5H2FE

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5h2fE00
5H2FE 5B66E 4IL6E 5GTHE 5TISE 4UB8E 5GTIE 5E79E 1W5CE 3WU2E 2AXTE 5KAIE 1S5LE 3A0HE 3JCUE 4UB6E 4PJ0E 5KAFE 5B5EE 3A0BE 3KZIE
chains in the Genus database with same CATH superfamily
1URQB 3D71A 5KAFH 3AE6C 1SQQE 3EFFK 2UWJE 2ZT9D 2KZJA 1GDTA 1YQ4C 3CXHD 5M1BA 5H2FH 1VQNP 3L72D 5B66H 3FWNA 1T8ZA 2BCCD 5TISH 1YJNP 3B71A 1YYCA 1EXIA 2N1TC 1X22A 1VQPP 3V4QA 2OYIA 1S9KE 2O1JA 1E5WA 3CX5I 4TT3H 1LTBC 1T2KD 1XTGB 3MUDA 1KTMA 3PTZA 3OW2O 4ZKUA 4IOIH 2W83C 5KLIC 4L73A 1L4AC 1U7JA 5APUA 1OW6A 3CC7P 4HYTB 3F89A 1MKMA 1G1JA 5AW3B 3WU2H 2FYUJ 2WITA 3A7OA 1EDIA 3AEDC 2NZ2A 4PD4E 2R5DA 4PV1B 4MN4C 3GMAA 3LW5J 4BXLA 4D6TD 3HE4B 4I1LA 3R2PA 4KHXA 1BCCE 3L70D 3AE4C 1IFIA 2Z5HA 1H8AA 2W6JH 1JNMA 1JO5A 3T97B 3UIAA 5GTHH 4UB8H 3G6EP 4IFFA 3CX5H 3B5NC 1SQQD 3U1AA 2C0XA 2OYHB 2K1AA 3L72J 3GHGB 1JM0A 1LT9C 3HE4A 2ZFCA 3CWBJ 2FYNC 3JSVC 1YHQP 3FX0A 2AXCA 4EOTA 4ZKPA 5AW2B 2IDBA 1OVRA 3L72G 2BCCG 2IX7C 3HD7B 2JWAA 1SQPK 3PHLA 4K3AA 3CWBG 3T97A 1DH3A 1DD4A 2QM8A 3ABVC 3B4SA 1HUCA 3MD0A 2OARA 4M3LA 2AEFA 1EDLA 1L0NK 1JMMA 1VDFA 1J1DB 2OYHA 2H8PD 2OTLP 5CCGA 1KQSO 3CPWO 1SFCB 5KAIE 1MFTA 1NYHA 1EXJA 1FZAA 4PD4D 1PGJA 1Q81Q 1PGPA 1GW3A 2HG5D 3M0AA 1BCCD 1URQD 1M1JB 1WT6A 3SFEC 4A7PA 3HE5A 2PGDA 3CI9A 2KZIA 1S2EA 3F5HA 3V6IA 5KAFE 1SLQA 3GF3A 1LTTC 4D6TG 2WPQA 1RE3A 2FFDC 5H2FE 2Q6QA 5B66E 1GL2B 2WQYC 4OWFA 5TISE 2IPPA 1XTCC 2R5BA 4R4MA 3TGUE 2QRXA 1MZ9A 5KLVE 3L37A 1A02J 1YTZI 1SQQG 1M1JA 3L75E 2E76B 1Q82Q 2FXMA 1GD2E 1YITP 1VF5B 2OYIC 1HF9A 1KILA 2KS1B 2LXBA 2WPVB 1EZVI 1JTHB 3KDPB 2K9JB 3S4RA 4XE5B 2XV5A 3GW6A 1NTZE 2WSFH 1L0LK 3WU2E 2Y0DA 3MTUE 2YXQB 4OGQC 1CW5A 1IFNA 4PV1D 1YJ9P 1M56D 1IK9A 3HRNA 3RK2C 3SWKA 5K5GB 3TYYA 2KP8A 3V2RA 3VN0A 3CCVP 2O3JA 1HJ0A 3H1KJ 3A3YB 4LLHA 4Z1MH 4BWNA 2VRSA 1GZLA 2YXRB 1VQ9P 5GTHE 1LP1B 4UB8E 1NOHA 1SQXE 1A02F 1FE6A 2K88A 3P7KA 5E79H 3RBXA 1UIXA 1BCCG 2M5AB 3PJSK 1AVOA 3VTPC 4JYCA 1JOCA 2XDJA 3TGUD 3HD7D 3TK1A 5AVQB 1JY3O 1NAFA 5KLVD 3MZWB 5APVA 3RL0D 2WSEJ 2FYUE 2JEEA 3SWFA 2Q7CA 1H89A 3L75D 1DD3A 3PRJA 1BSHA 2MJZA 1Q2NA 3O8ZA 1W2EA 2M5AA 2Q5UA 2QVAA 1LGHB 1SFCD 5APWA 1Q7YQ 2C0WA 1PV3A 2O01N 1VQ4P 1NTZD 2ZXXA 4H44C 1SQBK 3W68A 1EDJA 2CPBA 2LKMA 1U7MA 3CC4P 1PPJE 2OYHC 3I56P 1N86A 1T3JA 5CCGC 1NTKK 1MFZA 1VPCA 1JCCA 4AUWA 1PL5A 1QLED 2KXPB 1SQVJ 3OA7A 4H13C 1BDDA 3CWBE 2P67A 4I7ZB 1N73A 1GL2D 1P84I 2J59M 2WTYA 3D70A 4ASWA 5CHXA 1VQ6P 3IR9A 1M1KQ 3SWYA 3ZDMA 5AVSB 4I2LC 1SQXD 1X9VA 3D6YA 2WSEH 4L75A 1J1DC 1Y8AA 2R3CA 1NWQA 2L5GB 1LNQA 3OJAB 2QJKB 4H0LC 5EFWB 1RE3C 3EQ2A 5KJ7A 2E76D 1K05A 2HYNA 4RJTA 4WY4B 3HTKA 1OZHA 3H1HJ 4OVNF 2FYUD 5AW1B 5AVVB 1QX8A 2M8RA 3L75J 1BGYD 