5H2FE

Crystal structure of the psbm-deletion mutant of photosystem ii
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
TGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual relationships between structural and functional changes in a PsbM-deletion mutant of photosystem II.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 20
structure length 79
sequence length 79
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5h2fE00
3A0BE 4UB8E 4UB6E 5TISE 3A0HE 4IL6E 5B5EE 3WU2E 5GTHE 4PJ0E 5B66E 3JCUE 1W5CE 5KAIE 1S5LE 5GTIE 5KAFE 3KZIE 5E79E 5H2FE 2AXTE
chains in the Genus database with same CATH superfamily
3M0DA 1VQ5P 1ZRTE 1AQ5A 1XTGB 1K05A 2H7HA 3MD0A 1AA0A 3MGNA 3VP8A 2POHA 4LC1A 1BGYE 2BASA 1SQPJ 1KILA 2FXOA 3AEEC 3KQGA 4C7RA 1YJWP 3EQ2A 2OYIB 2ZXEB 1NWQA 2OYIC 1MV8A 1QVFO 1BDCA 3AEDC 1SQQJ 3GHGC 4PD4D 4XE5B 4PD4H 1M56D 3D71A 1S9KD 3AEAC 4DCKA 1HTLC 1X22A 5BVZA 5GTIH 3Q5SA 5CCHD 1N73B 3IAOA 4KJMA 1USEA 3GHGA 1SFCB 3F89A 5CMZA 3V2NA 1X9VA 2W8ZA 2M8RA 4C7NA 4WY4D 4ZMDA 1GK6A 5APTA 1W5CE 1Z56A 3L4FA 3L73G 3AEFC 2QEXP 3H1HG 3CXHE 2FXPA 4OGQC 4CPGA 1URQA 3F5HA 5B66H 2B87B 2KS1B 2HODA 4NPFX 1KB9E 3AEBC 2RMZA 1S5LX 3H1ID 3H32B 1GK4A 2ZVNB 2QJPC 3CXHI 3M0DC 1KD1Q 1EDKA 2DW3A 2KUBA 1EZVD 3S9OA 2P7JA 1KILC 1FAVA 1M7LA 2QRXA 2ZVOB 1VQMP 1M1JA 5E79H 2MKVA 3AE6C 5TISE 3HTKA 2JP3A 4EDFA 1SLQA 1SQQG 3NXSA 1SQXG 1JOCA 2QJKC 1JB0J 1FDOA 2B87A 2KS1A 2A45H 3H1JD 4HB1A 1OXZA 3RK2B 4ASVA 2D2CB 1W2EA 5APSA 5GTHE 4H13C 1YTZT 1JY3N 2RN0A 1M90Q 1JUNA 4HYTB 3WUVA 2YKOA 3H1KE 2XNDH 2KSJA 1BCCD 3Q1MA 4IL6X 2R5DA 1SQBD 2E5YA 4JPZB 5DJUB 1NTME 1QLED 1KQLA 3JCUE 3OA7A 2IZ0A 3II6A 5AVWB 1OZHA 4C7NB 2RKLA 5L8RJ 1VQLP 5GTIE 4WVZA 2O1JA 3WU2H 2C0XA 2W6AA 3O6QB 3B4SA 3RL0D 1KN7A 1QGKB 4A7PA 2C0WA 2QA4P 3CX5I 3IR9A 5KJ7A 1DD4A 3VMZA 1GU4A 4L73A 1LT1A 4JYBA 2N1TA 1SQPG 5KLIC 4H13D 2IDBA 3AE5C 2QM8A 3PRJA 2N1TC 3H1LJ 1SQXK 2LR2A 4IFMA 3CCVP 1M1JB 3A0HE 3TGUE 2JWDA 2HODB 1G1IA 1BE3J 1DEBA 1SS1A 4I1LA 2JO1A 3CCJP 1L4AC 4OWFA 4EOTA 1L4AB 2XV5A 3E7KA 3G71P 2WPSA 4AQRD 2FFDB 3HD7A 3CXHD 4Z1MH 5TISH 1WRGA 4GIFA 3GF3A 4O9BA 3W68A 3AE2C 3H1IG 3E1IA 1HJBA 5GTHH 1RE3C 2KK7A 1PPJE 4OVNF 1VDFA 2GA1A 5AVQB 2J58A 3PLNA 1HBWA 2WVRA 1S4XA 1N86A 1OFCX 3NFQA 1LWUA 3JCUH 2W90A 3H1JG 2WT7A 1LP1A 1SQVE 2FYUE 3L70J 1KORA 5APYA 2ZJSE 1KQFB 5KTBA 1LT9A 4WY4A 1L0LG 1NTZK 3CMAP 1HGZA 2R44A 4EIJA 1UIXA 1Q86Q 1L0NE 1N7SD 1SQBG 2NPSC 4IFFA 2AEFA 1L0NJ 4WB4A 2ZT9C 1S72P 2Q6QA 2VRSA 4M3LA 2OYHB 5CJ4A 1GL2A 1NTKD 1J1EC 2E74D 3CX5D 1NU1G 2M3BA 3KPEA 1SQVJ 4TLFA 3MIWA 4BRYA 1JMBA 2QJKB 1RH5B 3A0HH 3HD7B 1NTMJ 2WTYA 3Q5PA 4I2LC 1T3UA 3V2RA 2Y0DA 5AW5B 2OQQA 1YJNP 2G8YA 2B88A 1PIXA 2WSEH 2L91A 4N6JA 5E79E 2R3SA 4K35A 5CJ0A 3IFMA 1OWAA 3PHLA 4W7ZA 