4KHPB 5C93A 5JVDB 1URQB 1TVKB 3ZHUA 2F4VB 1IX9A 1IBMB 1K8AW 1ZMEC 3CCEV 1S5HC 2OCCB 1PL0A 3MIWA 2HVKC 5FNVB 3L70D 2C2AA 4GYCB 2ZM6O 2K37A 2WVRA 3UO3A 1OVVA 1IFNA 3T1CA 4FPPA 4FIPC 4P2ZA 2ILMA 2W27A 3RK2B 4DV5O 1PL5A 5TISH 4LF5B 3H1ID 2DWDC 1L0NJ 5E79E 2YNYA 2QTSA 3EHBB 2KG7A 3KCYA 1BQ0A 5AVWB 1GN4A 3JCUH 4UFZA 3SGIA 2ZE7A 2EIMB 3OT7A 4WFHA 2QDOA 4H44C 2QJPC 2ZE8A 2V4DA 4CS4A 3ZCCA 5FNVA 1L8DA 1F51A 2DQ3A 2IBZH 3V4QA 3CWBE 4L87A 1MV8A 4PV1B 4U3JB 3B5NC 1L0NE 1SP4A 3OEHG 2WWWA 1Y6XA 2ZINA 1YTFB 1NU1H 3GF7A 5JQGB 1EZVG 1WB8A 4O2AB 2KS1A 3Q5RA 4CZZA 4JPZB 1KP3A 3F5TA 4X1YA 5KJ7A 1VQOP 2C9LY 4DRXB 3H1IG 1THZA 3WB2A 5KLVG 1NTZJ 3E1IA 2H89C 5IYZB 3IJ4A 1S3JA 2Q0OC 4DR6O 1LNQA 2YC0A 2F1MA 2VWJA 3WG7C 4RUFA 1MSWD 1IVSA 3BFRA 3AE2C 3T1HB 2UXDO 2AXCA 2JDIH 5KX5B 5L3GA 1KQGB 3RK2D 2WITA 2OTJP 3BRCA 1EN5A 1GK9A 4D6TJ 3SPJA 2OTLP 1MMMA 4I7ZB 5CBOA 1ZWIC 1VIBA 1LTGC 1NVPB 2R5BA 5AVZB 1EDJA 2A06G 2QWRB 3OFNG 4JI2O 1HNWO 3AEIA 2BOCC 1MZEA 5IJ9B 1NTMG 4G28B 4MVMA 3MZWB 3F89A 2WLLA 2A45I 3R4YA 1IURA 3TNUB 4EKWA 4DV1O 3CJHB 1HP8A 2CK3G 4JI4O 1S9KD 4QMAA 4Z1VA 1USDA 1NTZG 4YPCA 1Q7YW 1YITP 2E74D 2VWKA 4X20B 2LW1A 3SJAC 4I4TA 4HH2A 3ABUA 4O4LB 1MKMA 1YJ9P 1FZEA 2YI8A 1T5EA 2F43G 3AK2A 2CE4A 4LR3A 2R32A 4R4LA 4KT0J 2XAFA 2WLKA 5H6QA 2PAJA 3HB3B 1I08A 1ZXGA 1AP6A 3H6PA 2CTWA 3LIEA 4R6ZA 3CXHD 1ZUQA 2ZE6A 1OZ0A 4X20A 2R3CA 4W4KA 2UXXA 1AJYA 3RK3D 3CCQP 2WSEJ 1G4YB 2ZXXA 4PDRA 3M9BA 1CXZB 3L9DA 1NTKJ 3K0DA 3SPGA 3RL0g 3JATB 4XBFA 3Q4HB 4DR1O 1FAVA 3J7AU 3KPEA 2Q9IA 1Y74B 1NO4A 3E8BA 1NTMK 3HKCA 1URFA 3VP8A 1FOSF 5AVTB 2UU9B 5KAFE 2BCCJ 4DR3B 1JMKC 1LT9B 3W7XA 5KX5A 3VOPA 4G27B 1X9VA 3CD6V 1OVRA 1JO5A 1SQBJ 2WZ7A 2HP8A 2ZT9C 3CCJP 1IFPA 2EIJC 1XTCC 3OTOB 4JASA 3FWNA 2EZPA 2RH0A 3EXAA 2IDBA 1N7SA 5CBGA 4DR7O 2KQXA 2ZYGA 4YY3O 2KB7P 2O57A 1AI6A 3HR0A 5LXTB 1BQZA 1LTIC 1N34O 2ITAA 1RF0C 2BCCE 1K05A 2YEVB 3JYCA 4MTOA 1R6TA 2R72A 3H1HG 1Z2GA 1M57B 1XOUA 4MSWC 1BE3H 1N33B 5AVUB 4G2KA 5TJHA 3U1AA 2GM4A 5BR8O 2BEQD 3II6A 2DN9A 1VF6A 1SESA 4LF6O 1LTJA 2DJVA 2Q3IA 3F7VC 2W6JG 2D2CB 1VQ4P 2QGNA 4GKKO 2YMKA 4ZMDA 4FM0A 1M1JA 4FLXA 3CCVV 1KORA 1J1DC 1N7SD 2K9YA 2A06E 3CPWO 3H1JG 2XT9A 4PD4I 3BA8A 2DE0X 3E1RA 2CUGA 3M9QA 1ZX3A 4ZHQB 4YJ2B 1OCRB 4JTAB 4IFDK 4Q6GA 1OCCB 1V55C 3JAWA 1VQ7V 1RY3A 4X9QA 2E76B 3LSQA 3CCLV 1FKAO 5KKZB 3C9IA 1N7LA 5TISE 1J1EB 4J10A 3CWBH 2E5LB 3H1IE 3H1KD 5B66H 4D6TE 1JA8A 1SQQG 1MSDA 4J9YB 1LWUA 4UVBA 3TCUA 5B1BC 3RT3C 1E79H 4Y99B 1GN2A 2JEEA 4U3FJ 4FK5C 1R73A 2RNBA 3QO8A 1SQXH 5TISZ 1RSOA 4LBEC 2UUAO 4UB6E 4JI3O 1SQPG 4DV4B 1URQD 1XQ8A 4LNUA 1QHTA 4UB8Z 1SQQD 4LH6A 3L71G 5IWAO 3RL0D 2HLDG 2ZXWB 1H88A 1DF5A 5B3SC 4O4IA 1GN6A 1HWYA 1W5CE 3L73E 3OGIB 3ABKB 4U3FE 2M8RA 1GO3F 5KHHA 2W6IG 4YHHB 4LH7A 1BCCH 1S9KE 2M6YA 1R8EA 1USEA 3L70E 2AXTH 1TUEB 3FFQA 3A5TA 1H2NA 4UB8E 3D6YA 2ZD9A 3O9OA 2FYUJ 1ZLZA 4UUJC 3A0BZ 4LNUB 3T97B 2DYSC 1ZSPA 4HZ3A 2LGWA 3W7TA 1TUBA 1LTAC 4B3RO 4B3SO 1WRGA 2OYQA 1A02J 4PDLA 1HR0O 4W4LA 1SERA 1EXIA 3CC2P 1VF7A 1ZOYC 3CXHF 2Q8VA 4TUYB 3CXHI 4OGQB 3HD7B 2AEFA 1IC2A 3CHXA 4QGPA 2OTLV 2FYUE 1PP9D 2QEXV 4X65B 2OQQA 1KQSU 1NH2D 1AB3A 3GG2A 2DYRC 2YKQA 2P7TC 4H0LB 4Y99C 1SQQJ 3SYQA 1SFCD 2H8PD 1OCZB 1JCCA 1A02F 1PNKA 2OARA 3HTKB 4TT3H 2YIBA 5KHIA 1OXZA 2JJLA 2WTYA 4E4EA 2EULA 3LSUA 3S1KA 2XAGA 3CRQA 1ZW0A 5LP6C 5BMVA 5KKZC 4W7YA 1RF0A 1YHQP 1GH6A 4NB5A 2EIKB 3SJQC 1HDJA 3STLC 5L3CA 1MZFA 3QO5A 4K0KB 1PP9E 1GN3A 1XMOO 1JQ0A 1M1KW 3ABTA 2HEPA 2XTAA 1WP7A 2V7QJ 3CCVP 2B89A 2HFED 3IR9A 1K4CC 1MABG 1K4DC 1Q7YQ 2UUAB 1SZXA 4D7SA 4J7KA 3L75J 4H0LC 4D6TD 1JTHB 4PD4F 1N86A 1H8HG 3WMM0 2B9BA 3K5BA 3BABA 2MKVA 4PJ0H 1PP9G 4B86A 3QNEA 1KB9I 3CI9A 4TV8A 1LGHB 2YMYA 3C3TA 4EFEA 2PI4A 2WQYC 2YIUC 2A79B 1S5JA 3SYAA 3NR7A 4WY4D 4NXMO 1OIPA 1FD9A 1QEXA 2BEZF 1NTMH 4LF8O 3KCXA 1F4NA 1KKCA 2ADPA 2FL4A 3VOUA 3OEEG 1IBMO 4ZOLB 2HKOA 2EIKC 2YDEA 5FL7G 3OR7C 2V7QH 3UKMA 3JCZA 4J7ZA 3LIDA 1K73Q 1J5EO 2UUBO 2OTKE 1VF6C 1Q43A 4L74A 1U7JA 1WLEA 5L3BA 1RF1B 3ZHRA 3U59A 1FS0E 1JEKA 1OZHA 2OT5A 4X8AA 2YO3A 1LTSC 3I55P 1VQPP 5CA0B 1CI6A 3OMAB 1I94O 3E8HA 1Q2NA 1TGOA 5CCGD 4CBCA 5GTHH 3L74D 4MTFA 4C7NB 3I5DA 2RJZA 1CPYA 1OJHA 4B3MB 4DCKA 4ZOLA 4IYIA 4PD4E 2PUSA 3CCJV 5C8YB 3T4DA 1IBKO 2WSSH 3NMDA 5EBLC 4GKGA 4FLZA 2EBOA 1SLQA 1GU4A 2DW4A 3CXHH 1YBKA 2PF4E 2WLNA 1HUCA 3AEBC 2Q7CA 1NI8A 3ZN1A 4YY3B 1Y8AA 3L70J 4QPJA 3I56P 1KB9E 3DGEA 2P2UA 2ZT9B 2K9JB 2IBZI 2RMKB 1YZBA 1XL4A 4N23A 3CC7P 2KLUA 2LR2A 1S4XA 3L75D 4WBNB 2Y4UA 1KN7A 4GDOA 4NXNB 4GX0A 2UXDB 2N1TD 3WU2E 3UT5B 3GB7C 3HKBA 5CA1B 3V4WA 2Q73A 4ZI7B 5L3FA 3IF4A 4KHXA 3X2QB 2ZDIA 1VP7A 4OPAA 4XE5B 3L70H 1M1KQ 1BSHA 2O3JA 1SQQE 5CB4B 3RBXA 1OWAA 3ZRSA 5KUKA 5B66E 3CCQV 3TXQA 3D3IA 4GX1A 2Q5ZA 3A2FA 2E75C 4GKKB 1EXJA 3T1YB 3B5NB 2WLIA 3CMAP 1L0LE 4EB6A 1NWQA 2YI9A 1D2DA 1BGYE 3CCRV 1AR1B 4I55A 1RPOA 4R7CA 1M8OB 5EZYA 2CAZC 3H01A 3ZHQA 4UB8H 4UB6H 4RKUJ 3JSLA 2J58A 3OW2U 2KZIA 4FFKA 3CC7V 3BCCJ 1PP9J 2IBZG 2H8PC 2PYJA 1SFCC 1YQ4C 3T97A 3GVMA 1GU5A 5CB4A 2WPQA 3P7KA 4DV7B 1IFDA 1Q81W 5LHHA 1QGKB 3L73H 1EZVH 4I4TB 4YJ3A 2V4HA 3ICXA 1YTZT 3OMIB 5IJ0B 2M7WA 1KB9F 3FD9A 5ITZA 3CX5E 1R3KC 4I2LC 4D6TG 2Y69B 3JD1A 1VQNP 1SQPH 4DV0B 5B3SB 1KQFB 4BRYA 2ZR2A 3ETDA 3MGNA 1M1JB 1XHZA 4PV1D 3KKYA 1HNXB 2ZCEA 3CCSV 3E86A 4XDLA 4O4IB 2JEXA 2NNUA 4UB6Z 3NXSA 3KDPB 3HE5B 1JVMA 3CCMV 5IWAB 4DV6O 1M4UA 1SQBD 1N73B 3DSQA 1G1XB 3L75H 1Z5VA 4JZ2A 5APYA 4DR2O 1RQVA 1AQ5A 3H1LH 1B04A 4O4JA 3W7UA 2IFNA 1JR9A 2ZIMA 1EDLA 1K33A 2P90A 3ZMSA 3LUTB 1ZP0C 4MW8A 1MOFA 3A0BE 2XKMA 4RWUA 4PA3A 2YSUB 2HG5D 1WMKA 1NTKD 4DV2O 2HFEC 4BIUA 3AE9C 1K8AQ 1HJ0A 3HE5A 1NU1J 2HG5C 4LFBB 1R1BA 5E79H 4NTXA 2C0XA 4HYOA 4RO2A 4H44D 4YIOA 2QRXA 4J80A 1QCEA
chains in the Genus database with same CATH topology
