5APTA

Sequence ienkadkad inserted between gcn4 adaptors - structure a9
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
68
structure length
68
Chain Sequence
b'HMKQLEDKVEELLSKVYHLENEVARLKKLIENKADKADMKQLEDKVEELLSKVYHLENEVARLKKLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 30
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aptA00
4I2LC 3T97A 3TK1A 2W27A 2WPRA 3NXSA 3MD0A 4KHXA 1NWQA 3V4WA 5AW2B 2WPQA 4DZOA 3UIAA 3VMZA 3KDPB 1S9KE 2ZFCA 3M9HA 2IPPA 2P2UA 2Q3IA 1GU4A 2YNYA 5APTA 1CZQA 1SP4A 4JYBA 2WPSA 3M0AA 1J2JB 3MGNA 3M91A 5AW4B 1DH3A 4C46A 1HWTC 1CI6B 3A3YB 1CI6A 1GK4A 1MFZA 3V4QA 3A7OA 2E43A 4AYCA 3P8MC 2Q7CA 4AQRD 2Z5HA 3VMYA 1MV8A 2R5DA 1KQLA 3VN0A 2R3CA 1CSBA 1OXZA 5APVA 2KP8A 5AW5B 1IO4A 5APUA 1GTWA 3L35A 5AW7B 1HJBA 3L37A 2JJLA 4XE5B 5APXA 2E42A 2QM7A 3M9BA 1A02F 4AUWA 4GKGA 3IR9A 4EOTA 1GZLA 5APYA 3A2AA 2Q5UA 2WWWA 1SLQA 4I6MC 5AVUB 5AW9B 2W6AA 3TNUB 5AVWB 3HE5B 3HTKA 2WT7A 2WT7B 1JNMA 3LIDA 3NTNA 5AVTB 5AW0B 1S9KD 3VMXA 1T2KD 3HE4B 1H89A 3HE4A 3P32A 1NAFA 2BASA 2YO3A 2XU6A 1H8AA 2WTYA 3SWFA 5APWA 2N9BA 3L36A 2XV5A 5APSA 5AW1B 1FOSF 1G2CB 2R32A 3O8ZA 4M3LA 1GU5A 3OAKA 1GD2E 2ZXEB 4JYCA 3TYYA 4LC1A 3VTPC 3NFQA 3VYIA 5AVYB 5AW8B 3TNUA 3HE5A 5AVQB 3M06A 2QM8A 2YO2A 2XZRA 2C9LY 2P67A 4B86A 1JUNA 3NMDA 2VRSA 1X8YA 1HUCA 5AVRB 1A02J 1OWAA 3P7KA 4C7NB 5AVSB 5AW6B 2Z5IA 4HYTB 4C7NA 1T2KC 2P7JA 3KQGA 5AVVB 4GT1A 1HBWA 1FAVA 1FOSE 5AVZB 1MUUA 5AVXB 3B8EB 3LIEA 5AW3B 3V5BA 2C9NY 4RESB 3A5TA 1YYCA 1GK6A 3I5CA 5CMZA 1H88A 2H7HA 2R5BA 5APQA 3M0DA
chains in the Genus database with same CATH superfamily
1KORA 1U7JA 2K1AA 2W27A 2E74C 3V4WA 2IDBA 2O1JA 3C9IA 3AE6C 5CCHD 1S3JA 5K5GB 3IN6A 1DH3A 1CI6A 4AYCA 2QSIA 4EI2A 2NPSC 2RH0A 2AEFA 2Z5HA 1FJKA 2CK3H 3D70A 3H1HE 1JCDA 1IO4A 1LWUC 2E75B 1JB0J 1N73C 3A0HH 2WMMA 2NRGA 5APYA 1SLQA 3FXDA 1RF1A 2WT7A 1NTKG 3TGUG 4RJTA 1BGYG 3P8CD 3LIDA 3Q3DA 2QIWA 1FZFA 3MIWA 1EXIA 1Z56A 1G2CA 4OVNF 1GU5A 1ZLLA 1NTZE 3NFQA 5AVYB 1OX3A 1U57A 3BRTB 3IAOA 3TNUA 3AE8C 1H0TB 1GL2C 1U7MA 5B66H 1JEKA 4H44B 1IK7A 1YJ9P 1OWAA 1RE4C 5AVSB 2Q3EA 3WUVA 4H0LC 1FE6A 2DW3A 1HBWA 2IBZI 3GLMA 3A5TA 1K9MQ 1T6AA 5TJHA 2W90A 5APQA 3AEAC 3SWYA 3MD0A 1L0LE 1JY2P 1VQLP 3JC22 3KDPB 2YKQA 3M9HA 4I7ZC 1NU1D 1FDOA 1P84I 4K3AA 1S4XA 4ZKPA 3CCJP 1ZN5A 3L72D 1PP9E 1D7MA 1N2DC 3F89A 2OYHC 2FYUJ 1M1JC 3CCEP 3D6YA 1RY3A 3Q5PA 1M8OB 1M57D 2KS1B 3L74J 1OFCX 1NTMG 3L74D 3M9BA 2HG5D 2WSFH 3HTKA 3C8VA 1IZNB 1AVOA 4Y28J 4U3FE 1GW3A 2YIUC 2BASA 5KTBA 4UB6E 1MFTA 1Q90D 1ZOYC 3OW2O 5KLVJ 1FOSF 2KXPB 1RQUA 3L70J 3BVHA 4N78D 3V2PA 1VF5C 1HVVA 2RMZA 3CWBJ 1L4AA 1FZAA 1JUNA 1EZVD 4C7NB 2MKVA 1ZV8A 2A45G 2CPBA 1RHZB 5EFWB 1YJNP 4W80A 1R5SA 2BCCD 1N8RQ 4KT0J 3LIEA 1L4AD 3KPEA 2H89C 3U1CA 1SS1A 2HPCA 1LTGC 2B87B 3USSA 3BCCJ 2W6JH 2FFDC 1YBKA 1GDTA 1N7SB 1HWTC 1SQBK 1SQQD 1GK4A 1EQ7A 4WVZA 4EIJA 1K73Q 2QA4P 2R3CA 2SPZA 4HKZH 3FX0A 3I55P 3L37A 1URQB 2JDIH 2FY8A 2R3SA 3H1JE 4GKGA 4AUWA 2Y9YA 3JCUE 2WWWA 2ZT9D 5AVUB 2KB7P 4ZNCA 3CXHE 3G71P 1H89A 2B88A 5M1BA 1LT1A 4R4LA 2XU6A 3CD6P 2B9BA 4XFJA 4UB6H 1NVOA 4PD4E 1GW4A 4NPEA 1GD2E 2E74D 2Y9ZA 4JYCA 2J59M 2H88C 1IFIA 2B89A 3BATA 4HB1A 3W67A 1LJ2A 1LWUA 4ZKUA 3IF4A 3RK2C 1SQVG 2NPSD 1YTZI 1X9VA 5CMZA 1M90Q 3S9OA 1S1CX 3G4SP 3TK1A 3H1HG 3W68A 3AECC 3P8CE 5AW2B 1NTKE 3E1IA 3KXDA 2P10A 2P2UA 1XTGB 1Y47A 3WU2E 2QJPC 1SQPD 1IK9A 3H6PA 1Q7YQ 1EDLA 1GL2A 2I8DA 3H25A 4WWIA 1IJDB 1RE4A 2WSFJ 2HR3A 2JR8A 2WSCJ 1GL2D 1BCCD 3TNUB 3D71A 3JCUH 3M0DC 2QJYC 4H0LD 5KKZC 3C1LA 3IFMA 3CL3D 1NTZK 5CJ0A 2ZXXA 3H1KD 1BE3D 1NU1E 1HGZA 4WBAA 5KAIE 4PD4H 3S1KA 3BASA 1KYOD 1PFIA 3L71G 1HTLC 1L0LG 3L72E 2OYHA 2KZIA 3HUSC 3N7NA 1M1JA 4BRYA 2QJKC 2IYOA 2FYZA 1T2KC 2P7JA 3R2PA 3SSUA 1PP9G 1LTJC 2LR2A 3RK3C 5AVXB 1L0LK 5AW3B 3QH9A 2UWJE 1NTME 1JTHA 2L91A 3T97A 1LGHB 3RL0C 2KLUA 3VMZA 3H32A 3CX5D 4DT0A 4IL6X 1RH5B 1KQGB 2KZJA 3L4FA 3B5NC 1M1KQ 2Q7CA 4U3FG 4N78E 1QL1A 1ZXGA 1DD3A 2CPSA 2KYVA 2KP8A 3D6ZA 4DCKA 3L35A 1FDMA 1LTAC 1VF5D 1EZVE 2E42A 1IFDA 1SFCC 3IR9A 2K88A 2L5GB 2BCCE 1M56D 5AVTB 2ZJSE 1LT9B 1NYHA 2IZ1A 2H8PD 2FFDA 5APWA 4H13B 3L36A 3H1IJ 3MUDC 1DX7A 3H1ID 