5APTA

Sequence ienkadkad inserted between gcn4 adaptors - structure a9
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
68
structure length
68
Chain Sequence
b'HMKQLEDKVEELLSKVYHLENEVARLKKLIENKADKADMKQLEDKVEELLSKVYHLENEVARLKKLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
molecule tags Structural protein
source organism Saccharomyces cerevisiae
publication title alpha / beta coiled coils.
pubmed doi rcsb
total genus 30
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aptA00
1KQLA 3IR9A 3TYYA 5AW5B 4C46A 1MFZA 3P8MC 2WT7B 3MD0A 3SWFA 2XZRA 3TK1A 3HE4A 5APVA 3MGNA 5AW0B 3LIEA 2ZFCA 1FOSF 5AVVB 2Z5HA 2W27A 3L36A 4GKGA 2Q7CA 3V5BA 4HYTB 2P67A 3A7OA 3LIDA 5AVUB 3TNUB 4DZOA 2C9LY 3M9BA 2YO3A 4JYBA 2P7JA 1MUUA 1SLQA 1X8YA 1CI6A 5AVQB 4KHXA 1CI6B 3O8ZA 1CSBA 5AVZB 3M06A 1YYCA 3A2AA 3P7KA 4C7NB 2WPQA 3A3YB 3M91A 3M0DA 5APSA 2BASA 1HBWA 3V4QA 1T2KC 3NXSA 1CZQA 3OAKA 2XU6A 1JUNA 1NAFA 3A5TA 2W6AA 5APYA 3M0AA 3M9HA 3T97A 1A02F 1A02J 5AVSB 3P32A 1H88A 2YNYA 2WWWA 4LC1A 5AW7B 4AYCA 5APTA 3HTKA 4M3LA 4EOTA 5AW6B 3VN0A 3VYIA 3B8EB 3HE5B 2R32A 1GZLA 2E43A 2R5BA 1HWTC 2JJLA 5AW4B 5AVRB 1G2CB 2Z5IA 1S9KD 2WTYA 3L35A 4XE5B 3UIAA 1GD2E 1DH3A 1J2JB 3HE4B 1HUCA 1HJBA 4C7NA 5AW8B 5AVTB 3TNUA 5APQA 3I5CA 2H7HA 3VMYA 2YO2A 4AQRD 3L37A 4I6MC 3HE5A 5CMZA 1JNMA 2WPSA 2R3CA 1S9KE 3V4WA 2KP8A 3VTPC 5APXA 5AVWB 2IPPA 5AVXB 3KQGA 3NMDA 2XV5A 1FAVA 5AW2B 1NWQA 3KDPB 1H8AA 5AW3B 1IO4A 5AW9B 1GK6A 2P2UA 5APWA 1GK4A 4AUWA 5APUA 1GTWA 5AVYB 2N9BA 5AW1B 2Q3IA 3NFQA 3NTNA 1H89A 2ZXEB 1T2KD 1FOSE 3VMXA 1SP4A 4RESB 1GU4A 4B86A 2WPRA 1OXZA 2WT7A 2E42A 3VMZA 4I2LC 2C9NY 2Q5UA 2VRSA 4JYCA 2QM8A 1OWAA 1MV8A 4GT1A 1GU5A 2R5DA 2QM7A
chains in the Genus database with same CATH superfamily
1KQLA 3IR9A 3L74E 4YXWH 4WY4B 1URQC 4OGQD 1N7LA 1RH5B 2KLUA 2Q6QA 4I7ZB 4Y99B 5H2FE 4D6TD 1DD4A 1LNQA 2R3SA 2WT7B 1PL5A 1LP1A 3AEGC 5GTIE 3SWFA 2KS1A 2FYUG 3H32B 3L73G 1EXJA 2E74D 1SQBJ 2BCCG 3L71J 3GHGB 1FZEA 1LP1B 3WU2E 2KSJA 1RHZB 3KYQA 2N1TB 2PGDA 1VF5B 1AVYA 1G2CA 3LIEA 2ZVNB 4IL6E 3L71D 1NAYA 3L74D 2FYZA 3I56P 1FZGA 3WUTA 2XNXA 1AVOA 3V2NA 1AA0A 3BCCJ 3H1KG 3S9OA 1FC2C 1NTZE 2JO1A 5AVUB 1S5LH 3TNUB 1ZOYC 1L0ND 2I1JA 5CCHA 5CCHC 3M9BA 5CHXA 1QVGO 2J59M 4UB8E 1NKZB 1X8YA 2FYUE 1CI6A 4HJGH 1LTJC 3CWBD 4WY4D 1KB9D 1SQVE 3RBZA 3GHGA 1GL2C 1CI6B 1CSBA 5TJHA 3W68A 3M06A 1N7SB 1IFNA 3CLQA 1BCCJ 1SFCB 1KYOI 3A2AA 4YTPC 1LJ2A 3A3YB 4L74A 3CXHH 1L0NE 1IFDA 2K3RA 3FXDA 4L76A 2GUVA 4OWFA 5APSA 5L8RJ 2B88A 3FWLA 3IF4A 3CCEP 1UIXA 2D2CC 2FYUD 3TDKA 3V4QA 4PD4E 3CMAP 1L4AD 1KB9E 2XU6A 1JUNA 1LTIC 2Y9YA 1KILA 3A5TA 2OTLP 3AE4C 1BGYE 2YKOA 4HKZH 1J1EB 1KN7A 3GF7A 4EI2A 4IFFA 5KKZB 1JCDA 3AE3C 2LXCB 2LKMA 3P32A 2QG4A 4U3FD 3CCSP 2P1JA 2YNYA 3CCVP 1LT9B 2M3EA 5AW7B 2WVRA 1Q7YQ 1SQPG 1JY2P 4PJ0H 1GL2B 1BCCE 1RE3C 3EWKA 1LTTC 3TGUD 2M8RA 3CMEP 1FZFA 2IDBA 1T3JA 1P84I 2KZIA 2V7QH 5EFWB 2Q1KA 5K5GB 1SQVJ 2JWDA 2R32A 1EDKA 1GZLA 1HWTC 1VDFA 4IFMA 1BDCA 1KB9H 1VF5C 1SQBG 3QWOC 4D6TG 4DOJA 1EDLA 2A06E 2Y0DA 5B5EE 1ZW0A 3BATA 1NTZJ 4XE5B 3UIAA 3HD7A 1DIPA 2IFNA 1K04A 3H1IJ 3H1JG 3CX5D 3CXHD 1H0TA 1NJIQ 1M1KQ 1Y8AA 1ZR2A 5C39A 4H44C 1QLED 1OVVA 3G3ZA 1RF1B 1NYHA 1EQ7A 2W90A 2FXMA 3L74G 4L73A 5APQA 5KLVD 4UB6E 2OYIC 2H7HA 1CW5A 2JR8A 4MN4C 2KI7B 3KXDA 1L2PA 4WY4C 2W6JH 3II6A 1YJWP 1BE3E 1USDA 2HFED 3JSVC 1E79H 3RK3B 3RK2B 3V4WA 1OX3A 2GM4A 2MKVA 3TGUE 1VQMP 3NMDA 2WPVB 2B89A 5AW2B 1L4AC 3A0HE 1T8ZA 2IBZI 1DEBA 2K88A 3B71A 5APWA 1GK4A 1N2DC 3V2RA 1M1JB 3CCRP 4DJGA 2H89C 2N9BA 4C7RA 1M90Q 1JM0A 5AW1B 5KAIE 1M1JA 1SQPK 1NU1E 4UB8H 4A7PA 1M57D 1LTGC 1ZV8A 1H89A 1P84E 1L0LD 1R5LA 2AXTH 3AE8C 1YHQP 2CPSA 3PP5A 5DJUB 2WT7A 2E42A 1HBWA 3VMZA 1K9MQ 1N8RQ 2LXBA 3FGAD 2P10A 3L73D 1OFCX 3Q5RA 1J1DC 2K9JB 2QJPB 1JY2O 1NU1K 1LGHB 2VRSA 3FX0A 2ZYAA 4EYYQ 3L4FA 4N78D 3CC4P 2OYIA 1OWAA 1BE3D 1MV8A 2E76C 2KNCB 2QJKC 1ZXGA 2QJYB 3FWNA 5CJ0A 2WSCH 2WITA 3TYYA 1MFTA 2E75C 2M3BA 5AW5B 3RGUA 3RK3D 2OYHB 2K9YA 1SQBD 2IBZG 5KAFH 1JB0J 3P8MC 1Q2NA 3I55P 2KXPB 2V7QJ 4U7JA 4WY4A 1HGZA 1FJPA 1BCCG 1AJYA 4BRYB 5AW0B 1NTKJ 3A0BH 3MUDC 1L0LE 2QE7H 3OA7A 3WU2H 3EFGA 2N1TA 1FOSF 1JY3O 