2AXCA

Crystal structure of cole7 translocation domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
Knots found
sequence length
236
structure length
232
Chain Sequence
SNSSVAAPMAFGFPALAAPGAGTLGISVSGEALSAAIADIFAALKFSAWGIALYGILPSEIAKDDPNMMSKIVTSLPAETVTNVQVSTLPLDQATVSVTKRVTDVVKDTRQHIAVVAGVPMSVPVVNAKPTRTPGVFHASFPGVPSLTVSTVKGLPVSTTLPRGITEDKGRTAVPAGFTFGGGSHEAVIRFPKESGQKPVYVSVTDVLTPAQVKQRQDEEKRLQQEWNDAHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Colicin E7
publication title High-resolution crystal structure of a truncated ColE7 translocation domain: implications for colicin transport across membranes
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
total genus 57
structure length 232
sequence length 236
other databases KnotProt 2.0: S +31 +31 +31 +31
ec nomenclature ec 3.1.-.-:
pdb deposition date 2005-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2axcA02
2O01N 1OZHA 2RH0A 2AXCA 3O6QB
chains in the Genus database with same CATH superfamily
4LLHA 2ZYDA 2HFED 1HH0A 4PD4E 1YHQP 1VQ7P 4UB8H 1NU1J 3LW5H 3D71A 2NZ2A 2QVAA 3BCCE 1H8AA 2O3JA 2YIUC 2R5BA 2KZJA 4H44B 4L76A 3B8EB 2E76D 2IZ1A 4PV1D 4YTPC 4R4LA 4IFFA 1KYOE 3H1IJ 3U1CA 1N7SD 2YKOA 4NPEA 3CCQP 1SQPD 3A3YB 1QL1A 5H2FE 3D70A 1X8YA 2HLOA 4XFJA 2WSEH 5TJHA 1NAFA 2FFDB 2BASA 3JC22 1UIIA 4PJ0E 3VMYA 2RH0A 3MTUE 1X9VA 2W6BA 1PPJG 3SWYA 3TGUJ 2CK3H 4KHXA 3L72J 1A02F 4IL6X 3GHGA 2W8ZA 3TF5A 2HPCB 1FJKA 1URQB 1VQ8P 4C46A 3EFFK 1IFJA 2QJKB 2ZYAA 1K05A 1KILD 3CLQA 4JYBA 1OX3A 2BCCD 2CPBA 5AVRB 1L0NE 1U7MA 1S5LH 1OIPA 1LTTC 1SFCD 2IFMA 3CCSP 1KQFB 2C9LY 5BU8B 3G3ZA 4H44C 3Q1MA 3AEDC 2R44A 2POHA 3VMZA 4A7PA 2JEEA 1BE3J 2WTYA 3NXSA 2R32A 1N73A 3L75E 3O8ZA 5B5EE 2KYVA 2Q5UA 3SSUA 3L74E 3RK2D 1N7LA 1LTJB 4U3FJ 1KB9H 3ITKA 1NTKD 5AW6B 1M90Q 5L8RJ 2FFDC 2WSCJ 3QWOC 1FU1A 1SQXE 2W6JH 2PP6A 2QM8A 2KNCB 3KXDA 3A7OA 2YMKA 1JB0J 1FZAA 4H13D 1L0NK 4HYTB 1AQTA 3LIDA 2IDBA 1QL2A 1URQC 1NTMJ 1VF5B 2QJKC 3H1HJ 1SQVD 3KQGA 2ZXEB 4OWFA 2L5GB 3L35A 1RE4A 1HGVA 1SQBG 3P8MC 3M0DA 1LTJA 2K1AA 2SPZA 3OW2O 1YTZI 3AEGC 3P32A 3CXHI 5E79E 2JR8A 5APWA 1P84H 1BCCJ 3A0HH 1KILE 2WPQA 1NU1G 1PIXA 3QH9A 2OARA 1RHZB 1SQPK 5AVVB 1KD1Q 1ZXGA 2KNCA 1FDOA 2FYUD 1VL2A 4GT1A 1KFMA 2IBZE 4HJGH 3HE4A 1FOSE 3M0DC 1LTJC 3AEAC 3NTNA 1LNQA 3RGUA 1PGOA 1VQLP 4H0LB 2QE7H 5APQA 1KORA 1NGMB 4I1LA 3GLMA 2WSFH 3NFQA 2A06E 5B66E 5AVQB 1LT9B 3Q5SA 1JTHA 1K04A 2H7HA 1VF5C 3H1KD 2YMYA 4WBAA 4I7ZC 3OA7A 4ZKUA 1NYHA 3LIEA 2N9BA 1LWUB 4O9BA 2C0WA 1L0NG 3WUUA 5TISH 5AW1B 2GM4A 2V7QH 4W80A 3RBZA 3TK1A 1N7SA 2KLUA 1E79H 5AVTB 3PJSK 1GL2B 1YYCA 5AVUB 2QA4P 4D6TE 3AE3C 3L75G 1BGYD 1LT9A 2M3EA 4JYCA 4RKUJ 2ZJSE 3HD7A 2YO2A 2N1TA 1SQQE 2O01J 1EZVD 3KHUA 1MV8A 3L74G 3TDKA 4R4MA 1XTCC 2QG4A 