5H2FE

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5h2fE00
4IL6E 3KZIE 5GTHE 3A0HE 5GTIE 5H2FE 4UB6E 5TISE 2AXTE 5B5EE 5E79E 3WU2E 4PJ0E 5B66E 5KAIE 3A0BE 5KAFE 4UB8E 1W5CE 1S5LE 3JCUE
chains in the Genus database with same CATH superfamily
3C9IA 1VQLP 3NTNA 2HR3A 2A06E 1PGQA 3CCUP 1PZQA 2KZJA 2Y9ZA 2N9BA 1VL2A 2CPSA 4N3YB 1VQ5P 4PD4E 1T2KD 3LW5H 2AXCA 3BASA 5KAFE 4DJGA 1RE3A 4GOFA 3CMAP 1GK4A 1VF5B 1KQFB 2R44A 1FZGA 1IFIA 1NTKG 4H13C 3E1RA 4DT0A 1W2BO 3B5NC 3AEAC 1QGKB 1ZV8A 1PV3A 1RQUA 2OYHA 2ZYAA 1KILB 1HF9A 1QLED 5CJ0A 1EZVE 4H0LB 2KSEA 2QM8A 4BWNA 3RL0C 2ZAEB 3PP5A 1J2JB 3CC7P 1SQBG 4NPFX 1IFMA 2WPVB 4CPGA 3D6YA 1PP9J 2N1TA 4XE5B 3LIEA 2OQQA 2WSFJ 1BE3J 3MZWB 5KLVD 3AEGC 3NXSA 3KZIE 1L0LJ 3S9OA 1JEKA 4NPEA 1NTKD 2N1TB 1L4AB 2K37A 1NOHA 2W27A 1GL2D 2FYUE 1EQ7A 1KC8Q 4IOIH 2YO3A 3L70J 1GZLA 3HE5B 2YIUB 2OYOA 3UIAA 3SSUA 4H44C 5APYA 4UB8E 2E74D 2YMKA 1MUUA 5AW7B 2JWDA 3M0DC 4GKGA 2QVAA 3O8ZA 3A5TA 4U7JA 1LT9A 5AW4B 4ZMDA 2WMMA 3A2AA 1GK6A 2GUSA 1PP9G 1N7SC 3L75E 2FYUK 1TU3F 1SFCD 2OTKE 1ZLLA 1L0NE 1BE3G 3CCSP 1URQD 3PJSK 1LT9B 2MJZA 3LW5J 1RF0C 5H2FH 2R3CA 2WSSH 1LNQA 1SQPD 5KLIB 3CX5H 1GL2A 1SQQJ 2E42A 1ZMEC 2A06D 4IFDK 1VDFA 4OH8B 3H1IE 5KKZB 1IJDB 2IZ0A 4PD4D 1EDJA 1K73Q 1JM0A 5AW2B 1OFCX 1FZCC 2XNDH 5KTBA 5AVSB 1RQVA 3RL0g 1JUNA 3TGUG 3P8CE 2YO2A 1GDTA 1M1JC 1SFCA 5DJTB 3PH0A 1URQA 1BGYJ 3CX5I 3A0HE 1MZ9A 1NTZK 1VQOP 1HGZA 3WU2E 1X9VA 3ZDMA 1Q7YQ 2M5AA 2YKOA 1UIIA 1NH4A 2FFDA 1LTJA 3NFQA 1HTLC 3CL3D 2Q6QA 5GTHH 1K8AQ 2N9YB 2H88C 3TGUD 1KYOE 2WITA 3AECC 1LJ2A 2QSIA 5DJUB 1JNMA 1GMJA 4EYYQ 3T97B 4W80A 3H1HE 1OVRA 2YXRB 3CD6P 1JY3N 1NU1K 4Y28J 4I2LC 1X79B 3KDPB 4U3FE 2WSCH 3FWNA 2FXOA 3EQ2A 1NTMK 2ZT9D 3G3ZA 3RK3D 5K5GB 2Y9YA 1WRGA 3CXHE 1G1IA 1L2PA 4L75A 1RF1B 4GT1A 3SWYA 2FYZA 1S9KD 4K35A 1VQ8P 1Q2NA 3QH9A 1L0ND 3CCLP 2JO1A 3I5CA 2AXTH 2Q9IA 3D6ZA 4I1LA 4RJTA 2YKPA 5AW5B 2A45G 1PPJE 5AVRB 1KB9E 2W90A 2KYVA 2O3JA 2IDBA 3H1ID 1YQ4C 3VOPA 4L74A 1FZAA 2JKVA 2QJYB 2QA4P 1Y47A 4H13D 2QJPB 1H0TB 2M3EA 2P2UA 2OYIA 3B5ND 3CCJP 4RKUJ 4MN4C 3P8CD 1YJNP 1FBMA 2QE7H 1NYHA 3GG2A 1N8RQ 3L71G 1FOSE 3EWKA 3H1HG 1FZBA 2KZIA 3RL0D 1JY2O 1ZRTD 3MGNA 3I56P 1AJYA 3MD0A 2B88A 2QRXA 3LIDA 2PGDA 3V5BA 1T3JA 5BU8B 1FZEA 4U3FG 2JJLA 4HJGH 5TISE 2AXTE 5AVXB 1S1CX 4PV1B 5B66E 3H1KG 3H1LJ 3I55P 2C0WA 3AE9C 3E1IA 1FOSF 1SQXJ 1VQMP 3JSVC 3HD7C 1OVUA 3GF7A 3S1KA 5AVYB 2CPBA 3M9BA 3L71D 1LGHB 3A0BE 2XZRA 2Q7CA 3H1HD 4WY4C 1BCCG 2M0BA 3WMM0 2ZVNB 3B5NA 4H44D 1XTCC 1AFOA 3PRJA 1JTHA 5CCHC 3CMEP 1OMIA 4H13B 2E5TA 2NPSC 5B5EE 4PD4H 1G2CB 4U3FD 1FDOA 1KD1Q 3M9QA 5KAFH 3H6PA 4Y99B 1M56D 5AW1B 3RGUA 3H1KD 1G1JA 1SQBE 2V7QH 1N86A 2OTJP 1N7SD 1PL5A 4QMAA 3CXHD 3RL0B 1LT1A 