1VQOP 3P8CD 2KZJA 5KLIC 2Z5HA 1QVFO 4ZKUA 1SQBE 2QVAA 3V5BA 1IZNB 2P67A 3AE6C 3H1HD 1OVRA 2KUBA 1EZVI 1NTME 2WQYC 4DZOA 2YO3A 1MUUA 4JF7A 1SLQA 1JY3N 1IFPA 5AVQB 3V6IA 1IK9A 1OW8A 4GOEA 4UB6H 5AVZB 3H1LE 1BGYG 5KJ7D 1N73A 1BSNA 3P7KA 4C7NB 2WPQA 4D6TJ 1A02F 1GMJA 1JMBA 2ZT9B 4JBZA 2O01J 2NRGA 2OARA 4IL6X 3D71A 2K37A 1SQVG 3L75G 3WUUA 1VQ4P 2C0XA 2WSEH 3N4XA 1SQQK 3PLNA 1JTHB 2I1KA 4IFDK 1AFOA 3H1IE 2W6AA 3MP7B 3HRNA 1NTKD 1SQQJ 1L0NG 2LR2A 1FDMA 3AEFC 2FXPA 2KK7A 2J5UA 3RK3C 1FU1A 2O01N 5KLVK 3CPWO 2B87A 4WWIA 1HGVA 5H2FH 1N7SD 1OW7A 4EOTA 3Q5PA 3W67A 1RQUA 2OYIB 3PHLA 1FE6A 3G9RA 1BCCD 1GL2A 3N7NA 3BRVB 3H1JJ 2IZ0A 2E43A 3R2PA 2E5YA 1YTZT 5B5EH 4IL6H 3T97B 1PPJE 1AQTA 2HG5D 3MHVA 3G71P 1VQ7P 3HD7B 1YIJP 4IOIH 1G2CB 2WTYA 3L35A 1PFIA 3GF3A 5E79H 3CC7P 1J2JB 3HE4B 2FBWC 4C7NA 1KILC 1S3JA 1VQ5P 5AW8B 3PH0A 4GDOA 4HH2A 4RO0A 1VQNP 1NTKK 4AQRD 3PJSK 3L37A 1FBMA 1SVFA 3L72G 1RY3A 3L72J 5KLVG 5KLVJ 1N86A 2IX7C 3A0BE 3SFEC 1JNMA 3BCCG 3USSA 1NOHA 2KSEA 4JQ0D 1L0LG 1LT9C 1W5CE 1KILD 2KP8A 1TU3F 2OGUA 2IPPA 3L72D 5DJTB 4W80A 5APXA 5KJ7A 1DD3A 1W2BO 1HTLC 2QSIA 1K8AQ 3ITKA 3KDPB 4BWNA 1PGPA 5AW3B 2E74B 1LTJA 3QH9A 3AEEC 1YJ9P 1IO4A 5GTHH 3A0HH 1NGMB 3D70A 1VL2A 3BRTB 3S1KA 3MIWA 1BE3G 1GTWA 5AVYB 2FFDA 1EDJA 1KYOH 1QGKB 2UWJE 1WMKA 2WZ7A 1K73Q 5CBOA 1U57A 2AXTE 2YKPA 3NFQA 3ABVC 3NTNA 4Z1MH 2Y9ZA 3VMXA 3H1LG 4WVZA 4RESB 3AECC 1JY3P 3AEAC 1N7SC 3H1ID 1YJNP 3L70D 4D6TE 1VQLP 3SFDC 2GA1A 3H1LD 1NU1J 2B87B 2Q5UA 1LTJB 2IBZD 1T6AA 1S5LX 2QM8A 3U59A 1FZBA 3AE5C 3C8VA 4ASVA 3MTUE 2A06G 3CWBE 1X9VA 4OH8B 4TT3H 2QJPC 2IYOA 1J1DB 3ZDMA 1BSHA 2CPBA 1FDOA 1MFZA 2M0BA 4LGDE 4C46A 2XKMA 3RL0g 1R8EA 1Q82Q 4O9BA 2HLOA 1E5WA 3MD0A 2G8YA 2KB7P 1KZUB 5KKZC 1YITP 5KLIB 1BGYJ 2XZRA 1KMIZ 2M5AA 3TK1A 3HE4A 5CJ4A 3TGUG 1AV1A 3H32A 3VP9A 4ZNCA 3MGNA 1QL1A 1ZN5A 3P8CE 4W7ZA 2ZYGA 1SQPD 1BGYD 4KJMA 2H8PD 2ZFCA 1ZR4A 3F89A 5AVVB 1L4AB 4OVNF 3WUVA 3JCUH 2E75D 4GKGA 4H13C 2Q7CA 1EZVD 4HYTB 4DT0A 3A7OA 1VQPP 1M56D 3LW5J 3RL0D 5BU8B 2FFDC 3Q5SA 1SFCC 4K3AA 3C1LA 2C9LY 1NU1D 1BE3J 1HJ0A 1NU1G 1FZAA 1PPJG 3EFFK 1P84D 4H0LC 2NPSA 2JKVA 3VMAA 1KFMA 4WBAA 1PP9J 1DEEG 3G4SP 1R5SA 2FYNC 2M5AB 2Y0CA 2NPSB 3E1RA 3KZIH 3O8ZA 4KHXA 4PD4I 5E79E 1N73B 4H44B 3U1AA 3H25A 1YYCA 1PP9D 3GW6A 5KAIH 1EZVE 4W7YA 1NTMG 2P58A 3T97A 4H13D 4XA4A 2ITAA 1OZHA 1SQBK 2V4HA 4EDFA 3KPEA 3CD6P 2BASA 1IFMA 1WRGA 1PGJA 3NXSA 3TF5A 3OAKA 2O1JA 2W6BA 4TLFA 3CX5E 1NAFA 1UIIA 2KOGA 3L71E 5APYA 3GHGC 2XDJA 1ZRTD 5KAFE 4BXLA 1RF0A 2NZ2A 1NTKG 1USEA 2SPZA 3HD7C 3IAOA 4GODA 4ASWA 1U7JA 1A02J 1EZVG 3L75E 2O3JA 3CCJP 4BRYA 5GTHE 3L70J 2OQQA 3WMM0 4AYCA 2C0WA 2JWAA 5APTA 3HTKA 1N73C 4M3LA 3RL0B 2FFDB 1LTBC 2K1AA 3RK2C 2YMKA 1LT1A 3CXHE 2FKWB 2PAJA 4N6JA 2CK3H 3EQ2A 4PV1D 1FJKA 3BASA 3H1HE 3TSIA 5B66H 1PP9E 3B8EB 4NPEA 2KS1B 2RKLA 2KLVA 2R5BA 3CCUP 1NTZK 2QRXA 5AVRB 1RE4A 4U3FG 5AW4B 5CBNA 1RF1C 2WMMA 2YMYA 1FZCB 3SWKA 4XFJA 1MZ9A 4WB4A 1PPJD 2WSSH 2D2CD 2W83C 3AE1C 3L74J 2L5GB 3GMAA 2IFMA 1SQXE 1SQQE 4LLHA 4PD4D 5GTIH 1L4AA 2ZT9D 3HTKB 1DH3A 2L91A 1HJBA 2HR3A 4Y28J 1LTSC 5AVTB 1OIPA 5KJ7C 5KTBA 1RQVA 2BEZF 1IJDB 1LWUC 1XTCC 3I5CA 3U1CA 2H43A 2YIUB 1VQKP 1M7LA 2BCCE 3L73J 2OYHA 3B4SA 1PZQA 3O6QB 4EIJA 1YI2P 1S9KE 3CX5I 1SS1A 1SQXD 2A45G 1IC2A 3KHUA 5AVXB 2H88C 2YIUC 3KQGA 2XV5A 1FAVA 3AE7C 1NWQA 1H8AA 2K9JA 1NTZG 1U7MA 1HVVA 2GUSA 3CCQP 2YKQA 2ZXXA 5AW9B 4NPDA 1GK6A 2J58A 3AEDC 1VF5D 3HUSA 2IYPA 2WSCJ 1IK7A 3HUSC 1NTZD 2A06D 3KZIE 5APUA 5CCHD 3E1IA 1EXIA 1J1EC 4N78E 3PRJA 3B5NA 3O6QA 2ZXEB 2O01H 3CC2P 1SP4A 1Z56A 2RN0A 3H1LJ 4I7ZC 1S1CX 3BCCD 2D2CB 2WPRA 1OW6A 1OXZA 4B86A 1URQD 1AQ5A 1OMIA 1ZLLA 3H1IG 1MKMA 3CL3D 1VQ8P 1X79B 4PD4H 2FY8A 3L70E 2W8ZA 1KFNA 3RL0C 1ZMEC 2KIKA 3GG2A 2E74C 2OYHC 2E75B 5TISE 2E76D 3S4RA 2WSFJ 4KT0J 1LWUA 1G1IA 1RF0C 1SFCD 4GT1A 1SQXK 4H0LD 2R5DA 2QM7A 3B5NB 4JYBA 5CCGA 1S9KD 1GU5A 1PGOA 3JC22 1DX7A 1GW3A 1KILB 1NTMK 1Y47A 1Q86Q 2HODB 4L75A 2AXCA 3CCMP 2ZJSE 1ZP0C 2POHA 1KYOD 3M0DC 2FYUK 3Q1MA 3L72E 3L70G 4R4LA 5KLVE 1Q90D 3H1KJ 1H0TB 5APVA 1FZCA 2IZ1A 1WT6A 1EC5A 2JEEA 4ZMDA 1NO4A 1PP9G 2PFXA 2HPCA 1YBKA 1S5LE 2W27A 3L36A 3B5NC 1KQSO 2NPSC 2BCCJ 