3CCMP 2WPQA 1X79B 3N4XA 4RJTA 2E74C 1SQPE 1LTSC 1IC2A 3L75J 1JY2P 2YO2A 2CK3H 3RBZA 3W67A 1JY3O 3LW5H 3CI9A 1LNQA 1NTMD 2IBZG 4DT0A 2LXBA 2N9YB 2WSFJ 3M06A 3BVHA 2QSIA 2Y0CA 2CPSA 2XU6A 1EZVG 1TU3F 3L71J 5AVVB 1HH0A 2MJZA 3TK1A 3WU2E 3CL3D 1JY2N 1P84I 5AW8B 1S5LH 2AEMA 1IFMA 2KB7P 1SQXD 5CCGD 1HGVA 3FGAD 1JCDA 1JTHB 1ZV8A 1DIPA 3AE1C 4IL6H 4U7JA 2OTLP 1KC8Q 2QVAA 4I7ZB 1BSHA 2ZFCA 1FZAA 2AEJA 1PP9J 4H0LC 1HUCA 1KYOI 2WZ7A 1MZ9A 2IYOA 2YXRB 4LGDE 1ZN5A 2AXTE 3HE5A 4Y99B 1Q81Q 3EWKA 2L5GB 3SFDC 2QJYB 5K5GB 1M1JC 2W6BA 5CBNA 1AJYA 1OW7A 3L72E 3WUUA 2LXCB 4XFJA 1FJPA 4I6MC 5H2FH 1PGQA 3V2QA 1W2BO 2JEEA 2OYIA 4WWIA 1A02J 1SQPD 2QJYC 1PFIA 1VQ6P 2Q3EA 1H8AA 2OGUA 2P67A 4JYCA 1NKNA 2C9LY 1EDLA 1GZLA 2YXQB 2W83C 3NTNA 4WBAA 5TJHA 1AVYA 3WUTA 2NPSA 3RK3C 4RO0A 1QEXA 1BE3D 4D6TD 5AVXB 3QWOC 4W80A 5KAIE 1JEKA 2XZRA 4LLHA 1VQ7P 3CC7P 2J59M 2B89A 3BCCE 5KLIB 1PPJG 3FWLA 3BCCJ 1NTMG 2IBZD 4UB6H 2FYNB 1JMMA 4IFDK 4Y99C 1ZR2A 5CCHC 1FU1A 2KZIA 2Y0EA 3MUDA 1BSNA 4H0LB 5CHXA 1M57D 3H32A 1G2CB 3HD7D 2FYUK 3RL0g 3M9QA 1DEEG 4H44D 1NU1K 1SQBJ 2E74B 1HWTC 5AW2B 1USDA 4ZKUA 1HF9A 3SSUA 1L0LD 3L74J 4DZOA 4PJ0E 3CD6P 3Q5RA 2O1KA 1AFOA 1OVVA 1IK7A 3H1JJ 1FDMA 1RE3A 1J2JB 1L0LK 1QX8A 3RBXA 2ZYGA 1JNMA 2R32A 3HUSA 1NTKG 1NTZD 2OARA 1NU1D 2FKWB 1NU1J 2BCCE 1S5LE 3AE8C 1KILB 1KQSO 4GKGA 3L73E 1KV4A 1CZQA 1URQD 4ZKPA 3M9BA 3TYYA 3PJSK 2WSSH 1BGYD 3B8EB 2BEZF 4PV1D 1PV3A 1IFNA 1KB9I 2HFED 1L0LE 2YMKA 5CCGC 1L0LJ 3L74D 3CCLP 3L72J 1RE4C 1VL2A 3L72G 1DD3A 3P8CE 1UIIA 2AXTH 1Q2NA 1IFPA 2LKMA 3JC22 3BATA 4UB6E 3USSA 3O8ZA 5AW4B 4BXLA 4IL6E 1U7MA 1KTMA 2M5AB 2PRRA 3K5BA 1CSBA 1MFZA 2IBZI 2JKVA 4N78D 5KAFH 3CPWO 1N73C 1K8AQ 1WMKA 2OYHC 2KSEA 1NYHA 1ZLLA 3BCCD 1L2PA 2Y9ZA 1NJIQ 3VYIA 2KYVA 3L37A 1T6AA 3HE4B 2Q3IA 3SWFA 1U57A 1T2KD 3A0BH 1LTTC 3D70A 1SQBE 4U3FG 5AW0B 3VTPC 5H2FE 2UWJE 3LIDA 4D6TJ 4KT0J 1IJDB 1X8YA 3B5NA 5KAIH 2I1KA 3H1LG 4N78E 5CCGA 3B5ND 3M91A 3U1AA 3H1JE 3KHUA 5B5EH 1EQ7A 1FS0E 1KFMA 1LTGC 1PL5A 5DJTB 2A06G 1H89A 2V4HA 4EYYQ 3CCRP 1HJ0A 1G1JA 3MHVA 1OX3A 2R3CA 3H1KD 4U3FE 1DX7A 4U3FJ 3SFEC 1NTZG 1R5LA 4NPEA 5KLVG 1FZFA 2WSFH 2W27A 1SQQK 1CI6B 3H1IE 4YXDC 1FE6A 1KB9D 1QL2A 1SFCD 2B9BA 3AE7C 4H0LD 4RKUJ 1BGYG 2FBWC 1KILD 4AUWA 1IFDA 1VQNP 3VOPA 1WT6A 3EFFK 2N1TB 1QL1A 2QIWA 3O6QA 1PZQA 1BE3G 1MUUA 1RHZB 2HR3A 2KNCB 2R5BA 5KAFE 4D6TG 3L72D 2GUVA 1VF5D 3T97B 1DH3A 2E75B 3CCUP 4GOFA 3G9RA 1IO4A 1KQGB 1N7SB 1SFCA 3ITKA 2SPZA 1NHLA 5APWA 1EXJA 1PPJD 2H89C 3L71D 1S9KE 2WPRA 2OTKE 1SQVG 5M1BA 3TDKA 4I7ZC 1AV1A 3CWBJ 4GT1A 1A02F 1U7JA 3UIAA 3BCCG 1PP9E 4GOEA 1T8ZA 1L0NG 1RQVA 1FJKA 2I8DA 2KI7B 2WWWA 2YKPA 3B5NC 4GDOA 4KHXA 1YBKA 5KLVK 1K9MQ 1N8RQ 2P10A 2BCCG 1GDTA 1Q90D 1SQPK 2YIUC 3GLMA 3V4WA 3MUDC 2D2CC 5AVUB 1YQ4C 1IFJA 