2FYUE 3RL0D 2B89A 4EDFA 3G4SP 3L70J 1Y8AA 4HKZH 4UB8E 4U3FG 1SQXG 3U1AA 1LWUA 4IFDK 3VN0A 1M56D 4LC1A 3IF4A 1GTWA 1LT9C 3B5ND 5CBOA 3H1LD 4TT3H 4YPCA 3CWBE 4OVNF 2RMZA 5EFWB 1N2DC 1KB9D 3OAKA 1YI2P 1GL2A 2Y9ZA 1LT1A 3SWKA 3T97B 1CW5A 1SFCA 1LWUC 2D2CB 3H1KE 3MUDC 3VP8A 2ZVNB 2WWWA 1ZN5A 1KZUB 2E75D 3L36A 2MJZA 1PP9D 2FYUK 1OVVA 3PLNA 1KMIZ 1ZRTD 3H1JE 1FZEA 5KJ7C 1FJPA 1GK6A 3L73J 1FDMA 2Z5IA 1BSNA 3F5HA 1HVVA 3CX5I 3M9QA 3L71J 2IBZG 3FXEA 5APYA 3CC4P 2P58A 5GTIH 1EDIA 1OXZA 3BVHA 3GG2A 3CCRP 5M1BA 2ZAEB 3S9OA 3V5BA 1S5LE 1JMBA 3CXHH 1YITP 1FZCA 2A06G 2KK7A 3AE4C 1JY2N 1ZP0C 4AQRD 1K73Q 1AVOA 3H1ID 1NTZD 2KSJA 5AW8B 5KAFH 1L4AA 1L0LE 4HB1A 4L74A 2D2CC 3H1LE 1VQ4P 1NAYA 2ZYGA 2WPSA 4AYCA 4GOFA 1WT6A 1U57A 2Q7CA 1JOCA 1JY3O 2LXBA 3TGUD 5APVA 3L72D 4N6JA 2FYNB 3JCUH 1YBKA 1W2BO 4HH2A 3TNUB 4BXLA 1CSBA 1HF9A 3AE6C 2W27A 4D6TG 1PP9E 3CL3D 5KTBA 1ZRTE 3BCCJ 2A45H 1SQQG 2E74D 2FXPA 1DX7A 3CCMP 2B88A 2H43A 5KLVE 3H25A 3GHGB 2FYUG 1JY3N 1USDA 1PL5A 1L0LK 2WT7A 3C8VA 5CCGC 3CC7P 1M8OB 4M3LA 1IK7A 4KJMA 1P84E 2J59M 3A0HE 4WB4A 1PFIA 3L70G 1R8EA 4GOEA 2XDJA 1BE3D 1RF0A 1IZNB 3IAOA 4IL6H 1KC8Q 1H0TB 1Q86Q 3CWBG 2MKVA 1S72P 3AE7C 3C9IA 2NPSD 3TNUA 2XZRA 3EWKA 2R5DA 1KQSO 2ZT9D 3CPWO 1M1JA 1RY3A 2KSEA 1NTZE 3GMAA 2V4HA 1N73B 2RN0A 2AXTH 4IOIH 3I5CA 3M9BA 1FZGA 2JJLA 1QEXA 1GZLA 1NKZB 1IFIA 5C39A 5AW2B 1RQVA 3H32B 2FYNC 5KLVK 1FBMA 3H1JG 1OVUA 1QGKB 2M5AA 1L0NJ 1ZR2A 3H1HD 3L73G 1T8ZA 1NJIQ 1MUUA 1H0TA 2QJPB 1YQ4C 1K8AQ 1Y9BA 3L71G 3GHGC 4C7RA 4DOJA 2Z5HA 3L75J 1NH4A 3AE9C 5KJ7D 4WWIA 1FAVA 1BCCD 5AW0B 5TISE 1PV3A 3L74J 1PGJA 3P8CD 4I6MC 1NTZK 3Q3DA 1ZV8A 1FDIA 1QX8A 1T6AA 3RK3D 3H32A 1SQXJ 1SQPJ 2HG5D 5BVZA 4N78D 1LP1B 1AVYA 1SQPE 1IFPA 1L0LG 1OVRA 3KYQA 3H1LG 1OMIA 2R3CA 3CXHD 1N73C 3AEEC 1M57D 1BSHA 1VPCA 3CCEP 4IFMA 3A2AA 4Z1MH 2GA1A 3HE4B 2FXOA 2R3SA 2RKLA 5APSA 1K9MQ 2Y0EA 3K5BA 2IBZI 2OTJP 4JBZA 1VQ5P 3GW6A 4OGQD 3AEFC 3IN6A 4NPFX 1JMMA 2QJPC 2C0XA 2PAJA 3VMXA 4WY4B 4XA4A 3B4SA 4N3YB 2QEXP 2BCCJ 1S3JA 3MHVA 1JTHB 1KFNA 2IPPA 1LP1A 4JPZB 1R5SA 2AEFA 3BCCG 1VQPP 5CCHD 5KLVG 2KLVA 2ZVOB 3WU2H 2BCCE 2KS1A 3E1IA 3G71P 1J2JB 1CZQA 2C9NY 1NOHA 1Z56A 1DIPA 4I2LC 3M0AA 2L91A 2AEJA 4QMAA 1RE4C 2QIWA 3EQ2A 4RJTA 1WRGA 5KAIH 2K3RA 3PHLA 3IFMA 2IYOA 5H2FH 4W7YA 4UB6H 1T3UA 2G8YA 2E76B 1IFNA 3CCLP 2XV5A 1VQ9P 4PV1B 1N7SB 1OW7A 3RK3E 1GW3A 5CCGD 1ZR4A 5GTIE 4LGDE 2YKPA 1NTKE 4WY4A 2N9YB 1NTZG 4N78E 3CCJP 4DJGA 3ZDMA 3HD7B 3HUSB 2N1TB 3CXHE 3IR9A 4DCKA 4CPGA 2WITA 1LTAC 1EC5A 1VQKP 4DZOA 3AEBC 2WSSH 4ZKPA 2J5UA 1PPJD 5KAFE 4WY4C 2OYHB 5APXA 3G6EP 1SQVE 3N4XA 1Q2NA 3CI9A 5GTHH 1KILB 4D6TJ 1OWAA 1TU3F 1N86A 3M91A 1SQQJ 1FZFA 2Y0CA 1EDKA 1S1CX 1SFCB 4GDOA 1D7MA 1NTKK 3HUSA 1X79B 2FYUJ 2WZ7A 2JKVA 3WUTA 3AE5C 4H0LC 