3BATA 5APVA 1LTAC 5KLVK 1FJKA 4D6TJ 1CI6A 3H1LG 2R32A 4YTPC 1NTKK 2IFMA 4JYBA 2KLUA 1BCCD 1SQXG 1NVOA 4L76A 1J1EB 1OW7A 3L72G 1FU1A 4PJ0E 2QJKC 2HPCA 1PPJD 2UWJE 3H32B 3II6A 1GU5A 4GIFA 1KB9D 3CWBJ 3V2RA 1KORA 2O01N 1P84D 3KPEA 1JOCA 4PD4I 3RK2B 3KZIH 1KV4A 1YQ3C 1E5WA 1SQVJ 2KUBA 3SFDC 3M0DA 2KK7A 1ZR4A 3F89A 2WPSA 3M91A 4KT0J 2Q1KA 2HLOA 1PP9E 2LXCB 1N7SA 2B9BA 1DD3A 2KSJA 3EFGA 1BE3E 3L72D 4JQ0D 1RF0A 1T8ZA 3V2PA 4N6JA 4UB8H 1SQPK 1EZVI 1N7SB 2P1JA 1NO4A 2E76B 3MHVA 4JYCA 3H1JJ 3P32A 1Q86Q 3KQGA 2E75C 2R5DA 4JBZA 2RMZA 1KQLA 2OYHB 1MFZA 2WWWA 2DW3A 1S5LE 2ZVOB 3AEFC 2H8PD 1VQPP 1FZCA 2L91A 2YKQA 2G3AA 1YTZI 2WVRA 1SQVG 2KNCA 2KOGA 1Q82Q 3TGUE 1KZUB 2PFXA 1YJ9P 1M90Q 3AE3C 2P58A 3Q1MA 3RBXA 3V6IA 2IBZI 2KNCB 1M1JA 4NPDA 3Q3DA 2K3RA 1DD4A 2RN0A 4WB4A 1FE6A 1BSHA 1QL1A 2ITAA 1VQNP 1N7LA 1M1JB 1SQBD 3B4SA 3RK3E 1SQQE 1BDCA 4N78E 2H43A 1NAFA 3P7KA 3H1JG 3H25A 4C7NA 3SWKA 4ASVA 3GLMA 1R8EA 1S9KE 4KHXA 2FXMA 3WUTA 2BASA 1VF5C 3VTPC 1FJPA 3FXDA 3A0HH 1L0LG 2KIKA 2SPZA 5CMZA 4HYTB 1RE4C 2FYUJ 3WU2H 2B87A 3CCVP 1OZHA 2ZXXA 2W6JH 1KILC 4AQRD 4H0LC 1YITP 3L70G 1CW5A 2WT7A 1KYOH 2B87B 2XNXA 1GL2B 1W2EA 3HTKA 5AW3B 1GW4A 3BCCJ 2WT7B 1PP9D 2O01H 1JY3O 3M0AA 2ZYDA 3L4FA 1L0NK 4M3LA 1BE3D 2BEZF 3L73J 2E74B 1L4AC 1L0LD 1LTBC 3L75J 1EDLA 1ZRTE 1MFTA 2Q3IA 2LR2A 4C46A 2LXBA 3IR9A 1VQ7P 2J59M 2JEEA 3G9RA 1N2DC 1YTZT 3CXHH 3HUSC 3L70D 1FDIA 1SLQA 3HD7D 1BSNA 3M06A 2FYNC 3GHGC 2Z5IA 1SFCB 1SQQG 2E5YA 1NTZJ 1URQB 1KYOI 3AE5C 4C7RA 2KP8A 3KHUA 4ZNCA 4WY4D 2AEJA 3O6QA 1HWTC 1MKMA 3GF3A 2M5AB 5CCHD 3L71E 2NPSD 2RKLA 2FFDB 1EC5A 1LTJB 1QL2A 3BCCG 1KB9H 2WSEH 4K3AA 3AEDC 1A02J 3V2QA 1JMBA 3TF5A 3GMAA 1FS0E 1T3UA 5C39A 1OVVA 3B8EB 5KLIC 3N7NA 4DOJA 2D2CC 2P7JA 2IYPA 4HH2A 2M8RA 2OARA 1NU1J 1IC2A 3SFEC 1QVGO 1SQQD 3CXHI 3H1KE 3OA7A 4N78D 1BGYG 1NTMJ 1USDA 3Q5SA 3AEBC 2HYNA 3HD7A 5E79E 3V4WA 4HB1A 5APSA 1S5LX 3IN6A 1NTZG 3ABVC 1OIPA 2AEMA 4WY4A 1BCCE 1OXZA 2HODA 1PFIA 3HD7B 3A3YB 3Q5PA 5TISH 1KB9I 5CCHA 5B66H 2NPSA 3IAOA 4WY4B 2O01J 5AW8B 1JY2P 1QX8A 2HODB 2BCCJ 5AVUB 2Z5HA 1KN7A 1P84E 5TJHA 5AVVB 1OWAA 1BGYD 4YPCA 3A0BH 1D7MA 3AE2C 2L5GB 1YYCA 3L74J 3HRNA 4KJMA 3H1LE 2J58A 2ZFCA 1SQXE 1QEXA 5B5EH 3L72E 2ZT9B 2OYIB 3RK3B 1W5CE 2E75D 2J5UA 1N73C 1M57D 1K05A 2FBWC 2C9NY 2B89A 4GODA 4IFFA 4XFJA 2KB7P 1IFPA 4OVNF 3JCUE 1H88A 3CCEP 1YJWP 2W6AA 3Q2YA 5GTIE 2WSCJ 3CX5D 1FZFA 4PJ0H 1RF1C 1JCDA 3L74G 3E7KA 1HJ0A 2GA1A 5CBNA 3VMXA 1EXIA 4WBAA 2XU6A 1M7LA 5AW9B 4YXWH 2Z4EA 5APQA 4ZKUA 1HH0A 3NMDA 3B5NB 1CZQA 2IFNA 1JTHB 3L35A 4TLFA 3C1LA 3D71A 2KI7B 1KMIZ 5CCGC 1EDIA 1IO4A 1VF5D 1ZOYC 1OW8A 3CLQA 1SQVE 1S3JA 5KAIE 5AVWB 2QJPC 3FGAD 3C8VA 1JY2N 2XDJA 3D70A 3TNUA 2QEXP 2PP6A 5KLVJ 