2FYZA

Structural of mumps virus fusion protein core
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
57
structure length
57
Chain Sequence
SAVSLVQAQTNARAIAAMKNSIQATNRAVFEVKEGTQRLAIAVQAIQDHINTIMNTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Fusion glycoprotein F0
publication title Structural characterization of mumps virus fusion protein core
pubmed doi rcsb
source organism Mumps virus
total genus 25
structure length 57
sequence length 57
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2006-02-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.300 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2fyzA00
2FYZA 1ZV8A 1SVFA 3KPEA 4EIJA 1G2CA 3SWYA 3EFGA 4N6JA
chains in the Genus database with same CATH superfamily
3AE9C 1U7JA 2KUBA 1YI2P 3Q1MA 3HUSA 2R3SA 4N6JA 3HUSB 1NTZE 2ZT9C 1OVRA 5CCHA 3SFEC 2K9YA 3GMAA 3H1IE 2M3EA 1JY3N 1PZQA 3KZIE 4U3FJ 3H1HE 3B8EB 3B5NC 1JY3P 1VL2A 1N7SC 3R2PA 1YJWP 1ZP0C 3MTUE 2SPZA 4BRYA 4BRYB 1Q90D 3S1KA 2K3RA 1JCDA 5AVXB 3CPWO 3H1JE 1DD3A 5CHXA 2AXTH 4GODA 1RF1C 4MN4C 1NKZB 3L73D 4L73A 3KDPB 3G71P 1ZRTE 3P8CE 4C7NA 3CCLP 3S4RA 4C7NB 4EIJA 3VTPC 3CMEP 2Q5UA 3WUUA 2O01H 3M0DC 4Y99C 4LLHA 2W6JH 4JF7A 1SQPD 2ZYDA 1TU3F 3RL0g 2ZT9D 1FBMA 2L91A 1N2DC 1L0NE 3B5ND 4IOIH 1N7SD 3OA7A 1FDMA 4L74A 1XTGB 2PGDA 2H7HA 1X79B 3FXEA 3MUDA 3D6ZA 3TNUA 2RMZA 3TNUB 2G3AA 5TISH 1NJIQ 1OVUA 4K35A 2BEZF 2R44A 1S5LX 2AXTE 4WB4A 1GU4A 2AXCA 3C8VA 3A2AA 2WTYA 2E5TA 1L0LG 1BGYE 2QEXP 1VQ8P 2ZAEB 5APTA 1BE3G 2OQQA 3EFGA 3L75G 1J1EB 4IL6X 1YTZT 2E74B 5AVVB 4IFDK 1IFJA 2IYPA 2P1JA 1SQXJ 2QJYC 2QM8A 4KJMA 4XE5B 3SSUA 4HJGH 3L70G 2OYHA 2OYHB 1NTKE 2OTKE 1JY2N 1JY2P 2QJKB 3A5TA 5CCGC 2QVAA 1NGMB 1G1IA 3HRNA 2FYUG 1S72P 3AE6C 3V2PA 2IDBA 3VYIA 1M8OB 1AQTA 3VN0A 3RL0C 3M06A 3D71A 3CC7P 3CWBJ 5TISE 3AE1C 1OZHA 3H1KE 1SQQE 3L73E 4PJ0H 3L36A 1S4XA 3WMM0 2P2UA 3M9QA 4WWIA 1FE6A 1KILC 2QJPC 2JKVA 2ZFCA 4I6MC 2WPQA 4PD4I 1ZW0A 2HYNA 3EWKA 1PP9J 5M1BA 1AQ5A 1ZMEC 3IF4A 2A45H 2LR2A 3KQGA 2BEQD 1FZCC 2R3CA 1VQMP 1SQBJ 4H44C 1DIPA 5CCGD 2NZ2A 4DOJA 1HF9A 2Y9YA 1IK9A 3AE3C 2A06D 1BSHA 3RL0D 3G3ZA 1OW6A 4HH2A 2H43A 1SQPG 3PHLA 2BCCG 1URQC 2YNYA 1VQ5P 2YKQA 4IFMA 3L74G 5AW2B 1VQPP 3L71D 2NPSC 3BASA 1YTZI 1T2KC 2W27A 1KILD 2Y0DA 1NTMJ 1EXJA 5KAFE 3WUVA 5APSA 1LGHB 1JY3O 1VDFA 3L37A 2WSEH 5AW7B 3VMXA 1KMIZ 1GTWA 1NO4A 3Q5SA 1QEXA 1PL5A 4H44D 2GUSA 3Q5RA 2YIUB 1JM0A 3H1LJ 4UB6H 4Y28J 3IAOA 3NMDA 2ZT9B 1X8YA 4U3FG 3CD6P 2OARA 2KXPB 3H1JJ 3EFFK 2B88A 5AW3B 1URQD 1HUCA 2E43A 5KLVJ 1NYHA 1IFPA 2UWJE 4EDFA 5B5EE 2NPSD 1YHQP 1T2KD 1M1KQ 3CL3D 2A45I 3AEFC 1MFZA 3L75J 2M8RA 2Q3EA 5AVWB 1UIXA 2LXBA 1W2BO 3BCCE 5APVA 4WVZA 3FGAD 3GW6A 1N86A 2PAJA 3RGUA 4DCKA 5APWA 2KYVA 3V4WA 4Y99B 1GW3A 5C39A 1RY3A 3LW5H 2N1TC 3WU2H 2A06E 1NKNA 3ABVC 2K37A 1JTHA 1JTHB 2MKVA 3OW2O 1VQ9P 1PGJA 2P7JA 3W67A 4LC1A 1BGYJ 3F5HA 3L71E 3KXDA 1AJYA 5KLIB 3AEAC 3CX5E 2YMYA 1P84D 3I5CA 5E79E 4GIFA 1QL1A 1T8ZA 3W68A 3EQ2A 1CZQA 4GOFA 2B9BA 1KQFB 5BVZA 1R5LA 2J5UA 4GT1A 2XU6A 5AW9B 1YBKA 1VQNP 4PV1C 3AE7C 1JY2O 1JMMA 2WMMA 2C9LY 1BCCJ 3U1AA 4WY4C 4R4MA 2YKOA 1SQXG 1PPJD 1FS0E 5H2FE 3CCRP 3CCSP 2E5YA 4N78D 2QJYB 5KAIH 1IK7A 3MP7B 1SS1A 4GKGA 1L4AA 2N1TD 4EOTA 1JMBA 3I55P 3PTZA 3VMYA 3L75D 3K5BA 2GM4A 2G8YA 2AEFA 1P84H 3LIDA 4D6TJ 3CWBG 5KKZC 1LTAC 1E79H 3RL0B 5B66H 1HVVA 4A7PA 5L8RJ 3M9BA 3ITKA 3M91A 1S2EA 4ZNCA 2HPCA 4I7ZC 2HPCB 5BU8B 1S3JA 3P8MC 3L35A 2E75C 2WPVB 2IBZD 2FYUK 1GW4A 1GL2A 1GL2B 4PV1D 2FYUD 2V7QH 1SQVJ 2QJPB 2WPRA 1MFTA 4WY4D 1KC8Q 1YYCA 3L4FA 1KFMA 1ZOYC 5GTIH 1PP9G 2OTJP 2WWWA 2Q1KA 1JO5A 5AW6B 5KAIE 1YQ3C 5AW0B 1U57A 4CPGA 1N73C 1FZCA 1FZCB 1SQBG 1VF5C 3Q2YA 1CSBA 2FXOA 4PD4D 5AW4B 3R4YA 2V4HA 4H44B 1W5CE 4OWFA 4JYBA 3A0BE 4UB8E 3MGNA 3FX0A 2QG4A 3H32A 1FOSE 3H32B 5B66E 1SLQA 1BCCD 1LTSC 2VRSA 