2AXCA

Crystal structure of cole7 translocation domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
236
structure length
232
Chain Sequence
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Colicin E7
publication title High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Hydrolase
total genus 57
structure length 232
sequence length 236
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2axcA02
2AXCA 3O6QB 2O01N 1OZHA 2RH0A
chains in the Genus database with same CATH superfamily
5AVSB 3CX5I 1LWUC 3GW6A 1USDA 4EI2A 1KQLA 5CCGA 4OWFA 1IFJA 1KQGB 2WZ7A 1VQ5P 1ZV8A 1S4XA 3EFFK 1GL2D 3VOPA 3PHLA 1AVOA 3KPEA 4TLFA 3WU2E 2IBZD 4W7YA 1LJ2A 3AEFC 5AW1B 2E75B 2N1TB 1KYOH 2JO1A 3S4RA 5E79E 3C9IA 3EWKA 1VDFA 4IFFA 2A45I 1BSNA 3H32B 4RJTA 5CCHA 4U3FJ 2IPPA 1IC2A 1PPJE 1LTBC 2BCCD 1KFNA 3B8EB 3U1CA 1NJIQ 1A02F 3L71E 1KB9D 1ZR2A 1NTME 3D6ZA 3H1KE 1GK4A 4C7RA 4KJMA 1HWTC 2WT7A 2Q3IA 3T97A 1Q7YQ 1MKMA 4IL6X 2KLUA 4L74A 1L0NE 1RE3C 1M1JA 3Q1MA 4UB8E 1L4AC 3LW5J 3C8VA 1EZVE 3RK3C 1ZN5A 3S1KA 1L0LK 1HGZA 5CCGC 1EXIA 3CCQP 3EQ2A 1IFDA 3Q5RA 2FXOA 3B5NA 3FWNA 3A0BE 3TGUG 1TU3F 4H13B 4PV1D 5AW9B 3A0HE 5H2FH 3I56P 2V4HA 5APSA 5CCHC 1PP9G 3L72D 1JY3P 2M3EA 3L35A 4BRYB 2FY8A 1BGYE 1MV8A 1RH5B 4EIJA 3PLNA 4GOEA 2YO2A 3NFQA 1SQBE 2IFNA 1AQ5A 4C7NA 5APVA 4LLHA 4L73A 3O8ZA 3L36A 4OGQB 4IL6H 2YKQA 1H8AA 4I6MC 3Q5SA 3CD6P 2WPVB 1NTKJ 2HLOA 3L70G 2BCCG 1VF5D 2MJZA 5APTA 3II6A 4DZOA 3CX5E 4I2LC 4IFMA 1NTMG 1IJDB 3H1LJ 4EYYQ 2YKOA 1AFOA 1U7MA 2A06D 1S5LE 3PH0A 2HYNA 3R2PA 2GA1A 3AE8C 1SQQJ 3B5NC 2P10A 2P1JA 3WU2H 2K9JA 1JY3O 5K5GB 3H1IG 2PAJA 1QX8A 3VYIA 1SQQD 3VP8A 2OYIA 1EDJA 4NPDA 1NTZE 3BVHA 3QH9A 3GMAA 1KILB 2I1JA 2QE7H 2WSFH 3CC2P 1LTAC 2HFED 2R5BA 3MGNA 1YI2P 1FBMA 3CCEP 4D6TJ 3L73J 4TT3H 3LW5H 1URQA 1K73Q 2H8PD 3AE4C 3CMAP 3M9BA 1LNQA 3L73D 1Q82Q 1ZMEC 1VQOP 1ZRTD 3U1AA 1HBWA 5AW3B 4Z1MH 5KLVG 1NU1J 1YJWP 3SFDC 5DJUB 4DCKA 3PJSK 2H43A 1SQPD 5KJ7A 4KHXA 1DEEG 1YTZT 1N73A 3G3ZA 1LTTC 2Q7CA 1NWQA 1YQ4C 3CWBJ 1OW7A 1DIPA 4IOIH 4Y99C 2KNCB 2M3BA 5B5EH 2OYIC 1BSHA 3ZDMA 3RK2B 3V2PA 4YXWH 2V7QH 2A06G 3KXDA 1R8EA 2XNDH 1VQ8P 4GDOA 1FC2C 4OVNF 2YMKA 1PGOA 1L0LE 2OGUA 5KKZB 4N78D 2E76C 1KC8Q 2HPCB 2JR8A 3RL0C 2WVRA 3L4FA 2YXQB 1SQVE 2LR2A 3SWKA 5AW2B 1QL2A 3AE5C 3BCCE 1URQC 3GHGB 2QJKC 1L4AD 3AEAC 3CCMP 3RK3D 2WTYA 5CCGD 3CPWO 1YJ9P 3KQGA 4EDFA 4RO0A 3PRJA 1GU4A 3OAKA 2ZYGA 5KJ7C 1RF0A 2KP8A 2JKVA 1CI6A 1N73C 2K37A 2JDIH 1LTGC 1YQ3C 3W68A 1LGHB 2G8YA 3CXHD 3K5BA 3PP5A 2PFXA 1AA0A 2G3AA 2FYUJ 1M7LA 2W83C 5CCHD 2KLVA 3JSVC 1H88A 1BCCJ 2FYUD 2A45H 3M91A 1SQPG 2ZT9B 3CI9A 1VQLP 1BCCD 2OARA 3H1HJ 5TISH 1FZCB 1KYOD 1SS1A 1T8ZA 3HE5B 4LC1A 2IFMA 1KILE 1MUUA 