5APTA

Sequence ienkadkad inserted between gcn4 adaptors - structure a9
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
68
structure length
68
Chain Sequence
HMKQLEDKVEELLSKVYHLENEVARLKKLIENKADKADMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 68
sequence length 68
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aptA00
4KHXA 2WPSA 3TNUB 3HTKA 3P8MC 2Z5IA 5AVSB 2Z5HA 1A02J 5APTA 4I2LC 5AW3B 2W6AA 5AW7B 4RESB 2Q7CA 5AW4B 1GK4A 4C7NA 1GD2E 3L37A 4EOTA 1GU4A 2E43A 3M9HA 1KQLA 5AVUB 4C46A 3MD0A 5APXA 1OXZA 3M9BA 5AW9B 1CZQA 3VMZA 1GTWA 1NWQA 2H7HA 5AVRB 3VMYA 4AQRD 4GT1A 1GU5A 3A3YB 2ZXEB 1HWTC 4AUWA 3IR9A 2WWWA 4B86A 3V5BA 5AVVB 1CI6B 3V4WA 2P67A 1DH3A 2VRSA 1T2KD 3B8EB 1SP4A 4C7NB 2E42A 1FAVA 2WPQA 2R32A 1MUUA 3HE4A 1HJBA 2Q3IA 3I5CA 1A02F 1MV8A 1SLQA 1H89A 3LIDA 1JNMA 3LIEA 1T2KC 3A5TA 5AVXB 1HUCA 3OAKA 1MFZA 1IO4A 3NXSA 3HE5A 2YO2A 2C9NY 1GZLA 3M91A 4JYBA 5AW6B 3TK1A 5APWA 2KP8A 3TNUA 5APSA 2Q5UA 2P2UA 3M0AA 1JUNA 3HE4B 2P7JA 2WT7A 2QM8A 1NAFA 4DZOA 3KDPB 5AW8B 2C9LY 3VMXA 4LC1A 1CSBA 5APQA 1OWAA 5AW2B 3VTPC 5AW0B 1GK6A 5AVYB 3NFQA 1HBWA 3M06A 2QM7A 5AVWB 3A2AA 3A7OA 2XZRA 3HE5B 5APVA 1YYCA 5AVZB 5AW1B 3SWFA 3VYIA 4I6MC 1S9KD 3NMDA 2YNYA 5APYA 3TYYA 3L36A 3O8ZA 2XV5A 3V4QA 3P32A 2BASA 1H8AA 2IPPA 1CI6A 2R5DA 1H88A 2WT7B 4GKGA 3L35A 3UIAA 3MGNA 3P7KA 2YO3A 1J2JB 3T97A 4AYCA 2JJLA 4JYCA 2W27A 1G2CB 2WPRA 2XU6A 5AVTB 1X8YA 2R5BA 5AVQB 4M3LA 3NTNA 4HYTB 3VN0A 5CMZA 2R3CA 1FOSE 3M0DA 3KQGA 2ZFCA 2N9BA 5AW5B 2WTYA 1FOSF 4XE5B 5APUA 1S9KE
chains in the Genus database with same CATH superfamily
2Z5IA 1IK7A 5AW3B 3CMEP 2HFED 5E79E 3LW5H 4OH8B 3M9BA 5TISE 1LTBC 3G3ZA 2OYHB 3LW5J 3L70D 2WWWA 1Z56A 1M1JB 3V4WA 2P67A 3D70A 1IK9A 1LTJB 1JB0J 3PTZA 1HGZA 4D6TD 1Y9BA 2OTKE 1QEXA 4Y99C 1YHQP 1KB9H 2YO2A 2C9NY 2KP8A 3L4FA 3L75G 3PJSK 1LTTC 3QH9A 4CPGA 1NTKJ 2QVAA 3CD6P 2OQQA 4DJGA 2IYPA 2A06D 4PV1C 4H44C 1BSHA 3A2AA 3HE5B 2KLUA 2FYUJ 3CC4P 3L73G 3HUSA 3SWFA 3E7KA 3V4QA 2PFXA 4Z1MH 1L4AC 2HPCB 3H1LD 2QRXA 2BEZF 1EZVD 5KLIB 5CMZA 2R3CA 4WY4C 1HJ0A 1J1EB 3HTKA 4IFFA 1YJNP 1RE3C 4OVNF 4EOTA 4WWIA 3CCUP 1KTMA 1PGJA 1Q7YQ 2XNDH 1JTHB 1IFNA 1SFCB 2G3AA 3CPWO 2H88C 4NPEA 1IFMA 3CX5H 3L72E 4U3FD 1RF1C 1OW6A 2QEXP 1T2KC 1ZP0C 1NKZB 3AEBC 4PD4D 5AW6B 1OVUA 3B71A 5CCGA 4H44D 3AEDC 1OMIA 3Q1MA 3SWYA 3HE4B 2KK7A 2P7JA 5AW8B 1AQ5A 5AW1B 3I55P 1M1JC 5APYA 1LTJC 1VQ7P 2BASA 4WY4D 1NU1D 4TT3H 1SQVK 4AYCA 1KILB 1IFPA 2KLVA 4IL6H 5KLVD 5AVQB 1BCCD 2K1AA 1UIXA 1W5CE 1GL2B 2D2CB 2FXOA 4L74A 3L74D 1SQVG 2HR3A 3C1LA 1SQQE 3OJAB 3ABVC 5AW4B 2L5GB 4C7NA 1L4AA 3Q3DA 1KQLA 1NKNA 2WPVB 3GF7A 2O1JA 3V2QA 3MD0A 2K9JB 2K37A 1SQXK 1SQPE 5B5EE 3AE3C 2JO1A 3VMZA 4UB6E 2H7HA 1JMMA 4WY4A 4AUWA 1GMJA 3U59A 1T2KD 4H0LB 4BRYB 1SQXG 2R32A 3O6QA 1VDFA 3CCMP 3B4SA 3FXEA 5KLIC 3EWKA 1SQBK 1J1EC 4ASVA 4EYYQ 1YBKA 2ZYAA 2OTJP 2WSSH 2OARA 1SQQK 4IL6E 3TGUD 3JCUE 1KYOD 2WT7A 1SQBG 1SQPK 5APQA 4N6JA 1E79H 2O3JA 1SQQG 1RF1A 2XZRA 1DX7A 2P10A 1PGOA 1P84H 5CBNA 2YNYA 1SQPG 1KILE 1SFCC 1EQ7A 4W80A 1NTMJ 1PGQA 1SS1A 3P7KA 3Q5SA 1J2JB 3SFDC 2XU6A 1KN7A 3WU2E 4M3LA 3TF5A 4LLHA 3V6IA 4GOFA 1QL1A 3CWBG 1M1JA 2W6AA 3T97B 1LTJA 1T3JA 1JY2N 3H1HG 1URQD 3RBZA 2JR8A 1NVOA 5BU5A 3C8VA 1W2EA 1KORA 4C46A 1VL2A 3HUSB 2MJZA 4GT1A 4RJTA 3V5BA 3FX0A 1LGHB 4A7PA 2QIWA 2YKPA 1KILC 2AEJA 2WSFH 1Q82Q 4GDOA 1OW7A 1NTME 4PJ0H 3AE4C 1GL2C 1L0NE 3H1JG 2D2CC 2WSFJ 2PGDA 1MFZA 2P58A 3HE5A 5APWA 1ZV8A 2C0XA 1UIIA 3VOPA 2IBZE 4LC1A 2HPCA 1BE3G 1PP9G 1SFCD 3RL0g 4JPZB 5KTBA 1KQFB 1QL2A 3USSA 4NPDA 3W67A 3TYYA 1BDCA 3K5BA 1CI6A 1DD4A 4H0LC 2J58A 2P1JA 2QE7H 1MFTA 1L0NK 3L71G 1FOSE 1NAYA 4IFDK 3V2RA 2K3RA 1JOCA 2RMZA 1BGYG 1JTHA 4W7YA 4L76A 1L0NG 1EZVI 4PJ0E 4I2LC 3E1IA 4ZKPA 4U7JA 3BCCG 4O9BA 2E75B 1HH0A 1ZRTD 3AEFC 5DJUB 2LXCB 5CCHA 3L70E 3BRTB 1VQ4P 5KAIH 1VQPP 1GL2D 1SVFA 2D2CD 4LGDE 3AE2C 3HE4A 3CXHD 2YXQB 1NYHA 1YJ9P 2KB7P 3IF4A 2AEMA 1YJWP 2HYNA 2FYZA 3S9OA 4JBZA 3AE8C 4PD4I 3L71D 2V4HA 2UWJE 2NPSD 1LP1A 4GIFA 1WRGA 2A06E 2I1JA 1KILA 4H0LD 3HUSC 1EDLA 1X9VA 1YYCA 5GTIH 1GL2A 3HD7B 5E79H 3O8ZA 1OVVA 4GKGA 2ZYDA 3OW2O 3L73J 2O1KA 1P84D 3H1LE 