1DX7A 1URQA 1URQB 5AW5B 3GHGA 1OMIA 3GHGB 1EDLA 4YXDC 2NPSA 1DEBA 2NPSB 5APXA 2E75D 1FOSF 1NTMG 4RO0A 3RK2D 1KORA 1FZFA 3A0HH 1LTTC 3CCJP 3I56P 1SQPK 5GTIE 2I1JA 1IFNA 3C9IA 1VPCA 2BCCD 3V2RA 2PRRA 3L74D 1L0LE 4D6TD 1OW8A 1VF5D 1P84I 4PD4H 1BE3E 5TJHA 1VQ7P 4TLFA 1LP1A 3H1LG 3KHUA 1LP1B 1LWUC 1Y47A 2XV5A 1T6AA 1M7LA 4HKZH 3VP8A 3H1JG 1HWTC 1SQVK 3AECC 1EDKA 1OIPA 3L72J 1PPJG 1SQVD 2OYIA 2OYIB 3L70E 4H13B 2AEJA 1IZNB 5KLVG 3BCCJ 1KV4A 4JBZA 2KLVA 2WPSA 4W7YA 1WRGA 2B87A 2B87B 1RE4A 2FYUE 2OYOA 4AYCA 1MUUA 1HGZA 1M90Q 2FBWC 3A0HE 2GA1A 1YJ9P 3SFDC 1EQ7A 2JWDA 4U3FD 3UIAA 1WMKA 1UIIA 3JSVC 4HYTB 1X22A 1OWAA 3E1RA 2Q9IA 1KFNA 3WUTA 3Q3DA 4NPFX 4PD4E 2IFMA 4YTPC 1R5SA 2IBZG 2JR8A 1KQGB 2I1KA 1CW5A 2IBZI 3CCMP 1HGVA 4OGQB 2YMKA 1RF0C 5KJ7C 2WQYC 1A02J 1NVOA 2HODA 2HODB 1FJPA 2I8DA 2R5DA 1BGYG 1LTIC 1NAYA 1NU1J 2KZIA 3T97B 4ZMDA 3D6YA 4K3AA 1K05A 1SFCC 1FDIA 1T3UA 2R32A 4LGDE 1AV1A 1Q7YQ 1SQPE 1S9KD 1ZXGA 4NPEA 3TGUJ 4ZKUA 1BCCG 4PV1B 3L74E 5AW1B 1KN7A 1SP4A 2OGUA 3L72D 2YKPA 1KTMA 4H0LC 3HUSC 4DZOA 2JWAA 2WSSH 3AEGC 1ZR4A 5CCHC 1AA0A 1QVFO 3OAKA 1DEEG 1LTJA 5KJ7D 1LTJB 1HTLC 2YO2A 3V6IA 1YQ4C 2WSCJ 1SQXK 1M1JC 1RE3C 1SQXD 1KYOI 3CXHD 4D6TG 2Q3IA 4PJ0E 1FZGA 1MZ9A 1SFCD 1PGQA 5AW8B 4RJTA 1QGKB 3V2NA 1S5LH 4U3FE 1G2CA 1QX8A 1G2CB 1HBWA 1NTZJ 3P32A 2E75B 2C9NY 4IL6H 1SQVG 1FZEA 3H1IJ 3RK2B 3SWYA 3H1HJ 3FWLA 2POHA 4OH8B 4O9BA 3HD7C 1PIXA 1MKMA 2E76C 2H8PD 3CWBD 3G9RA 1T3JA 3MD0A 1OW7A 4H0LD 1GMJA 1NU1D 3II6A 1J1DC 4L76A 2J59M 4EYYQ 2JJLA 4DJGA 3MIWA 5CCHD 3O6QA 4N3YB 2ZXXA 3O6QB 1N73A 1H8AA 1RH5B 1N73B 1VF5B 3B5NA 3B5NB 3IN6A 4AUWA 1N7SA 1N7SB 3GG2A 1NH4A 3E1IA 3GF7A 3CXHH 1PP9D 3GLMA 1EZVD 3MUDC 3TGUD 2RKLA 1AVYA 2OTLP 5AVQB 1SQBK 4XFJA 3B4SA 1RF1A 2FYZA 3E7KA 1RF1B 1SQBD 2N9BA 1ZN5A 2H88C 4Z1MH 3CMAP 1S9KE 2KSJA 3VP9A 2JDIH 2FY8A 2KB7P 4OVNF 1ZV8A 3VOPA 2C0WA 1L0NJ 3RBXA 3CLQA 1VQ6P 2M0BA 3HD7D 2E76D 3M0DA 2H89C 1KB9D 3CCUP 3TF5A 2FKWB 2HFED 4UB6E 1NTMK 3HTKA 3HTKB 2JEEA 1QVGO 1NTMD 2FYNC 2KI7B 1LWUA 1VQ4P 1LWUB 1SQXE 1NTZD 3CC2P 3U59A 2Y0CA 3RBZA 1FAVA 5GTHH 3L72G 3BRTB 2R5BA 1KILE 3H1ID 1HJBA 1GZLA 3BCCG 5AVSB 1N7LA 1IO4A 3M0AA 3SWKA 1BDCA 1YITP 1GK6A 1IFDA 3H1LD 3FWNA 1NTKJ 4C7RA 4DT0A 3H1JD 2XDJA 2E42A 1KB9H 2ZXEB 3NFQA 5KLVK 1Q81Q 2O1KA 5APYA 5KLVD 4QMAA 2ZYAA 2PP6A 2KSEA 3CXHI 3PLNA 2RH0A 3P8CD 3WU2E 3IFMA 1H88A 3NXSA 3A3YB 2KZJA 3H1KJ 1SQQJ 2AEMA 3L73J 1BDDA 5CCGA 1OFCX 1X9VA 2NRGA 3KYQA 2P58A 1L2PA 3AE8C 1YIJP 1FC2C 2ZVOB 3KZIH 1RF0A 1OXZA 1NU1G 1U7MA 2KK7A 1LTGC 2KIKA 1J2JB 3V5BA 3B71A 1R8EA 5KTBA 5CBNA 1KILA 1KILB 1SVFA 1EC5A 2QRXA 1KD1Q 1KB9E 1NOHA 1EZVG 2Y0EA 2DW3A 3TGUG 1BSNA 3N4XA 3G6EP 3VMZA 1BGYD 1KQSO 4L75A 1EZVI 3AEDC 1IFIA 2CPBA 1FDOA 4I2LC 4JPZB 3C1LA 3P7KA 4H0LB 2W6BA 2KNCA 2YIUC 2KNCB 4ZKPA 1NTKK 1GD2E 1XTCC 4R4LA 4C46A 1P84E 1NTKD 1JCCA 3GF3A 3SWFA 3BVHA 2IX7C 2QA4P 2ZJSE 1N8RQ 1M1JA 1AVOA 1RE3A 1M1JB 1KB9I 4W7ZA 2M3BA 3H1LE 2Z5HA 2W8ZA 3AE4C 4JYCA 2FXMA 1AFOA 1NTZG 1SQQK 1PPJE 3V2QA 3H1KD 1LT9C 4EI2A 1SQQD 4N78E 5CMZA 5KLVE 1Y9BA 1KYOD 1KQLA 3H1IG 2KS1A 1W2EA 2KS1B 1K04A 3H1HG 4BXLA 1FJKA 2D2CC 3HD7A 1Q82Q 1LTBC 2C0XA 3HD7B 2E76B 3L75E 3PP5A 3H25A 3IR9A 3OJAB 1Y8AA 5BU5A 1OX3A 4JQ0D 1J1DB 2O01N 1K9MQ 1JEKA 2JP3A 1WT6A 3H6PA 3CCQP 2M5AA 1X0TA 2M5AB 1JB0J 3TSIA 2IBZE 3N7NA 5KLIC 2XKMA 4HB1A 2IYOA 2WSEJ 3JC22 1ZLLA 3V4QA 1KYOH 3HE4A 1K73Q 3HE4B 1MV8A 1M56D 1JNMA 1L0NG 2D2CD 1VQOP 4M3LA 4BWNA 2Q6QA 5APQA 1PGPA 2HG5D 1G1JA 3L71J 2J58A 1L4AC 2N1TA 3TYYA 2N1TB 4RESB 2B89A 2K1AA 1BCCE 3AEEC 2FYNB 2RN0A 1NWQA 3T97A 1JUNA 3RK3C 1RQVA 2FFDC 3AEBC 2WZ7A 1YJNP 3ZDMA 2HR3A 3CI9A 1KYOE 4RKUJ 2QSIA 2BCCE 3LW5J 1NTKG 4YXWH 2K88A 3F89A 2WITA 2KOGA 1GL2C 1K8AQ 2ZVNB 4D6TE 1IC2A 4WY4A 3TDKA 4WY4B 5KAFH 5AVUB 4WBAA 1JOCA 2XNXA 3BCCD 1VQKP 2CPSA 2Y9ZA 3S9OA 1L4AD 5AVZB 1LJ2A 