2C0XA 1IFDA 3CCMP 2V4HA 1IFNA 2IYOA 1KILD 1NTKJ 2IX7C 4GOEA 3VMYA 4H0LD 1CI6B 1FDMA 3OJAB 3WUUA 2O1JA 1U7MA 1S5LH 2OTLP 1AVYA 4IFMA 1SQBK 1GD2E 1OX3A 2HPCB 3H1JE 2E43A 4EDFA 2BEQD 1SS1A 4H44B 1J1DC 1L4AD 3H1LD 1EDKA 1PGOA 2NZ2A 1AVOA 1SQXD 1Y8AA 4BXLA 1KQSO 1L0LE 3TYYA 4D6TG 1RE4A 1HJBA 2ZYGA 3G71P 5APWA 1K9MQ 4JF7A 5KLVG 4OGQC 2RH0A 3AE7C 1SQPJ 1KILA 1YIJP 3OW2O 1RY3A 5EFWB 3L70E 1YI2P 4B86A 3U59A 1H89A 1IK7A 2G8YA 4Y99C 1LWUC 1NHLA 3CWBG 2K9JA 2NRGA 1BDDA 4ASWA 1HGVA 1DEEG 1LTSC 4UB6H 1M1KQ 5AVTB 4I7ZC 1NKNA 1JO5A 4GDOA 4WWIA 2V7QJ 1FZCB 1JCCA 1VPCA 2K9JB 1H8AA 1L4AA 1L0LK 2IPPA 4D6TD 3BRTB 2D2CD 3KXDA 1J1EC 3VMZA 2I8DA 2H89C 3HE5A 1SVFA 1PGPA 1X8YA 3HUSA 5KJ7C 2GUVA 3GHGA 4IL6X 3CWBD 5AW6B 3RK2C 3TK1A 2QG4A 1SQPG 3MUDA 2IBZE 3HUSB 1ZN5A 2VRSA 1GW3A 3M9HA 4EOTA 1SQVD 3ITKA 1HBWA 2FYNB 3GHGB 1MV8A 3CCRP 4DZOA 3MIWA 2Y0CA 2A06G 2QM7A 3IFMA 3EFFK 2CK3H 2A45H 4HKZH 1HVVA 4C7NB 3AEEC 3BCCE 4Z1MH 2KS1A 3TGUJ 1R5LA 1JY3P 4UB6E 1NKZB 4W7YA 2XKMA 3P8MC 1RE3C 4A7PA 2WZ7A 3L73E 4AYCA 2KS1B 2ZJSE 1E79H 2E76C 2WPRA 1CSBA 3Q5RA 3FXEA 5APXA 1SQQK 1GTWA 1T6AA 1BGYE 1LTTC 3H1JD 4O9BA 2WQYC 3U1CA 2D2CB 1KTMA 3V2NA 2OYHC 1EZVG 2Y0EA 2K1AA 2PRRA 1NTZE 2P10A 4DCKA 3OAKA 2WPQA 3HTKB 1X22A 1NWQA 1ZP0C 2N1TC 1S4XA 1UIXA 2I1JA 2A45I 1S2EA 2K9YA 1KFMA 1L0NJ 5CHXA 3N4XA 2FY8A 2Y0DA 1T2KC 2YIUC 2JP3A 1DEBA 3R4YA 2FYUG 1RH5B 5E79H 3QWOC 3AE6C 4YXDC 2Q5UA 1WT6A 5M1BA 3MUDC 2GM4A 3GW6A 1EZVD 1NU1E 4LC1A 3H1IJ 2IBZG 5APTA 2R5BA 5BU5A 5H2FE 5APUA 3MTUE 1NTME 3CX5E 1PGJA 1RHZB 2R3SA 1A02F 2IZ1A 1LP1A 4R4MA 1AQTA 2JWAA 3T97A 3O6QB 1P84H 2HG5D 1DH3A 1ZXGA 1LT9C 1DIPA 1N73A 3W67A 1GU4A 1AQ5A 3VP9A 1LP1B 3L73G 5CCGD 1SP4A 3L75G 2FYUD 1IK9A 1L0NG 3USSA 4EI2A 1NAYA 1N73B 3RBZA 2BCCE 3CCQP 2IBZD 2PAJA 5KKZC 2Q3EA 1GL2C 1U57A 1AA0A 2YMYA 4RO0A 3AE8C 1RF1A 3L74E 1U7JA 3H1IG 3BCCD 4TT3H 3PTZA 1ZW0A 4IL6H 1X0TA 2FKWB 3L71J 1KILE 3CC4P 2E74C 1KQGB 3H1HJ 3B71A 3L73D 4L73A 3HE4A 1P84I 4PV1D 5CJ4A 3L75D 3AE1C 3JCUH 3W68A 5BVZA 1Q81Q 3VYIA 5AW0B 1VQ6P 5GTIH 5GTHE 3TSIA 2XV5A 4U3FJ 2MKVA 4ZKPA 3HE4B 2LKMA 2NPSB 1FC2C 5CCGA 1YBKA 1SFCC 3IF4A 3H1KJ 1NU1G 2O1KA 1DX7A 4LLHA 1URQC 1H0TA 2POHA 3MP7B 1AV1A 1NTZD 2KLVA 3CI9A 1NTMG 3AE4C 2KXPB 1VQ4P 3KYQA 4OGQD 1QVFO 4JPZB 2FFDC 1LTJC 1K04A 1BCCJ 1R5SA 1EXJA 3F5HA 4BRYA 4OWFA 4IL6E 1KFNA 1LTIC 3SWFA 5KAIH 2WSEJ 3R2PA 1IFJA 2QJKB 1WMKA 3V4QA 5L8RJ 1HUCA 3JC22 4BRYB 1NU1D 2BCCG 1NJIQ 2YNYA 3BVHA 4R4LA 1IZNB 1NTMD 3FWLA 2OGUA 1LTGC 3L36A 1SQXK 1YHQP 3CC2P 1Q90D 1PIXA 1XTGB 2FXPA 1J1DB 1NGMB 4D6TE 5KJ7D 1M8OB 1VQ9P 2AEFA 2JR8A 2HFED 3L72J 5KLVE 1KYOD 3RK2D 3G6EP 1NTKE 2WTYA 3CPWO 1G2CA 2W6BA 1FAVA 4XA4A 2M3BA 5CBOA 1LWUA 4OGQB 3BRVB 3A7OA 1USEA 2QIWA 3PLNA 3CWBE 3G4SP 2BCCD 4I6MC 1Y9BA 3U1AA 1ZR2A 3VN0A 2WSFH 4AUWA 1PPJG 2QJYC 2E75B 1JB0J 2P67A 1LWUB 3VMAA 3PHLA 1VQKP 3L74D 4WVZA 4RESB 4LGDE 1S72P 2H7HA 1OW6A 2ZXEB 2E76D 3VP8A 4EIJA 3TDKA 1Z56A 3FX0A 2I1KA 2ZT9C 2OYIC 4I7ZB 3RK3C 3TNUB 2JDIH 3L37A 2W83C 3K5BA 5AVQB 3H32A 5KJ7A 2C9LY 3WUVA 2W8ZA 1JMMA 4W7ZA 1SQPE 4PV1C 2YXQB 1SQBJ 1SQVK 2K88A 2N1TD 5AVZB 3S4RA