2FFDB 3U1CA 3H1KD 5AVTB 3RGUA 1Y47A 2K9JA 1KQGB 4D6TG 1BSNA 3PH0A 4MN4C 4ZMDA 3CCJP 3H1ID 2POHA 1PV3A 4BRYA 1GU4A 5AVUB 2E74B 3II6A 2Y0DA 1JY2O 3L75E 1ZN5A 2A06G 2ZT9D 2ZXXA 4HJGH 1K8AQ 1VQNP 4JQ0D 1VQ9P 1PPJD 5GTIE 1U7MA 1DEEG 3I5CA 3L73E 2OYIA 4XFJA 1EDJA 2DW3A 3H1LG 1IO4A 4K3AA 2B88A 2J5UA 1EZVG 5CCGC 1NJIQ 3B5NB 3V2PA 3M0AA 5B66E 1WMKA 4DZOA 2B87A 2E75C 1ZXGA 1GK6A 2BCCD 3NFQA 1S1CX 1YI2P 1KYOI 3RK2B 3AEAC 5TJHA 1AQTA 2IPPA 2R5DA 2AXCA 2MKVA 3T97A 2JWDA 1NO4A 1KD1Q 1VQMP 2IZ0A 2FYNB 3L74E 4U3FG 1LTSC 4L73A 1GDTA 1YTZI 1NTZD 1S9KE 3P8MC 5AVSB 5APTA 3N7NA 3L72J 1SQVJ 1PGPA 4OGQB 2G8YA 4HB1A 1FDIA 3TDKA 1K04A 3GG2A 3MUDA 5APXA 1JM0A 2OYOA 1N73C 1AA0A 2ZVOB 2ZXEB 3HD7C 1EXJA 1CI6B 2HG5D 1NU1K 4OWFA 3ZDMA 2ZJSE 1ZR4A 3P8CD 3VP9A 1XTCC 1MUUA 2FFDC 5CCGD 2WQYC 1L0LD 1Q86Q 1SQXJ 1NU1G 5AVXB 1LWUB 1FZBA 2KZIA 2WSEH 1PFIA 2E75D 5KLVG 4JYBA 1BCCG 1X79B 1EDKA 2WSEJ 3L74G 1KYOE 2H8PD 3KDPB 5CHXA 3G4SP 1GW4A 1N86A 3AE5C 3CCRP 2KS1B 3WMM0 1SQVE 2QM7A 2E74C 1SQBJ 1RY3A 2N1TA 2GM4A 4I6MC 1SQQJ 2Q1KA 4PV1D 5B5EH 1S72P 3BASA 4UB6H 1SQPJ 1KFNA 3IN6A 3IAOA 4H13B 4C7RA 4HYTB 3M0DA 5KKZB 3AE1C 1L4AD 1SQXE 3GMAA 3B5NC 2WPSA 4UB8H 3F5HA 5AW7B 1G1IA 1LP1B 2YIUB 3HD7D 2E43A 1USEA 3TGUG 1U57A 3MP7B 3OA7A 3JCUH 1DEBA 3RK2C 3PRJA 2AEFA 1HWTC 2IYOA 1SQBE 2WSCH 2CPBA 4N78D 3KZIH 1SLQA 1JNMA 2WSCJ 3LIEA 2FYNC 3Q5PA 3CXHI 1N73A 2WMMA 3H1JJ 3WU2H 3U1AA 3HD7A 1EXIA 2E74D 3CMAP 4OGQC 2HODB 3VTPC 2FFDA 2E5TA 1VQ5P 2N9YB 2NZ2A 1OX3A 2O01N 1NHLA 3GHGB 4UB8E 3CWBE 1BE3J 1PP9J 4YXWH 3H1HE 2KSEA 1KC8Q 1R5SA 2YO3A 1KB9D 1NTKD 2OYIB 1YITP 2E5YA 3NTNA 1FDOA 1LWUC 3FXDA 4KHXA 3KZIE 2FYUD 3AECC 3RK3E 3RK2D 2B87B 1JY3N 1BGYJ 3H1JE 1GK4A 3L72D 1L0NJ 1GD2E 3SFEC 2XNXA 4XA4A 3BCCJ 4KJMA 4IFMA 5CCHC 1GU5A 2K9YA 4N3YB 1BE3E 3B5NA 2OGUA 1PP9E 4Y28J 2JKVA 3BRVB 3CL3D 1MV8A 4H13C 3VP8A 3LIDA 5KKZC 4OGQD 2FXMA 2IDBA 1FBMA 3L71E 2QM8A 3AE6C 2IFMA 2YIUC 1RQUA 5AW2B 1BGYE 2LXBA 4RKUJ 5KAFH 5GTHH 1BDDA 3IFMA 3CX5D 2WITA 3BCCE 4WVZA 1OW8A 1IC2A 1NOHA 3L70J 4GODA 3VN0A 3KQGA 5AW5B 1E5WA 3AEEC 1T3UA 5CCHD 4RESB 3H32B 2Y9YA 4HH2A 4NPFX 5C39A 1OXZA 2GA1A 3GHGC 4W7ZA 2N1TB 1OIPA 1G1JA 1LWUA 4H13D 1N7SA 3G6EP 2E42A 5KAFE 1PPJE 5GTHE 1J1DB 2OYIC 3H6PA 3AE9C 1FZGA 1T8ZA 4TLFA 2FKWB 2KS1A 3PLNA 3H1KG 1KILD 3M91A 3H1LJ 3G71P 1JUNA 3H1IG 2Z4EA 4D6TE 2BCCE 2W8ZA 2W6BA 2YMKA 1JMBA 2BEQD 1HBWA 4RO0A 3WUUA 4BWNA 1KMIZ 1LJ2A 5APVA 1FZFA 5AVZB 4I1LA 4ZKUA 1X22A 4DOJA 1LTAC 3FWLA 1FU1A 1EC5A 2CK3H 4WBAA 3AEGC 2JDIH 4JYCA 3L75J 2A45I 1IFJA 1PPJG 3M9QA 4I7ZB 2XKMA 3CCSP 1N73B 5BU8B 2ZFCA 1FOSF 3MTUE 1A02J 2R44A 1IFIA 4PD4H 4U3FJ 1ZOYC 2J59M 1NTMD 5K5GB 3MUDC 2KOGA 2WVRA 2L91A 5CJ0A 1EZVE 2KIKA 5B66H 2RN0A 3CI9A 3VMYA 1RF0C 4AQRD 2BCCG 1N7LA 5AVVB 1JY3P 4EI2A 1ZR2A 3ITKA 3RBXA 3HRNA 2Q9IA 2IBZD 1LT9B 1AFOA 3Q2YA 3CLQA 2HODA 5EFWB 3WUTA 1NTZK 2KI7B 2H43A 3D6ZA 3GHGA 1RE4C 3EFGA 1GZLA 4ASWA 1NU1J 3TNUA 2Q5UA 2P2UA 1FJKA 1Q2NA 1NTZG 5L8RJ 2Y0EA 3A0BE 2PAJA 4U3FE 3L74J 3A7OA 3CCQP 2RH0A 1RH5B 2N1TC 1KZUB 1JCDA 3KHUA 4PD4E 1HVVA 3P32A 1QVGO 4JF7A 1L0LK 1IZNB 3S1KA 1J1DC 3TSIA 2KYVA 1G2CB 1VQ8P 1N2DC 2R5BA 3M0DC 2OTLP 4L75A 2GUVA 2Y9ZA 1KB9I 1L0LG 2QG4A 1Q81Q 1VPCA 2IFNA 1N8RQ 3RL0B 1NU1E 1YQ4C 3WUVA 1K9MQ 3M9HA 5KLVE 2YMYA 1BCCE 1NWQA 1GTWA 1KYOH 2KZJA 1S2EA 4IOIH 3A3YB 3TGUJ 3D71A 2VRSA 3V2NA 1YIJP 4QMAA 3B8EB 4YPCA 1FAVA 4N78E 3W68A 2E76B 2M5AB 3R4YA 1A02F 1Y8AA 2A45G 2FXPA 1H89A 2KNCB 3CCLP 2NRGA 4I7ZC 1AVYA 2YKQA 1HGVA 3EFFK 1URQB 1WT6A 1RF0A 2CPSA 3TK1A 3F89A 2N1TD 3CC2P 3R2PA 5KLVK 1OWAA 1OZHA 2ITAA 2YXRB 1N7SB 1VF5B 1RE4A 1JO5A 3TGUE 1KB9E 3CX5I 1NTKE 1LT9C 3H32A 1DD3A 3I56P 3L75D 1RHZB 2FYUE 3GLMA 2PRRA 1QLED 4WB4A 1JEKA 1VQOP 1LNQA 2I8DA 3D6YA 3L73D 2ZVNB 1LTIC 2B89A 2HLOA 4B86A 2QJPB 2I1KA 4DT0A 1NTKK 1FZCB 2ZAEB 1HJBA 3E1RA 2Q3IA 5H2FH 3FWNA 3CWBJ 3RK3B 2OYHC 1NTKG 3H1HJ 2FYUK 4KT0J 4ZNCA 1EDIA 3RL0C 5DJTB 1XTGB 3VMXA 2FYUG 4GOEA 5AW0B 3G9RA 3L72G 4R4LA 3CX5E 1M56D 1S9KD 2QJYB 2WZ7A 2FY8A 1H8AA 1T6AA 2O01H 3L35A 1RQVA 3SSUA 2E76C 2O01J 4YXDC 3FGAD 3CCVP 1FDMA 4K35A 1URQC 2N9BA 2NPSB 3CXHH 4XE5B 3TNUB 2M3BA 5H2FE 1H0TA 1RE3A 1KQSO 3GF3A 5CBOA 