4YPCA 1SQVE 3H1KG 1SQQG 3L73G 1QL2A 2YXRB 1RHZB 2O1JA 2IPPA 3VMAA 3RK3D 5AVYB 5KKZB 2ZYGA 2WSFJ 5CJ0A 1DH3A 4ASWA 1PV3A 1EDJA 5B5EH 3GHGC 1NHLA 4I7ZB 1USDA 1GL2D 1USEA 1HH0A 5AVTB 3CX5D 3MZWB 1ZR2A 5CBOA 2QM7A 1LNQA 1NU1K 1DD4A 2JO1A 3TK1A 2O3JA 2WVRA 1D7MA 2XNDH 4KHXA 4TT3H 3KPEA 1FU1A 3A7OA 1NAFA 1E5WA 2LKMA 4U7JA 1Z56A 2V7QJ 2BASA 2IZ1A 1H0TA 1H0TB 3USSA 3O8ZA 2W6AA 4W80A 2OYIC 4H13C 1S5LE 3AE5C 2IZ0A 1RQUA 4GDOA 3BATA 2A45G 3PH0A 4I1LA 2XZRA 5EFWB 1Q2NA 3CX5H 1RE4C 2Q7CA 1L0LJ 4IL6E 1J1EC 1IFMA 5E79H 1BE3J 3L72E 1GK4A 2E74C 1LT9A 1LT9B 3NTNA 2YXQB 3JCUH 1EXIA 3QH9A 4ASVA 2QIWA 3Q5PA 4AQRD 2LXCB 2OYHC 1PFIA 2D2CB 1GU5A 3L70J 1KZUB 2Z5IA 5H2FH 2FXPA 2QJKC 5DJTB 3CC4P 1NTZK 1CI6A 2L5GB 1CI6B 1VQLP 3RK3E 2GUVA 3CXHE 2FYUJ 4GOEA 3D70A 4OGQC 3H1HD 4H13D 2Z4EA 2HLOA 2O01J 2YO3A 5AVRB 3PJSK 2CK3H 1Q86Q 2N9YB 2E74D 1QLED 2K9JA 2K9JB 3CWBE 3LIEA 3HE5A 2WSCH 3HE5B 1NU1E 2A06G 4XA4A 3JCUE 4KT0J 3CCVP 1HJ0A 1ZRTD 1IJDB 5K5GB 1A02F 3G4SP 2P10A 2WSFH 2W90A 3PRJA 3L71G 1EDIA 3AE2C 4B86A 1S1CX 3CCEP 1H89A 2PFXA 5CJ4A 3U1CA 1PP9E 3MHVA 1EZVE 3M9HA 1L4AB 1PGOA 1L0LK 3TGUE 5GTHE 4NPDA 4OGQD 1L0NK 1L0LD 1LTJC 5KJ7A 3CX5I 3FXDA 1L0ND 2KLUA 1BE3D 2P67A 1FZBA 3QWOC 1SQBE 1SQPJ 2BCCJ 3A0BH 4UB8H 1FZAA 1OVVA 3RK3B 4IFFA 3L74J 1SFCA 1SFCB 2MJZA 2FFDA 2FFDB 2IFNA 5DJUB 1LT1A 3L70D 2ITAA 2WT7A 2WT7B 1M57D 2KP8A 2QE7H 2W83C 3BRVB 3RK2C 5APUA 1GDTA 1NTME
chains in the Genus database with same CATH topology
1JTHB 2Q3IA 3HE4A 1FZGA 1MZ9A 3HE4B 1SFCD 1MV8A 3HUSA 4N6JA 3HUSB 5AW8B 1JNMA 3V2NA 2P7JA 4M3LA 4LC1A 5CCHA 1G2CA 1HBWA 1G2CB 1JY3N 5APQA 3P32A 3B8EB 3B5NC 2HG5D 1JY3P 2YMYA 2C9NY 1G1JA 1FZEA 2J58A 3RK2B 1N7SC 3I5CA 3SWYA 3R2PA 4GIFA 2POHA 4OH8B 1L4AC 2N1TA 3TYYA 2N1TB 1QL1A 1T8ZA 3HD7C 4O9BA 3MTUE 3EQ2A 4RESB 2H8PD 1CZQA 1T3JA 3MD0A 5BVZA 5AVXB 1JCDA 4GT1A 2XU6A 5AW9B 3II6A 1NWQA 1J1DC 1JY2O 1JMMA 2J59M 2JJLA 2C9LY 3MIWA 5CCHD 4N3YB 5CHXA 3T97A 3U1AA 1RF1C 4WY4C 1JUNA 3RK3C 1N73A 1H8AA 1NKZB 1N73B 2YKOA 3KDPB 3B5NA 3B5NB 2FFDC 4N78D 2WZ7A 3P8CE 4AUWA 4C7NA 1N7SA 4C7NB 1N7SB 4EIJA 1NH4A 3E1IA 4GKGA 3VTPC 1L4AA 2N1TD 2Q5UA 4EOTA 3CI9A 2O01H 3M0DC 4Y99C 4LLHA 4JF7A 3VMYA 2WITA 2KOGA 1GL2C 5AVQB 1SQBK 1IC2A 1RF1A 2FYZA 1RF1B 1FBMA 4WY4A 2GM4A 4WY4B 2N9BA 5AVUB 1ZN5A 4WBAA 1JOCA 1N2DC 1S9KE 3B5ND 2KSJA 3LIDA 3VP9A 2XNXA 1LTAC 3RL0B 1HVVA 2KB7P 2CPSA 1ZV8A 3VOPA 2C0WA 1N7SD 3OA7A 1FDMA 1L4AD 3M9BA 3CLQA 5AVZB 2H7HA 1XTGB 3HD7D 1X79B 3M91A 2HPCA 3M0DA 2HPCB 3MUDA 5BU8B 3P8MC 3TNUA 3L35A 3TNUB 2FYUK 1GW4A 1GL2A 1GL2B 1QL2A 2FKWB 2HFED 2O1JA 2WPRA 2IPPA 4WY4D 4WB4A 3RK3D 1GU4A 1YYCA 1NTMK 3L4FA 1KFMA 3HTKA 3A2AA 3HTKB 2JEEA 2WWWA 2WTYA 1JO5A 5AVYB 5CJ0A 5AW6B 5APTA 3EFGA 1J1EB 1LWUA 1LWUB 1DH3A 1YTZT 5AW0B 3U59A 5AVVB 1N73C 1FZCA 1FAVA 3GHGC 1NHLA 1FZCB 4IFDK 1IFJA 1CSBA 3BRTB 2P1JA 2R5BA 5AW4B 2QM8A 1GZLA 1HJBA 1GL2D 4XE5B 1HH0A 5AVTB 5AVSB 1N7LA 1IO4A 3M0AA 4JYBA 1ZR2A 2OYHA 2OYHB 3MGNA 2QM7A 1JY2N 1GK6A 1NU1K 1IFDA 3TK1A 3H32A 1FOSE 1JY2P 3H32B 3A5TA 1SLQA 5CCGC 1LTSC 4C7RA 2VRSA 1G1IA 3HRNA 1DX7A 1URQA 1URQB 3V2PA 2XDJA 5AW5B 3VYIA 3GHGA 2E42A 3GHGB 4KHXA 2NPSA 1DEBA 2NPSB 5APXA 3KPEA 3VN0A 2ZXEB 3RL0C 3M06A 1FOSF 3NFQA 1FU1A 5KLVK 2O1KA 5APYA 3A7OA 3RK2D 1FZFA 1NAFA 2PP6A 1E5WA 1LTTC 2LKMA 3P8CD 1Z56A 3IFMA 1H88A 3NXSA 1SQPK 3A3YB 3L36A 2BASA 3WMM0 2I1JA 2P2UA 1IFNA 3O8ZA 3C9IA 2W6AA 1VPCA 4W80A 2OYIC 3M9QA 5CCGA 3V2RA 1KILC 1X9VA 2ZFCA 3KYQA 4I6MC 2WPQA 3BATA 2A45G 4I1LA 2XZRA 2HYNA 1RF0A 1RE4C 1OXZA 1AQ5A 2Q7CA 1J1EC 1IFMA 1LWUC 2A45H 1GK4A 1LTGC 1J2JB 3V5BA 2XV5A 1M7LA 3KQGA 1FZCC 2R3CA 3VP8A 1LT9A 1HWTC 1LT9B 1SQVK 3NTNA 5KTBA 2OYIA 2OYIB 5CCGD 1KILA 1KILB 4DOJA 1SVFA 4AQRD 2OYHC 1PFIA 1IK9A 1GU5A 2KLVA 2WPSA 1KZUB 2Z5IA 3RL0D 1NOHA 3G3ZA 4W7YA 1WRGA 1RE4A 4HH2A 2H43A 3N4XA 3VMZA 4AYCA 1MUUA 