5H2FE

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5h2fE00
5KAFE 4PJ0E 5E79E 5TISE 4UB8E 2AXTE 5B66E 3WU2E 3A0HE 1W5CE 3JCUE 4UB6E 5H2FE 5GTHE 5GTIE 3KZIE 5B5EE 1S5LE 4IL6E 3A0BE 5KAIE
chains in the Genus database with same CATH superfamily
4D6TJ 2QJPB 4JBZA 3A0BH 2WPSA 3M0DA 4U3FD 2PGDA 3AEEC 1XTCC 3KZIH 3CXHH 2J59M 4K3AA 4U3FE 3L73J 2QJYB 3HD7C 2QVAA 2Y0CA 3ABVC 2FXPA 2I8DA 4UB6H 1G1JA 1SP4A 2A06D 2ITAA 1LT9A 2MKVA 4KJMA 3U59A 3HE4B 2VRSA 5CCGA 2OTLP 1GW3A 2KSJA 2RN0A 1BGYE 2YXRB 2N1TC 1SQVG 1MKMA 2ZVNB 3M06A 3H1HG 2D2CB 4H13C 2OQQA 2HFED 2OGUA 4I2LC 2D2CD 5AW4B 3U1AA 3WUTA 1M57D 1MUUA 1NTZG 2YIUB 4N3YB 1E79H 3H1JJ 4W7YA 2OYIA 1IO4A 1X0TA 2RH0A 1NAYA 3H1IJ 3TNUB 1YJNP 2FYUG 5KLVJ 3G3ZA 1N86A 2J58A 1AV1A 1RF0A 3L70D 3D6ZA 2V7QH 1MZ9A 2KNCA 1MFZA 4RKUJ 1DH3A 2WQYC 5KAFE 1LTJC 2Z5IA 3MTUE 1GU4A 2NZ2A 1L0NG 3RL0D 3BVHA 1HJBA 4C7NA 1J1EB 5KLVK 1BCCE 3H1HE 2ZT9C 4GKGA 3RK3C 3PHLA 2HODB 1KD1Q 4JF7A 1LJ2A 2FYNB 3C1LA 2G3AA 3S1KA 3SFDC 3W67A 2KXPB 2WZ7A 1VQLP 4TT3H 1QL1A 4WVZA 4WY4D 1NTMG 3NTNA 2Q9IA 1EDIA 4RJTA 2AXTH 1NOHA 2ZT9D 4W80A 2IZ1A 4WY4B 1NO4A 3TSIA 3CC7P 4C46A 1X22A 2M3EA 1ZXGA 2A45G 2RKLA 2K37A 3FXEA 1L2PA 2G8YA 1IK7A 1L4AB 2WSEH 3GHGC 4JPZB 3T97B 1R8EA 5B5EE 1SQQD 1IC2A 1JOCA 1P84H 3AE2C 1VPCA 2NPSC 1T8ZA 3H6PA 3BASA 3VMZA 4GDOA 1OIPA 2O01N 3V5BA 4Z1MH 2D2CC 1RE4C 3M9HA 5M1BA 2HPCA 5CMZA 2FFDC 4PJ0E 1K9MQ 1RE4A 1EQ7A 4N78E 2FFDA 2KUBA 2BCCJ 1BDCA 3L74G 4DZOA 2YKOA 4EIJA 3AEBC 1ZV8A 2B88A 5CBNA 2WSSH 1N73A 3CC4P 1NTMJ 3CX5E 3KPEA 1PPJD 1NHLA 1NTKG 5KLVE 3QWOC 2IYPA 4PD4D 3H1LE 3CMAP 1YI2P 3N4XA 3EFGA 1JO5A 2IDBA 3BCCJ 2E43A 1N7SA 3AE7C 4L76A 2YKPA 2IYOA 3L71G 3PTZA 4Y99C 1OFCX 1BSNA 1UIXA 1NWQA 2GA1A 3V2NA 3H32A 2E74C 1OW7A 1M1JC 1URQC 2QRXA 3CLQA 3CCLP 1P84D 1FU1A 2V4HA 1GL2C 3GG2A 3A0BE 1YTZT 3EFFK 3CPWO 1RF1A 1YHQP 3CWBG 2PAJA 1U7MA 2OYOA 1KYOE 2IBZD 3P8CD 2JEEA 5BU8B 3Q5PA 1PP9G 4L73A 2KP8A 1M1KQ 4KHXA 2KLUA 2XU6A 1RQVA 2Y9YA 1SFCB 4LGDE 1SQXK 5GTHH 1PZQA 5TJHA 1OVRA 1FOSE 3AEGC 1DIPA 2R44A 3HE4A 1IFDA 1NGMB 3GF7A 3H1HD 1AVYA 3IR9A 4PJ0H 1M1JA 2QM7A 3AEDC 1NH4A 1EZVE 1X79B 1GK4A 4HYTB 3A0HH 1JY3P 1RE3A 3CCEP 2W8ZA 4U7JA 1ZW0A 4UB6E 2W6AA 2A45I 4K35A 3CX5I 5GTIE 3L73D 1VQMP 1IK9A 1LT9C 1FDIA 5CCGC 3V2RA 2QEXP 4YPCA 2JP3A 1LT1A 3P8MC 4BWNA 2JO1A 3GHGB 3HD7A 3W68A 1L4AC 3TYYA 4D6TD 1KZUB 1LP1B 3FXDA 3V4QA 1ZR4A 1HWTC 1FZGA 5APTA 3LW5H 1HF9A 3B5NC 2I1JA 4I6MC 1RQUA 2YO3A 1SQXG 2FXOA 2A06E 1G1IA 4BXLA 2J5UA 5KJ7A 4DCKA 3BCCD 1NTMD 5AVUB 5TISE 2JKVA 1FZCB 1LTSC 1R5LA 4XE5B 1Q2NA 1IFJA 2K9JB 2KZJA 2YO2A 3CXHI 1VQ8P 1SS1A 2ZXXA 1BE3D 1NTKJ 1KB9D 2K88A 4H44B 1CSBA 1KQSO 3AE8C 1ZRTD 2OYHC 1W5CE 5B5EH 2WMMA 1HJ0A 2ZVOB 2KB7P 5KTBA 1HTLC 