3B5ND 1LT9A 1S4XA 5AW9B 1YTZT 1X0TA 5AVRB 4YTPC 1P84I 1FZEA 5M1BA 2Q3EA 1N7SC 1VF5C 2IX7C 1IFDA 3L71J 1M8OB 1S5LH 1M1KQ 2WPQA 1QX8A 1SQVD 3A5TA 1ZRTE 1HUCA 3OAKA 3QWOC 3RL0D 2M3EA 4DCKA 1NGMB 1K05A 2IBZI 2QA4P 1JCCA 1ZLLA 1USDA 2W6JH 3H1KJ 1NAFA 2C9LY 3MZWB 3PHLA 2ZT9B 3CXHE 3M06A 1G2CA 5AVWB 1PZQA 3H1IJ 1MZ9A 1SQXD 2E76D 2OYHA 2Q6QA 2KXPB 2XV5A 2QJPC 1Q90D 1AJYA 1FZCC 1QGKB 5KJ7C 1W2BO 1L2PA 2C0WA 2H89C 3RK3C 4EIJA 2V7QH 1S5LE 2IZ1A 2WTYA 2QJKB 5APUA 2JEEA 1SQBD 2V7QJ 1R8EA 1DIPA 4IL6X 1SQQD 2Q7CA 1U7JA 1IJDB 1P84E 3L37A 1N7SD 1ZW0A 1VF5D 3PP5A 1VQKP 5CJ4A 2M5AA 3H1KE 2M8RA 1SQPD 2M0BA 1CZQA 2KNCA 3KYQA 3HTKB 1TU3F 3MHVA 1URQA 2QJYC 2KUBA 3H1IE 1DH3A 2YKOA 2AXTH 2Y0CA 4D6TJ 1FE6A 2BCCJ 1FZAA 2R3SA 1MKMA 2FBWC 2LR2A 3CWBD 2GUSA 2NPSC 3NXSA 1FC2C 1GW3A 3H1HD 1M57D 5APSA 1D7MA 1NTMK 2B9BA 3JC22 1CSBA 4EDFA 3EQ2A 1KFMA 1NTZJ 1NTMG 1HF9A 5KJ7D 3JSVC 1S5LX 1H88A 1SFCA 3RK3D 3MGNA 3H1JD 3A0HH 3S4RA 2JJLA 2WPRA 3KXDA 3AE7C 4Y99B 2IBZG 2AXTE 1ZMEC 2Z5HA 2QSIA 1BE3D 1PP9D 1L0LJ 3N4XA 1CW5A 1OVRA 1FS0E 1R5LA 2ZT9C 3VMAA 1FZCA 1M90Q 5KJ7A 4PV1B 4H44B 2JWAA 4R4MA 3GW6A 3SWKA 2W90A 3IR9A 3A0BH 1NTZE 1LTGC 1OFCX 1SP4A 4C7NB 3CC7P 1L4AB 4HKZH 1LT1A 1NH4A 3MIWA 2SPZA 1BGYD 2A45H 1L0ND 4WY4B 2W83C 2XDJA 3BATA 1JY3O 2QJKC 3C9IA 1FJPA 1AV1A 3A0HE 3BCCD 1H0TB 5TISH 2ZYGA 3O6QB 3L70G 1PIXA 3BVHA 2LKMA 3KPEA 3P8CE 3Q5RA 5KAIE 5AVYB 1L0LE 2PP6A 1VQ6P 2JP3A 5BVZA 1HTLC 3VYIA 3NMDA 1S3JA 3CCEP 2NPSA 3L36A 1KV4A 2WT7B 3UIAA 4BXLA 3H25A 1AVOA 5KLVJ 1QVFO 1BCCJ 2W27A 2RKLA 2KSJA 1RF1B 1X8YA 2K88A 1YQ3C 1K73Q 1M7LA 1PL5A 1VQLP 1JY2P
chains in the Genus database with same CATH topology
4KHXA 1JTHA 4W7YA 2Z5IA 4I2LC 5AW3B 3E1IA 4WB4A 4ZKPA 3RK2D 1JY3N 1GK4A 4O9BA 1GD2E 1LTIC 2HFED 1HH0A 2XNXA 3LW5H 4OH8B 4XA4A 3M9BA 1LTBC 4IFMA 5CCHC 3G3ZA 2OYHB 5CCHA 3BRTB 1GU5A 2HLOA 2WWWA 1Z56A 4B86A 1M1JB 3V4WA 4N3YB 2P67A 1IK9A 1LTJB 2I1KA 3B5NA 1GL2D 1NTKK 1SVFA 4LGDE 3BRVB 1FZCB 3HE4A 1HJBA 1HGZA 2Q3IA 3CL3D 1MV8A 3VP8A 3LIDA 3RK3B 4Y99C 2OYHC 2FYUK 2KB7P 2YO2A 2C9NY 2HYNA 2FYZA 2FXMA 2KP8A 3L4FA 1LTTC 3RL0C 1FBMA 1XTGB 2QM8A 2IFMA 3VMXA 2NPSD 4GIFA 1WRGA 5AW2B 5AW0B 2I1JA 1KILA 3A2AA 3HUSC 3HE5B 1X9VA 1YYCA 1GL2A 3HUSA 3SWFA 3IFMA 1S9KD 2WITA 3HD7B 3V4QA 3O8ZA 2WZ7A 1H8AA 2O01H 4GKGA 3L35A 1L4AC 2HPCB 2O1KA 1IC2A 2FFDB 1NOHA 3U1CA 5AVTB 3VN0A 5CMZA 2R3CA 4WY4C 1FDMA 3KQGA 1J1EB 1URQC 2N9BA 2NPSB 5AW5B 4XE5B 3TNUB 2M3BA 3HTKA 4IFFA 1E5WA 1RE3C 1T3UA 5CCHD 2POHA 1RE3A 4RESB 3H32B 4HH2A 4EOTA 1GU4A 5AVUB 3B5ND 1LT9A 1OXZA 3GHGC 3II6A 5AW9B 4W7ZA 2N1TB 1YTZT 1JY2O 5AVRB 1ZN5A 1JTHB 1G1JA 1FZEA 1IFNA 1N7SC 2IX7C 1LWUA 1IFDA 1SFCB 1N7SA 2E42A 2WPQA 1J1DB 1IFMA 2OYIC 3H6PA 3I5CA 1FZGA 2OYIA 1RF1C 1T8ZA 1T2KC 3A5TA 1NKZB 2FKWB 1HUCA 3OAKA 3RL0D 1IO4A 5CCGC 1KILD 3M91A 5AW6B 3B5NB 3V2PA 5CCGA 1JCCA 3M0AA 3SWYA 1JUNA 3HE4B 1ZLLA 2P7JA 1NAFA 4DZOA 2C9LY 5AW8B 2Z4EA 1GK6A 2W6BA 3NFQA 1HBWA 3M06A 1G2CA 5AVWB 1AQ5A 5APVA 3RK2B 1FZFA 5AVZB 1MZ9A 5AW1B 2OYHA 1M1JC 4I1LA 5APYA 4ZKUA 2XV5A 1LTJC 4DOJA 1LTAC 2BASA 2IPPA 2R5DA 1FU1A 4WY4D 1FZCC 4WBAA 5KJ7C 1SQVK 3T97A 4AYCA 1KILB 4JYCA 1NO4A 2KLVA 2C0WA 5AVQB 2A45I 1IFJA 3RK3C 1GL2B 3M9QA 4EIJA 2XKMA 1N73B 5BU8B 2ZFCA 1FOSF 2WTYA 1LTSC 1GDTA 1YTZI 5APUA 1S9KE 3MTUE 2JEEA 3P8MC 5AVSB 1A02J 5APTA 3N7NA 1IFIA 2Q7CA 3OJAB 5AW4B 2L5GB 2J59M 4C7NA 1IJDB 1L4AA 3L37A 1N7SD 2KOGA 1KQLA 1NKNA 3PP5A 2O1JA 5CJ4A 3V2QA 3MD0A 5CJ0A 3MUDA 1SQXK 2M8RA 5APXA 1CZQA 3VMZA 1N73C 3CI9A 2H7HA 3KYQA 1RF0C 3VMYA 4AQRD 1JMMA 3HTKB 4WY4A 2ZXEB 4AUWA 3HD7C 1N7LA 1URQA 5AVVB 1CI6B 1JY3P 2HG5D 1NU1K 3U59A 1DH3A 2YKOA 1T2KD 1ZR2A 1ZR4A 3P8CD 3HRNA 3VP9A 1XTCC 1MUUA 1VDFA 2R32A 2Q9IA 1FZAA 2FFDC 1LT9B 5CCGD 1AFOA 3CLQA 2HODA 5AVXB 1NTZK 1SQBK 2GUSA 1J1EC 1LWUB 2H43A 3GHGA 2NPSC 1FZBA 1RE4C 3NXSA 2WSEH 3EFGA 1PFIA 1GW3A 1GZLA 4JYBA 2OARA 1SQQK 1X79B 3TNUA 5APSA 2Q5UA 2P2UA 1FJKA 1NTMK 2WT7A 2H8PD 3KDPB 1CSBA 1SQPK 5APQA 4N6JA 5CHXA 1GW4A 1N86A 2PAJA 3WMM0 2QM7A 3EQ2A 3A7OA 1KFMA 1RF1A 2XZRA 2N1TC 1DX7A 1KZUB 1RY3A 1JCDA 5KJ7D 2N1TA 2GM4A 4I6MC 2YNYA 1SFCC 1HVVA 1EQ7A 3P32A 1H88A 4W80A 1SFCA 3BASA 3RK3D 