3E7KA 3H6PA 3L73E 3LIDA 2N9YB 1FDIA 1KYOE 2DW3A 4GIFA 1URQB 4Y99C 1KC8Q 1QL2A 2P7JA 3FXEA 3IFMA 4H0LB 1S72P 2I8DA 2HYNA 3M9QA 3SSUA 1HH0A 1L0NJ 4OGQB 4OGQC 1NVOA 1SQXG 1JOCA 1SQVD 3MUDA 3TGUJ 1FZCC 3CWBJ 1GDTA 1VQ6P 2RH0A 3L71G 1LT9A 3CI9A 3B5ND 1NTMD 1X22A 3M91A 4PV1B 3M0DA 4JPZB 2Z4EA 3Q2YA 1EDIA 2AEFA 2KYVA 3AE2C 1T2KC 1CZQA 3V2PA 3AEBC 3SWYA 1S2EA 3CWBG 5CCGC 2G3AA 2QEXP 3M0AA 3M9HA 2ZYDA 1JTHA 1PGQA 2N1TD 3CX5H 3LW5H 2ZT9C 1KORA 1YQ3C 3AE9C 4I1LA 4K35A 3L75J 3H1HG 1Y9BA 5AVSB 1H88A 1XTGB 2OYOA 2WWWA 1SFCA 4LC1A 1P84H 1RE4C 4U3FE 2O1KA 3L75D 4RKUJ 1PV3A 5M1BA 4U3FJ 2B9BA 2HPCB 4YPCA 5AW6B 2JP3A 2YXRB 3JCUE 3VYIA 3VN0A 1NTKE 4DCKA 1IFIA 3H1KE 3CCLP 1RE3A 1JEKA 1LTAC 3RK2D 3HE5B 2QA4P 5B66E 3OW2O 2JJLA 1YTZI 5BVZA 4H44D 3IN6A 1NTMJ 3GLMA 3MZWB 2Z5IA 1JO5A 1NH4A 2Q3EA 1L0LK 2WSFH 4PV1C 3K5BA 3CXHI 5TISH 1GD2E 1KQGB 2BEQD 1JY2N 1HUCA 2E5TA 1SQQD 3H1KD 1L0LJ 3BVHA 1D7MA 1X0TA 3R4YA 3TNUA 1Q81Q 1OVUA 3HUSB 2OTJP 1JCCA 1SQPJ 2YO2A 3VMYA 3RK3E 4RJTA 2QJKB 2R44A 2XNDH 2IBZE 3HE5A 4I6MC 5CMZA 1KTMA 1FS0E 1S4XA 2WPSA 2BCCD 2R3CA 4HB1A 1QX8A 3H1JE 1KD1Q 1URQA 3F5HA 3VTPC 1HF9A 2AEMA 5AVWB 1ZRTE 1N7SA 2OTKE 2RMZA 1W2EA 2QJYC 2AEJA 2E76B 5BU5A 1KV4A 3HD7D 1GL2D 2ZVOB 3OJAB 4QMAA 2MJZA 2ZAEB 2FYUJ 2P2UA 3C9IA 4AUWA 4CPGA 2PRRA 1LWUB 1JMMA 4GOFA 3V2QA 3D6ZA 3VOPA 1RF1A 2YXQB 1T3UA 5CCGD 1NHLA 2Q3IA 1PIXA 1KILE 2QIWA 2WSEJ 1IFJA 3BCCE 4NPFX 3RBXA 3Q3DA 1KQFB 1SQPE 2N1TC 1T2KD 4YXDC 4N3YB 4ZKPA 1FOSE 1QEXA 2HODA 1GU4A 4PJ0E 1K05A 4I2LC 2A45H 1GW4A 1M1JC 2Q9IA 1L0NK 3PTZA 2FYNB 1BDDA 2Y0EA 1YQ4C 3G6EP 2C9NY 2FXOA 2JDIH 2PP6A 2KNCA 3H1HJ 3VP8A 1VQ9P 4JYCA 2NPSD 1SQQG 3D6YA 3H1JD 2A45I 1VPCA 1SQVK 4R4MA 1M8OB 1SQXJ 1KB9I 1NKNA 4H13B 1G1JA
chains in the Genus database with same CATH topology
1KQLA 3IR9A 4WY4B 1URQC 4Y99B 1N7LA 2WT7B 3SWFA 3H32B 3GHGB 1FZEA 2KSJA 3KYQA 2N1TB 1G2CA 3LIEA 2FYZA 1FZGA 2XNXA 3V2NA 5AVUB 3TNUB 5CCHA 2I1JA 5CCHC 3M9BA 5CHXA 2J59M 1NKZB 1X8YA 1CI6A 1LTJC 4WY4D 3GHGA 1GL2C 1CI6B 1CSBA 3M06A 1N7SB 1IFNA 3CLQA 1SFCB 3A2AA 3A3YB 1IFDA 2GUVA 5APSA 1HBWA 3V4QA 1L4AD 2XU6A 1JUNA 1LTIC 1KILA 3A5TA 2YKOA 1J1EB 4IFFA 1JCDA 2LKMA 3P32A 2P1JA 2YNYA 1LT9B 5AW7B 1JY2P 1GL2B 1RE3C 1LTTC 2M8RA 1FZFA 1T3JA 2R32A 1GZLA 1HWTC 1VDFA 4IFMA 4DOJA 3BATA 4XE5B 3UIAA 3HD7A 2IFNA 1ZR2A 3G3ZA 1RF1B 5APQA 1EQ7A 1FZCC 2FXMA 2OYIC 2H7HA 1CW5A 4WY4C 3II6A 3V4WA 2HFED 3RK3B 3RK2B 2GM4A 3NMDA 5AW2B 1L4AC 1T8ZA 1DEBA 5APWA 1GK4A 1N2DC 3V2RA 1M1JB 2N9BA 4C7RA 5AW1B 1M1JA 1SQPK 1LTGC 1ZV8A 2CPSA 3PP5A 2WT7A 2E42A 3VMZA 1J1DC 1JY2O 1NU1K 1LGHB 2VRSA 3L4FA 4N78D 2OYIA 1OWAA 1MV8A 5CJ0A 2WSCH 2WITA 3TYYA 5AW5B 3RK3D 2M3BA 2OYHB 3P8MC 4WY4A 1HGZA 1FJPA 5AW0B 3OA7A 3EFGA 2N1TA 1FOSF 1JY3O 3P8CD 2Z5HA 4ZKUA 3V5BA 2P67A 4DZOA 2YO3A 1MUUA 4JF7A 1JY3N 1SLQA 5AVQB 1IK9A 5AVZB 5KJ7D 1N73A 3P7KA 4C7NB 2WPQA 2OARA 2C0XA 2WSEH 3N4XA 1SQQK 1JTHB 2I1KA 4IFDK 1AFOA 2W6AA 3HRNA 1FDMA 3RK3C 1FU1A 5KLVK 1HGVA 1N7SD 4EOTA 2OYIB 1GL2A 3N7NA 3BRVB 2E43A 3R2PA 1YTZT 2HG5D 3HD7B 1G2CB 2WTYA 3L35A 1PFIA 1J2JB 3HE4B 4C7NA 1KILC 5AW8B 4HH2A 1NTKK 4AQRD 3L37A 1FBMA 1SVFA 1RY3A 1N86A 2IX7C 1JNMA 1NOHA 1LT9C 2KP8A 1KILD 5KJ7A 5APXA 2IPPA 4W80A 1HTLC 3KDPB 5AW3B 1LTJA 1IO4A 3BRTB 3MIWA 1GTWA 5AVYB 2FFDA 2WZ7A 3NFQA 2YKPA 3NTNA 3VMXA 4RESB 1JY3P 1N7SC 2Q5UA 1LTJB 2QM8A 3U59A 1FZBA 3MTUE 1X9VA 4OH8B 1J1DB 2CPBA 4C46A 1MFZA 4LGDE 2XKMA 4O9BA 2HLOA 1E5WA 3MD0A 2KB7P 1KZUB 2XZRA 5CJ4A 3TK1A 3HE4A 3H32A 3VP9A 3MGNA 1QL1A 1ZN5A 3P8CE 4W7ZA 2H8PD 2ZFCA 1ZR4A 5AVVB 1L4AB 4GKGA 2Q7CA 4HYTB 3A7OA 5BU8B 3RL0D 2FFDC 1SFCC 2C9LY 1FZAA 2NPSA 1KFMA 4KHXA 2NPSB 3O8ZA 1N73B 3U1AA 1YYCA 4W7YA 4XA4A 1SQBK 3KPEA 2BASA 1IFMA 1WRGA 3NXSA 3OAKA 2O1JA 2W6BA 1NAFA 2KOGA 5APYA 3GHGC 2XDJA 1RF0A 3HD7C 1A02J 3WMM0 4AYCA 2C0WA 5APTA 3HTKA 1N73C 4M3LA 3RL0B 2FFDB 1LTBC 3RK2C 2FKWB 2PAJA 4N6JA 3TSIA 3EQ2A 1FJKA 3BASA 3B8EB 2KLVA 2R5BA 1NTZK 5AVRB 5AW4B 1RE4A 1RF1C 2YMYA 1FZCB 1MZ9A 4WB4A 4LLHA 1S9KD 2L5GB 2IFMA 1DH3A 1L4AA 3HTKB 1HJBA 1LTSC 5AVTB 5KJ7C 2H43A 5KTBA 3U1CA 1IJDB 1LWUC 1XTCC 3I5CA 1M7LA 2OYHA 4EIJA 1S9KE 2A45G 1IC2A 5AVXB 3KQGA 2XV5A 1FAVA 1NWQA 1H8AA 1HVVA 