1N7LA

Solution nmr structure of phospholamban in detergent micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
b'AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title NMR solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles.
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Signaling protein
total genus 22
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7lA00
1FJKA 2KYVA 2HYNA 1N7LA 1ZLLA 2M3BA 2KB7P 1FJPA
chains in the Genus database with same CATH superfamily
1JY2P 3TDKA 3L72D 1FDIA 1XTGB 3BATA 1BCCD 2H7HA 2R5DA 3CCMP 3ZDMA 5DJTB 3TNUB 1WT6A 4Z1MH 1HTLC 1HGZA 5AVUB 1UIIA 1KN7A 4XA4A 2FXOA 2ZT9B 5CJ0A 4GODA 1NAFA 4ASWA 5B5EE 1T6AA 1GW3A 3TGUE 1LJ2A 5AW3B 3AE8C 5K5GB 1GL2B 2AXTH 2IZ0A 3BCCE 2YIUC 3AEFC 4H44C 3HUSC 1GU4A 3H1HG 1BE3J 3WMM0 3CL3D 4NPEA 1HWTC 3BCCD 3Q5RA 2WPSA 2QJYB 1FS0E 1L0LE 2E75D 1DEEG 3IN6A 1RE3C 1T2KD 4JF7A 4IFFA 2O01J 1LP1A 4GOFA 3RK3E 1X9VA 1PP9J 1OW7A 4OH8B 2WSCH 2L91A 1L0LD 5L8RJ 1M1KQ 3G4SP 5GTHH 5CCGA 3E1RA 4LLHA 3Q2YA 1G2CA 3GG2A 4PV1D 1N73C 4M3LA 2O1KA 1NTKE 1SQVE 4Y28J 4MN4C 1KILE 5GTHE 1W5CE 3A0BH 3CCUP 2WMMA 4GIFA 2JKVA 2E74D 2KZJA 1H8AA 1FJPA 2OARA 1KQLA 2V7QH 1MFZA 3T97B 3OW2O 3B4SA 1H0TA 1LTJA 2K37A 4AQRD 2HYNA 2CK3H 2ZYAA 4XFJA 3L74E 4IL6H 1DD4A 1L4AA 3H32A 2BEZF 2QRXA 1YQ3C 1YHQP 3CC4P 2ZT9D 3L74D 4IL6E 2ITAA 2ZYGA 1HBWA 2Z5HA 3IFMA 3M9HA 1SQQE 3FWNA 2R3SA 1GL2D 2KLUA 2QJKB 2LR2A 1KFMA 1PGQA 3A5TA 3H1IG 2BCCG 1NU1K 2WPVB 2O01N 1MUUA 1LTBC 1DH3A 3LIDA 3M0DC 1NO4A 3RGUA 4H44B 3HUSB 3C8VA 3RK2D 2Z5IA 3P7KA 1N7SA 4U3FJ 2CPBA 3SWYA 4PJ0H 3CPWO 1OFCX 2IZ1A 3A0HH 2OYIC 2RKLA 2WSFH 3H1HJ 1SLQA 2IFMA 1WRGA 1ZW0A 1FZAA 4PJ0E 1RF0A 3NMDA 2XDJA 1KQSO 3C9IA 2YXRB 5AW4B 1GMJA 1HGVA 2KXPB 1SP4A 2XU6A 1BE3D 3CX5I 4CPGA 5APSA 3C1LA 2FYUG 2HLOA 4EDFA 4D6TE 3EFFK 3O6QB 1LT9C 3B5NB 2AEMA 1SFCA 3VP9A 2AXCA 5TISH 2W6AA 5KLVJ 1LTSC 1NU1G 4D6TD 5KJ7C 1YYCA 3MHVA 1KTMA 3BRVB 3RL0C 3QWOC 2E75C 1T2KC 4HH2A 4EIJA 3MTUE 3GF7A 3LW5J 5AW9B 1UIXA 1X22A 3AEAC 2XNXA 4BWNA 1YQ4C 4IL6X 1BDDA 1FBMA 3WUTA 3L75G 2WZ7A 3B8EB 2HG5D 1S1CX 3L70G 2FFDA 1FDMA 3B71A 3E7KA 1URQB 1QVGO 2KP8A 3VYIA 2QJPC 3H1JG 4IFMA 4H44D 1SQBJ 2E74C 3G6EP 3CXHE 2WPRA 2OYHA 2HFED 2KIKA 2POHA 1KQGB 4DT0A 2JEEA 2O3JA 3H1IJ 2BCCJ 2HR3A 5B66H 1ZN5A 3MUDA 1JB0J 3CXHD 1FU1A 3AE4C 1DEBA 5APTA 3GHGC 3SSUA 1VQ4P 1VQPP 1JCDA 3JCUH 4W80A 5B66E 1GD2E 2P2UA 2BEQD 2B9BA 1RQVA 4ZMDA 2FKWB 5CCHD 1X0TA 1Z56A 3CX5H 1OIPA 1FZCA 1GL2C 2YKPA 3CCSP 1GDTA 3JCUE 1AA0A 3PP5A 1KILA 1FC2C 3B5ND 4WWIA 1PZQA 3MIWA 5KAFH 1NHLA 2BASA 2N1TA 1BGYJ 1VQ7P 2A45I 4L75A 4K3AA 2IBZG 3D6YA 2OYOA 1L0NJ 3H1HD 2QJYC 1YI2P 1NH4A 1FOSE 2FYUJ 1PP9G 1ZV8A 1OMIA 3PTZA 3HTKB 5KTBA 1KZUB 1JO5A 3RL0B 3CC2P 1N86A 3HD7A 4RKUJ 2Y9ZA 1EC5A 1EDLA 2B88A 3R4YA 4U7JA 4L73A 3PRJA 4QMAA 3WUUA 1GZLA 3F5HA 2XZRA 2OGUA 2WSSH 2WTYA 4W7YA 2JR8A 1PGJA 2WT7A 5KAIH 1RE4C 2ZXEB 2FXMA 1LTTC 3CCVP 3VMAA 2FY8A 3L72E 2XNDH 2NRGA 4TLFA 4HB1A 4OVNF 5KAIE 3V4QA 2HPCB 1FZBA 2V7QJ 2B89A 3CCEP 2NPSA 1BSNA 3H1JJ 2H43A 4N3YB 1R5SA 4BRYB 5APQA 2IFNA 1D7MA 2KI7B 3RBXA 3Q3DA 2W8ZA 1YTZT 1MV8A 3H6PA 1HVVA 5B5EH 5TJHA 1IFPA 5BU8B 3AE5C 1M7LA 2E42A 2QEXP 3GHGB 2PP6A 4C7NB 2WSEJ 5AVWB 4DZOA 4W7ZA 5KLVK 3AEGC 1VDFA 4WVZA 1FZEA 3H1KG 2QJKC 4WY4A 1MZ9A 1NVOA 3GMAA 1KV4A 1LWUA 4U3FG 3HE5B 1QX8A 1M1JA 4AYCA 2A45H 1CSBA 1S72P 3OJAB 4GT1A 2RN0A 3H1ID 4PD4D 1Y47A 1IFJA 2AEFA 2PRRA 2ZYDA 3CI9A 5KJ7D 5CCGC 4GKGA 3CCLP 3RL0D 5CMZA 1EDIA 1LGHB 3R2PA 1IFIA 2Z4EA 1PPJG 1BDCA 1PGOA 1YJ9P 3CWBG 1NTZJ 1QLED 1JTHB 3GLMA 1LNQA 1TU3F 2K1AA 1RF1B 1JNMA 2E5TA 2ZFCA 3VOPA 3AE2C 1RQUA 1HH0A 1CI6B 5CCHC 2KNCA 5KKZC 1LTJC 5KLVG 3B5NC 2KZIA 4L74A 2NPSB 2C9LY 1U57A 2I8DA 3A3YB 5APUA 1PGPA 1E79H 5AVQB 1NU1E 1DD3A 1EQ7A 1RE3A 3L71J 3M91A 1N2DC 5CJ4A 4RO0A 