2AXCA

Crystal structure of cole7 translocation domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
236
structure length
232
Chain Sequence
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Hydrolase
molecule keywords Colicin E7
total genus 57
structure length 232
sequence length 236
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2axcA02
2O01N 2RH0A 3O6QB 2AXCA 1OZHA
chains in the Genus database with same CATH superfamily
1S3JA 1LTTC 1AVOA 3V2PA 2JJLA 1N73C 1YITP 1OFCX 1HF9A 3L70J 5APUA 2QA4P 5K5GB 5AVRB 3VP9A 2UWJE 1YJNP 2N1TD 2LXBA 3D6YA 3Q1MA 2E5TA 4C7NB 1SQVG 5TISH 1OW8A 2P58A 1H0TA 2KOGA 2ZVNB 1SFCD 1H0TB 5CJ4A 1NTME 2Q6QA 3FWLA 4ASWA 1JOCA 4RJTA 2A06E 5B5EH 1FOSE 2K9YA 1JTHA 4GDOA 3HE5B 2W83C 5AW8B 1OVVA 3NMDA 3V2QA 3CCEP 2AEMA 1OWAA 2H88C 2NRGA 1QX8A 5CBOA 3C9IA 2E42A 1N7LA 1P84I 2IFMA 3AECC 3PH0A 4NPDA 4D6TG 2OYIB 2K1AA 3TNUA 2KNCB 2WQYC 1RQVA 3CWBG 4U3FD 3E1IA 5GTIE 1USEA 4XE5B 1BGYJ 2IX7C 1J2JB 5APTA 1RE4C 3S4RA 3VMZA 3H25A 1FZFA 1SQXJ 2WWWA 5B66H 1FBMA 2SPZA 1HWTC 1JO5A 2G3AA 3HRNA 3L73J 1SQBD 2QJPC 2Q1KA 3L35A 4WY4D 5KLVD 1GK6A 4JQ0D 1IK9A 3V4QA 4BRYB 3EFGA 2Y0DA 2ZT9D 1LP1A 2O01H 2WSSH 3CWBE 1VQNP 1X22A 3ITKA 2C0WA 2H7HA 3IN6A 1VF5C 1OW6A 2A45G 2JWDA 1RF0C 4PV1D 4DCKA 3B5NA 3L72G 3V4WA 1EQ7A 1NTMJ 2FXMA 2N9BA 2WSFH 2B87B 2Y9YA 3KXDA 4GOFA 3RL0g 2E5YA 1ZP0C 4BWNA 2WZ7A 1URQD 1IO4A 1VDFA 5KLVK 1IFMA 2A45H 2P7JA 4I6MC 3MTUE 1GW3A 3AE6C 1A02F 1VQ9P 2LKMA 3HE4A 3KZIH 3Q5SA 3L70E 1LNQA 1JTHB 1PV3A 3CX5D 3MUDC 3N7NA 3PHLA 3L74D 1CZQA 2ZVOB 2K9JA 3M06A 2C9LY 3CXHI 1L0ND 1VL2A 3EWKA 1BE3E 2D2CC 3GW6A 3L73E 3R4YA 5AVWB 3VMYA 4PV1B 1YJWP 3MUDA 1S5LE 3CWBD 2JP3A 3A5TA 3D71A 1FZBA 2XDJA 4M3LA 2IBZG 3HTKB 1VQ6P 1RH5B 4U7JA 3HE4B 3CPWO 1YI2P 5KJ7C 1MFZA 1AA0A 3AE2C 4D6TJ 2ZAEB 4L74A 4L76A 1VF5D 3H1ID 1T8ZA 5L8RJ 1IFPA 1N73B 1KC8Q 2O1JA 2PAJA 2A06D 3P8CD 2P2UA 2ZT9C 4UB6H 5KTBA 2WSEH 1PPJE 3JCUE 3P32A 3SSUA 2XNXA 4A7PA 3Q5RA 1QVGO 1KTMA 3P8MC 1S5LX 2FYUD 2I1JA 3AE3C 2KIKA 3S9OA 1KB9D 5AVUB 1LP1B 2QSIA 4HYTB 2YMYA 1FZEA 1GL2C 4H13B 3RL0B 1HGZA 2Z5HA 2XU6A 4IFMA 2P1JA 1U7JA 1JM0A 1KB9H 1M1JC 2FYUJ 3QH9A 3BCCD 3U1CA 1URQA 1LT9B 1GD2E 1Y9BA 1W2BO 4D6TE 4H44C 1JY2P 4IL6X 3VTPC 2YO2A 1VQ8P 2W90A 4EIJA 1Q7YQ 3RK3B 2E76C 2RMZA 3A0BH 3CCSP 3VYIA 3VMXA 1M1JA 2ZXXA 1AQ5A 2J5UA 3TF5A 3C1LA 2D2CB 2QJYC 1L0NE 2KXPB 4UB8E 4YXDC 1BGYD 2FYNC 1S5LH 3USSA 1SS1A 5KKZC 2Z5IA 4PD4H 2HPCA 3SWFA 3GMAA 1NTMD 1OIPA 2N1TC 1L4AA 2E76D 2NZ2A 5AVSB 3Q3DA 1NU1D 1JY3N 1L2PA 2Y0CA 2YKQA 3FX0A 1FAVA 1AVYA 2L5GB 2KSEA 2WSFJ 1MKMA 4H44D 3NFQA 4Y99C 5APVA 2WTYA 1KD1Q 4ZNCA 2OTKE 1ZR4A 1KMIZ 5AW4B 3CC7P 1WMKA 1SQQK 1ZRTD 3HD7C 4R4LA 1UIXA 2WITA 