2BEQD 3EWKA 4PJ0E 4C46A 1JY2N 5KLVG 2B89A 1FC2C 5KAIH 3GF7A 1FZCB 2LXCB 1WRGA 2KSEA 1NKNA 3L75G 3MHVA 3WUTA 1KILC 3CCRP 4L74A 3V2QA 1DEEG 3KPEA 1NVOA 3AE8C 2GUSA 1ZMEC 1PPJD 1K04A 1P84H 3L74J 2ZVNB 1CI6B 1NTZG 3Q5PA 3E1RA 3G3ZA 4Y99B 5BU5A 2KIKA 3V2PA 2Z5IA 1PFIA 3CWBD 3CD6P 3FWLA 1VF5C 5E79E 1YIJP 2KI7B 1SQXJ 2H43A 1VQ7P 1LWUA 1J1EB 2YIUB 1JUNA 3L71D 2M3BA 1URQA 1CI6A 1HGZA 3H1JJ 1N7SB 2CK3H 1EZVE 1SQXG 4IL6X 5DJUB 2YMYA 3H1JG 3AE2C 2KSJA 1Q86Q 1IO4A 5AW7B 4NPDA 5AVUB 2A06E 1BGYJ 3RGUA 1W5CE 3H1KE 2JO1A 2ZT9C 4RO0A 4IFDK 1E79H 2FYUG 1KFMA 1LTGC 2PAJA 1IZNB 1BGYG 1OVVA 2QJPB 5KJ7D 5C39A 3EFGA 2QA4P 3U59A 1AQ5A 1DEBA 1QVGO 1M8OB 4WBAA 2KLUA 1T2KC 5AVWB 2Y0CA 2RKLA 3GG2A 3G71P 1GMJA 1L0ND 1YBKA 1PZQA 2PRRA 1LTJB 1SVFA 2E5YA 1PPJG 3AE9C 4WWIA 1UIIA 3HUSB 1NU1E 5APQA 3M06A 1FZEA 5CBNA 2WPSA 1N7LA 2A45I 2E74B 1EC5A 1G2CB 4DCKA 1N73C 2AEJA 4WY4D 2G3AA 4GT1A 3L71J 2HFED 3JC22 3RL0B 4DJGA 2RH0A 1EZVD 3VOPA 4GIFA 2E75D 3AE1C 1R5SA 1VL2A 4WB4A 4YXDC 3VYIA 3V4WA 1LTJA 2A45G 3GHGA 3H1LE 3LIEA 3B8EB 3VP8A 1SQQK 3L71G 3HUSA 1FZFA 1G1IA 2WSSH 1USEA 1SP4A 2JJLA 1YQ3C 5KJ7C 4W80A 5APYA 1FBMA 2A06D 3HD7A 2W90A 1CSBA 3QH9A 3E1IA 1SQVE 3S9OA 4OH8B 3KZIE 3H1KD 2WSFJ 3RK3D 1KD1Q 1M7LA 1JEKA 3RBZA 3L73E 1RF1C 4U7JA 3NTNA 3IAOA 1P84E 1Q90D 3FGAD 5APSA 3M0DA 2QJYC 1SFCA 5B5EH 5AVXB 2NPSD 4C7RA 2A45H 3U1CA 3OAKA 1L0NJ 3ITKA 1T6AA 1IFPA 2KNCB 3CMEP 1K9MQ 2WSCJ 1NU1D 3H1HE 3TNUB 2YO3A 2XNXA 1KC8Q 1N7SD 2D2CB 1L0NG 2XKMA 4LGDE 1YJWP 1K73Q 1ZOYC 2E42A 3O6QB 4AYCA 3CCQP 2N9BA 1GL2A 1K8AQ 2B9BA 1AQTA 4PJ0H 3MUDC 2IBZE 2K9YA 1LWUC 2N1TB 2H89C 3QWOC 1JY3P 4EYYQ 1H0TB 2KNCA 4IL6H 3H1LD 1JY2P 2XNDH 1URQC 1NAYA 1FS0E 4CPGA 1NHLA 3TNUA 3L74E 1VQ5P 1ZN5A 4ZNCA 1EZVG 3K5BA 4EI2A 3C1LA 3BASA 3AEFC 5AW4B 3P8MC 3O6QA 1SQVD 1L4AB 3CLQA 1GU4A 2KS1A 2JDIH 4YPCA 1OW7A 1JTHA 3L36A 1LTSC 3VMAA 5AVYB 2K9JA 1PGQA 2E43A 3KYQA 2R3SA 3L73D 3PLNA 2A06G 3A5TA 1J1EC 3H32B 2HR3A 1P84D 1H0TA 5AW5B 2WSCH 4QMAA 3H1KG 2B87B 1JMBA 1KB9E 3CMAP 3M9QA 5CCHD 2ZJSE 1EDKA 4K35A 3H1JE 2HODB 2E74D 3WMM0 1IJDB 4GDOA 3Q5SA 1NTME 4JF7A 1L0LJ 4N3YB 3H1HD 1NU1J 1CZQA 1SQBD 1QGKB 1NH4A 3N4XA 4PV1C 1LP1A 1BGYE 2O01J 1BDCA 3B5NB 1Z56A 3AECC 1FJKA 1KQFB 4B86A 1D7MA 1NU1G 1AFOA 1HTLC 3CC2P 1LT9B 3TF5A 2FYNB 2IBZD 3FXDA 2YMKA 2ZXEB 2FXPA 3H1LJ 1PP9D 3L35A 3L74D 1LTJC 3GHGC 3BCCD 5KLVK 3H1LG 3CCEP 3H1IE 3NXSA 3HUSC 1H88A 3CL3D 4JPZB 2W8ZA 4U3FE 3IFMA 1LT9A 3HD7C 1HBWA 4JQ0D 3CCUP 2KOGA 3L73J 5B5EE 1SQVG 5KTBA 3RL0C 2Y9YA 4BRYB 1AVYA 2E5TA 1KB9D 1NTZK 1IFDA 2GA1A 3L71E 2O01H 3L73G 3H1JD 2JKVA 4HH2A 2D2CD 3M0DC 5AW0B 1BE3D 2OTKE 1SFCC 1LTAC 2ZYGA 3C8VA 2IZ0A 1NTMD 3PP5A 1RQUA 3MIWA 1RE4A 4YXWH 1SQBJ 4C7NB 2R44A 4DT0A 4EIJA 