1SQGA 1FDIA 3SR2C 1SA0B 4EEQA 3AE8C 4F6RB 2E74D 1FFXA 2YIBD 2VWKA 4X20B 3RYFB 1TAEA 3SJAC 2FYNC 1K04A 4I4TA 5LMNB 3AE4C 4O4LB 1MKMA 4NVPA 2YI8A 1T5EA 4K8ZA 1SKVA 4FLUA 4LR3A 1XNQB 5ITZB 3UQ8A 5KMGA 1OW7A 2KKWA 1Q5OA 4R4LA 4KT0J 1Q90D 3K59A 2UXCB 1XMOB 1H2SB 4IIJA 1SA0A 4U3JA 1SQFA 5D5PA 3RGBA 4X20A 4FLTA 1PIXA 1IK7A 1AJYA 3RYHB 2P22C 2WSEJ 3Q2YA 4O2BA 3RL0g 4X1IA 3JATB 1M93A 4LFAB 5KMGB 3H25A 4FLYA 2WPVB 3B2EE 4I50A 3HKCA 1V9PA 2UU9B 1JFFB 3Q5SA 4TV9B 4DR3B 1JJOA 1JMKC 4O4JB 3AEEC 4U7JA 5KX5A 3ZEDA 3N2KA 3BA9A 5M1BA 2ZT9C 4IHJA 3OTOB 4DV2B 4I55B 1TU3F 4H44B 3JATA 3AECC 2IDBA 4TQDA 1Q8IA 5D5QA 3SJCC 5IJ9A 3EWKA 3Q1MA 3JALA 4UCRA 5LXTB 1K05A 4X64B 3JASA 5JJNB 2FXPA 2R72A 3HKEA 2ZM6B 2WSCJ 3JAKB 3N2KB 1WN7A 3K5OA 2NZ2A 3BAAA 3N2GA 1N33B 2E74C 5K1XA 5J2TB 3HKDA 2BEQD 4ZI7A 1O9HA 2D2CB 2YMKA 5C8YA 1O9GA 4DV1B 4FM0A 4FLXA 4DV5B 3SFEC 4UCSA 1KORA 1TUBB 2K9YA 5KHKA 3BA8A 1DIPA 3M7MX 1YEWA 2PGGA 3CSXA 1OMIA 4ZHQB 4JI5B 2BTOA 3RYHA 4YJ2B 3K5NA 4FFBA 4X1IB 3QG5A 4Q6GA 3JAWA 4AQYB 4YXDC 1U57A 2E76B 1JB0J 1HNZB 1ZAUA 3BHPA 2E74B 1RQUA 2E5LB 5LMUB 4CH6A 1P49A 4DV6B 2Q7GA 2QSIA 2G8YA 4EFBA 2G3AA 3B71A 1S5LX 4LF9B 3MAQA 4X1KA 3AE1C 4BWAA 2FBWC 1KTMA 4YJ2A 5IJ0A 1DD3A 5LA6A 5LOVA 4Y28J 2QM4A 4I9QA 4H13B 5FPOA 1RSOA 3E22A 3RWRD 1KILE 1NGMB 2P10A 4DUYB 4CH5A 1QQCA 4TQFA 4DV4B 1XQ8A 2ZNJA 4LNUA 4F6RA 3JASB 1QHTA 4LH6A 5JQGA 3RYFA 2BTQA 4PV1C 3K5LA 1WPBA 4O4IA 2HHHB 4JYAB 4O4LA 3BPZA 1OW6A 5KHHA 5J2TA 4EB6B 3Q5PA 4YHHB 4DR5B 4LH7A 3VQVA 4DK1A 2JGUA 2R9AA 1R8EA 5IYZA 3FFQA 5GONB 2UUBB 3S9OA 3D6YA 5JCOA 3QTCA 4O4HB 4LNUB 1HR0B 3T97B 2EX3A 1N34B 4OX9B 4L8JA 3SJBC 3D70A 1TUBA 1N36B 1DD4A 2OYQA 3AE5C 1I94B 4YJ3B 3FGAD 4UCOA 1EXIA 5CA1A 4FLVA 3RYCA 1VF7A 5LP6A 1HF9A 1ZOYC 4TUYB 3JAWB 5BMVB 4Z1MH 1HW7A 2JVDA 1TA8A 4OGQB 2P5OA 3CHXA 5GONA 4DUZB 4X65B 2RQ6A 5FPRA 2OQQA 4O4HA 4H0LB 3K58A 5J2UA 1N32B 1VL2A 3O6QA 4TT3H 2YIBA 3G9RA 5KHIA 3VQXA 3GLMA 1Z5WA 5KHJA 4HNAB 2Q7EA 5LP6C 5BMVA 4JV5B 2ZNIA 4YTPC 5KKZC 3WB1A 5K1PA 3ZS8C 5EYPB 4I7ZC 4TV8B 3IN6A 4JI8B 4K0KB 4LF7B 5JJEB 4DR1B 1FJGB 3AEAC 3JAKA 2WSFJ 4FVMA 2HEPA 3D71A 2PY5A 2YIAA 5JCOC 2V7QJ 3RK3E 3GF3A 2UXBB 4PHZA 4O2BB 2VQEB 3AEGC 3OTFA 3THOA 3C8VA 4HBNA 2UUAB 1IBLB 2GV9A 4D7SA 1KU9A 2Q0AA 4H0LC 4UCUA 1Y9BA 3IAYA 3U11A 5JJJB 4I50B 3BABA 2MKVA 2IM9A 4TV8A 3K57A 2ZT9D 1FFXB 3AE7C 4EFEA 2WQYC 2OWOA 2YIUC 3RYIB 2E75B 1S5JA 3AEDC 4H13D 3JARA 1WNSA 3UT5A 4JI0B 3D6ZA 4IHJB 4DR2B 2BEZF 1YQ3C 2O01J 1GMJA 4DV3B 4X1YB 3AE6C 4GKJB 4ZOLB 4LF8B 4PI2A 2VQFB 2PYLA 5BR8B 4TOIA 2F95B 1Q43A 4JI2B 1HNWB 3SFDC 3RYIA 5J2UB 1G6UA 2Q7HA 5CA0B 1ZRTE 4UCTA 1D5AA 3GMAA 1TGOA 1XI1A 2RJZA 4B3MB 4ZOLA 4JI1B 4IL6X 3VQWA 2PUSA 3LW5J 5C8YB 4R4MA 1XHXA 3RFRA 4CC5A 1FDOA 4FLZA 3U10A 4JI6B 4WBNA 2BTQB 5KHGA 2E75D 4DK0A 3PN1A 2PZSA 5EIBC 1NYHA 4KL1A 4UCVA 2F93B 5CA0A 3HKBB 4ZIBA 3AEBC 3Q3DA 4CS2A 1VF5B 4CH3A 4YY3B 2JO1A 4B08A 4FLWA 1KMIZ 3WB0A 1XMQB 2F66C 4OGQC 2ZT9B 5LYJB 2QJ1A 5JH7A 4D7TA 4IIJB 3AEFC 3K5MA 4FM2A 4WBNB 4GLXA 3ABVC 4LFCB 5JVDA 2H88C 2JS5A 4GDOA 4NXNB 1TVKA 2UXDB 4NXMB 3UT5B 4LF6B 3HKBA 5CA1B 3RYCB 4ZI7B 5LP6B 4B3TB 3JSNA 5EZYB 4DR7B 4B3SB 1M5IA 4CS3A 4X66B 4JI4B 4H13C 4FM1A 3LNNA 3HKCB 4XFJA 5CB4B 4CH4A 4JI3B 2UUCB 4KHPB 4TV9A 1VF5C 1XNRB 5JVDB 3A2FA 3QF7A 1TVKB 2E75C 2F4VB 4LF4B 4ZHQA 4GKKB 1EXJA 2ZIOA 3T1YB 3CB2A 1IBMB 4EB6A 1ZMEC 2YI9A 4I55A 4HNAA 4OGQD 5EZYA 2CAZC 1S1CX 5FNVB 4GYCB 4RKUJ 4AHCA 3JSLA 4CC6A 3IAOA 5EYPA 3JALB 1VF5D 4H0LD 2PYJA 1YQ4C 1OW8A 2PTMA 1PL5A 2QIWA 5CB4A 4LF5B 4DV7B 1J5EB 3HKEB 3AE3C 1I7FA 4I4TB 3N2GB 4YJ3A 2JP3A 4UFZA 3SGIA 3ICXA 4B3RB 5IJ0B 3HKDB 4H44C 2D2CC 5LOVB 5ITZA 2QJPC 2V4DA 3U0ZA 4CS4A 5FNVA 2R70A 3E22B 3ETQA 1L8DA 1NT2B 2D2CD 4DV0B 1KQFB 5EIBD 2YXLA 5LYJA 4U3JB 4PV1B 5JH7B 1Q3EA 1XHZA 4PV1D 4AILC 2ZINA 1IBKB 1HNXB 2ZCEA 3GF7A 5JQGB 3JARB 5KLIC 4O2AB 4O4IB 3Q5RA 2XHBA 2E76C 4X1YA 4DR6B 1DGSA 4FFBB 4DRXB 5IWAB 2E76D 3WB2A 1M4UA 2H89C 5IYZB 3DSQA 1Z5VA 2E3CA 2QJKC 1RQVA 2VWJA 2F1MA 3AE2C 1JFFA 4PI0A 3T1HB 1B04A 4O4JA 2QJYC 5KX5B 1KQGB 2ZIMA 1ZP0C 3BRCA 1X4TA 2J5UA 4O2AA 4K8XA 4I7ZB 4X1KB 4DR4B 1WMKA 5L8RJ 3AE9C 4BW9A 1HJ0A 5LA6B 4DRXA 4LFBB 1PV3A 3VQYA 1UIXA 4TUYA 5IJ9B 4H44D 4JI7B 4X62B 3R4YA 5LXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KMI Z; 
#chains in the Genus database with same CATH topology
 1MG1 A;  3IGA C;  2KK7 A;  3L36 A;  3CRR A;  4GX2 A;  3P8M C;  4EEQ A;  2YIB D;  3P3N A;  1YIJ V;  1HVV A;  1KD1 W;  4IFM A;  1J95 A;  3AG4 C;  3RYF B;  1TAE A;  1K04 A;  1L1F A;  5LMN B;  1G2C B;  1Y47 A;  1AJN A;  3PHL A;  4K8Z A;  1LTJ B;  4ZNC A;  4WFB V;  2KOG A;  5IT9 N;  1Q5O A;  1QVG U;  1Q90 D;  2XAQ A;  2YS8 A;  2UXC B;  2IH3 C;  1MZ9 A;  3FXD A;  3L72 D;  3TDK A;  2FYN B;  2B5U A;  5APX A;  1VQ5 V;  3CWB J;  5KAI E;  2Y48 A;  4TT3 G;  3H32 B;  3KZI Z;  4I0X A;  1BL8 A;  4EYY Q;  1PIX A;  4IL6 Z;  2JGD A;  3BY6 A;  1YF2 A;  2GTA A;  5LGU A;  3PRJ A;  1RF1 C;  4WFE A;  4QPK A;  3KQG A;  3M0D C;  3CCU P;  4PDM A;  1JPX A;  3MTU E;  1GMG A;  1ROP A;  3UIA A;  2QA4 P;  3ZHS A;  1NTZ E;  1V9P A;  4J42 A;  4F6E A;  2XOK G;  2ATK C;  2X7R B;  1JFF B;  2WSF H;  1IZN B;  1GL2 A;  4TV9 B;  1M56 D;  1JJO A;  3M99 B;  1AVO A;  3AEE C;  4LLH A;  2LKM A;  4ZKI A;  3ZED A;  1DX7 A;  3BA9 A;  4H37 A;  5M1B A;  3O6Q B;  1HJB A;  2IH1 C;  1P7B A;  1G1I A;  1R5S A;  4DV2 B;  3CWB D;  1NR1 A;  2AHY A;  3JAT A;  1YJW V;  5KLV K;  2A45 H;  5D5Q A;  1NH4 A;  3BCC E;  2Y9Y A;  5IJ9 A;  5IYB O;  2X6B A;  4U3F H;  2P7J A;  4R50 A;  4RAI A;  4E2L A;  3HKE A;  3PH0 A;  3CCU V;  1IFI A;  1BGY D;  3N2K B;  1WN7 A;  5CCH C;  1FOS E;  3BAA A;  3N2G A;  4LFB O;  1KIL C;  2KI7 B;  1IZ3 A;  5HFL A;  5J2T B;  2AEJ A;  3ZX6 A;  1LR1 A;  1E79 G;  