1NTZK 1HGZA 1CI6A 2L5GB 1CI6B 1URQC 1EQ7A 2GUVA 1IFIA 2YNYA 3UIAA 2YKQA 4IFMA 5AW2B 2CPBA 2NPSC 3BASA 4I2LC 1YTZI 3P7KA 1T2KC 4HYTB 2W27A 2W6BA 1KILD 2Z4EA 1OWAA 2HLOA 2YO3A 2Q9IA 5AVRB 1KFNA 4ZKPA 1NTKK 1GD2E 1XTCC 4C46A 1JCCA 2IFMA 3SWFA 5APSA 1LGHB 3BVHA 1JY3O 2IX7C 1VDFA 3L37A 2I1KA 2WSEH 5AW7B 1M1JA 3VMXA 1CW5A 1RE3A 1M1JB 3LIEA 1GTWA 1NO4A 3HE5A 4W7ZA 2M3BA 2WSCH 3HE5B 1HGVA 1RF0C 5KJ7C 4XA4A 1A02J 2Z5HA 2HODA 2GUSA 2HODB 4JYCA 1FJPA 2FXMA 1AFOA 1IJDB 2R5DA 1A02F 1LTIC 3NMDA 1X8YA 1SQQK 2WSFH 3V2QA 2OARA 1LT9C 4N78E 5CMZA 1SFCC 1T3UA 1KQLA 4B86A 1W2EA 1H89A 2R32A 5AW3B 1FJKA 5CJ4A 4LGDE 1URQD 3U1CA 1HUCA 2E43A 3M9HA 1L4AB 3HD7A 1L0LK 1LTBC 2C0XA 3HD7B 2NPSD 1L0NK 1LTJC 5KJ7A 1T2KD 1S9KD 3PP5A 3CL3D 3IR9A 2P67A 3OJAB 5BU5A 4ZKUA 1FZBA 2A45I 1J1DB 5AW1B 1MFZA 2M8RA 5AVWB 1SP4A 1FZAA 3RK3B 4IFFA 5APVA 2YKPA 1SFCA 1SFCB 2MJZA 1WT6A 2FFDA 3H6PA 3HUSC 4DZOA 2FFDB 2IFNA 1N86A 2PAJA 1ZR4A 3TSIA 5CCHC 2WT7A 3OAKA 2WT7B 5APWA 3N7NA 1LTJA 2KYVA 2KP8A 1LTJB 5KJ7D 3V4WA 1HTLC 4Y99B 2XKMA 1GW3A 2YO2A 3BRVB 3RK2C 1RY3A 3LW5H 1SQXK 5APUA 1GDTA 1M1JC 2N1TC 1RE3C 1NKNA 1ZLLA 3V4QA 1JTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYZ A;  1ZV8 A;  1SVF A;  3KPE A;  4EIJ A;  1G2C A;  3SWY A;  3EFG A;  4N6J A; 
#chains in the Genus database with same CATH topology
 3AE9 C;  1U7J A;  2KUB A;  1YI2 P;  3Q1M A;  3HUS A;  2R3S A;  4N6J A;  3HUS B;  1NTZ E;  2ZT9 C;  1OVR A;  5CCH A;  3SFE C;  2K9Y A;  3GMA A;  3H1I E;  2M3E A;  1JY3 N;  1PZQ A;  3KZI E;  4U3F J;  3H1H E;  3B8E B;  3B5N C;  1JY3 P;  1VL2 A;  1N7S C;  3R2P A;  1YJW P;  1ZP0 C;  3MTU E;  2SPZ A;  4BRY A;  4BRY B;  1Q90 D;  3S1K A;  2K3R A;  1JCD A;  5AVX B;  3CPW O;  3H1J E;  1DD3 A;  5CHX A;  2AXT H;  4GOD A;  1RF1 C;  4MN4 C;  1NKZ B;  3L73 D;  4L73 A;  3KDP B;  3G71 P;  1ZRT E;  3P8C E;  4C7N A;  3CCL P;  3S4R A;  4C7N B;  4EIJ A;  3VTP C;  3CME P;  2Q5U A;  3WUU A;  2O01 H;  3M0D C;  4Y99 C;  4LLH A;  2W6J H;  4JF7 A;  1SQP D;  2ZYD A;  1TU3 F;  3RL0 g;  2ZT9 D;  1FBM A;  2L91 A;  1N2D C;  1L0N E;  3B5N D;  4IOI H;  1N7S D;  3OA7 A;  1FDM A;  4L74 A;  1XTG B;  2PGD A;  2H7H A;  1X79 B;  3FXE A;  3MUD A;  3D6Z A;  3TNU A;  2RMZ A;  3TNU B;  2G3A A;  5TIS H;  1NJI Q;  1OVU A;  4K35 A;  2BEZ F;  2R44 A;  1S5L X;  2AXT E;  4WB4 A;  1GU4 A;  2AXC A;  3C8V A;  3A2A A;  2WTY A;  2E5T A;  1L0L G;  1BGY E;  2QEX P;  1VQ8 P;  2ZAE B;  5APT A;  1BE3 G;  2OQQ A;  3EFG A;  3L75 G;  1J1E B;  4IL6 X;  1YTZ T;  2E74 B;  5AVV B;  4IFD K;  1IFJ A;  2IYP A;  2P1J A;  1SQX J;  2QJY C;  2QM8 A;  4KJM A;  4XE5 B;  3SSU A;  4HJG H;  3L70 G;  2OYH A;  2OYH B;  1NTK E;  2OTK E;  1JY2 N;  1JY2 P;  2QJK B;  3A5T A;  5CCG C;  2QVA A;  1NGM B;  1G1I A;  3HRN A;  2FYU G;  1S72 P;  3AE6 C;  3V2P A;  2IDB A;  3VYI A;  1M8O B;  1AQT A;  3VN0 A;  3RL0 C;  3M06 A;  3D71 A;  3CC7 P;  3CWB J;  5TIS E;  3AE1 C;  1OZH A;  3H1K E;  1SQQ E;  3L73 E;  4PJ0 H;  3L36 A;  1S4X A;  3WMM 0;  2P2U A;  3M9Q A;  4WWI A;  1FE6 A;  1KIL C;  2QJP C;  2JKV A;  2ZFC A;  4I6M C;  2WPQ A;  4PD4 I;  1ZW0 A;  2HYN A;  3EWK A;  1PP9 J;  5M1B A;  1AQ5 A;  1ZME C;  3IF4 A;  2A45 H;  2LR2 A;  3KQG A;  2BEQ D;  1FZC C;  2R3C A;  1VQM P;  1SQB J;  4H44 C;  1DIP A;  5CCG D;  2NZ2 A;  4DOJ A;  1HF9 A;  2Y9Y A;  1IK9 A;  3AE3 C;  2A06 D;  1BSH A;  3RL0 D;  3G3Z A;  1OW6 A;  4HH2 A;  2H43 A;  1SQP G;  3PHL A;  2BCC G;  1URQ C;  2YNY A;  1VQ5 P;  2YKQ A;  4IFM A;  3L74 G;  5AW2 B;  1VQP P;  3L71 D;  2NPS C;  3BAS A;  1YTZ I;  1T2K C;  2W27 A;  1KIL D;  2Y0D A;  1NTM J;  1EXJ A;  5KAF E;  3WUV A;  5APS A;  1LGH B;  1JY3 O;  1VDF A;  3L37 A;  2WSE H;  5AW7 B;  3VMX A;  1KMI Z;  1GTW A;  1NO4 A;  3Q5S A;  1QEX A;  1PL5 A;  4H44 D;  2GUS A;  3Q5R A;  2YIU B;  1JM0 A;  3H1L J;  4UB6 H;  4Y28 