2AXCA

Crystal structure of cole7 translocation domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
236
structure length
232
Chain Sequence
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7
publication title High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Hydrolase
total genus 57
structure length 232
sequence length 236
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2axcA02
3O6QB 2AXCA 2O01N 1OZHA 2RH0A
chains in the Genus database with same CATH superfamily
1NO4A 2SPZA 3MGNA 3V2RA 1VQ4P 3L74D 4U7JA 4YTPC 1DEBA 2M5AB 1NTZG 1ZOYC 3RL0D 4Y99B 1M1KQ 1SQBD 3HUSC 3H1HG 5AVQB 1JMMA 2Y9YA 1KFMA 2ZYDA 3S4RA 2QM7A 4GOFA 1MUUA 1XTGB 2W27A 1G2CA 3M06A 2R5BA 2N1TB 3AEAC 3ZDMA 4GT1A 5CCGA 2XNXA 4U3FE 3CXHD 2XU6A 1VDFA 2A06E 3FXDA 3I55P 4H13D 3G6EP 3H25A 2WT7B 3TNUB 1EQ7A 3CCSP 2FXMA 1JCDA 1SQXJ 2LR2A 1KB9I 3GW6A 3SFDC 2YO2A 3FWNA 2AEFA 4H0LB 2QJPC 1GZLA 3O8ZA 2ZT9C 1LTBC 1WT6A 1ZV8A 4ASVA 2IBZD 2Z5IA 1ZP0C 2KS1A 2QEXP 1YBKA 2E76B 1VQLP 1AVOA 2GUSA 2N9BA 1FJPA 5CCGC 4TLFA 1VQ9P 1A02J 1K9MQ 2PGDA 1FBMA 2OYHA 3C8VA 1S3JA 4JYCA 1ZR2A 1IFPA 2I1JA 1URQB 3CCMP 3OW2O 4IOIH 2R32A 1USEA 1GL2A 4EYYQ 4K35A 1L0NJ 1VQ5P 1FZFA 1AV1A 3TGUE 2WZ7A 3B5NB 3CI9A 2N1TD 3VMYA 5KJ7D 4LLHA 1LTJA 2P58A 3L75D 3KQGA 2JWDA 1L0NE 1M57D 5H2FH 3A3YB 3N7NA 2KNCB 2JP3A 1LTAC 3BCCD 3LW5H 1RE3A 2FKWB 4O9BA 4U3FG 5KKZC 2A06G 2C0WA 2FY8A 1IO4A 3HTKB 4IL6E 2P67A 1W2EA 3HE5B 2XKMA 1RHZB 3H1LG 2JJLA 1GL2C 4DOJA 5BVZA 4H0LD 4IFMA 3H1JE 2WSCJ 3HE4A 4LC1A 2FYZA 2OARA 3A2AA 2CK3H 2E76D 1LTJC 5B66E 1GTWA 2QA4P 2CPSA 3RK3E 3M9QA 3VP8A 2BASA 2WSSH 5AVRB 3S1KA 4PD4E 1QEXA 1RE3C 3CCRP 3M9HA 1URQD 1VQPP 3SWKA 3KHUA 4MN4C 4OH8B 2QM8A 4OGQC 1E79H 3PJSK 4JQ0D 1QL1A 3B5ND 5GTIE 4RKUJ 1OW7A 1FOSF 2FYUK 1GDTA 4EIJA 2R3CA 2JR8A 1IFNA 1LWUC 3AEBC 2A45I 4PV1C 1KYOD 1GU4A 4HB1A 3TGUG 4H44B 5AW9B 1BSNA 3L37A 1N7SA 5AVTB 4KT0J 1Q82Q 1J1EC 2FFDA 4UB6E 2Q5UA 3B71A 4BRYB 1EC5A 2JKVA 2C0XA 4IL6H 3WU2H 5K5GB 2Q6QA 4UB8E 3D70A 1N7LA 3H6PA 2KXPB 1FE6A 5B66H 1SS1A 2QJKC 3OAKA 1J2JB 3BCCJ 1L4AA 3H1JG 2HPCB 1EZVE 1NH4A 2FXOA 4IL6X 3ABVC 3V6IA 1L0LJ 3RK2B 2ZYAA 1KORA 1HTLC 1N7SC 1L0LK 1SFCA 1IK9A 4PD4H 2OTJP 1JY3O 3CXHH 1M1JA 2O01J 2P1JA 3USSA 3EWKA 1GU5A 2Y9ZA 3L73G 5AW4B 1P84I 3AE7C 1NTZJ 1K73Q 5CJ4A 1L0LE 1BDCA 1NTZK 3MZWB 2OQQA 1IC2A 3H1HJ 1KILC 4JPZB 5GTIH 1HWTC 1Q90D 3P8CE 1JM0A 3QH9A 2K9JB 4U3FD 5AW7B 2A06D 2Z4EA 4NPDA 3G9RA 1JTHB 2D2CC 1NTZE 2ZFCA 4H44D 1Z56A 3CPWO 1BE3E 1L4AC 1NHLA 2QVAA 1G1IA 5L8RJ 1RF1B 2W6BA 2QRXA 3H1HE 1Q86Q 1Q7YQ 3SSUA 2B87A 1KD1Q 1JY2P 2QSIA 1SFCC 5GTHE 3CCEP 4RJTA 2GA1A 1M1JC 1ZMEC 4UB6H 1Q81Q 4WY4B 2FYUG 1KFNA 3RBZA 1H0TB 1NKNA 3F89A 4UB8H 1NU1K 2LXBA 