chains in the Genus database with same CATH topology
4IL6E 3KZIE 5GTHE 3A0HE 5GTIE 5H2FE 4UB6E 5TISE 2AXTE 5B5EE 5E79E 3WU2E 4PJ0E 5B66E 5KAIE 3A0BE 5KAFE 4UB8E 1W5CE 1S5LE 3JCUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IL6 E;  3KZI E;  5GTH E;  3A0H E;  5GTI E;  5H2F E;  4UB6 E;  5TIS E;  2AXT E;  5B5E E;  5E79 E;  3WU2 E;  4PJ0 E;  5B66 E;  5KAI E;  3A0B E;  5KAF E;  4UB8 E;  1W5C E;  1S5L E;  3JCU E; 
#chains in the Genus database with same CATH topology
 3C9I A;  1VQL P;  3NTN A;  2HR3 A;  2A06 E;  1PGQ A;  3CCU P;  1PZQ A;  2KZJ A;  2Y9Z A;  2N9B A;  1VL2 A;  2CPS A;  4N3Y B;  1VQ5 P;  4PD4 E;  1T2K D;  3LW5 H;  2AXC A;  3BAS A;  5KAF E;  4DJG A;  1RE3 A;  4GOF A;  3CMA P;  1GK4 A;  1VF5 B;  1KQF B;  2R44 A;  1FZG A;  1IFI A;  1NTK G;  4H13 C;  3E1R A;  4DT0 A;  1W2B O;  3B5N C;  3AEA C;  1QGK B;  1ZV8 A;  1PV3 A;  1RQU A;  2OYH A;  2ZYA A;  1KIL B;  1HF9 A;  1QLE D;  5CJ0 A;  1EZV E;  4H0L B;  2KSE A;  2QM8 A;  4BWN A;  3RL0 C;  2ZAE B;  3PP5 A;  1J2J B;  3CC7 P;  1SQB G;  4NPF X;  1IFM A;  2WPV B;  4CPG A;  3D6Y A;  1PP9 J;  2N1T A;  4XE5 B;  3LIE A;  2OQQ A;  2WSF J;  1BE3 J;  3MZW B;  5KLV D;  3AEG C;  3NXS A;  3KZI E;  1L0L J;  3S9O A;  1JEK A;  4NPE A;  1NTK D;  2N1T B;  1L4A B;  2K37 A;  1NOH A;  2W27 A;  1GL2 D;  2FYU E;  1EQ7 A;  1KC8 Q;  4IOI H;  2YO3 A;  3L70 J;  1GZL A;  3HE5 B;  2YIU B;  2OYO A;  3UIA A;  3SSU A;  4H44 C;  5APY A;  4UB8 E;  2E74 D;  2YMK A;  1MUU A;  5AW7 B;  2JWD A;  3M0D C;  4GKG A;  2QVA A;  3O8Z A;  3A5T A;  4U7J A;  1LT9 A;  5AW4 B;  4ZMD A;  2WMM A;  3A2A A;  1GK6 A;  2GUS A;  1PP9 G;  1N7S C;  3L75 E;  2FYU K;  1TU3 F;  1SFC D;  2OTK E;  1ZLL A;  1L0N E;  1BE3 G;  3CCS P;  1URQ D;  3PJS K;  1LT9 B;  2MJZ A;  3LW5 J;  1RF0 C;  5H2F H;  2R3C A;  2WSS H;  1LNQ A;  1SQP D;  5KLI B;  3CX5 H;  1GL2 A;  1SQQ J;  2E42 A;  1ZME C;  2A06 D;  4IFD K;  1VDF A;  4OH8 B;  3H1I E;  5KKZ B;  1IJD B;  2IZ0 A;  4PD4 D;  1EDJ A;  1K73 Q;  1JM0 A;  5AW2 B;  1OFC X;  1FZC C;  2XND H;  5KTB A;  5AVS B;  1RQV A;  3RL0 g;  1JUN A;  3TGU G;  3P8C E;  2YO2 A;  1GDT A;  1M1J C;  1SFC A;  5DJT B;  3PH0 A;  1URQ A;  1BGY J;  3CX5 I;  3A0H E;  1MZ9 A;  1NTZ K;  1VQO P;  1HGZ A;  3WU2 E;  1X9V A;  3ZDM A;  1Q7Y Q;  2M5A A;  2YKO A;  1UII A;  1NH4 A;  2FFD A;  1LTJ A;  