1N7LA

Solution nmr structure of phospholamban in detergent micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cardiac phospholamban
publication title NMR solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles.
pubmed rcsb
source organism Oryctolagus cuniculus
total genus 22
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7lA00
2M3BA 1FJKA 2KB7P 2KYVA 2HYNA 1FJPA 1ZLLA 1N7LA
chains in the Genus database with same CATH superfamily
2KS1A 1Y8AA 1Q81Q 3WMM0 2MJZA 1QVGO 5KLVD 3M9BA 2FKWB 5AVYB 4R4LA 3L73E 3LW5H 2A06D 1HGZA 3CCMP 3P7KA 3CXHE 3L74E 2AXCA 2KI7B 1BE3D 4GOFA 1YITP 1BCCD 4WVZA 1NTZD 3L75G 1QLED 3CCSP 2A45G 3H1LJ 1SQQK 1YI2P 1OVVA 1XTCC 2O01H 2NPSA 4IL6X 2K88A 2BCCJ 3L74J 4EIJA 3HD7D 1S5LE 1QGKB 1QEXA 2WPSA 3L72E 5TISE 3B71A 1EZVD 3TGUD 1HWTC 2WSEH 1FZCA 4TT3H 4C46A 2W6JH 3V2QA 3TNUB 3H1LG 2KB7P 2YKQA 2ZT9D 3VP9A 1DEBA 2WT7B 3USSA 1PFIA 3L74G 2Y9ZA 1SQQE 1DIPA 1VQPP 3PLNA 2ZT9C 3U1AA 3RBZA 5KLIB 1L0LK 1SQBK 2IDBA 1NJIQ 1EZVI 3HTKB 5APTA 3MD0A 4C7NB 2KSJA 4OGQB 3H1IE 5KKZB 1USEA 3HE5A 3RL0B 1ZN5A 1NU1K 3O6QA 1M90Q 1SQQJ 2NZ2A 2KNCA 1QVFO 4I6MC 1FZEA 2GUVA 3AE8C 4ASWA 2M3BA 2QSIA 3H1IJ 1CI6B 3H1KE 4EDFA 2HODA 2O01J 3Q1MA 1T2KD 2B89A 1EXJA 1IC2A 4RESB 2OYIB 2FYUD 1R8EA 1SQVK 2YO2A 1SQQG 1AA0A 3AEAC 1DD3A 1T2KC 1NU1E 2UWJE 2WSEJ 4JBZA 1X8YA 5CMZA 3V6IA 1KILE 3H1IG 4EOTA 4IOIH 2PFXA 2WQYC 1P84H 1M7LA 3C1LA 1L0LJ 1SQBJ 2J58A 3ABVC 3CCUP 1FZCC 2FYNC 3MP7B 2QJPC 2YIUC 1KORA 3P32A 5AW6B 2D2CD 1LTTC 2P10A 1NU1J 1M57D 2FFDC 1URQA 1GU4A 1VQLP 5B66E 1N73A 1HBWA 1GL2D 4IL6H 2HLOA 4GKGA 4JQ0D 3CC7P 2QJKB 3M0DA 1IK9A 1SQVE 4D6TD 1HUCA 2BEZF 2D2CC 1RHZB 3CCVP 3B5NB 4I7ZB 5AW7B 1L0LG 1GL2C 1SQBG 1BDDA 2LR2A 1ZV8A 4OVNF 1YTZT 3FWNA 5E79H 4I2LC 1GK4A 2HR3A 4R4MA 3CCQP 1NU1G 1UIXA 2A45I 1LTBC 3N7NA 5B5EH 3CPWO 3Q5RA 5AVTB 3AE2C 5APQA 1NTMK 2BCCD 3CX5D 2AXTH 2I1JA 1P84E 5L8RJ 3CCRP 3PP5A 2E5YA 2Z5HA 3T97B 4CPGA 1ZLLA 1OIPA 2KK7A 3TNUA 3H1JD 2GUSA 4DJGA 4IL6E 3NFQA 3MUDA 2OGUA 2G3AA 2IBZE 3MHVA 1JUNA 3VP8A 5DJUB 3HD7B 4HB1A 5E79E 1DD4A 3IF4A 5AVVB 3HTKA 1NTME 1URQD 3BCCD 4C7NA 2C0XA 3L70D 1IZNB 1EDKA 1OFCX 1AFOA 1DEEG 3AE3C 1GW4A 3VN0A 2KSEA 1LTJC 3C8VA 1OX3A 4OH8B 1L2PA 1EC5A 1URQC 3F5HA 4A7PA 1OMIA 4YTPC 1UIIA 1HH0A 1N73C 2R3SA 3LIEA 2AXTE 2Y9YA 3M0DC 1IFNA 2KZIA 4PJ0H 1NTMJ 3ZDMA 2OTJP 1JCDA 3GMAA 1CI6A 1BGYJ 1W5CE 1IO4A 3H25A 2A06E 3V5BA 3F89A 1JY3O 2LXBA 2OYIA 3NXSA 3TDKA 3A0HH 5APUA 1JY3P 3EFGA 3H32B 4WY4D 3TYYA 3GG2A 4L76A 2ITAA 2JR8A 2E74B 1NTMG 5KJ7A 2CK3H 2IZ0A 4WY4C 1ZMEC 1NWQA 1BGYG 2HYNA 4EYYQ 1E79H 4HJGH 2Q1KA 2OTLP 3P8CE 1M1KQ 3TGUE 3MUDC 1OW8A 1JMBA 1PZQA 3PJSK 1IFPA 4OGQD 3R4YA 5AW2B 4U3FE 2R32A 1FZCB 2YIUB 5KLIC 1FDOA 3RBXA 1X0TA 1JOCA 1KZUB 4JPZB 3NTNA 3RL0g 4OGQC 3A5TA 4O9BA 3A0HE 2FFDB 5KKZC 4GT1A 2M5AB 5CJ4A 5AVWB 3BATA 1LWUC 2OQQA 1VQMP 1SQXK 3SFDC 2D2CB 2IFMA 5K5GB 1JMMA 4U3FJ 1GZLA 1PPJG 1GL2B 3LIDA 2I8DA 3V4QA 3HE5B 2PP6A 3KZIH 3L71J 3O6QB 2IX7C 3RK2D 3CC2P 2ZVNB 3T97A 1MZ9A 1SQPK 3SFEC 1HTLC 3TK1A 2E75D 4TLFA 2OYIC 2GA1A 4YPCA 1S1CX 3RK2C 5C39A 4U3FG 3V4WA 1G1IA 2E75C 3L36A 1SQXE 3EFFK 5GTHH 1VF5D 2KUBA 3HD7A 3L71G 2C0WA 3FX0A 3G3ZA 1R5SA 1G1JA 4ZKPA 2PAJA 1FJKA 1VF5C 2WSCJ 1SQPE 2OYOA 1RQUA 5H2FH 4K35A 5AW8B 4NPEA 1SQXJ 1BSNA 1QL2A 3KZIE 1Q7YQ 1HJBA 3FGAD 5DJTB 3A0BE 2B87B 2KLVA 4I7ZC 1LTJB 4LGDE 2KYVA 2WSFH 4GOEA 3WUTA 1URQB 5CCGD 2Z5IA 1SQPJ 1LTIC 1N73B 3D6ZA 2XZRA 2ZAEB 3H32A 2FYZA 3M91A 3AEDC 1SQXG 3HE4B 1OXZA 5GTHE 3H1HJ 2B88A 4DT0A 2ZYAA 1NVOA 1N86A 1VQ5P 1Z56A 2W83C 4ZNCA 1SQPG 2RH0A 3H6PA 3BVHA 3L73J 3G71P 2Q3EA 3IN6A 2L5GB 2IFNA 5H2FE 1AQ5A 3R2PA 1HJ0A 4WY4B 1FU1A 3H1HG 2XDJA 3W67A 1JNMA 3H1JE 1USDA 2JDIH 5KAIH 3HD7C 1EQ7A 3GW6A 3O8ZA 2FFDA 3L73G 1IK7A 2XKMA 2M5AA 3FWLA 3KHUA 3L72J 1Q2NA 3VYIA 2VRSA 