5H2FE

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5h2fE00
5E79E 3WU2E 3A0BE 5B5EE 5H2FE 3KZIE 5GTHE 4UB8E 1W5CE 5KAIE 5KAFE 2AXTE 5TISE 5GTIE 4UB6E 3JCUE 1S5LE 3A0HE 4PJ0E 5B66E 4IL6E
chains in the Genus database with same CATH superfamily
4Y28J 2B87B 2QEXP 1L0LJ 2R44A 2JDIH 2H89C 3CX5I 3RK2B 4KHXA 3B4SA 5E79E 4W7YA 1L0LD 3BCCE 1KB9D 3KQGA 3B8EB 4EIJA 2K37A 3IF4A 2JKVA 3CI9A 2Y9ZA 1L4AA 2FFDA 3RL0D 1RF1B 2M5AA 3II6A 3RK3B 1URQD 1KQFB 2HFED 1GZLA 3WU2E 3Q5PA 2OYIA 5K5GB 2V4HA 1ZLLA 1SQVK 5TJHA 3MUDA 3BCCJ 4YTPC 1G1IA 4Z1MH 4L76A 5TISH 1Q81Q 3NXSA 2B89A 3BCCD 5EFWB 2OYHC 1R5SA 1Y47A 2KNCA 5GTHH 2ZXXA 2P1JA 1DH3A 1JCDA 3V2NA 2YO3A 2L91A 3G3ZA 1J2JB 1NTMD 3FGAD 1S5LE 1Y8AA 1Z56A 3TF5A 3VMZA 1LTJC 1RQUA 1VPCA 3H32A 2KIKA 2G8YA 4ZKUA 1D7MA 1DEBA 1LP1A 2QJKB 4JYBA 1P84I 1AQTA 1BDDA 3F89A 1FZBA 1BGYE 4RESB 1DD3A 1MZ9A 1JM0A 2BCCJ 3B5NC 3V2RA 1NWQA 5AVSB 1GDTA 2IYPA 4PD4I 5AW3B 1NTZG 3E7KA 1PPJG 3W67A 1FZCA 2OARA 1HUCA 1NU1E 3U1AA 3GW6A 3R2PA 3KZIE 1LNQA 1ZRTE 5H2FH 3P7KA 1BGYJ 1HVVA 1FDOA 1IC2A 2IBZE 2IFMA 4K35A 2XKMA 2PP6A 1N73C 2E74D 3CMEP 1BGYD 2WPVB 1LJ2A 1QVFO 3L72G 3O6QB 4OVNF 1NGMB 3F5HA 3RBZA 1GL2D 5KJ7A 1AV1A 1RHZB 5CBOA 1KYOE 3S1KA 1N7SD 5APYA 5AVYB 3AE5C 2ZT9C 2YMYA 1PP9E 3AE4C 1JY2O 1NU1D 1FBMA 1ZRTD 1VQMP 1RF1C 1OW7A 1WMKA 1VF5D 3GHGA 3RK3C 2IBZD 5KAFE 2PRRA 1X22A 3CCQP 1BE3E 5AW0B 1LWUC 1MV8A 3CC2P 2NPSA 1PP9J 3M06A 4R4LA 1WT6A 1ZN5A 1SQVE 2K9YA 3H1HE 4RKUJ 1KFNA 2H88C 4Y99C 2C9NY 2B88A 1PP9D 1BE3J 3RGUA 2E5TA 2KI7B 3TNUB 1EZVE 2AEJA 2LR2A 2H7HA 1NJIQ 2P10A 4GOEA 1SVFA 1BE3D 2ZFCA 2M3BA 1L4AD 4IFDK 1G2CB 2YMKA 2XNDH 3MGNA 3CD6P 1WRGA 1UIIA 1SQVJ 3BCCG 2LXBA 3H1HJ 1GD2E 2WTYA 2N1TA 3V5BA 4PV1C 1SQVD 3H1HD 1NTMG 3CWBD 3EFFK 2ITAA 3L37A 4KJMA 1EZVD 1H88A 2D2CB 5AW8B 3HD7A 4IOIH 2A45I 5AVQB 2HPCA 3CX5H 2CK3H 2P7JA 1OMIA 1SS1A 2FYZA 4YXWH 4H44D 4HJGH 1S5LX 1OWAA 5BU5A 3AEEC 3EWKA 2K3RA 2KSJA 4N6JA 1Q2NA 1JCCA 1Q90D 4A7PA 1LTGC 1T6AA 1L0NK 1XTCC 3HE5A 1ZOYC 3EQ2A 1JY2N 1H89A 1ZP0C 3RL0g 2Q5UA 4DOJA 1VQ5P 3B71A 5AVUB 5CCHD 3L74G 3HUSC 1VDFA 4BXLA 3L75E 3CCUP 1BGYG 3RK2D 1S1CX 3L73G 3C1LA 1EQ7A 1CW5A 2IYOA 4BWNA 1OX3A 2FY8A 4I7ZC 3OAKA 3Q1MA 3TYYA 2ZVOB 4JPZB 2C0WA 4D6TG 3CCEP 2E75B 1NU1G 1FDIA 1NTMK 1SQPE 3E1RA 3L75J 4OGQC 3TGUE 1CSBA 2XU6A 3C9IA 2IBZG 2AXCA 3SWFA 1RH5B 1KILA 1PFIA 1P84H 3L75D 4ZKPA 2FBWC 2FKWB 3SWKA 3T97B 1URQC 2NZ2A 3WUTA 2RMZA 4EI2A 3CL3D 2KSEA 5B66H 1KV4A 1PGPA 1SQPJ 1IK7A 4PD4H 4UB8E 3TGUJ 3V4WA 3N7NA 1PP9G 1FJPA 2FXOA 2N9YB 2IPPA 5CJ4A 2NPSD 1SQPD 2OYHB 3H1JE 2JJLA 3TGUD 3L4FA 1LGHB 2YXRB 1SLQA 1ZW0A 1BE3G 2WSFJ 4WY4C 4JYCA 2WWWA 1W2BO 3VP8A 2HYNA 4KT0J 1MFZA 3L72E 2V7QJ 1VQLP 2O01J 2QRXA 2WSEJ 4H0LC 1SQVG 1JO5A 