3CWBE 1IFMA 3B5NA 2ZXEB 1SQBG 3KZIE 4H0LC 2Q7CA 5CBOA 1BCCJ 5KKZC 1VQKP 1BSHA 3V2QA 2IFMA 1URQD 5CHXA 1BGYG 2YMYA 3MUDC 4BRYB 3CCVP 1URQB 1NTZD 3VOPA 2OARA 1PL5A 3L75D 1OZHA 3CL3D 3G9RA 2KIKA 3HE5B 1P84I 3RK2C 3C8VA 2IBZE 3L75E 4IOIH 3L72G 2WTYA 1VQ6P 3L75J 1RE3C 1HVVA 2QJKC 4H13D 4HKZH 3CXHE 3P32A 1EZVG 5AVTB 3Q2YA 1GD2E 1SQVJ 5TISH 1CZQA 4GT1A 4IL6H 1SFCC 5APXA 2E75C 1IFIA 2ZFCA 2E76D 1PP9J 3Q1MA 1NYHA 3HRNA 3WU2E 4BRYA 3D71A 1D7MA 1WT6A 2KZIA 3H1LG 3KHUA 5L8RJ 1OMIA 3RK3E 1H0TA 1HBWA 1SQPJ 2Z5HA 3AEAC 4DT0A 3H1KD 1SFCA 1AQTA 3CC2P 4IL6E 2AEMA 3H1KJ 4OGQB 5APVA 5KAFH 2WSCH 2C9NY 2H89C 1LT9B 1T3UA 1Y8AA 1OW8A 3CX5D 1JY3N 2WPVB 4N78D 1KILC 3H1LJ 5CCGD 2WVRA 2R5DA 1H0TB 3TGUJ 1S5LH 1KQFB 3Q3DA 2N1TD 2IPPA 2JDIH 2ZYAA 2OTJP 1S5LX 1KQLA 2N1TB 4JYCA 3VYIA 1YIJP 3R2PA 1QVGO 2FYUE 1SQQK 5CCHC 1FZCC 3N7NA 5GTIH 5APQA 2YIUC 3RK2B 2Y0DA 5CJ0A 2BCCE 2ZYGA 4NPDA 3HTKA 3RK2D 1J2JB 4B86A 2BCCD 2FY8A 1ZP0C 2JWDA 1LTBC 2FYZA 3CXHD 3EQ2A 2XKMA 3S4RA 1GU5A 1N73C 1QL2A 2HR3A 1JUNA 1BCCG 2FKWB 3A3YB 1L0LJ 2P1JA 2R3SA 3L71E 1PGPA 2P7JA 4WWIA 4WB4A 4IFDK 3Q5SA 1SVFA 3RK3D 3CX5H 1KB9H 1LP1A 1T2KD 4WY4A 3RK3B 3FGAD 1VQPP 1CI6B 1G2CA 3LW5J 5AW7B 4AUWA 2Q1KA 3H1JE 4PV1C 5H2FE 3RL0B 3GLMA 3L70J 1L4AA 1KYOI 1LTIC 4YTPC 2P67A 2C0WA 3SWYA 1FJKA 1ZMEC 1A02F 2PRRA 1PGJA 3GHGA 3JC22 2WITA 2QE7H 1SQVE 1SQXJ 5APUA 1KV4A 4I7ZB 5B66E 1JNMA 2WSFJ 3MP7B 1JY2P 4LLHA 4XA4A 1YJ9P 1JEKA 1NTZE 3IFMA 2E5YA 2K9YA 2E75B 1VQNP 2NPSB 3HTKB 2E75D 1W2BO 3OJAB 1KMIZ 1L4AD 3E1RA 3M9QA 5AW9B 1N7LA 5AW6B 3JSVC 5AVVB 2FYNC 1LTJA 1QEXA 3L72D 2FYUJ 3V2PA 4AYCA 3G4SP 1K73Q 1BE3E 1NU1K 3H1IG 2OYIC 3AE3C 1TU3F 1Y47A 1FZAA 1SQQJ 3CD6P 5EFWB 2LXCB 1Q7YQ 3B5ND 1EDJA 3IAOA 1KILB 1LTAC 3M0AA 3AE5C 3L73E 2A45H 1DX7A 1YITP 1FZFA 4ASVA 1JMMA 1H8AA 3L4FA 5AVWB 2HODA 3L37A 5APSA 4Y99B 2K9JA 1J1DC 3TGUD 1USDA 5B66H 1UIIA 1N7SC 1BDDA 3A0HE 3G71P 2M3BA 3TK1A 1VDFA 3L70G 4QMAA 3V6IA 1MFTA 3RL0C 1HGZA 1JB0J 3WU2H 2JWAA 3ITKA 3PLNA 2M0BA 3V4WA 5CCHA 1BE3G 1LNQA 2IBZI 2KK7A 3H1IE 3VMAA 2WPQA 3HUSB 2PP6A 1R5SA 1SQVD 2RMZA 2Q3IA 4R4MA 2K3RA 1N73B 4EDFA 1VF5C 1S2EA 3L71J 1DD4A 4JYBA 2HLOA 4OVNF 2WSCJ 3NMDA 3MD0A 1SQBD 2R32A 1M56D 2WWWA 2KSEA 3BRVB 4IFFA 1NTZJ 2DW3A 3G6EP 2OYHA 1L0LD 3HE5A 3I5CA 4DJGA 5GTHE 3OA7A 4ASWA 1A02J 5E79E 1SQBK 2XV5A 3KQGA 3CI9A 1SFCD 3H1HJ 3NXSA 3CCJP 1GL2D 1CW5A 1M1JB 3O6QB 3CMEP 3L75G 1GL2B 3LIDA 1OWAA 3L71D 1PFIA 3H25A 1SQQG 1W2EA 2YKQA 5AW3B 2Y0EA 4Y28J 4JQ0D 3MHVA 1NVOA 2HYNA 2QJYC 4ZMDA 1NTZK 4IFMA 3KYQA 1GW4A 1JCCA 1RHZB 2QM8A 3TNUA 3PRJA 3B4SA 3AE6C 2IFNA 3M91A 2OTKE 1GDTA 4ZNCA 2XDJA 4NPFX 1J1DB 4YXDC 3II6A 3AECC 4XFJA 2IZ0A 2O01J 3H1KG 5KAIE 4C7NB 1AFOA 3SFEC 1BE3J 1NTKD 5DJTB 1SQQE 