1AA0A 4JQ0D 1FS0E 3MHVA 1S5LX 2KSEA 4TT3H 1YQ3C 5KAIH 1SQQE 2KIKA 1NKNA 5AVQB 1JY3O 2HPCB 3HD7C 5GTHH 4PV1C 3P7KA 2Y0CA 1L0NJ 1EDKA 1IFNA 5DJTB 4OGQC 1VQKP 1OVVA 2ZT9B 2HFED 1EDIA 1T3JA 1LTTC 2YNYA 2RKLA 2POHA 3PRJA 2N1TC 2JKVA 1Q86Q 1NH4A 2E74B 3VMYA 3GG2A 3PJSK 3VN0A 1OVUA 2BEQD 2RN0A 1FZBA 1RF0C 1R8EA 1QVGO 3VMAA 1QGKB 3PTZA 1SQVE 1DEEG 1QLED 2W6AA 2A45H 1FZGA 2V7QH 3RK2D 1KV4A 4PD4I 1LWUB 3V6IA 3ITKA 1G1JA 4UB8H 1IFMA 1N86A 2OYOA 3CC7P 2M5AB 1SQPE 4I1LA 5AW8B 3II6A 5L8RJ 4JPZB 2ZYGA 2QRXA 5AW6B 5AVVB 1OMIA 2FXPA 1MUUA 3G3ZA 1NTKK 3TGUJ 1BGYJ 4IFDK 2H7HA 1PL5A 3M0DA 1GL2B 1BCCE 1JOCA 1KFMA 2YMKA 4H0LB 3KZIH 1JY2O 1KB9H 1SP4A 2WPSA 3H1KE 1BE3E 2M3BA 5TISH 1MFZA 2OTKE 3EWKA 3HUSA 1VPCA 1KYOE 1PV3A 4AQRD 3R4YA 3L71E 2WPVB 1WT6A 4I7ZB 2ZVNB 2O01H 1NU1G 1Q82Q 5KAFE 1SVFA 1X22A 1LTJA 3FWNA 3L73J 1FZCC 3L73D 3PH0A 3CCUP 3AEBC 3CC4P 3L72G 2OYIC 2OYHB 5AW9B 4BRYB 3CMAP 1T2KD 1USEA 1NU1K 1WMKA 3P32A 2H43A 2FYUD 3RK3D 1QL2A 3CX5E 4ASWA 3L74G 1TU3F 3RL0D 3B5NA 3A0BE 4IOIH 3TYYA 1JTHB 3T97B 3AE3C 2YIUB 4A7PA 1KQFB 2YO2A 3V2NA 3H32B 5CCGC 4HJGH 1E5WA 1UIIA 3B5ND 1KTMA 3LW5H 1NTMK 1FAVA 5KLVD 1SFCA 3MZWB 3V5BA 4K35A 1YITP 5CBOA 2R5BA 3L70D 4JF7A 4L74A 2IX7C 1VQOP 1IFJA 3CWBD 3MUDA 1EZVG 1SFCD 1GU4A 4JYBA 1LTSC 2W83C 5DJUB 1S72P 4DOJA 4TLFA 2BCCG 4QMAA 1KQSO 1KYOH 1PGQA 2FFDB 2E76C 3TDKA 3AEFC 2A45I 3RBXA 2K9JA 3FXEA 3BCCD 1YQ4C 5KAFH 2FXMA 1SQQG 4D6TJ 1SQBJ 4I6MC 4D6TD 1SQBD 1OZHA 4PV1D 5KJ7C 2G3AA 1LNQA 3HE4A 3L75J 4OGQD 1SQQK 3L75D 1EDJA 1RE3C 3E1RA 2N1TA 3A0BH 2E5YA 4GODA 3HE5A 2JP3A 4W7YA 1S5LE 3CCLP 4L76A 3N4XA 2V4HA 1X8YA 3I56P 1RF0A 2HLOA 2N1TD 1PZQA 4W7ZA 1ZRTD 1URQC 4RESB 2NPSA 4OH8B 2WQYC 1KB9I 2ZAEB 4WY4C 4I2LC 3TSIA 4N6JA 3NXSA 2AEMA 3FGAD 2Q3IA 4NPFX 5APTA 1N73A 2PGDA 1KZUB 1JY3N 3MGNA 1UIXA 4GOFA 4BWNA 2JO1A 1CI6B 3A3YB 4EDFA 1W5CE 2Q6QA 4IFMA 1KQLA 1Q2NA 4NPDA 1M7LA 1SQVK 1QVFO 1GTWA 2R44A 1LP1A 4GDOA 4Y99B 1SQPG 2QM7A 3GF3A 4EOTA 3H1HJ 3CI9A 5GTIE 1RF1B 2WT7B 4ASVA 1J1DC 5B5EE 1HGVA 1BSNA 1SQPK 2ITAA 4IFFA 1G2CB 3O8ZA 4M3LA 2A06D 3OAKA 2ZXEB 3V2RA 1X79B 1BCCG 3GW6A 1T8ZA 2D2CC 2KUBA 1VL2A 3MP7B 5KKZB 2IYPA 1J1EC 1JM0A 3CXHH 1S5LH 4B86A 1KC8Q 3H1KG 5AVRB 4ZMDA 3CMEP 1FZCA 1BE3G 1NTZJ 1FJPA 1L2PA 1T3UA 2OYIA 3G6EP 3HUSB 3O6QA 3L73E 2FYNC 1SQXJ 1WRGA 2IFMA 1SQXD 2WPRA 2QJKB 4KHXA 1KILC 1LTJB 2FYUE 3AEDC 3RK3E 1FBMA 3RK3B 1KYOI 1BDCA 2KLVA 4C46A 1HH0A 2LKMA 3L74E 1K05A 2O1KA 4YXDC 1MV8A 5CCGA 1OW8A 3KHUA 2K3RA 1PP9J 5AW7B 3B5NB 2N9YB 3U59A 1VDFA 3F5HA 5KLVE 3WU2H 5CCGD 3HTKB 3CLQA 1NO4A 5GTIH 2Y0DA 3L70E 3SWKA 1NAFA 3VP8A 2I1KA 5APSA 3CWBE 2I1JA 2C0WA 5BU5A 2KNCA 1K8AQ 4U3FJ 1CW5A 1PPJD 4L73A 2YMYA 5BVZA 2LXBA 1LTBC 3MTUE 1L4AB 3RL0g 3B4SA 3HRNA 4C7NA 3H1IG 5AVZB 3BCCE 2C9NY 1YYCA 2ZYAA 5KJ7A 2G8YA 2E76D 3AE5C 1NWQA 2FKWB 4PV1B 1YIJP 1AQTA 1LT9C 1PGJA 2IPPA 2K9JB 3A0HE 1FZEA 4H13C 2MJZA 1RE3A 5KLIC 4OGQB 5KJ7D 1FDIA 1ZR4A 1W2BO 3V4QA 1JMBA 1L0ND 3RGUA 1PGPA 2KK7A 3KYQA 4JBZA 1OVRA 1KN7A 4U7JA 1IC2A 1OW7A 1OXZA 5AW5B 4YTPC 2ZYDA 4XE5B 1URQA 4RKUJ 2N1TB 3H1LJ 4WY4A 1ZRTE 3H1LD 3HE5B 1VQMP 5AW0B 4BXLA 1JCCA 2JEEA 3CC2P 1URQD 1HF9A 3H1JJ 3H1JD 4WY4D 3CXHI 2NPSB 2Y0EA 5CHXA 2FBWC 5BU8B 3GHGC 3S4RA 4CPGA 2J58A 2PP6A 4PD4D 1N73B 2KSJA 1JO5A 3B8EB 3I5CA 2NZ2A 1LP1B 3G9RA 3Q2YA 5C39A 2XNXA 3M0AA 3M91A 2E75C 1NTKJ 2A06E 1NTKD 3TGUD 1IFPA 1BGYD 3PHLA 4OWFA 1FU1A 1KFNA 2C0XA 2D2CD 3SFDC 1NOHA 2IBZG 1R5LA 2GUSA 2J5UA 2IBZD 3ZDMA 3NTNA 1EC5A 1KILA 1S9KD 2QVAA 3WUUA 1SQXE 1Y9BA 3CCSP 3SWFA 1FZCB 2XKMA 2XV5A 4H44C 2HODA 2IFNA 2OYIB 1ZP0C 3L73G 2WITA 3O6QB 1P84D 1KILD 4PJ0E 1KD1Q 1M1JB 2ZVOB 4GIFA 3M9QA 3GMAA 3BRVB 2P67A 2YXQB 1NU1J 2FYUG 1VQNP 3RBZA 1HUCA 2M3EA 4MN4C 3L72J 1AJYA 2K9YA 1FOSE 2YKPA 1GK6A 4O9BA 2BEZF 1YTZT 2FYUK 4DZOA 1MKMA 2P58A 1CZQA 1NTMJ 2O01N 1J2JB 5KLVG 1NTMD 1VF5B 3A7OA 2M8RA 1YHQP 1G1IA 3L70G 1BSHA 1PPJE 1QEXA 2WSCH 3CWBG 5KLVK 2JJLA 2K37A 2KNCB 3H1IE 2WSEH 4IL6E 2FXOA 1EXJA 2AXCA 2E76B 3HD7A 1LT9A 1EZVI 2YO3A 3VOPA 2N9BA 1ZMEC 1NAYA 3BCCG 2BCCJ 2V7QJ 3K5BA 2R32A 2WZ7A 2W6BA 4LC1A 3HD7D 3GF7A 4D6TG 1SQBG 1L0NE 2GA1A 4PJ0H 4Z1MH 1AFOA 4N3YB 4H13D 3QWOC 3NMDA 