2GUSA 2YKQA 5AW9B 1GK6A 2J58A 3HUSA 5APUA 3HUSC 5CCHD 3E1IA 1J1EC 4N78E 3B5NA 2ZXEB 2O01H 1SP4A 1Z56A 4B86A 2WPRA 1OXZA 1URQD 1AQ5A 1ZLLA 3CL3D 1X79B 1KFNA 3RL0C 2OYHC 1LWUA 1G1IA 1RF0C 1SFCD 4GT1A 1SQXK 1GU5A 3B5NB 2R5DA 2QM7A 4JYBA 5CCGA 1DX7A 1GW3A 1KILB 1NTMK 2HODB 2POHA 3M0DC 2FYUK 5APVA 1FZCA 1WT6A 2JEEA 1NO4A 2HPCA 2W27A 3L36A 3B5NC 2NPSC 3LIDA 3H6PA 4GIFA 1URQB 4Y99C 1QL2A 2P7JA 3IFMA 2HYNA 3M9QA 1HH0A 1JOCA 3MUDA 1GDTA 1LT9A 3CI9A 3B5ND 3M91A 3M0DA 2Z4EA 1T2KC 2KYVA 1CZQA 3V2PA 3SWYA 5CCGC 3M0AA 3M9HA 3T97A 1JTHA 3LW5H 2N1TD 1A02F 4I1LA 5AVSB 1H88A 1XTGB 2WWWA 1SFCA 4LC1A 1RE4C 2O1KA 2HPCB 5AW6B 3VN0A 3VYIA 1IFIA 1RE3A 1LTAC 3RK2D 3HE5B 2JJLA 1YTZI 5BVZA 2Z5IA 1JO5A 1NH4A 1L0LK 2WSFH 1GD2E 1JY2N 1HUCA 3BVHA 3TNUA 3HUSB 1JCCA 2YO2A 3VMYA 4I6MC 3HE5A 5CMZA 2WPSA 2R3CA 1URQA 3VTPC 5AVWB 1N7SA 1W2EA 5BU5A 3HD7D 1GL2D 3OJAB 2MJZA 2P2UA 3C9IA 4AUWA 1RF1A 1LWUB 1JMMA 3V2QA 3VOPA 1T3UA 5CCGD 1NHLA 2Q3IA 1H89A 1IFJA 1T2KD 1FOSE 2N1TC 4ZKPA 4N3YB 2HODA 1GU4A 4I2LC 2A45H 1GW4A 1M1JC 2Q9IA 1L0NK 2C9NY 2PP6A 3VP8A 4JYCA 2NPSD 2A45I 1VPCA 1SQVK 1NKNA 4WBAA 1G1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQL A;  3IR9 A;  3TYY A;  5AW5 B;  4C46 A;  1MFZ A;  3P8M C;  2WT7 B;  3MD0 A;  3SWF A;  2XZR A;  3TK1 A;  3HE4 A;  5APV A;  3MGN A;  5AW0 B;  3LIE A;  2ZFC A;  1FOS F;  5AVV B;  2Z5H A;  2W27 A;  3L36 A;  4GKG A;  2Q7C A;  3V5B A;  4HYT B;  2P67 A;  3A7O A;  3LID A;  5AVU B;  3TNU B;  4DZO A;  2C9L Y;  3M9B A;  2YO3 A;  4JYB A;  2P7J A;  1MUU A;  1SLQ A;  1X8Y A;  1CI6 A;  5AVQ B;  4KHX A;  1CI6 B;  3O8Z A;  1CSB A;  5AVZ B;  3M06 A;  1YYC A;  3A2A A;  3P7K A;  4C7N B;  2WPQ A;  3A3Y B;  3M91 A;  3M0D A;  5APS A;  2BAS A;  1HBW A;  3V4Q A;  1T2K C;  3NXS A;  1CZQ A;  3OAK A;  2XU6 A;  1JUN A;  1NAF A;  3A5T A;  2W6A A;  5APY A;  3M0A A;  3M9H A;  3T97 A;  1A02 F;  1A02 J;  5AVS B;  3P32 A;  1H88 A;  2YNY A;  2WWW A;  4LC1 A;  5AW7 B;  4AYC A;  5APT A;  3HTK A;  4M3L A;  4EOT A;  5AW6 B;  3VN0 A;  3VYI A;  3B8E B;  3HE5 B;  2R32 A;  1GZL A;  2E43 A;  2R5B A;  1HWT C;  2JJL A;  5AW4 B;  5AVR B;  1G2C B;  2Z5I A;  1S9K D;  2WTY A;  3L35 A;  4XE5 B;  3UIA A;  1GD2 E;  1DH3 A;  1J2J B;  3HE4 B;  1HUC A;  1HJB A;  4C7N A;  5AW8 B;  5AVT B;  3TNU A;  5APQ A;  3I5C A;  2H7H A;  3VMY A;  2YO2 A;  4AQR D;  3L37 A;  4I6M C;  3HE5 A;  5CMZ A;  1JNM A;  2WPS A;  2R3C A;  1S9K E;  3V4W A;  2KP8 A;  3VTP C;  5APX A;  5AVW B;  2IPP A;  5AVX B;  3KQG A;  3NMD A;  2XV5 A;  1FAV A;  5AW2 B;  1NWQ A;  3KDP B;  1H8A A;  5AW3 B;  1IO4 A;  5AW9 B;  1GK6 A;  2P2U A;  5APW A;  1GK4 A;  4AUW A;  5APU A;  1GTW A;  5AVY B;  2N9B A;  5AW1 B;  2Q3I A;  3NFQ A;  3NTN A;  1H89 A;  2ZXE B;  1T2K D;  1FOS E;  3VMX A;  1SP4 A;  4RES B;  1GU4 A;  4B86 A;  2WPR A;  1OXZ A;  2WT7 A;  2E42 A;  3VMZ A;  4I2L C;  2C9N Y;  2Q5U A;  2VRS A;  4JYC A;  2QM8 A;  1OWA A;  1MV8 A;  4GT1 A;  1GU5 A;  2R5D A;  2QM7 A; 
#chains in the Genus database with same CATH topology
 1KQL A;  3IR9 A;  3L74 E;  4YXW H;  4WY4 B;  1URQ C;  4OGQ D;  1N7L A;  1RH5 B;  2KLU A;  2Q6Q A;  4I7Z B;  4Y99 B;  5H2F E;  4D6T D;  1DD4 A;  1LNQ A;  2R3S A;  2WT7 B;  1PL5 A;  1LP1 A;  3AEG C;  5GTI E;  3SWF A;  2KS1 A;  2FYU G;  3H32 B;  3L73 G;  1EXJ A;  2E74 D;  1SQB J;  2BCC G;  3L71 J;  3GHG B;  1FZE A;  1LP1 B;  3WU2 E;  2KSJ A;  1RHZ B;  3KYQ A;  2N1T B;  2PGD A;  1VF5 B;  1AVY A;  1G2C A;  3LIE A;  2ZVN B;  4IL6 E;  3L71 D;  1NAY A;  3L74 D;  2FYZ A;  3I56 P;  1FZG A;  3WUT A;  2XNX A;  1AVO A;  3V2N A;  1AA0 A;  3BCC J;  3H1K G;  3S9O A;  1FC2 C;  1NTZ E;  2JO1 A;  5AVU B;  1S5L H;  3TNU B;  1ZOY C;  1L0N D;  2I1J A;  5CCH A;  5CCH C;  3M9B A;  5CHX A;  1QVG O;  2J59 M;  4UB8 E;  1NKZ B;  1X8Y A;  2FYU E;  1CI6 A;  4HJG H;  1LTJ C;  3CWB D;  4WY4 D;  1KB9 D;  1SQV E;  3RBZ A;  3GHG A;  1GL2 C;  1CI6 B;  1CSB A;  5TJH A;  3W68 A;  3M06 A;  1N7S B;  1IFN A;  3CLQ A;  1BCC J;  1SFC B;  1KYO I;  3A2A A;  4YTP C;  1LJ2 A;  3A3Y B;  4L74 A;  3CXH H;  1L0N E;  1IFD A;  2K3R A;  3FXD A;  4L76 A;  2GUV A;  4OWF A;  5APS A;  5L8R J;  2B88 A;  3FWL A;  3IF4 A;  