2Q3IA 1GL2D 1QEXA 2WSEJ 2BEQD 1JY3O 2BCCD 3A2AA 4HJGH 2BEZF 1N8RQ 2P67A 3FGAD 1BSHA 1RY3A 2QIWA 1P84E 2IBZI 1ZXGA 2HR3A 1L0LD 2E75B 1E5WA 1ZLLA 4B86A 1P84H 1UIIA 3H32A 1L0NK 1PGPA 1PIXA 1HTLC 4K35A 4ASVA 1VQOP 1Q81Q 3D70A 2R3SA 1N7SD 2E74C 2ZYDA 2H43A 2Z4EA 4JBZA 1RE3C 1M90Q 2HYNA 3H1IJ 1LWUA 5AW0B 1R8EA 4O9BA 4TLFA 1H8AA 5KJ7D 1L0NJ 3C8VA 3V5BA 2N1TB 4U3FE 1MFTA 3AEBC 1NU1G 3MZWB 3O8ZA 1LTIC 3A7OA 1KQGB 2YKOA 3PLNA 1G1JA 1NVOA 1J1DC 1PP9E 1RE3A 2B88A 1MUUA 2CK3H 2WPVB 4KHXA 3JC22 2B89A 4PJ0H 3H1JE 2XNDH 2R5DA 4JYBA 3H1KE 1VPCA 5AW5B 1KORA 3L70D 2CPSA 3H1HE 1KILA 2AEFA 4LGDE 1LT9A 1Y47A 2WPSA 2FYUG 1L0LG 2E75C 3MP7B 4GT1A 5DJUB 4L73A 2IYOA 3RK3D 1NHLA 2NPSB 1NTZJ 2FXPA 1Y8AA 1KZUB 1M1KQ 2BCCG 1DD4A 2E74B 1PGOA 4PV1C 4WB4A 4LC1A 1KB9E 3II6A 4N78D 2GUSA 2R32A 2LXCB 1NO4A 1GK4A 1SQVE 1KQFB 2WPRA 2W6AA 1NTZD 1OX3A 2HFED 3BCCJ 1IFNA 1FZCC 1SQXE 4OGQD 3MD0A 1SQBE 2E76B 3G6EP 2C9NY 4WY4C 1A02J 3U1AA 1NGMB 2BASA 3CX5H 1NTKE 3K5BA 2W6BA 1KILE 3SFDC 3W68A 5KAIH 1BGYG 2ZYGA 3JSVC 1AJYA 3KHUA 3M9QA 3CL3D 3GHGA 4PD4I 3CC2P 2ITAA 1PZQA 3TYYA 5APSA 2YKPA 1K04A 5KLVJ 1DX7A 3L73G 3L75E 4RKUJ 1Q82Q 3IF4A 4WWIA 1KYOD 5E79H 3AE7C 2M3BA 5KAFH 1NTKG 1J1EC 2I8DA 1NU1J 3AE4C 1NJIQ 1QLED 2NPSA 4YTPC 3D6ZA 2R3CA 3BATA 1GDTA 3I55P 1IFIA 2HG5D 2V7QJ 1X8YA 1JY2O 3L37A 1M56D 5TJHA 2WT7B 3L72J 1FZCA 1JUNA 1NYHA 4HB1A 1NAYA 2BCCJ 2NPSC 1M1JB 3KZIE 2FBWC 5AW3B 2QJYB 1EDKA 1CW5A 1OVRA 1PGQA 3WU2H 1G1IA 3L74J 1L0LJ 1X0TA 4YPCA 1SVFA 1IJDB 1MV8A 1QL1A 2QE7H 1SP4A 2IPPA 1NTZG 1CSBA 1AV1A 1OZHA 3IFMA 4KJMA 1BDDA 2WVRA 2HODB 1S9KE 2POHA 1W5CE 1BCCE 3L71G 1M57D 1HJBA 1DH3A 1YIJP 1LTSC 4H0LC 1SQQD 1ZR2A 2Q5UA 4BXLA 4C46A 4CPGA 4N6JA 5EFWB 1PL5A 1NTMK 1YTZT 2N1TA 2M3EA 1JMBA 2G8YA 3L75G 2Q9IA 4OGQB 4AUWA 1NU1K 1LGHB 1VQPP 4Y99B 2D2CD 1XTCC 1NTKJ 4PD4D 1EXIA 5BU5A 1EXJA 1QGKB 1LTJB 1EZVE 3A0HE 3CXHE 3QWOC 4MN4C 5DJTB 3CMAP 5BVZA 3OA7A 3M9HA 5APYA 4DJGA 2AEJA 1NTKK 2OGUA 3F89A 1GU4A 3BCCG 2AXCA 3WMM0 3V6IA 3VN0A 5CHXA 1SQBK 2O01J 3RGUA 1SQXK 1LTGC 3RK2D 3HE5A 3HUSA 4NPFX 5AW2B 3WUTA 3CCUP 4N3YB 3RK3C 3M91A 2K9JB 1AQTA 1JB0J 3CCLP 1SQVK 3CCMP 2B9BA 1K9MQ 2C0XA 5AW1B 2HPCB 3TGUJ 4H0LB 3VOPA 3L36A 4AYCA 1OXZA 2M8RA 2YIUB 3EFFK 4PD4E 3VP8A 3CC4P 2QJPB 2IZ1A 3H1LD 3FXEA 3HUSC 4HKZH 4PJ0E 5CJ0A 5KLVG 1U57A 1WRGA 4TT3H 4EOTA 2V7QH 3CCVP 5CBNA 3RK2C 1IFDA 1DEBA 1Q2NA 2WSCJ 2JEEA 2O3JA 3AEGC 4W80A 3SWKA 1KQSO 1SQQE 2FXOA 2JR8A 3ZDMA 3RK2B 1JEKA 1ZN5A 3L72D 1RQUA 3AE5C 1GZLA 1GL2A 1G2CB 2IZ0A 2OQQA 4I7ZC 4WBAA 5APQA 3A3YB 3I56P 1JY2N 1RF1A 3M0DA 3RL0D 1CI6A 1MZ9A 3KQGA 5AVTB 2OYHC 5CCGC 4QMAA 4U3FG 1E79H 1OMIA 2E74D 2QM8A 2PFXA 5C39A 4EDFA 2IYPA 1VQ7P 3L74G 3L75J 1EDIA 