1GL2 D;  3ABL C;  2QA4 V;  3BCC H;  3G67 A;  1N7S B;  4JQ0 D;  5EC2 C;  4DUZ O;  1FPO A;  3G4S V;  4FMT A;  4TLF A;  1SQX G;  5C8Y A;  2QVA A;  1M56 C;  4KFM A;  1O9G A;  4DV1 B;  2CGO A;  3CWB G;  2V1D A;  3EVK A;  4OX9 O;  3ZMT A;  4KUM A;  1TUB B;  2XND H;  3T2M A;  3E35 A;  4UVC A;  3V5B A;  4JI5 B;  2BTO A;  1L0L D;  4FZ1 A;  5DED A;  3AK1 A;  3CL3 D;  1FBM A;  1QR8 A;  2OIE A;  4X1I B;  3SYC A;  2G38 A;  1SQB G;  1IFM A;  2KSE A;  1IXM A;  5APT A;  4YXD C;  2Y0I A;  1KYO I;  1HNZ B;  1MA1 A;  2BCC G;  1LWU C;  3AG7 A;  3BHP A;  3MD0 A;  1NKN A;  1XIL A;  2RN9 A;  3N27 A;  2C0W A;  5LMU B;  4CH6 A;  1KZU B;  2QSI A;  3JSV C;  1GKF A;  1NU1 K;  3CPW U;  3H1H D;  3SWK A;  1S5L X;  1S5L Z;  2KG7 B;  2FKX A;  4QNH B;  2UXB O;  1BZK A;  3JCU E;  1H89 A;  2NLJ C;  4K0K O;  3K04 A;  4BWA A;  1KTM A;  2KIK A;  1H0T A;  1SQB E;  4WY4 B;  1YSC A;  5LA6 A;  1HGV A;  4Y28 J;  4H13 B;  1NVP D;  1MUU A;  1LUV A;  4JF7 A;  4I1L A;  1F4M A;  3E22 A;  2B87 A;  4H33 A;  1XDC A;  1NGM B;  2IX7 C;  4CH5 A;  3CX5 F;  2ZNJ A;  1S72 V;  4LF7 O;  4DT0 A;  2K9P A;  2OCH A;  5APW A;  3SSU A;  5JQG A;  1JNM A;  3RYF A;  3K5L A;  3RVZ A;  2HHH B;  1JMM A;  3K03 A;  3BPZ A;  3R65 A;  3W68 A;  3TSI A;  1NKD A;  4DR5 B;  1NVO A;  4HKZ H;  3HUS B;  2QTO A;  4Q20 A;  3FAV A;  3SYO A;  2NPS D;  4NPE A;  2B88 A;  2KYV A;  2GUZ B;  3A0H H;  5JCO A;  1RM1 C;  2ZKO A;  2JJ1 G;  5A9G A;  1N34 B;  4OX9 B;  1NTM E;  5KAI Z;  4X64 O;  4MVZ A;  4L8J A;  1UJW B;  1NTK G;  2OGU A;  5AVX B;  3D70 A;  1N36 B;  2EIL C;  1BDD A;  3CLQ A;  2HVJ C;  3V6I A;  1JJ2 U;  4MVO A;  3B8M A;  3K06 A;  1VPC A;  1SRY A;  5IE9 A;  3OA7 A;  2P58 A;  1M1J C;  1HW7 A;  3JD3 A;  4B7K A;  2JVD A;  1YJW P;  3U1C A;  2KB1 A;  3V2P A;  1OVU A;  5GON A;  3STZ C;  3E8G A;  5EFW B;  2YKP A;  5FPR A;  5CN0 A;  4O4H A;  3A0H Z;  3CCM P;  1RFY A;  1LTJ C;  1YCI A;  1N32 B;  3H1I J;  2ZVO B;  4DW0 A;  1AIL A;  1I5X A;  3R66 A;  4DOJ A;  3G9R A;  1VQM P;  3M0A A;  1H2L A;  3ZRX A;  2IJK A;  4ZKU A;  1DEE G;  4C7N A;  2Q6A A;  3ASN C;  2NPS C;  1NQT A;  3JCU Z;  4YTP C;  3ML0 A;  3WB1 A;  3B09 A;  1L0L H;  2P4K A;  3WUU A;  5H2F H;  1ORQ C;  5EYP B;  3CC4 P;  2Q68 A;  5LHG A;  3ZRV A;  2HR3 A;  3E8F A;  4GUN A;  4JI8 B;  3IN6 A;  4IL6 E;  5JJE B;  5AVV B;  1FJG B;  2BSK A;  3AEA C;  4IL6 H;  3JAK A;  2WSF J;  3P8C E;  2W83 C;  4FVM A;  4JYC A;  1W2B O;  3RK3 E;  2POH A;  3CXC U;  4MT8 A;  3ETG A;  4PHZ A;  4O2B B;  1UPG A;  2VQE B;  2W8Z A;  3L73 J;  3C8V A;  2R9I A;  1YIJ P;  2GV9 A;  2WLM A;  2QKC A;  2GTS A;  4UCU A;  4FJC C;  1N8R W;  5JJJ B;  5FLX N;  2FB5 A;  3A2A A;  5DJT B;  3M06 A;  3T1H O;  1JCD A;  5B1A B;  2ETN A;  2EZO A;  2AEM A;  2ADQ B;  2OYI A;  1BHB A;  2P67 A;  5H6R A;  1PNM A;  1FFX B;  3TGU H;  3DXR B;  4BIZ A;  3ZDM A;  2OWO A;  4LFC O;  3RYI B;  5KA5 A;  4GOD A;  4H13 D;  4GKJ O;  3OM3 B;  5C39 A;  4IHJ B;  4DR2 B;  5LL6 Y;  5CBH A;  5BXZ A;  2O01 J;  4DV3 B;  4X1Y B;  1T8Z A;  3AE6 C;  1VQ5 P;  1QLE D;  1P7G A;  1W0K G;  3DTU B;  2N1T C;  2OIG A;  1LJ2 A;  4ZKP A;  3FWL A;  1OV9 A;  4N78 D;  2VQF B;  2AZ2 A;  2PYL A;  2OYI B;  2YXQ B;  1W2B U;  1BGY H;  4JI2 B;  1HNW B;  3SFD C;  4JZG A;  5J2U B;  3TXS A;  1PGQ A;  3FB6 C;  1PGP A;  1LP1 B;  1G6U A;  2NN4 A;  1ZRT E;  3GWK C;  1L0N G;  2K88 A;  2DW3 A;  1W2E A;  1IFJ A;  4PEL A;  3PJS K;  5DN6 G;  3GMA A;  4RQE A;  3E2E A;  1IDS A;  3HE4 A;  3CE2 A;  3VQW A;  1SF9 A;  2IYO A;  1T3U A;  2XAJ A;  3OUF A;  2R5D A;  3FXE A;  3ABM C;  1QX8 A;  5GTI E;  3U10 A;  4WBN A;  4ZBM A;  1UII A;  2E42 A;  4DK0 A;  3PN1 A;  1IXB A;  2PZS A;  4MVS A;  2FYU K;  4KL1 A;  2JS3 A;  1VQ4 V;  2P1J A;  5E1A C;  1L0L K;  5CBF A;  2UXC O;  4CS2 A;  4X89 A;  1GM9 A;  4CH3 A;  2FXO A;  2PRR A;  4WVZ A;  2A45 G;  1KP2 A;  1KMI Z;  2QWN B;  3H9V A;  1XMQ B;  3KXD A;  4OGQ C;  5BZB A;  2Z4E A;  1Q6U A;  1SQX J;  3BAT A;  2N9B A;  1KB9 H;  1Q6I A;  5LYJ B;  4XDK A;  3W7W A;  3AG2 C;  4D7T A;  3X2Q C;  3AEF C;  1RP3 B;  4GLX A;  1Q82 W;  4LFC B;  4QE7 A;  1WAZ A;  4NXM B;  3DC5 A;  4LF6 B;  2CTQ A;  4LWS A;  4PJ0 E;  3G6B A;  1WT6 A;  2CH7 B;  3RYC B;  2HOD A;  2HPC B;  3JSN A;  4MVR A;  3GW6 A;  1QL2 A;  3FX0 A;  1XBL A;  3LNN A;  2BE3 A;  1J1D B;  3HKC B;  5KTB A;  1YHQ V;  2O01 N;  1NS1 A;  4WFF A;  4BIO A;  2UUC B;  4TV9 A;  1VF5 C;  1PZQ A;  3CRM A;  4PJ0 Z;  2WSC H;  5KLV D;  3QF7 A;  2ZDI C;  2JJ2 G;  4ICG A;  4ZHQ A;  3OGC C;  2ZIO A;  2J59 M;  2W90 A;  1EM1 A;  1S1C X;  5CCH A;  1QU7 A;  1YXB A;  5LMU O;  4AHC A;  2M0B A;  4CC6 A;  3P3P A;  1M90 W;  5EYP A;  2SPZ A;  3B77 A;  1VF5 D;  5AW3 B;  1OW8 A;  2QIW A;  4UVA A;  3FKS G;  1J5E B;  4DXW A;  3HKE B;  1NTZ D;  1ZR4 A;  3N2G B;  2WA4 A;  1JUN A;  2JP3 A;  1BS3 A;  1SQX K;  3K08 A;  2WLI B;  4WY4 A;  3HKD B;  2D2C C;  1RE4 C;  5LOV B;  3N4X A;  2F23 A;  1NBM G;  1BSM A;  1FXV A;  1H2M A;  4WFG A;  2A06 H;  1KFN A;  3OUS A;  3E22 B;  3RBZ A;  3ETQ A;  2D2C D;  4MW3 A;  1VQ6 V;  1KKD A;  1K34 A;  5EIB D;  1L4A D;  1RE4 A;  2LGQ A;  1K92 A;  5AW1 B;  5GTH Z;  5JH7 B;  3HD7 C;  2GA1 A;  1Y66 A;  4JAV A;  1N73 C;  4AIL C;  1IBK B;  2JDI G;  1KC8 W;  4BWN A;  4N6J A;  1GM8 A;  3TYY A;  1M57 C;  3CME V;  2XHB A;  1WPX A;  3M0D A;  1HWT C;  4NKG B;  2YIU B;  3K3W A;  2ZVN B;  1DF4 A;  4FFB B;  2HPC A;  2A7W A;  2E76 D;  1GW3 A;  1NH2 B;  3HUS A;  4JI0 O;  1X8Y A;  3B40 A;  2E3C A;  2QJK C;  4JAA A;  4TSF G;  3M9H A;  5AW2 B;  3G80 A;  2VQE O;  4PI0 A;  2O01 H;  2Z3Y A;  4A5U B;  1G1J A;  1K9M Q;  1M56 B;  4R8C A;  1F7Y A;  3ZBH A;  4RUE A;  1WJZ A;  2QKS A;  1L0N D;  2WMM A;  1X4T A;  2Y0D A;  4O2A A;  1SVF A;  1T2K C;  2X6C A;  5J9P C;  4NXN O;  