3GF3A 2KIKA 1FC2C 1BCCE 1YI2P 2PRRA 3O6QB 5AW2B 1SQQK 1U7MA 3A7OA 3CX5I 3RK3B 3L70E 1K8AQ 1SQPK 2IFNA 3K5BA 1NU1E 1IFIA 5E79H 1L2PA 3ITKA 1LTTC 3AE5C 1VF5C 2WSFJ 4PJ0H 2WWWA 1IJDB 4JBZA 1GW4A 1SQQE 3AEEC 3RK2D 5KTBA 1OW6A 5APQA 1HJ0A 1PL5A 1SQPE 2LXCB 1A02F 2Z5HA 1LT9A 1EZVG 3PRJA 5APSA 1G2CB 3TGUD 3CCQP 2KSEA 3RL0g 1KZUB 1KQFB 2E75C 1MKMA 3S9OA 1JY3P 2Q7CA 3KZIE 1JCCA 3M0DA 5AVUB 3VP9A 2O01H 3FX0A 1JMBA 1OVVA 3CWBG 4W7ZA 1L0LG 1BSHA 4Y28J 2KZJA 1JO5A 2YNYA 5AW0B 2P10A 2XV5A 3PP5A 4HJGH 1YITP 2ZXEB 3HD7A 3P32A 1BE3G 1LT9C 4WY4D 1X0TA 3QWOC 3H1JD 1FJKA 3TDKA 2JO1A 3GHGB 3R2PA 5KLVK 1FDOA 2FYNC 4ASWA 1KQLA 3G3ZA 4U3FJ 1S2EA 1MZ9A 3M0DC 3LW5J 3L35A 1BDDA 3H1LJ 2KSJA 3RK3D 1PV3A 4N78E 1OVUA 5KLVE 2OYHB 2YMYA 1SLQA 1BCCG 2N9YB 4PD4D 1ZRTE 2J5UA 3AEGC 3RL0C 3A5TA 1CSBA 2NPSB 3MTUE 1KYOH 4C7NB 3L70G 3AE3C 2HODB 3H1LE 4YXDC 3U1CA 1NU1G 2E42A 1H8AA 3HD7C 1R8EA 2HG5D 1SQQG 3V4QA 2WSFH 2M0BA 3KPEA 2WQYC 2WVRA 1DD4A 1SQPG 3KZIH 2J59M 1CI6B 1X79B 5AVZB 3BRTB 2E74B 5AW6B 5AVWB 1PGPA 4H13C 3T97B 2FYUD 2M5AA 1N73B 3PH0A 3JC22 2HFED 3D6YA 5APTA 5KLIB 2POHA 3JSVC 1VQKP 4WVZA 1HJBA 3TGUJ 1GK4A 2WPVB 5APXA 4CPGA 1W5CE 4QMAA 3NMDA 3AE9C 1NTKK 1M56D 3N4XA 3HE4B 2N1TA 3SWYA 5KJ7A 2Q9IA 2KUBA 3II6A 2C9LY 2K1AA 2G8YA 3KXDA 1AA0A 1YJNP 1T3JA 2MJZA 1CZQA 2E5TA 1EZVD 2JWAA 2O1KA 2WT7A 3TNUA 1P84E 4Y99C 2BCCE 2NPSD 3AECC 3F5HA 3C9IA 1NJIQ 1D7MA 5KLVG 2YO3A 3AE4C 3H1JJ 1OFCX 2YIUB 3CWBD 1L0LD 5DJUB 2AXTE 1UIXA 2AEJA 3MHVA 3W68A 1LJ2A 2OYIB 2E43A 4A7PA 2N1TC 5KJ7C 2W6AA 1Q2NA 3AE1C 3P8CD 3JCUE 1FZCB 3LIDA 1FDMA 2E74D 3WMM0 3L73J 1FZAA 1NTZD 1LP1B 2QJYB 3EQ2A 1BE3D 1R5SA 1LWUA 4AQRD 3H1HD 1JNMA 5DJTB 3IAOA 3RGUA 2GUVA 3V2PA 3LIEA 2FFDB 2E5YA 4M3LA 3L73E 1K04A 3VMZA 1S72P 3V5BA 3L72G 3CC4P 3L71E 1QVGO 3H1KJ 4H0LC 1S5LE 3B5NA 2PFXA 1HGVA 1BCCD 5APWA 1YTZI 4C46A 2E76C 3H1IE 3L70D 2FYUJ 2IDBA 1NU1D 2V7QJ 3H1KE 3TSIA 2L91A 1KMIZ 2QIWA 2KNCA 1DD3A 3CL3D 2UWJE 4N3YB 1N2DC 1SQQD 1JY2O 3EFGA 2FBWC 1SQPD 1NTKG 4R4LA 1M1JB 1URQC 2FYUE 2RKLA 1G1JA 4I7ZB 3HE5A 5CBOA 5CJ0A 1HH0A 1ZR4A 1RQUA 3B5NC 2BCCG 1QX8A 2AXTH 4LGDE 3SFEC 1E5WA 1PPJG 2H8PD 1TU3F 3E7KA 3JCUH 1K05A 1KILA 2PAJA 1S9KE 1NWQA 1J1DB 3BVHA 1JOCA 1SP4A 5KAIE 1HBWA 3L74G 1VQMP 4D6TE 1GMJA 1AVYA 3CWBJ 3KYQA 3VN0A 1RH5B 5TISE 1YHQP 5CMZA 1YTZT 3HRNA 4EOTA 2W90A 2GM4A 2R44A 2QG4A 3CC2P 1GW3A 3CWBE 1BE3J 1LTGC 3L71G 4N78D 4BWNA 5KLVD 3BATA 1QGKB 1QL2A 2YXRB 1IFDA 1ZRTD 2PP6A 1U57A 5BU8B 3H1IG 3H1LD 1S5LX 4WWIA 1KB9E 1NOHA 1LT1A 3HUSB 3H1KG 4RESB 2V7QH 3AEDC 1T2KD 1BCCJ 3H32A 4AUWA 2ZVNB 2H88C 3PTZA 3L70J 3M9BA 1PP9E 2WPQA 3CMEP 1T6AA 4KJMA 1PIXA 5CCHD 1NU1J 1FZGA 1NTMK 3TYYA 1DIPA 4K3AA 5AVXB 5AVVB 1RE4A 1SQQJ 2KYVA 