3B71A 2ZJSE 3H6PA 4EYYQ 1AFOA 1FDMA 5BU8B 1GMJA 1NKZB 3VMAA 1SFCC 1G2CA 4IFDK 1SQBG 2AXTH 1NOHA 1TU3F 3L71E 2K88A 4W7YA 3L71J 3TGUE 1YJ9P 2OTLP 1PPJD 3H1HG 5AVVB 3HD7D 2QVAA 1D7MA 3TGUG 4WY4B 1OVUA 1K05A 3P8CE 4HH2A 1JCCA 1RHZB 2OARA 2V4HA 1DEEG 2XV5A 3I5CA 2P10A 4GODA 2K3RA 3GF7A 1N73A 1FJKA 1X9VA 2OYIA 3H1IG 3NXSA 5AVXB 1NTKD 3CXHD 3H1JJ 1ZMEC 3B8EB 2L91A 2QM7A 1BCCD 1KFNA 2YXQB 4YXWH 5CCGA 2OYHA 1YTZI 2R5BA 2E43A 3H1JD 1R5SA 2Y0EA 3KYQA 2ZYAA 3RBZA 3LIDA 1J1EB 3HD7A 1H88A 1KN7A 1LTJA 3UIAA 4I7ZB 3NTNA 3EQ2A 1KYOI 1BE3G 1EZVI 1IZNB 1SQPG 1RE4A 2AXTE 1KYOH 1GW4A 5CCGD 1K73Q 4XFJA 2OYOA 1SQPD 1QL2A 3R2PA 1L4AC 2FFDC 4H44B 1LWUC 1ZOYC 2KZIA 2MKVA 1FDIA 2YMKA 3H1LE 1URQB 3AEDC 3BCCE 2KK7A 3H1LJ 2KI7B 3U59A 1KILD 1YQ4C 3CD6P 2O01N 3V2RA 3AE1C 5KLIB 5H2FE 1SLQA 1SQQG 4IOIH 2GA1A 3M0AA 3L72E 4GOEA 3AEAC 1YQ3C 2FYUE 3O6QB 1RF0A 3H1KJ 3TGUD 4OGQC 4IFFA 4GIFA 3BVHA 1N7SC 2O1KA 5KLVE 3KPEA 1ZRTE 1ZW0A 2M0BA 1LTJC 2KUBA 3OJAB 1M7LA 1N7SB 3MIWA 3TNUB 5KJ7A 1M8OB 1PP9D 3B5NC 5AW9B 1T2KD 4EI2A 5GTIH 4IL6E 1JY3P 1KILB 3S1KA 1BDCA 1OW7A 2QJKB 4DZOA 3L75D 2WT7A 1NKNA 1SQXG 1Z56A 3SFEC 2KZJA 5CCHC 2W6JH 4H13D 3B5ND 3KDPB 2FYUK 2J59M 2E75D 4JPZB 4IL6H 3CLQA 5APXA 5APWA 5B5EE 1S1CX 3AEEC 1FC2C 1BE3J 5AVQB 1RF1C 4RO0A 2OYHB 1BGYE 2BCCE 4Y28J 4NPEA 1SQBJ 2YNYA 2KB7P 1DD3A 3AEFC 3TDKA 2DW3A 3PJSK 3L74E 1NAFA 3G4SP 1L0LE 1N86A 3BASA 1YHQP 1VQLP 2QEXP 1USDA 3GG2A 3H1LG 3HUSB 5KKZB 2ZXEB 1KQLA 1H89A 3CCJP 3G3ZA 1URQC 4C7RA 1NTMG 5H2FH 4I1LA 2W27A 3GHGC 4N78E 3Q5PA 1VQ4P 2MJZA 4XA4A 1ZV8A 2M5AA 2B87A 1IC2A 2RH0A 1L4AD 3GF3A 3TK1A 3RK3E 2YIUC 1DIPA 3M0DC 1PP9G 4WVZA 3G9RA 3JCUH 1SQPK 1EZVG 4DOJA 3FWNA 1NU1E 1PGJA 3HD7B 1P84D 4UB6E 1SQQJ 2FYZA 5AW7B 1K8AQ 1VQ5P 5AW6B 2R44A 2IFNA 4JYCA 1T3JA 1JCDA 1SQPJ 3H1KG 1SFCA 2GUVA 5M1BA 3E1RA 1WT6A 2YO3A 2KS1B 3CI9A 5GTHE 3E7KA 4ZKPA 1KV4A 2XKMA 3CCQP 1U7MA 1HVVA 2Y9ZA 3WU2E 2KNCA 4UB8H 2Q7CA 1S9KD 3LW5H 4D6TD 2OYIC 4DT0A 2FFDB 2K37A 2GM4A 1FDOA 4OWFA 1FZCB 2LR2A 4OH8B 4W7ZA 2FFDA 3A0BE 3FXDA 3G71P 2H89C 1IFJA 1SFCB 2I1KA 2ZFCA 3Q2YA 1J1DB 2KLVA 4ZKUA 1NWQA 1HBWA 2KYVA 2N9YB 3BRTB 5TISE 5KLIC 3N4XA 2ZT9B 1Q86Q 3B4SA 3MHVA 3V2NA 1GTWA 1QVFO 1S72P 2OTJP 4H0LD 1S2EA 1LTBC 3AE9C 3PTZA 3L70G 1HUCA 5KAFE 4C7NA 1N2DC 2YXRB 3CX5I 1CI6B 1FE6A 3CXHH 1SQPE 3H32B 4I2LC 3H1KD 2JKVA 1KFMA 3ABVC 5AVYB 3RL0C 1BE3D 2CPBA 1BCCG 1KB9I 2VRSA 5CMZA 3M9BA 3W67A 3WUVA 1KYOE 3LIEA 2FY8A 1LTAC 1PP9J 1SQXD 2NPSD 2IBZE 1EC5A 2W8ZA 3HTKA 1FU1A 3LW5J 4GKGA 3BRVB 2M5AB 5AVZB 5CCHD 3T97B 1S4XA 5B66E 1PFIA 4AQRD 2RKLA 1FS0E 1FZAA 1HJ0A 5KAIE 1T2KC 3CMEP 3H1IE 3F5HA 1L0LK 1BSNA 3OAKA 1SQVJ 3CCRP 1L4AB 4U3FJ 3L4FA 2XZRA 4KT0J 4R4MA 3IAOA 2KP8A 