2E75B 2N1TD 4EDFA 1JY3N 1ZLLA 2WT7B 4YTPC 4BRYA 1NTKJ 5APXA 2YKQA 1M1JC 2HLOA 3H1HG 1SQBG 4IL6E 1SQXK 2IBZI 1ZW0A 2KLVA 1R8EA 3G9RA 1U57A 3KZIH 2IYOA 1JB0J 2PFXA 1AV1A 1GL2C 2J5UA 2GUVA 4WY4A 1PP9J 1L4AD 2YKOA 3RK3B 4UB6H 4C7NA 1SQPE 3SFDC 2IBZG 2AEMA 1KMIZ 2JWDA 3BCCJ 1N8RQ 2P7JA 3H1ID 1L0NE 2WT7A 1PP9G 2YNYA 3JCUE 2Z4EA 1KZUB 2FYUK 2KB7P 1ZP0C 2V7QJ 5KKZB 3L74G 4U3FD 1FZCA 2E76C 4OGQB 2W27A 1LTIC 3A2AA 1VQOP 2NPSB 2BEZF 3BCCG 4HJGH 1FJPA 3AEAC 3KHUA 3RK2B 1FDMA 3AEEC 1KB9I 3I55P 3BVHA 2GM4A 2OYOA 1OWAA 2FYZA 2K3RA 2KK7A 1GK4A 1Y9BA 1ZR2A 4L76A 1NGMB 1OIPA 4I6MC 2C9LY 1FDIA 2JR8A 2YO2A 1BE3J 1HVVA 3KQGA 3B5ND 3TSIA 3BRTB 5GTIH 1NTMJ 2I1KA 4W7ZA 2NPSA 1YTZT 3A0HH 4WVZA 5BU8B 1L2PA 2H7HA 3N7NA 1FAVA 1BE3G 1RH5B 3R4YA 1NTMG 2OTJP 1AJYA 2CPSA 3RK3E 1KYOI 1WMKA 1N7SA 2N9YB 5BVZA 3BRVB 3WUUA 2V7QH 1GW4A 3NFQA 2OGUA 1OFCX 1HJBA 1MV8A 4HB1A 1J2JB 1SQPD 1VQMP 2YKPA 1S5LH 1S4XA 2KUBA 1FDOA 3CCMP 2V4HA 3H1IJ 1KB9H 3Q2YA 3IF4A 3CCJP 5AVTB 1M57D 4H44B 1L0LE 4U3FJ 5CMZA 3CXHI 1FOSE 3CCSP 4R4LA 1AA0A 3H1IG 1KQGB 2BCCJ 1FU1A 2Y0EA 4U3FG 1T3UA 4KT0J 2WZ7A 1S9KD 1IK7A 1ZRTE 2QEXP 4H13B 1NKZB 3P8CE 3WUVA 1GU5A 2P2UA 2SPZA 2PP6A 2Y9ZA 1ZV8A 1KYOH 5CCHA 2WVRA 3A0BH 4IFMA 3LW5H 2B88A 2FBWC 3HE5B 4RESB 3Q5RA 1G2CA 1ZXGA 2AXTH 3VMYA 4I7ZC 3C9IA 1RE4C 4H0LB 1PIXA 2QSIA 3BATA 4N78E 1QL1A 4GODA 4UB6E 5AVZB 2IFMA 1TU3F 2DW3A 2QM7A 3M9BA 4D6TJ 2QJKC 1OVUA 5DJTB 2J58A 1RF0A 2P10A 3CXHH 3V5BA 1X0TA 1SQPJ 4OGQD 4DOJA 3L70J 2H88C 3SSUA 4WY4C 3RK2D 1OX3A 3M9HA 1KILB 3TDKA 4XA4A 1SQPG 1L0LD 3Q1MA 2E75C 4O9BA 1BSNA 1RHZB 3L70G 1SQBE 2M0BA 2LR2A 1SQQJ 2ZYDA 3RL0g 1OMIA 2OQQA 2O1KA 1FZCC 1QVFO 3VP9A 1NTKE 3M91A 3I5CA 5AW8B 2BASA 1USDA 1ZRTD 4GOEA 5GTIE 1EQ7A 2XU6A 1X8YA 3P8CD 1DX7A 3RK3C 5APTA 3A0HE 1PP9E 5AVRB 1M90Q 2ZYAA 2M3EA 3G4SP 3AEGC 4Y99C 3D6ZA 1VQ8P 3S1KA 4ASVA 3BCCE 3AEBC 5KKZC 1NU1K 1KQLA 5KLIB 1ZR4A 2NPSC 1HGVA 2QIWA 4ZMDA 4N78D 3MP7B 2POHA 1VQLP 3JCUH 5L8RJ 2MKVA 4PD4I 2N1TA 5TJHA 1N2DC 1NJIQ 2JP3A 2YIUC 4GOFA 1NO4A 1S5LE 1N7SC 3LIDA 1KILE 3H25A 4H44D 1BCCJ 2L91A 1Y47A 2ZT9B 3USSA 3CX5E 1BE3E 1L4AA 1R5LA 1S3JA 1QL2A 5CCGD 1GK6A 3PH0A 4DZOA 5CJ0A 1LJ2A 3P32A 2FKWB 1OW8A 1SQVK 4H13D 1S1CX 4Y28J 3H32A 2IZ1A 2NRGA 2ZAEB 1KV4A 3V2NA 2B87A 1NTKD 2KYVA 1L0LG 2HPCB 1JY2O 1FZBA 1MUUA 2QJPC 3FXEA 2W6BA 3AE5C 2HODA 3II6A 1KYOE 4AQRD 2Q3EA 3W67A 3A0BE 1X79B 3Q3DA 3KXDA 4HKZH 4H0LD 2K37A 4W7YA 3GLMA 2AXTE 5CBOA 3E7KA 1N73B 1S5LX 1SS1A 2Q3IA 4PD4H 1YI2P 3NMDA 4RKUJ 4XFJA 1IFJA 3B5NA 5CCHC 1KFNA 4GKGA 2HPCA 4NPFX 5AW6B 2E74C 5CJ4A 2QG4A 2ZVOB 2I1JA 4N6JA 1LT1A 1KN7A 3CXHE 3L72E 1IFMA 2BCCE 1FZGA 3AE3C 1FOSF 3HTKB 1KILD 3L4FA 4JBZA 2IYPA 2FXOA 3VMZA 1GTWA 4NPEA 3H6PA 2Q9IA 1S72P 2WMMA 1JCDA 3CX5D 1RF0C 4KJMA 1RF1B 2P58A 2IFNA 3CCLP 2I8DA 4TLFA 2FFDB 1DIPA 2G8YA 2Q1KA 3TGUJ 1QEXA 2QJYB 2WWWA 1W2BO 1OXZA 2XZRA 1VF5D 2QE7H 5KLVJ 2ITAA 2WPRA 3TGUG 2P1JA 1HH0A 1KYOD 2RMZA 1RQVA 4JYBA 1NTKG 1RF1A 1IC2A 2RN0A 1PGOA 1VQKP 4D6TE 2W6AA 1HWTC 3VMXA 5AW9B 3AE7C 3IN6A 2FFDA 2OYIB 1RY3A 3L70E 2FY8A 4LC1A 1NTMK 1NTZJ 2C9NY 2R32A 1KORA 1LWUB 2D2CC 3MGNA