3MGNA 4JF7A 1L0LK 1J1DC 3P7KA 1J2JB 3TSIA 2JJLA 1KFNA 2KYVA 1G2CB 2WPRA 2XU6A 1N2DC 2R5BA 3M0DC 4M3LA 4C7RA 4Y99B 4HYTB 3M0DA 2GUVA 1L4AD 4LLHA 3B5NC 2WPSA 1VPCA 1QL1A 2Z5HA 2IFNA 1M1JA 2W6AA 3RL0B 5AW7B 1LTJA 1T3JA 3N4XA 1CW5A 1JY2N 1G1IA 1URQD 1FZCA 3HD7D 3M9HA 2E43A 5BU5A 5KJ7A 1W2EA 4C46A 2YMYA 3OA7A 3HUSB 1NWQA 1GTWA 1DEBA 3RK2C 2MJZA 4GT1A 3A3YB 1HWTC 3IR9A 3V5BA 1LTGC 2VRSA 1LGHB 3V2NA 3B8EB 1SP4A 4C7NB 1FAVA 1L4AB 2WSCH 2CPBA 4N78D 2YKPA 4N78E 1KILC 1NH4A 2WSFH 3MIWA 1A02F 2A45G 1SLQA 1H89A 1JNMA 2A45H 3LIEA 1GL2C 4WY4B 2YKQA 1HGVA 2XDJA 1MFZA 1URQB 3BATA 1JY3O 3C9IA 3HE5A 1WT6A 1FJPA 1N73A 1RF0A 2CPSA 3TK1A 5APWA 3U1AA 1ZV8A 3HD7A 3BVHA 2C0XA 2LKMA 3KPEA 2N1TD 3P8CE 3VOPA 3R2PA 4LC1A 5KLVK 1OWAA 2HPCA 2HODB 3VTPC 5AVYB 1SFCD 2FFDA 2PP6A 5KTBA 1NHLA 3GHGB 1QL2A 5BVZA 1HTLC 3VYIA 3NMDA 1N7SB 2NPSA 1RE4A 3L36A 3TYYA 1CI6A 2WT7B 1JO5A 3UIAA 2J58A 2YO3A 1LT9C 2P1JA 2OYIB 1L0NK 2W27A 3H32A 2KSJA 1RF1B 1X8YA 3NTNA 1FOSE 1M7LA 1LWUC 4IFDK 3V2RA 1JOCA 1JY2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHX A;  2WPS A;  3TNU B;  3HTK A;  3P8M C;  2Z5I A;  5AVS B;  2Z5H A;  1A02 J;  5APT A;  4I2L C;  5AW3 B;  2W6A A;  5AW7 B;  4RES B;  2Q7C A;  5AW4 B;  1GK4 A;  4C7N A;  1GD2 E;  3L37 A;  4EOT A;  1GU4 A;  2E43 A;  3M9H A;  1KQL A;  5AVU B;  4C46 A;  3MD0 A;  5APX A;  1OXZ A;  3M9B A;  5AW9 B;  1CZQ A;  3VMZ A;  1GTW A;  1NWQ A;  2H7H A;  5AVR B;  3VMY A;  4AQR D;  4GT1 A;  1GU5 A;  3A3Y B;  2ZXE B;  1HWT C;  4AUW A;  3IR9 A;  2WWW A;  4B86 A;  3V5B A;  5AVV B;  1CI6 B;  3V4W A;  2P67 A;  1DH3 A;  2VRS A;  1T2K D;  3B8E B;  1SP4 A;  4C7N B;  2E42 A;  1FAV A;  2WPQ A;  2R32 A;  1MUU A;  3HE4 A;  1HJB A;  2Q3I A;  3I5C A;  1A02 F;  1MV8 A;  1SLQ A;  1H89 A;  3LID A;  1JNM A;  3LIE A;  1T2K C;  3A5T A;  5AVX B;  1HUC A;  3OAK A;  1MFZ A;  1IO4 A;  3NXS A;  3HE5 A;  2YO2 A;  2C9N Y;  1GZL A;  3M91 A;  4JYB A;  5AW6 B;  3TK1 A;  5APW A;  2KP8 A;  3TNU A;  5APS A;  2Q5U A;  2P2U A;  3M0A A;  1JUN A;  3HE4 B;  2P7J A;  2WT7 A;  2QM8 A;  1NAF A;  4DZO A;  3KDP B;  5AW8 B;  2C9L Y;  3VMX A;  4LC1 A;  1CSB A;  5APQ A;  1OWA A;  5AW2 B;  3VTP C;  5AW0 B;  1GK6 A;  5AVY B;  3NFQ A;  1HBW A;  3M06 A;  2QM7 A;  5AVW B;  3A2A A;  3A7O A;  2XZR A;  3HE5 B;  5APV A;  1YYC A;  5AVZ B;  5AW1 B;  3SWF A;  3VYI A;  4I6M C;  1S9K D;  3NMD A;  2YNY A;  5APY A;  3TYY A;  3L36 A;  3O8Z A;  2XV5 A;  3V4Q A;  3P32 A;  2BAS A;  1H8A A;  2IPP A;  1CI6 A;  2R5D A;  1H88 A;  2WT7 B;  4GKG A;  3L35 A;  3UIA A;  3MGN A;  3P7K A;  2YO3 A;  1J2J B;  3T97 A;  4AYC A;  2JJL A;  4JYC A;  2W27 A;  1G2C B;  2WPR A;  2XU6 A;  5AVT B;  1X8Y A;  2R5B A;  5AVQ B;  4M3L A;  3NTN A;  4HYT B;  3VN0 A;  5CMZ A;  2R3C A;  1FOS E;  3M0D A;  3KQG A;  2ZFC A;  2N9B A;  5AW5 B;  2WTY A;  1FOS F;  4XE5 B;  5APU A;  1S9K E; 
#chains in the Genus database with same CATH topology
 2Z5I A;  1IK7 A;  5AW3 B;  3CME P;  2HFE D;  5E79 E;  3LW5 H;  4OH8 B;  3M9B A;  5TIS E;  1LTB C;  3G3Z A;  2OYH B;  3LW5 J;  3L70 D;  2WWW A;  1Z56 A;  1M1J B;  3V4W A;  2P67 A;  3D70 A;  1IK9 A;  1LTJ B;  1JB0 J;  3PTZ A;  1HGZ A;  4D6T D;  1Y9B A;  2OTK E;  1QEX A;  4Y99 C;  1YHQ P;  1KB9 H;  2YO2 A;  2C9N Y;  2KP8 A;  3L4F A;  3L75 G;  3PJS K;  1LTT C;  3QH9 A;  4CPG A;  1NTK J;  2QVA A;  3CD6 P;  2OQQ A;  4DJG A;  2IYP A;  2A06 D;  4PV1 C;  4H44 C;  1BSH A;  3A2A A;  3HE5 B;  2KLU A;  2FYU J;  3CC4 P;  3L73 G;  3HUS A;  3SWF A;  3E7K A;  3V4Q A;  2PFX A;  4Z1M H;  1L4A C;  2HPC B;  3H1L D;  2QRX A;  2BEZ F;  1EZV D;  5KLI B;  5CMZ A;  2R3C A;  4WY4 C;  1HJ0 A;  1J1E B;  3HTK A;  4IFF A;  1YJN P;  1RE3 C;  4OVN F;  4EOT A;  4WWI A;  3CCU P;  1KTM A;  1PGJ A;  1Q7Y Q;  2XND H;  1JTH B;  1IFN A;  1SFC B;  2G3A A;  3CPW O;  2H88 C;  4NPE A;  1IFM A;  3CX5 H;  3L72 E;  4U3F D;  1RF1 C;  1OW6 A;  2QEX P;  1T2K C;  1ZP0 C;  1NKZ B;  3AEB C;  4PD4 D;  5AW6 B;  1OVU A;  3B71 A;  5CCG A;  4H44 D;  3AED C;  1OMI A;  3Q1M A;  3SWY A;  3HE4 B;  2KK7 A;  2P7J A;  5AW8 B;  1AQ5 A;  5AW1 B;  3I55 P;  1M1J C;  5APY A;  1LTJ C;  1VQ7 P;  2BAS A;  4WY4 D;  