2KLUA 1LJ2A 4Z1MH 2QG4A 1EDJA 3AE8C 2H8PD 1NH4A 1NTZE 2KSJA 1T6AA 2PGDA 1PPJG 1Q90D 1JMMA 1R5LA 1SQVD 1VF5B 2Q3EA 2JDIH 3H1HD 3PRJA 3L73D 4RESB 3L71D 1RF1B 4JF7A 1HH0A 5CCHA 4OVNF 2FKWB 2HLOA 3MGNA 3SWYA 1FJPA 1KILC 4WY4A 1YYCA 3H1HJ 1GU5A 2A06G 2RN0A 1EZVD 1VQKP 3GLMA 2KS1A 2JO1A 2WSCH 2PP6A 2QRXA 1N7SA 1W2EA 2JWAA 1FZGA 5GTHH 1LT9C 3PP5A 1XTGB 3B5NB 5E79E 3A0HH 4BRYA 1BCCJ 4ZMDA 1VQMP 3H1JG 2A45I 1EDLA 1T3UA 2QJKC 1NTZK 1L0NG 3WUUA 3CWBJ 1GL2B 4H13C 1IK7A 3O6QA 2J58A 4LLHA 1JNMA 1FOSF 3OW2O 3RBXA 3TSIA 3T97A 4K3AA 1HGVA 2HODA 2PRRA 2FYNB 1X79B 2IBZD 2WPQA 1LT1A 3CX5E 3IR9A 3GHGB 3P7KA 4L75A 1LWUB 1YBKA 2WMMA 2IDBA
chains in the Genus database with same CATH topology
2O01N 2RH0A 3O6QB 2AXCA 1OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 N;  2RH0 A;  3O6Q B;  2AXC A;  1OZH A; 
#chains in the Genus database with same CATH topology
 1S3J A;  1LTT C;  1AVO A;  3V2P A;  2JJL A;  1N73 C;  1YIT P;  1OFC X;  1HF9 A;  3L70 J;  5APU A;  2QA4 P;  5K5G B;  5AVR B;  3VP9 A;  2UWJ E;  1YJN P;  2N1T D;  2LXB A;  3D6Y A;  3Q1M A;  2E5T A;  4C7N B;  1SQV G;  5TIS H;  1OW8 A;  2P58 A;  1H0T A;  2KOG A;  2ZVN B;  1SFC D;  1H0T B;  5CJ4 A;  1NTM E;  2Q6Q A;  3FWL A;  4ASW A;  1JOC A;  4RJT A;  2A06 E;  5B5E H;  1FOS E;  2K9Y A;  1JTH A;  4GDO A;  3HE5 B;  2W83 C;  5AW8 B;  1OVV A;  3NMD A;  3V2Q A;  3CCE P;  2AEM A;  1OWA A;  2H88 C;  2NRG A;  1QX8 A;  5CBO A;  3C9I A;  2E42 A;  1N7L A;  1P84 I;  2IFM A;  3AEC C;  3PH0 A;  4NPD A;  4D6T G;  2OYI B;  2K1A A;  3TNU A;  2KNC B;  2WQY C;  1RQV A;  3CWB G;  4U3F D;  3E1I A;  5GTI E;  1USE A;  4XE5 B;  1BGY J;  2IX7 C;  1J2J B;  5APT A;  1RE4 C;  3S4R A;  3VMZ A;  3H25 A;  1FZF A;  1SQX J;  2WWW A;  5B66 H;  1FBM A;  2SPZ A;  1HWT C;  1JO5 A;  2G3A A;  3HRN A;  3L73 J;  1SQB D;  2QJP C;  2Q1K A;  3L35 A;  4WY4 D;  5KLV D;  1GK6 A;  4JQ0 D;  1IK9 A;  3V4Q A;  4BRY B;  3EFG A;  2Y0D A;  2ZT9 D;  1LP1 A;  2O01 H;  2WSS H;  3CWB E;  1VQN P;  1X22 A;  3ITK A;  2C0W A;  2H7H A;  3IN6 A;  1VF5 C;  1OW6 A;  2A45 G;  2JWD A;  1RF0 C;  4PV1 D;  4DCK A;  3B5N A;  3L72 G;  3V4W A;  1EQ7 A;  1NTM J;  2FXM A;  2N9B A;  2WSF H;  2B87 B;  2Y9Y A;  3KXD A;  4GOF A;  3RL0 g;  2E5Y A;  1ZP0 C;  4BWN A;  2WZ7 A;  1URQ D;  1IO4 A;  1VDF A;  5KLV K;  1IFM A;  2A45 H;  2P7J A;  4I6M C;  3MTU E;  1GW3 A;  3AE6 C;  1A02 F;  1VQ9 P;  2LKM A;  3HE4 A;  3KZI H;  3Q5S A;  3L70 E;  1LNQ A;  1JTH B;  1PV3 A;  3CX5 D;  3MUD C;  3N7N A;  3PHL A;  3L74 D;  1CZQ A;  2ZVO B;  2K9J A;  3M06 A;  2C9L Y;  3CXH I;  1L0N D;  1VL2 A;  3EWK A;  1BE3 E;  2D2C C;  3GW6 A;  3L73 E;  3R4Y A;  5AVW B;  3VMY A;  4PV1 B;  1YJW P;  