chains in the Genus database with same CATH topology
5H2FE 5B66E 4IL6E 5GTHE 5TISE 4UB8E 5GTIE 5E79E 1W5CE 3WU2E 2AXTE 5KAIE 1S5LE 3A0HE 3JCUE 4UB6E 4PJ0E 5KAFE 5B5EE 3A0BE 3KZIE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H2F E;  5B66 E;  4IL6 E;  5GTH E;  5TIS E;  4UB8 E;  5GTI E;  5E79 E;  1W5C E;  3WU2 E;  2AXT E;  5KAI E;  1S5L E;  3A0H E;  3JCU E;  4UB6 E;  4PJ0 E;  5KAF E;  5B5E E;  3A0B E;  3KZI E; 
#chains in the Genus database with same CATH topology
 1URQ B;  3D71 A;  5KAF H;  3AE6 C;  1SQQ E;  3EFF K;  2UWJ E;  2ZT9 D;  2KZJ A;  1GDT A;  1YQ4 C;  3CXH D;  5M1B A;  5H2F H;  1VQN P;  3L72 D;  5B66 H;  3FWN A;  1T8Z A;  2BCC D;  5TIS H;  1YJN P;  3B71 A;  1YYC A;  1EXI A;  2N1T C;  1X22 A;  1VQP P;  3V4Q A;  2OYI A;  1S9K E;  2O1J A;  1E5W A;  3CX5 I;  4TT3 H;  1LTB C;  1T2K D;  1XTG B;  3MUD A;  1KTM A;  3PTZ A;  3OW2 O;  4ZKU A;  4IOI H;  2W83 C;  5KLI C;  4L73 A;  1L4A C;  1U7J A;  5APU A;  1OW6 A;  3CC7 P;  4HYT B;  3F89 A;  1MKM A;  1G1J A;  5AW3 B;  3WU2 H;  2FYU J;  2WIT A;  3A7O A;  1EDI A;  3AED C;  2NZ2 A;  4PD4 E;  2R5D A;  4PV1 B;  4MN4 C;  3GMA A;  3LW5 J;  4BXL A;  4D6T D;  3HE4 B;  4I1L A;  3R2P A;  4KHX A;  1BCC E;  3L70 D;  3AE4 C;  1IFI A;  2Z5H A;  1H8A A;  2W6J H;  1JNM A;  1JO5 A;  3T97 B;  3UIA A;  5GTH H;  4UB8 H;  3G6E P;  4IFF A;  3CX5 H;  3B5N C;  1SQQ D;  3U1A A;  2C0X A;  2OYH B;  2K1A A;  3L72 J;  3GHG B;  1JM0 A;  1LT9 C;  3HE4 A;  2ZFC A;  3CWB J;  2FYN C;  3JSV C;  1YHQ P;  3FX0 A;  2AXC A;  4EOT A;  4ZKP A;  5AW2 B;  2IDB A;  1OVR A;  3L72 G;  2BCC G;  2IX7 C;  3HD7 B;  2JWA A;  1SQP K;  3PHL A;  4K3A A;  3CWB G;  3T97 A;  1DH3 A;  1DD4 A;  2QM8 A;  3ABV C;  3B4S A;  1HUC A;  3MD0 A;  2OAR A;  4M3L A;  2AEF A;  1EDL A;  1L0N K;  1JMM A;  1VDF A;  1J1D B;  2OYH A;  2H8P D;  2OTL P;  5CCG A;  1KQS O;  3CPW O;  1SFC B;  5KAI E;  1MFT A;  1NYH A;  1EXJ A;  1FZA A;  4PD4 D;  1PGJ A;  1Q81 Q;  1PGP A;  1GW3 A;  2HG5 D;  3M0A A;  1BCC D;  1URQ D;  1M1J B;  1WT6 A;  3SFE C;  4A7P A;  3HE5 A;  2PGD A;  3CI9 A;  2KZI A;  1S2E A;  3F5H A;  3V6I A;  5KAF E;  1SLQ A;  3GF3 A;  1LTT C;  4D6T G;  2WPQ A;  1RE3 A;  2FFD C;  5H2F E;  2Q6Q A;  5B66 E;  1GL2 B;  2WQY C;  4OWF A;  5TIS E;  2IPP A;  1XTC C;  2R5B A;  4R4M A;  3TGU E;  2QRX A;  1MZ9 A;  5KLV E;  