2E43A 1Y8AA 1YTZI 4HJGH 1MFTA 1HVVA 4U3FD 3RK2C 3D6YA 2ZXXA 3M0AA 2WSEJ 3VMAA 3FXDA 4L74A 2JR8A 3CX5H 3HD7C 4YPCA 1H88A 2HPCA 1OVUA 2V7QH 3FXEA 2WITA 4PD4I 1H0TA 1OW8A 2E76D 2FYUD 2QJPB 2ZAEB 4BWNA 1NAYA 4D6TE 2XNXA 3ZDMA 3H1KG 2ZT9B 5BU8B 3L75E 1LP1B 1N2DC 4IOIH 4PD4E 5AW6B 3RGUA 2D2CD 3A0BE 5KLVD 3C9IA 1VQ4P 1GTWA 2Q1KA 1RF1B 1IFIA 4BRYB 3T97A 3FWNA 3U1CA 1L0NK 3L74G 4TT3H 1URQB 3QH9A 1NU1E 2BCCJ 3GW6A 3L71E 3L70D 3CLQA 1NTZE 3L73J 5APXA 3HUSC 2WPVB 2M0BA 2KLVA 1SQVK 2K9JB 2C9NY 3RL0B 1J1EB 2KLUA 2V7QJ 3C1LA 3IN6A 1GW4A 1VPCA 1GL2C 4PV1C 3CXHH 1M1KQ 3BRTB 1RF1A 2NPSB 2Z5HA 1RF0A 3R2PA 4DJGA 1EXIA 4C46A 1KB9H 3P8CD 3WMM0 2JWAA 1EC5A 3L71G 2HYNA 3NMDA 4L75A 2FFDC 1NVOA 1PGJA 3A5TA 1NTKE 1P84D 1LJ2A 1XTCC 4R4MA 4B86A 1H0TB 3IF4A 1Q7YQ 2OYHA 1VQPP 1VQ8P 1PP9D 2A45G 1FZCB 4QMAA 2YO3A 4GODA 1J1DC 2BCCD 2WMMA 2E76C 3H1LD 3TSIA 5AW9B 1G2CA 1KZUB 3GG2A 1SQXE 5AW7B 3U59A 1FZGA 2A06D 2YNYA 2KOGA 1SQXJ 5KLVJ 3GMAA 1N73A 5KLVE 1YIJP 1KFNA 4JQ0D 1Y9BA 2FYUJ 2IFNA 2N1TD 3L35A 2FYUG 3L70E 3PP5A 2K9YA 1NO4A 2AXCA 4WY4B 5APQA 3CWBE 3B71A 2Q7CA 2K1AA 4EI2A 3TGUD 1VQ9P 1JO5A 1NGMB 5AVZB 1KMIZ 1IK9A 1R5SA 3H1LE 3L75D 4JF7A 5AW1B 2K9JA 5AW3B 1N7SA 3H1HE 1LTAC 1NTMK 1OMIA 1KYOE 1S2EA 1S3JA 2P58A 1LTBC 3AE3C 3AEGC 3MTUE 3CX5E 1N7SC 2JDIH 2NPSD 1EDIA 3AE9C 1VQKP 2E75C 1LWUB 1SP4A 5APVA 3I5CA 1T2KC 1FZCA 1LTJB 2WT7B 3BRVB 1YI2P 3CWBD 3D6ZA 1Q82Q 1LT9B 3TGUJ 1NKZB 2OTJP 3V5BA 2N9BA 1SQVD 2H8PD 1FZEA 4N3YB 1NTKJ 3CCEP 4H13B 2E42A 1VF5C 1L0ND 3KZIH 2HPCB 1PGPA 4Y28J 3AECC 1PGOA 2QG4A 1FBMA 2PAJA 2WSCH 4PJ0H 3OW2O 1ZP0C 2E76B 1GD2E 3OAKA 3N7NA 3PTZA 4K3AA 4L76A 3VMXA 3I56P 3R4YA 1EZVE 2I1JA 1GL2B 1J1DB 1E5WA 1L4AD 1RF0C 1SFCC 2O01H 2FYZA 2Z5IA 3E1RA 3OJAB 1NTKK 2HG5D 4DOJA 2J5UA 1GL2D 3C8VA 3H6PA 3TNUA 5BU5A 1R8EA 2Q5UA 3TF5A 2PGDA 1S1CX 3P8MC 4OGQB 4UB8E 1K73Q 1URQC 5C39A 5CBOA 1YHQP 2HLOA 3PH0A 4XA4A 2IYPA 1RF1C 2IFMA 2KP8A 2YMYA 1KYOH 1GMJA 2JJLA 2OYOA 2YKQA 2P1JA 2W6JH 4NPDA 2BEQD 2IX7C 2PFXA 1ZMEC 1FC2C 4PV1B 3V6IA 1L4AA 2O3JA 1LTIC 1MKMA 1P84E 3LIEA 2G3AA 2M3EA 1BDDA 3RK3E 3RL0C 3S4RA 3L75G 3AE4C 1Y47A 2E5TA 3L70G 3L73D 3HUSB 3CCQP 3HRNA 2NRGA 1GU5A 3H1HD 4H44C 2PP6A 3GHGB 2IZ1A 1JTHA 1NH4A 1FOSE 2E75D 1LGHB 3Q3DA 5APUA 4MN4C 1SQQE 5KKZC 3KXDA 3G6EP 1VF5B 1VQOP 1BCCE 3VMYA 1K04A 2YIUB 3JSVC 2Y9YA 4ASWA 3L36A 2ZYDA 3RK2D 1GW3A 3G4SP 2P2UA 5KJ7D 3VN0A 2FY8A 2KIKA 1QVGO 4OH8B 2Z4EA 1LT9C 1JM0A 5AVTB 3V4QA 4HKZH 2ZYAA 1RQUA 1YYCA 1AQTA 1PP9G 1YITP 5AVSB 1YQ3C 3CC4P 1M8OB 1BCCJ 1LWUC 2ITAA 3LW5J 1BCCG 5B5EE 3SWKA 1KYOD 1RE4A 2IPPA 1SQBK 2IBZE 3L74E 4OGQD 1YJ9P 1ZR4A 5CCHA 1BGYJ 2QE7H 3B5NB 3P7KA 2XDJA 5AVYB 1ZXGA 3KYQA 4ZNCA 2Q9IA 3MP7B 4AYCA 3V2PA 2GM4A 1NAFA 3KDPB 2CPBA 1NTZJ 1BE3E 1LTJC 1OIPA 3SWYA 3A2AA 1OVRA 