3MUD A;  1S5L E;  3CWB D;  2JP3 A;  3A5T A;  3D71 A;  1FZB A;  2XDJ A;  4M3L A;  2IBZ G;  3HTK B;  1VQ6 P;  1RH5 B;  4U7J A;  3HE4 B;  3CPW O;  1YI2 P;  5KJ7 C;  1MFZ A;  1AA0 A;  3AE2 C;  4D6T J;  2ZAE B;  4L74 A;  4L76 A;  1VF5 D;  3H1I D;  1T8Z A;  5L8R J;  1IFP A;  1N73 B;  1KC8 Q;  2O1J A;  2PAJ A;  2A06 D;  3P8C D;  2P2U A;  2ZT9 C;  4UB6 H;  5KTB A;  2WSE H;  1PPJ E;  3JCU E;  3P32 A;  3SSU A;  2XNX A;  4A7P A;  3Q5R A;  1QVG O;  1KTM A;  3P8M C;  1S5L X;  2FYU D;  2I1J A;  3AE3 C;  2KIK A;  3S9O A;  1KB9 D;  5AVU B;  1LP1 B;  2QSI A;  4HYT B;  2YMY A;  1FZE A;  1GL2 C;  4H13 B;  3RL0 B;  1HGZ A;  2Z5H A;  2XU6 A;  4IFM A;  2P1J A;  1U7J A;  1JM0 A;  1KB9 H;  1M1J C;  2FYU J;  3QH9 A;  3BCC D;  3U1C A;  1URQ A;  1LT9 B;  1GD2 E;  1Y9B A;  1W2B O;  4D6T E;  4H44 C;  1JY2 P;  4IL6 X;  3VTP C;  2YO2 A;  1VQ8 P;  2W90 A;  4EIJ A;  1Q7Y Q;  3RK3 B;  2E76 C;  2RMZ A;  3A0B H;  3CCS P;  3VYI A;  3VMX A;  1M1J A;  2ZXX A;  1AQ5 A;  2J5U A;  3TF5 A;  3C1L A;  2D2C B;  2QJY C;  1L0N E;  2KXP B;  4UB8 E;  4YXD C;  1BGY D;  2FYN C;  1S5L H;  3USS A;  1SS1 A;  5KKZ C;  2Z5I A;  4PD4 H;  2HPC A;  3SWF A;  3GMA A;  1NTM D;  1OIP A;  2N1T C;  1L4A A;  2E76 D;  2NZ2 A;  5AVS B;  3Q3D A;  1NU1 D;  1JY3 N;  1L2P A;  2Y0C A;  2YKQ A;  3FX0 A;  1FAV A;  1AVY A;  2L5G B;  2KSE A;  2WSF J;  1MKM A;  4H44 D;  3NFQ A;  4Y99 C;  5APV A;  2WTY A;  1KD1 Q;  4ZNC A;  2OTK E;  1ZR4 A;  1KMI Z;  5AW4 B;  3CC7 P;  1WMK A;  1SQQ K;  1ZRT D;  3HD7 C;  4R4L A;  1UIX A;  2WIT A;  2Q3I A;  1GL2 D;  1QEX A;  2WSE J;  2BEQ D;  1JY3 O;  2BCC D;  3A2A A;  4HJG H;  2BEZ F;  1N8R Q;  2P67 A;  3FGA D;  1BSH A;  1RY3 A;  2QIW A;  1P84 E;  2IBZ I;  1ZXG A;  2HR3 A;  1L0L D;  2E75 B;  1E5W A;  1ZLL A;  4B86 A;  1P84 H;  1UII A;  3H32 A;  1L0N K;  1PGP A;  1PIX A;  1HTL C;  4K35 A;  4ASV A;  1VQO P;  1Q81 Q;  3D70 A;  2R3S A;  1N7S D;  2E74 C;  2ZYD A;  2H43 A;  2Z4E A;  4JBZ A;  1RE3 C;  1M90 Q;  2HYN A;  3H1I J;  1LWU A;  5AW0 B;  1R8E A;  4O9B A;  4TLF A;  1H8A A;  5KJ7 D;  1L0N J;  3C8V A;  3V5B A;  2N1T B;  4U3F E;  1MFT A;  3AEB C;  1NU1 G;  3MZW B;  3O8Z A;  1LTI C;  3A7O A;  1KQG B;  2YKO A;  3PLN A;  1G1J A;  1NVO A;  1J1D C;  1PP9 E;  1RE3 A;  2B88 A;  1MUU A;  2CK3 H;  2WPV B;  4KHX A;  3JC2 2;  2B89 A;  4PJ0 H;  3H1J E;  2XND H;  2R5D A;  4JYB A;  3H1K E;  1VPC A;  5AW5 B;  1KOR A;  3L70 D;  2CPS A;  3H1H E;  1KIL A;  2AEF A;  4LGD E;  1LT9 A;  1Y47 A;  2WPS A;  2FYU G;  1L0L G;  2E75 C;  3MP7 B;  4GT1 A;  5DJU B;  4L73 A;  2IYO A;  3RK3 D;  1NHL A;  2NPS B;  1NTZ J;  2FXP A;  1Y8A A;  1KZU B;  1M1K Q;  2BCC G;  1DD4 A;  2E74 B;  1PGO A;  4PV1 C;  