1NU1 D;  4TT3 H;  1SQV K;  4AYC A;  1KIL B;  1IFP A;  2KLV A;  4IL6 H;  5KLV D;  5AVQ B;  1BCC D;  2K1A A;  1UIX A;  1W5C E;  1GL2 B;  2D2C B;  2FXO A;  4L74 A;  3L74 D;  1SQV G;  2HR3 A;  3C1L A;  1SQQ E;  3OJA B;  3ABV C;  5AW4 B;  2L5G B;  4C7N A;  1L4A A;  3Q3D A;  1KQL A;  1NKN A;  2WPV B;  3GF7 A;  2O1J A;  3V2Q A;  3MD0 A;  2K9J B;  2K37 A;  1SQX K;  1SQP E;  5B5E E;  3AE3 C;  2JO1 A;  3VMZ A;  4UB6 E;  2H7H A;  1JMM A;  4WY4 A;  4AUW A;  1GMJ A;  3U59 A;  1T2K D;  4H0L B;  4BRY B;  1SQX G;  2R32 A;  3O6Q A;  1VDF A;  3CCM P;  3B4S A;  3FXE A;  5KLI C;  3EWK A;  1SQB K;  1J1E C;  4ASV A;  4EYY Q;  1YBK A;  2ZYA A;  2OTJ P;  2WSS H;  2OAR A;  1SQQ K;  4IL6 E;  3TGU D;  3JCU E;  1KYO D;  2WT7 A;  1SQB G;  1SQP K;  5APQ A;  4N6J A;  1E79 H;  2O3J A;  1SQQ G;  1RF1 A;  2XZR A;  1DX7 A;  2P10 A;  1PGO A;  1P84 H;  5CBN A;  2YNY A;  1SQP G;  1KIL E;  1SFC C;  1EQ7 A;  4W80 A;  1NTM J;  1PGQ A;  1SS1 A;  3P7K A;  3Q5S A;  1J2J B;  3SFD C;  2XU6 A;  1KN7 A;  3WU2 E;  4M3L A;  3TF5 A;  4LLH A;  3V6I A;  4GOF A;  1QL1 A;  3CWB G;  1M1J A;  2W6A A;  3T97 B;  1LTJ A;  1T3J A;  1JY2 N;  3H1H G;  1URQ D;  3RBZ A;  2JR8 A;  1NVO A;  5BU5 A;  3C8V A;  1W2E A;  1KOR A;  4C46 A;  1VL2 A;  3HUS B;  2MJZ A;  4GT1 A;  4RJT A;  3V5B A;  3FX0 A;  1LGH B;  4A7P A;  2QIW A;  2YKP A;  1KIL C;  2AEJ A;  2WSF H;  1Q82 Q;  4GDO A;  1OW7 A;  1NTM E;  4PJ0 H;  3AE4 C;  1GL2 C;  1L0N E;  3H1J G;  2D2C C;  2WSF J;  2PGD A;  1MFZ A;  2P58 A;  3HE5 A;  5APW A;  1ZV8 A;  2C0X A;  1UII A;  3VOP A;  2IBZ E;  4LC1 A;  2HPC A;  1BE3 G;  1PP9 G;  1SFC D;  3RL0 g;  4JPZ B;  5KTB A;  1KQF B;  1QL2 A;  3USS A;  4NPD A;  3W67 A;  3TYY A;  1BDC A;  3K5B A;  1CI6 A;  1DD4 A;  4H0L C;  2J58 A;  2P1J A;  2QE7 H;  1MFT A;  1L0N K;  3L71 G;  1FOS E;  1NAY A;  4IFD K;  3V2R A;  2K3R A;  1JOC A;  2RMZ A;  1BGY G;  1JTH A;  4W7Y A;  4L76 A;  1L0N G;  1EZV I;  4PJ0 E;  4I2L C;  3E1I A;  4ZKP A;  4U7J A;  3BCC G;  4O9B A;  2E75 B;  1HH0 A;  1ZRT D;  3AEF C;  5DJU B;  2LXC B;  5CCH A;  3L70 E;  3BRT B;  1VQ4 P;  5KAI H;  1VQP P;  1GL2 D;  1SVF A;  2D2C D;  4LGD E;  3AE2 C;  3HE4 A;  3CXH D;  2YXQ B;  1NYH A;  1YJ9 P;  2KB7 P;  3IF4 A;  2AEM A;  1YJW P;  2HYN A;  2FYZ A;  3S9O A;  4JBZ A;  3AE8 C;  4PD4 I;  3L71 D;  2V4H A;  2UWJ E;  2NPS D;  1LP1 A;  4GIF A;  1WRG A;  2A06 E;  2I1J A;  1KIL A;  4H0L D;  3HUS C;  1EDL A;  1X9V A;  1YYC A;  5GTI H;  1GL2 A;  3HD7 B;  5E79 H;  3O8Z A;  1OVV A;  4GKG A;  2ZYD A;  3OW2 O;  3L73 J;  2O1K A;  1P84 D;  3H1L E;  2FFD B;  3U1C A;  3H1K D;  5AVT B;  3RGU A;  1Y47 A;  2K9J A;  1KQG B;  4D6T G;  1BSN A;  3PH0 A;  4MN4 C;  4ZMD A;  3CCJ P;  3H1I D;  2POH A;  1PV3 A;  4BRY A;  1GU4 A;  5AVU B;  2E74 B;  3II6 A;  2Y0D A;  1JY2 O;  3L75 E;  1ZN5 A;  2A06 G;  2ZT9 D;  2ZXX A;  4HJG H;  1K8A Q;  1VQN P;  4JQ0 D;  1VQ9 P;  1PPJ D;  5GTI E;  1U7M A;  1DEE G;  3I5C A;  3L73 E;  2OYI A;  4XFJ A;  1EDJ A;  2DW3 A;  3H1L G;  1IO4 A;  4K3A A;  2B88 A;  2J5U A;  1EZV G;  5CCG C;  1NJI Q;  3B5N B;  3V2P A;  3M0A A;  5B66 E;  1WMK A;  4DZO A;  2B87 A;  2E75 C;  1ZXG A;  1GK6 A;  2BCC D;  3NFQ A;  1S1C X;  1YI2 P;  1KYO I;  3RK2 B;  3AEA C;  5TJH A;  1AQT A;  2IPP A;  2R5D A;  2AXC A;  2MKV A;  3T97 A;  2JWD A;  1NO4 A;  1KD1 Q;  1VQM P;  2IZ0 A;  2FYN B;  3L74 E;  4U3F G;  1LTS C;  4L73 A;  1GDT A;  1YTZ I;  1NTZ D;  1S9K E;  3P8M C;  5AVS B;  5APT A;  3N7N A;  3L72 J;  1SQV J;  1PGP A;  4OGQ B;  2G8Y A;  4HB1 A;  1FDI A;  3TDK A;  1K04 A;  3GG2 A;  3MUD A;  5APX A;  1JM0 A;  2OYO A;  1N73 C;  1AA0 A;  2ZVO B;  2ZXE B;  3HD7 C;  1EXJ A;  1CI6 B;  2HG5 D;  1NU1 K;  4OWF A;  3ZDM A;  2ZJS E;  1ZR4 A;  3P8C D;  3VP9 A;  1XTC C;  1MUU A;  2FFD C;  5CCG D;  2WQY C;  1L0L D;  1Q86 Q;  1SQX J;  1NU1 G;  5AVX B;  1LWU B;  1FZB A;  2KZI A;  2WSE H;  1PFI A;  2E75 D;  5KLV G;  4JYB A;  1BCC G;  1X79 B;  1EDK A;  2WSE J;  3L74 G;  1KYO E;  2H8P D;  3KDP B;  5CHX A;  3G4S P;  1GW4 A;  1N86 A;  3AE5 C;  3CCR P;  2KS1 B;  3WMM 0;  1SQV E;  2QM7 A;  2E74 C;  1SQB J;  1RY3 A;  2N1T A;  2GM4 A;  4I6M C;  1SQQ J;  2Q1K A;  4PV1 D;  5B5E H;  1S72 P;  3BAS A;  4UB6 H;  1SQP J;  1KFN A;  3IN6 A;  3IAO A;  4H13 B;  4C7R A;  4HYT B;  3M0D A;  5KKZ B;  3AE1 C;  1L4A D;  1SQX E;  3GMA A;  3B5N C;  2WPS A;  4UB8 H;  3F5H A;  5AW7 B;  1G1I A;  1LP1 B;  2YIU B;  3HD7 D;  2E43 A;  1USE A;  3TGU G;  1U57 A;  3MP7 B;  3OA7 A;  3JCU H;  1DEB A;  3RK2 C;  3PRJ A;  2AEF A;  1HWT C;  2IYO A;  1SQB E;  2WSC H;  2CPB A;  4N78 D;  3KZI H;  1SLQ A;  1JNM A;  2WSC J;  3LIE A;  2FYN C;  3Q5P A;  3CXH I;  1N73 A;  2WMM A;  3H1J J;  3WU2 H;  3U1A A;  3HD7 A;  1EXI A;  2E74 D;  3CMA P;  4OGQ C;  2HOD B;  3VTP C;  2FFD A;  2E5T A;  1VQ5 P;  2N9Y B;  2NZ2 A;  1OX3 A;  2O01 N;  1NHL A;  3GHG B;  4UB8 E;  3CWB E;  1BE3 J;  1PP9 J;  4YXW H;  3H1H E;  2KSE A;  1KC8 Q;  1R5S A;  2YO3 A;  1KB9 D;  1NTK D;  2OYI B;  1YIT P;  2E5Y A;  3NTN A;  1FDO A;  1LWU C;  3FXD A;  4KHX A;  3KZI E;  2FYU D;  3AEC C;  3RK3 E;  3RK2 D;  2B87 B;  1JY3 N;  1BGY J;  3H1J E;  1GK4 A;  3L72 D;  1L0N J;  1GD2 E;  3SFE C;  2XNX A;  4XA4 A;  3BCC J;  4KJM A;  4IFM A;  5CCH C;  1GU5 A;  2K9Y A;  4N3Y B;  1BE3 E;  3B5N A;  2OGU A;  1PP9 E;  4Y28 J;  2JKV A;  3BRV B;  3CL3 D;  1MV8 A;  4H13 C;  3VP8 A;  3LID A;  5KKZ C;  4OGQ D;  2FXM A;  2IDB A;  1FBM A;  3L71 E;  2QM8 A;  3AE6 C;  2IFM A;  2YIU C;  1RQU A;  5AW2 B;  1BGY E;  2LXB A;  4RKU J;  5KAF H;  5GTH H;  1BDD A;  3IFM A;  3CX5 D;  2WIT A;  3BCC E;  4WVZ A;  1OW8 A;  1IC2 A;  1NOH A;  3L70 J;  4GOD A;  3VN0 A;  3KQG A;  5AW5 B;  1E5W A;  3AEE C;  1T3U A;  5CCH D;  4RES B;  3H32 B;  2Y9Y A;  4HH2 A;  4NPF X;  5C39 A;  1OXZ A;  2GA1 A;  3GHG C;  4W7Z A;  2N1T B;  1OIP A;  1G1J A;  1LWU A;  4H13 D;  1N7S A;  3G6E P;  2E42 A;  5KAF E;  1PPJ E;  5GTH E;  1J1D B;  2OYI C;  3H6P A;  3AE9 C;  1FZG A;  1T8Z A;  4TLF A;  2FKW B;  2KS1 A;  3PLN A;  3H1K G;  1KIL D;  3M91 A;  3H1L J;  3G71 P;  1JUN A;  3H1I G;  2Z4E A;  4D6T E;  2BCC E;  2W8Z A;  2W6B A;  2YMK A;  1JMB A;  2BEQ D;  1HBW A;  4RO0 A;  3WUU A;  4BWN A;  1KMI Z;  1LJ2 A;  5APV A;  1FZF A;  5AVZ B;  4I1L A;  4ZKU A;  1X22 A;  4DOJ A;  1LTA C;  3FWL A;  1FU1 A;  1EC5 A;  2CK3 H;  4WBA A;  3AEG C;  2JDI H;  4JYC A;  3L75 J;  2A45 I;  1IFJ A;  1PPJ G;  3M9Q A;  4I7Z B;  2XKM A;  3CCS P;  1N73 B;  5BU8 B;  2ZFC A;  1FOS F;  3MTU E;  1A02 J;  2R44 A;  1IFI A;  4PD4 H;  4U3F J;  1ZOY C;  2J59 M;  1NTM D;  5K5G B;  3MUD C;  2KOG A;  2WVR A;  2L91 A;  5CJ0 A;  1EZV E;  2KIK A;  5B66 H;  2RN0 A;  3CI9 A;  3VMY A;  1RF0 C;  4AQR D;  2BCC G;  1N7L A;  5AVV B;  1JY3 P;  4EI2 A;  1ZR2 A;  3ITK A;  3RBX A;  3HRN A;  2Q9I A;  2IBZ D;  1LT9 B;  1AFO A;  3Q2Y A;  3CLQ A;  2HOD A;  5EFW B;  3WUT A;  1NTZ K;  2KI7 B;  2H43 A;  3D6Z A;  3GHG A;  1RE4 C;  3EFG A;  1GZL A;  4ASW A;  1NU1 J;  3TNU A;  2Q5U A;  2P2U A;  1FJK A;  1Q2N A;  1NTZ G;  5L8R J;  2Y0E A;  3A0B E;  2PAJ A;  4U3F E;  3L74 J;  3A7O A;  3CCQ P;  2RH0 A;  1RH5 B;  2N1T C;  1KZU B;  1JCD A;  3KHU A;  4PD4 E;  1HVV A;  3P32 A;  1QVG O;  4JF7 A;  1L0L K;  1IZN B;  3S1K A;  1J1D C;  3TSI A;  2KYV A;  1G2C B;  1VQ8 P;  1N2D C;  2R5B A;  3M0D C;  2OTL P;  4L75 A;  2GUV A;  2Y9Z A;  1KB9 I;  1L0L G;  2QG4 A;  1Q81 Q;  1VPC A;  2IFN A;  1N8R Q;  3RL0 B;  1NU1 E;  1YQ4 C;  3WUV A;  1K9M Q;  3M9H A;  5KLV E;  2YMY A;  1BCC E;  1NWQ A;  1GTW A;  1KYO H;  2KZJ A;  1S2E A;  4IOI H;  3A3Y B;  3TGU J;  3D71 A;  2VRS A;  3V2N A;  1YIJ P;  4QMA A;  3B8E B;  4YPC A;  1FAV A;  4N78 E;  3W68 A;  2E76 B;  2M5A B;  3R4Y A;  1A02 F;  1Y8A A;  2A45 G;  2FXP A;  1H89 A;  2KNC B;  3CCL P;  2NRG A;  4I7Z C;  1AVY A;  2YKQ A;  1HGV A;  3EFF K;  1URQ B;  1WT6 A;  1RF0 A;  2CPS A;  3TK1 A;  3F89 A;  2N1T D;  3CC2 P;  3R2P A;  5KLV K;  1OWA A;  1OZH A;  2ITA A;  2YXR B;  1N7S B;  1VF5 B;  1RE4 A;  1JO5 A;  3TGU E;  1KB9 E;  3CX5 I;  1NTK E;  1LT9 C;  3H32 A;  1DD3 A;  3I56 P;  3L75 D;  1RHZ B;  2FYU E;  3GLM A;  2PRR A;  1QLE D;  4WB4 A;  1JEK A;  1VQO P;  1LNQ A;  2I8D A;  3D6Y A;  3L73 D;  2ZVN B;  1LTI C;  2B89 A;  2HLO A;  4B86 A;  2QJP B;  2I1K A;  4DT0 A;  1NTK K;  1FZC B;  2ZAE B;  1HJB A;  3E1R A;  