1JTHB 3P7KA 5AVXB 3VMXA 3KDPB 5BU5A 1S9KE 1YJWP 1PIXA 1GZLA 3VP9A 2OYIB 1P84E 1KQGB 1Q90D 2O3JA 2W90A 3MUDA 4HB1A 2UWJE 5KLIB 3VN0A 1YBKA 1IZNB 3HD7B 1QX8A 1NKNA 4MN4C 3I55P 1LTJB 2JJLA 3HD7D 2AEFA 3MIWA 1L0NK 1CI6A 4H44D 2WSFH 1N8RQ 4N6JA 1VQ9P 2AEJA 1FDMA 1KILE 3OW2O 2KLVA 2IBZG 3MGNA 2BEQD 2NPSA 2C9LY 1EDLA 4PD4E 2L91A 4A7PA 1FZCA 3M9BA 1URQA 1PPJE 5H2FH 2QIWA 3PH0A 4LC1A 5AW0B 1VQ4P 5CJ4A 3CCRP 2QJKB 3H1JD 2KNCB 3B8EB 4EOTA 4IL6X 2B9BA 2LR2A 3K5BA 2HPCB 1FOSF 1YQ3C 3UIAA 1QLED 2CK3H 1VL2A 4PD4I 1EZVI 1L0LE 2KYVA 1NU1J 2FXMA 1M8OB 5AVZB 1J1EC 1X9VA 2O1JA 3L73G 4DOJA 2M8RA 1PP9D 3QH9A 5AVQB 2ZT9B 1VQOP 4C7RA 1M90Q 1KYOH 1EDKA 3GMAA 5AW2B 1NU1G 2LXBA 1AA0A 2ZJSE 3I56P 1K8AQ 1FZEA 2H8PD 3FWNA 1OX3A 2W83C 1ZOYC 4EI2A 1KB9I 1VQ5P 4YXWH 3HUSA 1PGOA 3SWFA 2ZAEB 1T2KC 4WY4C 4U3FG 5KLVG 2W27A 3H1KE 1FJPA 5KLIC 1S1CX 2GM4A 2H7HA 1T6AA 1KB9E 1MV8A 3E1IA 1NTME 2QSIA 2BEZF 3E7KA 3USSA 1OXZA 3NFQA 1L0LG 3BCCG 4GOFA 2Z4EA 3OAKA 3TGUE 1EZVD 3IN6A 2H88C 2LKMA 5E79H 5K5GB 1JY3O 2R3CA 3CWBD 2Y9ZA 1QGKB 2B89A 5AVRB 5CCHD 2FFDB 3S9OA 3LIEA 4NPEA 3R4YA 2B87B 1RF1B 1JY2N 2B87A 2GUVA 2WPRA 3FWLA 1SQPK 4L74A 1YQ4C 1HGVA 4OGQC 4M3LA 4KT0J 1FS0E 2ZYDA 4OWFA 4D6TE 4EYYQ 1KC8Q 1L0LK 1NTMK 3CCMP 1JM0A 3BRTB 3L35A 2C0XA 1GTWA 1NAFA 4L75A 1Q82Q 1BGYD 4CPGA 3CCSP 3CWBJ 3BCCE 1L0NE 1JCDA 3TGUG 1USEA 5AW8B 1YYCA 1S5LE 1U57A 1L0ND 1RF0C 1WMKA 1Z56A 3SWKA 1NJIQ 1S3JA 3RBZA 1GMJA 2E74D 1LWUA 3D70A 3AEFC 1SQPG 2KOGA 1FDOA 2E74B 3O8ZA 1Y9BA 1Q86Q 4PV1B 3P8CE 2O1KA 3GW6A 3IF4A 2P2UA 2L5GB 2O01H 4PV1D 1S72P 2E5TA 3AE4C 5KAIH 4TLFA 2E76C 1LTGC 1QVFO 1KN7A 1YTZI 4I7ZC 1AVOA 1FC2C 2N9YB 3RL0g 1SQXE 3C9IA 1LWUB 4I1LA 4UB8E 2KS1B 3WMM0 4D6TG 3A7OA 2N1TA 1GK6A 1KORA 2BCCG 1SQVK 2Q6QA 1PP9E 2A06G 3D6YA 1T3JA 2YXQB 2H43A 1KFNA 1SQPE 4GOEA 1N2DC 2GUSA 1DD3A 1G2CB 3L74J 1OW6A 2K1AA 1IJDB 1JTHA 3AE1C 1WRGA 3L74E 2P58A 1DEEG 4O9BA 2NPSD 1U7JA 1LTTC 3MZWB 1RH5B 2FYUK 1DEBA 2KS1A 2V7QJ 3H1JG 4UB8H 3TF5A 3H1LD 5KJ7D 3VTPC 1KFMA 1EXIA 4W7ZA 2R5BA 1NTKE 3KXDA 3JCUH 2FYUD 4H0LD 1OVVA 1PPJG 4U3FJ 1KILA 2YNYA 5AVSB 2E42A 3CCUP 4H0LB 2P10A 3L36A 1H89A 1M7LA 3T97A 2CPBA 2FBWC 3B5NB 1KTMA 2BASA 1KILD 2XNXA 5KJ7C 3WUVA 2AXTE 1AJYA 2CPSA 2AXCA 1FBMA 1KYOD 1ZR2A 1LGHB 1RF1C 3TDKA 1E5WA 1NKZB 2PFXA 3AE9C 5KLVD 2M5AA 3FX0A 2QJPC 3HUSC 2WSEJ 2W6BA 4H44C 1FE6A 3ZDMA 2OYHB 4RO0A 3GF3A 2WT7B 1L0NJ 3CCQP 1S9KD 1XTGB 2POHA 3A5TA 2WT7A 2QG4A 1ZN5A 3H1ID 5AW1B 3SSUA 1FZBA 2IX7C 4RESB 5C39A 1BGYJ 5KKZB 1JY2O 3PP5A 1FAVA 2M5AB 5APWA 2I1KA 1OVUA 3VP8A 3A2AA 1N7SB 2XNDH 1SQBJ 1BCCD 1AQ5A 2KI7B 3PJSK 4H13B 3M0DC 1SQBE 3U1CA 1N7SD 3BATA 2N9BA 2NRGA 1X8YA 4OH8B 2QA4P 3EWKA 4ZKUA 3O6QA 1Q81Q 3L70E 3RGUA 3L72J 1EC5A 3Q5RA 1VQ7P 1PGQA 3L74D 2E76B 1VF5D 5APYA 3RBXA 1IFPA 2Q3EA 4WBAA 5AW5B 3F5HA 4PD4H 1VF5B 1H88A 5DJUB 5BVZA 4AQRD 1LWUC 3B71A 4GIFA 1S4XA 2SPZA 3JCUE 4HJGH 5AVYB 3L72E 2MJZA 1RY3A 4GODA 4R4LA 3WUUA 1ZLLA 2YMKA 1HH0A 2W6JH 1K04A 1PV3A 3H32B 1EXJA 1SQPD 1NU1E 3F89A 4OGQD 4HH2A 1HUCA 1NU1D 2JR8A 1K05A 4ZKPA 2HG5D 1NTKK 3VMYA 1SQXD 1SLQA 2Q5UA 2XZRA 1ZRTE 1GL2A 1JMBA 1IFNA