4WB4 A;  4LC1 A;  1KB9 E;  3II6 A;  4N78 D;  2GUS A;  2R32 A;  2LXC B;  1NO4 A;  1GK4 A;  1SQV E;  1KQF B;  2WPR A;  2W6A A;  1NTZ D;  1OX3 A;  2HFE D;  3BCC J;  1IFN A;  1FZC C;  1SQX E;  4OGQ D;  3MD0 A;  1SQB E;  2E76 B;  3G6E P;  2C9N Y;  4WY4 C;  1A02 J;  3U1A A;  1NGM B;  2BAS A;  3CX5 H;  1NTK E;  3K5B A;  2W6B A;  1KIL E;  3SFD C;  3W68 A;  5KAI H;  1BGY G;  2ZYG A;  3JSV C;  1AJY A;  3KHU A;  3M9Q A;  3CL3 D;  3GHG A;  4PD4 I;  3CC2 P;  2ITA A;  1PZQ A;  3TYY A;  5APS A;  2YKP A;  1K04 A;  5KLV J;  1DX7 A;  3L73 G;  3L75 E;  4RKU J;  1Q82 Q;  3IF4 A;  4WWI A;  1KYO D;  5E79 H;  3AE7 C;  2M3B A;  5KAF H;  1NTK G;  1J1E C;  2I8D A;  1NU1 J;  3AE4 C;  1NJI Q;  1QLE D;  2NPS A;  4YTP C;  3D6Z A;  2R3C A;  3BAT A;  1GDT A;  3I55 P;  1IFI A;  2HG5 D;  2V7Q J;  1X8Y A;  1JY2 O;  3L37 A;  1M56 D;  5TJH A;  2WT7 B;  3L72 J;  1FZC A;  1JUN A;  1NYH A;  4HB1 A;  1NAY A;  2BCC J;  2NPS C;  1M1J B;  3KZI E;  2FBW C;  5AW3 B;  2QJY B;  1EDK A;  1CW5 A;  1OVR A;  1PGQ A;  3WU2 H;  1G1I A;  3L74 J;  1L0L J;  1X0T A;  4YPC A;  1SVF A;  1IJD B;  1MV8 A;  1QL1 A;  2QE7 H;  1SP4 A;  2IPP A;  1NTZ G;  1CSB A;  1AV1 A;  1OZH A;  3IFM A;  4KJM A;  1BDD A;  2WVR A;  2HOD B;  1S9K E;  2POH A;  1W5C E;  1BCC E;  3L71 G;  1M57 D;  1HJB A;  1DH3 A;  1YIJ P;  1LTS C;  4H0L C;  1SQQ D;  1ZR2 A;  2Q5U A;  4BXL A;  4C46 A;  4CPG A;  4N6J A;  5EFW B;  1PL5 A;  1NTM K;  1YTZ T;  2N1T A;  2M3E A;  1JMB A;  2G8Y A;  3L75 G;  2Q9I A;  4OGQ B;  4AUW A;  1NU1 K;  1LGH B;  1VQP P;  4Y99 B;  2D2C D;  1XTC C;  1NTK J;  4PD4 D;  1EXI A;  5BU5 A;  1EXJ A;  1QGK B;  1LTJ B;  1EZV E;  3A0H E;  3CXH E;  3QWO C;  4MN4 C;  5DJT B;  3CMA P;  5BVZ A;  3OA7 A;  3M9H A;  5APY A;  4DJG A;  2AEJ A;  1NTK K;  2OGU A;  3F89 A;  1GU4 A;  3BCC G;  2AXC A;  3WMM 0;  3V6I A;  3VN0 A;  5CHX A;  1SQB K;  2O01 J;  3RGU A;  1SQX K;  1LTG C;  3RK2 D;  3HE5 A;  3HUS A;  4NPF X;  5AW2 B;  3WUT A;  3CCU P;  4N3Y B;  3RK3 C;  3M91 A;  2K9J B;  1AQT A;  1JB0 J;  3CCL P;  1SQV K;  3CCM P;  2B9B A;  1K9M Q;  2C0X A;  5AW1 B;  2HPC B;  3TGU J;  4H0L B;  3VOP A;  3L36 A;  4AYC A;  1OXZ A;  2M8R A;  2YIU B;  3EFF K;  4PD4 E;  3VP8 A;  3CC4 P;  2QJP B;  2IZ1 A;  3H1L D;  3FXE A;  3HUS C;  4HKZ H;  4PJ0 E;  5CJ0 A;  5KLV G;  1U57 A;  1WRG A;  4TT3 H;  4EOT A;  2V7Q H;  3CCV P;  5CBN A;  3RK2 C;  1IFD A;  1DEB A;  1Q2N A;  2WSC J;  2JEE A;  2O3J A;  3AEG C;  4W80 A;  3SWK A;  1KQS O;  1SQQ E;  2FXO A;  2JR8 A;  3ZDM A;  3RK2 B;  1JEK A;  1ZN5 A;  3L72 D;  1RQU A;  3AE5 C;  1GZL A;  1GL2 A;  1G2C B;  2IZ0 A;  2OQQ A;  4I7Z C;  4WBA A;  5APQ A;  3A3Y B;  3I56 P;  1JY2 N;  1RF1 A;  3M0D