1N7LA

Solution nmr structure of phospholamban in detergent micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cardiac phospholamban
publication title NMR solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles.
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Signaling protein
total genus 22
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7lA00
2M3BA 2HYNA 1FJKA 2KYVA 1ZLLA 2KB7P 1FJPA 1N7LA
chains in the Genus database with same CATH superfamily
3L75D 4Y99B 1J1EC 1NTMJ 1YYCA 5KLVG 3A3YB 1QVGO 5CCGC 1L0NE 2N1TC 2P10A 2XKMA 1HGVA 1VF5C 4GIFA 2E5TA 1USDA 1AVYA 1SQXE 1IFMA 1SQBJ 1IFJA 1FU1A 2R32A 3VP8A 2OTLP 2JWDA 3AE9C 1LTGC 3HD7B 1RE3A 1EZVI 2XV5A 1PGJA 2IZ1A 1SQVE 2QJKC 2IBZI 3O8ZA 1NTKK 1IK9A 1L4AB 1D7MA 3H1IE 3BRTB 2FFDA 1NTZE 1HJBA 2K3RA 3L74E 2ZXXA 3CCSP 1CZQA 1YI2P 2ZVNB 1CI6B 4DT0A 3CCEP 1JCDA 1UIIA 1KZUB 2IZ0A 2A06E 3HE4A 2HPCB 3Q5SA 2OYIA 2NPSC 2K9YA 3U1CA 1RF1C 2P1JA 1Q81Q 2KS1A 2GM4A 1VQ8P 1JO5A 2B89A 3II6A 1S9KE 3B71A 1GL2B 2P67A 1LTJA 4I7ZC 3L71G 3JC22 1EDJA 1VQNP 1VQLP 3PLNA 4YXDC 3V6IA 1OMIA 1TU3F 2QJPB 1KB9I 3V2PA 4IFFA 1GMJA 4L75A 1XTCC 3CCLP 1YTZI 4U3FG 3H1KG 2RN0A 2IBZG 4L76A 1KB9D 5KLVK 4ZMDA 3CCVP 1H0TB 1WT6A 1ZW0A 4DJGA 3NXSA 1PZQA 1YITP 2B87B 2FBWC 3PH0A 3CX5I 1N7SB 3HD7C 2AXCA 5BVZA 5AW7B 3AECC 4H0LD 3A0HH 4D6TG 1RH5B 3CX5D 2Q7CA 4I6MC 1LT9B 1L4AC 3ABVC 1P84D 3RL0g 3NMDA 3A0HE 3L71E 2FFDC 2B9BA 1GK4A 2N1TD 3Q5RA 4BXLA 1OW6A 1VF5D 1Q90D 2OARA 5CCHC 4DZOA 1IC2A 3L72G 3I56P 1VQOP 4Y28J 2HFED 3WU2H 1N8RQ 4C7RA 1M56D 2K1AA 1EZVE 3SWFA 1DD4A 3H25A 3WU2E 3GW6A 4BRYA 5CBOA 2Q9IA 3B5NA 3RK3C 2W6JH 2R3SA 1Y47A 4JPZB 2IBZE 2KNCB 4QMAA 5TISH 2BEQD 2WT7A 1KILE 5KJ7D 3S9OA 3LW5J 4HJGH 5TISE 5APTA 2L91A 1GTWA 2RH0A 3GF3A 2O1KA 3A0BH 2D2CC 5AVSB 1VQMP 1NTMK 3TGUJ 1HF9A 3P32A 1HJ0A 3A0BE 3VMAA 3FXDA 5B66H 3L35A 4OGQB 2O01H 4ZNCA 2H8PD 2QJYC 2ZT9B 1GW4A 5B66E 1QEXA 1OVVA 1USEA 2NPSD 4W7ZA 2Q6QA 1URQD 3AEBC 1SQBK 1KILB 1LGHB 4HB1A 1N86A 2XNDH 5APYA 3GHGA 3BRVB 1N7SC 2OYOA 1ZMEC 2I1KA 3D6YA 5APSA 1U7JA 1FZGA 1KB9H 3CWBJ 5GTHH 1JY3P 1JY3O 3JSVC 1SFCB 1KB9E 5GTHE 2LR2A 2R44A 4M3LA 3W67A 2YKPA 3GLMA 4GODA 1FC2C 2YO2A 2FYUG 4C7NA 1Q82Q 1LT1A 2QEXP 1YTZT 4K35A 1R5SA 2J5UA 2ZYGA 2P58A 3M0DA 1DD3A 3RL0B 1OX3A 3CX5H 3VN0A 5E79H 4OH8B 1SQXJ 2QM7A 3MD0A 3CX5E 5E79E 1P84E 1NTKD 1RF0A 1OWAA 2FKWB 1IFNA 4WY4A 1BSHA 3S4RA 4EDFA 5AVWB 2KZJA 4PD4D 3D71A 1KTMA 2YIUB 1YQ4C 1JY3N 1FDOA 1BE3J 1PP9G 1EDLA 2XDJA 3KHUA 5CCGA 3BCCD 2BCCJ 2N1TA 5BU5A 2FXMA 2O01N 3Q2YA 1HUCA 1X8YA 2NRGA 3L73D 1FDIA 5CCHD 4O9BA 2HYNA 2WWWA 3E7KA 4H44B 5KLVJ 4OGQC 4N6JA 2ZT9C 3P7KA 2B88A 1FZCC 2WVRA 1DX7A 2FYUE 5AW6B 3CCQP 2KLVA 2H88C 4PV1D 5AW2B 3G71P 4A7PA 1K8AQ 3RK3D 2ZVOB 1L0LD 1GD2E 2JWAA 2BCCD 2O3JA 2Z5IA 3R4YA 4WBAA 2POHA 2D2CD 5APQA 2KK7A 2E74D 1BCCD 2JEEA 2J59M 2E76B 3M91A 3NTNA 1NOHA 1PGQA 3KPEA 1PFIA 1Y9BA 1HWTC 3L4FA 3SWYA 1SQPD 1M1KQ 2H7HA 3BATA 1M1JC 1VPCA 2OTJP 2NPSA 3WUVA 2FXOA 2W6BA 1PV3A 3V4WA 2YNYA 3QWOC 2YKQA 1SQVG 1ZXGA 1S4XA 1BDDA 3CC4P 1NJIQ 1PPJD 1PL5A 3H1IG 3GG2A 1NU1G 1NTZG 4WY4C 1HVVA 2OYHC 1NYHA 3H32B 1EC5A 3H1LD 1DIPA 1IO4A 1AFOA 1SQQK 2LKMA 3HUSB 2RMZA 2WMMA 1S72P 3H1JE 5AVTB 2P2UA 2A06G 1NTKE 1E79H 3G6EP 4GKGA 1ZR2A 2QA4P 4LC1A 3AEGC 4N3YB 2YMKA 1FZBA 2W8ZA 2PGDA 1G2CA 2RKLA 4H13C 3TK1A 2E75B 3H1HD 2ZAEB 3R2PA 4TLFA 1DEBA 4UB8E 1XTGB 3U1AA 1W2EA 1KV4A 3HD7A 3BCCE 2E5YA 3OJAB 4U3FJ 3H1KJ 1NTMD 4JF7A 5AVRB 2ZXEB 2Q3IA 3B5ND 3L73E 4W7YA 3E1IA 1J1DC 3VOPA 2ZYDA 1W5CE 1KMIZ 1OXZA 3FWLA 1L4AA 2W27A 2WPQA 1BGYJ 1NU1E 2HLOA 3L70G 2WSCJ 1IFDA 4EIJA 3L75G 1PGOA 4IL6H 1FOSF 1SQBD 5AVVB 