J;  3IAO A;  3NMD A;  2ZT9 B;  1X8Y A;  4U3F G;  3CD6 P;  2OAR A;  2KXP B;  3H1J J;  3EFF K;  2B88 A;  5AW3 B;  1URQ D;  1HUC A;  2E43 A;  5KLV J;  1NYH A;  1IFP A;  2UWJ E;  4EDF A;  5B5E E;  2NPS D;  1YHQ P;  1T2K D;  1M1K Q;  3CL3 D;  2A45 I;  3AEF C;  1MFZ A;  3L75 J;  2M8R A;  2Q3E A;  5AVW B;  1UIX A;  2LXB A;  1W2B O;  3BCC E;  5APV A;  4WVZ A;  3FGA D;  3GW6 A;  1N86 A;  2PAJ A;  3RGU A;  4DCK A;  5APW A;  2KYV A;  3V4W A;  4Y99 B;  1GW3 A;  5C39 A;  1RY3 A;  3LW5 H;  2N1T C;  3WU2 H;  2A06 E;  1NKN A;  3ABV C;  2K37 A;  1JTH A;  1JTH B;  2MKV A;  3OW2 O;  1VQ9 P;  1PGJ A;  2P7J A;  3W67 A;  4LC1 A;  1BGY J;  3F5H A;  3L71 E;  3KXD A;  1AJY A;  5KLI B;  3AEA C;  3CX5 E;  2YMY A;  1P84 D;  3I5C A;  5E79 E;  4GIF A;  1QL1 A;  1T8Z A;  3W68 A;  3EQ2 A;  1CZQ A;  4GOF A;  2B9B A;  1KQF B;  5BVZ A;  1R5L A;  2J5U A;  4GT1 A;  2XU6 A;  5AW9 B;  1YBK A;  1VQN P;  4PV1 C;  3AE7 C;  1JY2 O;  1JMM A;  2WMM A;  2C9L Y;  1BCC J;  3U1A A;  4WY4 C;  4R4M A;  2YKO A;  1SQX G;  1PPJ D;  1FS0 E;  5H2F E;  3CCR P;  3CCS P;  2E5Y A;  4N78 D;  2QJY B;  5KAI H;  1IK7 A;  3MP7 B;  1SS1 A;  4GKG A;  1L4A A;  2N1T D;  4EOT A;  1JMB A;  3I55 P;  3PTZ A;  3VMY A;  3L75 D;  3K5B A;  2GM4 A;  2G8Y A;  2AEF A;  1P84 H;  3LID A;  4D6T J;  3CWB G;  5KKZ C;  1LTA C;  1E79 H;  3RL0 B;  5B66 H;  1HVV A;  4A7P A;  5L8R J;  3M9B A;  3ITK A;  3M91 A;  1S2E A;  4ZNC A;  2HPC A;  4I7Z C;  2HPC B;  5BU8 B;  1S3J A;  3P8M C;  3L35 A;  2E75 C;  2WPV B;  2IBZ D;  2FYU K;  1GW4 A;  1GL2 A;  1GL2 B;  4PV1 D;  2FYU D;  2V7Q H;  1SQV J;  2QJP B;  2WPR A;  1MFT A;  4WY4 D;  1KC8 Q;  1YYC A;  3L4F A;  1KFM A;  1ZOY C;  5GTI H;  1PP9 G;  2OTJ P;  2WWW A;  2Q1K A;  1JO5 A;  5AW6 B;  5KAI E;  1YQ3 C;  5AW0 B;  1U57 A;  4CPG A;  1N73 C;  1FZC A;  1FZC B;  1SQB G;  1VF5 C;  3Q2Y A;  1CSB A;  2FXO A;  4PD4 D;  5AW4 B;  3R4Y A;  2V4H A;  4H44 B;  1W5C E;  4OWF A;  4JYB A;  3A0B E;  4UB8 E;  3MGN A;  3FX0 A;  2QG4 A;  3H32 A;  1FOS E;  3H32 B;  5B66 E;  1SLQ A;  1BCC D;  1LTS C;  2VRS A;  1DX7 A;  1URQ A;  1URQ B;  5AW5 B;  3GHG A;  1OMI A;  3GHG B;  1EDL A;  4YXD C;  2NPS A;  1DEB A;  2NPS B;  5APX A;  2E75 D;  1FOS F;  1NTM G;  4RO0 A;  3RK2 D;  1KOR A;  1FZF A;  3A0H H;  1LTT C;  3CCJ P;  3I56 P;  1SQP K;  5GTI E;  2I1J A;  1IFN A;  3C9I A;  1VPC A;  2BCC D;  3V2R A;  2PRR A;  3L74 D;  1L0L E;  4D6T D;  1OW8 A;  1VF5 D;  1P84 I;  4PD4 H;  1BE3 E;  5TJH A;  1VQ7 P;  4TLF A;  1LP1 A;  3H1L G;  3KHU A;  1LP1 B;  1LWU C;  1Y47 A;  2XV5 A;  1T6A A;  1M7L A;  4HKZ H;  3VP8 A;  3H1J G;  1HWT C;  1SQV K;  3AEC C;  1EDK A;  1OIP A;  3L72 J;  1PPJ G;  1SQV D;  2OYI A;  2OYI B;  3L70 E;  4H13 B;  2AEJ A;  1IZN B;  5KLV G;  3BCC J;  1KV4 A;  4JBZ A;  2KLV A;  2WPS A;  4W7Y A;  1WRG A;  2B87 A;  2B87 B;  1RE4 A;  2FYU E;  2OYO A;  4AYC A;  1MUU A;  1HGZ A;  1M90 Q;  2FBW C;  3A0H E;  2GA1 A;  1YJ9 P;  3SFD C;  1EQ7 A;  2JWD A;  4U3F D;  3UIA A;  1WMK A;  1UII A;  3JSV C;  4HYT B;  1X22 A;  1OWA A;  3E1R A;  2Q9I A;  1KFN A;  3WUT A;  3Q3D A;  4NPF X;  4PD4 E;  2IFM A;  4YTP C;  1R5S A;  2IBZ G;  2JR8 A;  1KQG B;  2I1K A;  1CW5 A;  2IBZ I;  3CCM P;  1HGV A;  4OGQ B;  2YMK A;  1RF0 C;  5KJ7 C;  2WQY C;  1A02 J;  1NVO A;  2HOD A;  2HOD B;  1FJP A;  2I8D A;  2R5D A;  1BGY G;  1LTI C;  1NAY A;  1NU1 J;  2KZI A;  3T97 B;  4ZMD A;  3D6Y A;  4K3A A;  1K05 A;  1SFC C;  1FDI A;  1T3U A;  2R32 A;  4LGD E;  1AV1 A;  1Q7Y Q;  1SQP E;  1S9K D;  1ZXG A;  4NPE A;  3TGU J;  4ZKU A;  1BCC G;  4PV1 B;  3L74 E;  5AW1 B;  1KN7 A;  1SP4 A;  2OGU A;  3L72 D;  2YKP A;  1KTM A;  4H0L C;  3HUS C;  4DZO A;  2JWA A;  2WSS H;  3AEG C;  1ZR4 A;  5CCH C;  1AA0 A;  1QVF O;  3OAK A;  1DEE G;  1LTJ A;  5KJ7 D;  1LTJ B;  1HTL C;  2YO2 A;  3V6I A;  1YQ4 C;  2WSC