A;  3RL0 D;  1CI6 A;  1MZ9 A;  3KQG A;  5AVT B;  2OYH C;  5CCG C;  4QMA A;  4U3F G;  1E79 H;  1OMI A;  2E74 D;  2QM8 A;  2PFX A;  5C39 A;  4EDF A;  2IYP A;  1VQ7 P;  3L74 G;  3L75 J;  1EDI A;  3B71 A;  2ZJS E;  3H6P A;  4EYY Q;  1AFO A;  1FDM A;  5BU8 B;  1GMJ A;  1NKZ B;  3VMA A;  1SFC C;  1G2C A;  4IFD K;  1SQB G;  2AXT H;  1NOH A;  1TU3 F;  3L71 E;  2K88 A;  4W7Y A;  3L71 J;  3TGU E;  1YJ9 P;  2OTL P;  1PPJ D;  3H1H G;  5AVV B;  3HD7 D;  2QVA A;  1D7M A;  3TGU G;  4WY4 B;  1OVU A;  1K05 A;  3P8C E;  4HH2 A;  1JCC A;  1RHZ B;  2OAR A;  2V4H A;  1DEE G;  2XV5 A;  3I5C A;  2P10 A;  4GOD A;  2K3R A;  3GF7 A;  1N73 A;  1FJK A;  1X9V A;  2OYI A;  3H1I G;  3NXS A;  5AVX B;  1NTK D;  3CXH D;  3H1J J;  1ZME C;  3B8E B;  2L91 A;  2QM7 A;  1BCC D;  1KFN A;  2YXQ B;  4YXW H;  5CCG A;  2OYH A;  1YTZ I;  2R5B A;  2E43 A;  3H1J D;  1R5S A;  2Y0E A;  3KYQ A;  2ZYA A;  3RBZ A;  3LID A;  1J1E B;  3HD7 A;  1H88 A;  1KN7 A;  1LTJ A;  3UIA A;  4I7Z B;  3NTN A;  3EQ2 A;  1KYO I;  1BE3 G;  1EZV I;  1IZN B;  1SQP G;  1RE4 A;  2AXT E;  1KYO H;  1GW4 A;  5CCG D;  1K73 Q;  4XFJ A;  2OYO A;  1SQP D;  1QL2 A;  3R2P A;  1L4A C;  2FFD C;  4H44 B;  1LWU C;  1ZOY C;  2KZI A;  2MKV A;  1FDI A;  2YMK A;  3H1L E;  1URQ B;  3AED C;  3BCC E;  2KK7 A;  3H1L J;  2KI7 B;  3U59 A;  1KIL D;  1YQ4 C;  3CD6 P;  2O01 N;  3V2R A;  3AE1 C;  5KLI B;  5H2F E;  1SLQ A;  1SQQ G;  4IOI H;  2GA1 A;  3M0A A;  3L72 E;  4GOE A;  3AEA C;  1YQ3 C;  2FYU E;  3O6Q B;  1RF0 A;  3H1K J;  3TGU D;  4OGQ C;  4IFF A;  4GIF A;  3BVH A;  1N7S C;  2O1K A;  5KLV E;  3KPE A;  1ZRT E;  1ZW0 A;  2M0B A;  1LTJ C;  2KUB A;  3OJA B;  1M7L A;  1N7S B;  3MIW A;  3TNU B;  5KJ7 A;  1M8O B;  1PP9 D;  3B5N C;  5AW9 B;  1T2K D;  4EI2 A;  5GTI H;  4IL6 E;  1JY3 P;  1KIL B;  3S1K A;  1BDC A;  1OW7 A;  2QJK B;  4DZO A;  3L75 D;  2WT7 A;  1NKN A;  1SQX G;  1Z56 A;  3SFE C;  2KZJ A;  5CCH C;  2W6J H;  4H13 D;  3B5N D;  3KDP B;  2FYU K;  2J59 M;  2E75 D;  4JPZ B;  4IL6 H;  3CLQ A;  5APX A;  5APW A;  5B5E E;  1S1C X;  3AEE C;  1FC2 C;  1BE3 J;  5AVQ B;  1RF1 C;  4RO0 A;  2OYH B;  1BGY E;  2BCC E;  4Y28 J;  4NPE A;  1SQB J;  2YNY A;  2KB7 P;  1DD3 A;  3AEF C;  3TDK A;  2DW3 A;  3PJS K;  3L74 E;  1NAF A;  3G4S P;  1L0L E;  1N86 A;  3BAS A;  1YHQ P;  1VQL P;  2QEX P;  1USD A;  3GG2 A;  3H1L G;  3HUS B;  5KKZ B;  2ZXE B;  1KQL A;  1H89 A;  3CCJ P;  3G3Z A;  1URQ C;  4C7R A;  1NTM G;  5H2F H;  4I1L A;  2W27 A;  3GHG C;  4N78 E;  3Q5P A;  1VQ4 P;  2MJZ A;  4XA4 A;  1ZV8 A;  2M5A A;  2B87 A;  1IC2 A;  2RH0 A;  1L4A D;  3GF3 A;  3TK1 A;  3RK3 E;  2YIU C;  1DIP A;  3M0D C;  1PP9 G;  4WVZ A;  3G9R A;  3JCU H;  1SQP