2HPCA 2QE7H 1SQPJ 1BGYE 1FZEA 1IFJA 2K37A 1NTME 3A0BE 1VQ6P 4W80A 1HF9A 4EDFA 2B9BA 3HD7B 5KAIH 1DEEG 1JY3N 4PD4I 1ZLLA 3AE8C 3OA7A 3IF4A 3CXHI 1KV4A 2KI7B 3GF7A 4DJGA 5M1BA 1ZN5A 2IFMA 1ZXGA 2QJPB 2ZT9B 4KHXA 4D6TG 2MKVA 2K9JA 3VMAA 2YKOA 1FAVA 2WITA 3CCLP 1OX3A 1RE4C 1EDKA 4NPFX 2P7JA 5APVA 1P84D 2IBZI 3WUVA 2M8RA 4ZMDA 2BCCD 3RK2C 1PPJD 3FXEA 1KQSO 1KB9H 1DX7A 1HGZA 3P8MC 2OYOA 1H0TA 2JDIH 3UIAA 5APUA 1R5LA 3TK1A 5GTHH 2R3SA 2YKQA 3O6QA 4HH2A 5BU5A 2I8DA 1EXJA 5KLVJ 3D71A 2KS1B 1H89A 1KILE 2HR3A 5EFWB 3B4SA 1QVFO 4JF7A 2M3EA 1Y9BA 5AW5B 5CHXA 1PP9G 1NKZB 2ITAA 1RF1C 4ZKPA 3WUUA 1LTSC 2OTKE 1HUCA 1OWAA 1EZVI 3A0BH 1RQVA 3HD7D 3L73D 2H7HA 1AJYA 4I1LA 3L71D 5KKZB 1QLED 1IZNB 3CX5D 4WY4C 2IPPA 1BGYG 1Y47A 2YKPA 4L73A 1H88A 1NTMG 3Q5RA 1GL2B 2NZ2A 3BASA 2ZXXA 2ZT9D 3H1ID 5H2FE 2IX7C 1SQVJ 1MFTA 3L72J 1N86A 2HLOA 3EFFK 3TF5A 1FU1A 1YYCA 4EI2A 3RK3C 3H1KD 1LTJB 1SQVK 2OGUA 3GMAA 5CCGD 4GKGA 3Q3DA 2XZRA 3VYIA 1VL2A 3MUDA 3FWLA 4L75A 1SQVE 1OZHA 1YJ9P 1SQXK 1PZQA 3L72E 4I6MC 2K88A 3RBXA 3M91A 1IK7A 3D6ZA 3B8EB 2O1JA 4OWFA 4DT0A 2AXCA 3GHGA 1LTIC 4OGQB 1SQXE 3MIWA 5AVSB 1X9VA 3P7KA 1NTKJ 4C7RA 1WMKA 4BXLA 4GOEA 4RO0A 3NFQA 2Q3EA 3FGAD 2ZYGA 1S9KD 1LWUB 4PV1B 2M3BA 3CD6P 2YXQB 2RMZA 2BCCJ 1NTKE 4ZNCA 2WPSA 1VQ7P 5AVYB 3NTNA 2NPSA 4GIFA 2H43A 4C7NA 3Q2YA 3AEFC 4D6TD 2HODA 3MUDC 3Q1MA 4NPEA 2ZVOB 1KYOI 1J1EB 1L0NK 2RH0A 1YQ3C 1T8ZA 4W7YA 1OW8A 1PPJE 1S4XA 3GHGC 1GL2D 3AE6C 2WSEJ 1FZBA 4Z1MH 3L74J 1CI6A 1NAYA 4HKZH 4B86A 3MD0A 1OVRA 2B88A 2RN0A 4JYBA 2A45H 1JUNA 5C39A 1SQBJ 4WBAA 3E1IA 3T97A 2QJKB 1N73A 2OYHC 2O3JA 5AW3B 5B5EE 1SQBK 2ZAEB 1NGMB 3I5CA 1VQOP 3L74E 1PGJA 3A0HE 3E1RA 2A45G 1KB9D 1N8RQ 3L71J 2NPSC 3V4WA 1N7SB 3WU2E 2IZ0A 1SQBE 1URQA 3L36A 4XA4A 3KDPB 1RF0A 3H1IJ 4OGQD 3G4SP 1EXIA 2KOGA 1SQVG 1PP9D 2Y0DA 3GLMA 3CX5E 1KILB 1EDLA 2E74C 1EDIA 1NYHA 2J58A 2IYOA 2VRSA 1SQXG 4TT3H 4PV1D 4XE5B 4XFJA 1BGYD 2D2CB 1N73C 3CXHE 2DW3A 1NTMD 3PHLA 1L4AB 2KLUA 5KLIC 4R4MA 1XTCC 3W67A 1PGQA 3NXSA 1SFCB 1DH3A 2IYPA 3CC7P 5KAFE 2W6JH 1P84H 2C9NY 1GK6A 1JEKA 2K3RA 3HTKA 1LGHB 2OYIA 3V2NA 1RF0C 4IFFA 1FZCA 1S1CX 3IR9A 1U7JA 3V2QA 2IBZE 2IZ1A 1LP1A 1AQ5A 4IFDK 2B89A 3GG2A 4WB4A 5TJHA 5B5EH 1SVFA 4D6TJ 1VF5B 2WSEH 2O01N 1L0NG 1NVOA 3A0HH 4HYTB 1KC8Q 1GD2E 2ZJSE 1N7SD 1Y8AA 2B87B 3PLNA 3L4FA 2W83C 3H32B 2NRGA 2YIUC 3L75J 1AQTA 3VMXA 1VQ8P 3IN6A 4N6JA 2OYIC 3OJAB 2E75B 5E79E 1FZCC 1SQBG 2BEZF 1KILD 4L76A 3CX5H 1S5LH 2I1KA 1YQ4C 4PJ0E 2QJYC 3U59A 3L75E 1X8YA 1IFMA 1KQGB 2WSCH 5AW1B 2KZIA 1HVVA 2D2CD 1T3UA 1L4AD 1FDIA 1JY2N 2G3AA 1CW5A 1ZW0A 3BCCE 2FFDC 1YJWP 2JEEA 1SFCD 3R4YA 4DZOA 3VOPA 4DCKA 1PP9J 5KAFH 3Q5PA 4L74A 1OXZA 1LT9B 4BRYA 2CPBA 1FS0E 