1SVFA 3EFGA 3KZIE 3TGUG 3I55P 1X0TA 3H1IJ 2WSCJ 2KXPB 2RH0A 2K37A 4RESB 4YXWH 4JBZA 1LTJA 2FYNC 2O01J 1JY3P 2ZT9D 1CI6A 2K3RA 1JCCA 1JY2O 1IZNB 4R4LA 3FX0A 1FDIA 1CW5A 3G3ZA 3H25A 1N7LA 3HE4A 3A7OA 1ZW0A 1KILE 4HH2A 1D7MA 1OW6A 3VP9A 4WY4C 5AVRB 4YTPC 2QM7A 4UB8H 5KJ7C 3A3YB 3RK3B 3CWBG 1ZRTD 2GUSA 2H43A 2NZ2A 2WQYC 2KZJA 3CMEP 1RY3A 2O01N 3M9HA 5B66E 4W7YA 5KKZB 1AVOA 3BASA 1EZVI 3ABVC 1SQQD 3H1KJ 3S1KA 2H88C 1FOSF 2A06E 2KNCA 1P84H 1FZBA 3Q2YA 2FFDA 1ZOYC 1T3JA 4H44B 2K88A 3CC2P 2M5AA 2FXMA 2A45I 3H1HJ 5EFWB 3HE5B 3CCSP 3HTKB 1E79H 3TNUB 3GF7A 3P32A 1FZCC 1NOHA 3RK3D 3MZWB 1EDJA 2XKMA
chains in the Genus database with same CATH topology
3A0BE 4UB8E 4UB6E 5TISE 3A0HE 4IL6E 5B5EE 3WU2E 5GTHE 4PJ0E 5B66E 3JCUE 1W5CE 5KAIE 1S5LE 5GTIE 5KAFE 3KZIE 5E79E 5H2FE 2AXTE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B E;  4UB8 E;  4UB6 E;  5TIS E;  3A0H E;  4IL6 E;  5B5E E;  3WU2 E;  5GTH E;  4PJ0 E;  5B66 E;  3JCU E;  1W5C E;  5KAI E;  1S5L E;  5GTI E;  5KAF E;  3KZI E;  5E79 E;  5H2F E;  2AXT E; 
#chains in the Genus database with same CATH topology
 3M0D A;  1VQ5 P;  1ZRT E;  1AQ5 A;  1XTG B;  1K05 A;  2H7H A;  3MD0 A;  1AA0 A;  3MGN A;  3VP8 A;  2POH A;  4LC1 A;  1BGY E;  2BAS A;  1SQP J;  1KIL A;  2FXO A;  3AEE C;  3KQG A;  4C7R A;  1YJW P;  3EQ2 A;  2OYI B;  2ZXE B;  1NWQ A;  2OYI C;  1MV8 A;  1QVF O;  1BDC A;  3AED C;  1SQQ J;  3GHG C;  4PD4 D;  4XE5 B;  4PD4 H;  1M56 D;  3D71 A;  1S9K D;  3AEA C;  4DCK A;  1HTL C;  1X22 A;  5BVZ A;  5GTI H;  3Q5S A;  5CCH D;  1N73 B;  3IAO A;  4KJM A;  1USE A;  3GHG A;  1SFC B;  3F89 A;  5CMZ A;  3V2N A;  1X9V A;  2W8Z A;  2M8R A;  4C7N A;  4WY4 D;  4ZMD A;  1GK6 A;  5APT A;  1W5C E;  1Z56 A;  3L4F A;  3L73 G;  3AEF C;  2QEX P;  3H1H G;  3CXH E;  2FXP A;  4OGQ C;  4CPG A;  1URQ A;  3F5H A;  5B66 H;  2B87 B;  2KS1 B;  2HOD A;  4NPF X;  1KB9 E;  3AEB C;  2RMZ A;  1S5L X;  3H1I D;  3H32 B;  1GK4 A;  2ZVN B;  2QJP C;  3CXH I;  3M0D C;  1KD1 Q;  1EDK A;  2DW3 A;  2KUB A;  1EZV D;  3S9O A;  2P7J A;  1KIL C;  1FAV A;  1M7L A;  2QRX A;  2ZVO B;  1VQM P;  1M1J A;  5E79 H;  2MKV A;  3AE6 C;  5TIS E;  3HTK A;  2JP3 A;  4EDF A;  1SLQ A;  1SQQ G;  3NXS A;  1SQX G;  1JOC A;  2QJK C;  1JB0 J;  1FDO A;  2B87 A;  2KS1 A;  2A45 H;  3H1J D;  4HB1 A;  1OXZ A;  3RK2 B;  4ASV A;  2D2C B;  1W2E A;  5APS A;  5GTH E;  4H13 C;  1YTZ T;  1JY3 N;  2RN0 A;  1M90 Q;  1JUN A;  4HYT B;  3WUV A;  2YKO A;  3H1K E;  2XND H;  2KSJ A;  1BCC D;  3Q1M A;  4IL6 X;  2R5D A;  1SQB D;  2E5Y A;  4JPZ B;  5DJU B;  1NTM E;  1QLE D;  1KQL A;  3JCU E;  3OA7 A;  2IZ0 A;  3II6 A;  5AVW B;  1OZH A;  4C7N B;  2RKL A;  5L8R J;  1VQL P;  5GTI E;  4WVZ A;  2O1J A;  3WU2 H;  2C0X A;  2W6A A;  3O6Q B;  3B4S