1VQPP 3L75G 1SQQJ 3CCVP 2WSSH 2JWAA 2HYNA 3CX5H 3AE4C 1N7SC 3Q1MA 4C7RA 3H1LE 1DIPA 4DJGA 2WPQA 3ABVC 3AE1C 2OTJP 2Q9IA 3CCQP 5CBNA 2O3JA 1KMIZ 2QEXP 5AW4B 4WY4B 3JSVC 4HH2A 3GHGA 1VQ7P 1KB9D 4GOEA 2R5DA 1PGOA 3OJAB 5APVA 3V2QA 3RK2B 1JMMA 1HJBA 2QG4A 2PFXA 1BDDA 3U1AA 1A02F 1VQ9P 2O01J 3A2AA 5CCHC 1JNMA 1PIXA 3Q5RA 4IL6H 2OTLP 1YJWP 1H8AA 1SQVJ 1HJ0A 5AW1B 2QJPB 1SQVD 4YPCA 1AVYA 3VP9A 2M5AA 3CCMP 3VYIA 1J1DB 3AE2C 3Q5SA 3H1HD 3TGUE 2PRRA 1BGYE 2OGUA 1XTCC 1LTIC 2E75D 1K04A 2AXTE 1SQPJ 3AE9C 2D2CB 2A06G 4Y99C 2OQQA 1VQ5P 1W2EA 1H88A 3PP5A 3LW5J 1J1EB 2QJYB 1QX8A 1ZW0A 1RF1C 2E5TA 2AEJA 4LGDE 2IBZE 2W8ZA 1H0TA 3UIAA 1S9KE 3SFEC 2WVRA 2XNDH 2XDJA 2KI7B 1Q81Q 5H2FE 1NTZG 3EFGA 1NTZD 1BCCJ 2FYNB 3TF5A 2E43A 2JWDA 3P8MC 3WMM0 1P84E 1SQXG 4LLHA 1KILE 1KILB 3AE7C 4H44D 2P1JA 4KJMA 2WSEJ 3H1KJ 1BE3J 2HODB 1VQ6P 1VQ4P 4YXWH 5CJ4A 2OARA 4RO0A 1S2EA 1SQXK 1NKZB 3L71J 1L0LJ 2Q5UA 3RL0B 3L71D 5AVWB 1L0LD 3AEGC 3VMXA 5GTHE 2Z4EA 4L75A 4WB4A 2WTYA 3EQ2A 2Q1KA 1Y8AA 2KS1A 1PP9D 1E79H 3VTPC 1RQVA 2GM4A 1JY2N 1YI2P 3M06A 2LXCB 3CX5I 2XZRA 4XA4A 3CPWO 5B5EH 2Z5IA 4HYTB 2QE7H 2AXTH 1SFCB 3PLNA 5E79E 1NHLA 1PPJG 4U3FD 2M0BA 2PAJA 1NGMB 3E7KA 2ZFCA 3CCRP 3WUTA 5H2FH 1AV1A 2YXRB 2KOGA 3AEEC 3HD7B 1MZ9A 1P84H 1ZR2A 2GUVA 4D6TE 1SQBE 1CSBA 1L4AC 1OIPA 4UB8E 2B87A 5APUA 5KLIB 5APXA 1N7SA 1OW6A 1L0NG 3L75E 4EYYQ 3B71A 1GZLA 1X0TA 3FWLA 3HE4B 1N7LA 3EFFK 4R4MA 1NJIQ 1N7SD 2YKOA 1DEBA 1L0NK 1GMJA 1FC2C 1JY3P 1AQ5A 3H1LG 5B66E 2QM8A 1USDA 3KZIE 2C9LY 2ZT9C 1VQ8P 2IZ0A 1KB9E 2VRSA 1A02J 3H1JG 5TISE 3KQGA 4GT1A 3OA7A 1DD4A 5CCHA 5E79H 3CXHD 3GHGB
chains in the Genus database with same CATH topology
4WY4C 4I2LC 3TSIA 1JTHA 3T97A 1LGHB 2FYUK 4N6JA 2W27A 3RL0C 3NXSA 3V4WA 4DZOA 3VMZA 2O1JA 3C9IA 3H32A 2Q3IA 5APTA 1CZQA 1N73A 1KZUB 5CCHD 1J2JB 1JY3N 3MGNA 3L4FA 1DH3A 1CI6B 3A3YB 1CI6A 3A7OA 2M8RA 3B5NC 4AYCA 1G1IA 2NPSC 2Q7CA 4N78E 1QL1A 2Z5HA 1FJKA 4IFMA 2CPSA 1KQLA 2KYVA 2WSCH 1M7LA 2KP8A 1SQVK 1JCDA 5KLVK 1IO4A 1GTWA 3L35A 1LWUC 1FDMA 1LTAC 2JJLA 4Y99B 1N73C 2E42A 2QM7A 1IFDA 1SFCC 2WSEH 3IR9A 4EOTA 5APYA 1SLQA 2L5GB 3CI9A 1RF1B 2WT7B 1RF1A 2WT7A 3P8CD 3LIDA 5AVTB 1LT9B 3HD7A 1J1DC 1LT9A 1FZFA 2H8PD 2YO3A 1HGVA 3VOPA 2FFDA 3MIWA 2N9BA 5APWA 3L36A 1SQPK 4IFFA 1DX7A 1G2CB 1Z56A 1G2CA 2R32A 2WZ7A 3O8ZA 4M3LA 1GU5A 3OAKA 2W6BA 2ZXEB 1ZLLA 3V2RA 1X79B 4LC1A 1T8ZA 3NFQA 3HD7D 5AVYB 3BRTB 3TNUA 1NKNA 5AVQB 1AFOA 4N3YB 1JY3O 1J1EC 2HPCB 1GL2C 3HD7C 4B86A 3NMDA 5AVRB 1OWAA 1RE4C 3P7KA 1FZCA 5AVSB 1FJPA 1T3UA 1HBWA 2OYIA 1IFNA 2HYNA 3A5TA 3HUSB 1N7SC 5APQA 1WRGA 2IFMA 2WPRA 3SWYA 4C7RA 2HFED 3MD0A 4KHXA 1JY2P 1T3JA 1KILC 2WPQA 3KDPB 2YKQA 1LTTC 3M9HA 2Q9IA 2YNYA 1LTJB 1FBMA 3RK3B 4ZKPA 2KLVA 2POHA 5AW4B 4C46A 1ZN5A 4WY4B 1HH0A 2LKMA 1N2DC 2N1TC 2O1KA 1NH4A 4HH2A 3GHGA 3VMYA 2OYHC 1MV8A 2R5DA 1M1JC 3VN0A 5CCGA 3OJAB 5APVA 3V2QA 1RY3A 3RK2B 5AW7B 1JMMA 1HJBA 1FZBA 1RF0C 3B5NB 3U59A 3M9BA 3U1AA 1VDFA 1A02F 3A2AA 2HG5D 2W6AA 5CCGD 2A45H 3HTKB 2WSFH 3CLQA 1NO4A 3HTKA 5CCHC 1JNMA 1FZGA 3RK2D 1NAFA 1GW3A 2BASA 1LWUB 1H8AA 5KTBA 3VP8A 2I1KA 1G1JA 5APSA 5AW1B 1FOSF 1IFMA 2I1JA 2C0WA 1N86A 5BU5A 3BVHA 4N78D 3VP9A 1CW5A 3V2PA 3VYIA 4I1LA 1J1DB 5AW8B 2YMYA 5BVZA 3II6A 1HVVA 1LTBC 3MTUE 1L4AB 1L4AA 1XTCC 1FZAA 1JUNA 1LTIC 3HRNA 4C7NB 5AW6B 4C7NA 1ZV8A 2A45G 2CPBA 5AVVB 5AVZB 4W80A 1MUUA 4Y99C 3G3ZA 3LIEA 1NTKK 2C9NY 1YYCA 1W2EA 4IFDK 1H88A 2H7HA 3PP5A 5KJ7A 3M0DA 1J1EB 1L4AD 1GL2B 3KPEA 1RF1C 1JOCA 4LGDE 1NWQA 1KFMA 2FKWB 3UIAA 3U1CA 2HPCA 1S9KE 1LT9C 1LTGC 2IPPA 2XDJA 1JY2O 2FFDC 1FZEA 1SP4A 1GDTA 2WPSA 2MJZA 3EFGA 1RE3A 1N7SB 5KJ7D 2M3BA 1ZR4A 1HWTC 1SQBK 1MFZA 1GK4A 3V4QA 2E43A 3HUSA 3P8MC 1EQ7A 3KYQA 1VPCA 3WMM0 4AQRD 4LLHA 1KILB 2P1JA 4EIJA 1IC2A 1WT6A 2R3CA 1OXZA 2O01H 5AW5B 2HODB 1SVFA 3L37A 1LTJA 5CJ4A 1FZCC 1URQB 4XE5B 1URQA 2OARA 2N1TB 1SQXK 4GKGA 2OYIC 4AUWA 1NKZB 4WY4A 2Q5UA 2WWWA 2OYHB 5AVUB 5AW9B 3RL0B 5AVWB 3HE5B 2KB7P 5AW0B 1T2KD 3VMXA 1JCCA 2JEEA 1NU1K 1H89A 2Z4EA 3P32A 4WB4A 2H43A 3RK3D 2XU6A 1URQD 2WTYA 3EQ2A 1QL2A 4WY4D 1GW4A 3RL0D 3B5NA 1GD2E 2NPSB 4JYCA 2J59M 3TYYA 3VTPC 1IFIA 5CHXA 2GM4A 1JTHB 