1PFIA 5CCHA 2XDJA 1W2BO 2W8ZA 2FYNB 2KLVA 2L5GB 2Q3IA 2YMKA 5CBNA 1BGYJ 1M8OB 1NTMJ 4OVNF 5APYA 1AFOA 1SQVD 1VF5D 2IBZG 3L72D 3MP7B 3RL0B 4H44C 3CCVP 2AEMA 1M90Q 2KB7P 1LNQA 4I7ZC 4YXWH 1OMIA 1T2KC 2Q1KA 1SQXD 3CMAP 2Y0EA 1PGOA 2Y0CA 2H89C 3M0AA 3AE2C 3I56P 2WPRA 1YIJP 3IFMA 5CCHC 5TISH 2E75D 1RY3A 1WRGA 1MV8A 1MFZA 4I2LC 3CCUP 2KP8A 1FOSE 3Q5SA 1NTKD 2FXPA 1KYOE 4H13B 1J1DC 1JTHA 3U1AA 4YPCA 3BRVB 3G71P 3HUSA 2LKMA 1RF1A 1EDJA 3SWFA 1VQNP 3L75G 3WUTA 2P2UA 2XNDH 2HYNA 2WTYA 2R5DA 1X22A 1M7LA 2BEQD 2K9YA 2V4HA 1JB0J 3CLQA 4AYCA 1KTMA 3BCCG 3C1LA 1VPCA 2OTLP 4WY4A 4ZKUA 3CCJP 4GODA 3VTPC 1L0ND 4GDOA 1NAFA 1KN7A 5AW8B 1UIIA 2KK7A 1OIPA 1USDA 2WMMA
chains in the Genus database with same CATH topology
3O6QB 2AXCA 2O01N 1OZHA 2RH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O6Q B;  2AXC A;  2O01 N;  1OZH A;  2RH0 A; 
#chains in the Genus database with same CATH topology
 1NO4 A;  2SPZ A;  3MGN A;  3V2R A;  1VQ4 P;  3L74 D;  4U7J A;  4YTP C;  1DEB A;  2M5A B;  1NTZ G;  1ZOY C;  3RL0 D;  4Y99 B;  1M1K Q;  1SQB D;  3HUS C;  3H1H G;  5AVQ B;  1JMM A;  2Y9Y A;  1KFM A;  2ZYD A;  3S4R A;  2QM7 A;  4GOF A;  1MUU A;  1XTG B;  2W27 A;  1G2C A;  3M06 A;  2R5B A;  2N1T B;  3AEA C;  3ZDM A;  4GT1 A;  5CCG A;  2XNX A;  4U3F E;  3CXH D;  2XU6 A;  1VDF A;  2A06 E;  3FXD A;  3I55 P;  4H13 D;  3G6E P;  3H25 A;  2WT7 B;  3TNU B;  1EQ7 A;  3CCS P;  2FXM A;  1JCD A;  1SQX J;  2LR2 A;  1KB9 I;  3GW6 A;  3SFD C;  2YO2 A;  3FWN A;  2AEF A;  4H0L B;  2QJP C;  1GZL A;  3O8Z A;  2ZT9 C;  1LTB C;  1WT6 A;  1ZV8 A;  4ASV A;  2IBZ D;  2Z5I A;  1ZP0 C;  2KS1 A;  2QEX P;  1YBK A;  2E76 B;  1VQL P;  1AVO A;  2GUS A;  2N9B A;  1FJP A;  5CCG C;  4TLF A;  1VQ9 P;  1A02 J;  1K9M Q;  2PGD A;  1FBM A;  2OYH A;  3C8V A;  1S3J A;  4JYC A;  1ZR2 A;  1IFP A;  2I1J A;  1URQ B;  3CCM P;  3OW2 O;  4IOI H;  2R32 A;  1USE A;  1GL2 A;  4EYY Q;  4K35 A;  1L0N J;  1VQ5 P;  1FZF A;  1AV1 A;  3TGU E;  2WZ7 A;  3B5N B;  3CI9 A;  2N1T D;  3VMY A;  5KJ7 D;  4LLH A;  1LTJ A;  2P58 A;  3L75 D;  3KQG A;  2JWD A;  1L0N E;  1M57 D;  5H2F H;  3A3Y B;  3N7N A;  2KNC B;  2JP3 A;  1LTA C;  3BCC D;  3LW5 H;  1RE3 A;  2FKW B;  4O9B A;  4U3F G;  5KKZ C;  2A06 G;  2C0W A;  2FY8 A;  1IO4 A;  3HTK B;  4IL6 E;  2P67 A;  1W2E A;  3HE5 B;  2XKM A;  1RHZ B;  3H1L G;  2JJL A;  1GL2 C;  4DOJ A;  5BVZ A;  4H0L D;  4IFM A;  3H1J E;  2WSC J;  3HE4 A;  4LC1 A;  2FYZ A;  2OAR A;  3A2A A;  2CK3 H;  2E76 D;  1LTJ C;  5B66 E;  1GTW A;  2QA4 P;  2CPS A;  3RK3 E;  3M9Q A;  3VP8 A;  2BAS A;  2WSS H;  5AVR B;  3S1K A;  4PD4 E;  1QEX A;  1RE3 C;  3CCR P;  3M9H A;  1URQ D;  1VQP P;  3SWK A;  3KHU A;  4MN4 C;  