A;  3RL0 D;  1KN7 A;  1QGK B;  4A7P A;  2C0W A;  2QA4 P;  3CX5 I;  3IR9 A;  5KJ7 A;  1DD4 A;  3VMZ A;  1GU4 A;  4L73 A;  1LT1 A;  4JYB A;  2N1T A;  1SQP G;  5KLI C;  4H13 D;  2IDB A;  3AE5 C;  2QM8 A;  3PRJ A;  2N1T C;  3H1L J;  1SQX K;  2LR2 A;  4IFM A;  3CCV P;  1M1J B;  3A0H E;  3TGU E;  2JWD A;  2HOD B;  1G1I A;  1BE3 J;  1DEB A;  1SS1 A;  4I1L A;  2JO1 A;  3CCJ P;  1L4A C;  4OWF A;  4EOT A;  1L4A B;  2XV5 A;  3E7K A;  3G71 P;  2WPS A;  4AQR D;  2FFD B;  3HD7 A;  3CXH D;  4Z1M H;  5TIS H;  1WRG A;  4GIF A;  3GF3 A;  4O9B A;  3W68 A;  3AE2 C;  3H1I G;  3E1I A;  1HJB A;  5GTH H;  1RE3 C;  2KK7 A;  1PPJ E;  4OVN F;  1VDF A;  2GA1 A;  5AVQ B;  2J58 A;  3PLN A;  1HBW A;  2WVR A;  1S4X A;  1N86 A;  1OFC X;  3NFQ A;  1LWU A;  3JCU H;  2W90 A;  3H1J G;  2WT7 A;  1LP1 A;  1SQV E;  2FYU E;  3L70 J;  1KOR A;  5APY A;  2ZJS E;  1KQF B;  5KTB A;  1LT9 A;  4WY4 A;  1L0L G;  1NTZ K;  3CMA P;  1HGZ A;  2R44 A;  4EIJ A;  1UIX A;  1Q86 Q;  1L0N E;  1N7S D;  1SQB G;  2NPS C;  4IFF A;  2AEF A;  1L0N J;  4WB4 A;  2ZT9 C;  1S72 P;  2Q6Q A;  2VRS A;  4M3L A;  2OYH B;  5CJ4 A;  1GL2 A;  1NTK D;  1J1E C;  2E74 D;  3CX5 D;  1NU1 G;  2M3B A;  3KPE A;  1SQV J;  4TLF A;  3MIW A;  4BRY A;  1JMB A;  2QJK B;  1RH5 B;  3A0H H;  3HD7 B;  1NTM J;  2WTY A;  3Q5P A;  4I2L C;  1T3U A;  3V2R A;  2Y0D A;  5AW5 B;  2OQQ A;  1YJN P;  2G8Y A;  2B88 A;  1PIX A;  2WSE H;  2L91 A;  4N6J A;  5E79 E;  2R3S A;  4K35 A;  5CJ0 A;  3IFM A;  1OWA A;  3PHL A;  4W7Z A;  3CCM P;  2WPQ A;  1X79 B;  3N4X A;  4RJT A;  2E74 C;  1SQP E;  1LTS C;  1IC2 A;  3L75 J;  1JY2 P;  2YO2 A;  2CK3 H;  3RBZ A;  3W67 A;  1JY3 O;  3LW5 H;  3CI9 A;  1LNQ A;  1NTM D;  2IBZ G;  4DT0 A;  2LXB A;  2N9Y B;  2WSF J;  3M06 A;  3BVH A;  2QSI A;  2Y0C A;  2CPS A;  2XU6 A;  1EZV G;  1TU3 F;  3L71 J;  5AVV B;  1HH0 A;  2MJZ A;  3TK1 A;  3WU2 E;  3CL3 D;  1JY2 N;  1P84 I;  5AW8 B;  1S5L H;  2AEM A;  1IFM A;  2KB7 P;  1SQX D;  5CCG D;  1HGV A;  3FGA D;  1JCD A;  1JTH B;  1ZV8 A;  1DIP A;  3AE1 C;  4IL6 H;  4U7J A;  2OTL P;  1KC8 Q;  2QVA A;  4I7Z B;  1BSH A;  2ZFC A;  1FZA A;  2AEJ A;  1PP9 J;  4H0L C;  1HUC A;  1KYO I;  2WZ7 A;  1MZ9 A;  2IYO A;  2YXR B;  4LGD E;  1ZN5 A;  2AXT E;  3HE5 A;  4Y99 B;  1Q81 Q;  3EWK A;  2L5G B;  3SFD C;  2QJY B;  5K5G B;  1M1J C;  2W6B A;  5CBN A;  1AJY A;  1OW7 A;  3L72 E;  3WUU A;  2LXC B;  4XFJ A;  1FJP A;  4I6M C;  5H2F H;  1PGQ A;  3V2Q A;  1W2B O;  2JEE A;  2OYI A;  4WWI A;  1A02 J;  1SQP D;  2QJY C;  1PFI A;  1VQ6 P;  2Q3E A;  1H8A A;  2OGU A;  2P67 A;  4JYC A;  1NKN A;  2C9L Y;  1EDL A;  1GZL A;  2YXQ B;  2W83 C;  3NTN A;  4WBA A;  5TJH A;  1AVY A;  3WUT A;  2NPS A;  3RK3 C;  4RO0 A;  1QEX A;  1BE3 D;  4D6T D;  5AVX B;  3QWO C;  4W80 