1JY2N 3BATA 5BU8B 3GHGC 3M06A 2YO2A 2XZRA 3V2NA 3H32B 5CCGC 4XA4A 2J58A 2PP6A 1LWUA 4ZKUA 1E5WA 3B5ND 3LW5H 1NTMK 1N73B 2Z5IA 4HYTB 3RK2C 2NPSD 2KSJA 1JO5A 1FAVA 1YTZI 1SFCB 1SFCA 3B8EB 1X9VA 1NHLA 3V5BA 3I5CA 5CMZA 2R5BA 4JF7A 3TK1A 2PAJA 3P8CE 2IX7C 5AW2B 3E1IA 1IFJA 3MUDA 2ZFCA 1SFCD 2P2UA 1GU4A 4JYBA 1LTSC 2XNXA 1XTGB 3M0AA 4DOJA 3M91A 1IK9A 3H6PA 2KOGA 3HD7B 1GL2A 1MZ9A 1ZR2A 2GUVA 1FU1A 1IJDB 1CSBA 2FFDB 1KFNA 1RE4A 1L4AC 2C0XA 2A45I 5APUA 5APXA 2FXMA 1NOHA 1N7SA 1GZLA 1GL2D 4I6MC 2GUSA 3TNUB 5KJ7C 3M0DC 3NTNA 1KILA 1S9KD 3HE4B 3HE4A 1N7LA 3IFMA 3SWFA 3CL3D 1FZCB 1NTZK 5CJ0A 2XKMA 1N7SD 2XV5A 2YKOA 1SQQK 1DEBA 2HODA 2IFNA 1L0NK 2OYIB 2WITA 1HGZA 1RE3C 4WBAA 2N1TA 3BASA 1KILD 1JY3P 1PFIA 1AQ5A 1HTLC 2OYHA 3HUSC 3HE5A 1M1JB 3N7NA 1M1JA 4GIFA 4W7YA 3M9QA 2QM8A 3BRVB 3N4XA 2C9LY 2P67A 2VRSA 1X8YA 1HUCA 1A02J 1RF0A 2FYZA 1T2KC 2HLOA 2N1TD 2P7JA 3KQGA 3R2PA 4GT1A 4W7ZA 3OA7A 1FOSE 1LTJC 3RK3C 5AVXB 1L0LK 1URQC 5AW3B 4RESB 2YKPA 1GK6A 4O9BA 2NPSA 4OH8B 5CCHA 1YTZT 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2L C;  3T97 A;  3TK1 A;  2W27 A;  2WPR A;  3NXS A;  3MD0 A;  4KHX A;  1NWQ A;  3V4W A;  5AW2 B;  2WPQ A;  4DZO A;  3UIA A;  3VMZ A;  3KDP B;  1S9K E;  2ZFC A;  3M9H A;  2IPP A;  2P2U A;  2Q3I A;  1GU4 A;  2YNY A;  5APT A;  1CZQ A;  1SP4 A;  4JYB A;  2WPS A;  3M0A A;  1J2J B;  3MGN A;  3M91 A;  5AW4 B;  1DH3 A;  4C46 A;  1HWT C;  1CI6 B;  3A3Y B;  1CI6 A;  1GK4 A;  1MFZ A;  3V4Q A;  3A7O A;  2E43 A;  4AYC A;  3P8M C;  2Q7C A;  4AQR D;  2Z5H A;  3VMY A;  1MV8 A;  2R5D A;  1KQL A;  3VN0 A;  2R3C A;  1CSB A;  1OXZ A;  5APV A;  2KP8 A;  5AW5 B;  1IO4 A;  5APU A;  1GTW A;  3L35 A;  5AW7 B;  1HJB A;  3L37 A;  2JJL A;  4XE5 B;  5APX A;  2E42 A;  2QM7 A;  3M9B A;  1A02 F;  4AUW A;  4GKG A;  3IR9 A;  4EOT A;  1GZL A;  5APY A;  3A2A A;  2Q5U A;  2WWW A;  1SLQ A;  4I6M C;  5AVU B;  5AW9 B;  2W6A A;  3TNU B;  5AVW B;  3HE5 B;  3HTK A;  2WT7 A;  2WT7 B;  1JNM A;  3LID A;  3NTN A;  5AVT B;  5AW0 B;  1S9K D;  3VMX A;  1T2K D;  3HE4 B;  1H89 A;  3HE4 A;  3P32 A;  1NAF A;  2BAS A;  2YO3 A;  2XU6 A;  1H8A A;  2WTY A;  3SWF A;  5APW A;  2N9B A;  3L36 A;  2XV5 A;  5APS A;  5AW1 B;  1FOS F;  1G2C B;  2R32 A;  3O8Z A;  4M3L A;  1GU5 A;  3OAK A;  1GD2 E;  2ZXE B;  4JYC A;  3TYY A;  4LC1 A;  3VTP C;  3NFQ A;  3VYI A;  5AVY B;  5AW8 B;  3TNU A;  3HE5 A;  5AVQ B;  3M06 A;  2QM8 A;  2YO2 A;  2XZR A;  2C9L Y;  2P67 A;  4B86 A;  1JUN A;  3NMD A;  2VRS A;  1X8Y A;  1HUC A;  5AVR B;  1A02 J;  1OWA A;  3P7K A;  4C7N B;  5AVS B;  5AW6 B;  2Z5I A;  4HYT B;  4C7N A;  1T2K C;  2P7J A;  3KQG A;  5AVV B;  4GT1 A;  1HBW A;  1FAV A;  1FOS E;  5AVZ B;  1MUU A;  5AVX B;  3B8E B;  3LIE A;  5AW3 B;  3V5B A;  2C9N Y;  4RES B;  3A5T A;  1YYC A;  1GK6 A;  3I5C A;  5CMZ A;  1H88 A;  2H7H A;  2R5B A;  5APQ A;  3M0D A; 
#chains in the Genus database with same CATH topology
 1KOR A;  1U7J A;  2K1A A;  2W27 A;  2E74 C;  3V4W A;  2IDB A;  2O1J A;  3C9I A;  3AE6 C;  5CCH D;  1S3J A;  5K5G B;  3IN6 A;  1DH3 A;  1CI6 A;  4AYC A;  2QSI A;  4EI2 A;  2NPS C;  2RH0 A;  2AEF A;  2Z5H A;  1FJK A;  2CK3 H;  3D70 A;  3H1H E;  1JCD A;  1IO4 A;  1LWU C;  2E75 B;  1JB0 J;  1N73 C;  3A0H H;  2WMM A;  2NRG A;  5APY A;  1SLQ A;  3FXD A;  1RF1 A;  2WT7 A;  1NTK G;  3TGU G;  4RJT A;  1BGY G;  3P8C D;  3LID A;  3Q3D A;  2QIW A;  1FZF A;  3MIW A;  1EXI A;  1Z56 A;  1G2C A;  4OVN F;  1GU5 A;  1ZLL A;  1NTZ E;  3NFQ A;  5AVY B;  1OX3 A;  1U57 A;  3BRT B;  3IAO A;  3TNU A;  3AE8 C;  1H0T B;  1GL2 C;  1U7M A;  5B66 H;  1JEK A;  4H44 B;  1IK7 A;  1YJ9 P;  1OWA A;  1RE4 C;  5AVS B;  2Q3E A;  3WUV A;  4H0L C;  1FE6 A;  2DW3 A;  1HBW A;  2IBZ I;  3GLM A;  3A5T A;  1K9M Q;  1T6A A;  5TJH A;  2W90 A;  5APQ A;  3AEA C;  3SWY A;  3MD0 A;  1L0L E;  1JY2 P;  1VQL P;  3JC2 2;  3KDP B;  2YKQ A;  3M9H A;  4I7Z C;  1NU1 D;  1FDO A;  1P84 I;  4K3A A;  1S4X A;  4ZKP A;  3CCJ P;  1ZN5 A;  3L72 D;  1PP9 E;  1D7M A;  1N2D C;  3F89 A;  2OYH C;  2FYU J;  1M1J C;  3CCE P;  3D6Y A;  1RY3 A;  3Q5P A;  1M8O B;  1M57 D;  2KS1 B;  3L74 J;  1OFC X;  1NTM G;  