4OH8 B;  2QM8 A;  4OGQ C;  1E79 H;  3PJS K;  4JQ0 D;  1QL1 A;  3B5N D;  5GTI E;  4RKU J;  1OW7 A;  1FOS F;  2FYU K;  1GDT A;  4EIJ A;  2R3C A;  2JR8 A;  1IFN A;  1LWU C;  3AEB C;  2A45 I;  4PV1 C;  1KYO D;  1GU4 A;  4HB1 A;  3TGU G;  4H44 B;  5AW9 B;  1BSN A;  3L37 A;  1N7S A;  5AVT B;  4KT0 J;  1Q82 Q;  1J1E C;  2FFD A;  4UB6 E;  2Q5U A;  3B71 A;  4BRY B;  1EC5 A;  2JKV A;  2C0X A;  4IL6 H;  3WU2 H;  5K5G B;  2Q6Q A;  4UB8 E;  3D70 A;  1N7L A;  3H6P A;  2KXP B;  1FE6 A;  5B66 H;  1SS1 A;  2QJK C;  3OAK A;  1J2J B;  3BCC J;  1L4A A;  3H1J G;  2HPC B;  1EZV E;  1NH4 A;  2FXO A;  4IL6 X;  3ABV C;  3V6I A;  1L0L J;  3RK2 B;  2ZYA A;  1KOR A;  1HTL C;  1N7S C;  1L0L K;  1SFC A;  1IK9 A;  4PD4 H;  2OTJ P;  1JY3 O;  3CXH H;  1M1J A;  2O01 J;  2P1J A;  3USS A;  3EWK A;  1GU5 A;  2Y9Z A;  3L73 G;  5AW4 B;  1P84 I;  3AE7 C;  1NTZ J;  1K73 Q;  5CJ4 A;  1L0L E;  1BDC A;  1NTZ K;  3MZW B;  2OQQ A;  1IC2 A;  3H1H J;  1KIL C;  4JPZ B;  5GTI H;  1HWT C;  1Q90 D;  3P8C E;  1JM0 A;  3QH9 A;  2K9J B;  4U3F D;  5AW7 B;  2A06 D;  2Z4E A;  4NPD A;  3G9R A;  1JTH B;  2D2C C;  1NTZ E;  2ZFC A;  4H44 D;  1Z56 A;  3CPW O;  1BE3 E;  1L4A C;  1NHL A;  2QVA A;  1G1I A;  5L8R J;  1RF1 B;  2W6B A;  2QRX A;  3H1H E;  1Q86 Q;  1Q7Y Q;  3SSU A;  2B87 A;  1KD1 Q;  1JY2 P;  2QSI A;  1SFC C;  5GTH E;  3CCE P;  4RJT A;  2GA1 A;  1M1J C;  1ZME C;  4UB6 H;  1Q81 Q;  4WY4 B;  2FYU G;  1KFN A;  3RBZ A;  1H0T B;  1NKN A;  3F89 A;  4UB8 H;  1NU1 K;  2LXB A;  3GF3 A;  2KIK A;  1FC2 C;  1BCC E;  1YI2 P;  2PRR A;  3O6Q B;  5AW2 B;  1SQQ K;  1U7M A;  3A7O A;  3CX5 I;  3RK3 B;  3L70 E;  1K8A Q;  1SQP K;  2IFN A;  3K5B A;  1NU1 E;  1IFI A;  5E79 H;  1L2P A;  3ITK A;  1LTT C;  3AE5 C;  1VF5 C;  2WSF J;  4PJ0 H;  2WWW A;  1IJD B;  4JBZ A;  1GW4 A;  1SQQ E;  3AEE C;  3RK2 D;  5KTB A;  1OW6 A;  5APQ A;  1HJ0 A;  1PL5 A;  1SQP E;  2LXC B;  1A02 F;  2Z5H A;  1LT9 A;  1EZV G;  3PRJ A;  5APS A;  1G2C B;  3TGU D;  3CCQ P;  2KSE A;  3RL0 g;  1KZU B;  1KQF B;  2E75 C;  1MKM A;  3S9O A;  1JY3 P;  2Q7C A;  3KZI E;  1JCC A;  3M0D A;  5AVU B;  3VP9 A;  2O01 H;  3FX0 A;  1JMB A;  1OVV A;  3CWB G;  4W7Z A;  1L0L G;  1BSH A;  4Y28 J;  2KZJ A;  1JO5 A;  2YNY A;  5AW0 B;  2P10 A;  2XV5 A;  3PP5 A;  4HJG H;  1YIT P;  2ZXE B;  3HD7 A;  3P32 A;  1BE3 G;  1LT9 C;  4WY4 D;  1X0T A;  3QWO C;  3H1J D;  1FJK A;  3TDK A;  2JO1 A;  3GHG B;  3R2P A;  5KLV K;  1FDO A;  2FYN C;  4ASW A;  1KQL A;  3G3Z A;  4U3F J;  1S2E A;  1MZ9 A;  3M0D C;  3LW5 J;  3L35 A;  1BDD A;  3H1L J;  2KSJ A;  3RK3 D;  1PV3 A;  4N78 E;  1OVU A;  5KLV E;  2OYH B;  2YMY A;  1SLQ A;  1BCC G;  2N9Y B;  4PD4 D;  1ZRT E;  2J5U A;  3AEG C;  