2E76C 3KPEA 4PV1C 4C7NA 1GW4A 3AECC 3LW5J 1N7SC 1S9KD 1LTBC 1VQMP 2WPVB 1PGPA 5AVWB 4H44D 4JQ0D 2QM7A 1SQPG 3D6YA 2W90A 3RK2B 2OGUA 2ZXXA 4B86A 2OYHA 2WSCH 3CWBJ 3HD7C 3HUSC 2N1TC 4ZMDA 3VYIA 1MFTA 1SQVK 1KILA 3CX5D 4XE5B 2Q9IA 3H1KJ 4YXWH 1NVOA 3TSIA 1H89A 3USSA 4K3AA 2WSEJ 1EDJA 4H13B 4IL6E 2OYHC 3NMDA 1A02J 3V2PA 2HODA 3R4YA 1FZCB 3FGAD 3H1JJ 3E1RA 3A5TA 3BRVB 2QSIA 1KILC 3JSVC 1GL2C 1URQD 1SS1A 1IJDB 2AXTE 1BDCA 4L73A 2BCCG 1M7LA 1L4AB 4BRYA 3Q2YA 3AE1C 1LGHB 1SFCC 2XKMA 2LR2A 1SQBD 1LTIC 3I55P 3A0BH 1KV4A 1RF1A 1ZOYC 2XU6A 1EXJA 1AFOA 1NU1D 1BGYE 2Y0DA 3PTZA 1FOSF 1PZQA 3RK2C 1EZVE 3BATA 2CPSA 1H88A 3HTKA 1HTLC 1JM0A 3V2RA 2B87B 1LJ2A 1NTKG 2JDIH 5AVSB 1RE3A 1ZMEC 5AW7B 1L0LJ 2AXCA 3M9HA 1OW8A 3H1LJ 1BDDA 1MFZA 2JWDA 2KZIA 1VQNP 4PD4I 5DJUB 3VOPA 2J58A 4H13C 3W67A 1JEKA 2WT7B 1EQ7A 4ASWA 2PGDA 1QVGO 1Y47A 1KB9E 2XNDH 1T3JA 1FZCC 1IFMA 2FY8A 2H88C 1SQVG 1VF5D 2P2UA 2M3BA 1FC2C 1P84I 2FXMA 1L4AC 1KYOI 1DD3A 1OFCX 2B9BA 1PP9J 3RL0g 1GDTA 2B87A 2P1JA 1X22A 1M1JB 1EXIA 2QRXA 3MGNA 2E43A 1KQGB 5KLVJ 1J1EB 1L0ND 3V4QA 3V4WA 2O01H 1SQBE 1EDLA 1YJNP 1WMKA 1MKMA 3HE5A 2O01N 2A45G 3L75D 2M5AB 1DD4A 3N7NA 1NU1E 3MD0A 3F89A 3RL0B 3WU2E 2WVRA 3L74D 4EI2A 2KP8A 3WMM0 4H0LD 1NTZJ 1AJYA 3Q5PA 5KAIE 4U3FD 1SQXD 3B5NB 3H1IE 1DEEG 2K9JB 3H1KG 4UB6E 2HYNA 2QJYB 5AW3B 3HD7D 1RF0C 2N1TD 2WSFJ 1L2PA 1NHLA 2Q3IA 3GF3A 2W6AA 1LTGC 5CJ4A 2ZFCA 1SQBK 4GKGA 2WPRA 3CMAP 1NTMD 4NPDA 1HJ0A 1M1JC 1GMJA 3TGUE 3PH0A 1J1EC 3L72E 2E75B 3P7KA 2ITAA 2YXQB 5AW5B 2M0BA 3VP9A 1G1IA 1SP4A 1NU1K 5K5GB 3V6IA 2Y9YA 1CI6B 4RESB 3VTPC 1YQ3C 4U7JA 3B5NA 2OQQA 1BGYG 2V7QJ 1GL2D 1JCCA 2K9JA 1AA0A 1YJWP 1EZVG 1RH5B 4MN4C 2JO1A 3RL0C 2IBZD 2E42A 2KB7P 1GU5A 5GTHE 2FFDA 5AVZB 2O1KA 3KZIH 1MZ9A 1X0TA 2K37A 5KKZB 4EYYQ 3CX5H 1GK4A 1GD2E 3S4RA 3CCUP 3O6QB 4TLFA 3B5NC 4Y28J 1BE3E 3SFEC 1S5LX 2KS1B 3GF7A 2YXRB 1VDFA 1IFDA 2HPCA 1USEA 2QJYC 5AVYB 1URQA 1HJBA 3C1LA 2A06D 3W68A 4U3FE 1CI6A 2YO3A 1SLQA 3B71A 2BEZF 2FYZA 2P7JA 2M8RA 3TYYA 3L4FA 4YXDC 2NRGA 4K35A 2D2CD 1IK9A 1U7JA 2OYIB 2E75C 2E5YA 1PP9G 4PD4H 2GUSA 2KUBA 1DH3A 2KI7B 4I7ZB 1NTME 3O6QA 1G2CB 2H89C 2W83C 3H1HE 1PGQA 3MIWA 1HGZA 1L4AD 3FX0A 5AVXB 1T2KC 2E74B 2YKQA 4D6TD 2GUVA 4BWNA 1KYOH 1XTGB 2KIKA 2VRSA 5KKZC 1SQQD 4JF7A 5BU5A 2IYPA 3I56P 1BCCE 2K9YA 1SQXK 1Q90D 1R5LA 4ASVA 4AUWA 3P8CE 1GU4A 2PFXA 1E5WA 5APUA 1NTKJ 3MP7B 3WUVA 2OYIA 1G1JA 1HWTC 4PJ0H 3A0BE 4Y99B 1FE6A 1W5CE 3G9RA 3L70D 3H1IG 4WVZA 1LTSC 2WMMA 1Q81Q 3CMEP 1JNMA 1AV1A 3FXDA 2IZ0A 2NPSB 2JWAA 1JUNA 1G2CA 3CWBD 3AE8C 2PRRA 1J1DB 1NTMK 2ZT9B 2I1JA 4C7NB 1JO5A 1FS0E 2DW3A 2OYIC 1YJ9P 5APTA 2YNYA 3II6A 5KLIB 4W7ZA 1SQVJ 4DT0A 3TGUG 1ZLLA 3L72G 3EFGA 3KDPB 2IX7C 1VQOP 5CHXA 5CJ0A 2A45I 2UWJE 2I1KA 2Q1KA 3U59A 3H1JD 