3CCE P;  1UIX A;  2D2C C;  2FYU D;  3TDK A;  3V4Q A;  4PD4 E;  3CMA P;  1L4A D;  1KB9 E;  2XU6 A;  1JUN A;  1LTI C;  2Y9Y A;  1KIL A;  3A5T A;  2OTL P;  3AE4 C;  1BGY E;  2YKO A;  4HKZ H;  1J1E B;  1KN7 A;  3GF7 A;  4EI2 A;  4IFF A;  5KKZ B;  1JCD A;  3AE3 C;  2LXC B;  2LKM A;  3P32 A;  2QG4 A;  4U3F D;  3CCS P;  2P1J A;  2YNY A;  3CCV P;  1LT9 B;  2M3E A;  5AW7 B;  2WVR A;  1Q7Y Q;  1SQP G;  1JY2 P;  4PJ0 H;  1GL2 B;  1BCC E;  1RE3 C;  3EWK A;  1LTT C;  3TGU D;  2M8R A;  3CME P;  1FZF A;  2IDB A;  1T3J A;  1P84 I;  2KZI A;  2V7Q H;  5EFW B;  2Q1K A;  5K5G B;  1SQV J;  2JWD A;  2R32 A;  1EDK A;  1GZL A;  1HWT C;  1VDF A;  4IFM A;  1BDC A;  1KB9 H;  1VF5 C;  1SQB G;  3QWO C;  4D6T G;  4DOJ A;  1EDL A;  2A06 E;  2Y0D A;  5B5E E;  1ZW0 A;  3BAT A;  1NTZ J;  4XE5 B;  3UIA A;  3HD7 A;  1DIP A;  2IFN A;  1K04 A;  3H1I J;  3H1J G;  3CX5 D;  3CXH D;  1H0T A;  1NJI Q;  1M1K Q;  1Y8A A;  1ZR2 A;  5C39 A;  4H44 C;  1QLE D;  1OVV A;  3G3Z A;  1RF1 B;  1NYH A;  1EQ7 A;  2W90 A;  2FXM A;  3L74 G;  4L73 A;  5APQ A;  5KLV D;  4UB6 E;  2OYI C;  2H7H A;  1CW5 A;  2JR8 A;  4MN4 C;  2KI7 B;  3KXD A;  1L2P A;  4WY4 C;  2W6J H;  3II6 A;  1YJW P;  1BE3 E;  1USD A;  2HFE D;  3JSV C;  1E79 H;  3RK3 B;  3RK2 B;  3V4W A;  1OX3 A;  2GM4 A;  2MKV A;  3TGU E;  1VQM P;  3NMD A;  2WPV B;  2B89 A;  5AW2 B;  1L4A C;  3A0H E;  1T8Z A;  2IBZ I;  1DEB A;  2K88 A;  3B71 A;  5APW A;  1GK4 A;  1N2D C;  3V2R A;  1M1J B;  3CCR P;  4DJG A;  2H89 C;  2N9B A;  4C7R A;  1M90 Q;  1JM0 A;  5AW1 B;  5KAI E;  1M1J A;  1SQP K;  1NU1 E;  4UB8 H;  4A7P A;  1M57 D;  1LTG C;  1ZV8 A;  1H89 A;  1P84 E;  1L0L D;  1R5L A;  2AXT H;  3AE8 C;  1YHQ P;  2CPS A;  3PP5 A;  5DJU B;  2WT7 A;  2E42 A;  1HBW A;  3VMZ A;  1K9M Q;  1N8R Q;  2LXB A;  3FGA D;  2P10 A;  3L73 D;  1OFC X;  3Q5R A;  1J1D C;  2K9J B;  2QJP B;  1JY2 O;  1NU1 K;  1LGH B;  2VRS A;  3FX0 A;  2ZYA A;  4EYY Q;  3L4F A;  4N78 D;  3CC4 P;  2OYI A;  1OWA A;  1BE3 D;  1MV8 A;  2E76 C;  2KNC B;  2QJK C;  1ZXG A;  2QJY B;  3FWN A;  5CJ0 A;  2WSC H;  2WIT A;  3TYY A;  1MFT A;  2E75 C;  2M3B A;  5AW5 B;  3RGU A;  3RK3 D;  2OYH B;  2K9Y A;  1SQB D;  2IBZ G;  5KAF H;  1JB0 J;  3P8M C;  1Q2N A;  3I55 P;  2KXP B;  2V7Q J;  4U7J A;  4WY4 A;  1HGZ A;  1FJP A;  1BCC G;  1AJY A;  4BRY B;  5AW0 B;  1NTK J;  3A0B H;  3MUD C;  1L0L E;  2QE7 H;  3OA7 A;  3WU2 H;  3EFG A;  2N1T A;  1FOS F;  1JY3 O;  1VQO P;  3P8C D;  2KZJ A;  5KLI C;  2Z5H A;  1QVF O;  4ZKU A;  1SQB E;  2QVA A;  3V5B A;  1IZN B;  2P67 A;  3AE6 C;  3H1H D;  1OVR A;  2KUB A;  1EZV I;  1NTM E;  2WQY C;  4DZO A;  2YO3 A;  1MUU A;  4JF7 A;  1SLQ A;  1JY3 N;  1IFP A;  5AVQ B;  3V6I A;  1IK9 A;  1OW8 A;  4GOE A;  4UB6 H;  5AVZ B;  3H1L E;  1BGY G;  5KJ7 D;  1N73 A;  1BSN A;  3P7K A;  4C7N B;  2WPQ A;  4D6T J;  1A02 F;  1GMJ A;  1JMB A;  2ZT9 B;  4JBZ A;  2O01 J;  2NRG A;  2OAR A;  4IL6 X;  3D71 A;  2K37 A;  1SQV G;  3L75 G;  3WUU A;  1VQ4 P;  2C0X A;  2WSE H;  3N4X A;  1SQQ K;  3PLN A;  1JTH B;  2I1K A;  4IFD K;  1AFO A;  3H1I E;  2W6A A;  3MP7 B;  3HRN A;  1NTK D;  1SQQ J;  1L0N G;  2LR2 A;  1FDM A;  3AEF C;  2FXP A;  2KK7 A;  2J5U A;  3RK3 C;  1FU1 A;  2O01 N;  5KLV K;  3CPW O;  2B87 A;  4WWI A;  1HGV A;  5H2F H;  1N7S D;  1OW7 A;  4EOT A;  3Q5P A;  3W67 A;  1RQU A;  2OYI B;  3PHL A;  1FE6 A;  3G9R A;  1BCC D;  1GL2 A;  3N7N A;  3BRV B;  3H1J J;  2IZ0 A;  2E43 A;  3R2P A;  2E5Y A;  1YTZ T;  5B5E H;  4IL6 H;  3T97 B;  1PPJ E;  1AQT A;  2HG5 D;  3MHV A;  3G71 P;  1VQ7 P;  3HD7 B;  1YIJ P;  4IOI H;  1G2C B;  2WTY A;  3L35 A;  1PFI A;  3GF3 A;  5E79 H;  3CC7 P;  1J2J B;  3HE4 B;  2FBW C;  4C7N A;  1KIL C;  1S3J A;  1VQ5 P;  5AW8 B;  3PH0 A;  4GDO A;  4HH2 A;  4RO0 A;  1VQN P;  1NTK K;  4AQR D;  3PJS K;  3L37 A;  1FBM A;  1SVF A;  3L72 G;  1RY3 A;  3L72 J;  5KLV G;  5KLV J;  1N86 A;  2IX7 C;  3A0B E;  3SFE C;  1JNM A;  3BCC G;  3USS A;  1NOH A;  2KSE A;  4JQ0 D;  1L0L G;  1LT9 C;  1W5C E;  1KIL D;  2KP8 A;  1TU3 F;  2OGU A;  2IPP A;  3L72 D;  5DJT B;  4W80 A;  5APX A;  5KJ7 A;  1DD3 A;  1W2B O;  1HTL C;  2QSI A;  1K8A Q;  3ITK A;  3KDP B;  4BWN A;  