3H1LJ 2B87A 3L73J 4I6MC 1CZQA 1NU1D 2K9JA 2ZVOB 2A06E 2JJLA 3IAOA 2Q5UA 3RL0g 1N73A 3L75E 4H0LB 3L70E 1VQLP 1J2JB 1L0NK 2A06D 1NTMJ 3M06A 2FYUK 2Q7CA 3L75D 1SQBG 2C0WA 1URQC 3L70D 1GK4A 1SQXJ 3AECC 3W68A 2M5AA 3CXHI 1FDOA 3NXSA 1YJNP 2KS1A 1U7JA 1JMMA 3G3ZA 3H1JD 4IOIH 3H1KJ 1MKMA 1LP1B 2K3RA 5AVSB 1ZRTE 3NTNA 3I56P 2R44A 1ZP0C 1R8EA 2Y0CA 3TGUG 1G2CB 1JM0A 1K04A 1AV1A 2N9YB 1ZRTD 1BE3E 4NPFX 2QM8A 3FXEA 1NOHA 2O01H 1IK9A 1BGYG 5KLIB 1FE6A 3AEBC 2JWDA 4JQ0D 1Q86Q 1EZVG 1KC8Q 3M0DA 3HE4A 3CWBJ 1T8ZA 1L0NG 4H13B 3RBZA 3V2PA 2IBZE 2Q3IA 3II6A 1OXZA 2E76C 3M9BA 5KKZB 4OGQB 1H0TB 1LTJB 1DIPA 1JY3O 1PP9E 2OYIA 1JY2O 2IBZD 1SQPJ 2W90A 2IYPA 1L4AB 3H32B 2AEJA 2ZJSE 4GOEA 1IFDA 1NTKG 1PP9D 1SQVG 1KYOE 2FFDC 1L2PA 1VQNP 1Q82Q 3BVHA 4H0LD 1KMIZ 2QM7A 2I1KA 5AVZB 1QL2A 4JYCA 1KYOD 3WUVA 2M3EA 1AVOA 4IFDK 2HODA 1LT9A 3USSA 2M3BA 1QL1A 2XKMA 1SS1A 1S9KE 2YXQB 3AEEC 1N7SB 2FYNB 3CXHH 1VL2A 1NWQA 1NTZK 2KK7A 1BCCJ 1HJ0A 2E5YA 5E79E 1JCCA 1VF5B 4UB8E 2QIWA 1LTGC 4WB4A 4DJGA 1S9KD 5AW5B 1NKNA 5CCGD 2SPZA 1EXJA 2YMKA 1NKZB 1SQQG 2OQQA 4KJMA 3OAKA 2R3CA 3CC7P 2WITA 4Y99C 1YBKA 1Y8AA 2K9YA 1OWAA 3NFQA 2YNYA 3M9QA 2QE7H 1FZGA 1N8RQ 4L76A 4PD4I 1HJBA 2QG4A 3ABVC 1JMBA 1IO4A 3EWKA 4H13D 4U3FE 3TGUJ 2GA1A 1PL5A 3BCCJ 1SFCB 3Q1MA 4OGQD 3SFDC 1JOCA 3H1HE 3L36A 4ZNCA 4U3FD 2OTLP 3TK1A 4TT3H 2Y0DA 2E76B 3HD7C 4EYYQ 2D2CB 2IPPA 1L4AD 5M1BA 1ZXGA 4HYTB 1L0LJ 2G3AA 1KD1Q 1NTMK 3TNUA 1N7LA 1ZLLA 2Q1KA 1NTZG 2WWWA 2KLVA 4I7ZC 3AE7C 1SQXK 1JUNA 2W6BA 4O9BA 1S5LH 2FFDB 1USEA 1RF1C 3AE6C 5AW6B 3WU2H 1GL2A 3CWBD 1NJIQ 1YJWP 1NTKJ 5CBOA 1SQVJ 3U1CA 2WSCJ 1T3JA 1S5LE 5DJUB 3V4WA 5KLVE 3VN0A 1YTZI 2RMZA 3LW5H 3L71G 1RHZB 1VPCA 3KQGA 1URQD 2R5BA 1QEXA 3P32A 3WU2E 3U1AA 2MKVA 3TYYA 2NPSC 5AW7B 1JEKA 1VF5D 5C39A 2WPQA 4BXLA 4KHXA 3H1LG 2OYHB 2K88A 4ASVA 2H8PD 5KLVD 3L73G 2WVRA 2V4HA 1NYHA 1P84I 1YIJP 2KSEA 4N78E 3RK3B 3GW6A 3L74J 2QA4P 3D6ZA 3SWKA 1Q90D 1NGMB 1VQ6P 3BASA 3BRTB 4N78D 1NTMG 2J59M 4H0LC 5AW8B 4C7RA 1IFMA 1SQXG 1FJKA 1SQBE 1FZCB 4Y99B 2GUVA 4PD4H 3EQ2A 1KILB 1SQPK 1SQQJ 3F89A 3CMEP 1RE4A 1SFCD 5BVZA 4YXWH 3GF3A 4ZKPA 2N1TB 1K9MQ 2H89C 1KORA 2N9BA 1AQTA 1SQBD 3H1IE 2BCCE 5APWA 2NZ2A 1ZR2A 4PD4E 3T97A 2IYOA 1LT1A 2P67A 2Q3EA 3V5BA 5AVTB 2E76D 2D2CD 2LXCB 1HF9A 5AW1B 1H89A 2BCCD 1Y9BA 1J1DB 2O1JA 1W2EA 1LTIC 3HD7B 1XTCC 1RY3A 1DX7A 3L35A 3PLNA 4I7ZB 4AUWA 1FAVA 5AVYB 2WSFJ 2WQYC 3JSVC 3TGUD 1BGYE 2AXTE 2LXBA 3U59A 1SQBK 2PGDA 3PH0A 3S9OA 1OVRA 3RK2B 1S5LX 1VQKP 1EZVE 5KLIC 2LKMA 2IBZI 2WT7B 1L0NE 1IK7A 1J1EC 2FYUE 4H13C 3HUSA 1GW4A 1BGYD 4D6TJ 1VQ8P 2YO2A 2YO3A 4HKZH 5APYA 3TF5A 1SQPG 3QH9A 2Y9YA 1EZVD 4OGQC 5CBNA 1L0ND 1ZR4A 5AVRB 1PIXA 5AVXB 2FYUD 2M8RA 3RK3D 4ZKUA 1IC2A 1Q2NA 2E43A 2P10A 1P84H 1KYOI 1L4AC 1IJDB 2ZAEB 2KOGA 3S4RA 1AQ5A 2JDIH 2M0BA 1BSHA 1KB9I 3KXDA 5EFWB 1P84E 1IFNA 1SVFA 1OW6A 4EI2A 1NTKD 2W83C 1SQVD 3P8CE 3AEDC 3KZIH 1KILD 1ZMEC 5CCHA 1OVVA 2VRSA 3MZWB 3A0BE 4WY4B 3S1KA 3L72G 2J58A 2N1TD 3O6QA 1P84D 2GUSA 1LWUB 3B5NA 1L0LK 3P8CD 3MP7B 1AFOA 2OTJP 1BCCG 1M1JB 4DOJA 3KZIE 3JC22 1S3JA 3AE9C 1N7SC 4C46A 2FYNC 3H1JE 3N4XA 2Q6QA 3AE1C 1M90Q 2WSEH 1VF5C 3FGAD 3G9RA 2PFXA 1K05A 3HD7D 3LIEA 1E5WA 2Y0EA 1R5LA 2OTKE 1NTKK 1SQVK 5APXA 1RF0C 1X79B 3AE3C 2YKQA 4EOTA 3VMZA 1FZFA 3IF4A 1SQQD 2KSJA 5BU5A 2YIUB 4NPDA 3BCCG 1URQA 3CD6P 1ZOYC 2FXPA 5CHXA 3VMXA 2KNCB 1A02J 1CW5A 4JBZA 3KDPB 3L4FA 1SFCC 2P58A 3V2NA 4RESB 3UIAA 3FXDA 1RH5B 4RJTA 2A45G 3FX0A 2G8YA 4YPCA 1J1EB 1OZHA 1L0LG 1W2BO 4LC1A 2NPSD 3A0HE 1USDA 2D2CC 2B87B 5APVA 1MFTA 1VQ9P 1NTZE 2P1JA 2K9JB 2JP3A 4WBAA 3V2QA 1KYOH 5AW2B 1SQQK 4R4MA 3CCJP 1N73B 2C9NY 4XE5B 1KB9H 1NTZD 2UWJE 4JPZB 3N7NA 3M0AA 1EXIA 4WY4D 4R4LA 1EDJA 3KHUA 1KB9E 4OWFA 3EFGA 3L71E 3VP8A 3FWLA 2M5AB 3G71P 3V6IA 2KS1B 1JY3N 2GM4A 3H1LE 5E79H 