3L74 D;  3M9B A;  2HG5 D;  2WSF H;  3HTK A;  3C8V A;  1IZN B;  1AVO A;  4Y28 J;  4U3F E;  1GW3 A;  2YIU C;  2BAS A;  5KTB A;  4UB6 E;  1MFT A;  1Q90 D;  1ZOY C;  3OW2 O;  5KLV J;  1FOS F;  2KXP B;  1RQU A;  3L70 J;  3BVH A;  4N78 D;  3V2P A;  1VF5 C;  1HVV A;  2RMZ A;  3CWB J;  1L4A A;  1FZA A;  1JUN A;  1EZV D;  4C7N B;  2MKV A;  1ZV8 A;  2A45 G;  2CPB A;  1RHZ B;  5EFW B;  1YJN P;  4W80 A;  1R5S A;  2BCC D;  1N8R Q;  4KT0 J;  3LIE A;  1L4A D;  3KPE A;  2H89 C;  3U1C A;  1SS1 A;  2HPC A;  1LTG C;  2B87 B;  3USS A;  3BCC J;  2W6J H;  2FFD C;  1YBK A;  1GDT A;  1N7S B;  1HWT C;  1SQB K;  1SQQ D;  1GK4 A;  1EQ7 A;  4WVZ A;  4EIJ A;  1K73 Q;  2QA4 P;  2R3C A;  2SPZ A;  4HKZ H;  3FX0 A;  3I55 P;  3L37 A;  1URQ B;  2JDI H;  2FY8 A;  2R3S A;  3H1J E;  4GKG A;  4AUW A;  2Y9Y A;  3JCU E;  2WWW A;  2ZT9 D;  5AVU B;  2KB7 P;  4ZNC A;  3CXH E;  3G71 P;  1H89 A;  2B88 A;  5M1B A;  1LT1 A;  4R4L A;  2XU6 A;  3CD6 P;  2B9B A;  4XFJ A;  4UB6 H;  1NVO A;  4PD4 E;  1GW4 A;  4NPE A;  1GD2 E;  2E74 D;  2Y9Z A;  4JYC A;  2J59 M;  2H88 C;  1IFI A;  2B89 A;  3BAT A;  4HB1 A;  3W67 A;  1LJ2 A;  1LWU A;  4ZKU A;  3IF4 A;  3RK2 C;  1SQV G;  2NPS D;  1YTZ I;  1X9V A;  5CMZ A;  1M90 Q;  3S9O A;  1S1C X;  3G4S P;  3TK1 A;  3H1H G;  3W68 A;  3AEC C;  3P8C E;  5AW2 B;  1NTK E;  3E1I A;  3KXD A;  2P10 A;  2P2U A;  1XTG B;  1Y47 A;  3WU2 E;  2QJP C;  1SQP D;  1IK9 A;  3H6P A;  1Q7Y Q;  1EDL A;  1GL2 A;  2I8D A;  3H25 A;  4WWI A;  1IJD B;  1RE4 A;  2WSF J;  2HR3 A;  2JR8 A;  2WSC J;  1GL2 D;  1BCC D;  3TNU B;  3D71 A;  3JCU H;  3M0D C;  2QJY C;  4H0L D;  5KKZ C;  3C1L A;  3IFM A;  3CL3 D;  1NTZ K;  5CJ0 A;  2ZXX A;  3H1K D;  1BE3 D;  1NU1 E;  1HGZ A;  4WBA A;  5KAI E;  4PD4 H;  3S1K A;  3BAS A;  1KYO D;  1PFI A;  3L71 G;  1HTL C;  1L0L G;  3L72 E;  2OYH A;  2KZI A;  3HUS C;  3N7N A;  1M1J A;  4BRY A;  2QJK C;  2IYO A;  2FYZ A;  1T2K C;  2P7J A;  3R2P A;  3SSU A;  1PP9 G;  1LTJ C;  2LR2 A;  3RK3 C;  5AVX B;  1L0L K;  5AW3 B;  3QH9 A;  2UWJ E;  1NTM E;  1JTH A;  2L91 A;  3T97 A;  1LGH B;  3RL0 C;  2KLU A;  3VMZ A;  3H32 A;  3CX5 D;  4DT0 A;  4IL6 X;  1RH5 B;  1KQG B;  2KZJ A;  3L4F A;  3B5N C;  1M1K Q;  2Q7C A;  4U3F G;  4N78 E;  1QL1 A;  1ZXG A;  1DD3 A;  2CPS A;  2KYV A;  2KP8 A;  3D6Z A;  4DCK A;  3L35 A;  1FDM A;  1LTA C;  1VF5 D;  1EZV E;  2E42 A;  1IFD A;  1SFC C;  3IR9 A;  2K88 A;  2L5G B;  2BCC E;  1M56 D;  5AVT B;  2ZJS E;  1LT9 B;  1NYH A;  2IZ1 A;  2H8P D;  2FFD A;  5APW A;  4H13 B;  3L36 A;  3H1I J;  3MUD C;  1DX7 A;  3H1I D;  1AA0 A;  4JQ0 D;  1FS0 E;  3MHV A;  1S5L X;  2KSE A;  4TT3 H;  1YQ3 C;  5KAI H;  1SQQ E;  2KIK A;  1NKN A;  5AVQ B;  1JY3 O;  2HPC B;  3HD7 C;  5GTH H;  4PV1 C;  3P7K A;  2Y0C A;  1L0N J;  1EDK A;  1IFN A;  5DJT B;  4OGQ C;  1VQK P;  1OVV A;  2ZT9 B;  2HFE D;  1EDI A;  1T3J A;  1LTT C;  2YNY A;  2RKL A;  2POH A;  3PRJ A;  2N1T C;  2JKV A;  1Q86 Q;  1NH4 A;  2E74 B;  3VMY A;  3GG2 A;  3PJS K;  3VN0 A;  1OVU A;  2BEQ D;  2RN0 A;  1FZB A;  1RF0 C;  1R8E A;  1QVG O;  3VMA A;  1QGK B;  3PTZ A;  1SQV E;  1DEE G;  1QLE D;  2W6A A;  2A45 H;  1FZG A;  2V7Q H;  3RK2 D;  1KV4 A;  4PD4 I;  1LWU B;  3V6I A;  3ITK A;  1G1J A;  4UB8 H;  1IFM A;  1N86 A;  2OYO A;  3CC7 P;  2M5A B;  1SQP E;  4I1L A;  5AW8 B;  3II6 A;  5L8R J;  4JPZ B;  2ZYG A;  2QRX A;  5AW6 B;  5AVV B;  1OMI A;  2FXP A;  1MUU A;  3G3Z A;  1NTK K;  3TGU J;  1BGY J;  4IFD K;  2H7H A;  1PL5 A;  3M0D A;  1GL2 B;  1BCC E;  1JOC A;  1KFM A;  2YMK A;  4H0L B;  3KZI H;  1JY2 O;  1KB9 H;  1SP4 A;  2WPS A;  3H1K E;  1BE3 E;  2M3B A;  5TIS H;  1MFZ A;  2OTK E;  3EWK A;  3HUS A;  1VPC A;  1KYO E;  1PV3 A;  4AQR D;  3R4Y A;  3L71 E;  2WPV B;  1WT6 A;  4I7Z B;  2ZVN B;  2O01 H;  1NU1 G;  1Q82 Q;  5KAF E;  1SVF A;  1X22 A;  1LTJ A;  3FWN A;  3L73 J;  1FZC C;  3L73 D;  3PH0 A;  3CCU P;  3AEB C;  3CC4 P;  3L72 G;  2OYI C;  2OYH B;  5AW9 B;  4BRY B;  3CMA P;  1T2K D;  1USE A;  1NU1 K;  1WMK A;  3P32 A;  2H43 A;  2FYU D;  3RK3 D;  1QL2 A;  3CX5 E;  4ASW A;  3L74 G;  1TU3 F;  3RL0 D;  3B5N A;  3A0B E;  4IOI H;  3TYY A;  1JTH B;  3T97 