3L70E 1J1EC 2WMMA 2WTYA 2K9YA 1WMKA 1OVUA 2WSFJ 1GL2A 3BRVB 2ZFCA 3LW5J 1G2CB 1LWUB 2C9NY 1T3UA 4LC1A 4PD4D 4UB8H 2N9YB 1YTZI 2E74D 3L72G 5AW5B 5B66H 2BASA 3FXEA 1H89A 1X22A 1KFMA 5KAIE 3CD6P 1YJNP 2N1TD 2E74C 1KQGB 4H13B 3SWFA 1IFMA 2I1KA 2QG4A 2FXMA 1KB9H 2IYPA 5EFWB 3BRTB 3S1KA 3RK2B 5CHXA 4PD4I 3AEGC 1EDIA 1LTGC 2E75B 1ZRTD 3KQGA 3H1KJ 4AYCA 1L0NK 1KD1Q 1KC8Q 2DW3A 3TSIA 1R5LA 1LTAC 1FJPA 2IZ1A 4HKZH 1VQKP 2Z4EA 2QA4P 3CI9A 2JEEA 1VF5B 5CBOA 3SWKA 2B87A 1JEKA 3L75D 1LTJA 4UB8E 3G6EP 1VPCA 4N6JA 1NOHA 4KHXA 4RJTA 1HF9A 2R5BA 4HH2A 1KYOH 3H1KG 2JWDA 1QX8A 3WU2H 1A02F 1K9MQ 3HE4A 1T3JA 1JO5A 2O1JA 2V7QH 3RK3D 1XTGB 2W6BA 2XV5A 1KB9E 3C9IA 1OWAA 1L0NE 1LTSC 2FXPA 2JJLA 2KP8A 2K9JA 3H1LD 3RK3C 1JY2O 3AEBC 2P7JA 3VMZA 1SQVJ 1JY2P 1KQFB 1NTKK 1N2DC 2K1AA 3CXHD 3L74D 2PGDA 1FDMA 3CL3D 1ZR4A 4WY4A 2ZJSE 3CC4P 1J2JB 2MKVA 2LXCB 1VQNP 1LGHB 1VQ7P 1SVFA 2J59M 3CWBE 4XE5B 2W8ZA 1SQVG 2H89C 3AEEC 1KYOE 1YQ4C 3WU2E 5KLVK 2RKLA 3CMEP 3EQ2A 3CXHI 3VTPC 1ZR2A 1PP9E 3TF5A 2OYHB 1NTKE 1L0NG 3IR9A 4DZOA 4GIFA 2GM4A 3U59A 3CWBJ 4H44D 1NTZK 3AE5C 2Q3IA 4K3AA 4MN4C 3KXDA 1NAYA 1YJ9P 1G2CA 1LWUA 1N8RQ 2ZVOB 1J1EB 2V7QJ 1SQQD 4H44C 1PP9J 4GODA 1IFIA 3CMAP 1KFNA 5TJHA 3P8MC 1S4XA 4WBAA 1SFCD 2W90A 1OZHA 1YYCA 3H1ID 4I1LA 1FE6A 5KLVE 1YIJP 1FBMA 3CWBG 3WUUA 1NHLA 2E42A 5BVZA 2IBZG 1JTHA 3HUSC 1SFCC 5APVA 1PGPA 1BE3E 1BCCE 2E5TA 3OJAB 4IFDK 1NTZE 1PP9G 4YXWH 1NTKG 1YQ3C 1YJWP 5KLVJ 2POHA 1VQ4P 2JP3A 1HVVA 2V4HA 5APYA 1RF0C 1L0LD 1SQBD 2N1TB 1BE3J 4BRYB 1BCCJ 1GK6A 2KOGA 4B86A 2M3EA 3AE7C 1PL5A 1EZVE 2OTKE 2P2UA 1Q82Q 2W27A 1RQVA 3AE4C 1NU1D 2O3JA 4NPFX 2KZJA 1KILD 4GDOA 1BSHA 1M8OB 5KLVG 1KV4A 1PGQA 2A06G 2YNYA 3L4FA 1KQSO 2YKPA 2AEFA 4EI2A 1KILC 1BE3G 2Q9IA 1BCCG 1MKMA 3TGUJ 1S72P 1NTZG 3N4XA 2HFED 2WITA 3GF3A 5AW0B 1RF1A 2FYUK 3B4SA 1D7MA 1U7JA 5CCGA 1ZOYC 4M3LA 4H13D 1J1DC 2XNDH 3NMDA 3PTZA 2Y0CA 4KT0J 5APXA 3A0BH 4H13C 3RK3B 1K8AQ 1EZVG 2ZXEB 3TGUG 3CCJP 4ZMDA 4KJMA 3I55P 1GD2E 2JO1A 2Q6QA 4HYTB 1RH5B 2FYUE 1H8AA 1P84D 1JY2N 4Y99C 2OYHA 1KTMA 1KB9I 1AQTA 4Y28J 5AVSB 1K04A 1LT1A 5GTIH 2QVAA 2YO3A 4LLHA 1A02J 3VMYA 1M1JC 3CX5H 3M9HA 3VOPA 4N78D 4JYBA 1VL2A 2FYUJ 2L91A 2YXRB 3PRJA 3S4RA 2CPBA 1OVRA 3GF7A 1P84I 1FZBA 2J5UA 1MFZA 3KYQA 4BXLA 1VQOP 1NTMD 1AVYA 1NGMB 2WPVB 2QJYB 1BGYD 4D6TE 3CCEP 2Y0DA 2K37A 3D70A 1CZQA 3L37A 4H44B 1RF1C 1VQ9P 1KYOI 2IBZI 3BASA 2FYUG 5CCHA 5CCGC 5AVXB 2M8RA 4Z1MH 1FS0E 1SP4A 3H1LE 3AEFC 1X79B 3G9RA 4D6TJ 5GTIE 3HUSB 1SFCB 2FY8A 2K9JB 2BCCE 3GHGC 4L75A 3V2NA 2Q7CA 3CX5E 2N1TA 3RGUA 3OW2O 2SPZA 2H88C 4BRYA 2WPQA 3II6A 1N7SA 1T6AA 1VQ6P 4DOJA 2JWAA 1JY3N 5AVRB 4JYCA 1GU5A 1PPJD 5M1BA 1K05A 4D6TG 2OYHC 1S9KD 2K3RA 3FXDA 4QMAA 3AE9C 5CJ0A 1PGOA 3P8CD 1CSBA 2QM7A 2KXPB 2E76D 3BCCE 1WRGA 3H1JJ 3Q3DA 1K73Q 4U3FD 4RO0A 2IYOA 3JC22 2LKMA 1KILB 2BCCG 2E76C 1MFTA 5CCHD 1IFJA 2JKVA 3L71D 2WWWA 1H0TB 1RE3A 3A7OA 3E1RA 3E1IA 3QWOC 1PGJA 3BCCJ 3L70J 1EDLA 2FXOA 1J1DB 1FDIA 5CBNA 5CCHC 2XNXA 3AECC 1NKZB 3H1JG 1LP1A 1KQLA 2P58A 4PV1D 1FAVA 1NAFA 2FBWC 4L73A 5BU8B 4WB4A 3KPEA 1ZXGA 2QEXP 1N7SD 3I56P 1JTHB 4PV1C 5KTBA 2N1TC 3BCCG 5AVZB 3L70G 4AUWA 1N7SC 2NPSD 1WT6A 1S2EA 4YXDC 2Q5UA 1L0LE 1SQBE 4Y99B 1Q90D 1DH3A 5BU5A 5APWA 1SQXD 3SSUA 1FOSF 2C9LY 1IFDA 2CPSA 2NPSC 1W2EA 1YHQP 4C7RA 1L4AA 2N9BA 3JCUH 1M1JB 2AEJA 1LT9B 5AVUB 1QL1A 2HG5D 1SQPD 1KMIZ 2KLUA 1JM0A 1T8ZA 1NO4A 2YKOA 3H1HD 1PIXA 2M0BA 3HRNA 2QRXA 3SWYA 4JF7A 1RF1B 1GW3A 1EXIA 3HUSA 1SFCA 3B8EB 2G8YA 1RE3C 1W2BO 2QE7H 5KAFH 5AVQB 3L73D 1FC2C 2AEMA 1S3JA 1Y47A 4RKUJ 1CW5A 1NH4A 4WWIA 1TU3F 3VMAA 1L0NJ 1JB0J 1RF0A 3JCUE 3GHGB 3A2AA 1MV8A 3Q2YA 3V2PA 3OAKA 3VMXA 3W68A 2R44A 3MTUE 2O01N 2P67A 2XU6A 2PRRA 4ZKUA 2WVRA 2ZYDA 3S9OA 3ITKA 1L4AD 3L72D 1MUUA 1YBKA 1NKNA 4OWFA 1X9VA 4N78E 4L74A 