3NFQ A;  1HTL C;  3CL3 D;  2Q6Q A;  5GTH H;  1K8A Q;  2N9Y B;  2H88 C;  3TGU D;  1KYO E;  2WIT A;  3AEC C;  1LJ2 A;  2QSI A;  5DJU B;  1JNM A;  1GMJ A;  4EYY Q;  3T97 B;  4W80 A;  3H1H E;  1OVR A;  2YXR B;  3CD6 P;  1JY3 N;  1NU1 K;  4Y28 J;  4I2L C;  1X79 B;  3KDP B;  4U3F E;  2WSC H;  3FWN A;  2FXO A;  3EQ2 A;  1NTM K;  2ZT9 D;  3G3Z A;  3RK3 D;  5K5G B;  2Y9Y A;  1WRG A;  3CXH E;  1G1I A;  1L2P A;  4L75 A;  1RF1 B;  4GT1 A;  3SWY A;  2FYZ A;  1S9K D;  4K35 A;  1VQ8 P;  1Q2N A;  3QH9 A;  1L0N D;  3CCL P;  2JO1 A;  3I5C A;  2AXT H;  2Q9I A;  3D6Z A;  4I1L A;  4RJT A;  2YKP A;  5AW5 B;  2A45 G;  1PPJ E;  5AVR B;  1KB9 E;  2W90 A;  2KYV A;  2O3J A;  2IDB A;  3H1I D;  1YQ4 C;  3VOP A;  4L74 A;  1FZA A;  2JKV A;  2QJY B;  2QA4 P;  1Y47 A;  4H13 D;  2QJP B;  1H0T B;  2M3E A;  2P2U A;  2OYI A;  3B5N D;  3CCJ P;  4RKU J;  4MN4 C;  3P8C D;  1YJN P;  1FBM A;  2QE7 H;  1NYH A;  3GG2 A;  1N8R Q;  3L71 G;  1FOS E;  3EWK A;  3H1H G;  1FZB A;  2KZI A;  3RL0 D;  1JY2 O;  1ZRT D;  3MGN A;  3I56 P;  1AJY A;  3MD0 A;  2B88 A;  2QRX A;  3LID A;  2PGD A;  3V5B A;  1T3J A;  5BU8 B;  1FZE A;  4U3F G;  2JJL A;  4HJG H;  5TIS E;  2AXT E;  5AVX B;  1S1C X;  4PV1 B;  5B66 E;  3H1K G;  3H1L J;  3I55 P;  2C0W A;  3AE9 C;  3E1I A;  1FOS F;  1SQX J;  1VQM P;  3JSV C;  3HD7 C;  1OVU A;  3GF7 A;  3S1K A;  5AVY B;  2CPB A;  3M9B A;  3L71 D;  1LGH B;  3A0B E;  2XZR A;  2Q7C A;  3H1H D;  4WY4 C;  1BCC G;  2M0B A;  3WMM 0;  2ZVN B;  3B5N A;  4H44 D;  1XTC C;  1AFO A;  3PRJ A;  1JTH A;  5CCH C;  3CME P;  1OMI A;  4H13 B;  2E5T A;  2NPS C;  5B5E E;  4PD4 H;  1G2C B;  4U3F D;  1FDO A;  1KD1 Q;  3M9Q A;  5KAF H;  3H6P A;  4Y99 B;  1M56 D;  5AW1 B;  3RGU A;  3H1K D;  1G1J A;  1SQB E;  2V7Q H;  1N86 A;  2OTJ P;  1N7S D;  1PL5 A;  4QMA A;  3CXH D;  3RL0 B;  1LT1 A;  3BAT A;  5APV A;  1LTA C;  5KLV K;  1FJK A;  4D6T J;  1CI6 A;  3H1L G;  2R32 A;  4YTP C;  1NTK K;  2IFM A;  4JYB A;  2KLU A;  1BCC D;  1SQX G;  1NVO A;  4L76 A;  1J1E B;  1OW7 A;  3L72 G;  1FU1 A;  4PJ0 E;  2QJK C;  2HPC A;  1PPJ D;  2UWJ E;  3H32 B;  3II6 A;  1GU5 A;  4GIF A;  1KB9 D;  3CWB J;  3V2R A;  1KOR A;  2O01 N;  1P84 D;  3KPE A;  1JOC A;  4PD4 I;  3RK2 B;  3KZI H;  1KV4 A;  1YQ3 C;  1E5W A;  1SQV J;  2KUB A;  3SFD C;  3M0D A;  2KK7 A;  1ZR4 A;  3F89 A;  2WPS A;  3M91 A;  4KT0 J;  2Q1K A;  2HLO A;  1PP9 E;  2LXC B;  1N7S A;  2B9B A;  1DD3 A;  2KSJ A;  3EFG A;  1BE3 E;  3L72 D;  4JQ0 D;  1RF0 A;  1T8Z A;  3V2P A;  4N6J A;  4UB8 H;  1SQP K;  1EZV I;  1N7S B;  2P1J A;  1NO4 A;  2E76 B;  3MHV A;  4JYC A;  3H1J J;  3P32 A;  1Q86 Q;  3KQG A;  2E75 C;  2R5D A;  4JBZ A;  2RMZ A;  1KQL A;  2OYH B;  1MFZ A;  2WWW A;  2DW3 