chains in the Genus database with same CATH topology
5KAFE 4PJ0E 5E79E 5TISE 4UB8E 2AXTE 5B66E 3WU2E 3A0HE 1W5CE 3JCUE 4UB6E 5H2FE 5GTHE 5GTIE 3KZIE 5B5EE 1S5LE 4IL6E 3A0BE 5KAIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF E;  4PJ0 E;  5E79 E;  5TIS E;  4UB8 E;  2AXT E;  5B66 E;  3WU2 E;  3A0H E;  1W5C E;  3JCU E;  4UB6 E;  5H2F E;  5GTH E;  5GTI E;  3KZI E;  5B5E E;  1S5L E;  4IL6 E;  3A0B E;  5KAI E; 
#chains in the Genus database with same CATH topology
 4D6T J;  2QJP B;  4JBZ A;  3A0B H;  2WPS A;  3M0D A;  4U3F D;  2PGD A;  3AEE C;  1XTC C;  3KZI H;  3CXH H;  2J59 M;  4K3A A;  4U3F E;  3L73 J;  2QJY B;  3HD7 C;  2QVA A;  2Y0C A;  3ABV C;  2FXP A;  2I8D A;  4UB6 H;  1G1J A;  1SP4 A;  2A06 D;  2ITA A;  1LT9 A;  2MKV A;  4KJM A;  3U59 A;  3HE4 B;  2VRS A;  5CCG A;  2OTL P;  1GW3 A;  2KSJ A;  2RN0 A;  1BGY E;  2YXR B;  2N1T C;  1SQV G;  1MKM A;  2ZVN B;  3M06 A;  3H1H G;  2D2C B;  4H13 C;  2OQQ A;  2HFE D;  2OGU A;  4I2L C;  2D2C D;  5AW4 B;  3U1A A;  3WUT A;  1M57 D;  1MUU A;  1NTZ G;  2YIU B;  4N3Y B;  1E79 H;  3H1J J;  4W7Y A;  2OYI A;  1IO4 A;  1X0T A;  2RH0 A;  1NAY A;  3H1I J;  3TNU B;  1YJN P;  2FYU G;  5KLV J;  3G3Z A;  1N86 A;  2J58 A;  1AV1 A;  1RF0 A;  3L70 D;  3D6Z A;  2V7Q H;  1MZ9 A;  2KNC A;  1MFZ A;  4RKU J;  1DH3 A;  2WQY C;  5KAF E;  1LTJ C;  2Z5I A;  3MTU E;  1GU4 A;  2NZ2 A;  1L0N G;  3RL0 D;  3BVH A;  1HJB A;  4C7N A;  1J1E B;  5KLV K;  1BCC E;  3H1H E;  2ZT9 C;  4GKG A;  3RK3 C;  3PHL A;  2HOD B;  1KD1 Q;  4JF7 A;  1LJ2 A;  2FYN B;  3C1L A;  2G3A A;  3S1K A;  3SFD C;  3W67 A;  2KXP B;  2WZ7 A;  1VQL P;  4TT3 H;  1QL1 A;  4WVZ A;  4WY4 D;  1NTM G;  3NTN A;  2Q9I A;  1EDI A;  4RJT A;  2AXT H;  1NOH A;  2ZT9 D;  4W80 A;  2IZ1 A;  4WY4 B;  1NO4 A;  3TSI A;  3CC7 P;  4C46 A;  1X22 A;  2M3E A;  1ZXG A;  2A45 G;  2RKL A;  2K37 A;  3FXE A;  1L2P A;  2G8Y A;  1IK7 A;  1L4A B;  2WSE H;  3GHG C;  4JPZ B;  3T97 B;  1R8E A;  5B5E E;  1SQQ D;  1IC2 A;  1JOC A;  1P84 H;  3AE2 C;  1VPC A;  2NPS C;  1T8Z A;  3H6P A;  3BAS A;  3VMZ A;  4GDO A;  1OIP A;  2O01 N;  3V5B A;  4Z1M H;  2D2C C;  1RE4 C;  3M9H A;  5M1B A;  2HPC A;  5CMZ A;  2FFD C;  4PJ0 E;  1K9M Q;  1RE4 A;  1EQ7 A;  4N78 E;  2FFD A;  2KUB A;  2BCC J;  1BDC A;  3L74 G;  4DZO A;  2YKO A;  4EIJ A;  3AEB C;  1ZV8 A;  