4H0LD 1KILA 2WT7A 1GMJA 4XA4A 1L4AC 3AE6C 3CX5I 5KAFE 5AW9B 3D71A 2QJYC 1H0TA 3IFMA 3GLMA 3M06A 1N7LA 4H0LC 4UB6H 3KDPB 3V2RA 1NTKJ 2Y0EA 1BGYE 2E76B 5B5EE 2B9BA 2HPCB 2R3CA 2RN0A 2ZT9B 3MGNA 3MIWA 2O1KA 1KN7A 3G4SP 4ASVA 1OW7A 1VDFA 3OA7A 1BDCA 3MZWB 2R5DA 1Y9BA 3E7KA 2KS1B 4XFJA 1AV1A 3H1KD 4W7YA 5AW1B 4PV1B 1HGVA 2YXQB 1FZFA 4PD4H 2E43A 1S5LX 4AQRD 3PH0A 4DCKA 4N3YB 3K5BA 1NTZJ 4UB6E 1PV3A 1N7SB 1M1JA 1AVOA 2QM8A 1LT9A 4NPDA 1PPJE 1OW6A 3L35A 3EWKA 3M9QA 2IPPA 1S9KE 1SS1A 3CCLP 2WSSH 2H7HA 3QH9A 2NRGA 2NPSB 1FZAA 1DX7A 1NYHA 3AE1C 2KIKA 1RE4A 2QIWA 4PJ0E 2WSCH 2FYNB 3RL0D 2QJPB 2ZYGA 3B5NA 2W6AA 3UIAA 3U1CA 1FOSE 1SQVD 3L71E 4IFFA 3RL0C 3JSVC 4PD4E 1SLQA 1KB9D 2A45H 1L0ND 3GHGA 2WPRA 3M0AA 1AJYA 2RMZA 2H8PD 2YMYA 1LP1B 3PHLA 5APSA 1JCCA 2H43A 1U7MA 4BWNA 3CLQA 2KNCB 3Q5SA 3A3YB 1M56D 5KJ7D 2BEQD 5AW4B 4U7JA 4IFMA 1ZRTE 1VQ8P 3CWBD 2HODB 5KJ7C 1GTWA 3CXHH 1LNQA 1LJ2A 1KYOD 2IBZD 1LT9C 3I5CA 3D6YA 1U57A 5AW3B 3L75E 1PP9D 3Q5PA 2OARA 1FZGA 2ZXXA 1NTKD 2P1JA 1EDJA 1IJDB 1H88A 1L4AB 2HPCA 4W80A 1Q86Q 3B5ND 1RE4C 4W7ZA 1ZP0C 2YMKA 3IAOA 1S5LH 4H0LB 3WUVA 2QJKC 1GDTA 1ZW0A 5TISH 3RK3E 3H1HE 3L75J 3B5NC 2WZ7A 1RY3A 1E5WA
chains in the Genus database with same CATH topology
5AW2B 3KPEA 2R32A 1N7SD 1FZCB 1JTHB 5KLVK 3WMM0 3EQ2A 2MJZA 3VTPC 1ZR2A 5KTBA 1JOCA 1KZUB 2N1TC 3M9BA 2FKWB 3NTNA 5AVZB 5AVYB 3A5TA 4O9BA 2FFDB 3LW5H 2OYHB 4AUWA 1HGZA 1N7SC 3IR9A 4GT1A 2NPSD 3P7KA 4GIFA 4DZOA 2GM4A 5CJ4A 3U59A 1WT6A 5AVWB 3BATA 1LWUC 2Q5UA 4Y99B 1SQXK 1NTZK 1DH3A 5BU5A 5APWA 2IFMA 2Q3IA 1JMMA 1FOSF 2C9LY 1IFDA 1G2CA 2CPSA 1GZLA 1LWUA 1W2EA 2NPSC 2A45G 1GL2B 3LIDA 1SQQK 4C7RA 1L4AA 1J1EB 2N9BA 1XTCC 2O01H 3V4QA 3HE5B 1M1JB 1IFIA 2PP6A 2IX7C 1KFNA 1LT9B 3RK2D 2NPSA 5AVUB 3T97A 1MZ9A 3P8MC 1QL1A 1SQPK 4EIJA 2HG5D 4WBAA 1HTLC 3HD7D 3TK1A 1SFCD 1YYCA 4I1LA 2OYIC 2WPSA 1FBMA 1NHLA 3RK2C 2E42A 1HWTC 5BVZA 1T8ZA 2WSEH 1NO4A 1FZCA 2YKOA 1JTHA 3HUSC 4C46A 1SFCC 5APVA 3V2QA 3HRNA 3TNUB 3V4WA 1G1IA 3SWYA 2KB7P 3L36A 2YKQA 3OJAB 4JF7A 4IFDK 3VP9A 1RF1B 1GW3A 3HD7A 1DEBA 3HUSA 1SFCA 3B8EB 1RE3C 2WT7B 2C0WA 1PFIA 3G3ZA 1G1JA 4ZKPA 2POHA 2PAJA 5AVQB 1HVVA 1FJKA 3U1AA 5APYA 1RF0C 1L0LK 1SQBK 3HTKB 5APTA 3MD0A 2N1TB 4C7NB 1CW5A 2KSJA 1NH4A 1GK6A 5AW8B 2KOGA 4B86A 1RF0A 3HE5A 1QL2A 3RL0B 1ZN5A 2P2UA 1NU1K 3GHGB 3A2AA 1MV8A 2W27A 3V2PA 3OAKA 1HJBA 3VMXA 3MTUE 2KLVA 1LTJB 1KILD 4LGDE 4I6MC 2KYVA 2P67A 2WSFH 2XU6A 1FZEA 2GUVA 5CCGD 1URQB 2M3BA 2YNYA 2Z5IA 3L4FA 4ZKUA 1LTIC 1N73B 2YKPA 1CI6B 1L4AD 2XZRA 1KILC 3H32A 2Q9IA 1MUUA 2HODA 2FYZA 3M91A 1T2KD 3N4XA 2HFED 3HE4B 2WITA 5AW0B 1RF1A 1OXZA 2FYUK 1NKNA 1IC2A 1X9VA 4N78E 4RESB 2OYIB 1KILA 2WT7A 4XA4A 1L4AC 1SQVK 2YO2A 5CCGA 4M3LA 5AW9B 1J1DC 1T2KC 1N86A 3NMDA 3IFMA 1Z56A 3M06A 1N7LA 1X8YA 5CMZA 3KDPB 3H6PA 3BVHA 3V2RA 2L5GB 2IFNA 5APXA 4EOTA 1AQ5A 3R2PA 3RK3B 2ZXEB 1M7LA 2J58A 1FZCC 4WY4B 2HPCB 2R3CA 1FU1A 2XDJA 1JNMA 3MGNA 3P32A 3MIWA 5AW6B 1LTTC 1GD2E 2O1KA 2FFDC 1URQA 3HD7C 1GU4A 4HYTB 1H8AA 1N73A 1HBWA 1GL2D 2HLOA 1VDFA 1JY2N 1EQ7A 3OA7A 4GKGA 4Y99C 3M0DA 1IK9A 3O8ZA 2R5DA 1HUCA 2OYHA 2FFDA 3B5NB 2XKMA 5AVSB 5AW7B 1GL2C 3VYIA 2VRSA 4W7YA 1ZV8A 2YO3A 5AW1B 1J1EC 1YTZT 4LLHA 1HGVA 1A02J 3VMYA 2WTYA 1M1JC 3M9HA 4I2LC 3VOPA 1FZFA 1GK4A 4N78D 4JYBA 1GL2A 2E43A 4AQRD 2A45I 4N3YB 1LTBC 3BRVB 2CPBA 1N7SB 1M1JA 3N7NA 2QM8A 1LT9A 5AVTB 2ZFCA 1FZBA 1G2CB 5APQA 1NTMK 1LWUB 1MFZA 3L35A 2C9NY 3KYQA 1T3UA 3M9QA 4LC1A 2IPPA 1S9KE 2I1JA 1YTZI 2H7HA 3PP5A 2NPSB 5AW5B 2Z5HA 1FZAA 1CZQA 1ZLLA 2BASA 3L37A 1DX7A 1RF1C 1H89A 1KFMA 3BASA 3TNUA 5CCHA 1RE4A 2N1TD 2WSCH 3SWFA 2GUSA 1IFMA 2I1KA 5CCGC 5AVXB 3NFQA 3MUDA 2M8RA 3RL0D 2FXMA 3BRTB 3B5NA 1SP4A 1JUNA 1X79B 2W6AA 3RK2B 3VP8A 3UIAA 3U1CA 1FOSE 5CHXA 3HD7B 3HUSB 1SFCB 1LTGC 4IFFA 3RL0C 3GHGC 