5APTA

Sequence ienkadkad inserted between gcn4 adaptors - structure a9
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
68
structure length
68
Chain Sequence
HMKQLEDKVEELLSKVYHLENEVARLKKLIENKADKADMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 30
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aptA00
1T2KC 2IPPA 3L37A 1A02J 5AW8B 1FOSE 1HWTC 1IO4A 2JJLA 3NTNA 3VN0A 1YYCA 2C9NY 5AVSB 4B86A 5APQA 3TNUB 3V4QA 1OWAA 3NXSA 2R5BA 3M9BA 2YO3A 3MGNA 2W6AA 4KHXA 5AVXB 5AW6B 2YO2A 4JYCA 1DH3A 4GT1A 2P2UA 2XZRA 2WWWA 3P32A 3V5BA 3M91A 2BASA 4XE5B 2QM7A 1GU4A 3VYIA 1H8AA 3HE4A 2Z5IA 3HTKA 4AYCA 5APVA 4C7NB 2N9BA 5AW4B 3LIDA 5AW3B 2ZXEB 3MD0A 3A3YB 3NMDA 1G2CB 1CI6A 4EOTA 4I6MC 5APWA 4LC1A 3VMYA 1GD2E 4C46A 3I5CA 1J2JB 4HYTB 5APSA 2W27A 3IR9A 2E43A 3KQGA 5AW9B 5AVUB 2WTYA 1JNMA 5AVZB 1A02F 2XV5A 5APUA 3O8ZA 2VRSA 2XU6A 3M9HA 1CI6B 5AVTB 1S9KE 3T97A 4JYBA 4DZOA 1H89A 3VMZA 3L36A 5CMZA 1KQLA 2QM8A 2ZFCA 3A2AA 1GK6A 3V4WA 1SLQA 3TYYA 2C9LY 1GZLA 1HUCA 2WPQA 1MV8A 1CZQA 1GK4A 2H7HA 5AW2B 3M06A 3HE4B 1T2KD 3HE5A 5AVWB 2WT7A 1NAFA 5AW7B 2Q5UA 3VMXA 1HBWA 3TNUA 5AVRB 5APXA 2E42A 4AUWA 1X8YA 1SP4A 3A7OA 3B8EB 4I2LC 5AW5B 3KDPB 3A5TA 4GKGA 3OAKA 2Q3IA 5AVQB 5APTA 3HE5B 5AVYB 3SWFA 2WT7B 3P8MC 5AVVB 1JUNA 1H88A 3UIAA 3VTPC 1S9KD 4C7NA 4RESB 2WPSA 3LIEA 2YNYA 3P7KA 3L35A 2R5DA 1FAVA 1CSBA 2Z5HA 2P67A 5AW0B 1NWQA 5AW1B 1OXZA 1MUUA 2R32A 4M3LA 3TK1A 2P7JA 3M0DA 3NFQA 1GTWA 1FOSF 3M0AA 1HJBA 1GU5A 2KP8A 2R3CA 4AQRD 5APYA 2WPRA 2Q7CA 1MFZA
chains in the Genus database with same CATH superfamily
2WSEH 2IFNA 2YMKA 3L73D 1IJDB 3BRTB 3FWNA 3VN0A 5E79H 4PV1D 2Q6QA 1JY3P 1SQQE 1RF0C 1Y9BA 3EWKA 2QE7H 1FDOA 1OFCX 1SQPK 3L73G 1YJ9P 2B9BA 1M1JB 1NU1J 1WT6A 5KKZB 1NTMD 3GW6A 3NMDA 1NGMB 1PPJE 1N7SA 4H44C 3CX5H 1L4AD 2IBZD 4RKUJ 2R44A 5APUA 4TT3H 2B87B 2BEQD 1JMBA 1KV4A 3L73J 2ZYDA 3H1JG 4A7PA 3FXDA 1FJKA 3A0BE 2IBZG 3AE5C 4IOIH 4ZNCA 2XNDH 1T2KD 2J59M 1L0NK 2XDJA 5APXA 3H32B 5AVQB 3H1JJ 2KS1A 1VQNP 3AE4C 2QJKB 3L74E 3CCRP 2KZJA 1QVFO 4DT0A 1DIPA 4UB8H 1GU5A 3L75G 3D71A 3RBXA 1JO5A 4H13B 1EDJA 3CX5I 2WVRA 1FJPA 5AW6B 1PGQA 3EFFK 2M3EA 3CWBG 5E79E 5K5GB 1LP1A 1X0TA 3ITKA 1H8AA 1K8AQ 3HTKA 3L75J 4HJGH 1G1IA 1P84H 3CCEP 3G6EP 4EOTA 3H1HE 4L73A 1FS0E 1SFCC 1VQ6P 3L70E 1ZRTE 2FYUD 1KILA 2A06G 2E43A 1JB0J 5DJTB 2O01H 4IFMA 1RE4A 1NTMK 3CWBJ 1BGYG 3CX5E 4XFJA 1URQD 3AEFC 1GK6A 2FFDA 1NTKD 1T3UA 2QG4A 1GMJA 1JOCA 1CZQA 5KKZC 1NTZD 3GHGB 1SQVG 1VQ4P 1EDIA 1RHZB 3VMXA 1BGYJ 1AQTA 2IYOA 3O6QB 3CCVP 3CCJP 2HPCA 4AUWA 4D6TG 3A5TA 3CCLP 3H1KD 1NAYA 1JCDA 2E74D 2I1JA 3CC4P 4N78D 2FYUJ 1NTZG 1AJYA 1DD4A 1KQFB 1VF5D 1IK9A 1SQVJ 1P84I 3N4XA 1HGVA 1S4XA 3H1KG 2L91A 2QJYB 3V6IA 3AE6C 4D6TJ 4Y99B 5AW8B 1FOSE 2HLOA 4K3AA 5KLVE 3WU2H 1NTZJ 2WSCJ 3MZWB 3TNUB 4PV1B 3V4QA 3K5BA 4GT1A 2WSFJ 2GM4A 1E5WA 3BVHA 3V5BA 2BASA 1OIPA 2FKWB 2QJKC 3H1KJ 1HGZA 4ZMDA 1VQKP 1Q90D 1MKMA 3R2PA 3SSUA 1L0LG 2ZXXA 1G2CB 3KZIH 3RK2C 1E79H 2XNXA 4PD4D 1S5LX 3SFDC 3VMYA 1P84E 1NYHA 1JY2N 4H13C 4U3FD 3MUDA 3IAOA 1JMMA 1JNMA 1S9KE 2FYUK 1SQXG 1L0LJ 1YHQP 2BCCG 2KUBA 2AEJA 3JCUE 5AW7B 3RL0g 1NTKK 4YTPC 3B8EB 1NTZK 1W5CE 1T3JA 3EQ2A 1EXJA 5CCHC 2J5UA 3KHUA 2BCCJ 1EZVG 1BCCG 3HRNA 1KORA 3GHGC 4WY4B 3L72E 5GTHE 4EYYQ 5H2FE 4Z1MH 5KJ7C 3WU2E 4XE5B 1LTJA 1NU1E 1VQ7P 2K9YA 2PAJA 4YPCA 3LIDA 2M3BA 3BASA 3I5CA 2QJYC 1ZP0C 4I7ZC 1GL2B 4Y99C 3CD6P 2K9JA 3CXHH 4WVZA 3PP5A 1KILE 1PGPA 1A02F 3RK3E 4PV1C 3PLNA 1FZFA 3VMZA 3HD7D 2M0BA 3L36A 3AECC 1EC5A 2N1TD 1QLED 1S5LH 1X9VA 1ZOYC 5CBNA 3H1LD 3G9RA 3H1JE 4IL6X 1BE3G 2A45G 3N7NA 1M90Q 2E74B 2CPBA 1XTGB 2YNYA 1R5SA 1KYOI 1VF5B 1WRGA 2P7JA 3M0AA 2N9YB 1BE3J 1T2KC 3FXEA 2JJLA 2OQQA 3CXHI 4GDOA 4KT0J 2RN0A 1OWAA 2YO3A 3MGNA 1VL2A 4JPZB 3L75E 1FZCB 2Y0EA 2ZYGA 4HB1A 4H44B 3CCQP 1KYOE 2K1AA 1LWUB 2IZ0A 1YIJP 1ZR2A 3CWBE 2KI7B 4YXDC 3KQGA 5KAIH 3SFEC 5KAFH 1IK7A 2XU6A 2PFXA 1N7SD 3CXHE 1Q7YQ 2B88A 2QJPC 1SQPG 3HUSB 2A06E 1ZR4A 4Y28J 3CCUP 1H0TB 1GW3A 1R8EA 1BGYE 5KLIB 1S5LE 1DEEG 2Q5UA 4NPFX 1RF1B 1GL2C 2OYIC 2K37A 2D2CD 2KLUA 3HE5B 1H88A 1SQPJ 1HF9A 3P7KA 1M1JA 1SQVE 3B5ND 1Y47A 3AEDC 1URQC 3H1ID 1OXZA 