3L37 A;  1A02 J;  1YTZ I;  1SQQ G;  1M1J A;  3L75 E;  2E76 B;  1Q82 Q;  2FXM A;  1GD2 E;  1YIT P;  1VF5 B;  2OYI C;  1HF9 A;  1KIL A;  2KS1 B;  2LXB A;  2WPV B;  1EZV I;  1JTH B;  3KDP B;  2K9J B;  3S4R A;  4XE5 B;  2XV5 A;  3GW6 A;  1NTZ E;  2WSF H;  1L0L K;  3WU2 E;  2Y0D A;  3MTU E;  2YXQ B;  4OGQ C;  1CW5 A;  1IFN A;  4PV1 D;  1YJ9 P;  1M56 D;  1IK9 A;  3HRN A;  3RK2 C;  3SWK A;  5K5G B;  3TYY A;  2KP8 A;  3V2R A;  3VN0 A;  3CCV P;  2O3J A;  1HJ0 A;  3H1K J;  3A3Y B;  4LLH A;  4Z1M H;  4BWN A;  2VRS A;  1GZL A;  2YXR B;  1VQ9 P;  5GTH E;  1LP1 B;  4UB8 E;  1NOH A;  1SQX E;  1A02 F;  1FE6 A;  2K88 A;  3P7K A;  5E79 H;  3RBX A;  1UIX A;  1BCC G;  2M5A B;  3PJS K;  1AVO A;  3VTP C;  4JYC A;  1JOC A;  2XDJ A;  3TGU D;  3HD7 D;  3TK1 A;  5AVQ B;  1JY3 O;  1NAF A;  5KLV D;  3MZW B;  5APV A;  3RL0 D;  2WSE J;  2FYU E;  2JEE A;  3SWF A;  2Q7C A;  1H89 A;  3L75 D;  1DD3 A;  3PRJ A;  1BSH A;  2MJZ A;  1Q2N A;  3O8Z A;  1W2E A;  2M5A A;  2Q5U A;  2QVA A;  1LGH B;  1SFC D;  5APW A;  1Q7Y Q;  2C0W A;  1PV3 A;  2O01 N;  1VQ4 P;  1NTZ D;  2ZXX A;  4H44 C;  1SQB K;  3W68 A;  1EDJ A;  2CPB A;  2LKM A;  1U7M A;  3CC4 P;  1PPJ E;  2OYH C;  3I56 P;  1N86 A;  1T3J A;  5CCG C;  1NTK K;  1MFZ A;  1VPC A;  1JCC A;  4AUW A;  1PL5 A;  1QLE D;  2KXP B;  1SQV J;  3OA7 A;  4H13 C;  1BDD A;  3CWB E;  2P67 A;  4I7Z B;  1N73 A;  1GL2 D;  1P84 I;  2J59 M;  2WTY A;  3D70 A;  4ASW A;  5CHX A;  1VQ6 P;  3IR9 A;  1M1K Q;  3SWY A;  3ZDM A;  5AVS B;  4I2L C;  1SQX D;  1X9V A;  3D6Y A;  2WSE H;  4L75 A;  1J1D C;  1Y8A A;  2R3C A;  1NWQ A;  2L5G B;  1LNQ A;  3OJA B;  2QJK B;  4H0L C;  5EFW B;  1RE3 C;  3EQ2 A;  5KJ7 A;  2E76 D;  1K05 A;  2HYN A;  4RJT A;  4WY4 B;  3HTK A;  1OZH A;  3H1H J;  4OVN F;  2FYU D;  5AW1 B;  5AVV B;  1QX8 A;  2M8R A;  3L75 J;  1BGY D;  2BEQ D;  3EWK A;  4PJ0 E;  4C46 A;  1JY2 N;  5KLV G;  2B89 A;  1FC2 C;  5KAI H;  3GF7 A;  1FZC B;  2LXC B;  1WRG A;  2KSE A;  1NKN A;  3L75 G;  3MHV A;  3WUT A;  1KIL C;  3CCR P;  4L74 A;  3V2Q A;  1DEE G;  3KPE A;  1NVO A;  3AE8 C;  2GUS A;  1ZME C;  1PPJ D;  1K04 A;  1P84 H;  3L74 J;  2ZVN B;  1CI6 B;  1NTZ G;  3Q5P A;  3E1R A;  3G3Z A;  4Y99 B;  5BU5 A;  2KIK A;  3V2P A;  2Z5I A;  1PFI A;  3CWB D;  3CD6 P;  3FWL A;  1VF5 C;  5E79 E;  1YIJ P;  2KI7 B;  1SQX J;  2H43 A;  1VQ7 P;  1LWU A;  1J1E B;  2YIU B;  1JUN A;  3L71 D;  2M3B A;  1URQ A;  1CI6 A;  1HGZ A;  3H1J J;  1N7S B;  2CK3 H;  1EZV E;  1SQX G;  4IL6 X;  5DJU B;  2YMY A;  3H1J G;  3AE2 C;  2KSJ A;  1Q86 Q;  1IO4 A;  5AW7 B;  4NPD A;  5AVU B;  2A06 E;  1BGY J;  3RGU A;  1W5C E;  3H1K E;  2JO1 A;  2ZT9 C;  4RO0 A;  4IFD K;  1E79 H;  2FYU G;  1KFM A;  1LTG C;  2PAJ A;  