1PGP A;  5AW3 B;  2E74 B;  1LTJ A;  3QH9 A;  3AEE C;  1YJ9 P;  1IO4 A;  5GTH H;  3A0H H;  1NGM B;  3D70 A;  1VL2 A;  3BRT B;  3S1K A;  3MIW A;  1BE3 G;  1GTW A;  5AVY B;  2FFD A;  1EDJ A;  1KYO H;  1QGK B;  2UWJ E;  1WMK A;  2WZ7 A;  1K73 Q;  5CBO A;  1U57 A;  2AXT E;  2YKP A;  3NFQ A;  3ABV C;  3NTN A;  4Z1M H;  2Y9Z A;  3VMX A;  3H1L G;  4WVZ A;  4RES B;  3AEC C;  1JY3 P;  3AEA C;  1N7S C;  3H1I D;  1YJN P;  3L70 D;  4D6T E;  1VQL P;  3SFD C;  2GA1 A;  3H1L D;  1NU1 J;  2B87 B;  2Q5U A;  1LTJ B;  2IBZ D;  1T6A A;  1S5L X;  2QM8 A;  3U59 A;  1FZB A;  3AE5 C;  3C8V A;  4ASV A;  3MTU E;  2A06 G;  3CWB E;  1X9V A;  4OH8 B;  4TT3 H;  2QJP C;  2IYO A;  1J1D B;  3ZDM A;  1BSH A;  2CPB A;  1FDO A;  1MFZ A;  2M0B A;  4LGD E;  4C46 A;  2XKM A;  3RL0 g;  1R8E A;  1Q82 Q;  4O9B A;  2HLO A;  1E5W A;  3MD0 A;  2G8Y A;  2KB7 P;  1KZU B;  5KKZ C;  1YIT P;  5KLI B;  1BGY J;  2XZR A;  1KMI Z;  2M5A A;  3TK1 A;  3HE4 A;  5CJ4 A;  3TGU G;  1AV1 A;  3H32 A;  3VP9 A;  4ZNC A;  3MGN A;  1QL1 A;  1ZN5 A;  3P8C E;  4W7Z A;  2ZYG A;  1SQP D;  1BGY D;  4KJM A;  2H8P D;  2ZFC A;  1ZR4 A;  3F89 A;  5AVV B;  1L4A B;  4OVN F;  3WUV A;  3JCU H;  2E75 D;  4GKG A;  4H13 C;  2Q7C A;  1EZV D;  4HYT B;  4DT0 A;  3A7O A;  1VQP P;  1M56 D;  3LW5 J;  3RL0 D;  5BU8 B;  2FFD C;  3Q5S A;  1SFC C;  4K3A A;  3C1L A;  2C9L Y;  1NU1 D;  1BE3 J;  1HJ0 A;  1NU1 G;  1FZA A;  1PPJ G;  3EFF K;  1P84 D;  4H0L C;  2NPS A;  2JKV A;  3VMA A;  1KFM A;  4WBA A;  1PP9 J;  1DEE G;  3G4S P;  1R5S A;  2FYN C;  2M5A B;  2Y0C A;  2NPS B;  3E1R A;  3KZI H;  3O8Z A;  4KHX A;  4PD4 I;  5E79 E;  1N73 B;  4H44 B;  3U1A A;  3H25 A;  1YYC A;  1PP9 D;  3GW6 A;  5KAI H;  1EZV E;  4W7Y A;  1NTM G;  2P58 A;  3T97 A;  4H13 D;  4XA4 A;  2ITA A;  1OZH A;  1SQB K;  2V4H A;  4EDF A;  3KPE A;  3CD6 P;  2BAS A;  1IFM A;  1WRG A;  1PGJ A;  3NXS A;  3TF5 A;  3OAK A;  2O1J A;  2W6B A;  4TLF A;  3CX5 E;  1NAF A;  1UII A;  2KOG A;  3L71 E;  5APY A;  3GHG C;  2XDJ A;  1ZRT D;  5KAF E;  4BXL A;  1RF0 A;  2NZ2 A;  1NTK G;  1USE A;  2SPZ A;  3HD7 C;  3IAO A;  4GOD A;  4ASW A;  1U7J A;  1A02 J;  1EZV G;  3L75 E;  2O3J A;  3CCJ P;  4BRY A;  5GTH E;  3L70 J;  2OQQ A;  3WMM 0;  4AYC A;  2C0W A;  2JWA A;  5APT A;  3HTK A;  1N73 C;  4M3L A;  3RL0 B;  2FFD B;  1LTB C;  2K1A A;  3RK2 C;  2YMK A;  1LT1 A;  3CXH E;  2FKW B;  2PAJ A;  4N6J A;  2CK3 H;  3EQ2 A;  4PV1 D;  1FJK A;  3BAS A;  3H1H E;  3TSI A;  5B66 H;  1PP9 E;  3B8E B;  4NPE A;  2KS1 B;  2RKL A;  2KLV A;  2R5B A;  3CCU P;  1NTZ K;  2QRX A;  5AVR B;  1RE4 A;  4U3F G;  5AW4 B;  5CBN A;  1RF1 C;  2WMM A;  2YMY A;  1FZC B;  3SWK A;  4XFJ A;  1MZ9 A;  4WB4 A;  1PPJ D;  2WSS H;  2D2C D;  2W83 C;  3AE1 C;  3L74 J;  2L5G B;  3GMA A;  2IFM A;  1SQX E;  1SQQ E;  4LLH A;  4PD4 D;  5GTI H;  1L4A A;  2ZT9 D;  3HTK B;  1DH3 A;  2L91 A;  1HJB A;  2HR3 A;  4Y28 J;  1LTS C;  5AVT B;  1OIP A;  5KJ7 C;  5KTB A;  1RQV A;  2BEZ F;  1IJD B;  1LWU C;  1XTC C;  3I5C A;  3U1C A;  2H43 A;  2YIU B;  1VQK P;  1M7L A;  2BCC E;  3L73 J;  2OYH A;  3B4S A;  1PZQ A;  3O6Q B;  4EIJ A;  1YI2 P;  1S9K E;  3CX5 I;  1SS1 A;  1SQX D;  2A45 G;  1IC2 A;  3KHU A;  5AVX B;  2H88 C;  2YIU C;  3KQG A;  2XV5 A;  1FAV A;  3AE7 C;  1NWQ A;  1H8A A;  2K9J A;  1NTZ G;  1U7M A;  1HVV A;  2GUS A;  3CCQ P;  2YKQ A;  2ZXX A;  5AW9 B;  4NPD A;  1GK6 A;  2J58 A;  3AED C;  1VF5 D;  3HUS A;  2IYP A;  2WSC J;  1IK7 A;  3HUS C;  1NTZ D;  2A06 D;  3KZI E;  5APU A;  5CCH D;  3E1I A;  1EXI A;  1J1E C;  4N78 E;  3PRJ A;  3B5N A;  3O6Q A;  2ZXE B;  2O01 H;  3CC2 P;  1SP4 A;  1Z56 A;  2RN0 A;  3H1L J;  4I7Z C;  1S1C X;  3BCC D;  2D2C B;  2WPR A;  1OW6 A;  1OXZ A;  4B86 A;  1URQ D;  1AQ5 A;  1OMI A;  1ZLL A;  3H1I G;  1MKM A;  3CL3 D;  1VQ8 P;  1X79 B;  4PD4 H;  2FY8 A;  3L70 E;  2W8Z A;  1KFN A;  3RL0 C;  1ZME C;  2KIK A;  3GG2 A;  2E74 C;  2OYH C;  2E75 B;  5TIS E;  2E76 D;  3S4R A;  2WSF J;  4KT0 J;  1LWU A;  1G1I A;  1RF0 C;  1SFC D;  4GT1 A;  1SQX K;  4H0L D;  2R5D A;  2QM7 A;  3B5N B;  4JYB A;  5CCG A;  1S9K D;  1GU5 A;  1PGO A;  3JC2 2;  1DX7 A;  1GW3 A;  1KIL B;  1NTM K;  1Y47 