A;  5KAI E;  1JEK A;  2XZR A;  4LLH A;  1VQ7 P;  3CC7 P;  2J59 M;  2B89 A;  3BCC E;  5KLI B;  1PPJ G;  3FWL A;  3BCC J;  1NTM G;  2IBZ D;  4UB6 H;  2FYN B;  1JMM A;  4IFD K;  4Y99 C;  1ZR2 A;  5CCH C;  1FU1 A;  2KZI A;  2Y0E A;  3MUD A;  1BSN A;  4H0L B;  5CHX A;  1M57 D;  3H32 A;  1G2C B;  3HD7 D;  2FYU K;  3RL0 g;  3M9Q A;  1DEE G;  4H44 D;  1NU1 K;  1SQB J;  2E74 B;  1HWT C;  5AW2 B;  1USD A;  4ZKU A;  1HF9 A;  3SSU A;  1L0L D;  3L74 J;  4DZO A;  4PJ0 E;  3CD6 P;  3Q5R A;  2O1K A;  1AFO A;  1OVV A;  1IK7 A;  3H1J J;  1FDM A;  1RE3 A;  1J2J B;  1L0L K;  1QX8 A;  3RBX A;  2ZYG A;  1JNM A;  2R32 A;  3HUS A;  1NTK G;  1NTZ D;  2OAR A;  1NU1 D;  2FKW B;  1NU1 J;  2BCC E;  1S5L E;  3AE8 C;  1KIL B;  1KQS O;  4GKG A;  3L73 E;  1KV4 A;  1CZQ A;  1URQ D;  4ZKP A;  3M9B A;  3TYY A;  3PJS K;  2WSS H;  1BGY D;  3B8E B;  2BEZ F;  4PV1 D;  1PV3 A;  1IFN A;  1KB9 I;  2HFE D;  1L0L E;  2YMK A;  5CCG C;  1L0L J;  3L74 D;  3CCL P;  3L72 J;  1RE4 C;  1VL2 A;  3L72 G;  1DD3 A;  3P8C E;  1UII A;  2AXT H;  1Q2N A;  1IFP A;  2LKM A;  3JC2 2;  3BAT A;  4UB6 E;  3USS A;  3O8Z A;  5AW4 B;  4BXL A;  4IL6 E;  1U7M A;  1KTM A;  2M5A B;  2PRR A;  3K5B A;  1CSB A;  1MFZ A;  2IBZ I;  2JKV A;  4N78 D;  5KAF H;  3CPW O;  1N73 C;  1K8A Q;  1WMK A;  2OYH C;  2KSE A;  1NYH A;  1ZLL A;  3BCC D;  1L2P A;  2Y9Z A;  1NJI Q;  3VYI A;  2KYV A;  3L37 A;  1T6A A;  3HE4 B;  2Q3I A;  3SWF A;  1U57 A;  1T2K D;  3A0B H;  1LTT C;  3D70 A;  1SQB E;  4U3F G;  5AW0 B;  3VTP C;  5H2F E;  2UWJ E;  3LID A;  4D6T J;  4KT0 J;  1IJD B;  1X8Y A;  3B5N A;  5KAI H;  2I1K A;  3H1L G;  4N78 E;  5CCG A;  3B5N D;  3M91 A;  3U1A A;  3H1J E;  3KHU A;  5B5E H;  1EQ7 A;  1FS0 E;  1KFM A;  1LTG C;  1PL5 A;  5DJT B;  2A06 G;  1H89 A;  2V4H A;  4EYY Q;  3CCR P;  1HJ0 A;  1G1J A;  3MHV A;  1OX3 A;  2R3C A;  3H1K D;  4U3F E;  1DX7 A;  4U3F J;  3SFE C;  1NTZ G;  1R5L A;  4NPE A;  5KLV G;  1FZF A;  2WSF H;  2W27 A;  1SQQ K;  1CI6 B;  3H1I E;  4YXD C;  1FE6 A;  1KB9 D;  1QL2 A;  1SFC D;  2B9B A;  3AE7 C;  4H0L D;  4RKU J;  1BGY G;  2FBW C;  1KIL D;  4AUW A;  1IFD A;  1VQN P;  3VOP A;  1WT6 A;  3EFF K;  2N1T B;  1QL1 A;  2QIW A;  3O6Q A;  1PZQ A;  1BE3 G;  1MUU A;  1RHZ B;  2HR3 A;  2KNC B;  2R5B A;  5KAF E;  4D6T G;  3L72 D;  2GUV A;  1VF5 D;  3T97 B;  1DH3 A;  2E75 B;  3CCU P;  4GOF A;  3G9R A;  1IO4 A;  1KQG B;  1N7S B;  1SFC A;  3ITK A;  2SPZ A;  1NHL A;  5APW A;  1EXJ A;  1PPJ D;  2H89 C;  3L71 D;  1S9K E;  2WPR A;  2OTK E;  1SQV G;  5M1B A;  3TDK A;  4I7Z C;  1AV1 A;  3CWB J;  4GT1 A;  1A02 F;  1U7J A;  3UIA A;  3BCC G;  1PP9 E;  4GOE A;  1T8Z A;  1L0N G;  1RQV A;  1FJK A;  2I8D A;  2KI7 B;  2WWW A;  2YKP A;  3B5N C;  4GDO A;  4KHX A;  1YBK A;  5KLV K;  