2Q1KA 2Q3EA 5GTIH 5CCHA 1L0LE 1CI6A 4IL6E 1NHLA 1VL2A 1Q7YQ 5GTIE 1LNQA 2IYPA 2CPSA 4D6TJ 3S1KA 1L0NK 4U3FD 2HPCA 2OTKE 3RK2B 4IFMA 2WSFH 1SVFA 4NPEA 1SQXK 1FZAA 3BASA 1GL2A 1T3UA 5AW3B 1SP4A 4XA4A 3HE4B 3L72J 3A5TA 1BGYD 3OW2O 2OYIB 3IN6A 3VP9A 1SQPE 5AW5B 2C9NY 1QL2A 3BVHA 3M0AA 4Y99C 1FS0E 1FDMA 1LP1A 1MFTA 1SQVK 4Z1MH 1JTHA 4AQRD 1H8AA 1N73B 4MN4C 1HBWA 1EZVG 4L73A 3CL3D 3L70E 2OQQA 4LGDE 1FE6A 1NH4A 3L75E 3C1LA 2FYNB 2Y0DA 3CCUP 4XE5B 3RBXA 1N7SA 3MUDC 3PJSK 3PP5A 2IFNA 1P84I 4WY4D 2V7QH 3TNUB 2YKOA 1PGPA 2KYVA 3G4SP 3ITKA 3P8CD 1ZRTD 3WUUA 4GOFA 3GF7A 1LT9A 1FOSE 3B8EB 5CCGD 2C9LY 5AW1B 1U57A 4EOTA 1QGKB 2PFXA 5AVYB 5AW0B 1ZLLA 2QRXA 3PHLA 1NKNA 3AE8C 4H13D 3AE7C 4CPGA 2L5GB 5TJHA 1ZV8A 3O6QA 1FJKA 1H88A 1Q86Q 2M5AB 2PRRA 1HGZA 2C0WA 1AVOA 2W6AA 1SQBE 1RY3A 3M9QA 1LJ2A 1GL2C 2Y0CA 3FWNA 1JMMA 1SQQJ 2QE7H 3A2AA 5EFWB 2YMYA 3TDKA 1VQPP 1X0TA 2PP6A 2KP8A 4L74A 4R4MA 1K05A 3F89A 2WSEJ 1S2EA 1AA0A 1N73C 3AE1C 2QJPC 1KYOI 5AVZB 3M9HA 3MHVA 3TF5A 3AE4C 3WUTA 3K5BA 2I1JA 1PP9J 1S3JA 2HR3A 2KSJA 1FZCA 4BWNA 1SQQD 1JUNA 3U59A 1DEEG 1KYOD 3M06A 3JCUH 1K9MQ 1GZLA 2KI7B 4W80A 2XZRA 2C0XA 3JCUE 1FZFA 4YPCA 4TT3H 1X9VA 5AW9B 2K9JB 3TGUD 1WMKA 1ZR4A 1LTAC 1GW3A 2KUBA 1JY2P 1JY2O 2QIWA 3CMAP 2YO3A 1SFCA 3AEFC 3L36A 2ZJSE 3GHGB 1NAFA 1LT9C 4HH2A 2M3EA 5APWA 1A02F 3MGNA 1L0NJ 1S1CX 1M1JA 4GOEA 2FY8A 4IL6X 2AEMA 3V4QA 4OWFA 1LWUB 3KQGA 1EDKA 3PTZA 4ASWA 3CD6P 3RBZA 5KKZB 1P84H 1OFCX 4PD4I 1T6AA 1K73Q 3V2NA 1FJPA 3CWBD 2MKVA 3HD7D 2BEZF 2OYHA 3USSA 2QSIA 2QVAA 4KJMA 2KSEA 1JY2N 1SQVJ 2HODA 2IPPA 4B86A 3IAOA 1L0ND 3FGAD 1L4AD 1OW7A 5BU8B 5AVXB 3H1IJ 1NU1J 1NTZJ 3KDPB 4H0LB 3SWKA 3L74J 1SQXD 3CLQA 1J1EB 2FXPA 1VQ5P 3EFFK 1L2PA 3MTUE 4I1LA 1MKMA 2CPBA 4IOIH 3TSIA 2N1TB 3AEDC 1VF5B 1VQ9P 2E43A 2WITA 1KILC 1SQVD 4ASVA 3EFGA 1BE3D 3H1JG 1GU4A 4IFDK 2WSFJ 1GL2D 3F5HA 1U7MA 2I8DA 1NTKG 4PJ0E 2ZYAA 3T97A 2Z4EA 3L74D 3MZWB 1KYOH 1Y8AA 1KFNA 4JBZA 1SFCC 1AQTA 1KYOE 5KLVD 2JDIH 2E42A 1BSNA 3BCCG 1FZEA 3TGUE 3AE2C 1NVOA 5CHXA 1NAYA 5APUA 1S9KD 1YQ3C 1LWUC 3C9IA 3RL0C 3L73G 3B4SA 3OAKA 3L75J 3HE5B 4JQ0D 1EDIA 3HTKB 5KTBA 1N7SD 2FYUK 2G8YA 2NPSB 3H32A 2XNXA 2KIKA 4RJTA 1RF1B 1URQB 1KQSO 3CPWO 1CSBA 2AEFA 5DJUB 1L0LG 2YIUC 1R5LA 3SFDC 1M7LA 3WMM0 3N7NA 3D70A 1RE4C 3CC2P 3G3ZA 4UB6H 1K04A 4AUWA 3CWBE 2YXQB 3L71J 1X79B 5KAFH 4UB6E 4KT0J 2V4HA 4PD4H 1WRGA 1M57D 1BCCG 5KAFE 4PD4E 4H44C 4UB8H 2N9BA 2R3CA 3AE6C 3PRJA 3A7OA 1SQPG 1G1JA 3MUDA 2GUSA 2KXPB 1OIPA 2HG5D 1G2CB 2KZIA 5CJ0A 3IFMA 1T8ZA 3L71D 1PPJG 1T2KC 3VMZA 4KHXA 5AVQB 4RKUJ 2GUVA 3H1LG 3CXHI 2LXCB 1QVFO 3C8VA 2E76C 2IFMA 1BE3E 2A45I 5KJ7C 3RK3E 1VQ7P 2N9YB 3CC7P 2JO1A 1SLQA 1EZVD 2R5DA 4OGQD 2VRSA 2BCCE 2FFDB 3SFEC 3CXHD 2ZT9D 1IFIA 3H1KD 2O1JA 5C39A 4JYBA 4RO0A 4ZKPA 2O01J 2QM8A 2IBZD 4NPDA 1BCCE 3H1HG 5KLVE 1KILD 1H89A 2WZ7A 2Q5UA 1YIJP 4I2LC 1X22A 3RGUA 1MV8A 2M3BA 1URQC 1NTMG 2KS1B 4PV1B 4R4LA 1N7LA 2W90A 3RK3B 3HUSC 1SFCD 3NFQA 1KD1Q 2JP3A 3CMEP 5L8RJ 1LTJB 4D6TD 3N4XA 4YTPC 3H6PA 5AW4B 1N73A 3VMYA 3OA7A 1IZNB 1ZN5A 1PPJE 1NU1K 1NTZK 4K3AA 5KLIB 2P7JA 5M1BA 5H2FH 2D2CB 5CBNA 2E74B 1LP1B 1JTHB 1SQBG 3H1LE 5H2FE 2K37A 4U7JA 3RL0D 1L0LK 2Z5HA 1N2DC 2E75C 3L72D 4JYCA 1OVUA 1H0TA 2M0BA 4WWIA 2B87A 1EXJA 2QJYB 2AEJA 1KFMA 3AEEC 3KZIH 2WQYC 1G1IA 2A45G 2KLUA 3MP7B 3TNUA 4NPFX 3KZIE 3H1HE 1JOCA 1ZP0C 1BGYG 5APVA 1OZHA 1RQVA 1S5LH 3VYIA 1SQPK 3D6ZA 1RE3C 4N78D 2NZ2A 1UIXA 3AE5C 1S5LE 4AYCA 1NTME 1Z56A 3I55P 3LIEA 2G3AA 1FBMA 1AQ5A 4H44D 3IR9A 2H89C 1KQFB 3RK2C 1FAVA 2M5AA 1LTBC 2XU6A 2FYUJ 1IFPA 2R5BA 2KNCA 1KQLA 3O6QB 3AEAC 2Y0EA 1IJDB 3CXHH 1NWQA 2PAJA 1NO4A 