3HTKA 5AVVB 3V2NA 1URQD 2Q7CA 3KQGA 2N1TA 4C7NA 2C0XA 4AYCA 2WPQA 1SLQA 1L0NK 2A45H 3TSIA 1AFOA 3II6A 1LTAC 1GW4A 1FJPA 1N7SA 3VN0A 1LTJC 3GHGA 2WPRA 2Z4EA 4OH8B 4DOJA 3M0AA 3CI9A 1URQC 1JY3N 2JEEA 5AVRB 4JYCA 1GU5A 1HH0A 1N73C 1LTJA 2H8PD 2YMYA 3LIEA 3M0DC 1VPCA 5APSA 1IFNA 2OYHC 4N6JA 1JCCA 1S9KD 2H43A 1NOHA 4KHXA 3CLQA 1JCDA 5CJ0A 3A3YB 1CI6A 2R5BA 4HH2A 5KJ7D 3P8CD 1CSBA 2QM7A 1IO4A 1A02F 5AW4B 3HE4A 1T3JA 1JO5A 2O1JA 4IFMA 3V5BA 1JY3O 3RK3D 1XTGB 2W6BA 2OYIA 3NXSA 2XV5A 5APUA 1JY3P 1WRGA 3EFGA 3H32B 3C9IA 4WY4D 2HODB 3TYYA 1OWAA 5KJ7C 1GTWA 1LTSC 2JJLA 2KP8A 1LT9C 3I5CA 2LKMA 1KILB 3RK3C 5AW3B 1JY2O 2P7JA 3VMZA 5KJ7A 1JY2P 5CCHD 4WY4C 1NTKK 1IFJA 2OARA 1N2DC 1NWQA 1FZGA 2WWWA 1RE3A 2P1JA 2HYNA 3A7OA 3E1IA 1IJDB 1H88A 1L4AB 1FDMA 3CL3D 1ZR4A 4WY4A 2HPCA 4W80A 3B5ND 1J1DB 5CCHC 1RE4C 4W7ZA 2XNXA 1J2JB 3P8CE 1NKZB 4WB4A 1KQLA 1FAVA 1LGHB 1GDTA 1NAFA 1SVFA 5BU8B 2J59M 3B5NC 2WZ7A 4XE5B 1RY3A 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3B A;  1FJK A;  2KB7 P;  2KYV A;  2HYN A;  1FJP A;  1ZLL A;  1N7L A; 
#chains in the Genus database with same CATH topology
 2KS1 A;  1Y8A A;  1Q81 Q;  3WMM 0;  2MJZ A;  1QVG O;  5KLV D;  3M9B A;  2FKW B;  5AVY B;  4R4L A;  3L73 E;  3LW5 H;  2A06 D;  1HGZ A;  3CCM P;  3P7K A;  3CXH E;  3L74 E;  2AXC A;  2KI7 B;  1BE3 D;  4GOF A;  1YIT P;  1BCC D;  4WVZ A;  1NTZ D;  3L75 G;  1QLE D;  3CCS P;  2A45 G;  3H1L J;  1SQQ K;  1YI2 P;  1OVV A;  1XTC C;  2O01 H;  2NPS A;  4IL6 X;  2K88 A;  2BCC J;  3L74 J;  4EIJ A;  3HD7 D;  1S5L E;  1QGK B;  1QEX A;  2WPS A;  3L72 E;  5TIS E;  3B71 A;  1EZV D;  3TGU D;  1HWT C;  2WSE H;  1FZC A;  4TT3 H;  4C46 A;  2W6J H;  3V2Q A;  3TNU B;  3H1L G;  2KB7 P;  2YKQ A;  2ZT9 D;  3VP9 A;  1DEB A;  2WT7 B;  3USS A;  1PFI A;  3L74 G;  2Y9Z A;  1SQQ E;  1DIP A;  1VQP P;  3PLN A;  2ZT9 C;  3U1A A;  3RBZ A;  5KLI B;  1L0L K;  1SQB K;  2IDB A;  1NJI Q;  1EZV I;  3HTK B;  5APT A;  3MD0 A;  4C7N B;  2KSJ A;  4OGQ B;  3H1I E;  5KKZ B;  1USE A;  3HE5 A;  3RL0 B;  1ZN5 A;  1NU1 K;  3O6Q A;  1M90 Q;  1SQQ J;  2NZ2 A;  2KNC A;  1QVF O;  4I6M C;  1FZE A;  2GUV A;  3AE8 C;  4ASW A;  2M3B A;  2QSI A;  3H1I J;  1CI6 B;  3H1K E;  4EDF A;  2HOD A;  2O01 J;  3Q1M A;  1T2K D;  2B89 A;  1EXJ A;  1IC2 A;  4RES B;  2OYI B;  2FYU D;  1R8E A;  1SQV K;  2YO2 A;  1SQQ G;  1AA0 A;  3AEA C;  1DD3 A;  1T2K C;  1NU1 E;  2UWJ E;  2WSE J;  4JBZ A;  1X8Y A;  5CMZ A;  3V6I A;  1KIL E;  3H1I G;  4EOT A;  4IOI H;  2PFX A;  2WQY C;  1P84 H;  1M7L A;  3C1L A;  1L0L J;  1SQB J;  2J58 A;  3ABV C;  3CCU P;  1FZC C;  2FYN C;  3MP7 B;  2QJP C;  2YIU C;  1KOR A;  3P32 A;  5AW6 B;  2D2C D;  1LTT C;  2P10 A;  1NU1 J;  1M57 D;  2FFD C;  1URQ A;  1GU4 A;  1VQL P;  5B66 E;  1N73 A;  1HBW A;  1GL2 D;  4IL6 H;  2HLO A;  4GKG A;  4JQ0 D;  3CC7 P;  2QJK B;  3M0D A;  1IK9 A;  1SQV E;  4D6T D;  1HUC A;  2BEZ F;  2D2C C;  1RHZ B;  3CCV P;  3B5N B;  4I7Z B;  5AW7 B;  1L0L G;  1GL2 C;  1SQB G;  1BDD A;  2LR2 A;  1ZV8 A;  4OVN F;  1YTZ T;  3FWN A;  5E79 H;  4I2L C;  1GK4 A;  2HR3 A;  4R4M A;  3CCQ P;  1NU1 G;  1UIX A;  2A45 I;  1LTB C;  3N7N A;  5B5E H;  3CPW O;  3Q5R A;  5AVT B;  3AE2 C;  5APQ A;  1NTM K;  2BCC D;  3CX5 D;  2AXT H;  2I1J A;  1P84 E;  5L8R J;  3CCR P;  3PP5 A;  2E5Y A;  2Z5H A;  3T97 B;  4CPG A;  1ZLL A;  1OIP A;  2KK7 A;  3TNU A;  3H1J D;  2GUS A;  4DJG A;  4IL6 E;  3NFQ A;  3MUD A;  2OGU A;  2G3A A;  2IBZ E;  3MHV A;  1JUN A;  3VP8 A;  5DJU B;  3HD7 B;  4HB1 A;  5E79 E;  1DD4 A;  3IF4 A;  5AVV B;  3HTK A;  1NTM E;  1URQ D;  3BCC D;  4C7N A;  2C0X A;  3L70 D;  1IZN B;  1EDK A;  1OFC X;  1AFO A;  1DEE G;  3AE3 C;  1GW4 A;  3VN0 A;  2KSE A;  1LTJ C;  3C8V A;  1OX3 A;  4OH8 B;  1L2P A;  1EC5 A;  1URQ C;  3F5H A;  