2KK7A 3H1JJ 2HODB 3H1HG 2E76B 3CWBG 3VMYA 2WPQA 3PRJA 3LIDA 3RBXA 1FZGA 2QE7H 1KMIZ 1GL2A 2XNXA 1EZVG 3H1JD 5GTIH 5AW7B 2KUBA 3B5NB 3L72J 1Q7YQ 2KP8A 2N1TD 3BRTB 1RF0C 1LT1A 2L5GB 2KOGA 2Y0DA 2W8ZA 1NU1K 4L73A 3AE2C 3LW5H 3A0BH 1FC2C 1SQBE 3L72D 1LTAC 1L0NE 3Q5SA 3MHVA 3HD7D 2M0BA 5APTA 1SFCD 1KZUB 5DJTB 3I56P 1K8AQ 1N73B 2WQYC 5CCGC 1Q86Q 1AQ5A 4WB4A 3M0DC 3A0HE 2ZJSE 1L0NJ 2IX7C 3I5CA 2O1KA 3CC4P 5AVWB 1SQBD 5CBNA 2E75C 2ZT9B 1AA0A 1L0ND 3VMAA 5KLIB 2GM4A 1CI6B 5DJUB 2G3AA 3MTUE 4PJ0E 3PH0A 1NTME 2YIUC 2K9JB 4IL6H 1JB0J 2OGUA 1LWUB 1KILE 4LGDE 2IDBA 3OJAB 1IFIA 2A45H 1SQQE 3AEBC 4WWIA 1OVUA 5KTBA 2IFNA 4DZOA 2R3SA 3BATA 5AVZB 2ZVNB 3L75G 3Q5RA 4Y99B 1NTMJ 5AVXB 5BVZA 4H13D 1PL5A 3D70A 3D6ZA 1AVOA 1T2KD 4GODA 1SQQJ 2Y9YA 2FFDC 1KILD 3AE7C 3P32A 2FXMA 1P84E 3HTKB 4QMAA 2I8DA 1SQPG 1KC8Q 1VQNP 3PP5A 1SQQD 3JC22 1M1KQ 3TGUG 2E76C 2ZYDA 3L74E 4PV1B 1JY3O 2HG5D 3ABVC 3HRNA 1NVOA 3MUDC 2FYNC 4RJTA 2CPSA 4GDOA 4PD4E 1GK4A 3H1IE 1W2EA 1J1DC 3UIAA 1IFPA 3KXDA 5CCHA 1VQ4P 3IAOA 2B87A 1OXZA 2SPZA 3L73E 1GW4A 4M3LA 1LTBC 2Y0EA 1ZXGA 1KN7A 5CJ0A 2R5BA 5KLVK 2ZAEB 3L74J 3D71A 2BASA 1P84D 5C39A 1IFNA 3PJSK 2FXPA 4D6TE 2WMMA 1ZMEC 1LT9B 3KYQA 3PHLA 3H1JG 1JMBA 3L74D 1EXIA 3L73J 4PD4D 3H1ID 1PGQA 1A02F 3AEDC 1J1EC 2Q9IA 3L73D 2JWAA 4D6TJ 1IZNB 2QJYB 1NU1J 3CLQA 3HUSB 2JO1A 4HKZH 2WSCJ 4D6TD 4U7JA 2B9BA 2GA1A 5KLIC 3A0BE 5B5EE 2R32A 3AE1C 1M8OB 4XA4A 2W27A 3OW2O 3AE9C 1RE3A 3VN0A 2O3JA 1SQPK 3C8VA 3NMDA 1SQBG 4I7ZB 1KYOI 2KLVA 1MFTA 2HLOA 1L0NG 1W5CE 1S4XA 2WT7B 3GF3A 4OGQB 1JNMA 4L75A 3HE5B 3FXDA 2J5UA 3CWBE 2A06E 3RL0B 5KJ7C 1A02J 1DX7A 2QM8A 3HE4A 3WUVA 1VQ9P 1NYHA 3WUUA 1URQB 3V2QA 3W68A 4LLHA 1DEEG 4YXDC 1BSNA 1JY3N 1RQVA 2VRSA 3U1CA 2QJPC 1KTMA 2MJZA 4C7NB 3BRVB 4IL6E 4ASVA 3CWBJ 3R4YA 4JQ0D 1SP4A 4GOFA 2NPSC 1YITP 4JBZA 2O1JA 3CXHI 5TISE 2A06D 4WY4B 2WVRA 1Y9BA 1U7MA 2Z4EA 2YKOA 5M1BA 1M56D 1SFCA 3O6QA 1SQQG 5GTHE 2K88A 1S2EA 3SFEC 2C0XA 4H0LB 3KDPB 1E79H 1LTTC 3CCRP 3B5ND 1LT9C 1X8YA 1QVGO 2O01N 1VL2A 2BEQD 5KLVE 3JSVC 1FS0E 1QLED 1SQBK 3K5BA 3LIEA 1HTLC 1HBWA 2KZIA 1NAYA 2RN0A 3D6YA 3RK3E 1HH0A 5CHXA 1IO4A 1TU3F 2QJYC 5E79H 4BRYB 1ZR4A 5KLVJ 1GU5A 1RY3A 1SQXK 2KYVA 1FZEA 1RE4A 3H1IG 4K3AA 2Z5HA 3L71G 5KLVD 1R8EA 1N7LA 3L70D 5H2FE 1KQLA 1HWTC 2ZT9D 2E5YA 2DW3A 2YXQB 4HB1A 3H25A 4IFFA 5AW4B 1N7SB 1AJYA 1G2CA 1OFCX 3AE6C 3RK3D 4WVZA 3CC7P 2J58A 1MKMA 1K05A 1FOSF 3G6EP 3RL0C 1T3UA 2YIUB 1SQQK 1VQ7P 3OA7A 1H0TB 4HYTB 2Q3EA 1S3JA 5AVRB 1JMMA 1M90Q 1VQPP 3WMM0 1EXJA 1S72P 4TT3H 1FOSE 1FU1A 4R4MA 5AW5B 3FWNA 4LC1A 4HH2A 1NAFA 3S4RA 1HJ0A 4OH8B 2Q7CA 1T2KC 1L4AB 4EOTA 2FFDB 4XFJA 2M5AB 1KILC 4EDFA 2IZ0A 2OYIB 2WPRA 3TK1A 2A06G 5AW6B 1M1JA 3TSIA 2NRGA 2QG4A 