5APQ A;  1P84 H;  4BW9 A;  3AG4 B;  3WG7 B;  5LA6 B;  1V55 B;  3VQY A;  4TUY A;  3NFQ A;  1JTH A;  2EIL B;  4JI7 B;  4PA6 A;  2FYU H;  1EFR G;  4NTW A;  5LXT A;  4X62 B;  3I56 V;  2FY8 A;  4X66 O;  1SQG A;  3CXH E;  3QH9 A;  1FDI A;  3SR2 C;  1SA0 B;  1KEC A;  3PLN A;  3AE8 C;  4F6R B;  1BCC J;  1FFX A;  5AW4 B;  1HTL C;  4JI1 O;  2Y0C A;  2FYN C;  3L4F A;  1QR9 A;  2Q69 A;  1JX9 A;  4B7E A;  4OH8 B;  4NVP A;  2IZ0 A;  2K3R A;  1DTO A;  4FLU A;  1R5L A;  3ZHT A;  5ITZ B;  3MDS A;  1OW7 A;  2KKW A;  1YTF D;  1SS1 A;  5DM6 V;  2NR5 A;  1J1E C;  1SQV H;  3ZJZ A;  2XDJ A;  3CJH A;  1GRJ A;  1XMO B;  1SQP J;  2HYN A;  2KXP B;  1SA0 A;  2GUZ A;  1BCC E;  1YVW A;  1EBO A;  1NJI Q;  1SQF A;  3CP1 A;  1VEW A;  1ZLL A;  3RGB A;  1JY2 N;  1L2P A;  3P8C D;  1FAF A;  1IK7 A;  3RYH B;  4L75 A;  2P22 C;  3JD0 A;  4JBZ A;  2YUA A;  3Q2Y A;  5LHI A;  3H1J D;  1M93 A;  1FJG O;  4DYL A;  3CCE P;  2O1J A;  5KLV J;  3H25 A;  2WPV B;  1NTZ H;  2EIJ B;  3B2E E;  1N32 O;  4I50 A;  1NHL A;  2CTR A;  2H3O A;  3SPH A;  4QJF B;  4IT5 A;  1FZG A;  4ASV A;  3L37 A;  1LWU B;  2E5T A;  3SDL A;  3SWY A;  3N2K A;  4YXW H;  2Z5I A;  3ABK C;  4GT1 A;  2CGN A;  4NYK A;  1BE3 G;  1FZB A;  1KC8 Q;  2GUS A;  3VMA A;  4MS2 A;  4I55 B;  4H44 B;  1TU3 F;  3P32 A;  2OYH C;  2HHH O;  3BRT B;  1Q8I A;  4B3T O;  3BAS A;  4NR1 A;  1NU1 E;  3EWK A;  3ZIA G;  3MUD C;  3OTO O;  4K3A A;  3WU2 Z;  2W6J H;  4YIP A;  2IZ1 A;  1EZV E;  2IPP A;  1BDC A;  2YIC A;  2DYS B;  4N21 A;  3LDD A;  3ABL B;  1N7S C;  3JAS A;  2Y4T A;  1M9N A;  2Z0A A;  1SFC A;  1GL2 B;  2JRI A;  1AR4 A;  4DR4 O;  4W80 A;  2WSC J;  3JAK B;  2QWQ B;  2NZ2 A;  3K5O A;  1XL6 A;  2VS0 A;  1GAX A;  2WLJ A;  5AW0 B;  1Q81 Q;  1URQ C;  3G3Z A;  1IK9 A;  2E74 C;  1X79 B;  3HKD A;  1N36 O;  4CPG A;  1B06 A;  4ZI7 A;  1HBW A;  4MTX A;  1FDM A;  1K97 A;  1JMB A;  3FAV B;  1NOH A;  2Q1K A;  1JCH A;  2QJP B;  1ZR2 A;  1FC2 C;  1BGY G;  5CCG C;  3CEI A;  4MVQ A;  3H1H E;  5AVY B;  2GBO A;  2ZR3 A;  1VMG A;  4DV5 B;  4UCS A;  3FYI B;  4NTY A;  4DV3 O;  4N3Y B;  4J7J A;  3DXR A;  4KP4 A;  4LP8 A;  5KHK A;  2KS1 B;  1DIP A;  3APQ A;  1YEW A;  2PGG A;  3CSX A;  3N7N A;  3RK2 C;  3RYH A;  1SQV E;  1H2G A;  3S4R A;  3EFF K;  3K5N A;  2W6B A;  1V54 B;  1AVM A;  4FFB A;  2VQF O;  3QG5 A;  4J41 A;  4LF4 O;  1N0N A;  2ITC C;  3AG2 B;  3K0G A;  3VN0 A;  4JI5 O;  3J80 N;  1T3J A;  1JB0 J;  1S76 D;  2HLO A;  2B1I A;  5AW5 B;  3UO2 A;  1Y76 B;  2WT7 A;  1LUW A;  1CSB A;  1P49 A;  1FFT B;  2Q7G A;  3UCS C;  1BHA A;  2IFM A;  1K5S A;  3JAM N;  4PD4 D;  4EFB A;  1HNZ O;  3B71 A;  4EOT A;  1KFM A;  1LT9 A;  2WPR A;  1Q86 W;  1FYJ A;  4LF9 B;  3EFG A;  1R6K A;  3MAQ A;  1KYO H;  1NTK H;  2LXB A;  2E43 A;  4BAY A;  3B8E B;  3L35 A;  2XAH A;  3D3Q A;  5AW7 B;  5IJ0 A;  1DD3 A;  2XV5 A;  2MK3 A;  5LOV A;  1RHZ B;  3OE7 G;  2QM4 A;  3VBB A;  1YJ9 V;  3W67 A;  4HJG H;  5FPO A;  1Q6H A;  2P10 A;  1RH5 B;  2N1T B;  3CYO A;  4BXL A;  1QQC A;  2YXH A;  4TQF A;  1SQX D;  3E89 A;  1VQ8 P;  3FB8 C;  1COW G;  3H1J H;  4F6R A;  2X6A A;  3I55 V;  1JY2 O;  4JPR A;  4YHH O;  4PV1 C;  4JYA B;  2W6A A;  4O4L A;  4N78 E;  3RK3 B;  1VQ7 P;  1AI5 A;  1H0T B;  5J2T A;  3Q5P A;  4EB6 B;  4I5S A;  1GM7 A;  3VQV A;  1VQM V;  2R9A A;  3GHG C;  1XNR O;  2XAS A;  2R44 A;  4JYY A;  1SQP E;  1YI2 P;  1T6A A;  5GON B;  1LTB C;  3VTP C;  2UUB B;  1N4C A;  4F4L A;  3ETE A;  2H7H A;  2EJR A;  1X22 A;  3GWO A;  2Y0E A;  3L71 H;  2EX3 A;  3SJB C;  1AV1 A;  3RK3 C;  3SWF A;  2N04 A;  3L73 G;  1DD4 A;  1FXK B;  2UWJ E;  1GZL A;  1FE6 A;  3A3Y B;  1FZF A;  1AP5 A;  4YJ3 B;  1Y4M A;  4J11 A;  2WPD G;  1EZV D;  3FGA D;  1N33 O;  2QM8 A;  1VQ8 V;  5CA1 A;  3Q4H A;  5KLV E;  4FLV A;  3FB7 C;  1K73 W;  2CH7 A;  3RYC A;  1S72 P;  5E79 Z;  4U3F D;  3JAW B;  5BMV B;  4Z1M H;  1Y74 A;  1BCC D;  1R3J C;  4KXR A;  1TA8 A;  5APU A;  1AA0 A;  2P5O A;  1BE3 J;  2YXR B;  4UV9 A;  1X59 A;  1OX3 A;  2CK3 H;  4AQR D;  1FZC C;  4WFA V;  1FXK C;  4JI6 O;  1JY2 P;  4PA9 A;  1K7D A;  2R3S A;  3K9A A;  1PP9 H;  3ZRW B;  5CJ0 A;  3OAK A;  3O6Q A;  5F2V O;  3G71 V;  2XUM A;  4KJM A;  3VQX A;  1AJP A;  1ENV A;  4C7R A;  5KHJ A;  1U7M A;  5KLI B;  1BE3 E;  2KLV A;  5K1P A;  5IDJ A;  4MN4 C;  4GOE A;  5B5E E;  3ZS8 C;  5BU5 A;  4TV8 B;  2FYU D;  4LF7 B;  4GOF A;  1R6N A;  4IYH A;  2KUB A;  4X88 A;  5L3D A;  2YIA A;  3F7Y C;  5JCO C;  1H8E G;  2KNC B;  3E7K A;  3GF3 A;  1B6Q A;  2UXB B;  4DV0 O;  1QVF U;  1E1R G;  3THO A;  4A7P A;  2YKO A;  1CP9 A;  4HBN A;  3I5C A;  1IBL B;  1M7L A;  1L0N H;  4DUY O;  2Q0A A;  3FB5 C;  5AG2 A;  1Y9B A;  1PV0 A;  3IAY A;  3U11 A;  1GDT A;  4LFA O;  3MHS C;  2L6L A;  4MVU A;  3O65 A;  2B1G A;  1VQL V;  1MFZ A;  3VMY A;  1W0J G;  5BU8 B;  1ARO P;  4UV8 A;  2WPS A;  1FU1 A;  2LW7 A;  2E75 B;  3AED C;  3V2R A;  3B5N D;  4QIW F;  3JAR A;  4X62 O;  4DR3 O;  1U97 A;  1R3I C;  3H1L J;  1K9M W;  1H38 A;  2XZR A;  2FFD A;  1WA8 A;  2N9Y B;  1RE3 C;  2NPS B;  1VDF A;  3ITK A;  4M3L A;  1BT8 A;  2E5Y A;  3PTZ A;  1OCR C;  2KZJ A;  1SQV G;  5A2Q N;  4O9B A;  2IJH A;  4LF8 B;  5APS A;  4PI2 A;  3SPI A;  2FYZ A;  4TOI A;  5BY1 A;  2L35 A;  2IJJ A;  2F95 B;  5EK0 A;  1AI4 A;  4KHP O;  2CPS A;  5B1O A;  3BVO A;  3RYI A;  2LQT A;  4I0X B;  4WF9 V;  4WCE V;  4WBA A;  2H43 A;  1SQP D;  3H1L E;  2XNX A;  2EIN C;  3SPC A;  3WUV A;  3G6E V;  2VRZ A;  4UCT A;  1D5A A;  5KJ7 C;  3A0R A;  1XI1 A;  5IY5 C;  2AW9 A;  2N1T A;  1H8A A;  5CJ4 A;  4IL6 X;  2WLL B;  3QO7 A;  2RKL A;  4R4M A;  1PGJ A;  1XHX A;  1QL1 A;  3L72 H;  1WB7 A;  1X0T A;  3H1K H;  3H1K J;  3M91 A;  2BTQ B;  2RCV A;  1US6 A;  3S3X A;  4EDF A;  1LP1 A;  1ZN5 A;  3OD4 A;  5CA0 