4A7P A;  1OMI A;  4YTP C;  1UII A;  1HH0 A;  1N73 C;  2R3S A;  3LIE A;  2AXT E;  2Y9Y A;  3M0D C;  1IFN A;  2KZI A;  4PJ0 H;  1NTM J;  3ZDM A;  2OTJ P;  1JCD A;  3GMA A;  1CI6 A;  1BGY J;  1W5C E;  1IO4 A;  3H25 A;  2A06 E;  3V5B A;  3F89 A;  1JY3 O;  2LXB A;  2OYI A;  3NXS A;  3TDK A;  3A0H H;  5APU A;  1JY3 P;  3EFG A;  3H32 B;  4WY4 D;  3TYY A;  3GG2 A;  4L76 A;  2ITA A;  2JR8 A;  2E74 B;  1NTM G;  5KJ7 A;  2CK3 H;  2IZ0 A;  4WY4 C;  1ZME C;  1NWQ A;  1BGY G;  2HYN A;  4EYY Q;  1E79 H;  4HJG H;  2Q1K A;  2OTL P;  3P8C E;  1M1K Q;  3TGU E;  3MUD C;  1OW8 A;  1JMB A;  1PZQ A;  3PJS K;  1IFP A;  4OGQ D;  3R4Y A;  5AW2 B;  4U3F E;  2R32 A;  1FZC B;  2YIU B;  5KLI C;  1FDO A;  3RBX A;  1X0T A;  1JOC A;  1KZU B;  4JPZ B;  3NTN A;  3RL0 g;  4OGQ C;  3A5T A;  4O9B A;  3A0H E;  2FFD B;  5KKZ C;  4GT1 A;  2M5A B;  5CJ4 A;  5AVW B;  3BAT A;  1LWU C;  2OQQ A;  1VQM P;  1SQX K;  3SFD C;  2D2C B;  2IFM A;  5K5G B;  1JMM A;  4U3F J;  1GZL A;  1PPJ G;  1GL2 B;  3LID A;  2I8D A;  3V4Q A;  3HE5 B;  2PP6 A;  3KZI H;  3L71 J;  3O6Q B;  2IX7 C;  3RK2 D;  3CC2 P;  2ZVN B;  3T97 A;  1MZ9 A;  1SQP K;  3SFE C;  1HTL C;  3TK1 A;  2E75 D;  4TLF A;  2OYI C;  2GA1 A;  4YPC A;  1S1C X;  3RK2 C;  5C39 A;  4U3F G;  3V4W A;  1G1I A;  2E75 C;  3L36 A;  1SQX E;  3EFF K;  5GTH H;  1VF5 D;  2KUB A;  3HD7 A;  3L71 G;  2C0W A;  3FX0 A;  3G3Z A;  1R5S A;  1G1J A;  4ZKP A;  2PAJ A;  1FJK A;  1VF5 C;  2WSC J;  1SQP E;  2OYO A;  1RQU A;  5H2F H;  4K35 A;  5AW8 B;  4NPE A;  1SQX J;  1BSN A;  1QL2 A;  3KZI E;  1Q7Y Q;  1HJB A;  3FGA D;  5DJT B;  3A0B E;  2B87 B;  2KLV A;  4I7Z C;  1LTJ B;  4LGD E;  2KYV A;  2WSF H;  4GOE A;  3WUT A;  1URQ B;  5CCG D;  2Z5I A;  1SQP J;  1LTI C;  1N73 B;  3D6Z A;  2XZR A;  2ZAE B;  3H32 A;  2FYZ A;  3M91 A;  3AED C;  1SQX G;  3HE4 B;  1OXZ A;  5GTH E;  3H1H J;  2B88 A;  4DT0 A;  2ZYA A;  1NVO A;  1N86 A;  1VQ5 P;  1Z56 A;  2W83 C;  4ZNC A;  1SQP G;  2RH0 A;  3H6P A;  3BVH A;  3L73 J;  3G71 P;  2Q3E A;  3IN6 A;  2L5G B;  2IFN A;  5H2F E;  1AQ5 A;  3R2P A;  1HJ0 A;  4WY4 B;  1FU1 A;  3H1H G;  2XDJ A;  3W67 A;  1JNM A;  3H1J E;  1USD A;  2JDI H;  5KAI H;  3HD7 C;  1EQ7 A;  3GW6 A;  3O8Z A;  2FFD A;  3L73 G;  1IK7 A;  2XKM A;  2M5A A;  3FWL A;  3KHU A;  3L72 J;  1Q2N A;  3VYI A;  2VRS A;  3L70 E;  1J1E C;  2WMM A;  2WTY A;  2K9Y A;  1WMK A;  1OVU A;  2WSF J;  1GL2 A;  3BRV B;  2ZFC A;  3LW5 J;  1G2C B;  1LWU B;  2C9N Y;  1T3U A;  4LC1 A;  4PD4 D;  4UB8 H;  2N9Y B;  1YTZ I;  2E74 D;  3L72 G;  5AW5 B;  5B66 H;  2BAS A;  3FXE A;  1H89 A;  1X22 A;  1KFM A;  5KAI E;  3CD6 P;  1YJN P;  2N1T D;  2E74 C;  1KQG B;  4H13 B;  3SWF A;  1IFM A;  2I1K A;  2QG4 A;  2FXM A;  1KB9 H;  2IYP A;  5EFW B;  3BRT B;  3S1K A;  3RK2 B;  5CHX A;  4PD4 I;  3AEG C;  1EDI A;  1LTG C;  2E75 B;  1ZRT D;  3KQG A;  3H1K J;  4AYC A;  1L0N K;  1KD1 Q;  1KC8 Q;  2DW3 A;  3TSI A;  1R5L A;  1LTA C;  1FJP A;  2IZ1 A;  4HKZ H;  1VQK P;  2Z4E A;  2QA4 P;  3CI9 A;  2JEE A;  1VF5 B;  5CBO A;  3SWK A;  2B87 A;  1JEK A;  3L75 D;  1LTJ A;  4UB8 E;  3G6E P;  1VPC A;  4N6J A;  1NOH A;  4KHX A;  4RJT A;  1HF9 A;  2R5B A;  4HH2 A;  1KYO H;  3H1K G;  2JWD A;  1QX8 A;  3WU2 H;  1A02 F;  1K9M Q;  3HE4 A;  1T3J A;  1JO5 A;  2O1J A;  2V7Q H;  3RK3 D;  1XTG B;  2W6B A;  2XV5 A;  1KB9 E;  3C9I A;  1OWA A;  1L0N E;  1LTS C;  2FXP A;  2JJL A;  2KP8 A;  2K9J A;  3H1L D;  3RK3 C;  1JY2 O;  3AEB C;  2P7J A;  3VMZ A;  1SQV J;  1JY2 P;  1KQF B;  1NTK K;  1N2D C;  2K1A A;  3CXH D;  3L74 D;  2PGD A;  1FDM A;  3CL3 D;  1ZR4 A;  4WY4 A;  2ZJS E;  3CC4 P;  1J2J B;  2MKV A;  2LXC B;  1VQN P;  1LGH B;  1VQ7 P;  1SVF A;  2J59 M;  3CWB E;  4XE5 B;  2W8Z A;  1SQV G;  2H89 C;  3AEE C;  1KYO E;  1YQ4 C;  3WU2 E;  5KLV K;  