A;  1Q86 Q;  2HOD B;  4L75 A;  2AXC A;  3CCM P;  2ZJS E;  1ZP0 C;  2POH A;  1KYO D;  3M0D C;  2FYU K;  3Q1M A;  3L72 E;  3L70 G;  4R4L A;  5KLV E;  1Q90 D;  3H1K J;  1H0T B;  5APV A;  1FZC A;  2IZ1 A;  1WT6 A;  1EC5 A;  2JEE A;  4ZMD A;  1NO4 A;  1PP9 G;  2PFX A;  2HPC A;  1YBK A;  1S5L E;  2W27 A;  3L36 A;  3B5N C;  1KQS O;  2NPS C;  2BCC J;  3E7K A;  3H6P A;  3L73 E;  3LID A;  2N9Y B;  1FDI A;  1KYO E;  2DW3 A;  4GIF A;  1URQ B;  4Y99 C;  1KC8 Q;  1QL2 A;  2P7J A;  3FXE A;  3IFM A;  4H0L B;  1S72 P;  2I8D A;  2HYN A;  3M9Q A;  3SSU A;  1HH0 A;  1L0N J;  4OGQ B;  4OGQ C;  1NVO A;  1SQX G;  1JOC A;  1SQV D;  3MUD A;  3TGU J;  1FZC C;  3CWB J;  1GDT A;  1VQ6 P;  2RH0 A;  3L71 G;  1LT9 A;  3CI9 A;  3B5N D;  1NTM D;  1X22 A;  3M91 A;  4PV1 B;  3M0D A;  4JPZ B;  2Z4E A;  3Q2Y A;  1EDI A;  2AEF A;  2KYV A;  3AE2 C;  1T2K C;  1CZQ A;  3V2P A;  3AEB C;  3SWY A;  1S2E A;  3CWB G;  5CCG C;  2G3A A;  2QEX P;  3M0A A;  3M9H A;  2ZYD A;  1JTH A;  1PGQ A;  2N1T D;  3CX5 H;  3LW5 H;  2ZT9 C;  1KOR A;  1YQ3 C;  3AE9 C;  4I1L A;  4K35 A;  3L75 J;  3H1H G;  1Y9B A;  5AVS B;  1H88 A;  1XTG B;  2OYO A;  2WWW A;  1SFC A;  4LC1 A;  1P84 H;  1RE4 C;  4U3F E;  2O1K A;  3L75 D;  4RKU J;  1PV3 A;  5M1B A;  4U3F J;  2B9B A;  2HPC B;  4YPC A;  5AW6 B;  2JP3 A;  2YXR B;  3JCU E;  3VYI A;  3VN0 A;  1NTK E;  4DCK A;  1IFI A;  3H1K E;  3CCL P;  1RE3 A;  1JEK A;  1LTA C;  3RK2 D;  3HE5 B;  2QA4 P;  5B66 E;  3OW2 O;  2JJL A;  1YTZ I;  5BVZ A;  4H44 D;  3IN6 A;  1NTM J;  3GLM A;  3MZW B;  2Z5I A;  1JO5 A;  1NH4 A;  2Q3E A;  1L0L K;  2WSF H;  4PV1 C;  3K5B A;  3CXH I;  5TIS H;  1GD2 E;  1KQG B;  2BEQ D;  1JY2 N;  1HUC A;  2E5T A;  1SQQ D;  3H1K D;  1L0L J;  3BVH A;  1D7M A;  1X0T A;  3R4Y A;  3TNU A;  1Q81 Q;  1OVU A;  3HUS B;  2OTJ P;  1JCC A;  1SQP J;  2YO2 A;  3VMY A;  3RK3 E;  4RJT A;  2QJK B;  2R44 A;  2XND H;  2IBZ E;  3HE5 A;  4I6M C;  5CMZ A;  1KTM A;  1FS0 E;  1S4X A;  2WPS A;  2BCC D;  2R3C A;  4HB1 A;  1QX8 A;  3H1J E;  1KD1 Q;  1URQ A;  3F5H A;  3VTP C;  1HF9 A;  2AEM A;  5AVW B;  1ZRT E;  1N7S A;  2OTK E;  2RMZ A;  1W2E A;  2QJY C;  2AEJ A;  2E76 B;  5BU5 A;  1KV4 A;  3HD7 D;  1GL2 D;  2ZVO B;  3OJA B;  4QMA A;  2MJZ A;  2ZAE B;  2FYU J;  2P2U A;  3C9I A;  4AUW A;  4CPG A;  2PRR A;  1LWU B;  1JMM A;  4GOF A;  3V2Q A;  3D6Z A;  3VOP A;  1RF1 A;  2YXQ B;  1T3U A;  5CCG D;  1NHL A;  2Q3I A;  1PIX A;  1KIL E;  2QIW A;  2WSE J;  1IFJ A;  3BCC E;  4NPF X;  3RBX A;  3Q3D A;  1KQF B;  1SQP E;  2N1T C;  1T2K D;  4YXD C;  4N3Y B;  4ZKP A;  1FOS E;  1QEX A;  2HOD A;  1GU4 A;  4PJ0 E;  1K05 A;  4I2L C;  2A45 H;  1GW4 A;  1M1J C;  2Q9I A;  1L0N K;  3PTZ A;  2FYN B;  1BDD A;  2Y0E A;  1YQ4 C;  3G6E P;  2C9N Y;  2FXO A;  2JDI H;  2PP6 A;  2KNC A;  3H1H J;  3VP8 A;  1VQ9 P;  4JYC A;  2NPS D;  1SQQ G;  3D6Y A;  3H1J D;  2A45 I;  1VPC A;  1SQV K;  4R4M A;  1M8O B;  1SQX J;  1KB9 I;  1NKN A;  4H13 B;  1G1J A; 
#chains in the Genus database with same CATH homology
 1KQL A;  3IR9 A;  4WY4 B;  1URQ C;  4Y99 B;  1N7L A;  2WT7 B;  3SWF A;  3H32 B;  3GHG B;  1FZE A;  2KSJ A;  3KYQ A;  2N1T B;  1G2C A;  3LIE A;  2FYZ A;  1FZG A;  2XNX A;  3V2N A;  5AVU B;  3TNU B;  5CCH A;  2I1J A;  5CCH C;  3M9B A;  5CHX A;  2J59 M;  1NKZ B;  1X8Y A;  1CI6 A;  1LTJ C;  4WY4 D;  3GHG A;  1GL2 C;  1CI6 B;  1CSB A;  3M06 A;  1N7S B;  1IFN A;  3CLQ A;  1SFC B;  3A2A A;  3A3Y B;  1IFD A;  2GUV A;  5APS A;  1HBW A;  3V4Q A;  1L4A D;  2XU6 A;  1JUN A;  1LTI C;  1KIL A;  3A5T A;  2YKO A;  1J1E B;  4IFF A;  1JCD A;  2LKM A;  3P32 A;  2P1J A;  2YNY A;  1LT9 B;  5AW7 B;  1JY2 P;  1GL2 B;  1RE3 C;  1LTT C;  2M8R A;  1FZF A;  1T3J A;  2R32 A;  1GZL A;  1HWT C;  1VDF A;  4IFM A;  4DOJ A;  3BAT A;  4XE5 B;  3UIA A;  3HD7 A;  2IFN A;  1ZR2 A;  3G3Z A;  1RF1 B;  5APQ A;  1EQ7 A;  1FZC C;  2FXM A;  2OYI C;  2H7H A;  1CW5 A;  4WY4 C;  3II6 A;  3V4W A;  2HFE D;  3RK3 B;  3RK2 B;  2GM4 A;  3NMD A;  5AW2 B;  1L4A C;  1T8Z A;  1DEB A;  5APW A;  1GK4 A;  1N2D C;  3V2R A;  1M1J B;  2N9B A;  4C7R A;  5AW1 B;  1M1J A;  1SQP K;  1LTG C;  1ZV8 A;  2CPS A;  3PP5 A;  2WT7 A;  