2FYNB 3KZIH 1JTHA 4CPGA 1J1DB 3A3YB 2GUSA 3USSA 3JCUH 4IL6X 4DT0A 1NTKE 1T8ZA 2LXCB 2KNCB 4NPDA 2N9BA 1FAVA 3A5TA 1KYOH 2KS1A 2OQQA 3KPEA 1YIJP 1GMJA 1IFDA 2R5DA 4GT1A 2A45G 2WSSH 3H32B 3CX5E 3AEGC 2W6JH 3VMXA 2E74C 3BASA 4N3YB 5KAFH 1SQXE 3T97A 4C7RA 1LP1B 4TLFA 1SQBJ 1NTKD 1J1EB 1GL2C 3EFGA 1KB9I 3V4QA 1N7SC 4I6MC 4WBAA 3NTNA 3Q3DA 3CCVP 2R3CA 3O8ZA 2RH0A 5KLVG 5L8RJ 2M3EA 1K04A 2OYHA 3L70G 1SQXJ 3BVHA 1FZCB 1OW6A 1VF5C 3CXHH 1YYCA 3CX5D 1ZV8A 1NOHA 3IFMA 2JR8A 2YKQA 5AW2B 4OGQD 1NO4A 1X79B 1SQXD 1ZR2A 1LTJA 1FZFA 2QIWA 2AXTH 2QM7A 1S9KE 1PV3A 3VYIA 3M9HA 1FZAA 1OVRA 2HODA 1BDCA 2LKMA 3AEFC 2BEZF 1YQ3C 2FYUK 4I2LC 3B5NA 2QJPB 1YHQP 1L4AC 1NKNA 3GHGB 1FE6A 2H43A 1QL2A 2OYIC 2M8RA 2Z5IA 4WY4D 1S9KD 2NPSB 1YJ9P 2D2CD 2PGDA 2BCCE 5B66E 3FXEA 1N86A 3L71E 1PGJA 2ZXEB 4H0LD 1N73A 1JY3P 4MN4C 1HJBA 3GG2A 2YKPA 3HE4B 2KXPB 1U7JA 2Q6QA 1G1JA 3IR9A 3E1IA 4OWFA 4H44C 2OTKE 3SWYA 1AFOA 1E5WA 5AW1B 3H1IJ 1DD4A 1X0TA 2E43A 3PLNA 3L71J 3QWOC 2BCCD 1CI6A 1JUNA 1RF1A 1KD1Q 2N1TB 5APSA 4N78E 2K9JA 3FX0A 3KHUA 4B86A 3L71D 1YQ4C 1LWUA 2AEMA 2Q1KA 5APVA 5APXA 5GTIE 3M0AA 2XV5A 3JCUE 3P8CE 1LTSC 5CCHC 3HD7B 4ZNCA 1SFCB 5CCGD 1KQGB 3MZWB 2P58A 2HPCB 1N8RQ 2QA4P 2OTLP 3CCMP 2IBZI 3H1KE 3CCJP 3RK2C 2ZYGA 2W6AA 1FZCC 1NTKG 4O9BA 1QEXA 3N4XA 4DCKA 2E75D 3SSUA 1M7LA 3CCLP 4AYCA 3G71P 1JY2P 2J59M 4W80A 1USDA 4N78D 2Q3IA 2WSFH 1VQKP 2I1KA 3HTKA 4GIFA 4UB8H 3LW5J 2V7QH 2XDJA 5KKZB 2O01H 3P8CD 3QH9A 2WSEH 3H1KJ 1K73Q 5AVTB 1VQOP 1YJNP 1L0LG 3NFQA 1YI2P 2H8PD 4DJGA 1SQXG 3P8MC 3H1KD 1KYOD 2OYOA 1EDJA 2E42A 2KZJA 5APUA 2GUVA 2JWDA 3U59A 1GW3A 1IK9A 2FYUE 3CXHE 2POHA 3GHGC 3ITKA 1FJKA 1GU4A 4U3FE 2WITA 1RE3C 1NTZK 3H1LE 1LT9A 3GMAA 1OW8A 4GKGA 2AXTE 2RKLA 4H13B 1EZVI 1BCCE 4UB6H 1IFJA 3SFDC 2JEEA 2C9LY 1IFMA 1LTIC 4JF7A 2OTJP 2FYUJ 2E76D 1KILB 1EDIA 2QJKC 1M57D 2UWJE 1EC5A 4U3FJ 2QVAA 3H1LJ 2ZYAA 5KAIH 1KB9H 2FYUD 3CXHD 3IN6A 3MD0A 3CPWO 1USEA 1U57A 1AVYA 1NTKK 1DIPA 3HUSA 4U3FD 4RO0A 1BCCJ 2WZ7A 3H1LD 4ASWA 3L70E 3CMAP 1YJWP 3AE3C 4ZMDA 1BCCD 2N1TC 1PZQA 1IJDB 3A0HH 3V2PA 2W83C 1MUUA 2MKVA 1OIPA 1L0LK 3HD7C 3MIWA 2P2UA 1SFCC 2YO2A 2BCCG 2WT7A 1JOCA 1QL1A 1R5LA 3GLMA 1HGVA 3L70J 1YTZT 4AUWA 2XZRA 3CCSP 3M9BA 2E74B 4PJ0H 3H6PA 1GK6A 4IFMA 1M1JB 1URQA 3TNUA 4W7ZA 3M9QA 3WU2H 1VQ6P 1GL2B 1JTHB 2KB7P 1QGKB 2W90A 1PGOA 2YNYA 3TDKA 3ZDMA 2AEFA 1NKZB 3G9RA 5APQA 3VTPC 4C7NA 4AQRD 1X9VA 2IZ1A 2CPBA 1KFMA 2PAJA 5KKZC 3PTZA 1N2DC 1NHLA 1BSHA 2KS1B 1VF5B 1L2PA 1UIXA 2W6BA 5APWA 1Q82Q 4WY4A 1VQ8P 1KQSO 3A2AA 1S5LH 1RE4C 2QSIA 4I1LA 5KJ7D 3A7OA 5BU8B 4C46A 3MP7B 3V6IA 5AW9B 3GF7A 3Q2YA 3H1KG 3S9OA 2WPSA 3AEAC 1QX8A 4H13C 2HR3A 1NTZE 1HGZA 1PPJE 3VP9A 3G4SP 4EYYQ 1GTWA 4NPFX 1PIXA 4NPEA 1RF0A 4PV1D 3M91A 5AVVB 1T3JA 2I1JA 2KLUA 2Y0CA 4BRYA 2D2CC 1LTJB 1JEKA 1YBKA 2P67A 1NTZJ 2JP3A 3AECC 3L36A 3L35A 2WSCH 1EDKA 2K1AA 1NTZD 5CCGA 5CMZA 1PPJD 2FYUG 3M0DA 4XE5B 4YPCA 4UB6E 4H44B 2PFXA 4U3FG 1N7SA 1XTGB 1HF9A 3H1LG 1YTZI 1OVVA 3AE8C 3VOPA 4L74A 3FWLA 1H8AA 1OZHA 1BCCG 1NTKJ 1L0LE 5B5EH 5KAIE 1KB9E 1EDLA 3I55P 1CZQA 1KORA 1M1JC 1NH4A 1H0TA 1K9MQ 1FDMA