A;  2F93 B;  5B1B B;  4LWS B;  5B5E Z;  5IYC O;  1CI6 B;  5AW6 B;  5BVZ A;  3Q3D A;  1VF5 B;  1VQK V;  4B08 A;  3C1L A;  3AG1 C;  3IC9 A;  4BR6 A;  1XTG B;  4Z2W A;  1AJQ A;  4U3F G;  2IU3 A;  2Q4P A;  3CMA V;  1KIL A;  3LW5 H;  2LJ2 A;  2QJ1 A;  4JYB A;  2Q5U A;  3H1K E;  2DYR B;  4IIJ B;  3K5M A;  4OPH A;  4YXW G;  3L73 D;  5GTI Z;  4L73 A;  5DEC A;  1S5L H;  1VQP V;  1PD3 A;  3M8A A;  3ABV C;  5JVD A;  4HAM A;  2E5L O;  2JS5 A;  1DK1 A;  5IY5 B;  1TVK A;  3J81 N;  4W7Z A;  1SS3 A;  1GW4 A;  2YID A;  4U7N A;  1F23 A;  2DWE C;  5H2F Z;  3ZMU A;  2EIM C;  5EZY B;  4DR7 B;  2YO2 A;  4B3S B;  2FFD B;  4JTC B;  3HD7 A;  3B8N A;  1PL4 A;  4JI4 B;  2WSS G;  4H13 C;  4FM1 A;  4PDV A;  2I1J A;  1PNL A;  4I6M C;  3A0H E;  3CCL P;  2P06 A;  1SQQ K;  3OJA B;  2ZQM A;  1XNR B;  3A7O A;  1VQ6 P;  2QG4 A;  5H2F E;  1VQK P;  1AR5 A;  2WA3 A;  4LF4 B;  3CB2 A;  1SQB H;  4RO0 A;  4HNA A;  1ZTE A;  3TJT A;  4OGQ D;  5GTI H;  2DQ0 A;  1PPJ G;  3CME P;  4HB1 A;  2N05 A;  1KUQ A;  1SZT A;  3IAO A;  3OMN B;  1XNQ O;  3JAL B;  4H0L D;  4RQF A;  4WB4 A;  4K35 A;  2PTM A;  1NTM D;  4JTD B;  4AQY O;  3CRA A;  3VMX A;  3AE3 C;  2Y9Z A;  1OCO B;  1I7F A;  2FML A;  4ASW A;  3B5N A;  4B3R B;  1BE3 D;  4DV7 O;  3KHU A;  5AW9 B;  5AW8 B;  2WLH A;  2XU6 A;  3L70 G;  1OCZ C;  1P84 F;  4DW1 A;  3U0Z A;  2I8D A;  4HYT B;  3TGU J;  2R70 A;  1NT2 B;  2HJF C;  2AXT E;  2JK5 C;  2YXL A;  2ZXW C;  5LYJ A;  4AI8 A;  1M57 D;  3KZI E;  4PA4 A;  2A3Q A;  1EQ7 A;  1Q3E A;  3H1L G;  2DOS A;  2P4V A;  2RMZ A;  1NU1 D;  2C9N Y;  3JAR B;  3L74 E;  5KLI C;  1NTK E;  3MHV A;  1SET A;  2D3O W;  2E76 C;  3OAA G;  2M3E A;  4DR6 B;  3ASO C;  1DGS A;  2KP8 A;  2NPS A;  3CX5 H;  3TGU E;  2ZE5 A;  2PI5 A;  4XDJ A;  2JKV A;  1HH0 A;  5KAF Z;  1QLE B;  2AXT Z;  4OVN F;  3G71 P;  2N74 A;  1JFF A;  1NTM J;  3ABM B;  3L71 J;  2BSK B;  1L4A C;  1NU1 G;  2QJY C;  1M90 Q;  1FZC A;  1FXK A;  4ASU G;  1MNG A;  2J5U A;  4K8X A;  1ZL8 A;  4X1K B;  3S3W A;  4RJT A;  4DR4 B;  2LFS A;  1VQN V;  1EDI A;  5L8R J;  3WUT A;  2W0F C;  4D6T H;  1HGZ A;  2QE7 H;  1OCC C;  3H1I H;  1V54 C;  4DRX A;  1L0N K;  1PV3 A;  1UIX A;  1FS0 G;  3L75 E;  1Q86 Q;  2Q67 A;  1L4A B;  2QJY B;  3IFM A;  3W7S A;  3L71 E;  4DO2 A;  4J9Z B;  3H1L D;  4JI7 O;  3H32 A;  2OYO A;  2UUC O;  1AQT A;  1EN4 A;  1KBH A;  1ZL8 B;  5EC1 C;  3ASO B;  3AE4 C;  5KLV H;  3IFX A;  1WA8 B;  3GHG A;  1SKV A;  3L75 G;  1XNQ B;  2Q3E A;  2CTP A;  3LSS A;  3UQ8 A;  3CD6 P;  5KMG A;  2JIZ G;  3AG3 C;  1DEB A;  3APO A;  2IU0 A;  4JI8 O;  1Q82 Q;  3K59 A;  4B3M O;  3RGU A;  2RDC A;  1L4A A;  2HJD A;  3OR6 C;  2GUV A;  2M5A B;  1H2S B;  2V7Q G;  4IIJ A;  4BRY B;  4U3J A;  4U7O A;  1Z56 A;  5D5P A;  1RE3 A;  1RF1 A;  2IBZ D;  2P6J A;  1K3E A;  1OCO C;  1BSN A;  4FLT A;  1ZRT D;  1P4R A;  1IBL O;  3TET A;  2L91 A;  1JM0 A;  4O2B A;  2HOD B;  3ZMV A;  4X1I A;  1NTZ K;  3QVN A;  5EBM C;  3KZI H;  2FXM A;  1YI2 V;  5KA6 A;  4LFA B;  2O1K A;  1KQL A;  5KMG B;  2K1A A;  4FLY A;  1YIT V;  1N2D C;  3BCC G;  1VQ9 P;  1EZV I;  2Y69 C;  1RPR A;  4IGG A;  2JR8 A;  4TWK A;  4QE9 A;  2AGA A;  1N0J A;  2RN0 A;  5CMU A;  3Q5S A;  4U7J A;  1D5N A;  2DMX A;  1A32 A;  4O4J B;  3ZMZ A;  1VAR A;  4IOI H;  4EIJ A;  2ODM A;  1WP8 A;  2IYP A;  2XND G;  1J2J B;  4IHJ A;  1GL2 C;  2L5G B;  3AEC C;  4JYA O;  4TQD A;  3L74 H;  2WAM A;  3A0B H;  1T2K D;  3SJC C;  1KYO E;  3USS A;  4AYC A;  3CS5 A;  2QEX P;  3Q1M A;  2X0L A;  3JAL A;  1QLN A;  4UCR A;  3RW0 A;  4DV4 O;  4X64 B;  5JJN B;  2BCC H;  1SC5 B;  2ZJS E;  2FXP A;  1P84 E;  4UXN A;  2AZ0 A;  3CX5 I;  2ZM6 B;  3TGU D;  1QBZ A;  2JWA A;  3ZHV A;  2I1K A;  2A0L A;  1DH3 A;  3RL0 B;  2LO1 A;  5KUM A;  3V2Q A;  5CCG A;  2YXY A;  5K1X A;  1VQ9 V;  3HRN A;  1GD2 E;  3LDE A;  4LGD E;  2CDY A;  4PD4 H;  2QWP B;  3ASN B;  2FTK A;  3HPL C;  1O9H A;  2M3B A;  5EBW C;  3HE4 B;  4GIF A;  3BCC D;  2F4V O;  1NTK K;  5B66 Z;  1NJI W;  1KYO D;  5CHX A;  2WT7 B;  2QSA A;  5KAF H;  2FFD C;  3H1H H;  4I9W A;  3L74 J;  3UM7 A;  3PP5 A;  3SFE C;  2IW5 A;  3JC2 2;  5LGN A;  1JOY A;  3M7M X;  1OMI A;  5DJU B;  1PKX A;  2OYH B;  3F5W C;  1XMQ O;  1HNX O;  3L71 D;  3MUD A;  1KIL D;  4AQY B;  1BGY J;  3VYI A;  1EZJ A;  4BW5 A;  1U57 A;  1N73 A;  1YJN V;  4JAU A;  1SQX E;  1KYO F;  1VQL P;  1B3Q A;  1ZAU A;  2Y0P A;  1KIL B;  1LT9 C;  2E74 B;  4X65 O;  1PGO A;  3RL0 C;  5B1A C;  1RQU A;  1H2K A;  3LDC A;  1I5Y A;  4DV6 B;  2R9R B;  3ZRW A;  2G8Y A;  2G3A A;  2JWD A;  5AVS B;  3D8C A;  4X1K A;  3AE1 C;  3C90 A;  2KSD A;  2FBW C;  3JD2 A;  2ZFC A;  3BRV B;  4YJ2 A;  1RM1 B;  1PPJ E;  1EN6 A;  2H94 A;  3L72 E;  1JOC A;  4I9Q A;  1SQV D;  3JD4 A;  2ZXE B;  1U96 A;  2AHZ A;  1KIL E;  3RWR D;  2QWO B;  4FZ0 A;  2IBZ E;  1D7M A;  1QVG O;  2MW2 B;  1XRE A;  4Z1M G;  4DUY B;  2CPB A;  3K9S A;  3JAS B;  3WFV A;  4GX5 A;  2BTQ A;  4C7U A;  1WPB A;  2KNC A;  1AVY A;  4DZO A;  1Y67 A;  1OW6 A;  3A8T A;  3B4S A;  1JY3 P;  3L72 J;  1YJN P;  2EIN B;  1PPJ H;  4GCZ A;  4DK1 A;  2JGU A;  1GK4 A;  4C46 A;  5IYZ A;  2Q6Q A;  2FKW B;  2QE7 G;  5KJ7 D;  4L76 A;  2W0X A;  3S9O A;  4DR5 O;  2IJI A;  1SQQ H;  1XUQ A;  3QTC A;  3DC6 A;  2GDS A;  4O4H B;  4WY4 C;  1HR0 B;  1EC5 A;  1L0L G;  1PFI A;  2QJK B;  4AUW A;  1LTT C;  3H1H J;  1CW5 A;  1YTZ I;  1FXH A;  1FZC B;  5JWP A;  3AE5 C;  3T1Y O;  5CMZ A;  1I94 B;  5AVQ B;  3CC4 V;  1PM9 A;  1GK6 A;  3MHH C;  4UCO A;  2BCC D;  2OYH A;  4EI2 A;  1SQV J;  4LF5 O;  5LP6 A;  1HF9 A;  3CCS P;  1BMF G;  1DLB A;  4OXS A;  1NR7 A;  3TNU A;  5K5G B;  3TK1 A;  1QNM A;  4DUZ B;  2LP7 A;  4ABM A;  2RQ6 A;  4PA7 A;  1SQB K;  3TF5 A;  1VQO V;  1NAF A;  1R3L C;  3RN4 A;  3K58 A;  2WSE