2N1TA 4Y28J 2IYOA 1N8RQ 2H89C 5EFWB 1KQSO 5M1BA 4BXLA 4DT0A 3JC22 3H32A 1LTSC 3H1JJ 3D71A 2D2CB 1L0LG 3HD7B 1KN7A 1AV1A 1PIXA 3HE4B 3H1JD 1IK9A 4JBZA 1U57A 3L74D 1RF0C 3B5ND 1FJPA 3RL0g 3BRTB 3L75D 5CHXA 1K9MQ 4K35A 1BE3J 4MN4C 5AVZB 2C0WA 2IZ1A 2K3RA 2M5AB 3NMDA 2FFDB 1RY3A 2M8RA 5AVRB 5AVWB 1Q2NA 1KORA 1NTKK 2E5YA 2RKLA 4A7PA 3W67A 3KYQA 2W27A 3M06A 2AXCA 3CC7P 2R32A 4PD4I 2Q6QA 3GF7A 2YO3A 4W80A 3WUUA 4HKZH 1SLQA 2N1TC 1S2EA 1DD3A 4GT1A 5GTHE 3M9QA 1NHLA 1SQQK 4GOFA 1IFMA 4YTPC 1IO4A 4I7ZB 4GIFA 3PTZA 4YXDC 1NH4A 3TGUE 1MZ9A 2ZXEB 2NPSB 2YNYA 2Q5UA 3E7KA 2Q1KA 3SSUA 1NVOA 2Y0EA 1P84E 3AEDC 1VPCA 1HJBA 4RESB 1PP9E 2OYHB 2K9YA 5B66E 3M0DA 3D70A 1FZEA 3LIEA 3I55P 3KDPB 5CJ0A 1U7JA 4B86A 5AVXB 2Y9ZA 2BASA 3A7OA 1SQXJ 3L74G 2QRXA 3O6QB 1AQTA 1YTZI 1EQ7A 4N6JA 1HH0A 1SQXD 1SQPK 2E76D 3C1LA 3L75G 3L70E 2BCCE 1RF1C 4U3FD 5BU8B 3RL0D 1NU1K 4H13C 1G2CB 3A3YB 2O3JA 1PPJD 1URQD 4H44D 3MUDA 3L71J 3CCVP 4UB6E 2WSSH 2WSFJ 1NTMJ 3P8MC 2YIUC 3H1KJ 1LT9B 2E5TA 1LWUB 5BVZA 3HTKB 3N7NA 3H1IE 4WY4C 3H1KD 1L0NJ 2PP6A 1KILA 1FZGA 2ZVNB 2IYPA 1VQKP 1N86A 3GF3A 2E74D 2YKPA 1L0ND 2N9YB 3AE1C 3M0DC 2BEQD 5TJHA 3KZIE 2ZYDA 5APQA 1FZFA 4M3LA 2Y9YA 1YHQP 3P7KA 3VN0A 1T2KC 1GDTA 1NO4A 1EC5A 1KZUB 3TK1A 2KUBA 3L72E 2XKMA 2M0BA 4XFJA 1R5LA 1W2EA 1JY2P 2P2UA 1S1CX 1Y9BA 5AW6B 2IBZG 2V7QJ 4PD4E 2WQYC 5AVVB 1H0TB 5CBNA 1SFCA 5KLVE 5APWA 1BGYJ 2WPSA 1FZBA 1PGPA 3MP7B 3MUDC 2QJYC 1JY2N 1Q81Q 2KNCA 1L4AB 1RHZB 2E43A 1SQBJ 2AXTE 2FYUK 1M1JC 2AEJA 1OXZA 5C39A 1SQBD 1KILC 4WB4A 3V2RA 1NTKD 1P84H 2HPCA 2A06E 1N7SA 1OFCX 5B66H 3CXHI 1KTMA 3H1LD 1QL1A 5AW4B 3V4WA 3GHGA 2OTJP 1Q86Q 1JY2O 4CPGA 3KHUA 4WVZA 1E79H 5E79H 2JWAA 1ZR4A 5AVUB 2RH0A 1A02J 3TNUB 4H0LD 1NYHA 1LTJB 1RE4A 2ZAEB 1MFTA 1FDMA 2I8DA 3G6EP 1ZLLA 2N1TD 1NTZJ 1SFCC 3TYYA 4NPEA 1KQFB 5AW5B 3OA7A 2Z5IA 1NTZD 4UB6H 1AVYA 3TSIA 3L72G 1J1DB 3CLQA 2I1KA 3WMM0 2B87A 3G71P 4R4LA 4D6TD 4UB8H 4XE5B 2WMMA 1VQ7P 1FZCA 3QWOC 2NRGA 3MTUE 2WSCH 1SQPE 1S72P 1N7SC 1S5LX 5BU5A 1T3JA 1NU1D 3G9RA 2WSEJ 3A0BH 3KZIH 1N2DC 3GHGC 2WPRA 3VMXA 1OVRA 3HD7A 3A0HH 1X8YA 1NTKG 2O01J 3V5BA 1KD1Q 3CWBD 3HE4A 1Q90D 2HODB 3AEGC 1GTWA 1HTLC 1RE4C 1JTHB 2R3SA 1JNMA 3H1LG 4H13D 4ZNCA 2OTKE 4PD4H 4N78E 3FGAD 1OIPA 1OZHA 2PGDA 1L0LJ 1SQQG 2OTLP 2K88A 3P8CD 1PFIA 3V2NA 2M5AA 2FFDA 2JEEA 4YPCA 2LXBA 2IX7C 2ZT9C 2AXTH 3AE3C 1SQVJ 2FYNC 4WY4D 3GG2A 1KFMA 1USEA 1K04A 3V4QA 3BCCJ 5KAIE 2QEXP 1N7LA 1SQXK 3CX5H 2KS1B 1MFZA 3E1RA 3FWLA 3HRNA 3BCCD 1GL2B 3M9HA 1S5LH 1X79B 5AVTB 1T3UA 1T6AA 3CXHE 2IBZI 1J1EC 3G4SP 4N3YB 2XU6A 1OX3A 3L73G 3RGUA 3NXSA 3D6YA 1NKZB 2D2CC 1T2KD 1FOSF 3S9OA 3HD7C 5KAFE 2NPSA 2QIWA 5AW0B 3RBZA 3CC4P 2E76B 1OWAA 5KLIB 1NU1G 