chains in the Genus database with same CATH topology
5E79E 3WU2E 3A0BE 5B5EE 5H2FE 3KZIE 5GTHE 4UB8E 1W5CE 5KAIE 5KAFE 2AXTE 5TISE 5GTIE 4UB6E 3JCUE 1S5LE 3A0HE 4PJ0E 5B66E 4IL6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 E;  3WU2 E;  3A0B E;  5B5E E;  5H2F E;  3KZI E;  5GTH E;  4UB8 E;  1W5C E;  5KAI E;  5KAF E;  2AXT E;  5TIS E;  5GTI E;  4UB6 E;  3JCU E;  1S5L E;  3A0H E;  4PJ0 E;  5B66 E;  4IL6 E; 
#chains in the Genus database with same CATH topology
 4Y28 J;  2B87 B;  2QEX P;  1L0L J;  2R44 A;  2JDI H;  2H89 C;  3CX5 I;  3RK2 B;  4KHX A;  3B4S A;  5E79 E;  4W7Y A;  1L0L D;  3BCC E;  1KB9 D;  3KQG A;  3B8E B;  4EIJ A;  2K37 A;  3IF4 A;  2JKV A;  3CI9 A;  2Y9Z A;  1L4A A;  2FFD A;  3RL0 D;  1RF1 B;  2M5A A;  3II6 A;  3RK3 B;  1URQ D;  1KQF B;  2HFE D;  1GZL A;  3WU2 E;  3Q5P A;  2OYI A;  5K5G B;  2V4H A;  1ZLL A;  1SQV K;  5TJH A;  3MUD A;  3BCC J;  4YTP C;  1G1I A;  4Z1M H;  4L76 A;  5TIS H;  1Q81 Q;  3NXS A;  2B89 A;  3BCC D;  5EFW B;  2OYH C;  1R5S A;  1Y47 A;  2KNC A;  5GTH H;  2ZXX A;  2P1J A;  1DH3 A;  1JCD A;  3V2N A;  2YO3 A;  2L91 A;  3G3Z A;  1J2J B;  1NTM D;  3FGA D;  1S5L E;  1Y8A A;  1Z56 A;  3TF5 A;  3VMZ A;  1LTJ C;  1RQU A;  1VPC A;  3H32 A;  2KIK A;  2G8Y A;  4ZKU A;  1D7M A;  1DEB A;  1LP1 A;  2QJK B;  4JYB A;  1P84 I;  1AQT A;  1BDD A;  3F89 A;  1FZB A;  1BGY E;  4RES B;  1DD3 A;  1MZ9 A;  1JM0 A;  2BCC J;  3B5N C;  3V2R A;  1NWQ A;  5AVS B;  1GDT A;  2IYP A;  4PD4 I;  5AW3 B;  1NTZ G;  3E7K A;  1PPJ G;  3W67 A;  1FZC A;  2OAR A;  1HUC A;  1NU1 E;  3U1A A;  3GW6 A;  3R2P A;  3KZI E;  1LNQ A;  1ZRT E;  5H2F H;  3P7K A;  1BGY J;  1HVV A;  1FDO A;  1IC2 A;  2IBZ E;  2IFM A;  4K35 A;  2XKM A;  2PP6 A;  1N73 C;  2E74 D;  3CME P;  1BGY D;  2WPV B;  1LJ2 A;  1QVF O;  3L72 G;  3O6Q B;  4OVN F;  1NGM B;  3F5H A;  3RBZ A;  1GL2 D;  5KJ7 A;  1AV1 A;  1RHZ B;  5CBO A;  1KYO E;  3S1K A;  1N7S D;  5APY A;  5AVY B;  3AE5 C;  2ZT9 C;  2YMY A;  1PP9 E;  3AE4 C;  1JY2 O;  1NU1 D;  1FBM A;  1ZRT D;  1VQM P;  1RF1 C;  1OW7 A;  1WMK A;  1VF5 D;  3GHG A;  3RK3 C;  2IBZ D;  5KAF E;  2PRR A;  1X22 A;  3CCQ P;  1BE3 E;  5AW0 B;  1LWU C;  1MV8 A;  3CC2 P;  2NPS A;  1PP9 J;  3M06 A;  4R4L A;  1WT6 A;  1ZN5 A;  1SQV E;  2K9Y A;  3H1H E;  4RKU J;  1KFN A;  2H88 C;  4Y99 C;  2C9N Y;  