3VTPC 2OYIC 1YHQP 1T2KD 3G9RA 2A45H 3CXHE 4BRYB 4U3FE 3H1KE 1CW5A 1LTIC 4PV1C 1EXIA 3B5NB 2WTYA 2OGUA 1LTJC 2WT7B 2E76D 3Q5PA 1M90Q 1GDTA 3CCRP 1YJWP 1A02J 2WSCH 3KYQA 2AXTH 2YXRB 1BGYE 5KLIC 2FYUD 2QG4A 4DCKA 2AXTE 1JNMA 2E74C 3AE3C 4GT1A 1MFZA 1SS1A 1JMBA 2JJLA 1NGMB 1MUUA 2FYNC 1ZOYC 1KILA 1QX8A 3V5BA 4D6TE 4EI2A 1VQ6P 1VQKP 2WSSH 5B5EH 3CCJP 1FZCB 2K9JA 5AW8B 1E5WA 3KXDA 5B5EE 1W2BO 2IYOA 1GK6A 2LXBA 3Q3DA 3VMXA 3CCMP 3EWKA 3L72E 3QH9A 1YJNP 3H1JJ 1PP9D 5K5GB 1NTKJ 2SPZA 3HRNA 2WPVB 2JKVA 2CK3H 1OW8A 1LWUA 2W83C 3P8CE 1ZRTE 4LLHA 3UIAA 1PIXA 2E75D 5KAIH 3MIWA 1EQ7A 4C7NB 5KAIE 4N78E 1M1JB 1GU5A 1T3JA 3BCCJ 2WPSA 2JR8A 1SQQG 1JB0J 4C46A 3H1JD 3L73J 4WVZA 4HYTB 3LIDA 1JM0A 1QL1A 2KB7P 4DOJA 1RE4A 3L37A 1AJYA 4WY4B 3SSUA 4RESB 3TGUG 4ZKUA 2OYHB 1BDCA 4WB4A 3TYYA 3B5NC 1YJ9P 1VQ4P 3M9BA 2HODB 2ZFCA 1L0LJ 2MJZA 1R8EA 3RK2D 2IDBA 2KOGA 1KQGB 4H13B 5CMZA 1AV1A 2Y9ZA 1BCCJ 1JCCA 5AVUB 4PJ0H 3V2RA 1LTTC 1YBKA 3CWBG 3H1ID 2Y9YA 1NU1D 1NTZD 2IX7C 1SQPJ 1MZ9A 3GMAA 3LW5H 2UWJE 3FXEA 1SQQE 2ITAA 3GHGC 2QJKB 5KJ7A 1LTSC 3FX0A 1J1DB 5DJTB 1S5LX 1QLED 2A06D 3T97B 1L0NG 2WSEH 1KN7A 1KC8Q 1OVRA 1HH0A 1VDFA 1M8OB 4EYYQ 1J2JB 1HTLC 1SQXG 5CJ4A 3Q1MA 4HKZH 2M8RA 3H1LJ 1KORA 2GA1A 3L70J 3W68A 2J58A 5KKZC 3CI9A 3I5CA 2DW3A 1PP9E 3E1RA 3IF4A 4OVNF 2FYZA 1JEKA 3HE5A 4YXWH 3HTKA 3M0DC 2BASA 1RF1A 1URQA 5APXA 1BE3G 2V7QJ 3HUSA 1Q2NA 4GDOA 4I7ZB 1RF0C 2WPRA 3H1HJ 3EQ2A 1RQUA 2H43A 3P8MC 2BCCG 3L74G 1NKZB 1IK7A 4XFJA 3V2QA 1RHZB 1DH3A 2K88A 3L70D 3ZDMA 4H0LC
chains in the Genus database with same CATH topology
4Y99B 1J1EC 1ZN5A 1YYCA 2XDJA 1NU1K 1NTZK 1N73C 5CCGA 2P7JA 5AVZB 2N1TA 3M9HA 5BU5A 2FXMA 3A3YB 1HUCA 1JTHB 1X8YA 5CCGC 3RL0D 2I1JA 5CCHD 1L0LK 4O9BA 2N1TC 2HYNA 2Z5HA 1N2DC 2WWWA 4JYCA 2KSJA 2XKMA 1HGVA 1FZCA 4GIFA 4N6JA 1JUNA 3U59A 3P7KA 3M06A 1KFMA 1FZCC 1IFMA 1GZLA 1DX7A 1G1IA 2A45G 5AW6B 1IFJA 3TNUA 1FU1A 4W80A 2XZRA 2C0XA 2KLVA 1FZFA 2R32A 3VP8A 5AW2B 1X9VA 5AW9B 3RK3D 1LTGC 3HD7B 1ZR4A 1GD2E 1LTAC 1RE3A 1JOCA 5APVA 1GW3A 1JY2P 1JY2O 2XV5A 2Z5IA 2YO3A 1SFCA 3VYIA 1SQPK 4WBAA 1RE3C 3L36A 4N78D 3GHGB 3O8ZA 2POHA 1NAFA 1LT9C 4AYCA 5APQA 1NTKK 1IK9A 1L4AB 4HH2A 2JEEA 1Z56A 2J59M 3BRTB 5APWA 2FFDA 3LIEA 1A02F 1HJBA 3MGNA 3M91A 3NTNA 1FBMA 1M1JA 3KPEA 1NOHA 1PFIA 1AQ5A 3IR9A 1CZQA 1HWTC 3V4QA 1LWUB 3KQGA 3L4FA 3SWYA 1CI6B 2H7HA 3BATA 1M1JC 1JCDA 1VPCA 3RK2C 1FAVA 1LTBC 1KZUB 2XU6A 2NPSA 3V2NA 2W6BA 3HE4A 1FJPA 3V4WA 2HPCB 2YNYA 2YKQA 2OYIA 2R5BA 1KQLA 2NPSC 3HD7D 3U1CA 1RF1C 2P1JA 1IJDB 2OYHA 2GM4A 1NWQA 2PAJA 1NO4A 1JO5A 3II6A 3VTPC 2OYIC 1S9KE 1T2KD 1GL2B 2A45H 2P67A 4WY4C 1HVVA 2OYHC 3H32B 1CW5A 1LTJA 1LTIC 1JY2N 2HODA 2IPPA 3B5NB 2WTYA 4B86A 1IO4A 1AFOA 1SQQK 2LKMA 1L4AD 3HUSB 1LTJC 2WT7B 5BU8B 5AVTB 5AVXB 1GDTA 2P2UA 3KDPB 1A02J 2WSCH 3KYQA 3CLQA 1J1EB 4GKGA 1ZR2A 1JNMA 4LC1A 3MTUE 4I1LA 4N3YB 4GT1A 1FZBA 3V2PA 1MFZA 4IFFA 2CPBA 2JJLA 1XTCC 3TSIA 1YTZI 1MUUA 1G2CA 2N1TB 3TK1A 1KILA 3V5BA 3R2PA 2E43A 2WITA 1DEBA 1KILC 1XTGB 3EFGA 5KLVK 1GU4A 1FZCB 3U1AA 1WT6A 4IFDK 1W2EA 3HD7A 1GL2D 5AW8B 1E5WA 1GK6A 3NXSA 3OJAB 4JF7A 5AVRB 3VMXA 2ZXEB 2Q3IA 3B5ND 1N7SB 3HD7C 3T97A 5BVZA 5AW7B 2Z4EA 4W7YA 1KFNA 3E1IA 1J1DC 3VOPA 1OXZA 1SFCC 1L4AA 2W27A 3HRNA 2WPQA 2Q7CA 2HLOA 4I6MC 1LT9B 1L4AC 1IFDA 3NMDA 4EIJA 1FOSF 2E42A 5AVVB 2FFDC 1LWUA 1GK4A 5CCHA 1FZEA 1CI6A 3P8CE 4LLHA 2N1TD 1NHLA 3UIAA 3MIWA 5CHXA 5APUA 1S9KD 2CPSA 1LWUC 3C9IA 2OARA 3RL0C 5CCHC 1EQ7A 1L0NK 4DZOA 4C7NB 2HPCA 1IC2A 3OAKA 4N78E 1M1JB 3RK2B 1GU5A 4IFMA 2WSFH 1T3JA 1SVFA 2HFED 2WPSA 1SQXK 3HE5B 4C7RA 4C46A 1FZAA 3HTKB 5KTBA 3SWFA 3BASA 1N7SD 1GL2A 