4NPFX 1AJYA 1IK7A 1L0NK 1GU5A 1PV3A 1OVUA 4ZKUA 1W2BO 1KB9I 4AYCA 3H1HD 1URQB 4GKGA 4H44B 4LGDE 3CCJP 1W5CE 2W6AA 3CWBG 1M57D 2Y0CA 2ZVOB 2H88C 2HG5D 1S9KE 2C0XA 1WRGA 1OW6A 3IN6A 1FJKA 1QGKB 1LTIC 4JPZB 4KT0J 1SP4A 3U59A 2W6BA 2E74B 2YXRB 2B89A 3L74E 1G2CA 2WSEH 2GUVA 4C46A 2QSIA 4WWIA 4PV1B 5AW7B 2KYVA 3L75E 1LT9A 4JQ0D 1JCDA 2O01H 1LWUA 1ZXGA 4PJ0E 1Y47A 3HTKA 2OQQA 2NPSC 1BE3D 2ZYAA 1SQBK 2J59M 3E1IA 1VL2A 2IDBA 1NKNA 1SFCD 3I5CA 4XA4A 3VMYA 2O1KA 3CCUP 4HJGH 3ABVC 1FE6A 2E75C 4ASVA 4BWNA 2FYUG 1QLED 1PL5A 4DOJA 1JB0J 2CPSA 1UIIA 1VF5B 1BCCG 2IZ0A 3CXHH 1UIXA 2QJPB 4ASWA 1DD4A 4BRYA 5KAIH 1CI6B 1LP1B 1NAYA 3TGUJ 1RQVA 3H1HG 1N7SD 1H0TA 2W8ZA 1SVFA 3HUSB 1GD2E 3BATA 2KXPB 2GM4A 1FU1A 3TGUD 2XZRA 1L4AA 1PP9J 2IBZE 1NTZK 1YITP 1LT9C 3IF4A 2Z4EA 2R5DA 2KI7B 1P84D 3H1JG 5KAFH 2K1AA 1PP9D 1M8OB 4GODA 4OH8B 4H0LB 1X22A 1PZQA 1YJNP 1VQ6P 1JUNA 1SQXE 1JMBA 1PGQA 1JOCA 2AEFA 4U3FE 1K05A 1CSBA 1VQMP 2L5GB 3ITKA 1JO5A 3AECC 1KB9E 3L70J 1GW3A 2BCCJ 1BE3G 3TF5A 1RQUA 2ZT9D 3L70D 2BEZF 1EDLA 3L71D 3TNUA 2VRSA 1LTJA 1NTMD 4JYBA 1FZAA 1Z56A 5KJ7D 4HYTB 2NZ2A 3AEEC 3H1IJ 2KSEA 2FYZA 2HR3A 3GLMA 1G1IA 3RBXA 3R4YA 2FBWC 3H1ID 5KTBA 1HUCA 2WSCJ 2D2CD 1M56D 4OGQC 1EZVD 3HD7D 5L8RJ 4PJ0H 4O9BA 1NAFA 2QVAA 3F89A 1IZNB 3A5TA 1RF1B 4ZMDA 3B71A 1SQVK 1JMMA 2KK7A 2J5UA 3MZWB 1CZQA 2XNXA 3L72J 2Z5HA 5B5EE 2AEMA 1CW5A 2YIUB 1X0TA 5APYA 5GTHH 1XTCC 5KLVJ 4WY4B 2XV5A 2ZJSE 4ZKPA 2HODA 4PD4D 3RK3B 1BGYD 1QVFO 4QMAA 2LKMA 1HVVA 1SQXG 3CCLP 5KLVD 2UWJE 1LTJC 1JTHA 4U3FG 3EFGA 3MD0A 1JY3N 3JCUE 1NTKE 2B88A 2JWDA 1GW4A 1PPJG 2Q3EA 2MKVA 2O01N 3SWYA 3SWFA 1JEKA 1QVGO 2FXPA 4WBAA 3A2AA 1J1DC 3H1LE 3V2QA 3CX5D 3L71G 2NPSD 3H1KG 1VQPP 1SQQE 2R44A 2KS1A 3L37A 1L0NG 2P67A 1K8AQ 3WUVA 1GL2A 3H25A 5APXA 1VQ9P 4K3AA 3VP9A 1KYOI 1VQNP 1EZVG 2QJYB 2WT7B 1XTGB 2E75D 5AVQB 3T97B 1LT1A 1KB9H 1NGMB 3M0AA 1HF9A 1R5SA 1M1JB 3USSA 5AW8B 3UIAA 4DJGA 2YMYA 1YIJP 1OMIA 3TDKA 5TISE 2H7HA 2CPBA 3RK2C 5CMZA 1JCCA 2J58A 2Q9IA 2N9BA 2QA4P 3SFEC 4D6TE 1WMKA 4JYCA 3OW2O 3L73E 4R4MA 1ZRTE 5KKZC 2RN0A 3VMAA 4RKUJ 3HE5A 5CJ4A 3B5NB 2WITA 1BDCA 2GUSA 5AVYB 3CMEP 1QEXA 1GMJA 1GZLA 1YBKA 5DJTB 1BGYG 1NU1E 1KMIZ 1SQPJ 3MHVA 1YYCA 2C9LY 4HH2A 1VQ4P 1IFIA 1S3JA 1SQBG 1IFNA 1OVVA 3BASA 3CL3D 1GK6A 3CWBE 1FDIA 1SFCB 1Y8AA 1GL2C 4C7NB 2R3CA 1M90Q 3P8CE 3V6IA 2LXCB 4HB1A 2P7JA 1DEBA 2FKWB 1E5WA 3AEBC 1L0LD 1NOHA 2KZIA 2RMZA 1M1KQ 5GTIE 3CCRP 2OYOA 1FDOA 3B4SA 3RK3E 2C9NY 5KLIC 1L2PA 2E42A 2W90A 2JJLA 1N7SB 2XDJA 1FZCC 3AE2C 1SQVD 3JCUH 2A45G 2K9JB 3F5HA 2KZJA 4H44C 3H6PA 2KB7P 1JM0A 1NTZG 4EOTA 1H89A 4OGQD 2WPQA 4Y99B 2O1JA 4AUWA 4AQRD 1DX7A 4D6TG 2PRRA 2OYIB 1KV4A 1FAVA 1P84I 4L76A 1LP1A 1NTMK 2FYUE 