2Q3I A;  5H2F H;  3FWN A;  3CWB J;  3RK3 B;  2OYH C;  1NTK G;  3H1H J;  2FYU K;  4KT0 J;  4ZNC A;  1EDI A;  3RL0 C;  5DJT B;  1XTG B;  3VMX A;  2FYU G;  4GOE A;  5AW0 B;  3G9R A;  3L72 G;  4R4L A;  3CX5 E;  1M56 D;  1S9K D;  2QJY B;  2WZ7 A;  2FY8 A;  1H8A A;  1T6A A;  2O01 H;  3L35 A;  1RQV A;  3SSU A;  2E76 C;  2O01 J;  4YXD C;  3FGA D;  3CCV P;  1FDM A;  4K35 A;  1URQ C;  2N9B A;  2NPS B;  3CXH H;  4XE5 B;  3TNU B;  2M3B A;  5H2F E;  1H0T A;  1RE3 A;  1KQS O;  3GF3 A;  5CBO A;  3B5N D;  1LT9 A;  1S4X A;  5AW9 B;  1YTZ T;  1X0T A;  5AVR B;  4YTP C;  1P84 I;  1FZE A;  5M1B A;  2Q3E A;  1N7S C;  1VF5 C;  2IX7 C;  1IFD A;  3L71 J;  1M8O B;  1S5L H;  1M1K Q;  2WPQ A;  1QX8 A;  1SQV D;  3A5T A;  1ZRT E;  1HUC A;  3OAK A;  3QWO C;  3RL0 D;  2M3E A;  4DCK A;  1NGM B;  1K05 A;  2IBZ I;  2QA4 P;  1JCC A;  1ZLL A;  1USD A;  2W6J H;  3H1K J;  1NAF A;  2C9L Y;  3MZW B;  3PHL A;  2ZT9 B;  3CXH E;  3M06 A;  1G2C A;  5AVW B;  1PZQ A;  3H1I J;  1MZ9 A;  1SQX D;  2E76 D;  2OYH A;  2Q6Q A;  2KXP B;  2XV5 A;  2QJP C;  1Q90 D;  1AJY A;  1FZC C;  1QGK B;  5KJ7 C;  1W2B O;  1L2P A;  2C0W A;  2H89 C;  3RK3 C;  4EIJ A;  2V7Q H;  1S5L E;  2IZ1 A;  2WTY A;  2QJK B;  5APU A;  2JEE A;  1SQB D;  2V7Q J;  1R8E A;  1DIP A;  4IL6 X;  1SQQ D;  2Q7C A;  1U7J A;  1IJD B;  1P84 E;  3L37 A;  1N7S D;  1ZW0 A;  1VF5 D;  3PP5 A;  1VQK P;  5CJ4 A;  2M5A A;  3H1K E;  2M8R A;  1SQP D;  2M0B A;  1CZQ A;  2KNC A;  3KYQ A;  3HTK B;  1TU3 F;  3MHV A;  1URQ A;  2QJY C;  2KUB A;  3H1I E;  1DH3 A;  2YKO A;  2AXT H;  2Y0C A;  4D6T J;  1FE6 A;  2BCC J;  1FZA A;  2R3S A;  1MKM A;  2FBW C;  2LR2 A;  3CWB D;  2GUS A;  2NPS C;  3NXS A;  1FC2 C;  1GW3 A;  3H1H D;  1M57 D;  5APS A;  1D7M A;  1NTM K;  2B9B A;  3JC2 2;  1CSB A;  4EDF A;  3EQ2 A;  1KFM A;  1NTZ J;  1NTM G;  1HF9 A;  5KJ7 D;  3JSV C;  1S5L X;  1H88 A;  1SFC A;  3RK3 D;  3MGN A;  3H1J D;  3A0H H;  3S4R A;  2JJL A;  2WPR A;  3KXD A;  3AE7 C;  4Y99 B;  2IBZ G;  2AXT E;  1ZME C;  2Z5H A;  2QSI A;  1BE3 D;  1PP9 D;  1L0L J;  3N4X A;  1CW5 A;  1OVR A;  1FS0 E;  1R5L A;  2ZT9 C;  3VMA A;  1FZC A;  1M90 Q;  5KJ7 A;  4PV1 B;  4H44 B;  2JWA A;  4R4M A;  3GW6 A;  3SWK A;  2W90 A;  3IR9 A;  3A0B H;  1NTZ E;  1LTG C;  1OFC X;  1SP4 A;  4C7N B;  3CC7 P;  1L4A B;  4HKZ H;  1LT1 A;  1NH4 A;  3MIW A;  2SPZ A;  1BGY D;  2A45 H;  1L0N D;  4WY4 B;  2W83 C;  2XDJ A;  3BAT A;  1JY3 O;  2QJK C;  3C9I A;  1FJP A;  1AV1 A;  3A0H E;  3BCC D;  1H0T B;  5TIS H;  2ZYG A;  3O6Q B;  3L70 G;  1PIX A;  3BVH A;  2LKM A;  3KPE A;  3P8C E;  3Q5R A;  5KAI E;  5AVY B;  1L0L E;  2PP6 A;  1VQ6 P;  2JP3 A;  5BVZ A;  1HTL C;  3VYI A;  3NMD A;  1S3J A;  3CCE P;  2NPS A;  3L36 A;  1KV4 A;  2WT7 B;  3UIA A;  4BXL A;  3H25 A;  1AVO A;  5KLV J;  1QVF O;  1BCC J;  2W27 A;  2RKL A;  2KSJ A;  1RF1 B;  1X8Y A;  2K88 A;  1YQ3 C;  1K73 Q;  1M7L A;  1PL5 A;  1VQL P;  1JY2 P; 
#chains in the Genus database with same CATH homology
 4KHX A;  1JTH A;  4W7Y A;  2Z5I A;  4I2L C;  5AW3 B;  3E1I A;  4WB4 A;  4ZKP A;  3RK2 D;  1JY3 N;  1GK4 A;  4O9B A;  1GD2 E;  1LTI C;  2HFE D;  1HH0 A;  2XNX A;  3LW5 H;  4OH8 B;  4XA4 A;  3M9B A;  1LTB C;  4IFM A;  5CCH C;  3G3Z A;  2OYH B;  5CCH A;  3BRT B;  1GU5 A;  2HLO A;  2WWW A;  1Z56 A;  4B86 A;  1M1J B;  3V4W A;  4N3Y B;  2P67 A;  1IK9 A;  1LTJ B;  2I1K A;  3B5N A;  1GL2 D;  1NTK K;  1SVF A;  4LGD E;  3BRV B;  1FZC B;  3HE4 A;  1HJB A;  1HGZ A;  2Q3I A;  3CL3 D;  1MV8 A;  3VP8 A;  3LID A;  3RK3 B;  4Y99 C;  2OYH C;  2FYU K;  2KB7 P;  2YO2 A;  2C9N Y;  2HYN A;  2FYZ A;  2FXM A;  2KP8 A;  3L4F A;  1LTT C;  3RL0 C;  1FBM A;  1XTG B;  2QM8 A;  2IFM A;  3VMX A;  2NPS D;  4GIF A;  1WRG A;  5AW2 B;  5AW0 B;  2I1J A;  1KIL A;  3A2A A;  3HUS C;  3HE5 B;  1X9V A;  1YYC A;  1GL2 A;  3HUS A;  3SWF A;  3IFM A;  1S9K D;  2WIT A;  3HD7 B;  3V4Q A;  3O8Z A;  2WZ7 A;  1H8A A;  2O01 H;  4GKG A;  3L35 A;  1L4A C;  2HPC B;  2O1K A;  1IC2 A;  2FFD B;  1NOH A;  3U1C A;  5AVT B;  3VN0 A;  5CMZ A;  2R3C A;  4WY4 C;  1FDM A;  3KQG A;  1J1E B;  1URQ C;  2N9B A;  2NPS B;  5AW5 B;  4XE5 B;  3TNU B;  