2FYUK 1T3UA 5AW3B 2NPSB 1SP4A 3H32A 2XNXA 4XA4A 4HYTB 1RF1B 3LIDA 2Q9IA 1URQB 3HE4B 3A5TA 1QL1A 2KB7P 4DOJA 3B5NA 3RK3C 2OYIB 1RE4A 1CSBA 3VP9A 3L37A 4WY4B 4RESB 4ZKUA 2OYHB 1M7LA 3WMM0 2WT7A 3N7NA 4WB4A 5AW5B 3TYYA 3B5NC 5KJ7D 2C9NY 1RE4C 1QL2A 5APTA 1GTWA 3G3ZA 3BVHA 3M0AA 4Y99C 1FDMA 1SQVK 3M9BA 1JTHA 4AUWA 4AQRD 1H8AA 2O1KA 2HODB 1X79B 2ZFCA 1N73B 5AVSB 1NTMK 2MJZA 1WRGA 3P32A 1HBWA 3CL3D 3RK2D 3L35A 2N9BA 2R3CA 3A7OA 2KOGA 2O01H 4LGDE 2H8PD 1NH4A 1GW4A 1G1JA 5CMZA 4XE5B 1JCCA 3MUDA 5AVUB 2GUSA 2NPSD 2HG5D 4W7ZA 3V2RA 1LTTC 1URQD 1G2CB 1SQBK 1KILB 1N7SA 1LGHB 2IX7C 5CJ0A 3PP5A 2IFNA 4WY4D 3IFMA 1N86A 3TNUB 2YKOA 5APYA 3GHGA 1MZ9A 1T8ZA 2KYVA 1N7SC 3BRVB 1T2KC 3VMZA 4KHXA 3LW5H 2I1KA 3P8CD 5APSA 3GHGC 1FZGA 5KJ7A 1LTSC 5AVQB 1J1DB 1JY3P 2GUVA 1JY3O 1LT9A 1SFCB 2WSEH 2IFMA 1FOSE 2A45I 5KJ7C 3B8EB 1HH0A 5CCGD 4M3LA 1VDFA 5AW1B 2C9LY 1J2JB 4EOTA 2YKPA 1HTLC 5CJ4A 1SLQA 5AVYB 5AW0B 2R5DA 1ZLLA 2VRSA 2FFDB 2M8RA 2YO2A 1NKNA 4C7NA 1IFIA 2J58A 2O1JA 3CI9A 4JYBA 3I5CA 2L5GB 1YTZT 1ZV8A 4ZKPA 2QM8A 3M0DA 1FJKA 3RL0B 3VN0A 2FYZA 3HE5A 1H88A 4OH8B 3HTKA 1KILD 2QM7A 3MD0A 1H89A 2WZ7A 3M0DC 2Q5UA 1HGZA 2BASA 2C0WA 1RF1A 1URQA 2W6AA 1RF0A 4I2LC 1RY3A 3M9QA 5APXA 1OWAA 1GL2C 2FKWB 1IFNA 4WY4A 1JMMA 3HUSA 1MV8A 2M3BA 1URQC 1RF0C 2WPRA 3EQ2A 3A2AA 5AVWB 2H43A 1N7LA 2YMYA 3P8MC 3RK3B 3HUSC 1SFCD 3NFQA 1NKZB 1LTJB 1JY3N 2PP6A 3V2QA 3N4XA 3H6PA 1DH3A 5AW4B 1N73A 2KP8A 3VMYA 3OA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M3B A;  2HYN A;  1FJK A;  2KYV A;  1ZLL A;  2KB7 P;  1FJP A;  1N7L A; 
#chains in the Genus database with same CATH topology
 3L75 D;  4Y99 B;  1J1E C;  1NTM J;  1YYC A;  5KLV G;  3A3Y B;  1QVG O;  5CCG C;  1L0N E;  2N1T C;  2P10 A;  2XKM A;  1HGV A;  1VF5 C;  4GIF A;  2E5T A;  1USD A;  1AVY A;  1SQX E;  1IFM A;  1SQB J;  1IFJ A;  1FU1 A;  2R32 A;  3VP8 A;  2OTL P;  2JWD A;  3AE9 C;  1LTG C;  3HD7 B;  1RE3 A;  1EZV I;  2XV5 A;  1PGJ A;  2IZ1 A;  1SQV E;  2QJK C;  2IBZ I;  3O8Z A;  1NTK K;  1IK9 A;  1L4A B;  1D7M A;  3H1I E;  3BRT B;  2FFD A;  1NTZ E;  1HJB A;  2K3R A;  3L74 E;  2ZXX A;  3CCS P;  1CZQ A;  1YI2 P;  2ZVN B;  1CI6 B;  4DT0 A;  3CCE P;  1JCD A;  1UII A;  1KZU B;  2IZ0 A;  2A06 E;  3HE4 A;  2HPC B;  3Q5S A;  2OYI A;  2NPS C;  2K9Y A;  3U1C A;  1RF1 C;  2P1J A;  1Q81 Q;  2KS1 A;  2GM4 A;  1VQ8 P;  1JO5 A;  2B89 A;  3II6 A;  1S9K E;  3B71 A;  1GL2 B;  2P67 A;  1LTJ A;  4I7Z C;  3L71 G;  3JC2 2;  1EDJ A;  1VQN P;  1VQL P;  3PLN A;  4YXD C;  3V6I A;  1OMI A;  1TU3 F;  2QJP B;  1KB9 I;  3V2P A;  4IFF A;  1GMJ A;  4L75 A;  1XTC C;  3CCL P;  1YTZ I;  4U3F G;  3H1K G;  2RN0 A;  2IBZ G;  4L76 A;  1KB9 D;  5KLV K;  4ZMD A;  3CCV P;  1H0T B;  1WT6 A;  1ZW0 A;  4DJG A;  3NXS A;  1PZQ A;  1YIT P;  2B87 B;  2FBW C;  3PH0 A;  3CX5 I;  1N7S B;  3HD7 C;  2AXC A;  5BVZ A;  5AW7 B;  3AEC C;  4H0L D;  3A0H H;  4D6T G;  1RH5 B;  3CX5 D;  2Q7C A;  4I6M C;  1LT9 B;  1L4A C;  3ABV C;  1P84 D;  3RL0 g;  3NMD A;  3A0H E;  3L71 E;  2FFD C;  2B9B A;  1GK4 A;  2N1T D;  3Q5R A;  4BXL A;  1OW6 A;  1VF5 D;  1Q90 D;  2OAR A;  5CCH C;  4DZO A;  1IC2 A;  3L72 G;  3I56 P;  1VQO P;  4Y28 J;  2HFE D;  3WU2 H;  1N8R Q;  4C7R A;  1M56 D;  2K1A A;  1EZV E;  3SWF A;  1DD4 A;  3H25 A;  3WU2 E;  3GW6 A;  4BRY A;  5CBO A;  2Q9I A;  3B5N A;  3RK3 C;  2W6J H;  2R3S A;  1Y47 A;  4JPZ B;  2IBZ E;  2KNC B;  4QMA A;  5TIS H;  2BEQ D;  2WT7 A;  1KIL E;  5KJ7 D;  3S9O A;  3LW5 J;  4HJG H;  5TIS E;  5APT A;  2L91 A;  1GTW A;  2RH0 A;  3GF3 A;  2O1K A;  3A0B H;  2D2C C;  5AVS B;  1VQM P;  1NTM K;  3TGU J;  1HF9 A;  