A;  1S5L E;  2ZVO B;  3AEF C;  2H8P D;  1VQP P;  1FZC A;  2L91 A;  2YKQ A;  2G3A A;  1YTZ I;  2WVR A;  1SQV G;  2KNC A;  2KOG A;  1Q82 Q;  3TGU E;  1KZU B;  2PFX A;  1YJ9 P;  1M90 Q;  3AE3 C;  2P58 A;  3Q1M A;  3RBX A;  3V6I A;  2IBZ I;  2KNC B;  1M1J A;  4NPD A;  3Q3D A;  2K3R A;  1DD4 A;  2RN0 A;  4WB4 A;  1FE6 A;  1BSH A;  1QL1 A;  2ITA A;  1VQN P;  1N7L A;  1M1J B;  1SQB D;  3B4S A;  3RK3 E;  1SQQ E;  1BDC A;  4N78 E;  2H43 A;  1NAF A;  3P7K A;  3H1J G;  3H25 A;  4C7N A;  3SWK A;  4ASV A;  3GLM A;  1R8E A;  1S9K E;  4KHX A;  2FXM A;  3WUT A;  2BAS A;  1VF5 C;  3VTP C;  1FJP A;  3FXD A;  3A0H H;  1L0L G;  2KIK A;  2SPZ A;  5CMZ A;  4HYT B;  1RE4 C;  2FYU J;  3WU2 H;  2B87 A;  3CCV P;  1OZH A;  2ZXX A;  2W6J H;  1KIL C;  4AQR D;  4H0L C;  1YIT P;  3L70 G;  1CW5 A;  2WT7 A;  1KYO H;  2B87 B;  2XNX A;  1GL2 B;  1W2E A;  3HTK A;  5AW3 B;  1GW4 A;  3BCC J;  2WT7 B;  1PP9 D;  2O01 H;  1JY3 O;  3M0A A;  2ZYD A;  3L4F A;  1L0N K;  4M3L A;  1BE3 D;  2BEZ F;  3L73 J;  2E74 B;  1L4A C;  1L0L D;  1LTB C;  3L75 J;  1EDL A;  1ZRT E;  1MFT A;  2Q3I A;  2LR2 A;  4C46 A;  2LXB A;  3IR9 A;  1VQ7 P;  2J59 M;  2JEE A;  3G9R A;  1N2D C;  1YTZ T;  3CXH H;  3HUS C;  3L70 D;  1FDI A;  1SLQ A;  3HD7 D;  1BSN A;  3M06 A;  2FYN C;  3GHG C;  2Z5I A;  1SFC B;  1SQQ G;  2E5Y A;  1NTZ J;  1URQ B;  1KYO I;  3AE5 C;  4C7R A;  2KP8 A;  3KHU A;  4ZNC A;  4WY4 D;  2AEJ A;  3O6Q A;  1HWT C;  1MKM A;  3GF3 A;  2M5A B;  5CCH D;  3L71 E;  2NPS D;  2RKL A;  2FFD B;  1EC5 A;  1LTJ B;  1QL2 A;  3BCC G;  1KB9 H;  2WSE H;  4K3A A;  3AED C;  1A02 J;  3V2Q A;  1JMB A;  3TF5 A;  3GMA A;  1FS0 E;  1T3U A;  5C39 A;  1OVV A;  3B8E B;  5KLI C;  3N7N A;  4DOJ A;  2D2C C;  2P7J A;  2IYP A;  4HH2 A;  2M8R A;  2OAR A;  1NU1 J;  1IC2 A;  3SFE C;  1QVG O;  1SQQ D;  3CXH I;  3H1K E;  3OA7 A;  4N78 D;  1BGY G;  1NTM J;  1USD A;  3Q5S A;  3AEB C;  2HYN A;  3HD7 A;  5E79 E;  3V4W A;  4HB1 A;  5APS A;  1S5L X;  3IN6 A;  1NTZ G;  3ABV C;  1OIP A;  2AEM A;  4WY4 A;  1BCC E;  1OXZ A;  2HOD A;  1PFI A;  3HD7 B;  3A3Y B;  3Q5P A;  5TIS H;  1KB9 I;  5CCH A;  5B66 H;  2NPS A;  3IAO A;  4WY4 B;  2O01 J;  5AW8 B;  1JY2 P;  1QX8 A;  2HOD B;  2BCC J;  5AVU B;  2Z5H A;  1KN7 A;  1P84 E;  5TJH A;  5AVV B;  1OWA A;  1BGY D;  4YPC A;  3A0B H;  1D7M A;  3AE2 C;  2L5G B;  1YYC A;  3L74 J;  3HRN A;  4KJM A;  3H1L E;  2J58 A;  2ZFC A;  1SQX E;  1QEX A;  5B5E H;  3L72 E;  2ZT9 B;  2OYI B;  3RK3 B;  1W5C E;  2E75 D;  2J5U A;  1N73 C;  1M57 D;  1K05 A;  2FBW C;  2C9N Y;  2B89 A;  4GOD A;  4IFF A;  4XFJ A;  2KB7 P;  1IFP A;  4OVN F;  3JCU E;  1H88 A;  3CCE P;  1YJW P;  2W6A A;  3Q2Y A;  5GTI E;  2WSC J;  3CX5 D;  1FZF A;  4PJ0 