1MUUA 1IZNB 3NFQA 1GTWA 3AE3C 4IL6H 1MV8A 1L0NG 3Q5RA 3D70A 3SWYA 1M57D 2B87A 2AXTH 3H1IG 3A0HH 2E75D 4WBAA 2E74C 2NPSD 2N9BA 1SFCB 1VF5C 2KXPB 2WZ7A 4EIJA 2FXMA 1CI6A 5C39A 1JM0A 4XA4A 1FU1A 2IFMA 4W80A 2W27A 3H1IJ 2V7QH 3WUUA 4H0LD 2M5AB 5CCGA 1EDKA 1LTGC 4BWNA 5KAIE 1L0LE 3RGUA 4GODA 5KAFE 2PRRA 3TSIA 4L76A 1JTHA 1FZCC 1Y8AA 2N1TB 1S1CX 3ZDMA 1Q86Q 2C9LY 1FZEA 1GK4A 2FY8A 3D6ZA 5AVWB 2WT7A 3H25A 1LWUC 2IYPA 2MJZA 1OW6A 1EZVI 1M8OB 1SQXE 1NTMG 5BU5A 1VQMP 2POHA 4NPDA 2FYZA 5TISH 2BCCE 2IX7C 3MHVA 3CLQA 3E1RA 5M1BA 3CMAP 2A45H 3AE1C 2M8RA 3HUSC 5KTBA 1BDDA 2KP8A 1NTMJ 2WPRA 5KLIC 3OJAB 1RF1C 4IL6E 3IN6A 1YYCA 1EZVE 5APQA 1BCCE 2ZT9D 2E76D 1FDIA 3L71D 3FWLA 1KTMA 1M56D 3V2PA 4JYCA 2AXTE 3A0HE 1LTTC 1D7MA 4GOFA 3RK2B 1QEXA 1X22A 3GHGA 3MP7B 5APVA 2Y0CA 3V2RA 3MD0A 1IFNA 2QVAA 4DOJA 3L71G 3O6QA 1GW4A 3TGUD 1SQBD 4RJTA 2AEMA 3BATA 1ZLLA 5AVZB 1Q81Q 3AE8C 2H8PD 1N7SB 1N7LA 3B71A 4ZKPA 2QM8A 1ZV8A 4C7RA 3I56P 3BCCE 3TYYA 2FXPA 2A45I 1LT9A 3L71J 1LT1A 3CC7P 2OARA 1KD1Q 2UWJE 3P8CE 2HFED 4BXLA 3TNUA 1FZAA 4IFFA 1VQLP 2D2CB 1BSNA 3P8MC 1VQPP 1KB9H 2FYUG 3V2NA 2Q9IA 1IFDA 2I1KA 3JCUH 1VQ8P 5TISE 3B5NB 5BU8B 1G2CA 4UB6E 2N1TC 3KXDA 2LKMA 2JWDA 1BE3E 3TK1A 3AEEC 1PP9D 3M0DA 1HJBA 4JQ0D 1NKNA 1NTKG 1HH0A 3L37A 1ZW0A 2G8YA 1XTCC 2C9NY 1J1EB 4B86A 1QX8A 1RE3C 2YKQA 4BRYB 1EDLA 1W2EA 1J1DB 1NVOA 3AE2C 1T8ZA 4DJGA 4KJMA 5GTHH 2NPSB 5H2FH 3C8VA 3ABVC 2ZXEB 1NTKJ 4I7ZB 2C0WA 4ASWA 4I6MC 2JKVA 2FYNB 4QMAA 4WB4A 2NRGA 1Q82Q 1M7LA 5AW9B 1JY2P 1PP9J 3F89A 3GF7A 3JC22 1YQ3C 1KB9I 1SQQD 1SQBK 1N8RQ 4WY4A 3S4RA 3HE4B 1K9MQ 1NAFA 1PGOA 1PPJD 1L4AB 2WMMA 2O01N 1LTBC 4JF7A 1NO4A 4ASVA 1AA0A 2HG5D 1SQPE 2ITAA 4GKGA 5TJHA 2RMZA 4U3FG 1N7SC 2LXCB 1U57A 1KB9E 1IFPA 3I55P 2CK3H 2YKOA 4R4MA 2Y9YA 1GL2A 2H43A 3Q5SA 3CPWO 2Q7CA 2G3AA 1KFNA 1OW7A 3NTNA 2B89A 4U3FJ 5CHXA 3LW5J 2R5BA 2W6AA 2E76B 2D2CC 1M1KQ 2Q3EA 5GTIE 2LR2A 1L0NE 4O9BA 2SPZA 3B5NC 3L74D 5AW4B 3GG2A 3RBZA 1GD2E 2KK7A 3IFMA 2H89C 1N73B 1X79B 3L74G 2K88A 2QJPB 1J1EC 3GLMA 1KYOH 2E75C 1J1DC 1KQLA 2NPSC 3AE7C 2WPQA 3QH9A 2OYHB 2H7HA 2OYIB 1SQQK 2IBZI 1RF0A 3H1HD 2FYNC 3L70D 3L73E 1ZRTD 3WUTA 3L74J 1QL2A 1USEA 2YIUB 3TF5A 2ZVNB 2KYVA 3A7OA 1EQ7A 1OVRA 3SWFA 4GOEA 1Q2NA 1URQB 1JUNA 3CX5D 3RL0D 3AE9C 2R5DA 2WSEJ 1RE4C 1NTME 2E5YA 1LGHB 1VQ5P 4L75A 1FOSF 2P58A 1MZ9A 1L4AC 3B4SA 4L74A 3U59A 1AVYA 2IBZE 2HR3A 1OVUA 4IFDK 5AVXB 3H1LG 1ZN5A 3HUSA 2WQYC 3MTUE 2QM7A 1H0TA 2WSCH 1OZHA 2GUSA 2WSFH 4OWFA 1AFOA 5APWA 1RQUA 1IFMA 4C46A 5L8RJ 2QA4P 5KLVD 3F5HA 4LGDE 2JO1A 3H1LJ 3O8ZA 2LXBA 1NJIQ 1U7JA 2E76C 3GF3A 5CMZA 2WITA 1G1JA 2K9JB 3A2AA 5CCGD 1OMIA 4CPGA 1USDA 2QEXP 2J58A 2AXCA 5KLVG 2ZAEB 5BVZA 1P84D 3CC2P 4MN4C 5B66H 2E42A 2KSEA 2HODA 3KDPB 3OAKA 1FZGA 1QGKB 1N73C 3EFGA 4W7YA 1JY2O 1KQGB 2KNCB 1S9KD 1SFCA 3CCMP 3QWOC 5KLVJ 3GMAA 1PIXA 4N3YB 3T97B 1NWQA 1FDMA 4PD4H 1LTIC 1YBKA 2E5TA 2GUVA 4YXWH 1VQOP 3MIWA 2OYHC 2FYUE 2HYNA 3WMM0 2JP3A 2YIUC 2N1TA 2XZRA 4D6TE 3VYIA 1FZBA 4AYCA 4C7NB 3U1CA 3G71P 2W83C 2O01J 1NTZE 3FGAD 4OGQD 4LC1A 3R4YA 1RE3A 1OW8A 3L72D 3WUVA 1TU3F 3H1KE 3OA7A 1ZMEC 1LTSC 4JYBA 2MKVA 2R3SA 5KLVK 3V4WA 1NU1D 3V2QA 4PD4I 3H32A 5EFWB 1HTLC 2KZIA 1HBWA 2Z4EA 4HKZH 2PP6A 2P1JA 1Z56A 1KILD 5B66E 3VOPA 3HD7B 3Q3DA 3RK3D 3L72J 3RL0B 1BDCA 1YI2P 5B5EH 2V4HA 1RY3A 2OTKE 2OTLP 4PD4E 4U3FE 2KOGA 1HVVA 1K05A 3H1JD 3USSA 3JSVC 1FBMA 4UB6H 1JY3N 4HH2A 4PJ0H 1FC2C 3M9QA 5AW3B 2IZ1A 2IDBA 2W6BA 5CCHA 1KQSO 3IF4A 1LTAC 5AVUB 2WTYA 1L2PA 1LNQA 1CI6B 3Q1MA 2JR8A 5AVTB 1NH4A 3B5NA 2QSIA 2ZJSE 4JBZA 3L75D 2FXOA 1UIXA 1GDTA 5KJ7A 1K04A 1FE6A 1W2BO 4U7JA 1KYOD 1JTHB 1NU1K 3CWBD 2GA1A 3AEBC 1PFIA 2JEEA 4WY4D 2P10A 4BRYA 4N6JA 3SWKA 5AVYB 2WT7B 2YKPA 2KIKA 2NPSA 3TGUG 3CXHD 1SQBG 2KLVA 4RESB 3LIEA 4TLFA 1CSBA 1SS1A 2QIWA 2A06D 2YMYA 2R32A 3Q5PA 1S3JA 1BGYD 1YTZI 5B5EE 5DJUB 2BEZF 1IO4A 3BRVB 1K73Q 1YJWP 3TGUJ 1SQBJ 1GL2D 3CL3D 3M9BA 3HD7C 1AQ5A 2P2UA 3P32A 3E1IA 3RL0C 1SQVD 2KS1B 3HE4A 3PH0A 1L4AA 3FX0A 4PJ0E 4D6TD 4OGQB 3VMAA 1BSHA 3H1LE 5GTIH 1M1JC 3IR9A 2E75B 1PP9G 3PHLA 1VPCA 2QRXA 4NPEA 4DZOA 2JWAA 2L5GB 1LP1B 2O1JA 3HTKB 3E7KA 4H0LB 1KZUB 1RH5B 3W68A 