H;  5J2U A;  1VL2 A;  4RES B;  2BAS A;  2QR4 A;  5GTH E;  4NPF X;  2ZAE B;  1JY3 O;  1BCC G;  1FJP A;  3GHG B;  3GLM A;  1Z5W A;  4HNA B;  2OTJ V;  2PP6 A;  2Q7E A;  5GW7 A;  1S77 D;  1MFT A;  2A06 D;  4JV5 B;  1AI7 A;  2ZNI A;  3R2P A;  1RSO B;  1I0H A;  2YEV A;  1NZ6 A;  3CX5 D;  3G4S P;  4I7Z C;  1KQS O;  3K79 A;  3OW2 O;  4DR1 B;  1KV4 A;  3VMZ A;  1FZA A;  5AVR B;  3TGU G;  2QKA A;  3D71 A;  2PY5 A;  4P9O A;  4LC1 A;  2JGD B;  3VP9 A;  4LF9 O;  1QLE C;  3D36 A;  3AEG C;  3OTF A;  2UU9 O;  5IYD O;  1LT1 A;  4GZR B;  1KU9 A;  1E5W A;  1NAY A;  5APV A;  3E83 A;  3FYE B;  2FYU G;  1EDK A;  4I50 B;  5CBN A;  1UFI A;  2IM9 A;  1NKZ B;  2GHY A;  5B5E H;  3K57 A;  2ZT9 D;  3AE7 C;  3L72 G;  4WWI A;  1WNS A;  4JGS A;  3UT5 A;  1E1Q G;  3AG3 B;  4JI0 B;  3D6Z A;  3IC7 A;  1YQ3 C;  2B9Z A;  2UXN A;  2OCC C;  3F5H A;  1GMJ A;  1YDX A;  3ZN0 A;  3FX7 A;  4GKJ B;  1GTO A;  2K1E A;  3QWO C;  1AFO A;  3SYP A;  3HD7 D;  1Y76 A;  3KYQ A;  5BR8 B;  1P84 D;  2GSM B;  5CA3 A;  2PFX A;  3AG1 B;  3H1K G;  3NTN A;  5L3E A;  1CEZ A;  1S5L E;  1URQ A;  2PGD A;  1SQV K;  2ZYA A;  5LMN O;  1L0L J;  3T4Z A;  2Q7H A;  2A9H A;  3HTK A;  4P9P A;  3AK3 A;  1OFC X;  1GTW A;  3CRC A;  3BEH A;  3H1J E;  1IO4 A;  2B87 B;  3MP7 B;  1QVF O;  2KSJ A;  4JV5 O;  2LXC B;  1FJK A;  3KG2 A;  4JI1 B;  3LW5 J;  2EJ7 A;  2ITD C;  3RFR A;  4CC5 A;  1YYC A;  3C3S A;  4P30 A;  4DJG A;  1FDO A;  1S0V A;  4JF3 A;  1S2E A;  2BOB C;  5B1N A;  4JI6 B;  2E75 D;  3LNM B;  5KHG A;  1PPJ D;  1ZV8 A;  3RVY A;  5EIB C;  1NYH A;  2ARH A;  4UCV A;  3HKB B;  1G2C A;  4ZIB A;  2OYI C;  3H1J J;  2Z5U A;  3V2N A;  2JO1 A;  4FLW A;  3L74 G;  4MTG A;  1IJD B;  1G8M A;  3WB0 A;  5LGT A;  3CC2 V;  5H9C A;  2ZYD A;  2F66 C;  3CCR P;  1CZQ A;  1K5Q A;  5HFM A;  1P84 I;  4IFF A;  5JH7 A;  2M5A A;  3HUS C;  4OWF A;  4LCU C;  1SFC B;  2MJZ A;  3G6E P;  4FM2 A;  3P30 A;  3EQ2 A;  5CCH D;  5LBQ A;  1N8R Q;  1XEQ A;  5H5N A;  2H88 C;  1JY3 N;  1SQP K;  1W59 A;  3WU2 H;  3O8Z A;  4XA4 A;  5LP6 B;  4B3T B;  2NRG A;  2JEU A;  3BVH A;  1M5I A;  2Z5H A;  5KAI H;  4CS3 A;  4X66 B;  4NPD A;  1KD1 Q;  2LFR A;  2QM7 A;  1KB9 D;  2K9J A;  4XFJ A;  2VRS A;  4CH4 A;  2Q9L A;  1OHH G;  4JI3 B;  3D36 C;  4KHP B;  5C93 A;  5JVD B;  1URQ B;  1TVK B;  3ZHU A;  2F4V B;  1IX9 A;  1IBM B;  1K8A W;  1ZME C;  3CCE V;  1S5H C;  2OCC B;  1PL0 A;  3MIW A;  2HVK C;  5FNV B;  3L70 D;  2C2A A;  4GYC B;  2ZM6 O;  2K37 A;  2WVR A;  3UO3 A;  1OVV A;  1IFN A;  3T1C A;  4FPP A;  4FIP C;  4P2Z A;  2ILM A;  2W27 A;  3RK2 B;  4DV5 O;  1PL5 A;  5TIS H;  4LF5 B;  3H1I D;  2DWD C;  1L0N J;  5E79 E;  2YNY A;  2QTS A;  3EHB B;  2KG7 A;  3KCY A;  1BQ0 A;  5AVW B;  1GN4 A;  3JCU H;  4UFZ A;  3SGI A;  2ZE7 A;  2EIM B;  3OT7 A;  4WFH A;  2QDO A;  4H44 C;  2QJP C;  2ZE8 A;  2V4D A;  4CS4 A;  3ZCC A;  5FNV A;  1L8D A;  1F51 A;  2DQ3 A;  2IBZ H;  3V4Q A;  3CWB E;  4L87 A;  1MV8 A;  4PV1 B;  4U3J B;  3B5N C;  1L0N E;  1SP4 A;  3OEH G;  2WWW A;  1Y6X A;  2ZIN A;  1YTF B;  1NU1 H;  3GF7 A;  5JQG B;  1EZV G;  1WB8 A;  4O2A B;  2KS1 A;  3Q5R A;  4CZZ A;  4JPZ B;  1KP3 A;  3F5T A;  4X1Y A;  5KJ7 A;  1VQO P;  2C9L Y;  4DRX B;  3H1I G;  1THZ A;  3WB2 A;  5KLV G;  1NTZ J;  3E1I A;  2H89 C;  5IYZ B;  3IJ4 A;  1S3J A;  2Q0O C;  4DR6 O;  1LNQ A;  2YC0 A;  2F1M A;  2VWJ A;  3WG7 C;  4RUF A;  1MSW D;  1IVS A;  3BFR A;  3AE2 C;  3T1H B;  2UXD O;  2AXC A;  2JDI H;  5KX5 B;  5L3G A;  1KQG B;  3RK2 D;  2WIT A;  2OTJ P;  3BRC A;  1EN5 A;  1GK9 A;  4D6T J;  3SPJ A;  2OTL P;  1MMM A;  4I7Z B;  5CBO A;  1ZWI C;  1VIB A;  1LTG C;  1NVP B;  2R5B A;  5AVZ B;  1EDJ A;  2A06 G;  2QWR B;  3OFN G;  4JI2 O;  1HNW O;  3AEI A;  2BOC C;  1MZE A;  5IJ9 B;  1NTM G;  4G28 B;  4MVM A;  3MZW B;  3F89 A;  2WLL A;  2A45 I;  3R4Y A;  1IUR A;  3TNU B;  4EKW A;  4DV1 O;  3CJH B;  1HP8 A;  2CK3 G;  4JI4 O;  1S9K D;  4QMA A;  4Z1V A;  1USD A;  1NTZ G;  4YPC A;  1Q7Y W;  1YIT P;  2E74 D;  2VWK A;  4X20 B;  2LW1 A;  3SJA C;  4I4T A;  4HH2 A;  3ABU A;  4O4L B;  1MKM A;  1YJ9 P;  1FZE A;  2YI8 A;  1T5E A;  2F43 G;  3AK2 A;  2CE4 A;  4LR3 A;  2R32 A;  4R4L A;  4KT0 J;  2XAF A;  2WLK A;  5H6Q A;  2PAJ A;  3HB3 B;  1I08 A;  1ZXG A;  1AP6 A;  3H6P A;  2CTW A;  3LIE A;  4R6Z A;  3CXH D;  1ZUQ A;  2ZE6 A;  1OZ0 A;  4X20 A;  2R3C A;  4W4K A;  2UXX A;  1AJY A;  3RK3 D;  3CCQ P;  2WSE J;  1G4Y B;  2ZXX A;  4PDR A;  3M9B A;  1CXZ B;  3L9D A;  1NTK J;  3K0D A;  3SPG A;  3RL0 g;  3JAT B;  4XBF A;  3Q4H B;  4DR1 O;  1FAV A;  3J7A U;  3KPE A;  2Q9I A;  1Y74 B;  1NO4 A;  3E8B A;  1NTM K;  3HKC A;  1URF A;  3VP8 A;  1FOS F;  5AVT B;  2UU9 B;  5KAF E;  2BCC J;  4DR3 B;  1JMK C;  1LT9 B;  3W7X A;  5KX5 A;  3VOP A;  4G27 B;  1X9V A;  3CD6 V;  1OVR A;  1JO5 A;  1SQB J;  2WZ7 A;  2HP8 A;  2ZT9 C;  3CCJ P;  1IFP A;  2EIJ C;  1XTC C;  3OTO B;  4JAS A;  3FWN A;  2EZP A;  2RH0 A;  3EXA A;  2IDB A;  1N7S A;  5CBG A;  4DR7 O;  2KQX A;  2ZYG A;  4YY3 O;  2KB7 P;  2O57 A;  1AI6 A;  3HR0 A;  5LXT B;  1BQZ A;  1LTI C;  1N34 O;  2ITA A;  1RF0 C;  2BCC E;  1K05 A;  2YEV B;  3JYC A;  4MTO A;  1R6T A;  2R72 A;  3H1H G;  1Z2G A;  1M57 B;  1XOU A;  4MSW C;  1BE3 H;  1N33 B;  5AVU B;  4G2K A;  5TJH A;  3U1A A;  2GM4 A;  5BR8 O;  2BEQ D;  3II6 A;  2DN9 A;  1VF6 A;  1SES A;  4LF6 O;  1LTJ A;  2DJV A;  2Q3I A;  3F7V C;  2W6J G;  2D2C B;  1VQ4 P;  2QGN A;  4GKK O;  2YMK A;  4ZMD A;  4FM0 A;  1M1J A;  4FLX A;  3CCV V;  1KOR A;  1J1D C;  1N7S D;  2K9Y A;  2A06 E;  3CPW O;  3H1J G;  2XT9 A;  4PD4 I;  3BA8 A;  2DE0 X;  3E1R A;  2CUG A;  3M9Q A;  1ZX3 A;  4ZHQ B;  4YJ2 B;  1OCR B;  4JTA B;  4IFD K;  4Q6G A;  1OCC B;  1V55 C;  3JAW A;  1VQ7 V;  1RY3 A;  4X9Q A;  2E76 B;  3LSQ A;  