1K9M Q;  1N8R Q;  2P10 A;  2BCC G;  1GDT A;  1Q90 D;  1SQP K;  2YIU C;  3GLM A;  3V4W A;  3MUD C;  2D2C C;  5AVU B;  1YQ4 C;  1IFJ A;  2E43 A;  1Y8A A;  1YTZ I;  4HJG H;  1MFT A;  1HVV A;  4U3F D;  3RK2 C;  3D6Y A;  2ZXX A;  3M0A A;  2WSE J;  3VMA A;  3FXD A;  4L74 A;  2JR8 A;  3CX5 H;  3HD7 C;  4YPC A;  1H88 A;  2HPC A;  1OVU A;  2V7Q H;  3FXE A;  2WIT A;  4PD4 I;  1H0T A;  1OW8 A;  2E76 D;  2FYU D;  2QJP B;  2ZAE B;  4BWN A;  1NAY A;  4D6T E;  2XNX A;  3ZDM A;  3H1K G;  2ZT9 B;  5BU8 B;  3L75 E;  1LP1 B;  1N2D C;  4IOI H;  4PD4 E;  5AW6 B;  3RGU A;  2D2C D;  3A0B E;  5KLV D;  3C9I A;  1VQ4 P;  1GTW A;  2Q1K A;  1RF1 B;  1IFI A;  4BRY B;  3T97 A;  3FWN A;  3U1C A;  1L0N K;  3L74 G;  4TT3 H;  1URQ B;  3QH9 A;  1NU1 E;  2BCC J;  3GW6 A;  3L71 E;  3L70 D;  3CLQ A;  1NTZ E;  3L73 J;  5APX A;  3HUS C;  2WPV B;  2M0B A;  2KLV A;  1SQV K;  2K9J B;  2C9N Y;  3RL0 B;  1J1E B;  2KLU A;  2V7Q J;  3C1L A;  3IN6 A;  1GW4 A;  1VPC A;  1GL2 C;  4PV1 C;  3CXH H;  1M1K Q;  3BRT B;  1RF1 A;  2NPS B;  2Z5H A;  1RF0 A;  3R2P A;  4DJG A;  1EXI A;  4C46 A;  1KB9 H;  3P8C D;  3WMM 0;  2JWA A;  1EC5 A;  3L71 G;  2HYN A;  3NMD A;  4L75 A;  2FFD C;  1NVO A;  1PGJ A;  3A5T A;  1NTK E;  1P84 D;  1LJ2 A;  1XTC C;  4R4M A;  4B86 A;  1H0T B;  3IF4 A;  1Q7Y Q;  2OYH A;  1VQP P;  1VQ8 P;  1PP9 D;  2A45 G;  1FZC B;  4QMA A;  2YO3 A;  4GOD A;  1J1D C;  2BCC D;  2WMM A;  2E76 C;  3H1L D;  3TSI A;  5AW9 B;  1G2C A;  1KZU B;  3GG2 A;  1SQX E;  5AW7 B;  3U59 A;  1FZG A;  2A06 D;  2YNY A;  2KOG A;  1SQX J;  5KLV J;  3GMA A;  1N73 A;  5KLV E;  1YIJ P;  1KFN A;  4JQ0 D;  1Y9B A;  2FYU J;  2IFN A;  2N1T D;  3L35 A;  2FYU G;  3L70 E;  3PP5 A;  2K9Y A;  1NO4 A;  2AXC A;  4WY4 B;  5APQ A;  3CWB E;  3B71 A;  2Q7C A;  2K1A A;  4EI2 A;  3TGU D;  1VQ9 P;  1JO5 A;  1NGM B;  5AVZ B;  1KMI Z;  1IK9 A;  1R5S A;  3H1L E;  3L75 D;  4JF7 A;  5AW1 B;  2K9J A;  5AW3 B;  1N7S A;  3H1H E;  1LTA C;  1NTM K;  1OMI A;  1KYO E;  1S2E A;  1S3J A;  2P58 A;  1LTB C;  3AE3 C;  3AEG C;  3MTU E;  3CX5 E;  1N7S C;  2JDI H;  2NPS D;  1EDI A;  3AE9 C;  1VQK P;  2E75 C;  1LWU B;  1SP4 A;  5APV A;  3I5C A;  1T2K C;  1FZC A;  1LTJ B;  2WT7 B;  3BRV B;  1YI2 P;  3CWB D;  3D6Z A;  1Q82 Q;  1LT9 B;  3TGU J;  1NKZ B;  2OTJ P;  3V5B A;  2N9B A;  1SQV D;  2H8P D;  1FZE A;  4N3Y B;  1NTK J;  3CCE P;  4H13 B;  2E42 A;  1VF5 C;  1L0N D;  3KZI H;  2HPC B;  1PGP A;  4Y28 J;  3AEC C;  1PGO A;  2QG4 A;  1FBM A;  2PAJ A;  2WSC H;  4PJ0 H;  3OW2 O;  1ZP0 C;  2E76 B;  1GD2 E;  3OAK A;  3N7N A;  3PTZ A;  4K3A A;  4L76 A;  3VMX A;  3I56 P;  3R4Y A;  1EZV E;  2I1J A;  1GL2 B;  1J1D B;  1E5W A;  1L4A D;  1RF0 C;  1SFC C;  2O01 H;  2FYZ A;  2Z5I A;  3E1R A;  3OJA B;  1NTK K;  2HG5 D;  