3P32 A;  1HJ0 A;  3A0B E;  3VMA A;  3FXD A;  5B66 H;  3L35 A;  4OGQ B;  2O01 H;  4ZNC A;  2H8P D;  2QJY C;  2ZT9 B;  1GW4 A;  5B66 E;  1QEX A;  1OVV A;  1USE A;  2NPS D;  4W7Z A;  2Q6Q A;  1URQ D;  3AEB C;  1SQB K;  1KIL B;  1LGH B;  4HB1 A;  1N86 A;  2XND H;  5APY A;  3GHG A;  3BRV B;  1N7S C;  2OYO A;  1ZME C;  2I1K A;  3D6Y A;  5APS A;  1U7J A;  1FZG A;  1KB9 H;  3CWB J;  5GTH H;  1JY3 P;  1JY3 O;  3JSV C;  1SFC B;  1KB9 E;  5GTH E;  2LR2 A;  2R44 A;  4M3L A;  3W67 A;  2YKP A;  3GLM A;  4GOD A;  1FC2 C;  2YO2 A;  2FYU G;  4C7N A;  1Q82 Q;  1LT1 A;  2QEX P;  1YTZ T;  4K35 A;  1R5S A;  2J5U A;  2ZYG A;  2P58 A;  3M0D A;  1DD3 A;  3RL0 B;  1OX3 A;  3CX5 H;  3VN0 A;  5E79 H;  4OH8 B;  1SQX J;  2QM7 A;  3MD0 A;  3CX5 E;  5E79 E;  1P84 E;  1NTK D;  1RF0 A;  1OWA A;  2FKW B;  1IFN A;  4WY4 A;  1BSH A;  3S4R A;  4EDF A;  5AVW B;  2KZJ A;  4PD4 D;  3D71 A;  1KTM A;  2YIU B;  1YQ4 C;  1JY3 N;  1FDO A;  1BE3 J;  1PP9 G;  1EDL A;  2XDJ A;  3KHU A;  5CCG A;  3BCC D;  2BCC J;  2N1T A;  5BU5 A;  2FXM A;  2O01 N;  3Q2Y A;  1HUC A;  1X8Y A;  2NRG A;  3L73 D;  1FDI A;  5CCH D;  4O9B A;  2HYN A;  2WWW A;  3E7K A;  4H44 B;  5KLV J;  4OGQ C;  4N6J A;  2ZT9 C;  3P7K A;  2B88 A;  1FZC C;  2WVR A;  1DX7 A;  2FYU E;  5AW6 B;  3CCQ P;  2KLV A;  2H88 C;  4PV1 D;  5AW2 B;  3G71 P;  4A7P A;  1K8A Q;  3RK3 D;  2ZVO B;  1L0L D;  1GD2 E;  2JWA A;  2BCC D;  2O3J A;  2Z5I A;  3R4Y A;  4WBA A;  2POH A;  2D2C D;  5APQ A;  2KK7 A;  2E74 D;  1BCC D;  2JEE A;  2J59 M;  2E76 B;  3M91 A;  3NTN A;  1NOH A;  1PGQ A;  3KPE A;  1PFI A;  1Y9B A;  1HWT C;  3L4F A;  3SWY A;  1SQP D;  1M1K Q;  2H7H A;  3BAT A;  1M1J C;  1VPC A;  2OTJ P;  2NPS A;  3WUV A;  2FXO A;  2W6B A;  1PV3 A;  3V4W A;  2YNY A;  3QWO C;  2YKQ A;  1SQV G;  1ZXG A;  1S4X A;  1BDD A;  3CC4 P;  1NJI Q;  1PPJ D;  1PL5 A;  3H1I G;  3GG2 A;  1NU1 G;  1NTZ G;  4WY4 C;  1HVV A;  2OYH C;  1NYH A;  3H32 B;  1EC5 A;  3H1L D;  1DIP A;  1IO4 A;  1AFO A;  1SQQ K;  2LKM A;  3HUS B;  2RMZ A;  2WMM A;  1S72 P;  3H1J E;  5AVT B;  2P2U A;  2A06 G;  1NTK E;  1E79 H;  3G6E P;  4GKG A;  1ZR2 A;  2QA4 P;  4LC1 A;  3AEG C;  4N3Y B;  2YMK A;  1FZB A;  2W8Z A;  2PGD A;  1G2C A;  2RKL A;  4H13 C;  3TK1 A;  2E75 B;  3H1H D;  2ZAE B;  3R2P A;  4TLF A;  1DEB A;  4UB8 E;  1XTG B;  3U1A A;  1W2E A;  1KV4 A;  3HD7 A;  3BCC E;  2E5Y A;  3OJA B;  4U3F J;  3H1K J;  1NTM D;  4JF7 A;  5AVR B;  2ZXE B;  2Q3I A;  3B5N D;  3L73 E;  4W7Y A;  3E1I A;  1J1D C;  3VOP A;  2ZYD A;  1W5C E;  1KMI Z;  1OXZ A;  3FWL A;  1L4A A;  2W27 A;  2WPQ A;  1BGY J;  1NU1 E;  2HLO A;  3L70 G;  2WSC J;  1IFD A;  4EIJ A;  3L75 G;  1PGO A;  4IL6 H;  1FOS F;  1SQB D;  5AVV B;  2Q1K A;  2Q3E A;  5GTI H;  5CCH A;  1L0L E;  1CI6 A;  4IL6 E;  1NHL A;  1VL2 A;  1Q7Y Q;  5GTI E;  1LNQ A;  2IYP A;  2CPS A;  4D6T J;  3S1K A;  1L0N K;  4U3F D;  2HPC A;  2OTK E;  3RK2 B;  4IFM A;  2WSF H;  1SVF A;  4NPE A;  1SQX K;  1FZA A;  3BAS A;  1GL2 A;  1T3U A;  5AW3 B;  1SP4 A;  4XA4 A;  3HE4 B;  3L72 J;  3A5T A;  1BGY D;  3OW2 O;  2OYI B;  3IN6 A;  3VP9 A;  1SQP E;  5AW5 B;  2C9N Y;  1QL2 A;  3BVH A;  3M0A A;  4Y99 C;  1FS0 E;  1FDM A;  1LP1 A;  1MFT A;  1SQV K;  4Z1M H;  1JTH A;  4AQR D;  1H8A A;  1N73 B;  4MN4 C;  1HBW A;  1EZV G;  4L73 A;  3CL3 D;  3L70 E;  2OQQ A;  4LGD E;  1FE6 A;  1NH4 A;  3L75 E;  3C1L A;  2FYN B;  2Y0D A;  3CCU P;  4XE5 B;  3RBX A;  1N7S A;  3MUD C;  3PJS K;  3PP5 A;  2IFN A;  1P84 I;  4WY4 D;  2V7Q H;  3TNU B;  2YKO A;  1PGP A;  2KYV A;  3G4S P;  3ITK A;  3P8C D;  1ZRT D;  3WUU A;  4GOF A;  3GF7 A;  1LT9 A;  1FOS E;  