2RKL A;  3CME P;  3EQ2 A;  3CXH I;  3VTP C;  1ZR2 A;  1PP9 E;  3TF5 A;  2OYH B;  1NTK E;  1L0N G;  3IR9 A;  4DZO A;  4GIF A;  2GM4 A;  3U59 A;  3CWB J;  4H44 D;  1NTZ K;  3AE5 C;  2Q3I A;  4K3A A;  4MN4 C;  3KXD A;  1NAY A;  1YJ9 P;  1G2C A;  1LWU A;  1N8R Q;  2ZVO B;  1J1E B;  2V7Q J;  1SQQ D;  4H44 C;  1PP9 J;  4GOD A;  1IFI A;  3CMA P;  1KFN A;  5TJH A;  3P8M C;  1S4X A;  4WBA A;  1SFC D;  2W90 A;  1OZH A;  1YYC A;  3H1I D;  4I1L A;  1FE6 A;  5KLV E;  1YIJ P;  1FBM A;  3CWB G;  3WUU A;  1NHL A;  2E42 A;  5BVZ A;  2IBZ G;  1JTH A;  3HUS C;  1SFC C;  5APV A;  1PGP A;  1BE3 E;  1BCC E;  2E5T A;  3OJA B;  4IFD K;  1NTZ E;  1PP9 G;  4YXW H;  1NTK G;  1YQ3 C;  1YJW P;  5KLV J;  2POH A;  1VQ4 P;  2JP3 A;  1HVV A;  2V4H A;  5APY A;  1RF0 C;  1L0L D;  1SQB D;  2N1T B;  1BE3 J;  4BRY B;  1BCC J;  1GK6 A;  2KOG A;  4B86 A;  2M3E A;  3AE7 C;  1PL5 A;  1EZV E;  2OTK E;  2P2U A;  1Q82 Q;  2W27 A;  1RQV A;  3AE4 C;  1NU1 D;  2O3J A;  4NPF X;  2KZJ A;  1KIL D;  4GDO A;  1BSH A;  1M8O B;  5KLV G;  1KV4 A;  1PGQ A;  2A06 G;  2YNY A;  3L4F A;  1KQS O;  2YKP A;  2AEF A;  4EI2 A;  1KIL C;  1BE3 G;  2Q9I A;  1BCC G;  1MKM A;  3TGU J;  1S72 P;  1NTZ G;  3N4X A;  2HFE D;  2WIT A;  3GF3 A;  5AW0 B;  1RF1 A;  2FYU K;  3B4S A;  1D7M A;  1U7J A;  5CCG A;  1ZOY C;  4M3L A;  4H13 D;  1J1D C;  2XND H;  3NMD A;  3PTZ A;  2Y0C A;  4KT0 J;  5APX A;  3A0B H;  4H13 C;  3RK3 B;  1K8A Q;  1EZV G;  2ZXE B;  3TGU G;  3CCJ P;  4ZMD A;  4KJM A;  3I55 P;  1GD2 E;  2JO1 A;  2Q6Q A;  4HYT B;  1RH5 B;  2FYU E;  1H8A A;  1P84 D;  1JY2 N;  4Y99 C;  2OYH A;  1KTM A;  1KB9 I;  1AQT A;  4Y28 J;  5AVS B;  1K04 A;  1LT1 A;  5GTI H;  2QVA A;  2YO3 A;  4LLH A;  1A02 J;  3VMY A;  1M1J C;  3CX5 H;  3M9H A;  3VOP A;  4N78 D;  4JYB A;  1VL2 A;  2FYU J;  2L91 A;  2YXR B;  3PRJ A;  3S4R A;  2CPB A;  1OVR A;  3GF7 A;  1P84 I;  1FZB A;  2J5U A;  1MFZ A;  3KYQ A;  4BXL A;  1VQO P;  1NTM D;  1AVY A;  1NGM B;  2WPV B;  2QJY B;  1BGY D;  4D6T E;  3CCE P;  2Y0D A;  2K37 A;  3D70 A;  1CZQ A;  3L37 A;  4H44 B;  1RF1 C;  1VQ9 P;  1KYO I;  2IBZ I;  3BAS A;  2FYU G;  5CCH A;  5CCG C;  5AVX B;  2M8R A;  4Z1M H;  1FS0 E;  1SP4 A;  3H1L E;  3AEF C;  1X79 B;  3G9R A;  4D6T J;  5GTI E;  3HUS B;  1SFC B;  2FY8 A;  2K9J B;  2BCC E;  3GHG C;  4L75 A;  3V2N A;  2Q7C A;  3CX5 E;  2N1T A;  3RGU A;  3OW2 O;  2SPZ A;  2H88 C;  4BRY A;  2WPQ A;  3II6 A;  1N7S A;  1T6A A;  1VQ6 P;  4DOJ A;  2JWA A;  1JY3 N;  5AVR B;  4JYC A;  1GU5 A;  1PPJ D;  5M1B A;  1K05 A;  4D6T G;  2OYH C;  1S9K D;  2K3R A;  3FXD A;  4QMA A;  3AE9 C;  5CJ0 A;  1PGO A;  3P8C D;  1CSB A;  2QM7 A;  2KXP B;  2E76 D;  3BCC E;  1WRG A;  3H1J J;  3Q3D A;  1K73 Q;  4U3F D;  4RO0 A;  2IYO A;  3JC2 2;  2LKM A;  1KIL B;  2BCC G;  2E76 C;  1MFT A;  5CCH D;  1IFJ A;  2JKV A;  3L71 D;  2WWW A;  1H0T B;  1RE3 A;  3A7O A;  3E1R A;  3E1I A;  3QWO C;  1PGJ A;  3BCC J;  3L70 J;  1EDL A;  2FXO A;  1J1D B;  1FDI A;  5CBN A;  5CCH C;  2XNX A;  3AEC C;  1NKZ B;  3H1J G;  1LP1 A;  1KQL A;  2P58 A;  4PV1 D;  1FAV A;  1NAF A;  2FBW C;  4L73 A;  5BU8 B;  4WB4 A;  3KPE A;  1ZXG A;  2QEX P;  1N7S D;  3I56 P;  1JTH B;  4PV1 C;  5KTB A;  2N1T C;  3BCC G;  5AVZ B;  3L70 G;  4AUW A;  1N7S C;  2NPS D;  1WT6 A;  1S2E A;  4YXD C;  2Q5U A;  1L0L E;  1SQB E;  4Y99 B;  1Q90 D;  1DH3 A;  5BU5 A;  5APW A;  1SQX D;  3SSU A;  1FOS F;  2C9L Y;  1IFD A;  2CPS A;  2NPS C;  1W2E A;  1YHQ P;  4C7R A;  1L4A A;  2N9B A;  3JCU H;  1M1J B;  2AEJ A;  1LT9 B;  5AVU B;  1QL1 A;  2HG5 D;  1SQP D;  1KMI Z;  2KLU A;  1JM0 A;  1T8Z A;  1NO4 A;  2YKO A;  3H1H D;  1PIX A;  2M0B A;  3HRN A;  2QRX A;  3SWY A;  4JF7 A;  1RF1 B;  1GW3 A;  1EXI A;  3HUS A;  1SFC A;  3B8E B;  2G8Y A;  1RE3 C;  1W2B O;  2QE7 