2B88 A;  5CBN A;  2WSS H;  1N73 A;  3CC4 P;  1NTM J;  3CX5 E;  3KPE A;  1PPJ D;  1NHL A;  1NTK G;  5KLV E;  3QWO C;  2IYP A;  4PD4 D;  3H1L E;  3CMA P;  1YI2 P;  3N4X A;  3EFG A;  1JO5 A;  2IDB A;  3BCC J;  2E43 A;  1N7S A;  3AE7 C;  4L76 A;  2YKP A;  2IYO A;  3L71 G;  3PTZ A;  4Y99 C;  1OFC X;  1BSN A;  1UIX A;  1NWQ A;  2GA1 A;  3V2N A;  3H32 A;  2E74 C;  1OW7 A;  1M1J C;  1URQ C;  2QRX A;  3CLQ A;  3CCL P;  1P84 D;  1FU1 A;  2V4H A;  1GL2 C;  3GG2 A;  3A0B E;  1YTZ T;  3EFF K;  3CPW O;  1RF1 A;  1YHQ P;  3CWB G;  2PAJ A;  1U7M A;  2OYO A;  1KYO E;  2IBZ D;  3P8C D;  2JEE A;  5BU8 B;  3Q5P A;  1PP9 G;  4L73 A;  2KP8 A;  1M1K Q;  4KHX A;  2KLU A;  2XU6 A;  1RQV A;  2Y9Y A;  1SFC B;  4LGD E;  1SQX K;  5GTH H;  1PZQ A;  5TJH A;  1OVR A;  1FOS E;  3AEG C;  1DIP A;  2R44 A;  3HE4 A;  1IFD A;  1NGM B;  3GF7 A;  3H1H D;  1AVY A;  3IR9 A;  4PJ0 H;  1M1J A;  2QM7 A;  3AED C;  1NH4 A;  1EZV E;  1X79 B;  1GK4 A;  4HYT B;  3A0H H;  1JY3 P;  1RE3 A;  3CCE P;  2W8Z A;  4U7J A;  1ZW0 A;  4UB6 E;  2W6A A;  2A45 I;  4K35 A;  3CX5 I;  5GTI E;  3L73 D;  1VQM P;  1IK9 A;  1LT9 C;  1FDI A;  5CCG C;  3V2R A;  2QEX P;  4YPC A;  2JP3 A;  1LT1 A;  3P8M C;  4BWN A;  2JO1 A;  3GHG B;  3HD7 A;  3W68 A;  1L4A C;  3TYY A;  4D6T D;  1KZU B;  1LP1 B;  3FXD A;  3V4Q A;  1ZR4 A;  1HWT C;  1FZG A;  5APT A;  3LW5 H;  1HF9 A;  3B5N C;  2I1J A;  4I6M C;  1RQU A;  2YO3 A;  1SQX G;  2FXO A;  2A06 E;  1G1I A;  4BXL A;  2J5U A;  5KJ7 A;  4DCK A;  3BCC D;  1NTM D;  5AVU B;  5TIS E;  2JKV A;  1FZC B;  1LTS C;  1R5L A;  4XE5 B;  1Q2N A;  1IFJ A;  2K9J B;  2KZJ A;  2YO2 A;  3CXH I;  1VQ8 P;  1SS1 A;  2ZXX A;  1BE3 D;  1NTK J;  1KB9 D;  2K88 A;  4H44 B;  1CSB A;  1KQS O;  3AE8 C;  1ZRT D;  2OYH C;  1W5C E;  5B5E H;  2WMM A;  1HJ0 A;  2ZVO B;  2KB7 P;  5KTB A;  1HTL C;  3CWB E;  1IFM A;  3B5N A;  2ZXE B;  1SQB G;  3KZI E;  4H0L C;  2Q7C A;  5CBO A;  1BCC J;  5KKZ C;  1VQK P;  1BSH A;  3V2Q A;  2IFM A;  1URQ D;  5CHX A;  1BGY G;  2YMY A;  3MUD C;  4BRY B;  3CCV P;  1URQ B;  1NTZ D;  3VOP A;  2OAR A;  1PL5 A;  3L75 D;  1OZH A;  3CL3 D;  3G9R A;  2KIK A;  3HE5 B;  1P84 I;  3RK2 C;  3C8V A;  2IBZ E;  3L75 E;  4IOI H;  3L72 G;  2WTY A;  1VQ6 P;  3L75 J;  1RE3 C;  1HVV A;  2QJK C;  4H13 D;  4HKZ H;  3CXH E;  3P32 A;  1EZV G;  5AVT B;  3Q2Y A;  1GD2 E;  1SQV J;  5TIS H;  1CZQ A;  4GT1 A;  4IL6 H;  1SFC C;  5APX A;  2E75 C;  1IFI A;  2ZFC A;  2E76 D;  1PP9 J;  3Q1M A;  1NYH A;  3HRN A;  3WU2 E;  4BRY A;  3D71 A;  1D7M A;  1WT6 A;  2KZI A;  3H1L G;  3KHU A;  5L8R J;  1OMI A;  3RK3 E;  1H0T A;  1HBW A;  1SQP J;  2Z5H A;  3AEA C;  4DT0 A;  3H1K D;  1SFC A;  1AQT A;  3CC2 P;  4IL6 E;  2AEM A;  3H1K J;  