4UB6H 5TISE 1KB9D 4UB8H 1S4XA 2IDBA 1JY2N 3L73E 2H88C 2OYHC 3L71D 1YITP 2A06G 3HTKA 3CMAP 1M56D 3L72J 3IR9A 3ITKA 3L74G 1OVUA 5KJ7A 2RH0A 3H1LD 4GDOA 4UB6E 3MUDC 2QSIA 3RK3C 4PV1C 3L73D 3K5BA 2Q9IA 4YXDC 2C0XA 1NTME 5AVVB 1K73Q 3KPEA 1KFNA 1SQXE 2CPSA 1Q7YQ 1PFIA 3VTPC 1NTMD 1FZCC 1Q81Q 1KILC 2PAJA 1GU5A 3HE4B 3MGNA 4LGDE 2J5UA 1HUCA 4JYBA 1T3UA 2N1TC 1SQXD 3H1KE 1M57D 1VQOP 1QVFO 1LTAC 3PJSK 2W27A 2FBWC 5AW0B 1GTWA 2R32A 2OYIB 4HJGH 1K8AQ 3W67A 2HPCA 3A7OA 3MD0A 3H1KD 1S2EA 3PHLA 1KQFB 2ZT9C 3VMYA 2IX7C 2KUBA 1A02F 3H25A 3CCQP 4BRYA 1J1DC 3CLQA 4KT0J 5GTIH 1H88A 3O8ZA 2XV5A 1BE3G 3Q5PA 4DCKA 3D71A 3Q5SA 3SFEC 3GHGA 2I1JA 4C7NA 2KB7P 1G1JA 1PPJE 3I55P 2YKOA 5GTIE 1QGKB 3CWBE 3D70A 1AVYA 1WMKA 2ZVNB 1EZVI 1FOSF 2KYVA 3CX5E 2HODB 2L5GB 1NAYA 1LT9B 2ZXXA 3RK2C 4D6TG 2YMYA 1VQ5P 5H2FH 5KAFE 1PPJD 1M8OB 3HE5A 1OW8A 3KYQA 1G1IA 1PV3A 4N6JA 4YTPC 4A7PA 1SQPE 3CX5D 2QVAA 3V2RA 1EDKA 2W6JH 5H2FE 1N7SD 2MJZA 2E75B 3SWFA 1NU1J 1GK6A 1SQPD 4B86A 1U7MA 2P7JA 3OA7A 1X8YA 2JWAA 1JTHA 3TSIA 1IZNB 1AJYA 3I5CA 4PV1B 3HRNA 1RF1A 4K35A 2FYZA 3L37A 3L75J 3A2AA 3L70J 3E1IA 1CI6A 2QJPB 2DW3A 4I1LA 4WY4C 3CCRP 4I2LC 2E74B 1BCCE 1LWUC 1VQMP 1JY3P 1OX3A 3P8MC 2JO1A 1M1JC
chains in the Genus database with same CATH topology
4W80A 1JY2P 1GD2E 1LTJB 2P2UA 1IFNA 1JY3O 1SVFA 1XTGB 3P8CE 2OYIA 3BATA 2FKWB 1JY2O 5CCHD 1Z56A 2H7HA 2R5DA 1KILD 5CCHA 1FZCA 1GL2C 2VRSA 2YKPA 1L4AB 4WY4B 1GDTA 3PP5A 3H32B 1KILA 3TNUB 1WT6A 3B5ND 1HTLC 1HGZA 2J58A 2N1TD 2GUSA 3MIWA 5AVUB 1LWUB 1L0LK 1IFDA 3B5NA 3P8CD 1NHLA 2BASA 2N1TA 2FFDC 1AFOA 2A45I 4XA4A 1M1JB 4DOJA 3BVHA 5CJ0A 4C46A 1N7SC 2QM7A 2I1KA 1NAFA 3N4XA 5AVZB 1QL2A 1NH4A 1FOSE 4JYCA 1ZV8A 1GW3A 2WSEH 3HTKB 5AW3B 1GL2B 5KTBA 1KZUB 4IFDK 3HUSC 2HODA 1GU4A 3HD7D 1LT9A 1JO5A 3LIEA 1E5WA 3RL0B 1NTKK 2M3BA 1SQVK 1N86A 3WMM0 3HD7A 5APXA 3CL3D 1QL1A 1RF0C 1HWTC 1X79B 2XKMA 1S9KE 1N7SB 2WPSA 2YKQA 1NWQA 4EOTA 1NTZK 1JCCA 3VMZA 1RE3C 1T2KD 4JF7A 1FZFA 1GZLA 2XZRA 4IFFA 2KSJA 5BU5A 1LTGC 4WB4A 1S9KD 5AW5B 2WTYA 1URQA 4W7YA 1NKNA 1X9VA 4OH8B 2WSCH 5CHXA 3VMXA 5CCGD 2WT7A 1A02J 1CW5A 1RE4C 1NKZB 2ZXEB 5CCGA 3KDPB 2FXMA 1LTTC 3L4FA 3OAKA 1SFCC 4LLHA 1G2CA 4RESB 2R3CA 3V2NA 3UIAA 2WITA 1N73C 2A45G 4M3LA 2O1KA 4Y99C 1J1EB 1OWAA 3NFQA 2YNYA 3M9QA 4LC1A 3V4QA 2NPSD 1FZGA 2HPCB 1FZBA 1HJBA 2NPSA 5APVA 2H43A 4N3YB 4GIFA 1IO4A 2P1JA 1H8AA 4WBAA 3V2QA 5APQA 5AW2B 2IFNA 1SQQK 1SFCB 1FJPA 1N73B 2C9NY 2OARA 1YTZT 1KQLA 1MV8A 3H6PA 1JOCA 1HVVA 4XE5B 1MFZA 5BU8B 1LTJA 3L36A 1M7LA 3N7NA 2E42A 4AQRD 3M0AA 3GHGB 2PP6A 2HYNA 3TK1A 4C7NB 5AVWB 4DZOA 4W7ZA 5KLVK 1VDFA 3HD7C 1FZEA 2IPPA 4WY4D 1L4AD 4WY4A 1L4AA 4HYTB 1MZ9A 3H32A 1NTMK 3TNUA 1N7LA 1ZLLA 2WWWA 2KLVA 1LWUA 3EFGA 3VP8A 3HE5B 1M1JA 4AYCA 1SQXK 1JUNA 2A45H 2W6BA 1CSBA 3OJAB 1JY3N 4O9BA 4GT1A 1HBWA 2GM4A 2Z5HA 3IFMA 2FFDB 3M9HA 1JY2N 1RF1C 1GL2D 1IFJA 2OYHC 3CI9A 3HTKA 5AW6B 1GL2A 5KJ7D 3IR9A 5CCGC 4GKGA 3U1CA 3RL0D 5KJ7A 1KFMA 5CMZA 1T3JA 3A5TA 1LGHB 3R2PA 1NU1K 1MUUA 3RK3C 3V4WA 3VN0A 1YTZI 1LTBC 1DH3A 3LIDA 1IFIA 3M0DC 3LW5H 1NO4A 1VPCA 3KQGA 2Z4EA 1URQD 2R5BA 2Q9IA 3P32A 3HUSB 3RK2D 2Z5IA 3P7KA 1N7SA 2C0XA 1JTHB 3U1AA 2CPBA 3TYYA 5AVVB 3SWYA 2NPSC 5AW7B 1RF1B 2WPQA 4KHXA 1JNMA 2OYHB 2H8PD 2ZFCA 3VOPA 3KPEA 1KFNA 2OYIC 2CPSA 2WSFH 1SLQA 2IFMA 1PFIA 1HH0A 3VTPC 1CI6B 1WRGA 4N78E 5CCHC 1FZCC 3RK3B 1KILC 2PAJA 1FZAA 1GU5A 3HE4B 3MGNA 4LGDE 1RF0A 1LTJC 3NMDA 1HUCA 4JYBA 1T3UA 3B5NC 2XDJA 2N1TC 3BASA 2NPSB 2C9LY 3A3YB 1LTAC 3C9IA 5APUA 2W27A 3BRTB 4N78D 5AVQB 5AW4B 1RE3A 1EQ7A 2J59M 5AW8B 5AW0B 3M91A 1GTWA 2R32A 4C7RA 1HGVA 2OYIB 1SP4A 1N2DC 2XU6A 5CJ4A 1IFMA 5APSA 2HPCA 3A7OA 3MD0A 1FJKA 1FZCB 2HLOA 4Y99B 2GUVA 3VMYA 2IX7C 3EQ2A 1KILB 4I6MC 1SQPK 1A02F 1CZQA 1RE4A 1SFCD 5BVZA 1J1DC 1LT9C 3B5NB 3CLQA 2JJLA 