2B88 A;  1PP9 D;  1BE3 J;  3RGU A;  2E5T A;  2KI7 B;  3TNU B;  1EZV E;  2AEJ A;  2LR2 A;  2H7H A;  1NJI Q;  2P10 A;  4GOE A;  1SVF A;  1BE3 D;  2ZFC A;  2M3B A;  1L4A D;  4IFD K;  1G2C B;  2YMK A;  2XND H;  3MGN A;  3CD6 P;  1WRG A;  1UII A;  1SQV J;  3BCC G;  2LXB A;  3H1H J;  1GD2 E;  2WTY A;  2N1T A;  3V5B A;  4PV1 C;  1SQV D;  3H1H D;  1NTM G;  3CWB D;  3EFF K;  2ITA A;  3L37 A;  4KJM A;  1EZV D;  1H88 A;  2D2C B;  5AW8 B;  3HD7 A;  4IOI H;  2A45 I;  5AVQ B;  2HPC A;  3CX5 H;  2CK3 H;  2P7J A;  1OMI A;  1SS1 A;  2FYZ A;  4YXW H;  4H44 D;  4HJG H;  1S5L X;  1OWA A;  5BU5 A;  3AEE C;  3EWK A;  2K3R A;  2KSJ A;  4N6J A;  1Q2N A;  1JCC A;  1Q90 D;  4A7P A;  1LTG C;  1T6A A;  1L0N K;  1XTC C;  3HE5 A;  1ZOY C;  3EQ2 A;  1JY2 N;  1H89 A;  1ZP0 C;  3RL0 g;  2Q5U A;  4DOJ A;  1VQ5 P;  3B71 A;  5AVU B;  5CCH D;  3L74 G;  3HUS C;  1VDF A;  4BXL A;  3L75 E;  3CCU P;  1BGY G;  3RK2 D;  1S1C X;  3L73 G;  3C1L A;  1EQ7 A;  1CW5 A;  2IYO A;  4BWN A;  1OX3 A;  2FY8 A;  4I7Z C;  3OAK A;  3Q1M A;  3TYY A;  2ZVO B;  4JPZ B;  2C0W A;  4D6T G;  3CCE P;  2E75 B;  1NU1 G;  1FDI A;  1NTM K;  1SQP E;  3E1R A;  3L75 J;  4OGQ C;  3TGU E;  1CSB A;  2XU6 A;  3C9I A;  2IBZ G;  2AXC A;  3SWF A;  1RH5 B;  1KIL A;  1PFI A;  1P84 H;  3L75 D;  4ZKP A;  2FBW C;  2FKW B;  3SWK A;  3T97 B;  1URQ C;  2NZ2 A;  3WUT A;  2RMZ A;  4EI2 A;  3CL3 D;  2KSE A;  5B66 H;  1KV4 A;  1PGP A;  1SQP J;  1IK7 A;  4PD4 H;  4UB8 E;  3TGU J;  3V4W A;  3N7N A;  1PP9 G;  1FJP A;  2FXO A;  2N9Y B;  2IPP A;  5CJ4 A;  2NPS D;  1SQP D;  2OYH B;  3H1J E;  2JJL A;  3TGU D;  3L4F A;  1LGH B;  2YXR B;  1SLQ A;  1ZW0 A;  1BE3 G;  2WSF J;  4WY4 C;  4JYC A;  2WWW A;  1W2B O;  3VP8 A;  2HYN A;  4KT0 J;  1MFZ A;  3L72 E;  2V7Q J;  1VQL P;  2O01 J;  2QRX A;  2WSE J;  4H0L C;  1SQV G;  1JO5 A;  2KK7 A;  3H1J J;  2HOD B;  3H1H G;  2E76 B;  3CWB G;  3VMY A;  2WPQ A;  3PRJ A;  3LID A;  3RBX A;  1FZG A;  2QE7 H;  1KMI Z;  1GL2 A;  2XNX A;  1EZV G;  3H1J D;  5GTI H;  5AW7 B;  2KUB A;  3B5N B;  3L72 J;  1Q7Y Q;  2KP8 A;  2N1T D;  3BRT B;  1RF0 C;  1LT1 A;  2L5G B;  2KOG A;  2Y0D A;  2W8Z A;  1NU1 K;  4L73 A;  3AE2 C;  3LW5 H;  3A0B H;  1FC2 C;  1SQB E;  3L72 D;  1LTA C;  1L0N E;  3Q5S A;  3MHV A;  3HD7 D;  2M0B A;  5APT A;  1SFC D;  1KZU B;  5DJT B;  3I56 P;  1K8A Q;  1N73 B;  2WQY C;  5CCG C;  1Q86 Q;  1AQ5 A;  4WB4 A;  3M0D C;  3A0H E;  2ZJS E;  1L0N J;  2IX7 C;  3I5C A;  2O1K A;  3CC4 P;  5AVW B;  1SQB D;  5CBN A;  2E75 C;  2ZT9 B;  1AA0 A;  1L0N D;  3VMA A;  5KLI B;  2GM4 A;  1CI6 B;  5DJU B;  2G3A A;  3MTU E;  4PJ0 E;  3PH0 A;  1NTM E;  2YIU C;  2K9J B;  4IL6 H;  1JB0 J;  2OGU A;  1LWU B;  1KIL E;  4LGD E;  2IDB A;  