H;  1RF1 C;  1JCD A;  3L74 G;  3E7K A;  1HJ0 A;  2GA1 A;  5CBN A;  3VMX A;  1EXI A;  4WBA A;  2XU6 A;  1M7L A;  5AW9 B;  4YXW H;  2Z4E A;  5APQ A;  4ZKU A;  1HH0 A;  3NMD A;  3B5N B;  1CZQ A;  2IFN A;  1JTH B;  3L35 A;  4TLF A;  3C1L A;  3D71 A;  2KI7 B;  1KMI Z;  5CCG C;  1EDI A;  1IO4 A;  1VF5 D;  1ZOY C;  1OW8 A;  3CLQ A;  1SQV E;  1S3J A;  5KAI E;  5AVW B;  2QJP C;  3FGA D;  3C8V A;  1JY2 N;  2XDJ A;  3D70 A;  3TNU A;  2QEX P;  2PP6 A;  5KLV J;  2C0X A;  1IFD A;  3CCM P;  2V4H A;  1IFN A;  2IYO A;  1KIL D;  1NTK J;  2IX7 C;  4GOE A;  3VMY A;  4H0L D;  1CI6 B;  1FDM A;  3OJA B;  3WUU A;  2O1J A;  1U7M A;  1S5L H;  2OTL P;  1AVY A;  4IFM A;  1SQB K;  1GD2 E;  1OX3 A;  2HPC B;  3H1J E;  2E43 A;  4EDF A;  2BEQ D;  1SS1 A;  4H44 B;  1J1D C;  1L4A D;  3H1L D;  1EDK A;  1PGO A;  2NZ2 A;  1AVO A;  1SQX D;  1Y8A A;  4BXL A;  1KQS O;  1L0L E;  3TYY A;  4D6T G;  1RE4 A;  1HJB A;  2ZYG A;  3G71 P;  5APW A;  1K9M Q;  4JF7 A;  5KLV G;  4OGQ C;  2RH0 A;  3AE7 C;  1SQP J;  1KIL A;  1YIJ P;  3OW2 O;  1RY3 A;  5EFW B;  3L70 E;  1YI2 P;  4B86 A;  3U59 A;  1H89 A;  1IK7 A;  2G8Y A;  4Y99 C;  1LWU C;  1NHL A;  3CWB G;  2K9J A;  2NRG A;  1BDD A;  4ASW A;  1HGV A;  1DEE G;  1LTS C;  4UB6 H;  1M1K Q;  5AVT B;  4I7Z C;  1NKN A;  1JO5 A;  4GDO A;  4WWI A;  2V7Q J;  1FZC B;  1JCC A;  1VPC A;  2K9J B;  1H8A A;  1L4A A;  1L0L K;  2IPP A;  4D6T D;  3BRT B;  2D2C D;  3KXD A;  1J1E C;  3VMZ A;  2I8D A;  2H89 C;  3HE5 A;  1SVF A;  1PGP A;  1X8Y A;  3HUS A;  5KJ7 C;  2GUV A;  3GHG A;  4IL6 X;  3CWB D;  5AW6 B;  3RK2 C;  3TK1 A;  2QG4 A;  1SQP G;  3MUD A;  2IBZ E;  3HUS B;  1ZN5 A;  2VRS A;  1GW3 A;  3M9H A;  4EOT A;  1SQV D;  3ITK A;  1HBW A;  2FYN B;  3GHG B;  1MV8 A;  3CCR P;  4DZO A;  3MIW A;  2Y0C A;  2A06 G;  2QM7 A;  3IFM A;  3EFF K;  2CK3 H;  2A45 H;  4HKZ H;  1HVV A;  4C7N B;  3AEE C;  3BCC E;  4Z1M H;  2KS1 A;  3TGU J;  1R5L A;  1JY3 P;  4UB6 E;  1NKZ B;  4W7Y A;  2XKM A;  3P8M C;  1RE3 C;  4A7P A;  2WZ7 A;  3L73 E;  4AYC A;  2KS1 B;  2ZJS E;  1E79 H;  2E76 C;  2WPR A;  1CSB A;  3Q5R A;  3FXE A;  5APX A;  1SQQ K;  1GTW A;  1T6A A;  1BGY E;  1LTT C;  3H1J D;  4O9B A;  2WQY C;  3U1C A;  2D2C B;  1KTM A;  3V2N A;  2OYH C;  1EZV G;  2Y0E A;  2K1A A;  2PRR A;  1NTZ E;  2P10 A;  4DCK A;  3OAK A;  2WPQ A;  3HTK B;  1X22 A;  1NWQ A;  1ZP0 C;  2N1T C;  1S4X A;  1UIX A;  2I1J A;  2A45 I;  1S2E A;  2K9Y A;  1KFM A;  1L0N J;  5CHX A;  3N4X A;  2FY8 A;  2Y0D A;  1T2K C;  2YIU C;  2JP3 A;  1DEB A;  3R4Y A;  2FYU G;  1RH5 B;  5E79 H;  3QWO C;  3AE6 C;  4YXD C;  2Q5U A;  1WT6 A;  5M1B A;  3MUD C;  2GM4 A;  3GW6 A;  1EZV D;  1NU1 E;  4LC1 A;  3H1I J;  2IBZ G;  5APT A;  2R5B A;  