2E74C 1EDIA 3IFMA 3CCSP 4IFDK 3HUSA 2ZXXA 3N4XA 2JP3A 1BCCE 2POHA 2OYHA 3RL0B 1J2JB 1KYOE 1G1JA 2SPZA 3BRVB 1HJ0A 4PV1C 2Y0DA 1BDDA 2ITAA 2B87B 3H1HE 2WWWA 3FXEA 4JF7A 2FYNB 2QJKB 3WUTA 1D7MA 3IAOA 2FFDC 2QM8A 1X9VA 1DH3A 2L91A 3VMZA 3FXDA 3O6QA 4W7ZA 2QM7A 1OW8A 1KILD 1IFPA 4I1LA 1ZW0A 1N73B 3H1JE 1ZP0C 5APUA 1S9KD 2KSJA 1J1EB 3Q3DA 3AE6C 3L74J 1EZVI 4I7ZC 3FX0A 1VF5C 2DW3A 2CK3H 3AE7C 2QJPC 4L75A 3Q2YA 3L75J 1SQVG 1HGVA 1EDKA 5KLVK 4U7JA 1BE3E 3BCCG 2FXMA 3P32A 3HUSC 2KIKA 2OYHC 3Q5PA 2P58A 1EXJA 1ZOYC 1PGJA 3VTPC 2B9BA 5H2FE 3OJAB 3RK2D 4H0LC 1RF1A 2W6JH 5GTIH 3MIWA 3AE9C 3LIDA 5CBOA 1WT6A 1FS0E 2KOGA 1FOSE 3NTNA 4IL6E 2ZFCA 3IR9A 1RE3A 2QG4A 4WY4A
chains in the Genus database with same CATH topology
2AXCA 3O6QB 2O01N 1OZHA 2RH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXC A;  3O6Q B;  2O01 N;  1OZH A;  2RH0 A; 
#chains in the Genus database with same CATH topology
 5AVS B;  3CX5 I;  1LWU C;  3GW6 A;  1USD A;  4EI2 A;  1KQL A;  5CCG A;  4OWF A;  1IFJ A;  1KQG B;  2WZ7 A;  1VQ5 P;  1ZV8 A;  1S4X A;  3EFF K;  1GL2 D;  3VOP A;  3PHL A;  1AVO A;  3KPE A;  4TLF A;  3WU2 E;  2IBZ D;  4W7Y A;  1LJ2 A;  3AEF C;  5AW1 B;  2E75 B;  2N1T B;  1KYO H;  2JO1 A;  3S4R A;  5E79 E;  3C9I A;  3EWK A;  1VDF A;  4IFF A;  2A45 I;  1BSN A;  3H32 B;  4RJT A;  5CCH A;  4U3F J;  2IPP A;  1IC2 A;  1PPJ E;  1LTB C;  2BCC D;  1KFN A;  3B8E B;  3U1C A;  1NJI Q;  1A02 F;  3L71 E;  1KB9 D;  1ZR2 A;  1NTM E;  3D6Z A;  3H1K E;  1GK4 A;  4C7R A;  4KJM A;  1HWT C;  2WT7 A;  2Q3I A;  3T97 A;  1Q7Y Q;  1MKM A;  4IL6 X;  2KLU A;  4L74 A;  1L0N E;  1RE3 C;  1M1J A;  3Q1M A;  4UB8 E;  1L4A C;  3LW5 J;  3C8V A;  1EZV E;  3RK3 C;  1ZN5 A;  3S1K A;  1L0L K;  1HGZ A;  5CCG C;  1EXI A;  3CCQ P;  3EQ2 A;  1IFD A;  3Q5R A;  2FXO A;  3B5N A;  3FWN A;  3A0B E;  3TGU G;  1TU3 F;  4H13 B;  4PV1 D;  5AW9 B;  3A0H E;  5H2F H;  3I56 P;  2V4H A;  5APS A;  5CCH C;  1PP9 G;  3L72 D;  1JY3 P;  2M3E A;  3L35 A;  4BRY B;  2FY8 A;  1BGY E;  1MV8 A;  1RH5 B;  4EIJ A;  3PLN A;  4GOE A;  2YO2 A;  3NFQ A;  1SQB E;  2IFN A;  1AQ5 A;  4C7N A;  5APV A;  4LLH A;  4L73 A;  3O8Z A;  3L36 A;  4OGQ B;  4IL6 H;  2YKQ A;  1H8A A;  4I6M C;  3Q5S A;  3CD6 P;  2WPV B;  1NTK J;  2HLO A;  3L70 G;  2BCC G;  1VF5 D;  2MJZ A;  5APT A;  3II6 A;  4DZO A;  3CX5 E;  4I2L C;  4IFM A;  1NTM G;  1IJD B;  3H1L J;  4EYY Q;  2YKO A;  1AFO A;  1U7M A;  2A06 D;  1S5L E;  3PH0 A;  2HYN A;  3R2P A;  2GA1 A;  3AE8 C;  1SQQ J;  3B5N C;  2P10 A;  2P1J A;  3WU2 H;  2K9J A;  1JY3 O;  5K5G B;  3H1I G;  2PAJ A;  1QX8 A;  3VYI A;  1SQQ D;  3VP8 A;  2OYI A;  1EDJ A;  4NPD A;  1NTZ E;  3BVH A;  3QH9 A;  3GMA A;  1KIL