4ZKPA 2N1TB 1SFCA 1H88A 3O8ZA 2XV5A 3VP9A 2Q5UA 1N73A 2N9BA 5APWA 2W6AA 1ZR2A 3T97A 2P67A 1LTSC 5KJ7C 1YYCA 3GHGA 2I1JA 5AVTB 3V5BA 4C7NA 1J2JB 2KB7P 1L0NK 1G1JA 3BRVB 3RL0C 2YKOA 3M06A 2FYUK 1T2KC 5AW1B 2Q7CA 1FOSF 2KYVA 1H89A 2HODB 2L5GB 2C0WA 4HH2A 1URQC 1J1DB 1LT9B 4EIJA 2O1JA 3MTUE 1W2EA 3RK2C 1GK4A 1LTIC 2YMYA 3HD7B 5AW9B 1XTCC 3HE5A 3KYQA 2XNXA 1G1IA 3NXSA 1RY3A 1FBMA 4N6JA 1DX7A 3L35A 2WZ7A 1JMMA 3G3ZA 3V2RA 3B8EB 2HG5D 4AUWA 1FAVA 5AVYB 2FFDA 1FDMA 1N7SD 2MJZA 3SWFA 3U59A 1GK6A 1SQBK 1URQB 2KP8A 5AVSB 3RK2B 3VYIA 4B86A 3NTNA 2LKMA 2WT7B 4IFMA 2P7JA 3OA7A 1J1EC 1X8YA 3HUSA 1G2CB 1GW4A 1JTHA 3TSIA 2YO2A 2YO3A 5APYA 3I5CA 3HRNA 1RF1A 2WPRA 2FYZA 3L37A 2OYHA 1ZR4A 2HFED 2POHA 5AVRB 2JEEA 2QM8A 5AVXB 1NOHA 2O01H 2M8RA 3A2AA 3RK3D 4ZKUA 1IK9A 1IC2A 3E1IA 1CI6A 2E43A 1ZN5A 3MUDA 4I1LA 4WY4C 1L4AC 1FU1A 1IJDB 3M0DA 3HE4A 1DEBA 1T8ZA 5APTA 2KOGA 4I2LC 3GHGC 1AQ5A 1LWUC 3V2PA 2Q3IA 1JY3P 3II6A 3P8MC 1JCDA 1OXZA 1M1JC 3M9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJK A;  2KYV A;  2HYN A;  1N7L A;  1ZLL A;  2M3B A;  2KB7 P;  1FJP A; 
#chains in the Genus database with same CATH topology
 1JY2 P;  3TDK A;  3L72 D;  1FDI A;  1XTG B;  3BAT A;  1BCC D;  2H7H A;  2R5D A;  3CCM P;  3ZDM A;  5DJT B;  3TNU B;  1WT6 A;  4Z1M H;  1HTL C;  1HGZ A;  5AVU B;  1UII A;  1KN7 A;  4XA4 A;  2FXO A;  2ZT9 B;  5CJ0 A;  4GOD A;  1NAF A;  4ASW A;  5B5E E;  1T6A A;  1GW3 A;  3TGU E;  1LJ2 A;  5AW3 B;  3AE8 C;  5K5G B;  1GL2 B;  2AXT H;  2IZ0 A;  3BCC E;  2YIU C;  3AEF C;  4H44 C;  3HUS C;  1GU4 A;  3H1H G;  1BE3 J;  3WMM 0;  3CL3 D;  4NPE A;  1HWT C;  3BCC D;  3Q5R A;  2WPS A;  2QJY B;  1FS0 E;  1L0L E;  2E75 D;  1DEE G;  3IN6 A;  1RE3 C;  1T2K D;  4JF7 A;  4IFF A;  2O01 J;  1LP1 A;  4GOF A;  3RK3 E;  1X9V A;  1PP9 J;  1OW7 A;  4OH8 B;  2WSC H;  2L91 A;  1L0L D;  5L8R J;  1M1K Q;  3G4S P;  5GTH H;  5CCG A;  3E1R A;  4LLH A;  3Q2Y A;  1G2C A;  3GG2 A;  4PV1 D;  1N73 C;  4M3L A;  2O1K A;  1NTK E;  1SQV E;  4Y28 J;  4MN4 C;  1KIL E;  5GTH E;  1W5C E;  3A0B H;  3CCU P;  2WMM A;  4GIF A;  2JKV A;  2E74 D;  2KZJ A;  1H8A A;  1FJP A;  2OAR A;  1KQL A;  2V7Q H;  1MFZ A;  3T97 B;  3OW2 O;  3B4S A;  1H0T A;  1LTJ A;  2K37 A;  4AQR D;  2HYN A;  2CK3 H;  2ZYA A;  4XFJ A;  3L74 E;  4IL6 H;  1DD4 A;  1L4A A;  3H32 A;  2BEZ F;  2QRX A;  1YQ3 C;  1YHQ P;  3CC4 P;  2ZT9 D;  3L74 D;  4IL6 E;  2ITA A;  2ZYG A;  1HBW A;  2Z5H A;  3IFM A;  3M9H A;  1SQQ E;  3FWN A;  2R3S A;  1GL2 D;  2KLU A;  2QJK B;  2LR2 A;  1KFM A;  1PGQ A;  3A5T A;  3H1I G;  2BCC G;  1NU1 K;  2WPV B;  2O01 N;  1MUU A;  1LTB C;  1DH3 A;  3LID A;  3M0D C;  1NO4 A;  3RGU A;  4H44 B;  3HUS B;  3C8V A;  3RK2 D;  2Z5I A;  3P7K A;  1N7S A;  4U3F J;  2CPB A;  3SWY A;  4PJ0 H;  3CPW O;  1OFC X;  2IZ1 A;  3A0H H;  2OYI C;  2RKL A;  2WSF H;  3H1H J;  1SLQ A;  2IFM A;  1WRG A;  1ZW0 A;  1FZA A;  4PJ0 E;  1RF0 A;  3NMD A;  2XDJ A;  1KQS O;  3C9I A;  2YXR B;  5AW4 B;  1GMJ A;  1HGV A;  2KXP B;  1SP4 A;  2XU6 A;  1BE3 D;  3CX5 I;  4CPG A;  5APS A;  3C1L A;  2FYU G;  2HLO A;  4EDF A;  4D6T E;  3EFF K;  3O6Q B;  1LT9 C;  3B5N B;  2AEM A;  1SFC A;  3VP9 A;  2AXC A;  5TIS H;  2W6A A;  5KLV J;  1LTS C;  1NU1 G;  4D6T D;  5KJ7 C;  1YYC A;  3MHV A;  1KTM A;  3BRV B;  3RL0 C;  3QWO C;  2E75 C;  1T2K C;  4HH2 A;  4EIJ A;  3MTU E;  3GF7 A;  3LW5 J;  5AW9 B;  1UIX A;  1X22 A;  3AEA C;  2XNX A;  4BWN A;  1YQ4 C;  4IL6 X;  1BDD A;  1FBM A;  3WUT A;  3L75 G;  2WZ7 A;  3B8E B;  2HG5 D;  1S1C X;  3L70 G;  2FFD A;  1FDM A;  3B71 A;  3E7K A;  1URQ B;  1QVG O;  2KP8 A;  3VYI A;  2QJP C;  3H1J G;  4IFM A;  4H44 D;  1SQB J;  2E74 C;  3G6E P;  3CXH E;  2WPR A;  2OYH A;  2HFE D;  2KIK A;  2POH A;  1KQG B;  4DT0 A;  2JEE A;  2O3J A;  3H1I J;  2BCC J;  2HR3 A;  5B66 H;  1ZN5 A;  3MUD A;  1JB0 J;  3CXH D;  1FU1 A;  3AE4 C;  1DEB A;  5APT A;  3GHG C;  3SSU A;  1VQ4 P;  1VQP P;  1JCD A;  3JCU H;  4W80 A;  5B66 E;  1GD2 E;  2P2U A;  2BEQ D;  2B9B A;  1RQV A;  4ZMD A;  2FKW B;  5CCH D;  1X0T A;  1Z56 A;  3CX5 H;  1OIP A;  1FZC A;  1GL2 C;  2YKP A;  3CCS P;  1GDT A;  3JCU E;  1AA0 A;  3PP5 A;  1KIL A;  1FC2 C;  3B5N D;  4WWI A;  1PZQ A;  3MIW A;  5KAF H;  1NHL A;  2BAS A;  2N1T A;  1BGY J;  1VQ7 P;  2A45 I;  4L75 A;  4K3A A;  2IBZ G;  3D6Y A;  2OYO A;  1L0N J;  3H1H D;  2QJY C;  1YI2 P;  1NH4 A;  1FOS E;  2FYU J;  1PP9 G;  1ZV8 A;  1OMI A;  3PTZ A;  3HTK B;  5KTB A;  1KZU B;  1JO5 A;  3RL0 B;  3CC2 P;  1N86 A;  3HD7 A;  4RKU J;  2Y9Z A;  1EC5 A;  1EDL A;  2B88 A;  3R4Y A;  4U7J A;  4L73 A;  3PRJ A;  4QMA A;  3WUU A;  1GZL A;  3F5H A;  2XZR A;  2OGU A;  2WSS H;  2WTY A;  4W7Y A;  2JR8 A;  1PGJ A;  2WT7 A;  5KAI H;  1RE4 C;  2ZXE B;  2FXM A;  1LTT C;  3CCV P;  3VMA A;  2FY8 A;  3L72 E;  2XND H;  2NRG A;  4TLF A;  4HB1 A;  4OVN F;  5KAI E;  3V4Q A;  2HPC B;  1FZB A;  2V7Q J;  2B89 A;  3CCE P;  2NPS A;  1BSN A;  3H1J J;  2H43 A;  4N3Y B;  1R5S A;  4BRY B;  5APQ A;  2IFN A;  1D7M A;  2KI7 B;  3RBX A;  3Q3D A;  2W8Z A;  1YTZ T;  1MV8 A;  3H6P A;  1HVV A;  5B5E H;  5TJH A;  1IFP A;  5BU8 B;  3AE5 C;  1M7L A;  2E42 A;  2QEX P;  3GHG B;  2PP6 A;  4C7N B;  2WSE J;  5AVW B;  4DZO A;  4W7Z A;  5KLV K;  3AEG C;  1VDF A;  4WVZ A;  1FZE A;  3H1K G;  2QJK C;  4WY4 A;  1MZ9 A;  1NVO A;  3GMA A;  1KV4 A;  1LWU A;  4U3F G;  3HE5 B;  1QX8 A;  1M1J A;  4AYC A;  2A45 H;  1CSB A;  1S72 P;  3OJA B;  4GT1 A;  2RN0 A;  3H1I D;  4PD4 D;  1Y47 A;  1IFJ A;  2AEF A;  2PRR A;  2ZYD A;  3CI9 A;  5KJ7 D;  5CCG C;  4GKG A;  3CCL P;  3RL0 D;  5CMZ A;  1EDI A;  1LGH B;  3R2P A;  1IFI A;  2Z4E A;  1PPJ G;  1BDC A;  1PGO A;  1YJ9 P;  3CWB G;  1NTZ J;  1QLE D;  1JTH B;  3GLM A;  1LNQ A;  1TU3 F;  2K1A A;  1RF1 B;  1JNM A;  2E5T A;  2ZFC A;  3VOP A;  3AE2 C;  1RQU A;  1HH0 A;  1CI6 B;  5CCH C;  2KNC A;  5KKZ C;  1LTJ C;  5KLV G;  3B5N C;  2KZI A;  4L74 A;  2NPS B;  2C9L Y;  1U57 A;  2I8D A;  3A3Y B;  5APU A;  1PGP A;  1E79 H;  5AVQ B;  1NU1 E;  1DD3 A;  1EQ7 A;  1RE3 A;  3L71 J;  3M91 A;  1N2D C;  5CJ4 A;  4RO0 A;  3H1L J;  2B87 A;  3L73 J;  4I6M C;  1CZQ A;  1NU1 D;  2K9J A;  2ZVO B;  2A06 E;  2JJL A;  3IAO A;  2Q5U A;  3RL0 g;  1N73 A;  3L75 E;  4H0L B;  3L70 E;  1VQL P;  1J2J B;  1L0N K;  2A06 D;  1NTM J;  3M06 A;  2FYU K;  2Q7C A;  3L75 D;  1SQB G;  2C0W A;  1URQ C;  3L70 D;  1GK4 A;  1SQX J;  3AEC C;  3W68 A;  2M5A A;  3CXH I;  1FDO A;  3NXS A;  1YJN P;  2KS1 A;  1U7J A;  1JMM A;  3G3Z A;  3H1J D;  4IOI H;  3H1K J;  1MKM A;  1LP1 B;  2K3R A;  5AVS B;  1ZRT E;  3NTN A;  3I56 P;  2R44 A;  1ZP0 C;  1R8E A;  2Y0C A;  3TGU G;  1G2C B;  1JM0 A;  1K04 A;  1AV1 A;  2N9Y B;  1ZRT D;  1BE3 E;  4NPF X;  2QM8 A;  3FXE A;  1NOH A;  2O01 H;  1IK9 A;  1BGY G;  5KLI B;  1FE6 A;  3AEB C;  2JWD A;  4JQ0 D;  1Q86 Q;  1EZV G;  1KC8 Q;  3M0D A;  3HE4 A;  3CWB J;  1T8Z A;  1L0N G;  4H13 B;  3RBZ A;  3V2P A;  2IBZ E;  2Q3I A;  3II6 A;  1OXZ A;  2E76 C;  3M9B A;  5KKZ B;  4OGQ B;  1H0T B;  1LTJ B;  1DIP A;  1JY3 O;  1PP9 E;  2OYI A;  1JY2 O;  2IBZ D;  1SQP J;  2W90 A;  2IYP A;  1L4A B;  3H32 B;  2AEJ A;  2ZJS E;  4GOE A;  1IFD A;  1NTK G;  1PP9 D;  1SQV G;  1KYO E;  2FFD C;  1L2P A;  1VQN P;  1Q82 Q;  3BVH A;  4H0L D;  1KMI Z;  2QM7 A;  2I1K A;  5AVZ B;  1QL2 A;  4JYC A;  1KYO D;  3WUV A;  2M3E A;  1AVO A;  4IFD K;  2HOD A;  1LT9 A;  3USS A;  2M3B A;  1QL1 A;  2XKM A;  1SS1 A;  1S9K E;  2YXQ B;  3AEE C;  1N7S B;  2FYN B;  3CXH H;  1VL2 A;  1NWQ A;  1NTZ K;  2KK7 A;  1BCC J;  1HJ0 A;  2E5Y A;  5E79 E;  1JCC A;  1VF5 B;  4UB8 E;  2QIW A;  1LTG