1IZN B;  1BGY G;  1OVV A;  2QJP B;  5KJ7 D;  5C39 A;  3EFG A;  2QA4 P;  3U59 A;  1AQ5 A;  1DEB A;  1QVG O;  1M8O B;  4WBA A;  2KLU A;  1T2K C;  5AVW B;  2Y0C A;  2RKL A;  3GG2 A;  3G71 P;  1GMJ A;  1L0N D;  1YBK A;  1PZQ A;  2PRR A;  1LTJ B;  1SVF A;  2E5Y A;  1PPJ G;  3AE9 C;  4WWI A;  1UII A;  3HUS B;  1NU1 E;  5APQ A;  3M06 A;  1FZE A;  5CBN A;  2WPS A;  1N7L A;  2A45 I;  2E74 B;  1EC5 A;  1G2C B;  4DCK A;  1N73 C;  2AEJ A;  4WY4 D;  2G3A A;  4GT1 A;  3L71 J;  2HFE D;  3JC2 2;  3RL0 B;  4DJG A;  2RH0 A;  1EZV D;  3VOP A;  4GIF A;  2E75 D;  3AE1 C;  1R5S A;  1VL2 A;  4WB4 A;  4YXD C;  3VYI A;  3V4W A;  1LTJ A;  2A45 G;  3GHG A;  3H1L E;  3LIE A;  3B8E B;  3VP8 A;  1SQQ K;  3L71 G;  3HUS A;  1FZF A;  1G1I A;  2WSS H;  1USE A;  1SP4 A;  2JJL A;  1YQ3 C;  5KJ7 C;  4W80 A;  5APY A;  1FBM A;  2A06 D;  3HD7 A;  2W90 A;  1CSB A;  3QH9 A;  3E1I A;  1SQV E;  3S9O A;  4OH8 B;  3KZI E;  3H1K D;  2WSF J;  3RK3 D;  1KD1 Q;  1M7L A;  1JEK A;  3RBZ A;  3L73 E;  1RF1 C;  4U7J A;  3NTN A;  3IAO A;  1P84 E;  1Q90 D;  3FGA D;  5APS A;  3M0D A;  2QJY C;  1SFC A;  5B5E H;  5AVX B;  2NPS D;  4C7R A;  2A45 H;  3U1C A;  3OAK A;  1L0N J;  3ITK A;  1T6A A;  1IFP A;  2KNC B;  3CME P;  1K9M Q;  2WSC J;  1NU1 D;  3H1H E;  3TNU B;  2YO3 A;  2XNX A;  1KC8 Q;  1N7S D;  2D2C B;  1L0N G;  2XKM A;  4LGD E;  1YJW P;  1K73 Q;  1ZOY C;  2E42 A;  3O6Q B;  4AYC A;  3CCQ P;  2N9B A;  1GL2 A;  1K8A Q;  2B9B A;  1AQT A;  4PJ0 H;  3MUD C;  2IBZ E;  2K9Y A;  1LWU C;  2N1T B;  2H89 C;  3QWO C;  1JY3 P;  4EYY Q;  1H0T B;  2KNC A;  4IL6 H;  3H1L D;  1JY2 P;  2XND H;  1URQ C;  1NAY A;  1FS0 E;  4CPG A;  1NHL A;  3TNU A;  3L74 E;  1VQ5 P;  1ZN5 A;  4ZNC A;  1EZV G;  3K5B A;  4EI2 A;  3C1L A;  3BAS A;  3AEF C;  5AW4 B;  3P8M C;  3O6Q A;  1SQV D;  1L4A B;  3CLQ A;  1GU4 A;  2KS1 A;  2JDI H;  4YPC A;  1OW7 A;  1JTH A;  3L36 A;  1LTS C;  3VMA A;  5AVY B;  2K9J A;  1PGQ A;  2E43 A;  3KYQ A;  2R3S A;  3L73 D;  3PLN A;  2A06 G;  3A5T A;  1J1E C;  3H32 B;  2HR3 A;  1P84 D;  1H0T A;  5AW5 B;  2WSC H;  4QMA A;  3H1K G;  2B87 B;  1JMB A;  1KB9 E;  3CMA P;  3M9Q A;  5CCH D;  2ZJS E;  1EDK A;  4K35 A;  3H1J E;  2HOD B;  2E74 D;  3WMM 0;  1IJD B;  4GDO A;  3Q5S A;  1NTM E;  4JF7 A;  1L0L J;  4N3Y B;  3H1H D;  1NU1 J;  1CZQ A;  1SQB D;  1QGK B;  1NH4 A;  3N4X A;  4PV1 C;  1LP1 A;  1BGY E;  2O01 J;  1BDC A;  3B5N B;  1Z56 A;  3AEC C;  1FJK A;  1KQF B;  4B86 A;  1D7M A;  1NU1 G;  1AFO A;  1HTL C;  3CC2 P;  1LT9 B;  3TF5 A;  2FYN B;  2IBZ D;  3FXD A;  2YMK A;  2ZXE B;  2FXP A;  3H1L J;  1PP9 D;  3L35 A;  3L74 D;  1LTJ C;  3GHG C;  3BCC D;  5KLV K;  3H1L G;  3CCE P;  3H1I E;  3NXS A;  3HUS C;  1H88 A;  3CL3 