4OGQ B;  5APV A;  5KAF H;  2WSC H;  2C9N Y;  2H89 C;  1LT9 B;  1T3U A;  1Y8A A;  1OW8 A;  3CX5 D;  1JY3 N;  2WPV B;  4N78 D;  1KIL C;  3H1L J;  5CCG D;  2WVR A;  2R5D A;  1H0T B;  3TGU J;  1S5L H;  1KQF B;  3Q3D A;  2N1T D;  2IPP A;  2JDI H;  2ZYA A;  2OTJ P;  1S5L X;  1KQL A;  2N1T B;  4JYC A;  3VYI A;  1YIJ P;  3R2P A;  1QVG O;  2FYU E;  1SQQ K;  5CCH C;  1FZC C;  3N7N A;  5GTI H;  5APQ A;  2YIU C;  3RK2 B;  2Y0D A;  5CJ0 A;  2BCC E;  2ZYG A;  4NPD A;  3HTK A;  3RK2 D;  1J2J B;  4B86 A;  2BCC D;  2FY8 A;  1ZP0 C;  2JWD A;  1LTB C;  2FYZ A;  3CXH D;  3EQ2 A;  2XKM A;  3S4R A;  1GU5 A;  1N73 C;  1QL2 A;  2HR3 A;  1JUN A;  1BCC G;  2FKW B;  3A3Y B;  1L0L J;  2P1J A;  2R3S A;  3L71 E;  1PGP A;  2P7J A;  4WWI A;  4WB4 A;  4IFD K;  3Q5S A;  1SVF A;  3RK3 D;  3CX5 H;  1KB9 H;  1LP1 A;  1T2K D;  4WY4 A;  3RK3 B;  3FGA D;  1VQP P;  1CI6 B;  1G2C A;  3LW5 J;  5AW7 B;  4AUW A;  2Q1K A;  3H1J E;  4PV1 C;  5H2F E;  3RL0 B;  3GLM A;  3L70 J;  1L4A A;  1KYO I;  1LTI C;  4YTP C;  2P67 A;  2C0W A;  3SWY A;  1FJK A;  1ZME C;  1A02 F;  2PRR A;  1PGJ A;  3GHG A;  3JC2 2;  2WIT A;  2QE7 H;  1SQV E;  1SQX J;  5APU A;  1KV4 A;  4I7Z B;  5B66 E;  1JNM A;  2WSF J;  3MP7 B;  1JY2 P;  4LLH A;  4XA4 A;  1YJ9 P;  1JEK A;  1NTZ E;  3IFM A;  2E5Y A;  2K9Y A;  2E75 B;  1VQN P;  2NPS B;  3HTK B;  2E75 D;  1W2B O;  3OJA B;  1KMI Z;  1L4A D;  3E1R A;  3M9Q A;  5AW9 B;  1N7L A;  5AW6 B;  3JSV C;  5AVV B;  2FYN C;  1LTJ A;  1QEX A;  3L72 D;  2FYU J;  3V2P A;  4AYC A;  3G4S P;  1K73 Q;  1BE3 E;  1NU1 K;  3H1I G;  2OYI C;  3AE3 C;  1TU3 F;  1Y47 A;  1FZA A;  1SQQ J;  3CD6 P;  5EFW B;  2LXC B;  1Q7Y Q;  3B5N D;  1EDJ A;  3IAO A;  1KIL B;  1LTA C;  3M0A A;  3AE5 C;  3L73 E;  2A45 H;  1DX7 A;  1YIT P;  1FZF A;  4ASV A;  1JMM A;  1H8A A;  3L4F A;  5AVW B;  2HOD A;  3L37 A;  5APS A;  4Y99 B;  2K9J A;  1J1D C;  3TGU D;  1USD A;  5B66 H;  1UII A;  1N7S C;  1BDD A;  3A0H E;  3G71 P;  2M3B A;  3TK1 A;  1VDF A;  3L70 G;  4QMA A;  3V6I A;  1MFT A;  3RL0 C;  1HGZ A;  1JB0 J;  3WU2 H;  2JWA A;  3ITK A;  3PLN A;  2M0B A;  3V4W A;  5CCH A;  1BE3 G;  1LNQ A;  2IBZ I;  2KK7 A;  3H1I E;  3VMA A;  2WPQ A;  3HUS B;  2PP6 A;  1R5S A;  1SQV D;  2RMZ A;  2Q3I A;  4R4M A;  2K3R A;  1N73 B;  4EDF A;  1VF5 C;  1S2E A;  3L71 J;  1DD4 A;  4JYB A;  2HLO A;  4OVN F;  2WSC J;  3NMD A;  3MD0 A;  1SQB D;  2R32 A;  1M56 D;  2WWW A;  2KSE A;  3BRV B;  4IFF A;  1NTZ J;  2DW3 A;  3G6E P;  2OYH A;  1L0L D;  3HE5 A;  3I5C A;  4DJG A;  5GTH E;  3OA7 A;  4ASW A;  1A02 J;  5E79 E;  1SQB K;  2XV5 A;  3KQG A;  3CI9 A;  1SFC D;  3H1H J;  3NXS A;  3CCJ P;  1GL2 D;  1CW5 A;  1M1J B;  3O6Q B;  3CME P;  3L75 G;  1GL2 B;  3LID