2E42 A;  3VMZ A;  1J1D C;  1JY2 O;  1NU1 K;  1LGH B;  2VRS A;  3L4F A;  4N78 D;  2OYI A;  1OWA A;  1MV8 A;  5CJ0 A;  2WSC H;  2WIT A;  3TYY A;  5AW5 B;  3RK3 D;  2M3B A;  2OYH B;  3P8M C;  4WY4 A;  1HGZ A;  1FJP A;  5AW0 B;  3OA7 A;  3EFG A;  2N1T A;  1FOS F;  1JY3 O;  3P8C D;  2Z5H A;  4ZKU A;  3V5B A;  2P67 A;  4DZO A;  2YO3 A;  1MUU A;  4JF7 A;  1JY3 N;  1SLQ A;  5AVQ B;  1IK9 A;  5AVZ B;  5KJ7 D;  1N73 A;  3P7K A;  4C7N B;  2WPQ A;  2OAR A;  2C0X A;  2WSE H;  3N4X A;  1SQQ K;  1JTH B;  2I1K A;  4IFD K;  1AFO A;  2W6A A;  3HRN A;  1FDM A;  3RK3 C;  1FU1 A;  5KLV K;  1HGV A;  1N7S D;  4EOT A;  2OYI B;  1GL2 A;  3N7N A;  3BRV B;  2E43 A;  3R2P A;  1YTZ T;  2HG5 D;  3HD7 B;  1G2C B;  2WTY A;  3L35 A;  1PFI A;  1J2J B;  3HE4 B;  4C7N A;  1KIL C;  5AW8 B;  4HH2 A;  1NTK K;  4AQR D;  3L37 A;  1FBM A;  1SVF A;  1RY3 A;  1N86 A;  2IX7 C;  1JNM A;  1NOH A;  1LT9 C;  2KP8 A;  1KIL D;  5KJ7 A;  5APX A;  2IPP A;  4W80 A;  1HTL C;  3KDP B;  5AW3 B;  1LTJ A;  1IO4 A;  3BRT B;  3MIW A;  1GTW A;  5AVY B;  2FFD A;  2WZ7 A;  3NFQ A;  2YKP A;  3NTN A;  3VMX A;  4RES B;  1JY3 P;  1N7S C;  2Q5U A;  1LTJ B;  2QM8 A;  3U59 A;  1FZB A;  3MTU E;  1X9V A;  4OH8 B;  1J1D B;  2CPB A;  4C46 A;  1MFZ A;  4LGD E;  2XKM A;  4O9B A;  2HLO A;  1E5W A;  3MD0 A;  2KB7 P;  1KZU B;  2XZR A;  5CJ4 A;  3TK1 A;  3HE4 A;  3H32 A;  3VP9 A;  3MGN A;  1QL1 A;  1ZN5 A;  3P8C E;  4W7Z A;  2H8P D;  2ZFC A;  1ZR4 A;  5AVV B;  1L4A B;  4GKG A;  2Q7C A;  4HYT B;  3A7O A;  5BU8 B;  3RL0 D;  2FFD C;  1SFC C;  2C9L Y;  1FZA A;  2NPS A;  1KFM A;  4KHX A;  2NPS B;  3O8Z A;  1N73 B;  3U1A A;  1YYC A;  4W7Y A;  4XA4 A;  1SQB K;  3KPE A;  2BAS A;  1IFM A;  1WRG A;  3NXS A;  3OAK A;  2O1J A;  2W6B A;  1NAF A;  2KOG A;  5APY A;  3GHG C;  2XDJ A;  1RF0 A;  3HD7 C;  1A02 J;  3WMM 0;  4AYC A;  2C0W A;  5APT A;  3HTK A;  1N73 C;  4M3L A;  3RL0 B;  2FFD B;  1LTB C;  3RK2 C;  2FKW B;  2PAJ A;  4N6J A;  3TSI A;  3EQ2 A;  1FJK A;  3BAS A;  3B8E B;  2KLV A;  2R5B A;  1NTZ K;  5AVR B;  5AW4 B;  1RE4 A;  1RF1 C;  2YMY A;  1FZC B;  1MZ9 A;  4WB4 A;  4LLH A;  1S9K D;  2L5G B;  2IFM A;  1DH3 A;  1L4A A;  3HTK B;  1HJB A;  1LTS C;  5AVT B;  5KJ7 C;  2H43 A;  5KTB A;  3U1C A;  1IJD B;  1LWU C;  1XTC C;  3I5C A;  1M7L A;  2OYH A;  4EIJ A;  1S9K E;  2A45 G;  1IC2 A;  5AVX B;  3KQG A;  2XV5 A;  1FAV A;  1NWQ A;  1H8A A;  1HVV A;  2GUS A;  2YKQ A;  5AW9 B;  1GK6 A;  2J58 A;  3HUS A;  5APU A;  3HUS C;  5CCH D;  3E1I A;  1J1E C;  4N78 E;  3B5N A;  2ZXE B;  2O01 H;  1SP4 A;  1Z56 A;  4B86 A;  2WPR A;  1OXZ A;  1URQ D;  1AQ5 A;  1ZLL A;  3CL3 D;  1X79 B;  1KFN A;  3RL0 C;  2OYH C;  1LWU A;  1G1I A;  1RF0 C;  1SFC D;  4GT1 A;  1SQX K;  1GU5 A;  3B5N B;  2R5D A;  2QM7 A;  4JYB A;  5CCG A;  1DX7 A;  1GW3 A;  1KIL B;  1NTM K;  2HOD B;  2POH A;  3M0D C;  2FYU K;  5APV A;  1FZC A;  1WT6 A;  2JEE A;  1NO4 A;  2HPC A;  2W27 A;  3L36 A;  3B5N C;  2NPS C;  3LID A;  3H6P A;  4GIF A;  1URQ B;  4Y99 C;  1QL2 A;  2P7J A;  3IFM A;  2HYN A;  3M9Q A;  1HH0 A;  1JOC A;  3MUD A;  1GDT A;  1LT9 A;  3CI9 A;  3B5N D;  3M91 A;  3M0D A;  2Z4E A;  1T2K C;  2KYV A;  1CZQ A;  3V2P A;  3SWY A;  5CCG C;  3M0A A;  3M9H A;  3T97 A;  1JTH A;  3LW5 H;  2N1T D;  1A02 F;  4I1L A;  5AVS B;  1H88 A;  1XTG B;  2WWW A;  1SFC A;  4LC1 A;  1RE4 C;  2O1K A;  2HPC B;  5AW6 B;  3VN0 A;  3VYI A;  1IFI A;  1RE3 A;  1LTA C;  3RK2 D;  3HE5 B;  2JJL A;  1YTZ I;  5BVZ A;  2Z5I A;  1JO5 A;  1NH4 A;  1L0L K;  2WSF H;  1GD2 E;  1JY2 N;  1HUC A;  3BVH A;  3TNU A;  3HUS B;  1JCC A;  2YO2 A;  3VMY A;  4I6M C;  3HE5 A;  5CMZ A;  2WPS A;  2R3C A;  1URQ A;  3VTP C;  5AVW B;  1N7S A;  1W2E A;  5BU5 A;  3HD7 D;  1GL2 D;  3OJA B;  2MJZ A;  2P2U A;  3C9I A;  4AUW A;  1RF1 A;  1LWU B;  1JMM A;  3V2Q A;  3VOP A;  1T3U A;  5CCG D;  1NHL A;  2Q3I A;  1H89 A;  1IFJ A;  1T2K D;  1FOS E;  2N1T C;  4ZKP A;  4N3Y B;  2HOD A;  1GU4 A;  4I2L C;  2A45 H;  1GW4 A;  1M1J C;  2Q9I A;  1L0N K;  2C9N Y;  2PP6 A;  3VP8 A;  4JYC A;  2NPS D;  2A45 I;  1VPC A;  1SQV K;  1NKN A;  4WBA A;  1G1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...