C;  4WB4 A;  4DJG A;  1S9K D;  5AW5 B;  1NKN A;  5CCG D;  2SPZ A;  1EXJ A;  2YMK A;  1NKZ B;  1SQQ G;  2OQQ A;  4KJM A;  3OAK A;  2R3C A;  3CC7 P;  2WIT A;  4Y99 C;  1YBK A;  1Y8A A;  2K9Y A;  1OWA A;  3NFQ A;  2YNY A;  3M9Q A;  2QE7 H;  1FZG A;  1N8R Q;  4L76 A;  4PD4 I;  1HJB A;  2QG4 A;  3ABV C;  1JMB A;  1IO4 A;  3EWK A;  4H13 D;  4U3F E;  3TGU J;  2GA1 A;  1PL5 A;  3BCC J;  1SFC B;  3Q1M A;  4OGQ D;  3SFD C;  1JOC A;  3H1H E;  3L36 A;  4ZNC A;  4U3F D;  2OTL P;  3TK1 A;  4TT3 H;  2Y0D A;  2E76 B;  3HD7 C;  4EYY Q;  2D2C B;  2IPP A;  1L4A D;  5M1B A;  1ZXG A;  4HYT B;  1L0L J;  2G3A A;  1KD1 Q;  1NTM K;  3TNU A;  1N7L A;  1ZLL A;  2Q1K A;  1NTZ G;  2WWW A;  2KLV A;  4I7Z C;  3AE7 C;  1SQX K;  1JUN A;  2W6B A;  4O9B A;  1S5L H;  2FFD B;  1USE A;  1RF1 C;  3AE6 C;  5AW6 B;  3WU2 H;  1GL2 A;  3CWB D;  1NJI Q;  1YJW P;  1NTK J;  5CBO A;  1SQV J;  3U1C A;  2WSC J;  1T3J A;  1S5L E;  5DJU B;  3V4W A;  5KLV E;  3VN0 A;  1YTZ I;  2RMZ A;  3LW5 H;  3L71 G;  1RHZ B;  1VPC A;  3KQG A;  1URQ D;  2R5B A;  1QEX A;  3P32 A;  3WU2 E;  3U1A A;  2MKV A;  3TYY A;  2NPS C;  5AW7 B;  1JEK A;  1VF5 D;  5C39 A;  2WPQ A;  4BXL A;  4KHX A;  3H1L G;  2OYH B;  2K88 A;  4ASV A;  2H8P D;  5KLV D;  3L73 G;  2WVR A;  2V4H A;  1NYH A;  1P84 I;  1YIJ P;  2KSE A;  4N78 E;  3RK3 B;  3GW6 A;  3L74 J;  2QA4 P;  3D6Z A;  3SWK A;  1Q90 D;  1NGM B;  1VQ6 P;  3BAS A;  3BRT B;  4N78 D;  1NTM G;  2J59 M;  4H0L C;  5AW8 B;  4C7R A;  1IFM A;  1SQX G;  1FJK A;  1SQB E;  1FZC B;  4Y99 B;  2GUV A;  4PD4 H;  3EQ2 A;  1KIL B;  1SQP K;  1SQQ J;  3F89 A;  3CME P;  1RE4 A;  1SFC D;  5BVZ A;  4YXW H;  3GF3 A;  4ZKP A;  2N1T B;  1K9M Q;  2H89 C;  1KOR A;  2N9B A;  1AQT A;  1SQB D;  3H1I E;  2BCC E;  5APW A;  2NZ2 A;  1ZR2 A;  4PD4 E;  3T97 A;  2IYO A;  1LT1 A;  2P67 A;  2Q3E A;  3V5B A;  5AVT B;  2E76 D;  2D2C D;  2LXC B;  1HF9 A;  5AW1 B;  1H89 A;  2BCC D;  1Y9B A;  1J1D B;  2O1J A;  1W2E A;  1LTI C;  3HD7 B;  1XTC C;  1RY3 A;  1DX7 A;  3L35 A;  3PLN A;  4I7Z B;  4AUW A;  1FAV A;  5AVY B;  2WSF J;  2WQY C;  3JSV C;  3TGU D;  1BGY E;  2AXT E;  2LXB A;  3U59 A;  1SQB K;  2PGD A;  3PH0 A;  3S9O A;  1OVR A;  3RK2 B;  1S5L X;  1VQK P;  1EZV E;  5KLI C;  2LKM A;  2IBZ I;  2WT7 B;  1L0N E;  1IK7 A;  1J1E C;  2FYU E;  4H13 C;  3HUS A;  1GW4 A;  1BGY D;  4D6T J;  1VQ8 P;  2YO2 A;  2YO3 A;  4HKZ H;  5APY A;  3TF5 A;  1SQP G;  3QH9 A;  2Y9Y A;  1EZV D;  4OGQ C;  5CBN A;  1L0N D;  1ZR4 A;  5AVR B;  1PIX A;  5AVX B;  2FYU D;  2M8R A;  3RK3 D;  4ZKU A;  1IC2 A;  1Q2N A;  2E43 A;  2P10 A;  1P84 H;  1KYO I;  1L4A C;  1IJD B;  2ZAE B;  2KOG A;  3S4R A;  1AQ5 A;  2JDI H;  2M0B A;  1BSH A;  1KB9 I;  3KXD A;  5EFW B;  1P84 E;  1IFN A;  1SVF A;  1OW6 A;  4EI2 A;  1NTK D;  2W83 C;  1SQV D;  3P8C E;  3AED C;  3KZI H;  1KIL D;  1ZME C;  5CCH A;  1OVV A;  2VRS A;  3MZW B;  3A0B E;  4WY4 B;  3S1K A;  3L72 G;  2J58 A;  2N1T D;  3O6Q A;  1P84 D;  2GUS A;  1LWU B;  3B5N A;  1L0L K;  3P8C D;  3MP7 B;  1AFO A;  2OTJ P;  1BCC G;  1M1J B;  4DOJ A;  3KZI E;  3JC2 2;  1S3J A;  3AE9 C;  1N7S C;  4C46 A;  2FYN C;  3H1J E;  3N4X A;  2Q6Q A;  3AE1 C;  1M90 Q;  2WSE H;  1VF5 C;  3FGA D;  3G9R A;  2PFX A;  1K05 A;  3HD7 D;  3LIE A;  1E5W A;  2Y0E A;  1R5L A;  2OTK E;  1NTK K;  1SQV K;  5APX A;  1RF0 C;  1X79 B;  3AE3 C;  2YKQ A;  4EOT A;  3VMZ A;  1FZF A;  3IF4 A;  1SQQ D;  2KSJ A;  5BU5 A;  2YIU B;  4NPD A;  3BCC G;  1URQ A;  3CD6 P;  1ZOY C;  2FXP A;  5CHX A;  3VMX A;  2KNC B;  1A02 J;  1CW5 A;  4JBZ A;  3KDP B;  3L4F A;  1SFC C;  2P58 A;  3V2N A;  4RES B;  3UIA A;  3FXD A;  1RH5 B;  4RJT A;  2A45 G;  3FX0 A;  2G8Y A;  4YPC A;  1J1E B;  1OZH A;  1L0L G;  1W2B O;  4LC1 A;  2NPS D;  3A0H E;  1USD A;  2D2C C;  2B87 B;  5APV A;  1MFT A;  1VQ9 P;  1NTZ E;  2P1J A;  2K9J B;  2JP3 A;  4WBA A;  3V2Q A;  1KYO H;  5AW2 B;  1SQQ K;  4R4M A;  3CCJ P;  1N73 B;  2C9N Y;  4XE5 B;  1KB9 H;  1NTZ D;  2UWJ E;  4JPZ B;  3N7N A;  3M0A A;  1EXI A;  4WY4 D;  4R4L A;  1EDJ A;  3KHU A;  1KB9 E;  4OWF A;  3EFG A;  3L71 E;  3VP8 A;  3FWL A;  2M5A B;  3G71 P;  3V6I A;  2KS1 B;  1JY3 N;  2GM4 A;  3H1L E;  5E79 H;  4UB6 H;  5TIS E;  1KB9 D;  4UB8 H;  1S4X A;  2IDB A;  1JY2 N;  3L73 E;  2H88 C;  2OYH C;  3L71 D;  1YIT P;  2A06 G;  3HTK A;  3CMA P;  1M56 D;  3L72 J;  3IR9 A;  3ITK A;  3L74 G;  1OVU A;  5KJ7 A;  2RH0 A;  3H1L D;  4GDO A;  4UB6 E;  3MUD C;  2QSI A;  3RK3 C;  4PV1 C;  3L73 D;  3K5B A;  2Q9I A;  4YXD C;  2C0X A;  1NTM E;  5AVV B;  1K73 Q;  3KPE A;  1KFN A;  1SQX E;  2CPS A;  1Q7Y Q;  1PFI A;  3VTP C;  1NTM D;  1FZC C;  1Q81 Q;  1KIL C;  2PAJ A;  1GU5 A;  3HE4 B;  3MGN A;  4LGD E;  2J5U A;  1HUC A;  4JYB A;  1T3U A;  2N1T C;  1SQX D;  3H1K E;  1M57 D;  1VQO P;  1QVF O;  1LTA C;  3PJS K;  2W27 A;  2FBW C;  5AW0 B;  1GTW A;  2R32 A;  2OYI B;  4HJG H;  1K8A Q;  3W67 A;  2HPC A;  3A7O A;  3MD0 A;  3H1K D;  1S2E A;  3PHL A;  1KQF B;  2ZT9 C;  3VMY A;  2IX7 C;  2KUB A;  1A02 F;  3H25 A;  3CCQ P;  4BRY A;  1J1D C;  3CLQ A;  4KT0 J;  5GTI H;  1H88 A;  3O8Z A;  2XV5 A;  1BE3 G;  3Q5P A;  4DCK A;  3D71 A;  3Q5S A;  3SFE C;  3GHG A;  2I1J A;  4C7N A;  2KB7 P;  1G1J A;  1PPJ E;  3I55 P;  2YKO A;  5GTI E;  1QGK B;  3CWB E;  3D70 A;  1AVY A;  1WMK A;  2ZVN B;  1EZV I;  1FOS F;  2KYV A;  3CX5 E;  2HOD B;  2L5G B;  1NAY A;  1LT9 B;  2ZXX A;  3RK2 C;  4D6T G;  2YMY A;  1VQ5 P;  5H2F H;  5KAF E;  1PPJ D;  1M8O B;  3HE5 A;  1OW8 A;  3KYQ A;  1G1I A;  1PV3 A;  4N6J A;  4YTP C;  4A7P A;  1SQP E;  3CX5 D;  2QVA A;  3V2R A;  1EDK A;  2W6J H;  5H2F E;  1N7S D;  2MJZ A;  2E75 B;  3SWF A;  1NU1 J;  1GK6 A;  1SQP D;  4B86 A;  1U7M A;  2P7J A;  3OA7 A;  1X8Y A;  2JWA A;  1JTH A;  3TSI A;  1IZN B;  1AJY A;  3I5C A;  4PV1 B;  3HRN A;  1RF1 A;  4K35 A;  2FYZ A;  3L37 A;  3L75 J;  3A2A A;  3L70 J;  3E1I A;  1CI6 A;  2QJP B;  2DW3 A;  4I1L A;  4WY4 C;  3CCR P;  4I2L C;  2E74 B;  1BCC E;  1LWU C;  1VQM P;  1JY3 P;  1OX3 A;  3P8M C;  2JO1 A;  1M1J C; 
#chains in the Genus database with same CATH homology
 4W80 A;  1JY2 P;  1GD2 E;  1LTJ B;  2P2U A;  1IFN A;  1JY3 O;  1SVF A;  1XTG B;  3P8C E;  2OYI A;  3BAT A;  2FKW B;  1JY2 O;  5CCH D;  1Z56 A;  2H7H A;  2R5D A;  1KIL D;  5CCH A;  1FZC A;  1GL2 C;  2VRS A;  2YKP A;  1L4A B;  4WY4 B;  1GDT A;  3PP5 A;  3H32 B;  1KIL A;  3TNU B;  1WT6 A;  3B5N D;  1HTL C;  1HGZ A;  2J58 A;  2N1T D;  2GUS A;  3MIW A;  5AVU B;  1LWU B;  1L0L K;  1IFD A;  3B5N A;  3P8C D;  1NHL A;  2BAS A;  2N1T A;  2FFD C;  1AFO A;  2A45 I;  4XA4 A;  1M1J B;  4DOJ A;  3BVH A;  5CJ0 A;  4C46 A;  1N7S C;  2QM7 A;  2I1K A;  1NAF A;  3N4X A;  5AVZ B;  1QL2 A;  1NH4 A;  1FOS E;  4JYC A;  1ZV8 A;  1GW3 A;  2WSE H;  3HTK B;  5AW3 B;  1GL2 B;  5KTB A;  1KZU B;  4IFD K;  3HUS C;  2HOD A;  1GU4 A;  3HD7 D;  1LT9 A;  1JO5 A;  3LIE A;  1E5W A;  3RL0 B;  1NTK K;  2M3B A;  1SQV K;  1N86 A;  3WMM 0;  3HD7 A;  5APX A;  3CL3 D;  1QL1 A;  1RF0 C;  1HWT C;  1X79 B;  2XKM A;  1S9K E;  1N7S B;  2WPS A;  2YKQ A;  1NWQ A;  4EOT A;  1NTZ K;  1JCC A;  3VMZ A;  1RE3 C;  1T2K D;  4JF7 A;  1FZF A;  1GZL A;  2XZR A;  4IFF A;  2KSJ A;  5BU5 A;  1LTG C;  4WB4 A;  1S9K D;  5AW5 B;  2WTY A;  1URQ A;  4W7Y A;  1NKN A;  1X9V A;  4OH8 B;  2WSC H;  5CHX A;  3VMX A;  5CCG D;  2WT7 A;  1A02 J;  1CW5 A;  1RE4 C;  1NKZ B;  2ZXE B;  5CCG A;  3KDP B;  2FXM A;  1LTT C;  3L4F A;  3OAK A;  1SFC C;  4LLH A;  1G2C A;  4RES B;  2R3C A;  3V2N A;  3UIA A;  2WIT A;  1N73 C;  2A45 G;  4M3L A;  2O1K A;  4Y99 C;  1J1E B;  1OWA A;  3NFQ A;  2YNY A;  