3B8E B;  5CCG D;  2C9L Y;  5AW1 B;  1U57 A;  4EOT A;  1QGK B;  2PFX A;  5AVY B;  5AW0 B;  1ZLL A;  2QRX A;  3PHL A;  1NKN A;  3AE8 C;  4H13 D;  3AE7 C;  4CPG A;  2L5G B;  5TJH A;  1ZV8 A;  3O6Q A;  1FJK A;  1H88 A;  1Q86 Q;  2M5A B;  2PRR A;  1HGZ A;  2C0W A;  1AVO A;  2W6A A;  1SQB E;  1RY3 A;  3M9Q A;  1LJ2 A;  1GL2 C;  2Y0C A;  3FWN A;  1JMM A;  1SQQ J;  2QE7 H;  3A2A A;  5EFW B;  2YMY A;  3TDK A;  1VQP P;  1X0T A;  2PP6 A;  2KP8 A;  4L74 A;  4R4M A;  1K05 A;  3F89 A;  2WSE J;  1S2E A;  1AA0 A;  1N73 C;  3AE1 C;  2QJP C;  1KYO I;  5AVZ B;  3M9H A;  3MHV A;  3TF5 A;  3AE4 C;  3WUT A;  3K5B A;  2I1J A;  1PP9 J;  1S3J A;  2HR3 A;  2KSJ A;  1FZC A;  4BWN A;  1SQQ D;  1JUN A;  3U59 A;  1DEE G;  1KYO D;  3M06 A;  3JCU H;  1K9M Q;  1GZL A;  2KI7 B;  4W80 A;  2XZR A;  2C0X A;  3JCU E;  1FZF A;  4YPC A;  4TT3 H;  1X9V A;  5AW9 B;  2K9J B;  3TGU D;  1WMK A;  1ZR4 A;  1LTA C;  1GW3 A;  2KUB A;  1JY2 P;  1JY2 O;  2QIW A;  3CMA P;  2YO3 A;  1SFC A;  3AEF C;  3L36 A;  2ZJS E;  3GHG B;  1NAF A;  1LT9 C;  4HH2 A;  2M3E A;  5APW A;  1A02 F;  3MGN A;  1L0N J;  1S1C X;  1M1J A;  4GOE A;  2FY8 A;  4IL6 X;  2AEM A;  3V4Q A;  4OWF A;  1LWU B;  3KQG A;  1EDK A;  3PTZ A;  4ASW A;  3CD6 P;  3RBZ A;  5KKZ B;  1P84 H;  1OFC X;  4PD4 I;  1T6A A;  1K73 Q;  3V2N A;  1FJP A;  3CWB D;  2MKV A;  3HD7 D;  2BEZ F;  2OYH A;  3USS A;  2QSI A;  2QVA A;  4KJM A;  2KSE A;  1JY2 N;  1SQV J;  2HOD A;  2IPP A;  4B86 A;  3IAO A;  1L0N D;  3FGA D;  1L4A D;  1OW7 A;  5BU8 B;  5AVX B;  3H1I J;  1NU1 J;  1NTZ J;  3KDP B;  4H0L B;  3SWK A;  3L74 J;  1SQX D;  3CLQ A;  1J1E B;  2FXP A;  1VQ5 P;  3EFF K;  1L2P A;  3MTU E;  4I1L A;  1MKM A;  2CPB A;  4IOI H;  3TSI A;  2N1T B;  3AED C;  1VF5 B;  1VQ9 P;  2E43 A;  2WIT A;  1KIL C;  1SQV D;  4ASV A;  3EFG A;  1BE3 D;  3H1J G;  1GU4 A;  4IFD K;  2WSF J;  1GL2 D;  3F5H A;  1U7M A;  2I8D A;  1NTK G;  4PJ0 E;  2ZYA A;  3T97 A;  2Z4E A;  3L74 D;  3MZW B;  1KYO H;  1Y8A A;  1KFN A;  4JBZ A;  1SFC C;  1AQT A;  1KYO E;  5KLV D;  2JDI H;  2E42 A;  1BSN A;  3BCC G;  1FZE A;  3TGU E;  3AE2 C;  1NVO A;  5CHX A;  1NAY A;  5APU A;  1S9K D;  1YQ3 C;  1LWU C;  3C9I A;  3RL0 C;  3L73 G;  3B4S A;  3OAK A;  3L75 J;  3HE5 B;  4JQ0 D;  1EDI A;  3HTK B;  5KTB A;  1N7S D;  2FYU K;  2G8Y A;  2NPS B;  3H32 A;  2XNX A;  2KIK A;  4RJT A;  1RF1 B;  1URQ B;  1KQS O;  3CPW O;  1CSB A;  2AEF A;  5DJU B;  1L0L G;  2YIU C;  1R5L A;  3SFD C;  1M7L A;  3WMM 0;  3N7N A;  3D70 A;  1RE4 C;  3CC2 P;  3G3Z A;  4UB6 H;  1K04 A;  4AUW A;  3CWB E;  2YXQ B;  3L71 J;  1X79 B;  5KAF H;  4UB6 E;  4KT0 J;  2V4H A;  4PD4 H;  1WRG A;  1M57 D;  1BCC G;  5KAF E;  4PD4 E;  4H44 C;  4UB8 H;  2N9B A;  2R3C A;  3AE6 C;  3PRJ A;  3A7O A;  1SQP G;  1G1J A;  3MUD A;  2GUS A;  2KXP B;  1OIP A;  2HG5 D;  1G2C B;  2KZI A;  5CJ0 A;  3IFM A;  1T8Z A;  3L71 D;  1PPJ G;  1T2K C;  3VMZ A;  4KHX A;  5AVQ B;  4RKU J;  2GUV A;  3H1L G;  3CXH I;  2LXC B;  1QVF O;  3C8V A;  2E76 C;  2IFM A;  1BE3 E;  2A45 I;  5KJ7 C;  3RK3 E;  1VQ7 P;  2N9Y B;  3CC7 P;  2JO1 A;  1SLQ A;  1EZV D;  2R5D A;  4OGQ D;  2VRS A;  2BCC E;  2FFD B;  3SFE C;  3CXH D;  2ZT9 D;  1IFI A;  3H1K D;  2O1J A;  5C39 A;  4JYB A;  4RO0 A;  4ZKP A;  2O01 J;  2QM8 A;  2IBZ D;  4NPD A;  1BCC E;  3H1H G;  5KLV E;  1KIL D;  1H89 A;  2WZ7 A;  2Q5U A;  1YIJ P;  4I2L C;  1X22 A;  3RGU A;  1MV8 A;  2M3B A;  1URQ C;  1NTM G;  2KS1 B;  4PV1 B;  4R4L A;  1N7L A;  2W90 A;  3RK3 B;  3HUS C;  1SFC D;  3NFQ A;  1KD1 Q;  2JP3 A;  3CME P;  5L8R J;  1LTJ B;  4D6T D;  3N4X A;  4YTP C;  3H6P A;  5AW4 B;  1N73 A;  