H;  5KAF H;  5AVQ B;  3L73 D;  1FC2 C;  2AEM A;  1S3J A;  1Y47 A;  4RKU J;  1CW5 A;  1NH4 A;  4WWI A;  1TU3 F;  3VMA A;  1L0N J;  1JB0 J;  1RF0 A;  3JCU E;  3GHG B;  3A2A A;  1MV8 A;  3Q2Y A;  3V2P A;  3OAK A;  3VMX A;  3W68 A;  2R44 A;  3MTU E;  2O01 N;  2P67 A;  2XU6 A;  2PRR A;  4ZKU A;  2WVR A;  2ZYD A;  3S9O A;  3ITK A;  1L4A D;  3L72 D;  1MUU A;  1YBK A;  1NKN A;  4OWF A;  1X9V A;  4N78 E;  4L74 A;  4H0L D;  1KIL A;  2WT7 A;  1GMJ A;  4XA4 A;  1L4A C;  3AE6 C;  3CX5 I;  5KAF E;  5AW9 B;  3D71 A;  2QJY C;  1H0T A;  3IFM A;  3GLM A;  3M06 A;  1N7L A;  4H0L C;  4UB6 H;  3KDP B;  3V2R A;  1NTK J;  2Y0E A;  1BGY E;  2E76 B;  5B5E E;  2B9B A;  2HPC B;  2R3C A;  2RN0 A;  2ZT9 B;  3MGN A;  3MIW A;  2O1K A;  1KN7 A;  3G4S P;  4ASV A;  1OW7 A;  1VDF A;  3OA7 A;  1BDC A;  3MZW B;  2R5D A;  1Y9B A;  3E7K A;  2KS1 B;  4XFJ A;  1AV1 A;  3H1K D;  4W7Y A;  5AW1 B;  4PV1 B;  1HGV A;  2YXQ B;  1FZF A;  4PD4 H;  2E43 A;  1S5L X;  4AQR D;  3PH0 A;  4DCK A;  4N3Y B;  3K5B A;  1NTZ J;  4UB6 E;  1PV3 A;  1N7S B;  1M1J A;  1AVO A;  2QM8 A;  1LT9 A;  4NPD A;  1PPJ E;  1OW6 A;  3L35 A;  3EWK A;  3M9Q A;  2IPP A;  1S9K E;  1SS1 A;  3CCL P;  2WSS H;  2H7H A;  3QH9 A;  2NRG A;  2NPS B;  1FZA A;  1DX7 A;  1NYH A;  3AE1 C;  2KIK A;  1RE4 A;  2QIW A;  4PJ0 E;  2WSC H;  2FYN B;  3RL0 D;  2QJP B;  2ZYG A;  3B5N A;  2W6A A;  3UIA A;  3U1C A;  1FOS E;  1SQV D;  3L71 E;  4IFF A;  3RL0 C;  3JSV C;  4PD4 E;  1SLQ A;  1KB9 D;  2A45 H;  1L0N D;  3GHG A;  2WPR A;  3M0A A;  1AJY A;  2RMZ A;  2H8P D;  2YMY A;  1LP1 B;  3PHL A;  5APS A;  1JCC A;  2H43 A;  1U7M A;  4BWN A;  3CLQ A;  2KNC B;  3Q5S A;  3A3Y B;  1M56 D;  5KJ7 D;  2BEQ D;  5AW4 B;  4U7J A;  4IFM A;  1ZRT E;  1VQ8 P;  3CWB D;  2HOD B;  5KJ7 C;  1GTW A;  3CXH H;  1LNQ A;  1LJ2 A;  1KYO D;  2IBZ D;  1LT9 C;  3I5C A;  3D6Y A;  1U57 A;  5AW3 B;  3L75 E;  1PP9 D;  3Q5P A;  2OAR A;  1FZG A;  2ZXX A;  1NTK D;  2P1J A;  1EDJ A;  1IJD B;  1H88 A;  1L4A B;  2HPC A;  4W80 A;  1Q86 Q;  3B5N D;  1RE4 C;  4W7Z A;  1ZP0 C;  2YMK A;  3IAO A;  1S5L H;  4H0L B;  3WUV A;  2QJK C;  1GDT A;  1ZW0 A;  5TIS H;  3RK3 E;  3H1H E;  3L75 J;  3B5N C;  2WZ7 A;  1RY3 A;  1E5W A; 
#chains in the Genus database with same CATH homology
 5AW2 B;  3KPE A;  2R32 A;  1N7S D;  1FZC B;  1JTH B;  5KLV K;  3WMM 0;  3EQ2 A;  2MJZ A;  3VTP C;  1ZR2 A;  5KTB A;  1JOC A;  1KZU B;  2N1T C;  3M9B A;  2FKW B;  3NTN A;  5AVZ B;  5AVY B;  3A5T A;  4O9B A;  2FFD B;  3LW5 H;  2OYH B;  4AUW A;  1HGZ A;  1N7S C;  3IR9 A;  4GT1 A;  2NPS D;  3P7K A;  4GIF A;  4DZO A;  2GM4 A;  5CJ4 A;  3U59 A;  1WT6 A;  5AVW B;  3BAT A;  1LWU C;  2Q5U A;  4Y99 B;  1SQX K;  1NTZ K;  1DH3 A;  5BU5 A;  5APW A;  2IFM A;  2Q3I A;  1JMM A;  1FOS F;  2C9L Y;  1IFD A;  1G2C A;  2CPS A;  1GZL A;  1LWU A;  1W2E A;  2NPS C;  2A45 G;  1GL2 B;  3LID A;  1SQQ K;  4C7R A;  1L4A A;  1J1E B;  2N9B A;  1XTC C;  2O01 H;  3V4Q A;  3HE5 B;  1M1J B;  1IFI A;  2PP6 A;  2IX7 C;  1KFN A;  1LT9 B;  3RK2 D;  2NPS A;  5AVU B;  3T97 A;  1MZ9 A;  3P8M C;  1QL1 A;  1SQP K;  4EIJ A;  2HG5 D;  4WBA A;  1HTL C;  3HD7 D;  3TK1 A;  1SFC D;  1YYC A;  4I1L A;  2OYI C;  2WPS A;  1FBM A;  1NHL A;  3RK2 C;  2E42 A;  1HWT C;  5BVZ A;  1T8Z A;  2WSE H;  1NO4 A;  1FZC A;  2YKO A;  1JTH A;  3HUS C;  4C46 A;  1SFC C;  5APV A;  3V2Q A;  3HRN A;  3TNU B;  3V4W A;  1G1I A;  3SWY A;  2KB7 P;  3L36 A;  2YKQ A;  3OJA B;  4JF7 A;  4IFD K;  3VP9 A;  1RF1 B;  1GW3 A;  3HD7 A;  1DEB A;  3HUS A;  1SFC A;  3B8E B;  1RE3 C;  2WT7 B;  2C0W A;  1PFI A;  3G3Z A;  1G1J A;  4ZKP A;  2POH A;  2PAJ A;  5AVQ B;  1HVV A;  1FJK A;  3U1A A;  5APY A;  1RF0 C;  1L0L K;  1SQB K;  3HTK B;  5APT A;  3MD0 A;  2N1T B;  4C7N B;  1CW5 A;  2KSJ A;  1NH4 A;  