D;  4JPZ B;  2W8Z A;  4U3F E;  3IFM A;  1LT9 A;  3HD7 C;  1HBW A;  4JQ0 D;  3CCU P;  2KOG A;  3L73 J;  5B5E E;  1SQV G;  5KTB A;  3RL0 C;  2Y9Y A;  4BRY B;  1AVY A;  2E5T A;  1KB9 D;  1NTZ K;  1IFD A;  2GA1 A;  3L71 E;  2O01 H;  3L73 G;  3H1J D;  2JKV A;  4HH2 A;  2D2C D;  3M0D C;  5AW0 B;  1BE3 D;  2OTK E;  1SFC C;  1LTA C;  2ZYG A;  3C8V A;  2IZ0 A;  1NTM D;  3PP5 A;  1RQU A;  3MIW A;  1RE4 A;  4YXW H;  1SQB J;  4C7N B;  2R44 A;  4DT0 A;  4EIJ A;  2E75 B;  2N1T D;  4EDF A;  1JY3 N;  1ZLL A;  2WT7 B;  4YTP C;  4BRY A;  1NTK J;  5APX A;  2YKQ A;  1M1J C;  2HLO A;  3H1H G;  1SQB G;  4IL6 E;  1SQX K;  2IBZ I;  1ZW0 A;  2KLV A;  1R8E A;  3G9R A;  1U57 A;  3KZI H;  2IYO A;  1JB0 J;  2PFX A;  1AV1 A;  1GL2 C;  2J5U A;  2GUV A;  4WY4 A;  1PP9 J;  1L4A D;  2YKO A;  3RK3 B;  4UB6 H;  4C7N A;  1SQP E;  3SFD C;  2IBZ G;  2AEM A;  1KMI Z;  2JWD A;  3BCC J;  1N8R Q;  2P7J A;  3H1I D;  1L0N E;  2WT7 A;  1PP9 G;  2YNY A;  3JCU E;  2Z4E A;  1KZU B;  2FYU K;  2KB7 P;  1ZP0 C;  2V7Q J;  5KKZ B;  3L74 G;  4U3F D;  1FZC A;  2E76 C;  4OGQ B;  2W27 A;  1LTI C;  3A2A A;  1VQO P;  2NPS B;  2BEZ F;  3BCC G;  4HJG H;  1FJP A;  3AEA C;  3KHU A;  3RK2 B;  1FDM A;  3AEE C;  1KB9 I;  3I55 P;  3BVH A;  2GM4 A;  2OYO A;  1OWA A;  2FYZ A;  2K3R A;  2KK7 A;  1GK4 A;  1Y9B A;  1ZR2 A;  4L76 A;  1NGM B;  1OIP A;  4I6M C;  2C9L Y;  1FDI A;  2JR8 A;  2YO2 A;  1BE3 J;  1HVV A;  3KQG A;  3B5N D;  3TSI A;  3BRT B;  5GTI H;  1NTM J;  2I1K A;  4W7Z A;  2NPS A;  1YTZ T;  3A0H H;  4WVZ A;  5BU8 B;  1L2P A;  2H7H A;  3N7N A;  1FAV A;  1BE3 G;  1RH5 B;  3R4Y A;  1NTM G;  2OTJ P;  1AJY A;  2CPS A;  3RK3 E;  1KYO I;  1WMK A;  1N7S A;  2N9Y B;  5BVZ A;  3BRV B;  3WUU A;  2V7Q H;  1GW4 A;  3NFQ A;  2OGU A;  1OFC X;  1HJB A;  1MV8 A;  4HB1 A;  1J2J B;  1SQP D;  1VQM P;  2YKP A;  1S5L H;  1S4X A;  2KUB A;  1FDO A;  3CCM P;  2V4H A;  3H1I J;  1KB9 H;  3Q2Y A;  3IF4 A;  3CCJ P;  5AVT B;  1M57 D;  4H44 B;  1L0L E;  4U3F J;  5CMZ A;  3CXH I;  1FOS E;  3CCS P;  4R4L A;  1AA0 A;  3H1I G;  1KQG B;  2BCC J;  1FU1 A;  2Y0E A;  4U3F G;  1T3U A;  4KT0 J;  2WZ7 A;  1S9K D;  1IK7 A;  1ZRT E;  2QEX P;  4H13 B;  1NKZ B;  3P8C E;  3WUV A;  1GU5 A;  2P2U A;  2SPZ A;  2PP6 A;  2Y9Z A;  1ZV8 A;  1KYO H;  5CCH A;  2WVR A;  3A0B H;  4IFM A;  3LW5 H;  2B88 A;  2FBW C;  3HE5 B;  4RES B;  3Q5R A;  1G2C A;  1ZXG A;  2AXT H;  3VMY A;  4I7Z C;  3C9I A;  1RE4 C;  4H0L B;  1PIX A;  2QSI A;  3BAT A;  4N78 E;  1QL1 A;  4GOD A;  4UB6 E;  5AVZ B;  2IFM A;  1TU3 F;  2DW3 A;  2QM7 A;  3M9B A;  4D6T J;  2QJK C;  1OVU A;  5DJT B;  2J58 A;  1RF0 A;  2P10 A;  3CXH H;  3V5B A;  1X0T A;  1SQP J;  4OGQ D;  4DOJ A;  3L70 J;  2H88 C;  