3OJA B;  1IFI A;  2A45 H;  1SQQ E;  3AEB C;  4WWI A;  1OVU A;  5KTB A;  2IFN A;  4DZO A;  2R3S A;  3BAT A;  5AVZ B;  2ZVN B;  3L75 G;  3Q5R A;  4Y99 B;  1NTM J;  5AVX B;  5BVZ A;  4H13 D;  1PL5 A;  3D70 A;  3D6Z A;  1AVO A;  1T2K D;  4GOD A;  1SQQ J;  2Y9Y A;  2FFD C;  1KIL D;  3AE7 C;  3P32 A;  2FXM A;  1P84 E;  3HTK B;  4QMA A;  2I8D A;  1SQP G;  1KC8 Q;  1VQN P;  3PP5 A;  1SQQ D;  3JC2 2;  1M1K Q;  3TGU G;  2E76 C;  2ZYD A;  3L74 E;  4PV1 B;  1JY3 O;  2HG5 D;  3ABV C;  3HRN A;  1NVO A;  3MUD C;  2FYN C;  4RJT A;  2CPS A;  4GDO A;  4PD4 E;  1GK4 A;  3H1I E;  1W2E A;  1J1D C;  3UIA A;  1IFP A;  3KXD A;  5CCH A;  1VQ4 P;  3IAO A;  2B87 A;  1OXZ A;  2SPZ A;  3L73 E;  1GW4 A;  4M3L A;  1LTB C;  2Y0E A;  1ZXG A;  1KN7 A;  5CJ0 A;  2R5B A;  5KLV K;  2ZAE B;  3L74 J;  3D71 A;  2BAS A;  1P84 D;  5C39 A;  1IFN A;  3PJS K;  2FXP A;  4D6T E;  2WMM A;  1ZME C;  1LT9 B;  3KYQ A;  3PHL A;  3H1J G;  1JMB A;  3L74 D;  1EXI A;  3L73 J;  4PD4 D;  3H1I D;  1PGQ A;  1A02 F;  3AED C;  1J1E C;  2Q9I A;  3L73 D;  2JWA A;  4D6T J;  1IZN B;  2QJY B;  1NU1 J;  3CLQ A;  3HUS B;  2JO1 A;  4HKZ H;  2WSC J;  4D6T D;  4U7J A;  2B9B A;  2GA1 A;  5KLI C;  3A0B E;  5B5E E;  2R32 A;  3AE1 C;  1M8O B;  4XA4 A;  2W27 A;  3OW2 O;  3AE9 C;  1RE3 A;  3VN0 A;  2O3J A;  1SQP K;  3C8V A;  3NMD A;  1SQB G;  4I7Z B;  1KYO I;  2KLV A;  1MFT A;  2HLO A;  1L0N G;  1W5C E;  1S4X A;  2WT7 B;  3GF3 A;  4OGQ B;  1JNM A;  4L75 A;  3HE5 B;  3FXD A;  2J5U A;  3CWB E;  2A06 E;  3RL0 B;  5KJ7 C;  1A02 J;  1DX7 A;  2QM8 A;  3HE4 A;  3WUV A;  1VQ9 P;  1NYH A;  3WUU A;  1URQ B;  3V2Q A;  3W68 A;  4LLH A;  1DEE G;  4YXD C;  1BSN A;  1JY3 N;  1RQV A;  2VRS A;  3U1C A;  2QJP C;  1KTM A;  2MJZ A;  4C7N B;  3BRV B;  4IL6 E;  4ASV A;  3CWB J;  3R4Y A;  4JQ0 D;  1SP4 A;  4GOF A;  2NPS C;  1YIT P;  4JBZ A;  2O1J A;  3CXH I;  5TIS E;  2A06 D;  4WY4 B;  2WVR A;  1Y9B A;  1U7M A;  2Z4E A;  2YKO A;  5M1B A;  1M56 D;  1SFC A;  3O6Q A;  1SQQ G;  5GTH E;  2K88 A;  1S2E A;  3SFE C;  2C0X A;  4H0L B;  3KDP B;  1E79 H;  1LTT C;  3CCR P;  3B5N D;  1LT9 C;  1X8Y A;  1QVG O;  2O01 N;  1VL2 A;  2BEQ D;  5KLV E;  3JSV C;  1FS0 E;  1QLE D;  1SQB K;  3K5B A;  3LIE A;  1HTL C;  1HBW A;  2KZI A;  1NAY A;  2RN0 A;  3D6Y A;  3RK3 E;  1HH0 A;  5CHX A;  1IO4 A;  1TU3 F;  2QJY C;  5E79 H;  4BRY B;  1ZR4 A;  5KLV J;  1GU5 A;  1RY3 A;  1SQX K;  2KYV A;  1FZE A;  1RE4 A;  3H1I G;  4K3A A;  2Z5H A;  3L71 G;  5KLV D;  1R8E A;  1N7L A;  3L70 D;  5H2F E;  1KQL A;  1HWT C;  2ZT9 D;  2E5Y A;  2DW3 A;  2YXQ B;  4HB1 A;  3H25 A;  4IFF A;  5AW4 B;  1N7S B;  1AJY A;  1G2C A;  1OFC X;  3AE6 C;  3RK3 D;  4WVZ A;  3CC7 P;  2J58 A;  1MKM A;  1K05 