1GK6 A;  5AW8 B;  2KOG A;  4B86 A;  1RF0 A;  3HE5 A;  1QL2 A;  3RL0 B;  1ZN5 A;  2P2U A;  1NU1 K;  3GHG B;  3A2A A;  1MV8 A;  2W27 A;  3V2P A;  3OAK A;  1HJB A;  3VMX A;  3MTU E;  2KLV A;  1LTJ B;  1KIL D;  4LGD E;  4I6M C;  2KYV A;  2P67 A;  2WSF H;  2XU6 A;  1FZE A;  2GUV A;  5CCG D;  1URQ B;  2M3B A;  2YNY A;  2Z5I A;  3L4F A;  4ZKU A;  1LTI C;  1N73 B;  2YKP A;  1CI6 B;  1L4A D;  2XZR A;  1KIL C;  3H32 A;  2Q9I A;  1MUU A;  2HOD A;  2FYZ A;  3M91 A;  1T2K D;  3N4X A;  2HFE D;  3HE4 B;  2WIT A;  5AW0 B;  1RF1 A;  1OXZ A;  2FYU K;  1NKN A;  1IC2 A;  1X9V A;  4N78 E;  4RES B;  2OYI B;  1KIL A;  2WT7 A;  4XA4 A;  1L4A C;  1SQV K;  2YO2 A;  5CCG A;  4M3L A;  5AW9 B;  1J1D C;  1T2K C;  1N86 A;  3NMD A;  3IFM A;  1Z56 A;  3M06 A;  1N7L A;  1X8Y A;  5CMZ A;  3KDP B;  3H6P A;  3BVH A;  3V2R A;  2L5G B;  2IFN A;  5APX A;  4EOT A;  1AQ5 A;  3R2P A;  3RK3 B;  2ZXE B;  1M7L A;  2J58 A;  1FZC C;  4WY4 B;  2HPC B;  2R3C A;  1FU1 A;  2XDJ A;  1JNM A;  3MGN A;  3P32 A;  3MIW A;  5AW6 B;  1LTT C;  1GD2 E;  2O1K A;  2FFD C;  1URQ A;  3HD7 C;  1GU4 A;  4HYT B;  1H8A A;  1N73 A;  1HBW A;  1GL2 D;  2HLO A;  1VDF A;  1JY2 N;  1EQ7 A;  3OA7 A;  4GKG A;  4Y99 C;  3M0D A;  1IK9 A;  3O8Z A;  2R5D A;  1HUC A;  2OYH A;  2FFD A;  3B5N B;  2XKM A;  5AVS B;  5AW7 B;  1GL2 C;  3VYI A;  2VRS A;  4W7Y A;  1ZV8 A;  2YO3 A;  5AW1 B;  1J1E C;  1YTZ T;  4LLH A;  1HGV A;  1A02 J;  3VMY A;  2WTY A;  1M1J C;  3M9H A;  4I2L C;  3VOP A;  1FZF A;  1GK4 A;  4N78 D;  4JYB A;  1GL2 A;  2E43 A;  4AQR D;  2A45 I;  4N3Y B;  1LTB C;  3BRV B;  2CPB A;  1N7S B;  1M1J A;  3N7N A;  2QM8 A;  1LT9 A;  5AVT B;  2ZFC A;  1FZB A;  1G2C B;  5APQ A;  1NTM K;  1LWU B;  1MFZ A;  3L35 A;  2C9N Y;  3KYQ A;  1T3U A;  3M9Q A;  4LC1 A;  2IPP A;  1S9K E;  2I1J A;  1YTZ I;  2H7H A;  3PP5 A;  2NPS B;  5AW5 B;  2Z5H A;  1FZA A;  1CZQ A;  1ZLL A;  2BAS A;  3L37 A;  1DX7 A;  1RF1 C;  1H89 A;  1KFM A;  3BAS A;  3TNU A;  5CCH A;  1RE4 A;  2N1T D;  2WSC H;  3SWF A;  2GUS A;  1IFM A;  2I1K A;  5CCG C;  5AVX B;  3NFQ A;  3MUD A;  2M8R A;  3RL0 D;  2FXM A;  3BRT B;  3B5N A;  1SP4 A;  1JUN A;  1X79 B;  2W6A A;  3RK2 B;  3VP8 A;  3UIA A;  3U1C A;  1FOS E;  5CHX A;  3HD7 B;  3HUS B;  1SFC B;  1LTG C;  4IFF A;  3RL0 C;  3GHG C;  3HTK A;  5AVV B;  3V2N A;  1URQ D;  2Q7C A;  3KQG A;  2N1T A;  4C7N A;  2C0X A;  4AYC A;  2WPQ A;  1SLQ A;  1L0N K;  2A45 H;  3TSI A;  1AFO A;  3II6 A;  1LTA C;  1GW4 A;  1FJP A;  1N7S A;  3VN0 A;  1LTJ C;  3GHG A;  2WPR A;  2Z4E A;  4OH8 B;  4DOJ A;  3M0A A;  3CI9 A;  1URQ C;  1JY3 N;  2JEE A;  5AVR B;  4JYC A;  1GU5 A;  1HH0 A;  1N73 C;  1LTJ A;  2H8P D;  2YMY A;  3LIE A;  3M0D C;  1VPC A;  5APS A;  1IFN A;  2OYH C;  4N6J A;  1JCC A;  1S9K D;  2H43 A;  1NOH A;  4KHX A;  3CLQ A;  1JCD A;  5CJ0 A;  3A3Y B;  1CI6 A;  2R5B A;  4HH2 A;  5KJ7 D;  3P8C D;  1CSB A;  2QM7 A;  1IO4 A;  1A02 F;  5AW4 B;  3HE4 A;  1T3J A;  1JO5 A;  2O1J A;  4IFM A;  3V5B A;  1JY3 O;  3RK3 D;  1XTG B;  2W6B A;  2OYI A;  3NXS A;  2XV5 A;  5APU A;  1JY3 P;  1WRG A;  3EFG A;  3H32 B;  3C9I A;  4WY4 D;  2HOD B;  3TYY A;  1OWA A;  5KJ7 C;  1GTW A;  1LTS C;  2JJL A;  2KP8 A;  1LT9 C;  3I5C A;  2LKM A;  1KIL B;  3RK3 C;  5AW3 B;  1JY2 O;  2P7J A;  3VMZ A;  5KJ7 A;  1JY2 P;  5CCH D;  4WY4 C;  1NTK K;  1IFJ A;  2OAR A;  1N2D C;  1NWQ A;  1FZG A;  2WWW A;  1RE3 A;  2P1J A;  2HYN A;  3A7O A;  3E1I A;  1IJD B;  1H88 A;  1L4A B;  1FDM A;  3CL3 D;  1ZR4 A;  4WY4 A;  2HPC A;  4W80 A;  3B5N D;  1J1D B;  5CCH C;  1RE4 C;  4W7Z A;  2XNX A;  1J2J B;  3P8C E;  1NKZ B;  4WB4 A;  1KQL A;  1FAV A;  1LGH B;  1GDT A;  1NAF A;  1SVF A;  5BU8 B;  2J59 M;  3B5N C;  2WZ7 A;  4XE5 B;  1RY3 A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...