3VMY A;  3OA7 A;  1IZN B;  1ZN5 A;  1PPJ E;  1NU1 K;  1NTZ K;  4K3A A;  5KLI B;  2P7J A;  5M1B A;  5H2F H;  2D2C B;  5CBN A;  2E74 B;  1LP1 B;  1JTH B;  1SQB G;  3H1L E;  5H2F E;  2K37 A;  4U7J A;  3RL0 D;  1L0L K;  2Z5H A;  1N2D C;  2E75 C;  3L72 D;  4JYC A;  1OVU A;  1H0T A;  2M0B A;  4WWI A;  2B87 A;  1EXJ A;  2QJY B;  2AEJ A;  1KFM A;  3AEE C;  3KZI H;  2WQY C;  1G1I A;  2A45 G;  2KLU A;  3MP7 B;  3TNU A;  4NPF X;  3KZI E;  3H1H E;  1JOC A;  1ZP0 C;  1BGY G;  5APV A;  1OZH A;  1RQV A;  1S5L H;  3VYI A;  1SQP K;  3D6Z A;  1RE3 C;  4N78 D;  2NZ2 A;  1UIX A;  3AE5 C;  1S5L E;  4AYC A;  1NTM E;  1Z56 A;  3I55 P;  3LIE A;  2G3A A;  1FBM A;  1AQ5 A;  4H44 D;  3IR9 A;  2H89 C;  1KQF B;  3RK2 C;  1FAV A;  2M5A A;  1LTB C;  2XU6 A;  2FYU J;  1IFP A;  2R5B A;  2KNC A;  1KQL A;  3O6Q B;  3AEA C;  2Y0E A;  1IJD B;  3CXH H;  1NWQ A;  2PAJ A;  1NO4 A;  3VTP C;  2OYI C;  1YHQ P;  1T2K D;  3G9R A;  2A45 H;  3CXH E;  4BRY B;  4U3F E;  3H1K E;  1CW5 A;  1LTI C;  4PV1 C;  1EXI A;  3B5N B;  2WTY A;  2OGU A;  1LTJ C;  2WT7 B;  2E76 D;  3Q5P A;  1M90 Q;  1GDT A;  3CCR P;  1YJW P;  1A02 J;  2WSC H;  3KYQ A;  2AXT H;  2YXR B;  1BGY E;  5KLI C;  2FYU D;  2QG4 A;  4DCK A;  2AXT E;  1JNM A;  2E74 C;  3AE3 C;  4GT1 A;  1MFZ A;  1SS1 A;  1JMB A;  2JJL A;  1NGM B;  1MUU A;  2FYN C;  1ZOY C;  1KIL A;  1QX8 A;  3V5B A;  4D6T E;  4EI2 A;  1VQ6 P;  1VQK P;  2WSS H;  5B5E H;  3CCJ P;  1FZC B;  2K9J A;  5AW8 B;  1E5W A;  3KXD A;  5B5E E;  1W2B O;  2IYO A;  1GK6 A;  2LXB A;  3Q3D A;  3VMX A;  3CCM P;  3EWK A;  3L72 E;  3QH9 A;  1YJN P;  3H1J J;  1PP9 D;  5K5G B;  1NTK J;  2SPZ A;  3HRN A;  2WPV B;  2JKV A;  2CK3 H;  1OW8 A;  1LWU A;  2W83 C;  3P8C E;  1ZRT E;  4LLH A;  3UIA A;  1PIX A;  2E75 D;  5KAI H;  3MIW A;  1EQ7 A;  4C7N B;  5KAI E;  4N78 E;  1M1J B;  1GU5 A;  1T3J A;  3BCC J;  2WPS A;  2JR8 A;  1SQQ G;  1JB0 J;  4C46 A;  3H1J D;  3L73 J;  4WVZ A;  4HYT B;  3LID A;  1JM0 A;  1QL1 A;  2KB7 P;  4DOJ A;  1RE4 A;  3L37 A;  1AJY A;  4WY4 B;  3SSU A;  4RES B;  3TGU G;  4ZKU A;  2OYH B;  1BDC A;  4WB4 A;  3TYY A;  3B5N C;  1YJ9 P;  1VQ4 P;  3M9B A;  2HOD B;  2ZFC A;  1L0L J;  2MJZ A;  1R8E A;  3RK2 D;  2IDB A;  2KOG A;  1KQG B;  4H13 B;  5CMZ A;  1AV1 A;  2Y9Z A;  1BCC J;  1JCC A;  5AVU B;  4PJ0 H;  3V2R A;  1LTT C;  1YBK A;  3CWB G;  3H1I D;  2Y9Y A;  1NU1 D;  1NTZ D;  2IX7 C;  1SQP J;  1MZ9 A;  3GMA A;  3LW5 H;  2UWJ E;  3FXE A;  1SQQ E;  2ITA A;  3GHG C;  2QJK B;  5KJ7 A;  1LTS C;  3FX0 A;  1J1D B;  5DJT B;  1S5L X;  1QLE D;  2A06 D;  3T97 B;  1L0N G;  2WSE H;  1KN7 A;  1KC8 Q;  1OVR A;  1HH0 A;  1VDF A;  1M8O B;  4EYY Q;  1J2J B;  1HTL C;  1SQX G;  5CJ4 A;  3Q1M A;  4HKZ H;  2M8R A;  3H1L J;  1KOR A;  2GA1 A;  3L70 J;  3W68 A;  2J58 A;  5KKZ C;  3CI9 A;  3I5C A;  2DW3 A;  1PP9 E;  3E1R A;  3IF4 A;  4OVN F;  2FYZ A;  1JEK A;  3HE5 A;  4YXW H;  3HTK A;  3M0D C;  2BAS A;  1RF1 A;  1URQ A;  5APX A;  1BE3 G;  2V7Q J;  3HUS A;  1Q2N A;  4GDO A;  4I7Z B;  1RF0 C;  2WPR A;  3H1H J;  3EQ2 A;  1RQU A;  2H43 A;  3P8M C;  2BCC G;  3L74 G;  1NKZ B;  1IK7 A;  4XFJ A;  3V2Q A;  1RHZ B;  1DH3 A;  2K88 A;  3L70 D;  3ZDM A;  4H0L C; 
#chains in the Genus database with same CATH homology