3M9Q A;  4LC1 A;  3V4Q A;  2NPS D;  1FZG A;  2HPC B;  1FZB A;  1HJB A;  2NPS A;  5APV A;  2H43 A;  4N3Y B;  4GIF A;  1IO4 A;  2P1J A;  1H8A A;  4WBA A;  3V2Q A;  5APQ A;  5AW2 B;  2IFN A;  1SQQ K;  1SFC B;  1FJP A;  1N73 B;  2C9N Y;  2OAR A;  1YTZ T;  1KQL A;  1MV8 A;  3H6P A;  1JOC A;  1HVV A;  4XE5 B;  1MFZ A;  5BU8 B;  1LTJ A;  3L36 A;  1M7L A;  3N7N A;  2E42 A;  4AQR D;  3M0A A;  3GHG B;  2PP6 A;  2HYN A;  3TK1 A;  4C7N B;  5AVW B;  4DZO A;  4W7Z A;  5KLV K;  1VDF A;  3HD7 C;  1FZE A;  2IPP A;  4WY4 D;  1L4A D;  4WY4 A;  1L4A A;  4HYT B;  1MZ9 A;  3H32 A;  1NTM K;  3TNU A;  1N7L A;  1ZLL A;  2WWW A;  2KLV A;  1LWU A;  3EFG A;  3VP8 A;  3HE5 B;  1M1J A;  4AYC A;  1SQX K;  1JUN A;  2A45 H;  2W6B A;  1CSB A;  3OJA B;  1JY3 N;  4O9B A;  4GT1 A;  1HBW A;  2GM4 A;  2Z5H A;  3IFM A;  2FFD B;  3M9H A;  1JY2 N;  1RF1 C;  1GL2 D;  1IFJ A;  2OYH C;  3CI9 A;  3HTK A;  5AW6 B;  1GL2 A;  5KJ7 D;  3IR9 A;  5CCG C;  4GKG A;  3U1C A;  3RL0 D;  5KJ7 A;  1KFM A;  5CMZ A;  1T3J A;  3A5T A;  1LGH B;  3R2P A;  1NU1 K;  1MUU A;  3RK3 C;  3V4W A;  3VN0 A;  1YTZ I;  1LTB C;  1DH3 A;  3LID A;  1IFI A;  3M0D C;  3LW5 H;  1NO4 A;  1VPC A;  3KQG A;  2Z4E A;  1URQ D;  2R5B A;  2Q9I A;  3P32 A;  3HUS B;  3RK2 D;  2Z5I A;  3P7K A;  1N7S A;  2C0X A;  1JTH B;  3U1A A;  2CPB A;  3TYY A;  5AVV B;  3SWY A;  2NPS C;  5AW7 B;  1RF1 B;  2WPQ A;  4KHX A;  1JNM A;  2OYH B;  2H8P D;  2ZFC A;  3VOP A;  3KPE A;  1KFN A;  2OYI C;  2CPS A;  2WSF H;  1SLQ A;  2IFM A;  1PFI A;  1HH0 A;  3VTP C;  1CI6 B;  1WRG A;  4N78 E;  5CCH C;  1FZC C;  3RK3 B;  1KIL C;  2PAJ A;  1FZA A;  1GU5 A;  3HE4 B;  3MGN A;  4LGD E;  1RF0 A;  1LTJ C;  3NMD A;  1HUC A;  4JYB A;  1T3U A;  3B5N C;  2XDJ A;  2N1T C;  3BAS A;  2NPS B;  2C9L Y;  3A3Y B;  1LTA C;  3C9I A;  5APU A;  2W27 A;  3BRT B;  4N78 D;  5AVQ B;  5AW4 B;  1RE3 A;  1EQ7 A;  2J59 M;  5AW8 B;  5AW0 B;  3M91 A;  1GTW A;  2R32 A;  4C7R A;  1HGV A;  2OYI B;  1SP4 A;  1N2D C;  2XU6 A;  5CJ4 A;  1IFM A;  5APS A;  2HPC A;  3A7O A;  3MD0 A;  1FJK A;  1FZC B;  2HLO A;  4Y99 B;  2GUV A;  3VMY A;  2IX7 C;  3EQ2 A;  1KIL B;  4I6M C;  1SQP K;  1A02 F;  1CZQ A;  1RE4 A;  1SFC D;  5BVZ A;  1J1D C;  1LT9 C;  3B5N B;  3CLQ A;  2JJL A;  4ZKP A;  2N1T B;  1SFC A;  1H88 A;  3O8Z A;  2XV5 A;  3VP9 A;  2Q5U A;  1N73 A;  2N9B A;  5APW A;  2W6A A;  1ZR2 A;  3T97 A;  2P67 A;  1LTS C;  5KJ7 C;  1YYC A;  3GHG A;  2I1J A;  5AVT B;  3V5B A;  4C7N A;  1J2J B;  2KB7 P;  1L0N K;  1G1J A;  3BRV B;  3RL0 C;  2YKO A;  3M06 A;  2FYU K;  1T2K C;  5AW1 B;  2Q7C A;  1FOS F;  2KYV A;  1H89 A;  2HOD B;  2L5G B;  2C0W A;  4HH2 A;  1URQ C;  1J1D B;  1LT9 B;  4EIJ A;  2O1J A;  3MTU E;  1W2E A;  3RK2 C;  1GK4 A;  1LTI C;  2YMY A;  3HD7 B;  5AW9 B;  1XTC C;  3HE5 A;  3KYQ A;  2XNX A;  1G1I A;  3NXS A;  1RY3 A;  1FBM A;  4N6J A;  1DX7 A;  3L35 A;  2WZ7 A;  1JMM A;  3G3Z A;  3V2R A;  3B8E B;  2HG5 D;  4AUW A;  1FAV A;  5AVY B;  2FFD A;  1FDM A;  1N7S D;  2MJZ A;  3SWF A;  3U59 A;  1GK6 A;  1SQB K;  1URQ B;  2KP8 A;  5AVS B;  3RK2 B;  3VYI A;  4B86 A;  3NTN A;  2LKM A;  2WT7 B;  4IFM A;  2P7J A;  3OA7 A;  1J1E C;  1X8Y A;  3HUS A;  1G2C B;  1GW4 A;  1JTH A;  3TSI A;  2YO2 A;  2YO3 A;  5APY A;  3I5C A;  3HRN A;  1RF1 A;  2WPR A;  2FYZ A;  3L37 A;  2OYH A;  1ZR4 A;  2HFE D;  2POH A;  5AVR B;  2JEE A;  2QM8 A;  5AVX B;  1NOH A;  2O01 H;  2M8R A;  3A2A A;  3RK3 D;  4ZKU A;  1IK9 A;  1IC2 A;  3E1I A;  1CI6 A;  2E43 A;  1ZN5 A;  3MUD A;  4I1L A;  4WY4 C;  1L4A C;  1FU1 A;  1IJD B;  3M0D A;  3HE4 A;  1DEB A;  1T8Z A;  5APT A;  2KOG A;  4I2L C;  3GHG C;  1AQ5 A;  1LWU C;  3V2P A;  2Q3I A;  1JY3 P;  3II6 A;  3P8M C;  1JCD A;  1OXZ A;  1M1J C;  3M9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...