A;  1OWA A;  3L71 D;  1PFI A;  3H25 A;  1SQQ G;  1W2E A;  2YKQ A;  5AW3 B;  2Y0E A;  4Y28 J;  4JQ0 D;  3MHV A;  1NVO A;  2HYN A;  2QJY C;  4ZMD A;  1NTZ K;  4IFM A;  3KYQ A;  1GW4 A;  1JCC A;  1RHZ B;  2QM8 A;  3TNU A;  3PRJ A;  3B4S A;  3AE6 C;  2IFN A;  3M91 A;  2OTK E;  1GDT A;  4ZNC A;  2XDJ A;  4NPF X;  1J1D B;  4YXD C;  3II6 A;  3AEC C;  4XFJ A;  2IZ0 A;  2O01 J;  3H1K G;  5KAI E;  4C7N B;  1AFO A;  3SFE C;  1BE3 J;  1NTK D;  5DJT B;  1SQQ E;  1JTH B;  3P7K A;  5AVX B;  3VMX A;  3KDP B;  5BU5 A;  1S9K E;  1YJW P;  1PIX A;  1GZL A;  3VP9 A;  2OYI B;  1P84 E;  1KQG B;  1Q90 D;  2O3J A;  2W90 A;  3MUD A;  4HB1 A;  2UWJ E;  5KLI B;  3VN0 A;  1YBK A;  1IZN B;  3HD7 B;  1QX8 A;  1NKN A;  4MN4 C;  3I55 P;  1LTJ B;  2JJL A;  3HD7 D;  2AEF A;  3MIW A;  1L0N K;  1CI6 A;  4H44 D;  2WSF H;  1N8R Q;  4N6J A;  1VQ9 P;  2AEJ A;  1FDM A;  1KIL E;  3OW2 O;  2KLV A;  2IBZ G;  3MGN A;  2BEQ D;  2NPS A;  2C9L Y;  1EDL A;  4PD4 E;  2L91 A;  4A7P A;  1FZC A;  3M9B A;  1URQ A;  1PPJ E;  5H2F H;  2QIW A;  3PH0 A;  4LC1 A;  5AW0 B;  1VQ4 P;  5CJ4 A;  3CCR P;  2QJK B;  3H1J D;  2KNC B;  3B8E B;  4EOT A;  4IL6 X;  2B9B A;  2LR2 A;  3K5B A;  2HPC B;  1FOS F;  1YQ3 C;  3UIA A;  1QLE D;  2CK3 H;  1VL2 A;  4PD4 I;  1EZV I;  1L0L E;  2KYV A;  1NU1 J;  2FXM A;  1M8O B;  5AVZ B;  1J1E C;  1X9V A;  2O1J A;  3L73 G;  4DOJ A;  2M8R A;  1PP9 D;  3QH9 A;  5AVQ B;  2ZT9 B;  1VQO P;  4C7R A;  1M90 Q;  1KYO H;  1EDK A;  3GMA A;  5AW2 B;  1NU1 G;  2LXB A;  1AA0 A;  2ZJS E;  3I56 P;  1K8A Q;  1FZE A;  2H8P D;  3FWN A;  1OX3 A;  2W83 C;  1ZOY C;  4EI2 A;  1KB9 I;  1VQ5 P;  4YXW H;  3HUS A;  1PGO A;  3SWF A;  2ZAE B;  1T2K C;  4WY4 C;  4U3F G;  5KLV G;  2W27 A;  3H1K E;  1FJP A;  5KLI C;  1S1C X;  2GM4 A;  2H7H A;  1T6A A;  1KB9 E;  1MV8 A;  3E1I A;  1NTM E;  2QSI A;  2BEZ F;  3E7K A;  3USS A;  1OXZ A;  3NFQ A;  1L0L G;  3BCC G;  4GOF A;  2Z4E A;  3OAK A;  3TGU E;  1EZV D;  3IN6 A;  2H88 C;  2LKM A;  5E79 H;  5K5G B;  1JY3 O;  2R3C A;  3CWB D;  2Y9Z A;  1QGK B;  2B89 A;  5AVR B;  5CCH D;  2FFD B;  3S9O A;  3LIE A;  4NPE A;  3R4Y A;  2B87 B;  1RF1 B;  1JY2 N;  2B87 A;  2GUV A;  2WPR A;  3FWL A;  1SQP K;  4L74 A;  1YQ4 C;  1HGV A;  4OGQ C;  4M3L A;  4KT0 J;  1FS0 E;  2ZYD A;  4OWF A;  4D6T E;  4EYY Q;  1KC8 Q;  1L0L K;  1NTM K;  3CCM P;  1JM0 A;  3BRT B;  3L35 A;  2C0X A;  1GTW A;  1NAF A;  4L75 A;  1Q82 Q;  1BGY D;  4CPG A;  3CCS P;  3CWB J;  3BCC E;  1L0N E;  1JCD A;  3TGU G;  1USE A;  5AW8 B;  1YYC A;  1S5L E;  1U57 A;  1L0N D;  1RF0 C;  1WMK A;  1Z56 A;  3SWK A;  1NJI Q;  1S3J A;  3RBZ A;  1GMJ A;  2E74 D;  1LWU A;  3D70 A;  3AEF C;  1SQP G;  2KOG A;  1FDO A;  2E74 B;  3O8Z A;  