1LT9B 1YJNP 1VQ9P 4LLHA 1KILB 4UB8E 5AVVB 1L0LD 3VTPC 3RK3B 3W67A 3Q2YA 3S9OA 2W8ZA 3L35A 2JDIH 1FAVA 1NOHA 5CCGC 4M3LA 2FFDB 1SQQG 4H44D 4AQRD 1KFMA 2KB7P 2RKLA 1N73A 1AV1A 2YXRB 1SQXD 1R5LA 3AEAC 2AEFA 1PPJG 4KHXA 2HPCB 2YO2A 1NHLA 1AVOA 1DH3A 2BCCD 2WWWA 3M91A 2OYHA 1SQQJ 2OYIA 3G4SP 1JY3O 4GIFA 3TDKA 1WMKA 2WPVB 2PGDA 1J2JB 1SQVK 4HYTB 1IFJA 1URQA 2ZT9B 1QL1A 1PL5A 1EZVD 3M9HA 1BCCD 1KMIZ 2ZVOB 1SQXJ 4K35A 1SLQA 3H1IE 2DW3A 4RO0A 1GZLA 1HUCA 1YITP 5AW2B 4ZKUA 2CPSA 4OGQC 1IFIA 1QVGO 5AVRB 4DCKA 2WSSH 1S2EA 1SP4A 5AW5B 1PGJA 1PV3A 3U1AA 2W6JH 3UIAA 1DX7A 2WPSA 2XKMA 2Z5HA 2P67A 3BCCD 1BCCJ 1L0LK 1SFCD 4R4LA 5APYA 1MFZA 3PTZA 4H0LC 1PZQA 1SVFA 3P8CD 1FZCA 1HWTC 2FBWC 1YQ4C 1LT9C 3BCCG 1CW5A 2K3RA 3H1HG 3NXSA 3KZIE 1KILC 5CJ0A 3L70G 1LWUA 3L4FA 3RK3C 2Y9ZA 1SQXK 2Z5IA 2OTJP 2V7QJ 3H6PA 1BE3D 3A3YB 2FFDC 2Q1KA 3BCCJ 2H88C 3H1HJ 2KNCA 3L70J 2XV5A 2VRSA 1RQVA 1ZXGA 3M0DC 1VDFA 3T97A 1KN7A 1H89A 4OH8B 2C0XA 3VP8A 2ZFCA 1RF1A 2KSJA 1LTJB 1DEBA 3AEGC 3M06A 3HE5A 2Y0DA 1UIIA 1YTZT 4OVNF 1X8YA 4I2LC 1T6AA 2ZT9C 5APTA 3L71E 4C7NA 5CBOA 1NKZB 5AW0B 1N2DC 5AW1B 2I8DA 3C9IA 3C1LA 3RK2D 4H13D 1DD3A 1IC2A 3TGUE 1SQBE 2IPPA 1A02J 1JEKA 4EDFA 1JCCA 3D6YA 4WWIA 1SQPD 5AVSB 4WY4C 3MUDC 4W7ZA 3KPEA 1LJ2A 1GU4A 3PJSK 3LW5H 1KB9D 3CCSP 2M5AA 3S1KA 1EXIA 1U7MA 2O1KA 1OX3A 5APSA 2W90A 3HD7A 3CMEP 2YXQB 2ZYAA 2OYOA 2O3JA 1NTKE 2RH0A 3II6A 3PRJA 5CCHD 3A0BH 1MFTA 1N86A 1L0ND 1PP9E 1HJ0A 2NZ2A 3G3ZA 1S72P 5KJ7D 2OGUA 4N78E 2Q3IA 4I1LA 3L72G 3CI9A 3VP9A 2HODB 3KYQA 1OVVA 5CJ4A 1KC8Q 1LTJC 3OW2O 4EI2A 2R3CA 1NU1G 1L0NJ
chains in the Genus database with same CATH topology
1T2KC 1KFNA 2WSEH 2IFNA 1IO4A 1IJDB 3BRTB 2JJLA 3BRVB 3NTNA 3VN0A 1GL2D 5CHXA 1OWAA 3CL3D 2R5BA 3M9BA 2YO3A 3MGNA 2W6AA 1JY3P 3HD7C 1AQ5A 1RF0C 2P2UA 1FZCB 3P32A 3E1IA 3RL0C 3HE4A 4O9BA 1SQPK 3B5NC 5AW4B 1L4AA 1M1JB 1WT6A 1LWUB 3NMDA 1GD2E 1ZR2A 1N7SA 1M1JC 3IR9A 3KQGA 3IFMA 1L4AD 1N73B 5APUA 2XU6A 1X79B 1VPCA 1J1EC 1N7SD 4DZOA 1J1DC 1KQLA 2L5GB 3HUSB 1FJKA 2NPSC 2WPQA 1ZR4A 2OYHB 1GW3A 2O1JA 2H7HA 3HTKB 1T2KD 2OYIB 1SQQK 1RF0A 1KZUB 2Q5UA 2J59M 1L0NK 1RF1B 2XDJA 1QL2A 1LT9B 5APXA 2KYVA 1GL2C 2OYIC 3A7OA 1EQ7A 3H32B 5AVQB 4LLHA 1KILB 3HE5B 3SWFA 5AVVB 1JUNA 1URQB 1H88A 3VTPC 3RK3B 3RL0D 3P7KA 1M1JA 3B5ND 3L35A 2R5DA 1FAVA 1NOHA 1URQC 1RE4C 5CCGC 1OXZA 1MUUA 1LGHB 4M3LA 2FFDB 3NFQA 1GTWA 1FOSF 1GU5A 4AQRD 1KFMA 1JO5A 2KB7P 1MV8A 1N73A 1MZ9A 1L4AC 3SWYA 3U59A 1FJPA 4WBAA 4KHXA 5AW6B 5AVXB 4IFDK 2HPCB 2YO2A 1ZN5A 1NHLA 1DH3A 3HUSA 2WWWA 3M91A 3MTUE 2QM7A 2NPSD 2WSCH 2OYHA 1H8AA 2GUSA 3HTKA 2OYIA 2N9BA 1SFCB 1G1IA 2WSFH 2WZ7A 1AFOA 4EIJA 1JY3O 2FXMA 4GIFA 1CI6A 4EOTA 5APWA 4XA4A 1IFMA 4C46A 1SFCC 1FU1A 1J2JB 1SQVK 4HYTB 2IFMA 4W80A 2W27A 1KILA 2E43A 1IFJA 1URQA 2O01H 4IFMA 4LGDE 1QL1A 1RE4A 1NTMK 5CCGA 3O8ZA 1LTGC 3M9HA 3TSIA 5CMZA 1URQD 2WITA 1JTHA 1G1JA 3A2AA 1FZCC 1GK6A 5CCGD 2FFDA 1T3UA 2N1TB 1SLQA 2J58A 2C9LY 1GZLA 1JOCA 1HUCA 1FZEA 1CZQA 1GK4A 5AW2B 3GHGB 5AVWB 2WT7A 4ZKUA 1LWUC 2CPSA 2MJZA 5BVZA 1IFIA 3VMXA 5AVRB 2E42A 4AUWA 2HPCA 5BU5A 1SP4A 2HODA 5AW5B 2POHA 3KDPB 3A5TA 3OAKA 1FZGA 1N73C 1JCDA 3EFGA 2FYZA 4W7YA 2I1JA 3U1AA 1JY2O 4N78D 3UIAA 1S9KD 2IX7C 1DX7A 1SFCA 2WPSA 2XKMA 3CLQA 4N3YB 2Z5HA 1IK9A 2A45H 2P67A 1NWQA 1FDMA 1LTIC 2M8RA 3HUSC 5KTBA 2GUVA 3N4XA 1HGVA 1L0LK 1SFCD 3MIWA 2OYHC 2KP8A 5APYA 2WPRA 2HYNA 1MFZA 4Y99B 5AW8B 1FOSE 1SVFA 1FZCA 3P8CD 2HLOA 3WMM0 1HWTC 3OJAB 1RF1C 1LT9C 1YYCA 5APQA 3TNUB 1CW5A 3V4QA 3NXSA 1KILC 3V2PA 4JYCA 5CJ0A 2N1TA 4GT1A 2GM4A 1LWUA 2XZRA 1E5WA 3L4FA 3RK3C 3V5BA 3BVHA 2BASA 1LTTC 2FKWB 3VYIA 1FZBA 1SQXK 3RK2B 2Z5IA 4AYCA 1HGZA 3GHGA 5APVA 4C7NB 3U1CA 3R2PA 3V2RA 3MD0A 3H6PA 1IFNA 3A3YB 1G2CB 4DOJA 2FFDC 3RK2C 4LC1A 2XNXA 3VMYA 1RE3A 1JY2N 1GW4A 3MUDA 3BATA 1ZLLA 1JMMA 1JNMA 5AVZB 3OA7A 2XV5A 2VRSA 3M0DC 2H8PD 1S9KE 1VDFA 1LTSC 1N7SB 3T97A 4JYBA 1N7LA 1H89A 2FYUK 4ZKPA 4OH8B 2C0XA 3VP8A 2QM8A 2ZFCA 5KLVK 3V4WA 1ZV8A 4C7RA 1RF1A 3V2QA 3TYYA 2A45I 1LT9A 2KSJA 1LTJB 1DEBA 3H32A 3M06A 2OARA 1HTLC 3HE5A 1YTZT 5AW7B 3P8CE 1NTKK 2HFED 1HBWA 3TNUA 1FZAA 2Z4EA 4IFFA 2PP6A 1X8YA 4I2LC 3B8EB 