B;  2I1J A;  2QE7 H;  2WSF H;  3CC2 P;  1LTA C;  2HFE D;  2R5B A;  3MGN A;  1YI2 P;  1FBM A;  3CCE P;  4D6T J;  3L73 J;  4TT3 H;  3LW5 H;  1URQ A;  1K73 Q;  2H8P D;  3AE4 C;  3CMA P;  3M9B A;  1LNQ A;  3L73 D;  1Q82 Q;  1ZME C;  1VQO P;  1ZRT D;  3U1A A;  1HBW A;  5AW3 B;  4Z1M H;  5KLV G;  1NU1 J;  1YJW P;  3SFD C;  5DJU B;  4DCK A;  3PJS K;  2H43 A;  1SQP D;  5KJ7 A;  4KHX A;  1DEE G;  1YTZ T;  1N73 A;  3G3Z A;  1LTT C;  2Q7C A;  1NWQ A;  1YQ4 C;  3CWB J;  1OW7 A;  1DIP A;  4IOI H;  4Y99 C;  2KNC B;  2M3B A;  5B5E H;  2OYI C;  1BSH A;  3ZDM A;  3RK2 B;  3V2P A;  4YXW H;  2V7Q H;  2A06 G;  3KXD A;  1R8E A;  2XND H;  1VQ8 P;  4GDO A;  1FC2 C;  4OVN F;  2YMK A;  1PGO A;  1L0L E;  2OGU A;  5KKZ B;  4N78 D;  2E76 C;  1KC8 Q;  2HPC B;  2JR8 A;  3RL0 C;  2WVR A;  3L4F A;  2YXQ B;  1SQV E;  2LR2 A;  3SWK A;  5AW2 B;  1QL2 A;  3AE5 C;  3BCC E;  1URQ C;  3GHG B;  2QJK C;  1L4A D;  3AEA C;  3CCM P;  3RK3 D;  2WTY A;  5CCG D;  3CPW O;  1YJ9 P;  3KQG A;  4EDF A;  4RO0 A;  3PRJ A;  1GU4 A;  3OAK A;  2ZYG A;  5KJ7 C;  1RF0 A;  2KP8 A;  2JKV A;  1CI6 A;  1N73 C;  2K37 A;  2JDI H;  1LTG C;  1YQ3 C;  3W68 A;  1LGH B;  2G8Y A;  3CXH D;  3K5B A;  3PP5 A;  2PFX A;  1AA0 A;  2G3A A;  2FYU J;  1M7L A;  2W83 C;  5CCH D;  2KLV A;  3JSV C;  1H88 A;  1BCC J;  2FYU D;  2A45 H;  3M91 A;  1SQP G;  2ZT9 B;  3CI9 A;  1VQL P;  1BCC D;  2OAR A;  3H1H J;  5TIS H;  1FZC B;  1KYO D;  1SS1 A;  1T8Z A;  3HE5 B;  4LC1 A;  2IFM A;  1KIL E;  1MUU A;  2N1T A;  4Y28 J;  2IYO A;  1N8R Q;  2H89 C;  5EFW B;  1KQS O;  5M1B A;  4BXL A;  4DT0 A;  3JC2 2;  3H32 A;  1LTS C;  3H1J J;  3D71 A;  2D2C B;  1L0L G;  3HD7 B;  1KN7 A;  1AV1 A;  1PIX A;  3HE4 B;  3H1J D;  1IK9 A;  4JBZ A;  1U57 A;  3L74 D;  1RF0 C;  3B5N D;  1FJP A;  3RL0 g;  3BRT B;  3L75 D;  5CHX A;  1K9M Q;  4K35 A;  1BE3 J;  4MN4 C;  5AVZ B;  2C0W A;  2IZ1 A;  2K3R A;  2M5A B;  3NMD A;  2FFD B;  1RY3 A;  2M8R A;  5AVR B;  5AVW B;  1Q2N A;  1KOR A;  1NTK K;  2E5Y A;  2RKL A;  4A7P A;  3W67 A;  3KYQ A;  2W27 A;  3M06 A;  2AXC A;  3CC7 P;  2R32 A;  4PD4 I;  2Q6Q A;  3GF7 A;  2YO3 A;  4W80 A;  3WUU A;  4HKZ H;  1SLQ A;  2N1T C;  1S2E A;  1DD3 A;  4GT1 A;  5GTH E;  3M9Q A;  1NHL A;  1SQQ K;  4GOF A;  1IFM A;  4YTP C;  1IO4 A;  4I7Z B;  4GIF A;  3PTZ A;  4YXD C;  1NH4 A;  3TGU E;  1MZ9 A;  2ZXE B;  2NPS B;  2YNY A;  2Q5U A;  3E7K A;  2Q1K A;  3SSU A;  1NVO A;  2Y0E A;  1P84 E;  3AED C;  1VPC A;  1HJB A;  4RES B;  1PP9 E;  2OYH B;  2K9Y A;  5B66 E;  3M0D A;  3D70 A;  1FZE A;  3LIE A;  3I55 P;  3KDP B;  5CJ0 A;  1U7J A;  4B86 A;  5AVX B;  2Y9Z A;  2BAS A;  3A7O A;  1SQX J;  3L74 G;  2QRX A;  3O6Q B;  1AQT A;  1YTZ I;  1EQ7 