1Y9B A;  1Q86 Q;  4PV1 B;  3P8C E;  2O1K A;  3GW6 A;  3IF4 A;  2P2U A;  2L5G B;  2O01 H;  4PV1 D;  1S72 P;  2E5T A;  3AE4 C;  5KAI H;  4TLF A;  2E76 C;  1LTG C;  1QVF O;  1KN7 A;  1YTZ I;  4I7Z C;  1AVO A;  1FC2 C;  2N9Y B;  3RL0 g;  1SQX E;  3C9I A;  1LWU B;  4I1L A;  4UB8 E;  2KS1 B;  3WMM 0;  4D6T G;  3A7O A;  2N1T A;  1GK6 A;  1KOR A;  2BCC G;  1SQV K;  2Q6Q A;  1PP9 E;  2A06 G;  3D6Y A;  1T3J A;  2YXQ B;  2H43 A;  1KFN A;  1SQP E;  4GOE A;  1N2D C;  2GUS A;  1DD3 A;  1G2C B;  3L74 J;  1OW6 A;  2K1A A;  1IJD B;  1JTH A;  3AE1 C;  1WRG A;  3L74 E;  2P58 A;  1DEE G;  4O9B A;  2NPS D;  1U7J A;  1LTT C;  3MZW B;  1RH5 B;  2FYU K;  1DEB A;  2KS1 A;  2V7Q J;  3H1J G;  4UB8 H;  3TF5 A;  3H1L D;  5KJ7 D;  3VTP C;  1KFM A;  1EXI A;  4W7Z A;  2R5B A;  1NTK E;  3KXD A;  3JCU H;  2FYU D;  4H0L D;  1OVV A;  1PPJ G;  4U3F J;  1KIL A;  2YNY A;  5AVS B;  2E42 A;  3CCU P;  4H0L B;  2P10 A;  3L36 A;  1H89 A;  1M7L A;  3T97 A;  2CPB A;  2FBW C;  3B5N B;  1KTM A;  2BAS A;  1KIL D;  2XNX A;  5KJ7 C;  3WUV A;  2AXT E;  1AJY A;  2CPS A;  2AXC A;  1FBM A;  1KYO D;  1ZR2 A;  1LGH B;  1RF1 C;  3TDK A;  1E5W A;  1NKZ B;  2PFX A;  3AE9 C;  5KLV D;  2M5A A;  3FX0 A;  2QJP C;  3HUS C;  2WSE J;  2W6B A;  4H44 C;  1FE6 A;  3ZDM A;  2OYH B;  4RO0 A;  3GF3 A;  2WT7 B;  1L0N J;  3CCQ P;  1S9K D;  1XTG B;  2POH A;  3A5T A;  2WT7 A;  2QG4 A;  1ZN5 A;  3H1I D;  5AW1 B;  3SSU A;  1FZB A;  2IX7 C;  4RES B;  5C39 A;  1BGY J;  5KKZ B;  1JY2 O;  3PP5 A;  1FAV A;  2M5A B;  5APW A;  2I1K A;  1OVU A;  3VP8 A;  3A2A A;  1N7S B;  2XND H;  1SQB J;  1BCC D;  1AQ5 A;  2KI7 B;  3PJS K;  4H13 B;  3M0D C;  1SQB E;  3U1C A;  1N7S D;  3BAT A;  2N9B A;  2NRG A;  1X8Y A;  4OH8 B;  2QA4 P;  3EWK A;  4ZKU A;  3O6Q A;  1Q81 Q;  3L70 E;  3RGU A;  3L72 J;  1EC5 A;  3Q5R A;  1VQ7 P;  1PGQ A;  3L74 D;  2E76 B;  1VF5 D;  5APY A;  3RBX A;  1IFP A;  2Q3E A;  4WBA A;  5AW5 B;  3F5H A;  4PD4 H;  1VF5 B;  1H88 A;  5DJU B;  5BVZ A;  4AQR D;  1LWU C;  3B71 A;  4GIF A;  1S4X A;  2SPZ A;  3JCU E;  4HJG H;  5AVY B;  3L72 E;  2MJZ A;  1RY3 A;  4GOD A;  4R4L A;  3WUU A;  1ZLL A;  2YMK A;  1HH0 A;  2W6J H;  1K04 A;  1PV3 A;  3H32 B;  1EXJ A;  1SQP D;  1NU1 E;  3F89 A;  4OGQ D;  4HH2 A;  1HUC A;  1NU1 D;  2JR8 A;  1K05 A;  4ZKP A;  2HG5 D;  1NTK K;  3VMY A;  1SQX D;  1SLQ A;  2Q5U A;  2XZR A;  1ZRT E;  1GL2 A;  1JMB A;  1IFN A; 
#chains in the Genus database with same CATH homology
 5KAF E;  4PJ0 E;  5E79 E;  5TIS E;  4UB8 E;  2AXT E;  5B66 E;  3WU2 E;  3A0H E;  1W5C E;  3JCU E;  4UB6 E;  5H2F E;  5GTH E;  5GTI E;  3KZI E;  5B5E E;  1S5L E;  4IL6 E;  3A0B E;  5KAI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...