A;  1FOS F;  3G6E P;  3RL0 C;  1T3U A;  2YIU B;  1SQQ K;  1VQ7 P;  3OA7 A;  1H0T B;  4HYT B;  2Q3E A;  1S3J A;  5AVR B;  1JMM A;  1M90 Q;  1VQP P;  3WMM 0;  1EXJ A;  1S72 P;  4TT3 H;  1FOS E;  1FU1 A;  4R4M A;  5AW5 B;  3FWN A;  4LC1 A;  4HH2 A;  1NAF A;  3S4R A;  1HJ0 A;  4OH8 B;  2Q7C A;  1T2K C;  1L4A B;  4EOT A;  2FFD B;  4XFJ A;  2M5A B;  1KIL C;  4EDF A;  2IZ0 A;  2OYI B;  2WPR A;  3TK1 A;  2A06 G;  5AW6 B;  1M1J A;  3TSI A;  2NRG A;  2QG4 A;  2FYN B;  3KZI H;  1JTH A;  4CPG A;  1J1D B;  3A3Y B;  2GUS A;  3USS A;  3JCU H;  4IL6 X;  4DT0 A;  1NTK E;  1T8Z A;  2LXC B;  2KNC B;  4NPD A;  2N9B A;  1FAV A;  3A5T A;  1KYO H;  2KS1 A;  2OQQ A;  3KPE A;  1YIJ P;  1GMJ A;  1IFD A;  2R5D A;  4GT1 A;  2A45 G;  2WSS H;  3H32 B;  3CX5 E;  3AEG C;  2W6J H;  3VMX A;  2E74 C;  3BAS A;  4N3Y B;  5KAF H;  1SQX E;  3T97 A;  4C7R A;  1LP1 B;  4TLF A;  1SQB J;  1NTK D;  1J1E B;  1GL2 C;  3EFG A;  1KB9 I;  3V4Q A;  1N7S C;  4I6M C;  4WBA A;  3NTN A;  3Q3D A;  3CCV P;  2R3C A;  3O8Z A;  2RH0 A;  5KLV G;  5L8R J;  2M3E A;  1K04 A;  2OYH A;  3L70 G;  1SQX J;  3BVH A;  1FZC B;  1OW6 A;  1VF5 C;  3CXH H;  1YYC A;  3CX5 D;  1ZV8 A;  1NOH A;  3IFM A;  2JR8 A;  2YKQ A;  5AW2 B;  4OGQ D;  1NO4 A;  1X79 B;  1SQX D;  1ZR2 A;  1LTJ A;  1FZF A;  2QIW A;  2AXT H;  2QM7 A;  1S9K E;  1PV3 A;  3VYI A;  3M9H A;  1FZA A;  1OVR A;  2HOD A;  1BDC A;  2LKM A;  3AEF C;  2BEZ F;  1YQ3 C;  2FYU K;  4I2L C;  3B5N A;  2QJP B;  1YHQ P;  1L4A C;  1NKN A;  3GHG B;  1FE6 A;  2H43 A;  1QL2 A;  2OYI C;  2M8R A;  2Z5I A;  4WY4 D;  1S9K D;  2NPS B;  1YJ9 P;  2D2C D;  2PGD A;  2BCC E;  5B66 E;  3FXE A;  1N86 A;  3L71 E;  1PGJ A;  2ZXE B;  4H0L D;  1N73 A;  1JY3 P;  4MN4 C;  1HJB A;  3GG2 A;  2YKP A;  3HE4 B;  2KXP B;  1U7J A;  2Q6Q A;  1G1J A;  3IR9 A;  3E1I A;  4OWF A;  4H44 C;  2OTK E;  3SWY A;  1AFO A;  1E5W A;  5AW1 B;  3H1I J;  1DD4 A;  1X0T A;  2E43 A;  3PLN A;  3L71 J;  3QWO C;  2BCC D;  1CI6 A;  1JUN A;  1RF1 A;  1KD1 Q;  2N1T B;  5APS A;  4N78 E;  2K9J A;  3FX0 A;  3KHU A;  4B86 A;  3L71 D;  1YQ4 C;  1LWU A;  2AEM A;  2Q1K A;  5APV A;  5APX A;  5GTI E;  3M0A A;  2XV5 A;  3JCU E;  3P8C E;  1LTS C;  5CCH C;  3HD7 B;  4ZNC A;  1SFC B;  5CCG D;  1KQG B;  3MZW B;  2P58 A;  2HPC B;  1N8R Q;  2QA4 P;  2OTL P;  3CCM P;  2IBZ I;  3H1K E;  3CCJ P;  3RK2 C;  2ZYG A;  2W6A A;  1FZC C;  1NTK G;  4O9B A;  1QEX A;  3N4X A;  4DCK A;  2E75 D;  3SSU A;  1M7L A;  3CCL P;  4AYC A;  3G71 P;  1JY2 P;  2J59 M;  4W80 A;  1USD A;  4N78 D;  2Q3I A;  2WSF H;  1VQK P;  2I1K A;  3HTK A;  4GIF A;  4UB8 H;  3LW5 J;  2V7Q H;  2XDJ A;  5KKZ B;  2O01 H;  3P8C D;  3QH9 A;  2WSE H;  3H1K J;  1K73 Q;  5AVT B;  1VQO P;  