3RL0 C;  3A5T A;  1CSB A;  2NPS B;  3MTU E;  1KYO H;  4C7N B;  3L70 G;  3AE3 C;  2HOD B;  3H1L E;  4YXD C;  3U1C A;  1NU1 G;  2E42 A;  1H8A A;  3HD7 C;  1R8E A;  2HG5 D;  1SQQ G;  3V4Q A;  2WSF H;  2M0B A;  3KPE A;  2WQY C;  2WVR A;  1DD4 A;  1SQP G;  3KZI H;  2J59 M;  1CI6 B;  1X79 B;  5AVZ B;  3BRT B;  2E74 B;  5AW6 B;  5AVW B;  1PGP A;  4H13 C;  3T97 B;  2FYU D;  2M5A A;  1N73 B;  3PH0 A;  3JC2 2;  2HFE D;  3D6Y A;  5APT A;  5KLI B;  2POH A;  3JSV C;  1VQK P;  4WVZ A;  1HJB A;  3TGU J;  1GK4 A;  2WPV B;  5APX A;  4CPG A;  1W5C E;  4QMA A;  3NMD A;  3AE9 C;  1NTK K;  1M56 D;  3N4X A;  3HE4 B;  2N1T A;  3SWY A;  5KJ7 A;  2Q9I A;  2KUB A;  3II6 A;  2C9L Y;  2K1A A;  2G8Y A;  3KXD A;  1AA0 A;  1YJN P;  1T3J A;  2MJZ A;  1CZQ A;  2E5T A;  1EZV D;  2JWA A;  2O1K A;  2WT7 A;  3TNU A;  1P84 E;  4Y99 C;  2BCC E;  2NPS D;  3AEC C;  3F5H A;  3C9I A;  1NJI Q;  1D7M A;  5KLV G;  2YO3 A;  3AE4 C;  3H1J J;  1OFC X;  2YIU B;  3CWB D;  1L0L D;  5DJU B;  2AXT E;  1UIX A;  2AEJ A;  3MHV A;  3W68 A;  1LJ2 A;  2OYI B;  2E43 A;  4A7P A;  2N1T C;  5KJ7 C;  2W6A A;  1Q2N A;  3AE1 C;  3P8C D;  3JCU E;  1FZC B;  3LID A;  1FDM A;  2E74 D;  3WMM 0;  3L73 J;  1FZA A;  1NTZ D;  1LP1 B;  2QJY B;  3EQ2 A;  1BE3 D;  1R5S A;  1LWU A;  4AQR D;  3H1H D;  1JNM A;  5DJT B;  3IAO A;  3RGU A;  2GUV A;  3V2P A;  3LIE A;  2FFD B;  2E5Y A;  4M3L A;  3L73 E;  1K04 A;  3VMZ A;  1S72 P;  3V5B A;  3L72 G;  3CC4 P;  3L71 E;  1QVG O;  3H1K J;  4H0L C;  1S5L E;  3B5N A;  2PFX A;  1HGV A;  1BCC D;  5APW A;  1YTZ I;  4C46 A;  2E76 C;  3H1I E;  3L70 D;  2FYU J;  2IDB A;  1NU1 D;  2V7Q J;  3H1K E;  3TSI A;  2L91 A;  1KMI Z;  2QIW A;  2KNC A;  1DD3 A;  3CL3 D;  2UWJ E;  4N3Y B;  1N2D C;  1SQQ D;  1JY2 O;  3EFG A;  2FBW C;  1SQP D;  1NTK G;  4R4L A;  1M1J B;  1URQ C;  2FYU E;  2RKL A;  1G1J A;  4I7Z B;  3HE5 A;  5CBO A;  5CJ0 A;  1HH0 A;  1ZR4 A;  1RQU A;  3B5N C;  2BCC G;  1QX8 A;  2AXT H;  4LGD E;  3SFE C;  1E5W A;  1PPJ G;  2H8P D;  1TU3 F;  3E7K A;  3JCU H;  1K05 A;  1KIL A;  2PAJ A;  1S9K E;  1NWQ A;  1J1D B;  3BVH A;  1JOC A;  1SP4 A;  5KAI E;  1HBW A;  3L74 G;  1VQM P;  4D6T E;  1GMJ A;  1AVY A;  3CWB J;  3KYQ A;  3VN0 A;  1RH5 B;  5TIS E;  1YHQ P;  5CMZ A;  1YTZ T;  3HRN A;  4EOT A;  2W90 A;  2GM4 A;  2R44 A;  2QG4 A;  3CC2 P;  1GW3 A;  3CWB E;  1BE3 J;  1LTG C;  3L71 G;  4N78 D;  4BWN A;  5KLV D;  3BAT A;  1QGK B;  1QL2 A;  2YXR B;  1IFD A;  1ZRT D;  2PP6 A;  1U57 A;  5BU8 B;  3H1I G;  3H1L D;  1S5L X;  4WWI A;  1KB9 E;  1NOH A;  1LT1 A;  3HUS B;  3H1K G;  4RES B;  2V7Q H;  3AED C;  1T2K D;  1BCC J;  3H32 A;  4AUW A;  2ZVN B;  2H88 C;  3PTZ A;  3L70 J;  3M9B A;  1PP9 