3CCL V;  1FKA O;  5KKZ B;  3C9I A;  1N7L A;  5TIS E;  1J1E B;  4J10 A;  3CWB H;  2E5L B;  3H1I E;  3H1K D;  5B66 H;  4D6T E;  1JA8 A;  1SQQ G;  1MSD A;  4J9Y B;  1LWU A;  4UVB A;  3TCU A;  5B1B C;  3RT3 C;  1E79 H;  4Y99 B;  1GN2 A;  2JEE A;  4U3F J;  4FK5 C;  1R73 A;  2RNB A;  3QO8 A;  1SQX H;  5TIS Z;  1RSO A;  4LBE C;  2UUA O;  4UB6 E;  4JI3 O;  1SQP G;  4DV4 B;  1URQ D;  1XQ8 A;  4LNU A;  1QHT A;  4UB8 Z;  1SQQ D;  4LH6 A;  3L71 G;  5IWA O;  3RL0 D;  2HLD G;  2ZXW B;  1H88 A;  1DF5 A;  5B3S C;  4O4I A;  1GN6 A;  1HWY A;  1W5C E;  3L73 E;  3OGI B;  3ABK B;  4U3F E;  2M8R A;  1GO3 F;  5KHH A;  2W6I G;  4YHH B;  4LH7 A;  1BCC H;  1S9K E;  2M6Y A;  1R8E A;  1USE A;  3L70 E;  2AXT H;  1TUE B;  3FFQ A;  3A5T A;  1H2N A;  4UB8 E;  3D6Y A;  2ZD9 A;  3O9O A;  2FYU J;  1ZLZ A;  4UUJ C;  3A0B Z;  4LNU B;  3T97 B;  2DYS C;  1ZSP A;  4HZ3 A;  2LGW A;  3W7T A;  1TUB A;  1LTA C;  4B3R O;  4B3S O;  1WRG A;  2OYQ A;  1A02 J;  4PDL A;  1HR0 O;  4W4L A;  1SER A;  1EXI A;  3CC2 P;  1VF7 A;  1ZOY C;  3CXH F;  2Q8V A;  4TUY B;  3CXH I;  4OGQ B;  3HD7 B;  2AEF A;  1IC2 A;  3CHX A;  4QGP A;  2OTL V;  2FYU E;  1PP9 D;  2QEX V;  4X65 B;  2OQQ A;  1KQS U;  1NH2 D;  1AB3 A;  3GG2 A;  2DYR C;  2YKQ A;  2P7T C;  4H0L B;  4Y99 C;  1SQQ J;  3SYQ A;  1SFC D;  2H8P D;  1OCZ B;  1JCC A;  1A02 F;  1PNK A;  2OAR A;  3HTK B;  4TT3 H;  2YIB A;  5KHI A;  1OXZ A;  2JJL A;  2WTY A;  4E4E A;  2EUL A;  3LSU A;  3S1K A;  2XAG A;  3CRQ A;  1ZW0 A;  5LP6 C;  5BMV A;  5KKZ C;  4W7Y A;  1RF0 A;  1YHQ P;  1GH6 A;  4NB5 A;  2EIK B;  3SJQ C;  1HDJ A;  3STL C;  5L3C A;  1MZF A;  3QO5 A;  4K0K B;  1PP9 E;  1GN3 A;  1XMO O;  1JQ0 A;  1M1K W;  3ABT A;  2HEP A;  2XTA A;  1WP7 A;  2V7Q J;  3CCV P;  2B89 A;  2HFE D;  3IR9 A;  1K4C C;  1MAB G;  1K4D C;  1Q7Y Q;  2UUA B;  1SZX A;  4D7S A;  4J7K A;  3L75 J;  4H0L C;  4D6T D;  1JTH B;  4PD4 F;  1N86 A;  1H8H G;  3WMM 0;  2B9B A;  3K5B A;  3BAB A;  2MKV A;  4PJ0 H;  1PP9 G;  4B86 A;  3QNE A;  1KB9 I;  3CI9 A;  4TV8 A;  1LGH B;  2YMY A;  3C3T A;  4EFE A;  2PI4 A;  2WQY C;  2YIU C;  2A79 B;  1S5J A;  3SYA A;  3NR7 A;  4WY4 D;  4NXM O;  1OIP A;  1FD9 A;  1QEX A;  2BEZ F;  1NTM H;  4LF8 O;  3KCX A;  1F4N A;  1KKC A;  2ADP A;  2FL4 A;  3VOU A;  3OEE G;  1IBM O;  4ZOL B;  2HKO A;  2EIK C;  2YDE A;  5FL7 G;  3OR7 C;  2V7Q H;  3UKM A;  3JCZ A;  4J7Z A;  3LID A;  1K73 Q;  1J5E O;  2UUB O;  2OTK E;  1VF6 C;  1Q43 A;  4L74 A;  1U7J A;  1WLE A;  5L3B A;  1RF1 B;  3ZHR A;  3U59 A;  1FS0 E;  1JEK A;  1OZH A;  2OT5 A;  4X8A A;  2YO3 A;  1LTS C;  3I55 P;  1VQP P;  5CA0 B;  1CI6 A;  3OMA B;  1I94 O;  3E8H A;  1Q2N A;  1TGO A;  5CCG D;  4CBC A;  5GTH H;  3L74 D;  4MTF A;  4C7N B;  3I5D A;  2RJZ A;  1CPY A;  1OJH A;  4B3M B;  4DCK A;  4ZOL A;  4IYI A;  4PD4 E;  2PUS A;  3CCJ V;  5C8Y B;  3T4D A;  1IBK O;  2WSS H;  3NMD A;  5EBL C;  4GKG A;  4FLZ A;  2EBO A;  1SLQ A;  1GU4 A;  2DW4 A;  3CXH H;  1YBK A;  2PF4 E;  2WLN A;  1HUC A;  3AEB C;  2Q7C A;  1NI8 A;  3ZN1 A;  4YY3 B;  1Y8A A;  3L70 J;  4QPJ A;  3I56 P;  1KB9 E;  3DGE A;  2P2U A;  2ZT9 B;  2K9J B;  2IBZ I;  2RMK B;  1YZB A;  1XL4 A;  4N23 A;  3CC7 P;  2KLU A;  2LR2 A;  1S4X A;  3L75 D;  4WBN B;  2Y4U A;  1KN7 A;  4GDO A;  4NXN B;  4GX0 A;  2UXD B;  2N1T D;  3WU2 E;  3UT5 B;  3GB7 C;  3HKB A;  5CA1 B;  3V4W A;  2Q73 A;  4ZI7 B;  5L3F A;  3IF4 A;  4KHX A;  3X2Q B;  2ZDI A;  1VP7 A;  4OPA A;  4XE5 B;  3L70 H;  1M1K Q;  1BSH A;  2O3J A;  1SQQ E;  5CB4 B;  3RBX A;  1OWA A;  3ZRS A;  5KUK A;  5B66 E;  3CCQ V;  3TXQ A;  3D3I A;  4GX1 A;  2Q5Z A;  3A2F A;  2E75 C;  4GKK B;  1EXJ A;  3T1Y B;  3B5N B;  2WLI A;  3CMA P;  1L0L E;  4EB6 A;  1NWQ A;  2YI9 A;  1D2D A;  1BGY E;  3CCR V;  1AR1 B;  4I55 A;  1RPO A;  4R7C A;  1M8O B;  5EZY A;  2CAZ C;  3H01 A;  3ZHQ A;  4UB8 H;  4UB6 H;  4RKU J;  3JSL A;  2J58 A;  3OW2 U;  2KZI A;  4FFK A;  3CC7 V;  3BCC J;  1PP9 J;  2IBZ G;  2H8P C;  2PYJ A;  1SFC C;  1YQ4 C;  3T97 A;  3GVM A;  1GU5 A;  5CB4 A;  2WPQ A;  3P7K A;  4DV7 B;  1IFD A;  1Q81 W;  5LHH A;  1QGK B;  3L73 H;  1EZV H;  4I4T B;  4YJ3 A;  2V4H A;  3ICX A;  1YTZ T;  3OMI B;  5IJ0 B;  2M7W A;  1KB9 F;  3FD9 A;  5ITZ A;  3CX5 E;  1R3K C;  4I2L C;  4D6T G;  2Y69 B;  3JD1 A;  1VQN P;  1SQP H;  4DV0 B;  5B3S B;  1KQF B;  4BRY A;  2ZR2 A;  3ETD A;  3MGN A;  1M1J B;  1XHZ A;  4PV1 D;  3KKY A;  1HNX B;  2ZCE A;  3CCS V;  3E86 A;  4XDL A;  4O4I B;  2JEX A;  2NNU A;  4UB6 Z;  3NXS A;  3KDP B;  3HE5 B;  1JVM A;  3CCM V;  5IWA B;  4DV6 O;  1M4U A;  1SQB D;  1N73 B;  3DSQ A;  1G1X B;  3L75 H;  1Z5V A;  4JZ2 A;  5APY A;  4DR2 O;  1RQV A;  1AQ5 A;  3H1L H;  1B04 A;  4O4J A;  3W7U A;  2IFN A;  1JR9 A;  2ZIM A;  1EDL A;  1K33 A;  2P90 A;  3ZMS A;  3LUT B;  1ZP0 C;  4MW8 A;  1MOF A;  3A0B E;  2XKM A;  4RWU A;  4PA3 A;  2YSU B;  2HG5 D;  1WMK A;  1NTK D;  4DV2 O;  2HFE C;  4BIU A;  3AE9 C;  1K8A Q;  1HJ0 A;  3HE5 A;  1NU1 J;  2HG5 C;  4LFB B;  1R1B A;  5E79 H;  4NTX A;  2C0X A;  4HYO A;  4RO2 A;  4H44 D;  4YIO A;  2QRX A;  4J80 A;  1QCE A; 
#chains in the Genus database with same CATH homology