2I8DA 4EIJA 2E74C 2LKMA 1QVFO 5B5EH 3L73D 2G3AA 2NPSA 3CD6P 2WQYC 2HR3A 2BEQD 3JCUE 2HODB 3L37A 3ABVC 3L71D 1OZHA 3UIAA 3RBXA 5CBNA 1RQUA 4Y99C 1BE3G 5AW9B 1KTMA 4BRYB 3RK3B 3Q5RA 2NPSC 1IC2A 1IO4A 1NKNA 1JCDA 2JP3A 2AEMA 1J1DC 2FKWB 2ZT9C 1SVFA 3FWNA 3L70E 1RF1B 3V2NA 3BRTB 1L0LD 2KXPB 3MUDA 5KLIC 3PRJA 2O1JA 1NWQA 3HTKB 2XNXA 4L75A 1JY2P 1ZW0A 2Q3EA 5KJ7A 1Q7YQ 3E7KA 3SFDC 1DEBA 1YTZT 3CC2P 1OW6A 1KN7A 3FWLA 1EZVI 3MZWB 5E79H 1NTMG 3SWFA 1YIJP 1PPJE 2P10A 4OGQB 3D6ZA 4EOTA 3H1HG 2OTKE 3R2PA 5AW4B 1SQQK 1QLED 3H6PA 1S2EA 4GODA 2LXCB 3PP5A 1AQ5A 4PD4D 4KT0J 3AE2C 2OTLP 4OH8B 1BGYJ 1BCCG 1HBWA 3BCCD 5KLVD 1KB9I 3HRNA 3L73E 3CCVP 1JY2O 3RK3C 3V2QA 1T2KD 3L71E 4GIFA 4RO0A 1P84D 3BASA 1KYOD 1S9KE 3T97A 4ZNCA 5B66H 2E5TA 1N8RQ 2P67A 2YIUB 1S4XA 1JY3P 1FZBA 1RF1C 1KQLA 2IFNA 1UIXA 5CMZA 3KZIE 3HE5B 3CX5E 3S1KA 2Z4EA 5CCHA 3M06A 3VMAA 2FBWC 1RE3C 1Q82Q 2K88A 4OGQC 1HUCA 1VQ6P 2OYOA 2Q6QA 5DJTB 3OJAB 1W2EA 2H8PD 1M1KQ 5CCHC 4WY4D 1NO4A 2KOGA 1SQBJ 5CCGA
chains in the Genus database with same CATH topology
2O01N 1OZHA 2RH0A 2AXCA 3O6QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 N;  1OZH A;  2RH0 A;  2AXC A;  3O6Q B; 
#chains in the Genus database with same CATH topology
 4LLH A;  2ZYD A;  2HFE D;  1HH0 A;  4PD4 E;  1YHQ P;  1VQ7 P;  4UB8 H;  1NU1 J;  3LW5 H;  3D71 A;  2NZ2 A;  2QVA A;  3BCC E;  1H8A A;  2O3J A;  2YIU C;  2R5B A;  2KZJ A;  4H44 B;  4L76 A;  3B8E B;  2E76 D;  2IZ1 A;  4PV1 D;  4YTP C;  4R4L A;  4IFF A;  1KYO E;  3H1I J;  3U1C A;  1N7S D;  2YKO A;  4NPE A;  3CCQ P;  1SQP D;  3A3Y B;  1QL1 A;  5H2F E;  3D70 A;  1X8Y A;  2HLO A;  4XFJ A;  2WSE H;  5TJH A;  1NAF A;  2FFD B;  2BAS A;  3JC2 2;  1UII A;  4PJ0 E;  3VMY A;  2RH0 A;  3MTU E;  1X9V A;  2W6B A;  1PPJ G;  3SWY A;  3TGU J;  2CK3 H;  4KHX A;  3L72 J;  1A02 F;  4IL6 X;  3GHG A;  2W8Z A;  3TF5 A;  2HPC B;  1FJK A;  1URQ B;  1VQ8 P;  4C46 A;  3EFF K;  1IFJ A;  2QJK B;  2ZYA A;  1K05 A;  1KIL D;  3CLQ A;  4JYB A;  1OX3 A;  2BCC D;  2CPB A;  5AVR B;  1L0N E;  1U7M A;  1S5L H;  1OIP A;  1LTT C;  1SFC D;  2IFM A;  3CCS P;  1KQF B;  2C9L Y;  5BU8 B;  3G3Z A;  4H44 C;  3Q1M A;  3AED C;  2R44 A;  2POH A;  3VMZ A;  4A7P A;  2JEE A;  1BE3 J;  2WTY A;  3NXS A;  2R32 A;  1N73 A;  3L75 E;  3O8Z A;  5B5E E;  2KYV A;  2Q5U A;  3SSU A;  3L74 E;  3RK2 D;  1N7L A;  1LTJ B;  4U3F J;  1KB9 H;  3ITK A;  1NTK D;  5AW6 B;  1M90 Q;  5L8R J;  2FFD C;  2WSC J;  3QWO C;  1FU1 A;  1SQX E;  2W6J H;  2PP6 A;  2QM8 A;  2KNC B;  3KXD A;  3A7O A;  2YMK A;  1JB0 J;  1FZA A;  4H13 D;  1L0N K;  4HYT B;  1AQT A;  3LID A;  2IDB A;  1QL2 A;  1URQ C;  1NTM J;  1VF5 B;  2QJK C;  3H1H J;  1SQV D;  3KQG A;  2ZXE B;  4OWF A;  2L5G B;  3L35 A;  1RE4 A;  1HGV A;  1SQB