K;  1EZV G;  4DOJ A;  3FWN A;  1NU1 E;  1PGJ A;  3HD7 B;  1P84 D;  4UB6 E;  1SQQ J;  2FYZ A;  5AW7 B;  1K8A Q;  1VQ5 P;  5AW6 B;  2R44 A;  2IFN A;  4JYC A;  1T3J A;  1JCD A;  1SQP J;  3H1K G;  1SFC A;  2GUV A;  5M1B A;  3E1R A;  1WT6 A;  2YO3 A;  2KS1 B;  3CI9 A;  5GTH E;  3E7K A;  4ZKP A;  1KV4 A;  2XKM A;  3CCQ P;  1U7M A;  1HVV A;  2Y9Z A;  3WU2 E;  2KNC A;  4UB8 H;  2Q7C A;  1S9K D;  3LW5 H;  4D6T D;  2OYI C;  4DT0 A;  2FFD B;  2K37 A;  2GM4 A;  1FDO A;  4OWF A;  1FZC B;  2LR2 A;  4OH8 B;  4W7Z A;  2FFD A;  3A0B E;  3FXD A;  3G71 P;  2H89 C;  1IFJ A;  1SFC B;  2I1K A;  2ZFC A;  3Q2Y A;  1J1D B;  2KLV A;  4ZKU A;  1NWQ A;  1HBW A;  2KYV A;  2N9Y B;  3BRT B;  5TIS E;  5KLI C;  3N4X A;  2ZT9 B;  1Q86 Q;  3B4S A;  3MHV A;  3V2N A;  1GTW A;  1QVF O;  1S72 P;  2OTJ P;  4H0L D;  1S2E A;  1LTB C;  3AE9 C;  3PTZ A;  3L70 G;  1HUC A;  5KAF E;  4C7N A;  1N2D C;  2YXR B;  3CX5 I;  1CI6 B;  1FE6 A;  3CXH H;  1SQP E;  3H32 B;  4I2L C;  3H1K D;  2JKV A;  1KFM A;  3ABV C;  5AVY B;  3RL0 C;  1BE3 D;  2CPB A;  1BCC G;  1KB9 I;  2VRS A;  5CMZ A;  3M9B A;  3W67 A;  3WUV A;  1KYO E;  3LIE A;  2FY8 A;  1LTA C;  1PP9 J;  1SQX D;  2NPS D;  2IBZ E;  1EC5 A;  2W8Z A;  3HTK A;  1FU1 A;  3LW5 J;  4GKG A;  3BRV B;  2M5A B;  5AVZ B;  5CCH D;  3T97 B;  1S4X A;  5B66 E;  1PFI A;  4AQR D;  2RKL A;  1FS0 E;  1FZA A;  1HJ0 A;  5KAI E;  1T2K C;  3CME P;  3H1I E;  3F5H A;  1L0L K;  1BSN A;  3OAK A;  1SQV J;  3CCR P;  1L4A B;  4U3F J;  3L4F A;  2XZR A;  4KT0 J;  4R4M A;  3IAO A;  2KP8 A;  2KLU A;  1LJ2 A;  4Z1M H;  2QG4 A;  1EDJ A;  3AE8 C;  2H8P D;  1NH4 A;  1NTZ E;  2KSJ A;  1T6A A;  2PGD A;  1PPJ G;  1Q90 D;  1JMM A;  1R5L A;  1SQV D;  1VF5 B;  2Q3E A;  2JDI H;  3H1H D;  3PRJ A;  3L73 D;  4RES B;  3L71 D;  1RF1 B;  4JF7 A;  1HH0 A;  5CCH A;  4OVN F;  2FKW B;  2HLO A;  3MGN A;  3SWY A;  1FJP A;  1KIL C;  4WY4 A;  1YYC A;  3H1H J;  1GU5 A;  2A06 G;  2RN0 A;  1EZV D;  1VQK P;  3GLM A;  2KS1 A;  2JO1 A;  2WSC H;  2PP6 A;  2QRX A;  1N7S A;  1W2E A;  2JWA A;  1FZG A;  5GTH H;  1LT9 C;  3PP5 A;  1XTG B;  3B5N B;  5E79 E;  3A0H H;  4BRY A;  1BCC J;  4ZMD A;  1VQM P;  3H1J G;  2A45 I;  1EDL A;  1T3U A;  2QJK C;  1NTZ K;  1L0N G;  3WUU A;  3CWB J;  1GL2 B;  4H13 C;  1IK7 A;  3O6Q A;  2J58 A;  4LLH A;  1JNM A;  1FOS F;  3OW2 O;  3RBX A;  3TSI A;  3T97 A;  4K3A A;  1HGV A;  2HOD A;  2PRR A;  2FYN B;  1X79 B;  2IBZ D;  2WPQ A;  1LT1 A;  3CX5 E;  3IR9 A;  3GHG B;  3P7K A;  4L75 A;  1LWU B;  1YBK A;  2WMM A;  2IDB A; 
#chains in the Genus database with same CATH homology
 2O01 N;  2RH0 A;  3O6Q B;  2AXC A;  1OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...