J;  1SQX K;  1M1J C;  1RE3 C;  1SQX D;  1KYO I;  3CXH D;  4D6T G;  2Q3I A;  4PJ0 E;  1FZG A;  1MZ9 A;  1SFC D;  1PGQ A;  5AW8 B;  4RJT A;  1QGK B;  3V2N A;  1S5L H;  4U3F E;  1G2C A;  1QX8 A;  1G2C B;  1HBW A;  1NTZ J;  3P32 A;  2E75 B;  2C9N Y;  4IL6 H;  1SQV G;  1FZE A;  3H1I J;  3RK2 B;  3SWY A;  3H1H J;  3FWL A;  2POH A;  4OH8 B;  4O9B A;  3HD7 C;  1PIX A;  1MKM A;  2E76 C;  2H8P D;  3CWB D;  3G9R A;  1T3J A;  3MD0 A;  1OW7 A;  4H0L D;  1GMJ A;  1NU1 D;  3II6 A;  1J1D C;  4L76 A;  2J59 M;  4EYY Q;  2JJL A;  4DJG A;  3MIW A;  5CCH D;  3O6Q A;  4N3Y B;  2ZXX A;  3O6Q B;  1N73 A;  1H8A A;  1RH5 B;  1N73 B;  1VF5 B;  3B5N A;  3B5N B;  3IN6 A;  4AUW A;  1N7S A;  1N7S B;  3GG2 A;  1NH4 A;  3E1I A;  3GF7 A;  3CXH H;  1PP9 D;  3GLM A;  1EZV D;  3MUD C;  3TGU D;  2RKL A;  1AVY A;  2OTL P;  5AVQ B;  1SQB K;  4XFJ A;  3B4S A;  1RF1 A;  2FYZ A;  3E7K A;  1RF1 B;  1SQB D;  2N9B A;  1ZN5 A;  2H88 C;  4Z1M H;  3CMA P;  1S9K E;  2KSJ A;  3VP9 A;  2JDI H;  2FY8 A;  2KB7 P;  4OVN F;  1ZV8 A;  3VOP A;  2C0W A;  1L0N J;  3RBX A;  3CLQ A;  1VQ6 P;  2M0B A;  3HD7 D;  2E76 D;  3M0D A;  2H89 C;  1KB9 D;  3CCU P;  3TF5 A;  2FKW B;  2HFE D;  4UB6 E;  1NTM K;  3HTK A;  3HTK B;  2JEE A;  1QVG O;  1NTM D;  2FYN C;  2KI7 B;  1LWU A;  1VQ4 P;  1LWU B;  1SQX E;  1NTZ D;  3CC2 P;  3U59 A;  2Y0C A;  3RBZ A;  1FAV A;  5GTH H;  3L72 G;  3BRT B;  2R5B A;  1KIL E;  3H1I D;  1HJB A;  1GZL A;  3BCC G;  5AVS B;  1N7L A;  1IO4 A;  3M0A A;  3SWK A;  1BDC A;  1YIT P;  1GK6 A;  1IFD A;  3H1L D;  3FWN A;  1NTK J;  4C7R A;  4DT0 A;  3H1J D;  2XDJ A;  2E42 A;  1KB9 H;  2ZXE B;  3NFQ A;  5KLV K;  1Q81 Q;  2O1K A;  5APY A;  5KLV D;  4QMA A;  2ZYA A;  2PP6 A;  2KSE A;  3CXH I;  3PLN A;  2RH0 A;  3P8C D;  3WU2 E;  3IFM A;  1H88 A;  3NXS A;  3A3Y B;  2KZJ A;  3H1K J;  1SQQ J;  2AEM A;  3L73 J;  1BDD A;  5CCG A;  1OFC X;  1X9V A;  2NRG A;  3KYQ A;  2P58 A;  1L2P A;  3AE8 C;  1YIJ P;  1FC2 C;  2ZVO B;  3KZI H;  1RF0 A;  1OXZ A;  1NU1 G;  1U7M A;  2KK7 A;  1LTG C;  2KIK A;  1J2J B;  3V5B A;  3B71 A;  1R8E A;  5KTB A;  5CBN A;  1KIL A;  1KIL B;  1SVF A;  1EC5 A;  2QRX A;  1KD1 Q;  1KB9 E;  1NOH A;  1EZV G;  2Y0E A;  2DW3 A;  3TGU G;  1BSN A;  3N4X A;  3G6E P;  3VMZ A;  1BGY D;  1KQS O;  4L75 A;  1EZV I;  3AED C;  1IFI A;  2CPB A;  1FDO A;  4I2L C;  4JPZ B;  3C1L A;  3P7K A;  4H0L B;  2W6B A;  2KNC A;  2YIU C;  2KNC B;  4ZKP A;  1NTK K;  1GD2 E;  1XTC C;  4R4L A;  4C46 A;  1P84 E;  1NTK D;  1JCC A;  3GF3 A;  3SWF A;  3BVH A;  2IX7 C;  2QA4 P;  2ZJS E;  1N8R Q;  1M1J A;  1AVO A;  1RE3 A;  1M1J B;  1KB9 I;  4W7Z A;  2M3B A;  3H1L E;  2Z5H A;  2W8Z A;  3AE4 C;  4JYC A;  2FXM A;  1AFO A;  1NTZ G;  1SQQ K;  1PPJ E;  3V2Q A;  3H1K D;  1LT9 C;  4EI2 A;  1SQQ D;  4N78 E;  5CMZ A;  5KLV E;  1Y9B A;  1KYO D;  1KQL A;  3H1I G;  2KS1 A;  1W2E A;  2KS1 B;  1K04 A;  3H1H G;  4BXL A;  1FJK A;  2D2C C;  3HD7 A;  1Q82 Q;  1LTB C;  2C0X A;  3HD7 B;  2E76 B;  3L75 E;  3PP5 A;  3H25 A;  3IR9 A;  3OJA B;  1Y8A A;  5BU5 A;  1OX3 A;  4JQ0 D;  1J1D B;  2O01 N;  1K9M Q;  1JEK A;  2JP3 A;  1WT6 A;  3H6P A;  3CCQ P;  2M5A A;  1X0T A;  2M5A B;  1JB0 J;  3TSI A;  2IBZ E;  3N7N A;  5KLI C;  2XKM A;  4HB1 A;  2IYO A;  2WSE J;  3JC2 2;  1ZLL A;  3V4Q A;  1KYO H;  3HE4 A;  1K73 Q;  3HE4 B;  1MV8 A;  1M56 D;  1JNM A;  1L0N G;  2D2C D;  1VQO P;  4M3L A;  4BWN A;  2Q6Q A;  5APQ A;  1PGP A;  2HG5 D;  1G1J A;  3L71 J;  2J58 A;  1L4A C;  2N1T A;  3TYY A;  2N1T B;  4RES B;  2B89 A;  2K1A A;  1BCC E;  3AEE C;  2FYN B;  2RN0 A;  1NWQ A;  3T97 A;  1JUN A;  3RK3 C;  1RQV A;  2FFD C;  3AEB C;  2WZ7 A;  1YJN P;  3ZDM A;  2HR3 A;  3CI9 A;  1KYO E;  4RKU J;  2QSI A;  2BCC E;  3LW5 J;  1NTK G;  4YXW H;  2K88 A;  3F89 A;  2WIT A;  2KOG A;  1GL2 C;  1K8A Q;  2ZVN B;  4D6T