G;  3P8M C;  3M0D A;  1LTJ A;  2K1A A;  2SPZ A;  3OW2 O;  1YTZ I;  3AEG C;  3P32 A;  3CXH I;  5E79 E;  2JR8 A;  5APW A;  1P84 H;  1BCC J;  3A0H H;  1KIL E;  2WPQ A;  1NU1 G;  1PIX A;  3QH9 A;  2OAR A;  1RHZ B;  1SQP K;  5AVV B;  1KD1 Q;  1ZXG A;  2KNC A;  1FDO A;  2FYU D;  1VL2 A;  4GT1 A;  1KFM A;  2IBZ E;  4HJG H;  3HE4 A;  1FOS E;  3M0D C;  1LTJ C;  3AEA C;  3NTN A;  1LNQ A;  3RGU A;  1PGO A;  1VQL P;  4H0L B;  2QE7 H;  5APQ A;  1KOR A;  1NGM B;  4I1L A;  3GLM A;  2WSF H;  3NFQ A;  2A06 E;  5B66 E;  5AVQ B;  1LT9 B;  3Q5S A;  1JTH A;  1K04 A;  2H7H A;  1VF5 C;  3H1K D;  2YMY A;  4WBA A;  4I7Z C;  3OA7 A;  4ZKU A;  1NYH A;  3LIE A;  2N9B A;  1LWU B;  4O9B A;  2C0W A;  1L0N G;  3WUU A;  5TIS H;  5AW1 B;  2GM4 A;  2V7Q H;  4W80 A;  3RBZ A;  3TK1 A;  1N7S A;  2KLU A;  1E79 H;  5AVT B;  3PJS K;  1GL2 B;  1YYC A;  5AVU B;  2QA4 P;  4D6T E;  3AE3 C;  3L75 G;  1BGY D;  1LT9 A;  2M3E A;  4JYC A;  4RKU J;  2ZJS E;  3HD7 A;  2YO2 A;  2N1T A;  1SQQ E;  2O01 J;  1EZV D;  3KHU A;  1MV8 A;  3L74 G;  3TDK A;  4R4M A;  1XTC C;  2QG4 A;  2FYU E;  3RL0 D;  2B89 A;  4EDF A;  3G4S P;  3L70 J;  1Y8A A;  4HKZ H;  4UB8 E;  4U3F G;  1SQX G;  3U1A A;  1LWU A;  4IFD K;  3VN0 A;  1M56 D;  4LC1 A;  3IF4 A;  1GTW A;  1LT9 C;  3B5N D;  5CBO A;  3H1L D;  4TT3 H;  4YPC A;  3CWB E;  4OVN F;  2RMZ A;  5EFW B;  1N2D C;  1KB9 D;  3OAK A;  1YI2 P;  1GL2 A;  2Y9Z A;  1LT1 A;  3SWK A;  3T97 B;  1CW5 A;  1SFC A;  1LWU C;  2D2C B;  3H1K E;  3MUD C;  3VP8 A;  2ZVN B;  2WWW A;  1ZN5 A;  1KZU B;  2E75 D;  3L36 A;  2MJZ A;  1PP9 D;  2FYU K;  1OVV A;  3PLN A;  1KMI Z;  1ZRT D;  3H1J E;  1FZE A;  5KJ7 C;  1FJP A;  1GK6 A;  3L73 J;  1FDM A;  2Z5I A;  1BSN A;  3F5H A;  1HVV A;  3CX5 I;  3M9Q A;  3L71 J;  2IBZ G;  3FXE A;  5APY A;  3CC4 P;  2P58 A;  5GTI H;  1EDI A;  1OXZ A;  3BVH A;  3GG2 A;  3CCR P;  5M1B A;  2ZAE B;  3S9O A;  3V5B A;  1S5L E;  1JMB A;  3CXH H;  1YIT P;  1FZC A;  2A06 G;  2KK7 A;  3AE4 C;  1JY2 N;  1ZP0 C;  4AQR D;  1K73 Q;  1AVO A;  3H1I D;  1NTZ D;  2KSJ A;  5AW8 B;  5KAF H;  1L4A A;  1L0L E;  4HB1 A;  4L74 A;  2D2C C;  3H1L E;  1VQ4 P;  1NAY A;  2ZYG A;  2WPS A;  4AYC A;  4GOF A;  1WT6 A;  1U57 A;  2Q7C A;  1JOC A;  1JY3 O;  2LXB A;  3TGU D;  5APV A;  3L72 D;  4N6J A;  2FYN B;  3JCU H;  1YBK A;  1W2B O;  4HH2 A;  3TNU B;  4BXL A;  1CSB A;  1HF9 A;  3AE6 C;  2W27 A;  4D6T G;  1PP9 E;  3CL3 D;  5KTB A;  1ZRT E;  3BCC J;  2A45 H;  1SQQ G;  2E74 D;  2FXP A;  1DX7 A;  3CCM P;  2B88 A;  2H43 A;  5KLV E;  3H25 A;  3GHG B;  2FYU G;  1JY3 N;  1USD A;  1PL5 A;  1L0L K;  2WT7 A;  3C8V A;  5CCG C;  3CC7 P;  1M8O B;  4M3L A;  1IK7 A;  4KJM A;  1P84 E;  2J59 M;  3A0H E;  4WB4 A;  1PFI A;  3L70 G;  1R8E A;  4GOE A;  2XDJ A;  1BE3 D;  1RF0 A;  1IZN B;  3IAO A;  4IL6 H;  1KC8 Q;  1H0T B;  1Q86 Q;  3CWB G;  2MKV A;  1S72 P;  3AE7 C;  3C9I A;  2NPS D;  3TNU A;  2XZR A;  3EWK A;  2R5D A;  1KQS O;  2ZT9 D;  3CPW O;  1M1J A;  1RY3 A;  2KSE A;  1NTZ E;  3GMA A;  2V4H A;  1N73 B;  2RN0 A;  2AXT H;  4IOI H;  3I5C A;  3M9B A;  1FZG A;  2JJL A;  1QEX A;  1GZL A;  1NKZ B;  1IFI A;  5C39 A;  5AW2 B;  1RQV A;  3H32 B;  2FYN C;  5KLV K;  1FBM A;  3H1J G;  1OVU A;  1QGK B;  2M5A A;  1L0N J;  1ZR2 A;  3H1H D;  3L73 G;  1T8Z A;  1NJI Q;  1MUU A;  1H0T A;  2QJP B;  1YQ4 C;  1K8A Q;  1Y9B A;  3L71 G;  3GHG C;  4C7R A;  4DOJ A;  2Z5H A;  3L75 J;  1NH4 A;  3AE9 C;  5KJ7 D;  4WWI A;  1FAV A;  1BCC D;  5AW0 B;  5TIS E;  1PV3 A;  3L74 J;  1PGJ A;  3P8C D;  4I6M C;  1NTZ K;  3Q3D A;  1ZV8 A;  1FDI A;  1QX8 A;  1T6A A;  3RK3 D;  3H32 A;  1SQX J;  1SQP J;  2HG5 D;  5BVZ A;  4N78 D;  1LP1 B;  1AVY A;  1SQP E;  1IFP A;  1L0L G;  1OVR A;  3KYQ A;  3H1L G;  1OMI A;  2R3C A;  3CXH D;  1N73 C;  3AEE C;  1M57 D;  1BSH A;  1VPC A;  3CCE P;  4IFM A;  3A2A A;  4Z1M H;  2GA1 A;  3HE4 B;  2FXO A;  2R3S A;  2RKL A;  5APS A;  1K9M Q;  2Y0E A;  3K5B A;  2IBZ I;  2OTJ P;  4JBZ A;  1VQ5 P;  3GW6 A;  4OGQ D;  3AEF C;  3IN6 A;  4NPF X;  1JMM A;  2QJP C;  2C0X A;  2PAJ A;  3VMX A;  4WY4 B;  4XA4 A;  3B4S A;  4N3Y B;  2QEX P;  2BCC J;  1S3J A;  3MHV A;  1JTH B;  1KFN A;  2IPP A;  1LP1 A;  4JPZ B;  1R5S A;  2AEF A;  3BCC G;  1VQP P;  5CCH D;  5KLV G;  2KLV A;  2ZVO B;  3WU2 H;  2BCC E;  2KS1 A;  3E1I A;  3G71 P;  1J2J B;  1CZQ A;  2C9N Y;  1NOH A;  1Z56 A;  1DIP A;  4I2L C;  3M0A A;  2L91 A;  2AEJ A;  4QMA A;  1RE4 C;  2QIW A;  3EQ2 A;  4RJT A;  1WRG A;  5KAI H;  2K3R A;  3PHL A;  3IFM A;  2IYO A;  5H2F H;  4W7Y A;  4UB6 H;  1T3U A;  2G8Y A;  2E76 B;  1IFN A;  3CCL P;  2XV5 A;  1VQ9 P;  4PV1 B;  1N7S B;  1OW7 A;  3RK3 E;  1GW3 A;  5CCG D;  1ZR4 A;  5GTI E;  4LGD E;  2YKP A;  1NTK E;  4WY4 A;  2N9Y B;  1NTZ G;  4N78 E;  3CCJ P;  4DJG A;  3ZDM A;  3HD7 B;  3HUS B;  2N1T B;  3CXH E;  3IR9 A;  4DCK A;  4CPG A;  2WIT A;  1LTA C;  1EC5 A;  1VQK P;  4DZO A;  3AEB C;  2WSS H;  4ZKP A;  2J5U A;  1PPJ D;  5KAF E;  4WY4 C;  2OYH B;  5APX A;  3G6E P;  1SQV E;  3N4X A;  1Q2N A;  3CI9 A;  5GTH H;  1KIL B;  4D6T J;  1OWA A;  1TU3 F;  1N86 A;  3M91 A;  1SQQ J;  1FZF A;  2Y0C A;  1EDK A;  1S1C X;  1SFC B;  4GDO A;  1D7M A;  1NTK K;  3HUS A;  1X79 B;  2FYU J;  2WZ7 A;  2JKV A;  3WUT A;  3AE5 C;  4H0L C;  2E76 C;  3KPE A;  4PV1 C;  4C7N A;  1GW4 A;  3AEC C;  3LW5 J;  1N7S C;  1S9K D;  1LTB C;  1VQM P;  2WPV B;  1PGP A;  5AVW B;  4H44 D;  4JQ0 D;  2QM7 A;  1SQP G;  3D6Y A;  2W90 A;  3RK2 B;  2OGU A;  2ZXX A;  4B86 A;  2OYH A;  2WSC H;  3CWB J;  3HD7 C;  3HUS C;  2N1T C;  