2P1JA 1Z56A 1KILD 5APTA 1NTZK 3VOPA 3P8MC 3HD7B 3RK3D 1T3JA 3EQ2A 4C7NA 3V2NA 2Q9IA 3RL0B 5CCHC 1IFDA 2I1KA 1NKZB 3B5NB 5AW0B 1N2DC 5AW1B 5BU8B 1G2CA 3C9IA 2N1TC 3HRNA 1RY3A 2LKMA 3RK2D 3TK1A 3M0DA 1HJBA 3GHGC 1NKNA 4WY4B 1IC2A 2IPPA 1HH0A 2KOGA 3L37A 1A02J 1HVVA 1XTCC 1JCCA 2C9NY 5KJ7C 1J1EB 1FBMA 4WY4C 5AVSB 4B86A 1RE3C 1JY3N 2YKQA 1W2EA 1J1DB 4W7ZA 4HH2A 4XE5B 1T8ZA 3KPEA 1LTJA 1GU4A 2NPSB 3LW5H 2PAJA 3M9QA 3LIDA 5AW3B 2ZXEB 2M3BA 2C0WA 4I6MC 2W6BA 3BASA 3I5CA 2O1KA 4WB4A 5CCHA 5APSA 1M7LA 1GL2B 4Y99C 1JY2P 1LTAC 3HD7A 5AVUB 5AW9B 2WTYA 3PP5A 1A02F 1CI6B 5AVTB 3II6A 1NH4A 5CCHD 3B5NA 1FZFA 3VMZA 1SQBK 1N86A 3HD7D 3L36A 2N1TD 1GDTA 5KJ7A 4WY4A 3HE4B 1X9VA 1NAFA 1JTHB 1L4AB 1NU1K 3G3ZA 1LTBC 4JF7A 1NO4A 1PFIA 5KJ7D 2JEEA 4WY4D 4N78E 2HG5D 4GKGA 2Q3IA 2A45G 4N6JA 3N7NA 5AVYB 2WT7B 2YKPA 4I1LA 2CPBA 2NPSA 1XTGB 3CI9A 2KLVA 4RESB 3LIEA 1N7SC 2YNYA 3VP9A 1CSBA 2HODB 3KYQA 2YKOA 1WRGA 2YMYA 2R32A 2P7JA 5CJ4A 1LTJC 1GL2A 3M0AA 2H43A 2R3CA 1YTZI 2Q7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T2K C;  2IPP A;  3L37 A;  1A02 J;  5AW8 B;  1FOS E;  1HWT C;  1IO4 A;  2JJL A;  3NTN A;  3VN0 A;  1YYC A;  2C9N Y;  5AVS B;  4B86 A;  5APQ A;  3TNU B;  3V4Q A;  1OWA A;  3NXS A;  2R5B A;  3M9B A;  2YO3 A;  3MGN A;  2W6A A;  4KHX A;  5AVX B;  5AW6 B;  2YO2 A;  4JYC A;  1DH3 A;  4GT1 A;  2P2U A;  2XZR A;  2WWW A;  3P32 A;  3V5B A;  3M91 A;  2BAS A;  4XE5 B;  2QM7 A;  1GU4 A;  3VYI A;  1H8A A;  3HE4 A;  2Z5I A;  3HTK A;  4AYC A;  5APV A;  4C7N B;  2N9B A;  5AW4 B;  3LID A;  5AW3 B;  2ZXE B;  3MD0 A;  3A3Y B;  3NMD A;  1G2C B;  1CI6 A;  4EOT A;  4I6M C;  5APW A;  4LC1 A;  3VMY A;  1GD2 E;  4C46 A;  3I5C A;  1J2J B;  4HYT B;  5APS A;  2W27 A;  3IR9 A;  2E43 A;  3KQG A;  5AW9 B;  5AVU B;  2WTY A;  1JNM A;  5AVZ B;  1A02 F;  2XV5 A;  5APU A;  3O8Z A;  2VRS A;  2XU6 A;  3M9H A;  1CI6 B;  5AVT B;  1S9K E;  3T97 A;  4JYB A;  4DZO A;  1H89 A;  3VMZ A;  3L36 A;  5CMZ A;  1KQL A;  2QM8 A;  2ZFC A;  3A2A A;  1GK6 A;  3V4W A;  1SLQ A;  3TYY A;  2C9L Y;  1GZL A;  1HUC A;  2WPQ A;  1MV8 A;  1CZQ A;  1GK4 A;  2H7H A;  5AW2 B;  3M06 A;  3HE4 B;  1T2K D;  3HE5 A;  5AVW B;  2WT7 A;  1NAF A;  5AW7 B;  2Q5U A;  3VMX A;  1HBW A;  3TNU A;  5AVR B;  5APX A;  2E42 A;  4AUW A;  1X8Y A;  1SP4 A;  3A7O A;  3B8E B;  4I2L C;  5AW5 B;  3KDP B;  3A5T A;  4GKG A;  3OAK A;  2Q3I A;  5AVQ B;  5APT A;  3HE5 B;  5AVY B;  3SWF A;  2WT7 B;  3P8M C;  5AVV B;  1JUN A;  1H88 A;  3UIA A;  3VTP C;  1S9K D;  4C7N A;  4RES B;  2WPS A;  3LIE A;  2YNY A;  3P7K A;  3L35 A;  2R5D A;  1FAV A;  1CSB A;  2Z5H A;  2P67 A;  5AW0 B;  1NWQ A;  5AW1 B;  1OXZ A;  1MUU A;  2R32 A;  4M3L A;  3TK1 A;  2P7J A;  3M0D A;  3NFQ A;  1GTW A;  1FOS F;  3M0A A;  1HJB A;  1GU5 A;  2KP8 A;  2R3C A;  4AQR D;  5APY A;  2WPR A;  2Q7C A;  1MFZ A; 
#chains in the Genus database with same CATH topology
 2WSE H;  2IFN A;  2YMK A;  3L73 D;  1IJD B;  3BRT B;  3FWN A;  3VN0 A;  5E79 H;  4PV1 D;  2Q6Q A;  1JY3 P;  1SQQ E;  1RF0 C;  1Y9B A;  3EWK A;  2QE7 H;  1FDO A;  1OFC X;  1SQP K;  3L73 G;  1YJ9 P;  2B9B A;  1M1J B;  1NU1 J;  1WT6 A;  5KKZ B;  1NTM D;  3GW6 A;  3NMD A;  1NGM B;  1PPJ E;  1N7S A;  4H44 C;  3CX5 H;  1L4A D;  2IBZ D;  4RKU J;  2R44 A;  5APU A;  4TT3 H;  2B87 B;  2BEQ D;  1JMB A;  1KV4 A;  3L73 J;  2ZYD A;  3H1J G;  4A7P A;  3FXD A;  1FJK A;  3A0B E;  2IBZ G;  3AE5 C;  4IOI H;  4ZNC A;  2XND H;  1T2K D;  2J59 M;  1L0N K;  2XDJ A;  5APX A;  3H32 B;  5AVQ B;  3H1J J;  2KS1 A;  1VQN P;  3AE4 C;  2QJK B;  3L74 E;  3CCR P;  2KZJ A;  1QVF O;  4DT0 A;  1DIP A;  4UB8 H;  1GU5 A;  3L75 G;  3D71 A;  3RBX A;  1JO5 A;  4H13 B;  1EDJ A;  3CX5 I;  2WVR A;  1FJP A;  5AW6 B;  1PGQ A;  3EFF K;  2M3E A;  3CWB G;  5E79 E;  5K5G B;  1LP1 A;  1X0T A;  3ITK A;  1H8A A;  1K8A Q;  3HTK A;  3L75 J;  4HJG H;  1G1I A;  1P84 H;  3CCE P;  3G6E P;  4EOT A;  3H1H E;  4L73 A;  1FS0 E;  1SFC C;  1VQ6 P;  3L70 E;  1ZRT E;  2FYU D;  1KIL A;  2A06 G;  2E43 A;  1JB0 J;  5DJT B;  2O01 H;  4IFM A;  1RE4 A;  1NTM K;  3CWB J;  1BGY G;  3CX5 E;  4XFJ A;  1URQ D;  3AEF C;  1GK6 A;  