1YJN P;  1L0L G;  3NFQ A;  1YI2 P;  2H8P D;  4DJG A;  1SQX G;  3P8M C;  3H1K D;  1KYO D;  2OYO A;  1EDJ A;  2E42 A;  2KZJ A;  5APU A;  2GUV A;  2JWD A;  3U59 A;  1GW3 A;  1IK9 A;  2FYU E;  3CXH E;  2POH A;  3GHG C;  3ITK A;  1FJK A;  1GU4 A;  4U3F E;  2WIT A;  1RE3 C;  1NTZ K;  3H1L E;  1LT9 A;  3GMA A;  1OW8 A;  4GKG A;  2AXT E;  2RKL A;  4H13 B;  1EZV I;  1BCC E;  4UB6 H;  1IFJ A;  3SFD C;  2JEE A;  2C9L Y;  1IFM A;  1LTI C;  4JF7 A;  2OTJ P;  2FYU J;  2E76 D;  1KIL B;  1EDI A;  2QJK C;  1M57 D;  2UWJ E;  1EC5 A;  4U3F J;  2QVA A;  3H1L J;  2ZYA A;  5KAI H;  1KB9 H;  2FYU D;  3CXH D;  3IN6 A;  3MD0 A;  3CPW O;  1USE A;  1U57 A;  1AVY A;  1NTK K;  1DIP A;  3HUS A;  4U3F D;  4RO0 A;  1BCC J;  2WZ7 A;  3H1L D;  4ASW A;  3L70 E;  3CMA P;  1YJW P;  3AE3 C;  4ZMD A;  1BCC D;  2N1T C;  1PZQ A;  1IJD B;  3A0H H;  3V2P A;  2W83 C;  1MUU A;  2MKV A;  1OIP A;  1L0L K;  3HD7 C;  3MIW A;  2P2U A;  1SFC C;  2YO2 A;  2BCC G;  2WT7 A;  1JOC A;  1QL1 A;  1R5L A;  3GLM A;  1HGV A;  3L70 J;  1YTZ T;  4AUW A;  2XZR A;  3CCS P;  3M9B A;  2E74 B;  4PJ0 H;  3H6P A;  1GK6 A;  4IFM A;  1M1J B;  1URQ A;  3TNU A;  4W7Z A;  3M9Q A;  3WU2 H;  1VQ6 P;  1GL2 B;  1JTH B;  2KB7 P;  1QGK B;  2W90 A;  1PGO A;  2YNY A;  3TDK A;  3ZDM A;  2AEF A;  1NKZ B;  3G9R A;  5APQ A;  3VTP C;  4C7N A;  4AQR D;  1X9V A;  2IZ1 A;  2CPB A;  1KFM A;  2PAJ A;  5KKZ C;  3PTZ A;  1N2D C;  1NHL A;  1BSH A;  2KS1 B;  1VF5 B;  1L2P A;  1UIX A;  2W6B A;  5APW A;  1Q82 Q;  4WY4 A;  1VQ8 P;  1KQS O;  3A2A A;  1S5L H;  1RE4 C;  2QSI A;  4I1L A;  5KJ7 D;  3A7O A;  5BU8 B;  4C46 A;  3MP7 B;  3V6I A;  5AW9 B;  3GF7 A;  3Q2Y A;  3H1K G;  3S9O A;  2WPS A;  3AEA C;  1QX8 A;  4H13 C;  2HR3 A;  1NTZ E;  1HGZ A;  1PPJ E;  3VP9 A;  3G4S P;  4EYY Q;  1GTW A;  4NPF X;  1PIX A;  4NPE A;  1RF0 A;  4PV1 D;  3M91 A;  5AVV B;  1T3J A;  2I1J A;  2KLU A;  2Y0C A;  4BRY A;  2D2C C;  1LTJ B;  1JEK A;  1YBK A;  2P67 A;  1NTZ J;  2JP3 A;  3AEC C;  3L36 A;  3L35 A;  2WSC H;  1EDK A;  2K1A A;  1NTZ D;  5CCG A;  5CMZ A;  1PPJ D;  2FYU G;  3M0D A;  4XE5 B;  4YPC A;  4UB6 E;  4H44 B;  2PFX A;  4U3F G;  1N7S A;  1XTG B;  1HF9 A;  3H1L G;  1YTZ I;  1OVV A;  3AE8 C;  3VOP A;  4L74 A;  3FWL A;  1H8A A;  1OZH A;  1BCC G;  1NTK J;  1L0L E;  5B5E H;  5KAI E;  1KB9 E;  1EDL A;  3I55 P;  1CZQ A;  1KOR A;  1M1J C;  1NH4 A;  1H0T A;  1K9M Q;  1FDM A; 
#chains in the Genus database with same CATH homology
 5E79 E;  3WU2 E;  3A0B E;  5B5E E;  5H2F E;  3KZI E;  5GTH E;  4UB8 E;  1W5C E;  5KAI E;  5KAF E;  2AXT E;  5TIS E;  5GTI E;  4UB6 E;  3JCU E;  1S5L E;  3A0H E;  4PJ0 E;  5B66 E;  4IL6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...