4DOJ A;  2J5U A;  1GL2 D;  3C8V A;  3H6P A;  3TNU A;  5BU5 A;  1R8E A;  2Q5U A;  3TF5 A;  2PGD A;  1S1C X;  3P8M C;  4OGQ B;  4UB8 E;  1K73 Q;  1URQ C;  5C39 A;  5CBO A;  1YHQ P;  2HLO A;  3PH0 A;  4XA4 A;  2IYP A;  1RF1 C;  2IFM A;  2KP8 A;  2YMY A;  1KYO H;  1GMJ A;  2JJL A;  2OYO A;  2YKQ A;  2P1J A;  2W6J H;  4NPD A;  2BEQ D;  2IX7 C;  2PFX A;  1ZME C;  1FC2 C;  4PV1 B;  3V6I A;  1L4A A;  2O3J A;  1LTI C;  1MKM A;  1P84 E;  3LIE A;  2G3A A;  2M3E A;  1BDD A;  3RK3 E;  3RL0 C;  3S4R A;  3L75 G;  3AE4 C;  1Y47 A;  2E5T A;  3L70 G;  3L73 D;  3HUS B;  3CCQ P;  3HRN A;  2NRG A;  1GU5 A;  3H1H D;  4H44 C;  2PP6 A;  3GHG B;  2IZ1 A;  1JTH A;  1NH4 A;  1FOS E;  2E75 D;  1LGH B;  3Q3D A;  5APU A;  4MN4 C;  1SQQ E;  5KKZ C;  3KXD A;  3G6E P;  1VF5 B;  1VQO P;  1BCC E;  3VMY A;  1K04 A;  2YIU B;  3JSV C;  2Y9Y A;  4ASW A;  3L36 A;  2ZYD A;  3RK2 D;  1GW3 A;  3G4S P;  2P2U A;  5KJ7 D;  3VN0 A;  2FY8 A;  2KIK A;  1QVG O;  4OH8 B;  2Z4E A;  1LT9 C;  1JM0 A;  5AVT B;  3V4Q A;  4HKZ H;  2ZYA A;  1RQU A;  1YYC A;  1AQT A;  1PP9 G;  1YIT P;  5AVS B;  1YQ3 C;  3CC4 P;  1M8O B;  1BCC J;  1LWU C;  2ITA A;  3LW5 J;  1BCC G;  5B5E E;  3SWK A;  1KYO D;  1RE4 A;  2IPP A;  1SQB K;  2IBZ E;  3L74 E;  4OGQ D;  1YJ9 P;  1ZR4 A;  5CCH A;  1BGY J;  2QE7 H;  3B5N B;  3P7K A;  2XDJ A;  5AVY B;  1ZXG A;  3KYQ A;  4ZNC A;  2Q9I A;  3MP7 B;  4AYC A;  3V2P A;  2GM4 A;  1NAF A;  3KDP B;  2CPB A;  1NTZ J;  1BE3 E;  1LTJ C;  1OIP A;  3SWY A;  3A2A A;  1OVR A;  1SVF A;  3EFG A;  3KZI E;  3TGU G;  3I55 P;  1X0T A;  3H1I J;  2WSC J;  2KXP B;  2RH0 A;  2K37 A;  4RES B;  4YXW H;  4JBZ A;  1LTJ A;  2FYN C;  2O01 J;  1JY3 P;  2ZT9 D;  1CI6 A;  2K3R A;  1JCC A;  1JY2 O;  1IZN B;  4R4L A;  3FX0 A;  1FDI A;  1CW5 A;  3G3Z A;  3H25 A;  1N7L A;  3HE4 A;  3A7O A;  1ZW0 A;  1KIL E;  4HH2 A;  1D7M A;  1OW6 A;  3VP9 A;  4WY4 C;  5AVR B;  4YTP C;  2QM7 A;  4UB8 H;  5KJ7 C;  3A3Y B;  3RK3 B;  3CWB G;  1ZRT D;  2GUS A;  2H43 A;  2NZ2 A;  2WQY C;  2KZJ A;  3CME P;  1RY3 A;  2O01 N;  3M9H A;  5B66 E;  4W7Y A;  5KKZ B;  1AVO A;  3BAS A;  1EZV I;  3ABV C;  1SQQ D;  3H1K J;  3S1K A;  2H88 C;  1FOS F;  2A06 E;  2KNC A;  1P84 H;  1FZB A;  3Q2Y A;  2FFD A;  1ZOY C;  1T3J A;  4H44 B;  2K88 A;  3CC2 P;  2M5A A;  2FXM A;  2A45 I;  3H1H J;  5EFW B;  3HE5 B;  3CCS P;  3HTK B;  1E79 H;  3TNU B;  3GF7 A;  3P32 A;  1FZC C;  1NOH A;  3RK3 D;  3MZW B;  1EDJ A;  2XKM A; 
#chains in the Genus database with same CATH homology
 3A0B E;  4UB8 E;  4UB6 E;  5TIS E;  3A0H E;  4IL6 E;  5B5E E;  3WU2 E;  5GTH E;  4PJ0 E;  5B66 E;  3JCU E;  1W5C E;  5KAI E;  1S5L E;  5GTI E;  5KAF E;  3KZI E;  5E79 E;  5H2F E;  2AXT E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...