4ZMD A;  3VYI A;  1MFT A;  1SQV K;  1KIL A;  3CX5 D;  4XE5 B;  2Q9I A;  3H1K J;  4YXW H;  1NVO A;  3TSI A;  1H89 A;  3USS A;  4K3A A;  2WSE J;  1EDJ A;  4H13 B;  4IL6 E;  2OYH C;  3NMD A;  1A02 J;  3V2P A;  2HOD A;  3R4Y A;  1FZC B;  3FGA D;  3H1J J;  3E1R A;  3A5T A;  3BRV B;  2QSI A;  1KIL C;  3JSV C;  1GL2 C;  1URQ D;  1SS1 A;  1IJD B;  2AXT E;  1BDC A;  4L73 A;  2BCC G;  1M7L A;  1L4A B;  4BRY A;  3Q2Y A;  3AE1 C;  1LGH B;  1SFC C;  2XKM A;  2LR2 A;  1SQB D;  1LTI C;  3I55 P;  3A0B H;  1KV4 A;  1RF1 A;  1ZOY C;  2XU6 A;  1EXJ A;  1AFO A;  1NU1 D;  1BGY E;  2Y0D A;  3PTZ A;  1FOS F;  1PZQ A;  3RK2 C;  1EZV E;  3BAT A;  2CPS A;  1H88 A;  3HTK A;  1HTL C;  1JM0 A;  3V2R A;  2B87 B;  1LJ2 A;  1NTK G;  2JDI H;  5AVS B;  1RE3 A;  1ZME C;  5AW7 B;  1L0L J;  2AXC A;  3M9H A;  1OW8 A;  3H1L J;  1BDD A;  1MFZ A;  2JWD A;  2KZI A;  1VQN P;  4PD4 I;  5DJU B;  3VOP A;  2J58 A;  4H13 C;  3W67 A;  1JEK A;  2WT7 B;  1EQ7 A;  4ASW A;  2PGD A;  1QVG O;  1Y47 A;  1KB9 E;  2XND H;  1T3J A;  1FZC C;  1IFM A;  2FY8 A;  2H88 C;  1SQV G;  1VF5 D;  2P2U A;  2M3B A;  1FC2 C;  1P84 I;  2FXM A;  1L4A C;  1KYO I;  1DD3 A;  1OFC X;  2B9B A;  1PP9 J;  3RL0 g;  1GDT A;  2B87 A;  2P1J A;  1X22 A;  1M1J B;  1EXI A;  2QRX A;  3MGN A;  2E43 A;  1KQG B;  5KLV J;  1J1E B;  1L0N D;  3V4Q A;  3V4W A;  2O01 H;  1SQB E;  1EDL A;  1YJN P;  1WMK A;  1MKM A;  3HE5 A;  2O01 N;  2A45 G;  3L75 D;  2M5A B;  1DD4 A;  3N7N A;  1NU1 E;  3MD0 A;  3F89 A;  3RL0 B;  3WU2 E;  2WVR A;  3L74 D;  4EI2 A;  2KP8 A;  3WMM 0;  4H0L D;  1NTZ J;  1AJY A;  3Q5P A;  5KAI E;  4U3F D;  1SQX D;  3B5N B;  3H1I E;  1DEE G;  2K9J B;  3H1K G;  4UB6 E;  2HYN A;  2QJY B;  5AW3 B;  3HD7 D;  1RF0 C;  2N1T D;  2WSF J;  1L2P A;  1NHL A;  2Q3I A;  3GF3 A;  2W6A A;  1LTG C;  5CJ4 A;  2ZFC A;  1SQB K;  4GKG A;  2WPR A;  3CMA P;  1NTM D;  4NPD A;  1HJ0 A;  1M1J C;  1GMJ A;  3TGU E;  3PH0 A;  1J1E C;  3L72 E;  2E75 B;  3P7K A;  2ITA A;  2YXQ B;  5AW5 B;  2M0B A;  3VP9 A;  1G1I A;  1SP4 A;  1NU1 K;  5K5G B;  3V6I A;  2Y9Y A;  1CI6 B;  4RES B;  3VTP C;  1YQ3 C;  4U7J A;  3B5N A;  2OQQ A;  1BGY G;  2V7Q J;  1GL2 D;  1JCC A;  2K9J A;  1AA0 A;  1YJW P;  1EZV G;  1RH5 B;  4MN4 C;  2JO1 A;  3RL0 C;  2IBZ D;  2E42 A;  2KB7 P;  1GU5 A;  5GTH E;  2FFD A;  5AVZ B;  2O1K A;  3KZI H;  1MZ9 A;  1X0T A;  2K37 A;  5KKZ B;  4EYY Q;  3CX5 H;  1GK4 A;  1GD2 E;  3S4R A;  3CCU P;  3O6Q B;  4TLF A;  3B5N C;  4Y28 J;  1BE3 E;  3SFE C;  1S5L X;  2KS1 B;  3GF7 A;  2YXR B;  1VDF A;  1IFD A;  2HPC A;  1USE A;  2QJY C;  5AVY B;  1URQ A;  1HJB A;  3C1L A;  2A06 D;  3W68 A;  4U3F E;  1CI6 A;  2YO3 A;  1SLQ A;  3B71 A;  2BEZ F;  2FYZ A;  2P7J A;  2M8R A;  3TYY A;  3L4F A;  4YXD C;  2NRG A;  4K35 