E;  1IC2 A;  4WY4 A;  3TDK A;  4WY4 B;  5KAF H;  5AVU B;  4WBA A;  1JOC A;  2XNX A;  3BCC D;  1VQK P;  2CPS A;  2Y9Z A;  3S9O A;  1L4A D;  5AVZ B;  1LJ2 A;  4YPC A;  1SQV E;  3H1K G;  1SQQ G;  3L73 G;  1QL2 A;  2YXR B;  1RHZ B;  2O1J A;  2IPP A;  3VMA A;  3RK3 D;  5AVY B;  5KKZ B;  2ZYG A;  2WSF J;  5CJ0 A;  1DH3 A;  4ASW A;  1PV3 A;  1EDJ A;  5B5E H;  3GHG C;  1NHL A;  4I7Z B;  1USD A;  1GL2 D;  1USE A;  1HH0 A;  5AVT B;  3CX5 D;  3MZW B;  1ZR2 A;  5CBO A;  2QM7 A;  1LNQ A;  1NU1 K;  1DD4 A;  2JO1 A;  3TK1 A;  2O3J A;  2WVR A;  1D7M A;  2XND H;  4KHX A;  4TT3 H;  3KPE A;  1FU1 A;  3A7O A;  1NAF A;  1E5W A;  2LKM A;  4U7J A;  1Z56 A;  2V7Q J;  2BAS A;  2IZ1 A;  1H0T A;  1H0T B;  3USS A;  3O8Z A;  2W6A A;  4W80 A;  2OYI C;  4H13 C;  1S5L E;  3AE5 C;  2IZ0 A;  1RQU A;  4GDO A;  3BAT A;  2A45 G;  3PH0 A;  4I1L A;  2XZR A;  5EFW B;  1Q2N A;  3CX5 H;  1RE4 C;  2Q7C A;  1L0L J;  4IL6 E;  1J1E C;  1IFM A;  5E79 H;  1BE3 J;  3L72 E;  1GK4 A;  2E74 C;  1LT9 A;  1LT9 B;  3NTN A;  2YXQ B;  3JCU H;  1EXI A;  3QH9 A;  4ASV A;  2QIW A;  3Q5P A;  4AQR D;  2LXC B;  2OYH C;  1PFI A;  2D2C B;  1GU5 A;  3L70 J;  1KZU B;  2Z5I A;  5H2F H;  2FXP A;  2QJK C;  5DJT B;  3CC4 P;  1NTZ K;  1CI6 A;  2L5G B;  1CI6 B;  1VQL P;  3RK3 E;  2GUV A;  3CXH E;  2FYU J;  4GOE A;  3D70 A;  4OGQ C;  3H1H D;  4H13 D;  2Z4E A;  2HLO A;  2O01 J;  2YO3 A;  5AVR B;  3PJS K;  2CK3 H;  1Q86 Q;  2N9Y B;  2E74 D;  1QLE D;  2K9J A;  2K9J B;  3CWB E;  3LIE A;  3HE5 A;  2WSC H;  3HE5 B;  1NU1 E;  2A06 G;  4XA4 A;  3JCU E;  4KT0 J;  3CCV P;  1HJ0 A;  1ZRT D;  1IJD B;  5K5G B;  1A02 F;  3G4S P;  2P10 A;  2WSF H;  2W90 A;  3PRJ A;  3L71 G;  1EDI A;  3AE2 C;  4B86 A;  1S1C X;  3CCE P;  1H89 A;  2PFX A;  5CJ4 A;  3U1C A;  1PP9 E;  3MHV A;  1EZV E;  3M9H A;  1L4A B;  1PGO A;  1L0L K;  3TGU E;  5GTH E;  4NPD A;  4OGQ D;  1L0N K;  1L0L D;  1LTJ C;  5KJ7 A;  3CX5 I;  3FXD A;  1L0N D;  2KLU A;  1BE3 D;  2P67 A;  1FZB A;  3QWO C;  1SQB E;  1SQP J;  2BCC J;  3A0B H;  4UB8 H;  1FZA A;  1OVV A;  3RK3 B;  4IFF A;  3L74 J;  1SFC A;  1SFC B;  2MJZ A;  2FFD A;  2FFD B;  2IFN A;  5DJU B;  1LT1 A;  3L70 D;  2ITA A;  2WT7 A;  2WT7 B;  1M57 D;  2KP8 A;  2QE7 H;  2W83 C;  3BRV B;  3RK2 C;  5APU A;  1GDT A;  1NTM E; 
#chains in the Genus database with same CATH homology
 1JTH B;  2Q3I A;  3HE4 A;  1FZG A;  1MZ9 A;  3HE4 B;  1SFC D;  1MV8 A;  3HUS A;  4N6J A;  3HUS B;  5AW8 B;  1JNM A;  3V2N A;  2P7J A;  4M3L A;  4LC1 A;  5CCH A;  1G2C A;  1HBW A;  1G2C B;  1JY3 N;  5APQ A;  3P32 A;  3B8E B;  3B5N C;  2HG5 D;  1JY3 P;  2YMY A;  2C9N Y;  1G1J A;  1FZE A;  2J58 A;  3RK2 B;  1N7S C;  3I5C A;  3SWY A;  3R2P A;  4GIF A;  2POH A;  4OH8 B;  1L4A C;  2N1T A;  3TYY A;  2N1T B;  1QL1 A;  1T8Z A;  3HD7 C;  4O9B A;  3MTU E;  3EQ2 A;  4RES B;  2H8P D;  1CZQ A;  1T3J A;  3MD0 A;  5BVZ A;  5AVX B;  1JCD A;  4GT1 A;  2XU6 A;  5AW9 B;  3II6 A;  1NWQ A;  1J1D C;  1JY2 O;  1JMM A;  2J59 M;  2JJL A;  2C9L Y;  3MIW A;  5CCH D;  4N3Y B;  5CHX A;  3T97 A;  3U1A A;  1RF1 C;  4WY4 C;  1JUN A;  3RK3 C;  1N73 A;  1H8A A;  1NKZ B;  1N73 B;  2YKO A;  3KDP B;  3B5N A;  3B5N B;  2FFD C;  4N78 D;  2WZ7 A;  3P8C E;  4AUW A;  4C7N A;  1N7S A;  4C7N B;  1N7S B;  4EIJ A;  1NH4 A;  3E1I A;  4GKG A;  3VTP C;  1L4A A;  2N1T D;  2Q5U A;  4EOT A;  3CI9 A;  2O01 H;  3M0D C;  4Y99 C;  4LLH A;  4JF7 A;  3VMY A;  2WIT A;  2KOG A;  1GL2 C;  5AVQ B;  1SQB K;  1IC2 A;  1RF1 A;  2FYZ A;  1RF1 B;  1FBM A;  4WY4 A;  2GM4 A;  4WY4 B;  2N9B A;  5AVU B;  1ZN5 A;  4WBA A;  1JOC A;  1N2D C;  1S9K E;  3B5N D;  2KSJ A;  3LID A;  3VP9 A;  2XNX A;  1LTA C;  3RL0 B;  1HVV A;  2KB7 P;  2CPS A;  1ZV8 A;  3VOP A;  2C0W A;  1N7S D;  3OA7 A;  1FDM A;  1L4A D;  3M9B A;  3CLQ A;  5AVZ B;  2H7H A;  1XTG B;  3HD7 