E;  2WPQ A;  3CME P;  1T6A A;  4KJM A;  1PIX A;  5CCH D;  1NU1 J;  1FZG A;  1NTM K;  3TYY A;  1DIP A;  4K3A A;  5AVX B;  5AVV B;  1RE4 A;  1SQQ J;  2KYV A;  2HPC A;  2QE7 H;  1SQP J;  1BGY E;  1FZE A;  1IFJ A;  2K37 A;  1NTM E;  3A0B E;  1VQ6 P;  4W80 A;  1HF9 A;  4EDF A;  2B9B A;  3HD7 B;  5KAI H;  1DEE G;  1JY3 N;  4PD4 I;  1ZLL A;  3AE8 C;  3OA7 A;  3IF4 A;  3CXH I;  1KV4 A;  2KI7 B;  3GF7 A;  4DJG A;  5M1B A;  1ZN5 A;  2IFM A;  1ZXG A;  2QJP B;  2ZT9 B;  4KHX A;  4D6T G;  2MKV A;  2K9J A;  3VMA A;  2YKO A;  1FAV A;  2WIT A;  3CCL P;  1OX3 A;  1RE4 C;  1EDK A;  4NPF X;  2P7J A;  5APV A;  1P84 D;  2IBZ I;  3WUV A;  2M8R A;  4ZMD A;  2BCC D;  3RK2 C;  1PPJ D;  3FXE A;  1KQS O;  1KB9 H;  1DX7 A;  1HGZ A;  3P8M C;  2OYO A;  1H0T A;  2JDI H;  3UIA A;  5APU A;  1R5L A;  3TK1 A;  5GTH H;  2R3S A;  2YKQ A;  3O6Q A;  4HH2 A;  5BU5 A;  2I8D A;  1EXJ A;  5KLV J;  3D71 A;  2KS1 B;  1H89 A;  1KIL E;  2HR3 A;  5EFW B;  3B4S A;  1QVF O;  4JF7 A;  2M3E A;  1Y9B A;  5AW5 B;  5CHX A;  1PP9 G;  1NKZ B;  2ITA A;  1RF1 C;  4ZKP A;  3WUU A;  1LTS C;  2OTK E;  1HUC A;  1OWA A;  1EZV I;  3A0B H;  1RQV A;  3HD7 D;  3L73 D;  2H7H A;  1AJY A;  4I1L A;  3L71 D;  5KKZ B;  1QLE D;  1IZN B;  3CX5 D;  4WY4 C;  2IPP A;  1BGY G;  1Y47 A;  2YKP A;  4L73 A;  1H88 A;  1NTM G;  3Q5R A;  1GL2 B;  2NZ2 A;  3BAS A;  2ZXX A;  2ZT9 D;  3H1I D;  5H2F E;  2IX7 C;  1SQV J;  1MFT A;  3L72 J;  1N86 A;  2HLO A;  3EFF K;  3TF5 A;  1FU1 A;  1YYC A;  4EI2 A;  3RK3 C;  3H1K D;  1LTJ B;  1SQV K;  2OGU A;  3GMA A;  5CCG D;  4GKG A;  3Q3D A;  2XZR A;  3VYI A;  1VL2 A;  3MUD A;  3FWL A;  4L75 A;  1SQV E;  1OZH A;  1YJ9 P;  1SQX K;  1PZQ A;  3L72 E;  4I6M C;  2K88 A;  3RBX A;  3M91 A;  1IK7 A;  3D6Z A;  3B8E B;  2O1J A;  4OWF A;  4DT0 A;  2AXC A;  3GHG A;  1LTI C;  4OGQ B;  1SQX E;  3MIW A;  5AVS B;  1X9V A;  3P7K A;  1NTK J;  4C7R A;  1WMK A;  4BXL A;  4GOE A;  4RO0 A;  3NFQ A;  2Q3E A;  3FGA D;  2ZYG A;  1S9K D;  1LWU B;  4PV1 B;  2M3B A;  3CD6 P;  2YXQ B;  2RMZ A;  2BCC J;  1NTK E;  4ZNC A;  2WPS A;  1VQ7 P;  5AVY B;  3NTN A;  2NPS A;  4GIF A;  2H43 A;  4C7N A;  3Q2Y A;  3AEF C;  4D6T D;  2HOD A;  3MUD C;  3Q1M A;  4NPE A;  2ZVO B;  1KYO I;  1J1E B;  1L0N K;  2RH0 A;  1YQ3 C;  1T8Z A;  4W7Y A;  1OW8 A;  1PPJ E;  1S4X A;  3GHG C;  1GL2 D;  3AE6 C;  2WSE J;  1FZB A;  4Z1M H;  3L74 J;  1CI6 A;  1NAY A;  4HKZ H;  4B86 A;  3MD0 A;  1OVR A;  2B88 A;  2RN0 A;  4JYB A;  2A45 H;  1JUN A;  5C39 A;  1SQB J;  4WBA A;  3E1I A;  3T97 A;  2QJK B;  1N73 A;  2OYH C;  2O3J A;  5AW3 B;  5B5E E;  1SQB K;  2ZAE B;  1NGM B;  3I5C A;  1VQO P;  3L74 E;  1PGJ A;  3A0H E;  3E1R A;  2A45 G;  1KB9 D;  