A;  4N6J A;  1HH0 A;  1SQX D;  1SQP K;  2E76 D;  3C1L A;  3L75 G;  3L70 E;  2BCC E;  1RF1 C;  4U3F D;  5BU8 B;  3RL0 D;  1NU1 K;  4H13 C;  1G2C B;  3A3Y B;  2O3J A;  1PPJ D;  1URQ D;  4H44 D;  3MUD A;  3L71 J;  3CCV P;  4UB6 E;  2WSS H;  2WSF J;  1NTM J;  3P8M C;  2YIU C;  3H1K J;  1LT9 B;  2E5T A;  1LWU B;  5BVZ A;  3HTK B;  3N7N A;  3H1I E;  4WY4 C;  3H1K D;  1L0N J;  2PP6 A;  1KIL A;  1FZG A;  2ZVN B;  2IYP A;  1VQK P;  1N86 A;  3GF3 A;  2E74 D;  2YKP A;  1L0N D;  2N9Y B;  3AE1 C;  3M0D C;  2BEQ D;  5TJH A;  3KZI E;  2ZYD A;  5APQ A;  1FZF A;  4M3L A;  2Y9Y A;  1YHQ P;  3P7K A;  3VN0 A;  1T2K C;  1GDT A;  1NO4 A;  1EC5 A;  1KZU B;  3TK1 A;  2KUB A;  3L72 E;  2XKM A;  2M0B A;  4XFJ A;  1R5L A;  1W2E A;  1JY2 P;  2P2U A;  1S1C X;  1Y9B A;  5AW6 B;  2IBZ G;  2V7Q J;  4PD4 E;  2WQY C;  5AVV B;  1H0T B;  5CBN A;  1SFC A;  5KLV E;  5APW A;  1BGY J;  2WPS A;  1FZB A;  1PGP A;  3MP7 B;  3MUD C;  2QJY C;  1JY2 N;  1Q81 Q;  2KNC A;  1L4A B;  1RHZ B;  2E43 A;  1SQB J;  2AXT E;  2FYU K;  1M1J C;  2AEJ A;  1OXZ A;  5C39 A;  1SQB D;  1KIL C;  4WB4 A;  3V2R A;  1NTK D;  1P84 H;  2HPC A;  2A06 E;  1N7S A;  1OFC X;  5B66 H;  3CXH I;  1KTM A;  3H1L D;  1QL1 A;  5AW4 B;  3V4W A;  3GHG A;  2OTJ P;  1Q86 Q;  1JY2 O;  4CPG A;  3KHU A;  4WVZ A;  1E79 H;  5E79 H;  2JWA A;  1ZR4 A;  5AVU B;  2RH0 A;  1A02 J;  3TNU B;  4H0L D;  1NYH A;  1LTJ B;  1RE4 A;  2ZAE B;  1MFT A;  1FDM A;  2I8D A;  3G6E P;  1ZLL A;  2N1T D;  1NTZ J;  1SFC C;  3TYY A;  4NPE A;  1KQF B;  5AW5 B;  3OA7 A;  2Z5I A;  1NTZ D;  4UB6 H;  1AVY A;  3TSI A;  3L72 G;  1J1D B;  3CLQ A;  2I1K A;  3WMM 0;  2B87 A;  3G71 P;  4R4L A;  4D6T D;  4UB8 H;  4XE5 B;  2WMM A;  1VQ7 P;  1FZC A;  3QWO C;  2NRG A;  3MTU E;  2WSC H;  1SQP E;  1S72 P;  1N7S C;  1S5L X;  5BU5 A;  1T3J A;  1NU1 D;  3G9R A;  2WSE J;  3A0B H;  3KZI H;  1N2D C;  3GHG C;  2WPR A;  3VMX A;  1OVR A;  3HD7 A;  3A0H H;  1X8Y A;  1NTK G;  2O01 J;  3V5B A;  1KD1 Q;  3CWB D;  3HE4 A;  1Q90 D;  2HOD B;  3AEG C;  1GTW A;  1HTL C;  1RE4 C;  1JTH B;  2R3S A;  1JNM A;  3H1L G;  4H13 D;  4ZNC A;  2OTK E;  4PD4 H;  4N78 E;  3FGA D;  1OIP A;  1OZH A;  2PGD A;  1L0L J;  1SQQ G;  2OTL P;  2K88 A;  3P8C D;  1PFI A;  3V2N A;  2M5A A;  2FFD A;  2JEE A;  4YPC A;  2LXB A;  2IX7 C;  2ZT9 C;  2AXT H;  3AE3 C;  1SQV J;  2FYN C;  4WY4 D;  3GG2 A;  1KFM A;  1USE A;  1K04 A;  3V4Q A;  3BCC J;  5KAI E;  2QEX P;  1N7L A;  1SQX K;  3CX5 H;  2KS1 B;  1MFZ A;  3E1R A;  3FWL A;  3HRN A;  3BCC D;  1GL2 B;  3M9H A;  1S5L H;  1X79 B;  5AVT B;  1T3U A;  1T6A A;  3CXH E;  2IBZ I;  1J1E C;  3G4S P;  4N3Y B;  2XU6 A;  1OX3 A;  3L73 G;  3RGU A;  3NXS A;  3D6Y A;  