2FFD A;  1NTK D;  1T3U A;  2QG4 A;  1GMJ A;  1JOC A;  1CZQ A;  5KKZ C;  1NTZ D;  3GHG B;  1SQV G;  1VQ4 P;  1EDI A;  1RHZ B;  3VMX A;  1BGY J;  1AQT A;  2IYO A;  3O6Q B;  3CCV P;  3CCJ P;  2HPC A;  4AUW A;  4D6T G;  3A5T A;  3CCL P;  3H1K D;  1NAY A;  1JCD A;  2E74 D;  2I1J A;  3CC4 P;  4N78 D;  2FYU J;  1NTZ G;  1AJY A;  1DD4 A;  1KQF B;  1VF5 D;  1IK9 A;  1SQV J;  1P84 I;  3N4X A;  1HGV A;  1S4X A;  3H1K G;  2L91 A;  2QJY B;  3V6I A;  3AE6 C;  4D6T J;  4Y99 B;  5AW8 B;  1FOS E;  2HLO A;  4K3A A;  5KLV E;  3WU2 H;  1NTZ J;  2WSC J;  3MZW B;  3TNU B;  4PV1 B;  3V4Q A;  3K5B A;  4GT1 A;  2WSF J;  2GM4 A;  1E5W A;  3BVH A;  3V5B A;  2BAS A;  1OIP A;  2FKW B;  2QJK C;  3H1K J;  1HGZ A;  4ZMD A;  1VQK P;  1Q90 D;  1MKM A;  3R2P A;  3SSU A;  1L0L G;  2ZXX A;  1G2C B;  3KZI H;  3RK2 C;  1E79 H;  2XNX A;  4PD4 D;  1S5L X;  3SFD C;  3VMY A;  1P84 E;  1NYH A;  1JY2 N;  4H13 C;  4U3F D;  3MUD A;  3IAO A;  1JMM A;  1JNM A;  1S9K E;  2FYU K;  1SQX G;  1L0L J;  1YHQ P;  2BCC G;  2KUB A;  2AEJ A;  3JCU E;  5AW7 B;  3RL0 g;  1NTK K;  4YTP C;  3B8E B;  1NTZ K;  1W5C E;  1T3J A;  3EQ2 A;  1EXJ A;  5CCH C;  2J5U A;  3KHU A;  2BCC J;  1EZV G;  1BCC G;  3HRN A;  1KOR A;  3GHG C;  4WY4 B;  3L72 E;  5GTH E;  4EYY Q;  5H2F E;  4Z1M H;  5KJ7 C;  3WU2 E;  4XE5 B;  1LTJ A;  1NU1 E;  1VQ7 P;  2K9Y A;  2PAJ A;  4YPC A;  3LID A;  2M3B A;  3BAS A;  3I5C A;  2QJY C;  1ZP0 C;  4I7Z C;  1GL2 B;  4Y99 C;  3CD6 P;  2K9J A;  3CXH H;  4WVZ A;  3PP5 A;  1KIL E;  1PGP A;  1A02 F;  3RK3 E;  4PV1 C;  3PLN A;  1FZF A;  3VMZ A;  3HD7 D;  2M0B A;  3L36 A;  3AEC C;  1EC5 A;  2N1T D;  1QLE D;  1S5L H;  1X9V A;  1ZOY C;  5CBN A;  3H1L D;  3G9R A;  3H1J E;  4IL6 X;  1BE3 G;  2A45 G;  3N7N A;  1M90 Q;  2E74 B;  2CPB A;  1XTG B;  2YNY A;  1R5S A;  1KYO I;  1VF5 B;  1WRG A;  2P7J A;  3M0A A;  2N9Y B;  1BE3 J;  1T2K C;  3FXE A;  2JJL A;  2OQQ A;  3CXH I;  4GDO A;  4KT0 J;  2RN0 A;  1OWA A;  2YO3 A;  3MGN A;  1VL2 A;  4JPZ B;  3L75 E;  1FZC B;  2Y0E A;  2ZYG A;  4HB1 A;  4H44 B;  3CCQ P;  1KYO E;  2K1A A;  1LWU B;  2IZ0 A;  1YIJ P;  1ZR2 A;  3CWB E;  2KI7 B;  4YXD C;  3KQG A;  5KAI H;  3SFE C;  5KAF H;  1IK7 A;  2XU6 A;  2PFX A;  1N7S D;  3CXH E;  1Q7Y Q;  2B88 A;  2QJP C;  1SQP G;  3HUS B;  2A06 E;  1ZR4 A;  4Y28 J;  3CCU P;  1H0T B;  1GW3 A;  1R8E A;  1BGY E;  5KLI B;  1S5L E;  1DEE G;  2Q5U A;  4NPF X;  1RF1 B;  1GL2 C;  2OYI C;  2K37 A;  2D2C D;  2KLU A;  3HE5 B;  1H88 A;  1SQP J;  1HF9 A;  3P7K A;  1M1J A;  1SQV E;  3B5N D;  1Y47 A;  3AED C;  1URQ C;  3H1I D;  1OXZ A;  1MUU A;  1IZN B;  3NFQ A;  1GTW A;  3AE3 C;  4IL6 H;  1MV8 A;  1L0N G;  3Q5R A;  3D70 A;  3SWY A;  1M57 D;  2B87 A;  2AXT H;  3H1I G;  3A0H H;  2E75 D;  4WBA A;  2E74 C;  2NPS D;  2N9B A;  1SFC B;  1VF5 C;  2KXP B;  2WZ7 A;  4EIJ A;  2FXM A;  1CI6 A;  5C39 A;  1JM0 A;  4XA4 A;  1FU1 A;  2IFM A;  4W80 A;  2W27 A;  3H1I J;  2V7Q H;  3WUU A;  4H0L D;  2M5A B;  5CCG A;  1EDK A;  1LTG C;  4BWN A;  5KAI E;  1L0L E;  3RGU A;  4GOD A;  5KAF E;  2PRR A;  3TSI A;  4L76 A;  1JTH A;  1FZC C;  1Y8A A;  2N1T B;  1S1C X;  3ZDM A;  1Q86 Q;  2C9L Y;  1FZE A;  1GK4 A;  2FY8 A;  3D6Z A;  5AVW B;  2WT7 A;  3H25 A;  1LWU C;  2IYP A;  2MJZ A;  1OW6 A;  1EZV I;  1M8O B;  1SQX E;  1NTM G;  5BU5 A;  1VQM P;  2POH A;  4NPD A;  2FYZ A;  5TIS H;  2BCC E;  2IX7 C;  3MHV A;  3CLQ A;  3E1R A;  5M1B A;  3CMA P;  2A45 H;  3AE1 C;  2M8R A;  3HUS C;  5KTB A;  1BDD A;  2KP8 A;  1NTM J;  2WPR A;  5KLI C;  3OJA B;  1RF1 C;  4IL6 E;  3IN6 A;  1YYC A;  1EZV E;  5APQ A;  1BCC E;  2ZT9 D;  2E76 D;  1FDI A;  3L71 D;  3FWL A;  1KTM A;  1M56 D;  3V2P A;  4JYC A;  2AXT E;  3A0H E;  1LTT C;  1D7M A;  4GOF A;  3RK2 B;  1QEX A;  1X22 A;  3GHG A;  3MP7 B;  5APV A;  2Y0C A;  3V2R A;  3MD0 A;  1IFN A;  2QVA A;  4DOJ A;  3L71 G;  3O6Q A;  1GW4 A;  3TGU D;  1SQB D;  4RJT A;  2AEM A;  3BAT A;  1ZLL A;  5AVZ B;  1Q81 Q;  3AE8 C;  2H8P D;  1N7S B;  1N7L A;  3B71 A;  4ZKP A;  2QM8 A;  1ZV8 A;  4C7R A;  3I56 P;  3BCC E;  3TYY A;  2FXP A;  2A45 I;  1LT9 A;  3L71 J;  1LT1 A;  3CC7 P;  2OAR A;  1KD1 Q;  