B;  3AE3 C;  2YIU B;  4A7P A;  1KQF B;  2YO2 A;  3V2N A;  3H32 B;  5CCG C;  4HJG H;  1E5W A;  1UII A;  3B5N D;  1KTM A;  3LW5 H;  1NTM K;  1FAV A;  5KLV D;  1SFC A;  3MZW B;  3V5B A;  4K35 A;  1YIT P;  5CBO A;  2R5B A;  3L70 D;  4JF7 A;  4L74 A;  2IX7 C;  1VQO P;  1IFJ A;  3CWB D;  3MUD A;  1EZV G;  1SFC D;  1GU4 A;  4JYB A;  1LTS C;  2W83 C;  5DJU B;  1S72 P;  4DOJ A;  4TLF A;  2BCC G;  4QMA A;  1KQS O;  1KYO H;  1PGQ A;  2FFD B;  2E76 C;  3TDK A;  3AEF C;  2A45 I;  3RBX A;  2K9J A;  3FXE A;  3BCC D;  1YQ4 C;  5KAF H;  2FXM A;  1SQQ G;  4D6T J;  1SQB J;  4I6M C;  4D6T D;  1SQB D;  1OZH A;  4PV1 D;  5KJ7 C;  2G3A A;  1LNQ A;  3HE4 A;  3L75 J;  4OGQ D;  1SQQ K;  3L75 D;  1EDJ A;  1RE3 C;  3E1R A;  2N1T A;  3A0B H;  2E5Y A;  4GOD A;  3HE5 A;  2JP3 A;  4W7Y A;  1S5L E;  3CCL P;  4L76 A;  3N4X A;  2V4H A;  1X8Y A;  3I56 P;  1RF0 A;  2HLO A;  2N1T D;  1PZQ A;  4W7Z A;  1ZRT D;  1URQ C;  4RES B;  2NPS A;  4OH8 B;  2WQY C;  1KB9 I;  2ZAE B;  4WY4 C;  4I2L C;  3TSI A;  4N6J A;  3NXS A;  2AEM A;  3FGA D;  2Q3I A;  4NPF X;  5APT A;  1N73 A;  2PGD A;  1KZU B;  1JY3 N;  3MGN A;  1UIX A;  4GOF A;  4BWN A;  2JO1 A;  1CI6 B;  3A3Y B;  4EDF A;  1W5C E;  2Q6Q A;  4IFM A;  1KQL A;  1Q2N A;  4NPD A;  1M7L A;  1SQV K;  1QVF O;  1GTW A;  2R44 A;  1LP1 A;  4GDO A;  4Y99 B;  1SQP G;  2QM7 A;  3GF3 A;  4EOT A;  3H1H J;  3CI9 A;  5GTI E;  1RF1 B;  2WT7 B;  4ASV A;  1J1D C;  5B5E E;  1HGV A;  1BSN A;  1SQP K;  2ITA A;  4IFF A;  1G2C B;  3O8Z A;  4M3L A;  2A06 D;  3OAK A;  2ZXE B;  3V2R A;  1X79 B;  1BCC G;  3GW6 A;  1T8Z A;  2D2C C;  2KUB A;  1VL2 A;  3MP7 B;  5KKZ B;  2IYP A;  1J1E C;  1JM0 A;  3CXH H;  1S5L H;  4B86 A;  1KC8 Q;  3H1K G;  5AVR B;  4ZMD A;  3CME P;  1FZC A;  1BE3 G;  1NTZ J;  1FJP A;  1L2P A;  1T3U A;  2OYI A;  3G6E P;  3HUS B;  3O6Q A;  3L73 E;  2FYN C;  1SQX J;  1WRG A;  2IFM A;  1SQX D;  2WPR A;  2QJK B;  4KHX A;  1KIL C;  1LTJ B;  2FYU E;  3AED C;  3RK3 E;  1FBM A;  3RK3 B;  1KYO I;  1BDC A;  2KLV A;  4C46 A;  1HH0 A;  2LKM A;  3L74 E;  1K05 A;  2O1K A;  4YXD C;  1MV8 A;  5CCG A;  1OW8 A;  3KHU A;  2K3R A;  1PP9 J;  5AW7 B;  3B5N B;  2N9Y B;  3U59 A;  1VDF A;  3F5H A;  5KLV E;  3WU2 H;  5CCG D;  3HTK B;  3CLQ A;  1NO4 A;  5GTI H;  2Y0D A;  3L70 E;  3SWK A;  1NAF A;  3VP8 A;  2I1K A;  5APS A;  3CWB E;  2I1J A;  2C0W A;  5BU5 A;  2KNC A;  1K8A Q;  4U3F J;  1CW5 A;  1PPJ D;  4L73 A;  2YMY A;  5BVZ A;  2LXB A;  1LTB C;  3MTU E;  1L4A B;  3RL0 g;  3B4S A;  3HRN A;  4C7N A;  3H1I G;  5AVZ B;  3BCC E;  2C9N Y;  1YYC A;  2ZYA A;  5KJ7 A;  2G8Y A;  2E76 D;  3AE5 C;  1NWQ A;  2FKW B;  4PV1 B;  1YIJ P;  1AQT A;  1LT9 C;  1PGJ A;  2IPP A;  2K9J B;  3A0H E;  1FZE A;  4H13 C;  2MJZ A;  1RE3 A;  5KLI C;  4OGQ B;  5KJ7 D;  1FDI A;  1ZR4 A;  1W2B O;  3V4Q A;  1JMB A;  1L0N D;  3RGU A;  1PGP A;  2KK7 A;  3KYQ A;  4JBZ A;  1OVR A;  1KN7 A;  4U7J A;  1IC2 A;  1OW7 A;  1OXZ A;  5AW5 B;  4YTP C;  2ZYD A;  4XE5 B;  1URQ A;  4RKU J;  2N1T B;  3H1L J;  4WY4 A;  1ZRT E;  3H1L D;  3HE5 B;  1VQM P;  5AW0 B;  4BXL A;  1JCC A;  2JEE A;  3CC2 P;  1URQ D;  1HF9 A;  3H1J J;  3H1J D;  4WY4 D;  3CXH I;  2NPS B;  2Y0E A;  5CHX A;  2FBW C;  5BU8 B;  3GHG C;  3S4R A;  4CPG A;  2J58 A;  2PP6 A;  4PD4 D;  1N73 B;  2KSJ A;  1JO5 A;  3B8E B;  3I5C A;  2NZ2 A;  1LP1 B;  3G9R A;  3Q2Y A;  5C39 A;  2XNX A;  3M0A A;  3M91 A;  2E75 C;  1NTK J;  2A06 E;  1NTK D;  3TGU D;  1IFP A;  1BGY D;  3PHL A;  4OWF A;  1FU1 A;  1KFN A;  2C0X A;  2D2C D;  3SFD C;  1NOH A;  2IBZ G;  1R5L A;  2GUS A;  2J5U A;  2IBZ D;  3ZDM A;  3NTN A;  1EC5 A;  1KIL A;  1S9K D;  2QVA A;  3WUU A;  1SQX E;  1Y9B A;  3CCS P;  3SWF A;  1FZC B;  2XKM A;  2XV5 A;  4H44 C;  2HOD A;  2IFN A;  2OYI B;  1ZP0 C;  3L73 G;  2WIT A;  3O6Q B;  1P84 D;  1KIL D;  4PJ0 E;  1KD1 Q;  1M1J B;  2ZVO B;  4GIF A;  3M9Q A;  3GMA A;  3BRV B;  2P67 A;  2YXQ B;  1NU1 J;  2FYU G;  1VQN P;  3RBZ A;  1HUC A;  2M3E A;  4MN4 C;  3L72 J;  1AJY A;  2K9Y A;  1FOS E;  2YKP A;  1GK6 A;  4O9B A;  2BEZ F;  1YTZ T;  2FYU K;  4DZO A;  1MKM A;  2P58 A;  1CZQ A;  1NTM J;  2O01 N;  1J2J B;  