5BU5 A;  5H2F E;  5APU A;  3MTU E;  1NTM E;  3CX5 E;  1PGJ A;  1RHZ B;  2R3S A;  1A02 F;  2IZ1 A;  1LP1 A;  4R4M A;  1AQT A;  2JWA A;  3T97 A;  3O6Q B;  1P84 H;  2HG5 D;  1DH3 A;  1ZXG A;  1LT9 C;  1DIP A;  1N73 A;  3W67 A;  1GU4 A;  1AQ5 A;  3VP9 A;  1LP1 B;  3L73 G;  5CCG D;  1SP4 A;  3L75 G;  2FYU D;  1IK9 A;  1L0N G;  3USS A;  4EI2 A;  1NAY A;  1N73 B;  3RBZ A;  2BCC E;  3CCQ P;  2IBZ D;  2PAJ A;  5KKZ C;  2Q3E A;  1GL2 C;  1U57 A;  1AA0 A;  2YMY A;  4RO0 A;  3AE8 C;  1RF1 A;  3L74 E;  1U7J A;  3H1I G;  3BCC D;  4TT3 H;  3PTZ A;  1ZW0 A;  4IL6 H;  1X0T A;  2FKW B;  3L71 J;  1KIL E;  3CC4 P;  2E74 C;  1KQG B;  3H1H J;  3B71 A;  3L73 D;  4L73 A;  3HE4 A;  1P84 I;  4PV1 D;  5CJ4 A;  3L75 D;  3AE1 C;  3JCU H;  3W68 A;  5BVZ A;  1Q81 Q;  3VYI A;  5AW0 B;  1VQ6 P;  5GTI H;  5GTH E;  3TSI A;  2XV5 A;  4U3F J;  2MKV A;  4ZKP A;  3HE4 B;  2LKM A;  2NPS B;  1FC2 C;  5CCG A;  1YBK A;  1SFC C;  3IF4 A;  3H1K J;  1NU1 G;  2O1K A;  1DX7 A;  4LLH A;  1URQ C;  1H0T A;  2POH A;  3MP7 B;  1AV1 A;  1NTZ D;  2KLV A;  3CI9 A;  1NTM G;  3AE4 C;  2KXP B;  1VQ4 P;  3KYQ A;  4OGQ D;  1QVF O;  4JPZ B;  2FFD C;  1LTJ C;  1K04 A;  1BCC J;  1R5S A;  1EXJ A;  3F5H A;  4BRY A;  4OWF A;  4IL6 E;  1KFN A;  1LTI C;  3SWF A;  5KAI H;  2WSE J;  3R2P A;  1IFJ A;  2QJK B;  1WMK A;  3V4Q A;  5L8R J;  1HUC A;  3JC2 2;  4BRY B;  1NU1 D;  2BCC G;  1NJI Q;  2YNY A;  3BVH A;  4R4L A;  1IZN B;  1NTM D;  3FWL A;  2OGU A;  1LTG C;  3L36 A;  1SQX K;  1YHQ P;  3CC2 P;  1Q90 D;  1PIX A;  1XTG B;  2FXP A;  1J1D B;  1NGM B;  4D6T E;  5KJ7 D;  1M8O B;  1VQ9 P;  2AEF A;  2JR8 A;  2HFE D;  3L72 J;  5KLV E;  1KYO D;  3RK2 D;  3G6E P;  1NTK E;  2WTY A;  3CPW O;  1G2C A;  2W6B A;  1FAV A;  4XA4 A;  2M3B A;  5CBO A;  1LWU A;  4OGQ B;  3BRV B;  3A7O A;  1USE A;  2QIW A;  3PLN A;  3CWB E;  3G4S P;  2BCC D;  4I6M C;  1Y9B A;  3U1A A;  1ZR2 A;  3VN0 A;  2WSF H;  4AUW A;  1PPJ G;  2QJY C;  2E75 B;  1JB0 J;  2P67 A;  1LWU B;  3VMA A;  3PHL A;  1VQK P;  3L74 D;  4WVZ A;  4RES B;  4LGD E;  1S72 P;  2H7H A;  1OW6 A;  2ZXE B;  2E76 D;  3VP8 A;  4EIJ A;  3TDK A;  1Z56 A;  3FX0 A;  2I1K A;  2ZT9 C;  2OYI C;  4I7Z B;  3RK3 C;  3TNU B;  2JDI H;  3L37 A;  2W83 C;  3K5B A;  5AVQ B;  3H32 A;  5KJ7 A;  2C9L Y;  3WUV A;  2W8Z A;  1JMM A;  4W7Z A;  1SQP E;  4PV1 C;  2YXQ B;  1SQB J;  1SQV K;  2K88 A;  2N1T D;  5AVZ B;  3S4R A; 
#chains in the Genus database with same CATH homology
 4IL6 E;  3KZI E;  5GTH E;  3A0H E;  5GTI E;  5H2F E;  4UB6 E;  5TIS E;  2AXT E;  5B5E E;  5E79 E;  3WU2 E;  4PJ0 E;  5B66 E;  5KAI E;  3A0B E;  5KAF E;  4UB8 E;  1W5C E;  1S5L E;  3JCU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...