2UWJ E;  3P8C E;  2HFE D;  4BXL A;  3TNU A;  1FZA A;  4IFF A;  1VQL P;  2D2C B;  1BSN A;  3P8M C;  1VQP P;  1KB9 H;  2FYU G;  3V2N A;  2Q9I A;  1IFD A;  2I1K A;  3JCU H;  1VQ8 P;  5TIS E;  3B5N B;  5BU8 B;  1G2C A;  4UB6 E;  2N1T C;  3KXD A;  2LKM A;  2JWD A;  1BE3 E;  3TK1 A;  3AEE C;  1PP9 D;  3M0D A;  1HJB A;  4JQ0 D;  1NKN A;  1NTK G;  1HH0 A;  3L37 A;  1ZW0 A;  2G8Y A;  1XTC C;  2C9N Y;  1J1E B;  4B86 A;  1QX8 A;  1RE3 C;  2YKQ A;  4BRY B;  1EDL A;  1W2E A;  1J1D B;  1NVO A;  3AE2 C;  1T8Z A;  4DJG A;  4KJM A;  5GTH H;  2NPS B;  5H2F H;  3C8V A;  3ABV C;  2ZXE B;  1NTK J;  4I7Z B;  2C0W A;  4ASW A;  4I6M C;  2JKV A;  2FYN B;  4QMA A;  4WB4 A;  2NRG A;  1Q82 Q;  1M7L A;  5AW9 B;  1JY2 P;  1PP9 J;  3F89 A;  3GF7 A;  3JC2 2;  1YQ3 C;  1KB9 I;  1SQQ D;  1SQB K;  1N8R Q;  4WY4 A;  3S4R A;  3HE4 B;  1K9M Q;  1NAF A;  1PGO A;  1PPJ D;  1L4A B;  2WMM A;  2O01 N;  1LTB C;  4JF7 A;  1NO4 A;  4ASV A;  1AA0 A;  2HG5 D;  1SQP E;  2ITA A;  4GKG A;  5TJH A;  2RMZ A;  4U3F G;  1N7S C;  2LXC B;  1U57 A;  1KB9 E;  1IFP A;  3I55 P;  2CK3 H;  2YKO A;  4R4M A;  2Y9Y A;  1GL2 A;  2H43 A;  3Q5S A;  3CPW O;  2Q7C A;  2G3A A;  1KFN A;  1OW7 A;  3NTN A;  2B89 A;  4U3F J;  5CHX A;  3LW5 J;  2R5B A;  2W6A A;  2E76 B;  2D2C C;  1M1K Q;  2Q3E A;  5GTI E;  2LR2 A;  1L0N E;  4O9B A;  2SPZ A;  3B5N C;  3L74 D;  5AW4 B;  3GG2 A;  3RBZ A;  1GD2 E;  2KK7 A;  3IFM A;  2H89 C;  1N73 B;  1X79 B;  3L74 G;  2K88 A;  2QJP B;  1J1E C;  3GLM A;  1KYO H;  2E75 C;  1J1D C;  1KQL A;  2NPS C;  3AE7 C;  2WPQ A;  3QH9 A;  2OYH B;  2H7H A;  2OYI B;  1SQQ K;  2IBZ I;  1RF0 A;  3H1H D;  2FYN C;  3L70 D;  3L73 E;  1ZRT D;  3WUT A;  3L74 J;  1QL2 A;  1USE A;  2YIU B;  3TF5 A;  2ZVN B;  2KYV A;  3A7O A;  1EQ7 A;  1OVR A;  3SWF A;  4GOE A;  1Q2N A;  1URQ B;  1JUN A;  3CX5 D;  3RL0 D;  3AE9 C;  2R5D A;  2WSE J;  1RE4 C;  1NTM E;  2E5Y A;  1LGH B;  1VQ5 P;  4L75 A;  1FOS F;  2P58 A;  1MZ9 A;  1L4A C;  3B4S A;  4L74 A;  3U59 A;  1AVY A;  2IBZ E;  2HR3 A;  1OVU A;  4IFD K;  5AVX B;  3H1L G;  1ZN5 A;  3HUS A;  2WQY C;  3MTU E;  2QM7 A;  1H0T A;  2WSC H;  1OZH A;  2GUS A;  2WSF H;  4OWF A;  1AFO A;  5APW A;  1RQU A;  1IFM A;  4C46 A;  5L8R J;  2QA4 P;  5KLV D;  3F5H A;  4LGD E;  2JO1 A;  3H1L J;  3O8Z A;  2LXB A;  1NJI Q;  1U7J A;  2E76 C;  3GF3 A;  5CMZ A;  2WIT A;  1G1J A;  2K9J B;  3A2A A;  5CCG D;  1OMI A;  4CPG A;  1USD A;  2QEX P;  2J58 A;  2AXC A;  5KLV G;  2ZAE B;  5BVZ A;  1P84 D;  3CC2 P;  4MN4 C;  5B66 H;  2E42 A;  2KSE A;  2HOD A;  3KDP B;  3OAK A;  1FZG A;  1QGK B;  1N73 C;  3EFG A;  4W7Y A;  1JY2 O;  1KQG B;  2KNC B;  1S9K D;  1SFC A;  3CCM P;  3QWO C;  5KLV J;  3GMA A;  1PIX A;  4N3Y B;  3T97 B;  1NWQ A;  1FDM A;  4PD4 H;  1LTI C;  1YBK A;  2E5T A;  2GUV A;  4YXW H;  1VQO P;  3MIW A;  2OYH C;  2FYU E;  2HYN A;  3WMM 0;  2JP3 A;  2YIU C;  2N1T A;  2XZR A;  4D6T E;  3VYI A;  1FZB A;  4AYC A;  4C7N B;  3U1C A;  3G71 P;  2W83 C;  2O01 J;  1NTZ E;  3FGA D;  4OGQ D;  4LC1 A;  3R4Y A;  1RE3 A;  1OW8 A;  3L72 D;  3WUV A;  1TU3 F;  3H1K E;  3OA7 A;  1ZME C;  1LTS C;  4JYB A;  2MKV A;  2R3S A;  5KLV K;  3V4W A;  1NU1 D;  3V2Q A;  4PD4 I;  3H32 A;  5EFW B;  1HTL C;  2KZI A;  1HBW A;  2Z4E A;  4HKZ H;  2PP6 A;  2P1J A;  1Z56 A;  1KIL D;  5B66 E;  3VOP A;  3HD7 B;  3Q3D A;  3RK3 D;  3L72 J;  3RL0 B;  1BDC A;  1YI2 P;  5B5E H;  2V4H A;  1RY3 A;  2OTK E;  2OTL P;  4PD4 E;  4U3F E;  2KOG A;  1HVV A;  1K05 A;  3H1J D;  3USS A;  3JSV C;  1FBM A;  4UB6 H;  1JY3 N;  4HH2 A;  4PJ0 H;  1FC2 C;  3M9Q A;  5AW3 B;  2IZ1 A;  2IDB A;  2W6B A;  5CCH A;  1KQS O;  3IF4 A;  1LTA C;  5AVU B;  2WTY A;  1L2P A;  1LNQ A;  1CI6 B;  3Q1M A;  2JR8 A;  5AVT B;  1NH4 A;  3B5N A;  2QSI A;  2ZJS E;  4JBZ A;  3L75 D;  2FXO A;  1UIX A;  1GDT A;  5KJ7 A;  1K04 A;  1FE6 A;  1W2B O;  4U7J A;  1KYO D;  1JTH B;  1NU1 K;  3CWB D;  2GA1 A;  3AEB C;  1PFI A;  2JEE A;  4WY4 D;  2P10 A;  4BRY A;  4N6J A;  3SWK A;  5AVY B;  2WT7 B;  2YKP A;  2KIK A;  2NPS A;  3TGU G;  3CXH D;  1SQB G;  2KLV A;  4RES B;  3LIE A;  4TLF A;  1CSB A;  1SS1 A;  2QIW A;  2A06 D;  