5KLV G;  1NTM D;  1VF5 B;  3A7O A;  2M8R A;  1YHQ P;  1G1I A;  3L70 G;  1BSH A;  1PPJ E;  1QEX A;  2WSC H;  3CWB G;  5KLV K;  2JJL A;  2K37 A;  2KNC B;  3H1I E;  2WSE H;  4IL6 E;  2FXO A;  1EXJ A;  2AXC A;  2E76 B;  3HD7 A;  1LT9 A;  1EZV I;  2YO3 A;  3VOP A;  2N9B A;  1ZME C;  1NAY A;  3BCC G;  2BCC J;  2V7Q J;  3K5B A;  2R32 A;  2WZ7 A;  2W6B A;  4LC1 A;  3HD7 D;  3GF7 A;  4D6T G;  1SQB G;  1L0N E;  2GA1 A;  4PJ0 H;  4Z1M H;  1AFO A;  4N3Y B;  4H13 D;  3QWO C;  3NMD A;  1VQP P;  3L75 G;  1SQQ J;  3CCV P;  2WSS H;  2JWA A;  2HYN A;  3CX5 H;  3AE4 C;  1N7S C;  3Q1M A;  4C7R A;  3H1L E;  1DIP A;  4DJG A;  2WPQ A;  3ABV C;  3AE1 C;  2OTJ P;  2Q9I A;  3CCQ P;  5CBN A;  2O3J A;  1KMI Z;  2QEX P;  5AW4 B;  4WY4 B;  3JSV C;  4HH2 A;  3GHG A;  1VQ7 P;  1KB9 D;  4GOE A;  2R5D A;  1PGO A;  3OJA B;  5APV A;  3V2Q A;  3RK2 B;  1JMM A;  1HJB A;  2QG4 A;  2PFX A;  1BDD A;  3U1A A;  1A02 F;  1VQ9 P;  2O01 J;  3A2A A;  5CCH C;  1JNM A;  1PIX A;  3Q5R A;  4IL6 H;  2OTL P;  1YJW P;  1H8A A;  1SQV J;  1HJ0 A;  5AW1 B;  2QJP B;  1SQV D;  4YPC A;  1AVY A;  3VP9 A;  2M5A A;  3CCM P;  3VYI A;  1J1D B;  3AE2 C;  3Q5S A;  3H1H D;  3TGU E;  2PRR A;  1BGY E;  2OGU A;  1XTC C;  1LTI C;  2E75 D;  1K04 A;  2AXT E;  1SQP J;  3AE9 C;  2D2C B;  2A06 G;  4Y99 C;  2OQQ A;  1VQ5 P;  1W2E A;  1H88 A;  3PP5 A;  3LW5 J;  1J1E B;  2QJY B;  1QX8 A;  1ZW0 A;  1RF1 C;  2E5T A;  2AEJ A;  4LGD E;  2IBZ E;  2W8Z A;  1H0T A;  3UIA A;  1S9K E;  3SFE C;  2WVR A;  2XND H;  2XDJ A;  2KI7 B;  1Q81 Q;  5H2F E;  1NTZ G;  3EFG A;  1NTZ D;  1BCC J;  2FYN B;  3TF5 A;  2E43 A;  2JWD A;  3P8M C;  3WMM 0;  1P84 E;  1SQX G;  4LLH A;  1KIL E;  1KIL B;  3AE7 C;  4H44 D;  2P1J A;  4KJM A;  2WSE J;  3H1K J;  1BE3 J;  2HOD B;  1VQ6 P;  1VQ4 P;  4YXW H;  5CJ4 A;  2OAR A;  4RO0 A;  1S2E A;  1SQX K;  1NKZ B;  3L71 J;  1L0L J;  2Q5U A;  3RL0 B;  3L71 D;  5AVW B;  1L0L D;  3AEG C;  3VMX A;  5GTH E;  2Z4E A;  4L75 A;  4WB4 A;  2WTY A;  3EQ2 A;  2Q1K A;  1Y8A A;  2KS1 A;  1PP9 D;  1E79 H;  3VTP C;  1RQV A;  2GM4 A;  1JY2 N;  1YI2 P;  3M06 A;  2LXC B;  3CX5 I;  2XZR A;  4XA4 A;  3CPW O;  5B5E H;  2Z5I A;  4HYT B;  2QE7 H;  2AXT H;  1SFC B;  3PLN A;  5E79 E;  1NHL A;  1PPJ G;  4U3F D;  2M0B A;  2PAJ A;  1NGM B;  3E7K A;  2ZFC A;  3CCR P;  3WUT A;  5H2F H;  1AV1 A;  2YXR B;  2KOG A;  3AEE C;  3HD7 B;  1MZ9 A;  1P84 H;  1ZR2 A;  2GUV A;  4D6T E;  1SQB E;  1CSB A;  1L4A C;  1OIP A;  4UB8 E;  2B87 A;  5APU A;  5KLI B;  5APX A;  1N7S A;  1OW6 A;  1L0N G;  3L75 E;  4EYY Q;  3B71 A;  1GZL A;  1X0T A;  3FWL A;  3HE4 B;  1N7L A;  3EFF K;  4R4M A;  1NJI Q;  1N7S D;  2YKO A;  1DEB A;  1L0N K;  1GMJ A;  1FC2 C;  1JY3 P;  1AQ5 A;  3H1L G;  5B66 E;  2QM8 A;  1USD A;  3KZI E;  2C9L Y;  2ZT9 C;  1VQ8 P;  2IZ0 A;  1KB9 E;  2VRS A;  1A02 J;  3H1J G;  5TIS E;  3KQG A;  4GT1 A;  3OA7 A;  1DD4 A;  5CCH A;  5E79 H;  3CXH D;  3GHG B; 
#chains in the Genus database with same CATH homology
 4WY4 C;  4I2L C;  3TSI A;  1JTH A;  3T97 A;  1LGH B;  2FYU K;  4N6J A;  2W27 A;  3RL0 C;  3NXS A;  3V4W A;  4DZO A;  3VMZ A;  2O1J A;  3C9I A;  3H32 A;  2Q3I A;  5APT A;  1CZQ A;  1N73 A;  1KZU B;  5CCH D;  1J2J B;  1JY3 N;  3MGN A;  3L4F A;  1DH3 A;  1CI6 B;  3A3Y B;  1CI6 A;  3A7O A;  2M8R A;  3B5N C;  4AYC A;  1G1I A;  2NPS C;  2Q7C A;  4N78 E;  1QL1 A;  2Z5H A;  1FJK A;  4IFM A;  2CPS A;  1KQL A;  2KYV A;  2WSC H;  1M7L A;  2KP8 A;  1SQV K;  1JCD A;  5KLV K;  1IO4 A;  1GTW A;  3L35 A;  1LWU C;  1FDM A;  1LTA C;  2JJL A;  4Y99 B;  1N73 C;  2E42 A;  2QM7 A;  1IFD A;  1SFC C;  2WSE H;  3IR9 A;  4EOT A;  5APY A;  1SLQ A;  2L5G B;  3CI9 A;  1RF1 B;  2WT7 B;  1RF1 A;  2WT7 A;  3P8C D;  3LID A;  5AVT B;  1LT9 B;  3HD7 A;  1J1D C;  1LT9 A;  1FZF A;  2H8P D;  2YO3 A;  1HGV A;  3VOP A;  2FFD A;  3MIW A;  2N9B A;  5APW A;  3L36 A;  1SQP K;  4IFF A;  1DX7 A;  1G2C B;  1Z56 A;  1G2C A;  2R32 A;  2WZ7 A;  3O8Z A;  4M3L A;  1GU5 A;  3OAK A;  2W6B A;  2ZXE B;  1ZLL A;  3V2R A;  1X79 B;  4LC1 A;  1T8Z A;  3NFQ A;  3HD7 D;  5AVY B;  3BRT B;  3TNU A;  1NKN A;  5AVQ B;  1AFO A;  4N3Y B;  1JY3 