D;  1X79 B;  3M91 A;  2HPC A;  3M0D A;  2HPC B;  3MUD A;  5BU8 B;  3P8M C;  3TNU A;  3L35 A;  3TNU B;  2FYU K;  1GW4 A;  1GL2 A;  1GL2 B;  1QL2 A;  2FKW B;  2HFE D;  2O1J A;  2WPR A;  2IPP A;  4WY4 D;  4WB4 A;  3RK3 D;  1GU4 A;  1YYC A;  1NTM K;  3L4F A;  1KFM A;  3HTK A;  3A2A A;  3HTK B;  2JEE A;  2WWW A;  2WTY A;  1JO5 A;  5AVY B;  5CJ0 A;  5AW6 B;  5APT A;  3EFG A;  1J1E B;  1LWU A;  1LWU B;  1DH3 A;  1YTZ T;  5AW0 B;  3U59 A;  5AVV B;  1N73 C;  1FZC A;  1FAV A;  3GHG C;  1NHL A;  1FZC B;  4IFD K;  1IFJ A;  1CSB A;  3BRT B;  2P1J A;  2R5B A;  5AW4 B;  2QM8 A;  1GZL A;  1HJB A;  1GL2 D;  4XE5 B;  1HH0 A;  5AVT B;  5AVS B;  1N7L A;  1IO4 A;  3M0A A;  4JYB A;  1ZR2 A;  2OYH A;  2OYH B;  3MGN A;  2QM7 A;  1JY2 N;  1GK6 A;  1NU1 K;  1IFD A;  3TK1 A;  3H32 A;  1FOS E;  1JY2 P;  3H32 B;  3A5T A;  1SLQ A;  5CCG C;  1LTS C;  4C7R A;  2VRS A;  1G1I A;  3HRN A;  1DX7 A;  1URQ A;  1URQ B;  3V2P A;  2XDJ A;  5AW5 B;  3VYI A;  3GHG A;  2E42 A;  3GHG B;  4KHX A;  2NPS A;  1DEB A;  2NPS B;  5APX A;  3KPE A;  3VN0 A;  2ZXE B;  3RL0 C;  3M06 A;  1FOS F;  3NFQ A;  1FU1 A;  5KLV K;  2O1K A;  5APY A;  3A7O A;  3RK2 D;  1FZF A;  1NAF A;  2PP6 A;  1E5W A;  1LTT C;  2LKM A;  3P8C D;  1Z56 A;  3IFM A;  1H88 A;  3NXS A;  1SQP K;  3A3Y B;  3L36 A;  2BAS A;  3WMM 0;  2I1J A;  2P2U A;  1IFN A;  3O8Z A;  3C9I A;  2W6A A;  1VPC A;  4W80 A;  2OYI C;  3M9Q A;  5CCG A;  3V2R A;  1KIL C;  1X9V A;  2ZFC A;  3KYQ A;  4I6M C;  2WPQ A;  3BAT A;  2A45 G;  4I1L A;  2XZR A;  2HYN A;  1RF0 A;  1RE4 C;  1OXZ A;  1AQ5 A;  2Q7C A;  1J1E C;  1IFM A;  1LWU C;  2A45 H;  1GK4 A;  1LTG C;  1J2J B;  3V5B A;  2XV5 A;  1M7L A;  3KQG A;  1FZC C;  2R3C A;  3VP8 A;  1LT9 A;  1HWT C;  1LT9 B;  1SQV K;  3NTN A;  5KTB A;  2OYI A;  2OYI B;  5CCG D;  1KIL A;  1KIL B;  4DOJ A;  1SVF A;  4AQR D;  2OYH C;  1PFI A;  1IK9 A;  1GU5 A;  2KLV A;  2WPS A;  1KZU B;  2Z5I A;  3RL0 D;  1NOH A;  3G3Z A;  4W7Y A;  1WRG A;  1RE4 A;  4HH2 A;  2H43 A;  3N4X A;  3VMZ A;  4AYC A;  1MUU A;  1NTZ K;  1HGZ A;  1CI6 A;  2L5G B;  1CI6 B;  1URQ C;  1EQ7 A;  2GUV A;  1IFI A;  2YNY A;  3UIA A;  2YKQ A;  4IFM A;  5AW2 B;  2CPB A;  2NPS C;  3BAS A;  4I2L C;  1YTZ I;  3P7K A;  1T2K C;  4HYT B;  2W27 A;  2W6B A;  1KIL D;  2Z4E A;  1OWA A;  2HLO A;  2YO3 A;  2Q9I A;  5AVR B;  1KFN A;  4ZKP A;  1NTK K;  1GD2 E;  1XTC C;  4C46 A;  1JCC A;  2IFM A;  3SWF A;  5APS A;  1LGH B;  3BVH A;  1JY3 O;  2IX7 C;  1VDF A;  3L37 A;  2I1K A;  2WSE H;  5AW7 B;  1M1J A;  3VMX A;  1CW5 A;  1RE3 A;  1M1J B;  3LIE A;  1GTW A;  1NO4 A;  3HE5 A;  4W7Z A;  2M3B A;  2WSC H;  3HE5 B;  1HGV A;  1RF0 C;  5KJ7 C;  4XA4 A;  1A02 J;  2Z5H A;  2HOD A;  2GUS A;  2HOD B;  4JYC A;  1FJP A;  2FXM A;  1AFO A;  1IJD B;  2R5D A;  1A02 F;  1LTI C;  3NMD A;  1X8Y A;  1SQQ K;  2WSF H;  3V2Q A;  2OAR A;  1LT9 C;  4N78 E;  5CMZ A;  1SFC C;  1T3U A;  1KQL A;  4B86 A;  1W2E A;  1H89 A;  2R32 A;  5AW3 B;  1FJK A;  5CJ4 A;  4LGD E;  1URQ D;  3U1C A;  1HUC A;  2E43 A;  3M9H A;  1L4A B;  3HD7 A;  1L0L K;  1LTB C;  2C0X A;  3HD7 B;  2NPS D;  1L0N K;  1LTJ C;  5KJ7 A;  1T2K D;  1S9K D;  3PP5 A;  3CL3 D;  3IR9 A;  2P67 A;  3OJA B;  5BU5 A;  4ZKU A;  1FZB A;  2A45 I;  1J1D B;  5AW1 B;  1MFZ A;  2M8R A;  5AVW B;  1SP4 A;  1FZA A;  3RK3 B;  4IFF A;  5APV A;  2YKP A;  1SFC A;  1SFC B;  2MJZ A;  1WT6 A;  2FFD A;  3H6P A;  3HUS C;  4DZO A;  2FFD B;  2IFN A;  1N86 A;  2PAJ A;  1ZR4 A;  3TSI A;  5CCH C;  2WT7 A;  3OAK A;  2WT7 B;  5APW A;  3N7N A;  1LTJ A;  2KYV A;  2KP8 A;  1LTJ B;  5KJ7 D;  3V4W A;  1HTL C;  4Y99 B;  2XKM A;  1GW3 A;  2YO2 A;  3BRV B;  3RK2 C;  1RY3 A;  3LW5 H;  1SQX K;  5APU A;  1GDT A;  1M1J C;  2N1T C;  1RE3 C;  1NKN A;  1ZLL A;  3V4Q A;  1JTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...