2YMY A;  2R32 A;  3Q5P A;  1S3J A;  1BGY D;  1YTZ I;  5B5E E;  5DJU B;  2BEZ F;  1IO4 A;  3BRV B;  1K73 Q;  1YJW P;  3TGU J;  1SQB J;  1GL2 D;  3CL3 D;  3M9B A;  3HD7 C;  1AQ5 A;  2P2U A;  3P32 A;  3E1I A;  3RL0 C;  1SQV D;  2KS1 B;  3HE4 A;  3PH0 A;  1L4A A;  3FX0 A;  4PJ0 E;  4D6T D;  4OGQ B;  3VMA A;  1BSH A;  3H1L E;  5GTI H;  1M1J C;  3IR9 A;  2E75 B;  1PP9 G;  3PHL A;  1VPC A;  2QRX A;  4NPE A;  4DZO A;  2JWA A;  2L5G B;  1LP1 B;  2O1J A;  3HTK B;  3E7K A;  4H0L B;  1KZU B;  1RH5 B;  3W68 A;  1LT9 B;  1YJN P;  1VQ9 P;  4LLH A;  1KIL B;  4UB8 E;  5AVV B;  1L0L D;  3VTP C;  3RK3 B;  3W67 A;  3Q2Y A;  3S9O A;  2W8Z A;  3L35 A;  2JDI H;  1FAV A;  1NOH A;  5CCG C;  4M3L A;  2FFD B;  1SQQ G;  4H44 D;  4AQR D;  1KFM A;  2KB7 P;  2RKL A;  1N73 A;  1AV1 A;  2YXR B;  1SQX D;  1R5L A;  3AEA C;  2AEF A;  1PPJ G;  4KHX A;  2HPC B;  2YO2 A;  1NHL A;  1AVO A;  1DH3 A;  2BCC D;  2WWW A;  3M91 A;  2OYH A;  1SQQ J;  2OYI A;  3G4S P;  1JY3 O;  4GIF A;  3TDK A;  1WMK A;  2WPV B;  2PGD A;  1J2J B;  1SQV K;  4HYT B;  1IFJ A;  1URQ A;  2ZT9 B;  1QL1 A;  1PL5 A;  1EZV D;  3M9H A;  1BCC D;  1KMI Z;  2ZVO B;  1SQX J;  4K35 A;  1SLQ A;  3H1I E;  2DW3 A;  4RO0 A;  1GZL A;  1HUC A;  1YIT P;  5AW2 B;  4ZKU A;  2CPS A;  4OGQ C;  1IFI A;  1QVG O;  5AVR B;  4DCK A;  2WSS H;  1S2E A;  1SP4 A;  5AW5 B;  1PGJ A;  1PV3 A;  3U1A A;  2W6J H;  3UIA A;  1DX7 A;  2WPS A;  2XKM A;  2Z5H A;  2P67 A;  3BCC D;  1BCC J;  1L0L K;  1SFC D;  4R4L A;  5APY A;  1MFZ A;  3PTZ A;  4H0L C;  1PZQ A;  1SVF A;  3P8C D;  1FZC A;  1HWT C;  2FBW C;  1YQ4 C;  1LT9 C;  3BCC G;  1CW5 A;  2K3R A;  3H1H G;  3NXS A;  3KZI E;  1KIL C;  5CJ0 A;  3L70 G;  1LWU A;  3L4F A;  3RK3 C;  2Y9Z A;  1SQX K;  2Z5I A;  2OTJ P;  2V7Q J;  3H6P A;  1BE3 D;  3A3Y B;  2FFD C;  2Q1K A;  3BCC J;  2H88 C;  3H1H J;  2KNC A;  3L70 J;  2XV5 A;  2VRS A;  1RQV A;  1ZXG A;  3M0D C;  1VDF A;  3T97 A;  1KN7 A;  1H89 A;  4OH8 B;  2C0X A;  3VP8 A;  2ZFC A;  1RF1 A;  2KSJ A;  1LTJ B;  1DEB A;  3AEG C;  3M06 A;  3HE5 A;  2Y0D A;  1UII A;  1YTZ T;  4OVN F;  1X8Y A;  4I2L C;  1T6A A;  2ZT9 C;  5APT A;  3L71 E;  4C7N A;  5CBO A;  1NKZ B;  5AW0 B;  1N2D C;  5AW1 B;  2I8D A;  3C9I A;  3C1L A;  3RK2 D;  4H13 D;  1DD3 A;  1IC2 A;  3TGU E;  1SQB E;  2IPP A;  1A02 J;  1JEK A;  4EDF A;  1JCC A;  3D6Y A;  4WWI A;  1SQP D;  5AVS B;  4WY4 C;  3MUD C;  4W7Z A;  3KPE A;  1LJ2 A;  1GU4 A;  3PJS K;  3LW5 H;  1KB9 D;  3CCS P;  2M5A A;  3S1K A;  1EXI A;  1U7M A;  2O1K A;  1OX3 A;  5APS A;  2W90 A;  3HD7 A;  3CME P;  2YXQ B;  2ZYA A;  2OYO A;  2O3J A;  1NTK E;  2RH0 A;  3II6 A;  3PRJ A;  5CCH D;  3A0B H;  1MFT A;  1N86 A;  1L0N D;  1PP9 E;  1HJ0 A;  2NZ2 A;  3G3Z A;  1S72 P;  5KJ7 D;  2OGU A;  4N78 E;  2Q3I A;  4I1L A;  3L72 G;  3CI9 A;  3VP9 A;  2HOD B;  3KYQ A;  1OVV A;  5CJ4 A;  1KC8 Q;  1LTJ C;  3OW2 O;  4EI2 A;  2R3C A;  1NU1 G;  1L0N J; 
#chains in the Genus database with same CATH homology
 1T2K C;  1KFN A;  2WSE H;  2IFN A;  1IO4 A;  1IJD B;  3BRT B;  2JJL A;  3BRV B;  3NTN A;  3VN0 A;  1GL2 D;  5CHX A;  1OWA A;  3CL3 D;  2R5B A;  3M9B A;  2YO3 A;  3MGN A;  2W6A A;  1JY3 P;  3HD7 C;  1AQ5 A;  1RF0 C;  2P2U A;  1FZC B;  3P32 A;  3E1I A;  3RL0 C;  3HE4 A;  4O9B A;  1SQP K;  3B5N C;  5AW4 B;  1L4A A;  1M1J B;  1WT6 A;  1LWU B;  3NMD A;  1GD2 E;  1ZR2 A;  1N7S A;  1M1J C;  3IR9 A;  3KQG A;  3IFM A;  1L4A D;  1N73 B;  5APU A;  2XU6 A;  1X79 B;  1VPC A;  1J1E C;  1N7S D;  4DZO A;  1J1D C;  1KQL A;  2L5G B;  3HUS B;  1FJK A;  2NPS C;  2WPQ A;  1ZR4 A;  2OYH B;  1GW3 A;  2O1J A;  2H7H A;  3HTK B;  1T2K D;  2OYI B;  1SQQ K;  1RF0 A;  1KZU B;  2Q5U A;  2J59 M;  1L0N K;  1RF1 B;  2XDJ A;  1QL2 A;  1LT9 B;  5APX A;  2KYV A;  1GL2 C;  2OYI C;  3A7O A;  1EQ7 A;  3H32 B;  5AVQ B;  4LLH A;  1KIL B;  3HE5 B;  3SWF A;  5AVV B;  1JUN A;  1URQ B;  1H88 A;  3VTP C;  3RK3 B;  3RL0 D;  3P7K A;  1M1J A;  3B5N D;  3L35 A;  2R5D A;  1FAV A;  1NOH A;  1URQ C;  1RE4 C;  5CCG C;  1OXZ A;  1MUU A;  1LGH B;  4M3L A;  2FFD B;  3NFQ A;  1GTW A;  1FOS F;  1GU5 A;  4AQR D;  1KFM A;  1JO5 A;  2KB7 P;  1MV8 