3SSU A;  4WY4 C;  3RK2 D;  1OX3 A;  3M9H A;  1KIL B;  3TDK A;  4XA4 A;  1SQP G;  1L0L D;  3Q1M A;  2E75 C;  4O9B A;  1BSN A;  1RHZ B;  3L70 G;  1SQB E;  2M0B A;  2LR2 A;  1SQQ J;  2ZYD A;  3RL0 g;  1OMI A;  2OQQ A;  2O1K A;  1FZC C;  1QVF O;  3VP9 A;  1NTK E;  3M91 A;  3I5C A;  5AW8 B;  2BAS A;  1USD A;  1ZRT D;  4GOE A;  5GTI E;  1EQ7 A;  2XU6 A;  1X8Y A;  3P8C D;  1DX7 A;  3RK3 C;  5APT A;  3A0H E;  1PP9 E;  5AVR B;  1M90 Q;  2ZYA A;  2M3E A;  3G4S P;  3AEG C;  4Y99 C;  3D6Z A;  1VQ8 P;  3S1K A;  4ASV A;  3BCC E;  3AEB C;  5KKZ C;  1NU1 K;  1KQL A;  5KLI B;  1ZR4 A;  2NPS C;  1HGV A;  2QIW A;  4ZMD A;  4N78 D;  3MP7 B;  2POH A;  1VQL P;  3JCU H;  5L8R J;  2MKV A;  4PD4 I;  2N1T A;  5TJH A;  1N2D C;  1NJI Q;  2JP3 A;  2YIU C;  4GOF A;  1NO4 A;  1S5L E;  1N7S C;  3LID A;  1KIL E;  3H25 A;  4H44 D;  1BCC J;  2L91 A;  1Y47 A;  2ZT9 B;  3USS A;  3CX5 E;  1BE3 E;  1L4A A;  1R5L A;  1S3J A;  1QL2 A;  5CCG D;  1GK6 A;  3PH0 A;  4DZO A;  5CJ0 A;  1LJ2 A;  3P32 A;  2FKW B;  1OW8 A;  1SQV K;  4H13 D;  1S1C X;  4Y28 J;  3H32 A;  2IZ1 A;  2NRG A;  2ZAE B;  1KV4 A;  3V2N A;  2B87 A;  1NTK D;  2KYV A;  1L0L G;  2HPC B;  1JY2 O;  1FZB A;  1MUU A;  2QJP C;  3FXE A;  2W6B A;  3AE5 C;  2HOD A;  3II6 A;  1KYO E;  4AQR D;  2Q3E A;  3W67 A;  3A0B E;  1X79 B;  3Q3D A;  3KXD A;  4HKZ H;  4H0L D;  2K37 A;  4W7Y A;  3GLM A;  2AXT E;  5CBO A;  3E7K A;  1N73 B;  1S5L X;  1SS1 A;  2Q3I A;  4PD4 H;  1YI2 P;  3NMD A;  4RKU J;  4XFJ A;  1IFJ A;  3B5N A;  5CCH C;  1KFN A;  4GKG A;  2HPC A;  4NPF X;  5AW6 B;  2E74 C;  5CJ4 A;  2QG4 A;  2ZVO B;  2I1J A;  4N6J A;  1LT1 A;  1KN7 A;  3CXH E;  3L72 E;  1IFM A;  2BCC E;  1FZG A;  3AE3 C;  1FOS F;  3HTK B;  1KIL D;  3L4F A;  4JBZ A;  2IYP A;  2FXO A;  3VMZ A;  1GTW A;  4NPE A;  3H6P A;  2Q9I A;  1S72 P;  2WMM A;  1JCD A;  3CX5 D;  1RF0 C;  4KJM A;  1RF1 B;  2P58 A;  2IFN A;  3CCL P;  2I8D A;  4TLF A;  2FFD B;  1DIP A;  2G8Y A;  2Q1K A;  3TGU J;  1QEX A;  2QJY B;  2WWW A;  1W2B O;  1OXZ A;  2XZR A;  1VF5 D;  2QE7 H;  5KLV J;  2ITA A;  2WPR A;  3TGU G;  2P1J A;  1HH0 A;  1KYO D;  2RMZ A;  1RQV A;  4JYB A;  1NTK G;  1RF1 A;  1IC2 A;  2RN0 A;  1PGO A;  1VQK P;  4D6T E;  2W6A A;  1HWT C;  3VMX A;  5AW9 B;  3AE7 C;  3IN6 A;  2FFD A;  2OYI B;  1RY3 A;  3L70 E;  2FY8 A;  4LC1 A;  1NTM K;  1NTZ J;  2C9N Y;  2R32 A;  1KOR A;  1LWU B;  2D2C C;  3MGN A; 
#chains in the Genus database with same CATH homology
 5H2F E;  5B66 E;  4IL6 E;  5GTH E;  5TIS E;  4UB8 E;  5GTI E;  5E79 E;  1W5C E;  3WU2 E;  2AXT E;  5KAI E;  1S5L E;  3A0H E;  3JCU E;  4UB6 E;  4PJ0 E;  5KAF E;  5B5E E;  3A0B E;  3KZI E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...