1NKZ B;  2D2C C;  1T2K D;  1FOS F;  3S9O A;  3HD7 C;  5KAF E;  2NPS A;  2QIW A;  5AW0 B;  3RBZ A;  3CC4 P;  2E76 B;  1OWA A;  5KLI B;  1NU1 G;  4NPF X;  1AJY A;  1IK7 A;  1L0N K;  1GU5 A;  1PV3 A;  1OVU A;  4ZKU A;  1W2B O;  1KB9 I;  4AYC A;  3H1H D;  1URQ B;  4GKG A;  4H44 B;  4LGD E;  3CCJ P;  1W5C E;  2W6A A;  3CWB G;  1M57 D;  2Y0C A;  2ZVO B;  2H88 C;  2HG5 D;  1S9K E;  2C0X A;  1WRG A;  1OW6 A;  3IN6 A;  1FJK A;  1QGK B;  1LTI C;  4JPZ B;  4KT0 J;  1SP4 A;  3U59 A;  2W6B A;  2E74 B;  2YXR B;  2B89 A;  3L74 E;  1G2C A;  2WSE H;  2GUV A;  4C46 A;  2QSI A;  4WWI A;  4PV1 B;  5AW7 B;  2KYV A;  3L75 E;  1LT9 A;  4JQ0 D;  1JCD A;  2O01 H;  1LWU A;  1ZXG A;  4PJ0 E;  1Y47 A;  3HTK A;  2OQQ A;  2NPS C;  1BE3 D;  2ZYA A;  1SQB K;  2J59 M;  3E1I A;  1VL2 A;  2IDB A;  1NKN A;  1SFC D;  3I5C A;  4XA4 A;  3VMY A;  2O1K A;  3CCU P;  4HJG H;  3ABV C;  1FE6 A;  2E75 C;  4ASV A;  4BWN A;  2FYU G;  1QLE D;  1PL5 A;  4DOJ A;  1JB0 J;  2CPS A;  1UII A;  1VF5 B;  1BCC G;  2IZ0 A;  3CXH H;  1UIX A;  2QJP B;  4ASW A;  1DD4 A;  4BRY A;  5KAI H;  1CI6 B;  1LP1 B;  1NAY A;  3TGU J;  1RQV A;  3H1H G;  1N7S D;  1H0T A;  2W8Z A;  1SVF A;  3HUS B;  1GD2 E;  3BAT A;  2KXP B;  2GM4 A;  1FU1 A;  3TGU D;  2XZR A;  1L4A A;  1PP9 J;  2IBZ E;  1NTZ K;  1YIT P;  1LT9 C;  3IF4 A;  2Z4E A;  2R5D A;  2KI7 B;  1P84 D;  3H1J G;  5KAF H;  2K1A A;  1PP9 D;  1M8O B;  4GOD A;  4OH8 B;  4H0L B;  1X22 A;  1PZQ A;  1YJN P;  1VQ6 P;  1JUN A;  1SQX E;  1JMB A;  1PGQ A;  1JOC A;  2AEF A;  4U3F E;  1K05 A;  1CSB A;  1VQM P;  2L5G B;  3ITK A;  1JO5 A;  3AEC C;  1KB9 E;  3L70 J;  1GW3 A;  2BCC J;  1BE3 G;  3TF5 A;  1RQU A;  2ZT9 D;  3L70 D;  2BEZ F;  1EDL A;  3L71 D;  3TNU A;  2VRS A;  1LTJ A;  1NTM D;  4JYB A;  1FZA A;  1Z56 A;  5KJ7 D;  4HYT B;  2NZ2 A;  3AEE C;  3H1I J;  2KSE A;  2FYZ A;  2HR3 A;  3GLM A;  1G1I A;  3RBX A;  3R4Y A;  2FBW C;  3H1I D;  5KTB A;  1HUC A;  2WSC J;  2D2C D;  1M56 D;  4OGQ C;  1EZV D;  3HD7 D;  5L8R J;  4PJ0 H;  4O9B A;  1NAF A;  2QVA A;  3F89 A;  1IZN B;  3A5T A;  1RF1 B;  4ZMD A;  3B71 A;  1SQV K;  1JMM A;  2KK7 A;  2J5U A;  3MZW B;  1CZQ A;  2XNX A;  3L72 J;  2Z5H A;  5B5E E;  2AEM A;  1CW5 A;  2YIU B;  1X0T A;  5APY A;  5GTH H;  1XTC C;  5KLV J;  4WY4 B;  2XV5 A;  2ZJS E;  4ZKP A;  2HOD A;  4PD4 D;  3RK3 B;  1BGY D;  1QVF O;  4QMA A;  2LKM A;  1HVV A;  1SQX G;  3CCL P;  5KLV D;  2UWJ E;  1LTJ C;  1JTH A;  4U3F G;  3EFG A;  3MD0 A;  1JY3 N;  3JCU E;  1NTK E;  2B88 A;  2JWD A;  1GW4 A;  1PPJ G;  2Q3E A;  2MKV A;  2O01 N;  3SWY A;  3SWF A;  1JEK A;  1QVG O;  2FXP A;  4WBA A;  3A2A A;  1J1D C;  3H1L E;  3V2Q A;  3CX5 D;  3L71 G;  2NPS D;  3H1K G;  