A;  1N73 A;  1MZ9 A;  1L4A C;  3SWY A;  3U59 A;  1FJP A;  4WBA A;  4KHX A;  5AW6 B;  5AVX B;  4IFD K;  2HPC B;  2YO2 A;  1ZN5 A;  1NHL A;  1DH3 A;  3HUS A;  2WWW A;  3M91 A;  3MTU E;  2QM7 A;  2NPS D;  2WSC H;  2OYH A;  1H8A A;  2GUS A;  3HTK A;  2OYI A;  2N9B A;  1SFC B;  1G1I A;  2WSF H;  2WZ7 A;  1AFO A;  4EIJ A;  1JY3 O;  2FXM A;  4GIF A;  1CI6 A;  4EOT A;  5APW A;  4XA4 A;  1IFM A;  4C46 A;  1SFC C;  1FU1 A;  1J2J B;  1SQV K;  4HYT B;  2IFM A;  4W80 A;  2W27 A;  1KIL A;  2E43 A;  1IFJ A;  1URQ A;  2O01 H;  4IFM A;  4LGD E;  1QL1 A;  1RE4 A;  1NTM K;  5CCG A;  3O8Z A;  1LTG C;  3M9H A;  3TSI A;  5CMZ A;  1URQ D;  2WIT A;  1JTH A;  1G1J A;  3A2A A;  1FZC C;  1GK6 A;  5CCG D;  2FFD A;  1T3U A;  2N1T B;  1SLQ A;  2J58 A;  2C9L Y;  1GZL A;  1JOC A;  1HUC A;  1FZE A;  1CZQ A;  1GK4 A;  5AW2 B;  3GHG B;  5AVW B;  2WT7 A;  4ZKU A;  1LWU C;  2CPS A;  2MJZ A;  5BVZ A;  1IFI A;  3VMX A;  5AVR B;  2E42 A;  4AUW A;  2HPC A;  5BU5 A;  1SP4 A;  2HOD A;  5AW5 B;  2POH A;  3KDP B;  3A5T A;  3OAK A;  1FZG A;  1N73 C;  1JCD A;  3EFG A;  2FYZ A;  4W7Y A;  2I1J A;  3U1A A;  1JY2 O;  4N78 D;  3UIA A;  1S9K D;  2IX7 C;  1DX7 A;  1SFC A;  2WPS A;  2XKM A;  3CLQ A;  4N3Y B;  2Z5H A;  1IK9 A;  2A45 H;  2P67 A;  1NWQ A;  1FDM A;  1LTI C;  2M8R A;  3HUS C;  5KTB A;  2GUV A;  3N4X A;  1HGV A;  1L0L K;  1SFC D;  3MIW A;  2OYH C;  2KP8 A;  5APY A;  2WPR A;  2HYN A;  1MFZ A;  4Y99 B;  5AW8 B;  1FOS E;  1SVF A;  1FZC A;  3P8C D;  2HLO A;  3WMM 0;  1HWT C;  3OJA B;  1RF1 C;  1LT9 C;  1YYC A;  5APQ A;  3TNU B;  1CW5 A;  3V4Q A;  3NXS A;  1KIL C;  3V2P A;  4JYC A;  5CJ0 A;  2N1T A;  4GT1 A;  2GM4 A;  1LWU A;  2XZR A;  1E5W A;  3L4F A;  3RK3 C;  3V5B A;  3BVH A;  2BAS A;  1LTT C;  2FKW B;  3VYI A;  1FZB A;  1SQX K;  3RK2 B;  2Z5I A;  4AYC A;  1HGZ A;  3GHG A;  5APV A;  4C7N B;  3U1C A;  3R2P A;  3V2R A;  3MD0 A;  3H6P A;  1IFN A;  3A3Y B;  1G2C B;  4DOJ A;  2FFD C;  3RK2 C;  4LC1 A;  2XNX A;  3VMY A;  1RE3 A;  1JY2 N;  1GW4 A;  3MUD A;  3BAT A;  1ZLL A;  1JMM A;  1JNM A;  5AVZ B;  3OA7 A;  2XV5 A;  2VRS A;  3M0D C;  2H8P D;  1S9K E;  1VDF A;  1LTS C;  1N7S B;  3T97 A;  4JYB A;  1N7L A;  1H89 A;  2FYU K;  4ZKP A;  4OH8 B;  2C0X A;  3VP8 A;  2QM8 A;  2ZFC A;  5KLV K;  3V4W A;  1ZV8 A;  4C7R A;  1RF1 A;  3V2Q A;  3TYY A;  2A45 I;  1LT9 A;  2KSJ A;  1LTJ B;  1DEB A;  3H32 A;  3M06 A;  2OAR A;  1HTL C;  3HE5 A;  1YTZ T;  5AW7 B;  3P8C E;  1NTK K;  2HFE D;  1HBW A;  3TNU A;  1FZA A;  2Z4E A;  4IFF A;  2PP6 A;  1X8Y A;  4I2L C;  3B8E B;  2P1J A;  1Z56 A;  1KIL D;  5APT A;  1NTZ K;  3VOP A;  3P8M C;  3HD7 B;  3RK3 D;  1T3J A;  3EQ2 A;  4C7N A;  3V2N A;  2Q9I A;  3RL0 B;  5CCH C;  1IFD A;  2I1K A;  1NKZ B;  3B5N B;  5AW0 B;  1N2D C;  5AW1 B;  5BU8 B;  1G2C A;  3C9I A;  2N1T C;  3HRN A;  1RY3 A;  2LKM A;  3RK2 D;  3TK1 A;  3M0D A;  1HJB A;  3GHG C;  1NKN A;  4WY4 B;  1IC2 A;  2IPP A;  1HH0 A;  2KOG A;  3L37 A;  1A02 J;  1HVV A;  1XTC C;  1JCC A;  2C9N Y;  5KJ7 C;  1J1E B;  1FBM A;  4WY4 C;  5AVS B;  4B86 A;  1RE3 C;  1JY3 N;  2YKQ A;  1W2E A;  1J1D B;  4W7Z A;  4HH2 A;  4XE5 B;  1T8Z A;  3KPE A;  1LTJ A;  1GU4 A;  2NPS B;  3LW5 H;  2PAJ A;  3M9Q A;  3LID A;  5AW3 B;  2ZXE B;  2M3B A;  2C0W A;  4I6M C;  2W6B A;  3BAS A;  3I5C A;  2O1K A;  4WB4 A;  5CCH A;  5APS A;  1M7L A;  1GL2 B;  4Y99 C;  1JY2 P;  1LTA C;  3HD7 A;  5AVU B;  5AW9 B;  2WTY A;  3PP5 A;  1A02 F;  1CI6 B;  5AVT B;  3II6 A;  1NH4 A;  5CCH D;  3B5N A;  1FZF A;  3VMZ A;  1SQB K;  1N86 A;  3HD7 D;  3L36 A;  2N1T D;  1GDT A;  5KJ7 A;  4WY4 A;  3HE4 B;  1X9V A;  1NAF A;  1JTH B;  1L4A B;  1NU1 K;  3G3Z A;  1LTB C;  4JF7 A;  1NO4 A;  1PFI A;  5KJ7 D;  2JEE A;  4WY4 D;  4N78 E;  2HG5 D;  4GKG A;  2Q3I A;  2A45 G;  4N6J A;  3N7N A;  5AVY B;  2WT7 B;  2YKP A;  4I1L A;  2CPB A;  2NPS A;  1XTG B;  3CI9 A;  2KLV A;  4RES B;  3LIE A;  1N7S C;  2YNY A;  3VP9 A;  1CSB A;  2HOD B;  3KYQ A;  2YKO A;  1WRG A;  2YMY A;  2R32 A;  2P7J A;  5CJ4 A;  1LTJ C;  1GL2 A;  3M0A A;  2H43 A;  2R3C A;  1YTZ I;  2Q7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...