1N8R Q;  3L71 J;  2NPS C;  3V4W A;  1N7S B;  3WU2 E;  2IZ0 A;  1SQB E;  1URQ A;  3L36 A;  4XA4 A;  3KDP B;  1RF0 A;  3H1I J;  4OGQ D;  3G4S P;  1EXI A;  2KOG A;  1SQV G;  1PP9 D;  2Y0D A;  3GLM A;  3CX5 E;  1KIL B;  1EDL A;  2E74 C;  1EDI A;  1NYH A;  2J58 A;  2IYO A;  2VRS A;  1SQX G;  4TT3 H;  4PV1 D;  4XE5 B;  4XFJ A;  1BGY D;  2D2C B;  1N73 C;  3CXH E;  2DW3 A;  1NTM D;  3PHL A;  1L4A B;  2KLU A;  5KLI C;  4R4M A;  1XTC C;  3W67 A;  1PGQ A;  3NXS A;  1SFC B;  1DH3 A;  2IYP A;  3CC7 P;  5KAF E;  2W6J H;  1P84 H;  2C9N Y;  1GK6 A;  1JEK A;  2K3R A;  3HTK A;  1LGH B;  2OYI A;  3V2N A;  1RF0 C;  4IFF A;  1FZC A;  1S1C X;  3IR9 A;  1U7J A;  3V2Q A;  2IBZ E;  2IZ1 A;  1LP1 A;  1AQ5 A;  4IFD K;  2B89 A;  3GG2 A;  4WB4 A;  5TJH A;  5B5E H;  1SVF A;  4D6T J;  1VF5 B;  2WSE H;  2O01 N;  1L0N G;  1NVO A;  3A0H H;  4HYT B;  1KC8 Q;  1GD2 E;  2ZJS E;  1N7S D;  1Y8A A;  2B87 B;  3PLN A;  3L4F A;  2W83 C;  3H32 B;  2NRG A;  2YIU C;  3L75 J;  1AQT A;  3VMX A;  1VQ8 P;  3IN6 A;  4N6J A;  2OYI C;  3OJA B;  2E75 B;  5E79 E;  1FZC C;  1SQB G;  2BEZ F;  1KIL D;  4L76 A;  3CX5 H;  1S5L H;  2I1K A;  1YQ4 C;  4PJ0 E;  2QJY C;  3U59 A;  3L75 E;  1X8Y A;  1IFM A;  1KQG B;  2WSC H;  5AW1 B;  2KZI A;  1HVV A;  2D2C D;  1T3U A;  1L4A D;  1FDI A;  1JY2 N;  2G3A A;  1CW5 A;  1ZW0 A;  3BCC E;  2FFD C;  1YJW P;  2JEE A;  1SFC D;  3R4Y A;  4DZO A;  3VOP A;  4DCK A;  1PP9 J;  5KAF H;  3Q5P A;  4L74 A;  1OXZ A;  1LT9 B;  4BRY A;  2CPB A;  1FS0 E;  1PFI A;  5CCH A;  2XDJ A;  1W2B O;  2W8Z A;  2FYN B;  2KLV A;  2L5G B;  2Q3I A;  2YMK A;  5CBN A;  1BGY J;  1M8O B;  1NTM J;  4OVN F;  5APY A;  1AFO A;  1SQV D;  1VF5 D;  2IBZ G;  3L72 D;  3MP7 B;  3RL0 B;  4H44 C;  3CCV P;  2AEM A;  1M90 Q;  2KB7 P;  1LNQ A;  4I7Z C;  4YXW H;  1OMI A;  1T2K C;  2Q1K A;  1SQX D;  3CMA P;  2Y0E A;  1PGO A;  2Y0C A;  2H89 C;  3M0A A;  3AE2 C;  3I56 P;  2WPR A;  1YIJ P;  3IFM A;  5CCH C;  5TIS H;  2E75 D;  1RY3 A;  1WRG A;  1MV8 A;  1MFZ A;  4I2L C;  3CCU P;  2KP8 A;  1FOS E;  3Q5S A;  1NTK D;  2FXP A;  1KYO E;  4H13 B;  1J1D C;  1JTH A;  3U1A A;  4YPC A;  3BRV B;  3G71 P;  3HUS A;  2LKM A;  1RF1 A;  1EDJ A;  3SWF A;  1VQN P;  3L75 G;  3WUT A;  2P2U A;  2XND H;  2HYN A;  2WTY A;  2R5D A;  1X22 A;  1M7L A;  2BEQ D;  2K9Y A;  2V4H A;  1JB0 J;  3CLQ A;  4AYC A;  1KTM A;  3BCC G;  3C1L A;  1VPC A;  2OTL P;  4WY4 A;  4ZKU A;  3CCJ P;  4GOD A;  3VTP C;  1L0N D;  4GDO A;  1NAF A;  1KN7 A;  5AW8 B;  1UII A;  2KK7 A;  1OIP A;  1USD A;  2WMM A; 
#chains in the Genus database with same CATH homology
 3O6Q B;  2AXC A;  2O01 N;  1OZH A;  2RH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...