1VQP P;  1SQQ E;  2R44 A;  2KS1 A;  3L37 A;  1L0N G;  2P67 A;  1K8A Q;  3WUV A;  1GL2 A;  3H25 A;  5APX A;  1VQ9 P;  4K3A A;  3VP9 A;  1KYO I;  1VQN P;  1EZV G;  2QJY B;  2WT7 B;  1XTG B;  2E75 D;  5AVQ B;  3T97 B;  1LT1 A;  1KB9 H;  1NGM B;  3M0A A;  1HF9 A;  1R5S A;  1M1J B;  3USS A;  5AW8 B;  3UIA A;  4DJG A;  2YMY A;  1YIJ P;  1OMI A;  3TDK A;  5TIS E;  2H7H A;  2CPB A;  3RK2 C;  5CMZ A;  1JCC A;  2J58 A;  2Q9I A;  2N9B A;  2QA4 P;  3SFE C;  4D6T E;  1WMK A;  4JYC A;  3OW2 O;  3L73 E;  4R4M A;  1ZRT E;  5KKZ C;  2RN0 A;  3VMA A;  4RKU J;  3HE5 A;  5CJ4 A;  3B5N B;  2WIT A;  1BDC A;  2GUS A;  5AVY B;  3CME P;  1QEX A;  1GMJ A;  1GZL A;  1YBK A;  5DJT B;  1BGY G;  1NU1 E;  1KMI Z;  1SQP J;  3MHV A;  1YYC A;  2C9L Y;  4HH2 A;  1VQ4 P;  1IFI A;  1S3J A;  1SQB G;  1IFN A;  1OVV A;  3BAS A;  3CL3 D;  1GK6 A;  3CWB E;  1FDI A;  1SFC B;  1Y8A A;  1GL2 C;  4C7N B;  2R3C A;  1M90 Q;  3P8C E;  3V6I A;  2LXC B;  4HB1 A;  2P7J A;  1DEB A;  2FKW B;  1E5W A;  3AEB C;  1L0L D;  1NOH A;  2KZI A;  2RMZ A;  1M1K Q;  5GTI E;  3CCR P;  2OYO A;  1FDO A;  3B4S A;  3RK3 E;  2C9N Y;  5KLI C;  1L2P A;  2E42 A;  2W90 A;  2JJL A;  1N7S B;  2XDJ A;  1FZC C;  3AE2 C;  1SQV D;  3JCU H;  2A45 G;  2K9J B;  3F5H A;  2KZJ A;  4H44 C;  3H6P A;  2KB7 P;  1JM0 A;  1NTZ G;  4EOT A;  1H89 A;  4OGQ D;  2WPQ A;  4Y99 B;  2O1J A;  4AUW A;  4AQR D;  1DX7 A;  4D6T G;  2PRR A;  2OYI B;  1KV4 A;  1FAV A;  1P84 I;  4L76 A;  1LP1 A;  1NTM K;  2FYU E;  2E74 C;  1EDI A;  3IFM A;  3CCS P;  4IFD K;  3HUS A;  2ZXX A;  3N4X A;  2JP3 A;  1BCC E;  2POH A;  2OYH A;  3RL0 B;  1J2J B;  1KYO E;  1G1J A;  2SPZ A;  3BRV B;  1HJ0 A;  4PV1 C;  2Y0D A;  1BDD A;  2ITA A;  2B87 B;  3H1H E;  2WWW A;  3FXE A;  4JF7 A;  2FYN B;  2QJK B;  3WUT A;  1D7M A;  3IAO A;  2FFD C;  2QM8 A;  1X9V A;  1DH3 A;  2L91 A;  3VMZ A;  3FXD A;  3O6Q A;  4W7Z A;  2QM7 A;  1OW8 A;  1KIL D;  1IFP A;  4I1L A;  1ZW0 A;  1N73 B;  3H1J E;  1ZP0 C;  5APU A;  1S9K D;  2KSJ A;  1J1E B;  3Q3D A;  3AE6 C;  3L74 J;  1EZV I;  4I7Z C;  3FX0 A;  1VF5 C;  2DW3 A;  2CK3 H;  3AE7 C;  2QJP C;  4L75 A;  3Q2Y A;  3L75 J;  1SQV G;  1HGV A;  1EDK A;  5KLV K;  4U7J A;  1BE3 E;  3BCC G;  2FXM A;  3P32 A;  3HUS C;  2KIK A;  2OYH C;  3Q5P A;  2P58 A;  1EXJ A;  1ZOY C;  1PGJ A;  3VTP C;  2B9B A;  5H2F E;  3OJA B;  3RK2 D;  4H0L C;  1RF1 A;  2W6J H;  5GTI H;  3MIW A;  3AE9 C;  3LID A;  5CBO A;  1WT6 A;  1FS0 E;  2KOG A;  1FOS E;  3NTN A;  4IL6 E;  2ZFC A;  3IR9 A;  1RE3 A;  2QG4 A;  4WY4 A; 
#chains in the Genus database with same CATH homology
 2AXC A;  3O6Q B;  2O01 N;  1OZH A;  2RH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...