O;  1J1E C;  2HPC B;  1GL2 C;  3HD7 C;  4B86 A;  3NMD A;  5AVR B;  1OWA A;  1RE4 C;  3P7K A;  1FZC A;  5AVS B;  1FJP A;  1T3U A;  1HBW A;  2OYI A;  1IFN A;  2HYN A;  3A5T A;  3HUS B;  1N7S C;  5APQ A;  1WRG A;  2IFM A;  2WPR A;  3SWY A;  4C7R A;  2HFE D;  3MD0 A;  4KHX A;  1JY2 P;  1T3J A;  1KIL C;  2WPQ A;  3KDP B;  2YKQ A;  1LTT C;  3M9H A;  2Q9I A;  2YNY A;  1LTJ B;  1FBM A;  3RK3 B;  4ZKP A;  2KLV A;  2POH A;  5AW4 B;  4C46 A;  1ZN5 A;  4WY4 B;  1HH0 A;  2LKM A;  1N2D C;  2N1T C;  2O1K A;  1NH4 A;  4HH2 A;  3GHG A;  3VMY A;  2OYH C;  1MV8 A;  2R5D A;  1M1J C;  3VN0 A;  5CCG A;  3OJA B;  5APV A;  3V2Q A;  1RY3 A;  3RK2 B;  5AW7 B;  1JMM A;  1HJB A;  1FZB A;  1RF0 C;  3B5N B;  3U59 A;  3M9B A;  3U1A A;  1VDF A;  1A02 F;  3A2A A;  2HG5 D;  2W6A A;  5CCG D;  2A45 H;  3HTK B;  2WSF H;  3CLQ A;  1NO4 A;  3HTK A;  5CCH C;  1JNM A;  1FZG A;  3RK2 D;  1NAF A;  1GW3 A;  2BAS A;  1LWU B;  1H8A A;  5KTB A;  3VP8 A;  2I1K A;  1G1J A;  5APS A;  5AW1 B;  1FOS F;  1IFM A;  2I1J A;  2C0W A;  1N86 A;  5BU5 A;  3BVH A;  4N78 D;  3VP9 A;  1CW5 A;  3V2P A;  3VYI A;  4I1L A;  1J1D B;  5AW8 B;  2YMY A;  5BVZ A;  3II6 A;  1HVV A;  1LTB C;  3MTU E;  1L4A B;  1L4A A;  1XTC C;  1FZA A;  1JUN A;  1LTI C;  3HRN A;  4C7N B;  5AW6 B;  4C7N A;  1ZV8 A;  2A45 G;  2CPB A;  5AVV B;  5AVZ B;  4W80 A;  1MUU A;  4Y99 C;  3G3Z A;  3LIE A;  1NTK K;  2C9N Y;  1YYC A;  1W2E A;  4IFD K;  1H88 A;  2H7H A;  3PP5 A;  5KJ7 A;  3M0D A;  1J1E B;  1L4A D;  1GL2 B;  3KPE A;  1RF1 C;  1JOC A;  4LGD E;  1NWQ A;  1KFM A;  2FKW B;  3UIA A;  3U1C A;  2HPC A;  1S9K E;  1LT9 C;  1LTG C;  2IPP A;  2XDJ A;  1JY2 O;  2FFD C;  1FZE A;  1SP4 A;  1GDT A;  2WPS A;  2MJZ A;  3EFG A;  1RE3 A;  1N7S B;  5KJ7 D;  2M3B A;  1ZR4 A;  1HWT C;  1SQB K;  1MFZ A;  1GK4 A;  3V4Q A;  2E43 A;  3HUS A;  3P8M C;  1EQ7 A;  3KYQ A;  1VPC A;  3WMM 0;  4AQR D;  4LLH A;  1KIL B;  2P1J A;  4EIJ A;  1IC2 A;  1WT6 A;  2R3C A;  1OXZ A;  2O01 H;  5AW5 B;  2HOD B;  1SVF A;  3L37 A;  1LTJ A;  5CJ4 A;  1FZC C;  1URQ B;  4XE5 B;  1URQ A;  2OAR A;  2N1T B;  1SQX K;  4GKG A;  2OYI C;  4AUW A;  1NKZ B;  4WY4 A;  2Q5U A;  2WWW A;  2OYH B;  5AVU B;  5AW9 B;  3RL0 B;  5AVW B;  3HE5 B;  2KB7 P;  5AW0 B;  1T2K D;  3VMX A;  1JCC A;  2JEE A;  1NU1 K;  1H89 A;  2Z4E A;  3P32 A;  4WB4 A;  2H43 A;  3RK3 D;  2XU6 A;  1URQ D;  2WTY A;  3EQ2 A;  1QL2 A;  4WY4 D;  1GW4 A;  3RL0 D;  3B5N A;  1GD2 E;  2NPS B;  4JYC A;  2J59 M;  3TYY A;  3VTP C;  1IFI A;  5CHX A;  2GM4 A;  1JTH B;  1JY2 N;  3BAT A;  5BU8 B;  3GHG C;  3M06 A;  2YO2 A;  2XZR A;  3V2N A;  3H32 B;  5CCG C;  4XA4 A;  2J58 A;  2PP6 A;  1LWU A;  4ZKU A;  1E5W A;  3B5N D;  3LW5 H;  1NTM K;  1N73 B;  2Z5I A;  4HYT B;  3RK2 C;  2NPS D;  2KSJ A;  1JO5 A;  1FAV A;  1YTZ I;  1SFC B;  1SFC A;  3B8E B;  1X9V A;  1NHL A;  3V5B A;  3I5C A;  5CMZ A;  2R5B A;  4JF7 A;  3TK1 A;  2PAJ A;  3P8C E;  2IX7 C;  5AW2 B;  3E1I A;  1IFJ A;  3MUD A;  2ZFC A;  1SFC D;  2P2U A;  1GU4 A;  4JYB A;  1LTS C;  2XNX A;  1XTG B;  3M0A A;  4DOJ A;  3M91 A;  1IK9 A;  3H6P A;  2KOG A;  3HD7 B;  1GL2 A;  1MZ9 A;  1ZR2 A;  2GUV A;  1FU1 A;  1IJD B;  1CSB A;  2FFD B;  1KFN A;  1RE4 A;  1L4A C;  2C0X A;  2A45 I;  5APU A;  5APX A;  2FXM A;  1NOH A;  1N7S A;  1GZL A;  1GL2 D;  4I6M C;  2GUS A;  3TNU B;  5KJ7 C;  3M0D C;  3NTN A;  1KIL A;  1S9K D;  3HE4 B;  3HE4 A;  1N7L A;  3IFM A;  3SWF A;  3CL3 D;  1FZC B;  1NTZ K;  5CJ0 A;  2XKM A;  1N7S D;  2XV5 A;  2YKO A;  1SQQ K;  1DEB A;  2HOD A;  2IFN A;  1L0N K;  2OYI B;  2WIT A;  1HGZ A;  1RE3 C;  4WBA A;  2N1T A;  3BAS A;  1KIL D;  1JY3 P;  1PFI A;  1AQ5 A;  1HTL C;  2OYH A;  3HUS C;  3HE5 A;  1M1J B;  3N7N A;  1M1J A;  4GIF A;  4W7Y A;  3M9Q A;  2QM8 A;  3BRV B;  3N4X A;  2C9L Y;  2P67 A;  2VRS A;  1X8Y A;  1HUC A;  1A02 J;  1RF0 A;  2FYZ A;  1T2K C;  2HLO A;  2N1T D;  2P7J A;  3KQG A;  3R2P A;  4GT1 A;  4W7Z A;  3OA7 A;  1FOS E;  1LTJ C;  3RK3 C;  5AVX B;  1L0L K;  1URQ C;  5AW3 B;  4RES B;  2YKP A;  1GK6 A;  4O9B A;  2NPS A;  4OH8 B;  5CCH A;  1YTZ T;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...