2M3B A;  3HTK A;  4IFF A;  1E5W A;  1RE3 C;  1T3U A;  5CCH D;  2POH A;  1RE3 A;  4RES B;  3H32 B;  4HH2 A;  4EOT A;  1GU4 A;  5AVU B;  3B5N D;  1LT9 A;  1OXZ A;  3GHG C;  3II6 A;  5AW9 B;  4W7Z A;  2N1T B;  1YTZ T;  1JY2 O;  5AVR B;  1ZN5 A;  1JTH B;  1G1J A;  1FZE A;  1IFN A;  1N7S C;  2IX7 C;  1LWU A;  1IFD A;  1SFC B;  1N7S A;  2E42 A;  2WPQ A;  1J1D B;  1IFM A;  2OYI C;  3H6P A;  3I5C A;  1FZG A;  2OYI A;  1RF1 C;  1T8Z A;  1T2K C;  3A5T A;  1NKZ B;  2FKW B;  1HUC A;  3OAK A;  3RL0 D;  1IO4 A;  5CCG C;  1KIL D;  3M91 A;  5AW6 B;  3B5N B;  3V2P A;  5CCG A;  1JCC A;  3M0A A;  3SWY A;  1JUN A;  3HE4 B;  1ZLL A;  2P7J A;  1NAF A;  4DZO A;  2C9L Y;  5AW8 B;  2Z4E A;  1GK6 A;  2W6B A;  3NFQ A;  1HBW A;  3M06 A;  1G2C A;  5AVW B;  1AQ5 A;  5APV A;  3RK2 B;  1FZF A;  5AVZ B;  1MZ9 A;  5AW1 B;  2OYH A;  1M1J C;  4I1L A;  5APY A;  4ZKU A;  2XV5 A;  1LTJ C;  4DOJ A;  1LTA C;  2BAS A;  2IPP A;  2R5D A;  1FU1 A;  4WY4 D;  1FZC C;  4WBA A;  5KJ7 C;  1SQV K;  3T97 A;  4AYC A;  1KIL B;  4JYC A;  1NO4 A;  2KLV A;  2C0W A;  5AVQ B;  2A45 I;  1IFJ A;  3RK3 C;  1GL2 B;  3M9Q A;  4EIJ A;  2XKM A;  1N73 B;  5BU8 B;  2ZFC A;  1FOS F;  2WTY A;  1LTS C;  1GDT A;  1YTZ I;  5APU A;  1S9K E;  3MTU E;  2JEE A;  3P8M C;  5AVS B;  1A02 J;  5APT A;  3N7N A;  1IFI A;  2Q7C A;  3OJA B;  5AW4 B;  2L5G B;  2J59 M;  4C7N A;  1IJD B;  1L4A A;  3L37 A;  1N7S D;  2KOG A;  1KQL A;  1NKN A;  3PP5 A;  2O1J A;  5CJ4 A;  3V2Q A;  3MD0 A;  5CJ0 A;  3MUD A;  1SQX K;  2M8R A;  5APX A;  1CZQ A;  3VMZ A;  1N73 C;  3CI9 A;  2H7H A;  3KYQ A;  1RF0 C;  3VMY A;  4AQR D;  1JMM A;  3HTK B;  4WY4 A;  2ZXE B;  4AUW A;  3HD7 C;  1N7L A;  1URQ A;  5AVV B;  1CI6 B;  1JY3 P;  2HG5 D;  1NU1 K;  3U59 A;  1DH3 A;  2YKO A;  1T2K D;  1ZR2 A;  1ZR4 A;  3P8C D;  3HRN A;  3VP9 A;  1XTC C;  1MUU A;  1VDF A;  2R32 A;  2Q9I A;  1FZA A;  2FFD C;  1LT9 B;  5CCG D;  1AFO A;  3CLQ A;  2HOD A;  5AVX B;  1NTZ K;  1SQB K;  2GUS A;  1J1E C;  1LWU B;  2H43 A;  3GHG A;  2NPS C;  1FZB A;  1RE4 C;  3NXS A;  2WSE H;  3EFG A;  1PFI A;  1GW3 A;  1GZL A;  4JYB A;  2OAR A;  1SQQ K;  1X79 B;  3TNU A;  5APS A;  2Q5U A;  2P2U A;  1FJK A;  1NTM K;  2WT7 A;  2H8P D;  3KDP B;  1CSB A;  1SQP K;  5APQ A;  4N6J A;  5CHX A;  1GW4 A;  1N86 A;  2PAJ A;  3WMM 0;  2QM7 A;  3EQ2 A;  3A7O A;  1KFM A;  1RF1 A;  2XZR A;  2N1T C;  1DX7 A;  1KZU B;  1RY3 A;  1JCD A;  5KJ7 D;  2N1T A;  2GM4 A;  4I6M C;  2YNY A;  1SFC C;  1HVV A;  1EQ7 A;  3P32 A;  1H88 A;  4W80 A;  1SFC A;  3BAS A;  3RK3 D;  3MGN A;  4JF7 A;  1L0L K;  1J1D C;  3P7K A;  1J2J B;  3TSI A;  2JJL A;  1KFN A;  2KYV A;  1G2C B;  2WPR A;  2XU6 A;  1N2D C;  2R5B A;  3M0D C;  4M3L A;  4C7R A;  4Y99 B;  4HYT B;  3M0D A;  2GUV A;  1L4A D;  4LLH A;  3B5N C;  2WPS A;  1VPC A;  1QL1 A;  2Z5H A;  2IFN A;  1M1J A;  2W6A A;  3RL0 B;  5AW7 B;  1LTJ A;  1T3J A;  3N4X A;  1CW5 A;  1JY2 N;  1G1I A;  1URQ D;  1FZC A;  3HD7 D;  3M9H A;  2E43 A;  5BU5 A;  5KJ7 A;  1W2E A;  4C46 A;  2YMY A;  3OA7 A;  3HUS B;  1NWQ A;  1GTW A;  1DEB A;  3RK2 C;  2MJZ A;  4GT1 A;  3A3Y B;  1HWT C;  3IR9 A;  3V5B A;  1LTG C;  2VRS A;  1LGH B;  3V2N A;  3B8E B;  1SP4 A;  4C7N B;  1FAV A;  1L4A B;  2WSC H;  2CPB A;  4N78 D;  2YKP A;  4N78 E;  1KIL C;  1NH4 A;  2WSF H;  3MIW A;  1A02 F;  2A45 G;  1SLQ A;  1H89 A;  1JNM A;  2A45 H;  3LIE A;  1GL2 C;  4WY4 B;  2YKQ A;  1HGV A;  2XDJ A;  1MFZ A;  1URQ B;  3BAT A;  1JY3 O;  3C9I A;  3HE5 A;  1WT6 A;  1FJP A;  1N73 A;  1RF0 A;  2CPS A;  3TK1 A;  5APW A;  3U1A A;  1ZV8 A;  3HD7 A;  3BVH A;  2C0X A;  2LKM A;  3KPE A;  2N1T D;  3P8C E;  3VOP A;  3R2P A;  4LC1 A;  5KLV K;  1OWA A;  2HPC A;  2HOD B;  3VTP C;  5AVY B;  1SFC D;  2FFD A;  2PP6 A;  5KTB A;  1NHL A;  3GHG B;  1QL2 A;  5BVZ A;  1HTL C;  3VYI A;  3NMD A;  1N7S B;  2NPS A;  1RE4 A;  3L36 A;  3TYY A;  1CI6 A;  2WT7 B;  1JO5 A;  3UIA A;  2J58 A;  2YO3 A;  1LT9 C;  2P1J A;  2OYI B;  1L0N K;  2W27 A;  3H32 A;  2KSJ A;  1RF1 B;  1X8Y A;  3NTN A;  1FOS E;  1M7L A;  1LWU C;  4IFD K;  3V2R A;  1JOC A;  1JY2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...