A;  2D2C D;  1IK9 A;  1U7J A;  2OYI B;  2E75 C;  2E5Y A;  1PP9 G;  4PD4 H;  2GUS A;  2KUB A;  1DH3 A;  2KI7 B;  4I7Z B;  1NTM E;  3O6Q A;  1G2C B;  2H89 C;  2W83 C;  3H1H E;  1PGQ A;  3MIW A;  1HGZ A;  1L4A D;  3FX0 A;  5AVX B;  1T2K C;  2E74 B;  2YKQ A;  4D6T D;  2GUV A;  4BWN A;  1KYO H;  1XTG B;  2KIK A;  2VRS A;  5KKZ C;  1SQQ D;  4JF7 A;  5BU5 A;  2IYP A;  3I56 P;  1BCC E;  2K9Y A;  1SQX K;  1Q90 D;  1R5L A;  4ASV A;  4AUW A;  3P8C E;  1GU4 A;  2PFX A;  1E5W A;  5APU A;  1NTK J;  3MP7 B;  3WUV A;  2OYI A;  1G1J A;  1HWT C;  4PJ0 H;  3A0B E;  4Y99 B;  1FE6 A;  1W5C E;  3G9R A;  3L70 D;  3H1I G;  4WVZ A;  1LTS C;  2WMM A;  1Q81 Q;  3CME P;  1JNM A;  1AV1 A;  3FXD A;  2IZ0 A;  2NPS B;  2JWA A;  1JUN A;  1G2C A;  3CWB D;  3AE8 C;  2PRR A;  1J1D B;  1NTM K;  2ZT9 B;  2I1J A;  4C7N B;  1JO5 A;  1FS0 E;  2DW3 A;  2OYI C;  1YJ9 P;  5APT A;  2YNY A;  3II6 A;  5KLI B;  4W7Z A;  1SQV J;  4DT0 A;  3TGU G;  1ZLL A;  3L72 G;  3EFG A;  3KDP B;  2IX7 C;  1VQO P;  5CHX A;  5CJ0 A;  2A45 I;  2UWJ E;  2I1K A;  2Q1K A;  3U59 A;  3H1J D;  2I8D A;  4EIJ A;  2E74 C;  2LKM A;  1QVF O;  5B5E H;  3L73 D;  2G3A A;  2NPS A;  3CD6 P;  2WQY C;  2HR3 A;  2BEQ D;  3JCU E;  2HOD B;  3L37 A;  3ABV C;  3L71 D;  1OZH A;  3UIA A;  3RBX A;  5CBN A;  1RQU A;  4Y99 C;  1BE3 G;  5AW9 B;  1KTM A;  4BRY B;  3RK3 B;  3Q5R A;  2NPS C;  1IC2 A;  1IO4 A;  1NKN A;  1JCD A;  2JP3 A;  2AEM A;  1J1D C;  2FKW B;  2ZT9 C;  1SVF A;  3FWN A;  3L70 E;  1RF1 B;  3V2N A;  3BRT B;  1L0L D;  2KXP B;  3MUD A;  5KLI C;  3PRJ A;  2O1J A;  1NWQ A;  3HTK B;  2XNX A;  4L75 A;  1JY2 P;  1ZW0 A;  2Q3E A;  5KJ7 A;  1Q7Y Q;  3E7K A;  3SFD C;  1DEB A;  1YTZ T;  3CC2 P;  1OW6 A;  1KN7 A;  3FWL A;  1EZV I;  3MZW B;  5E79 H;  1NTM G;  3SWF A;  1YIJ P;  1PPJ E;  2P10 A;  4OGQ B;  3D6Z A;  4EOT A;  3H1H G;  2OTK E;  3R2P A;  5AW4 B;  1SQQ K;  1QLE D;  3H6P A;  1S2E A;  4GOD A;  2LXC B;  3PP5 A;  1AQ5 A;  4PD4 D;  4KT0 J;  3AE2 C;  2OTL P;  4OH8 B;  1BGY J;  1BCC G;  1HBW A;  3BCC D;  5KLV D;  1KB9 I;  3HRN A;  3L73 E;  3CCV P;  1JY2 O;  3RK3 C;  3V2Q A;  1T2K D;  3L71 E;  4GIF A;  4RO0 A;  1P84 D;  3BAS A;  1KYO D;  1S9K E;  3T97 A;  4ZNC A;  5B66 H;  2E5T A;  1N8R Q;  2P67 A;  2YIU B;  1S4X A;  1JY3 P;  1FZB A;  1RF1 C;  1KQL A;  2IFN A;  1UIX A;  5CMZ A;  3KZI E;  3HE5 B;  3CX5 E;  3S1K A;  2Z4E A;  5CCH A;  3M06 A;  3VMA A;  2FBW C;  1RE3 C;  1Q82 Q;  2K88 A;  4OGQ C;  1HUC A;  1VQ6 P;  2OYO A;  2Q6Q A;  5DJT B;  3OJA B;  1W2E A;  2H8P D;  1M1K Q;  5CCH C;  4WY4 D;  1NO4 A;  2KOG A;  1SQB J;  5CCG A; 
#chains in the Genus database with same CATH homology
 2O01 N;  1OZH A;  2RH0 A;  2AXC A;  3O6Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...