 1SQG A;  1FDI A;  3SR2 C;  1SA0 B;  4EEQ A;  3AE8 C;  4F6R B;  2E74 D;  1FFX A;  2YIB D;  2VWK A;  4X20 B;  3RYF B;  1TAE A;  3SJA C;  2FYN C;  1K04 A;  4I4T A;  5LMN B;  3AE4 C;  4O4L B;  1MKM A;  4NVP A;  2YI8 A;  1T5E A;  4K8Z A;  1SKV A;  4FLU A;  4LR3 A;  1XNQ B;  5ITZ B;  3UQ8 A;  5KMG A;  1OW7 A;  2KKW A;  1Q5O A;  4R4L A;  4KT0 J;  1Q90 D;  3K59 A;  2UXC B;  1XMO B;  1H2S B;  4IIJ A;  1SA0 A;  4U3J A;  1SQF A;  5D5P A;  3RGB A;  4X20 A;  4FLT A;  1PIX A;  1IK7 A;  1AJY A;  3RYH B;  2P22 C;  2WSE J;  3Q2Y A;  4O2B A;  3RL0 g;  4X1I A;  3JAT B;  1M93 A;  4LFA B;  5KMG B;  3H25 A;  4FLY A;  2WPV B;  3B2E E;  4I50 A;  3HKC A;  1V9P A;  2UU9 B;  1JFF B;  3Q5S A;  4TV9 B;  4DR3 B;  1JJO A;  1JMK C;  4O4J B;  3AEE C;  4U7J A;  5KX5 A;  3ZED A;  3N2K A;  3BA9 A;  5M1B A;  2ZT9 C;  4IHJ A;  3OTO B;  4DV2 B;  4I55 B;  1TU3 F;  4H44 B;  3JAT A;  3AEC C;  2IDB A;  4TQD A;  1Q8I A;  5D5Q A;  3SJC C;  5IJ9 A;  3EWK A;  3Q1M A;  3JAL A;  4UCR A;  5LXT B;  1K05 A;  4X64 B;  3JAS A;  5JJN B;  2FXP A;  2R72 A;  3HKE A;  2ZM6 B;  2WSC J;  3JAK B;  3N2K B;  1WN7 A;  3K5O A;  2NZ2 A;  3BAA A;  3N2G A;  1N33 B;  2E74 C;  5K1X A;  5J2T B;  3HKD A;  2BEQ D;  4ZI7 A;  1O9H A;  2D2C B;  2YMK A;  5C8Y A;  1O9G A;  4DV1 B;  4FM0 A;  4FLX A;  4DV5 B;  3SFE C;  4UCS A;  1KOR A;  1TUB B;  2K9Y A;  5KHK A;  3BA8 A;  1DIP A;  3M7M X;  1YEW A;  2PGG A;  3CSX A;  1OMI A;  4ZHQ B;  4JI5 B;  2BTO A;  3RYH A;  4YJ2 B;  3K5N A;  4FFB A;  4X1I B;  3QG5 A;  4Q6G A;  3JAW A;  4AQY B;  4YXD C;  1U57 A;  2E76 B;  1JB0 J;  1HNZ B;  1ZAU A;  3BHP A;  2E74 B;  1RQU A;  2E5L B;  5LMU B;  4CH6 A;  1P49 A;  4DV6 B;  2Q7G A;  2QSI A;  2G8Y A;  4EFB A;  2G3A A;  3B71 A;  1S5L X;  4LF9 B;  3MAQ A;  4X1K A;  3AE1 C;  4BWA A;  2FBW C;  1KTM A;  4YJ2 A;  5IJ0 A;  1DD3 A;  5LA6 A;  5LOV A;  4Y28 J;  2QM4 A;  4I9Q A;  4H13 B;  5FPO A;  1RSO A;  3E22 A;  3RWR D;  1KIL E;  1NGM B;  2P10 A;  4DUY B;  4CH5 A;  1QQC A;  4TQF A;  4DV4 B;  1XQ8 A;  2ZNJ A;  4LNU A;  4F6R A;  3JAS B;  1QHT A;  4LH6 A;  5JQG A;  3RYF A;  2BTQ A;  4PV1 C;  3K5L A;  1WPB A;  4O4I A;  2HHH B;  4JYA B;  4O4L A;  3BPZ A;  1OW6 A;  5KHH A;  5J2T A;  4EB6 B;  3Q5P A;  4YHH B;  4DR5 B;  4LH7 A;  3VQV A;  4DK1 A;  2JGU A;  2R9A A;  1R8E A;  5IYZ A;  3FFQ A;  5GON B;  2UUB B;  3S9O A;  3D6Y A;  5JCO A;  3QTC A;  4O4H B;  4LNU B;  1HR0 B;  3T97 B;  2EX3 A;  1N34 B;  4OX9 B;  4L8J A;  3SJB C;  3D70 A;  1TUB A;  1N36 B;  1DD4 A;  2OYQ A;  3AE5 C;  1I94 B;  4YJ3 B;  3FGA D;  4UCO A;  1EXI A;  5CA1 A;  4FLV A;  3RYC A;  1VF7 A;  5LP6 A;  1HF9 A;  1ZOY C;  4TUY B;  3JAW B;  5BMV B;  4Z1M H;  1HW7 A;  2JVD A;  1TA8 A;  4OGQ B;  2P5O A;  3CHX A;  5GON A;  4DUZ B;  4X65 B;  2RQ6 A;  5FPR A;  2OQQ A;  4O4H A;  4H0L B;  3K58 A;  5J2U A;  1N32 B;  1VL2 A;  3O6Q A;  4TT3 H;  2YIB A;  3G9R A;  5KHI A;  3VQX A;  3GLM A;  1Z5W A;  5KHJ A;  4HNA B;  2Q7E A;  5LP6 C;  5BMV A;  4JV5 B;  2ZNI A;  4YTP C;  5KKZ C;  3WB1 A;  5K1P A;  3ZS8 C;  5EYP B;  4I7Z C;  4TV8 B;  3IN6 A;  4JI8 B;  4K0K B;  4LF7 B;  5JJE B;  4DR1 B;  1FJG B;  3AEA C;  3JAK A;  2WSF J;  4FVM A;  2HEP A;  3D71 A;  2PY5 A;  2YIA A;  5JCO C;  2V7Q J;  3RK3 E;  3GF3 A;  2UXB B;  4PHZ A;  4O2B B;  2VQE B;  3AEG C;  3OTF A;  3THO A;  3C8V A;  4HBN A;  2UUA B;  1IBL B;  2GV9 A;  4D7S A;  1KU9 A;  2Q0A A;  4H0L C;  4UCU A;  1Y9B A;  3IAY A;  3U11 A;  5JJJ B;  4I50 B;  3BAB A;  2MKV A;  2IM9 A;  4TV8 A;  3K57 A;  2ZT9 D;  1FFX B;  3AE7 C;  4EFE A;  2WQY C;  2OWO A;  2YIU C;  3RYI B;  2E75 B;  1S5J A;  3AED C;  4H13 D;  3JAR A;  1WNS A;  3UT5 A;  4JI0 B;  3D6Z A;  4IHJ B;  4DR2 B;  2BEZ F;  1YQ3 C;  2O01 J;  1GMJ A;  4DV3 B;  4X1Y B;  3AE6 C;  4GKJ B;  4ZOL B;  4LF8 B;  4PI2 A;  2VQF B;  2PYL A;  5BR8 B;  4TOI A;  2F95 B;  1Q43 A;  4JI2 B;  1HNW B;  3SFD C;  3RYI A;  5J2U B;  1G6U A;  2Q7H A;  5CA0 B;  1ZRT E;  4UCT A;  1D5A A;  3GMA A;  1TGO A;  1XI1 A;  2RJZ A;  4B3M B;  4ZOL A;  4JI1 B;  4IL6 X;  3VQW A;  2PUS A;  3LW5 J;  5C8Y B;  4R4M A;  1XHX A;  3RFR A;  4CC5 A;  1FDO A;  4FLZ A;  3U10 A;  4JI6 B;  4WBN A;  2BTQ B;  5KHG A;  2E75 D;  4DK0 A;  3PN1 A;  2PZS A;  5EIB C;  1NYH A;  4KL1 A;  4UCV A;  2F93 B;  5CA0 A;  3HKB B;  4ZIB A;  3AEB C;  3Q3D A;  4CS2 A;  1VF5 B;  4CH3 A;  4YY3 B;  2JO1 A;  4B08 A;  4FLW A;  1KMI Z;  3WB0 A;  1XMQ B;  2F66 C;  4OGQ C;  2ZT9 B;  5LYJ B;  2QJ1 A;  5JH7 A;  4D7T A;  4IIJ B;  3AEF C;  3K5M A;  4FM2 A;  4WBN B;  4GLX A;  3ABV C;  4LFC B;  5JVD A;  2H88 C;  2JS5 A;  4GDO A;  4NXN B;  1TVK A;  2UXD B;  4NXM B;  3UT5 B;  4LF6 B;  3HKB A;  5CA1 B;  3RYC B;  4ZI7 B;  5LP6 B;  4B3T B;  3JSN A;  5EZY B;  4DR7 B;  4B3S B;  1M5I A;  4CS3 A;  4X66 B;  4JI4 B;  4H13 C;  4FM1 A;  3LNN A;  3HKC B;  4XFJ A;  5CB4 B;  4CH4 A;  4JI3 B;  2UUC B;  4KHP B;  4TV9 A;  1VF5 C;  1XNR B;  5JVD B;  3A2F A;  3QF7 A;  1TVK B;  2E75 C;  2F4V B;  4LF4 B;  4ZHQ A;  4GKK B;  1EXJ A;  2ZIO A;  3T1Y B;  3CB2 A;  1IBM B;  4EB6 A;  1ZME C;  2YI9 A;  4I55 A;  4HNA A;  4OGQ D;  5EZY A;  2CAZ C;  1S1C X;  5FNV B;  4GYC B;  4RKU J;  4AHC A;  3JSL A;  4CC6 A;  3IAO A;  5EYP A;  3JAL B;  1VF5 D;  4H0L D;  2PYJ A;  1YQ4 C;  1OW8 A;  2PTM A;  1PL5 A;  2QIW A;  5CB4 A;  4LF5 B;  4DV7 B;  1J5E B;  3HKE B;  3AE3 C;  1I7F A;  4I4T B;  3N2G B;  4YJ3 A;  2JP3 A;  4UFZ A;  3SGI A;  3ICX A;  4B3R B;  5IJ0 B;  3HKD B;  4H44 C;  2D2C C;  5LOV B;  5ITZ A;  2QJP C;  2V4D A;  3U0Z A;  4CS4 A;  5FNV A;  2R70 A;  3E22 B;  3ETQ A;  1L8D A;  1NT2 B;  2D2C D;  4DV0 B;  1KQF B;  5EIB D;  2YXL A;  5LYJ A;  4U3J B;  4PV1 B;  5JH7 B;  1Q3E A;  1XHZ A;  4PV1 D;  4AIL C;  2ZIN A;  1IBK B;  1HNX B;  2ZCE A;  3GF7 A;  5JQG B;  3JAR B;  5KLI C;  4O2A B;  4O4I B;  3Q5R A;  2XHB A;  2E76 C;  4X1Y A;  4DR6 B;  1DGS A;  4FFB B;  4DRX B;  5IWA B;  2E76 D;  3WB2 A;  1M4U A;  2H89 C;  5IYZ B;  3DSQ A;  1Z5V A;  2E3C A;  2QJK C;  1RQV A;  2VWJ A;  2F1M A;  3AE2 C;  1JFF A;  4PI0 A;  3T1H B;  1B04 A;  4O4J A;  2QJY C;  5KX5 B;  1KQG B;  2ZIM A;  1ZP0 C;  3BRC A;  1X4T A;  2J5U A;  4O2A A;  4K8X A;  4I7Z B;  4X1K B;  4DR4 B;  1WMK A;  5L8R J;  3AE9 C;  4BW9 A;  1HJ0 A;  5LA6 B;  4DRX A;  4LFB B;  1PV3 A;  3VQY A;  1UIX A;  4TUY A;  5IJ9 B;  4H44 D;  4JI7 B;  4X62 B;  3R4Y A;  5LXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...