 4Y99 B;  1J1E C;  1ZN5 A;  1YYC A;  2XDJ A;  1NU1 K;  1NTZ K;  1N73 C;  5CCG A;  2P7J A;  5AVZ B;  2N1T A;  3M9H A;  5BU5 A;  2FXM A;  3A3Y B;  1HUC A;  1JTH B;  1X8Y A;  5CCG C;  3RL0 D;  2I1J A;  5CCH D;  1L0L K;  4O9B A;  2N1T C;  2HYN A;  2Z5H A;  1N2D C;  2WWW A;  4JYC A;  2KSJ A;  2XKM A;  1HGV A;  1FZC A;  4GIF A;  4N6J A;  1JUN A;  3U59 A;  3P7K A;  3M06 A;  1KFM A;  1FZC C;  1IFM A;  1GZL A;  1DX7 A;  1G1I A;  2A45 G;  5AW6 B;  1IFJ A;  3TNU A;  1FU1 A;  4W80 A;  2XZR A;  2C0X A;  2KLV A;  1FZF A;  2R32 A;  3VP8 A;  5AW2 B;  1X9V A;  5AW9 B;  3RK3 D;  1LTG C;  3HD7 B;  1ZR4 A;  1GD2 E;  1LTA C;  1RE3 A;  1JOC A;  5APV A;  1GW3 A;  1JY2 P;  1JY2 O;  2XV5 A;  2Z5I A;  2YO3 A;  1SFC A;  3VYI A;  1SQP K;  4WBA A;  1RE3 C;  3L36 A;  4N78 D;  3GHG B;  3O8Z A;  2POH A;  1NAF A;  1LT9 C;  4AYC A;  5APQ A;  1NTK K;  1IK9 A;  1L4A B;  4HH2 A;  2JEE A;  1Z56 A;  2J59 M;  3BRT B;  5APW A;  2FFD A;  3LIE A;  1A02 F;  1HJB A;  3MGN A;  3M91 A;  3NTN A;  1FBM A;  1M1J A;  3KPE A;  1NOH A;  1PFI A;  1AQ5 A;  3IR9 A;  1CZQ A;  1HWT C;  3V4Q A;  1LWU B;  3KQG A;  3L4F A;  3SWY A;  1CI6 B;  2H7H A;  3BAT A;  1M1J C;  1JCD A;  1VPC A;  3RK2 C;  1FAV A;  1LTB C;  1KZU B;  2XU6 A;  2NPS A;  3V2N A;  2W6B A;  3HE4 A;  1FJP A;  3V4W A;  2HPC B;  2YNY A;  2YKQ A;  2OYI A;  2R5B A;  1KQL A;  2NPS C;  3HD7 D;  3U1C A;  1RF1 C;  2P1J A;  1IJD B;  2OYH A;  2GM4 A;  1NWQ A;  2PAJ A;  1NO4 A;  1JO5 A;  3II6 A;  3VTP C;  2OYI C;  1S9K E;  1T2K D;  1GL2 B;  2A45 H;  2P67 A;  4WY4 C;  1HVV A;  2OYH C;  3H32 B;  1CW5 A;  1LTJ A;  1LTI C;  1JY2 N;  2HOD A;  2IPP A;  3B5N B;  2WTY A;  4B86 A;  1IO4 A;  1AFO A;  1SQQ K;  2LKM A;  1L4A D;  3HUS B;  1LTJ C;  2WT7 B;  5BU8 B;  5AVT B;  5AVX B;  1GDT A;  2P2U A;  3KDP B;  1A02 J;  2WSC H;  3KYQ A;  3CLQ A;  1J1E B;  4GKG A;  1ZR2 A;  1JNM A;  4LC1 A;  3MTU E;  4I1L A;  4N3Y B;  4GT1 A;  1FZB A;  3V2P A;  1MFZ A;  4IFF A;  2CPB A;  2JJL A;  1XTC C;  3TSI A;  1YTZ I;  1MUU A;  1G2C A;  2N1T B;  3TK1 A;  1KIL A;  3V5B A;  3R2P A;  2E43 A;  2WIT A;  1DEB A;  1KIL C;  1XTG B;  3EFG A;  5KLV K;  1GU4 A;  1FZC B;  3U1A A;  1WT6 A;  4IFD K;  1W2E A;  3HD7 A;  1GL2 D;  5AW8 B;  1E5W A;  1GK6 A;  3NXS A;  3OJA B;  4JF7 A;  5AVR B;  3VMX A;  2ZXE B;  2Q3I A;  3B5N D;  1N7S B;  3HD7 C;  3T97 A;  5BVZ A;  5AW7 B;  2Z4E A;  4W7Y A;  1KFN A;  3E1I A;  1J1D C;  3VOP A;  1OXZ A;  1SFC C;  1L4A A;  2W27 A;  3HRN A;  2WPQ A;  2Q7C A;  2HLO A;  4I6M C;  1LT9 B;  1L4A C;  1IFD A;  3NMD A;  4EIJ A;  1FOS F;  2E42 A;  5AVV B;  2FFD C;  1LWU A;  1GK4 A;  5CCH A;  1FZE A;  1CI6 A;  3P8C E;  4LLH A;  2N1T D;  1NHL A;  3UIA A;  3MIW A;  5CHX A;  5APU A;  1S9K D;  2CPS A;  1LWU C;  3C9I A;  2OAR A;  3RL0 C;  5CCH C;  1EQ7 A;  1L0N K;  4DZO A;  4C7N B;  2HPC A;  1IC2 A;  3OAK A;  4N78 E;  1M1J B;  3RK2 B;  1GU5 A;  4IFM A;  2WSF H;  1T3J A;  1SVF A;  2HFE D;  2WPS A;  1SQX K;  3HE5 B;  4C7R A;  4C46 A;  1FZA A;  3HTK B;  5KTB A;  3SWF A;  3BAS A;  1N7S D;  1GL2 A;  2FYU K;  1T3U A;  5AW3 B;  2NPS B;  1SP4 A;  3H32 A;  2XNX A;  4XA4 A;  4HYT B;  1RF1 B;  3LID A;  2Q9I A;  1URQ B;  3HE4 B;  3A5T A;  1QL1 A;  2KB7 P;  4DOJ A;  3B5N A;  3RK3 C;  2OYI B;  1RE4 A;  1CSB A;  3VP9 A;  3L37 A;  4WY4 B;  4RES B;  4ZKU A;  2OYH B;  1M7L A;  3WMM 0;  2WT7 A;  3N7N A;  4WB4 A;  5AW5 B;  3TYY A;  3B5N C;  5KJ7 D;  2C9N Y;  1RE4 C;  1QL2 A;  5APT A;  1GTW A;  3G3Z A;  3BVH A;  3M0A A;  4Y99 C;  1FDM A;  1SQV K;  3M9B A;  1JTH A;  4AUW A;  4AQR D;  1H8A A;  2O1K A;  2HOD B;  1X79 B;  2ZFC A;  1N73 B;  5AVS B;  1NTM K;  2MJZ A;  1WRG A;  3P32 A;  1HBW A;  3CL3 D;  3RK2 D;  3L35 A;  2N9B A;  2R3C A;  3A7O A;  2KOG A;  2O01 H;  4LGD E;  2H8P D;  1NH4 A;  1GW4 A;  1G1J A;  5CMZ A;  4XE5 B;  1JCC A;  3MUD A;  5AVU B;  2GUS A;  2NPS D;  2HG5 D;  4W7Z A;  3V2R A;  1LTT C;  1URQ D;  1G2C B;  1SQB K;  1KIL B;  1N7S A;  1LGH B;  2IX7 C;  5CJ0 A;  3PP5 A;  2IFN A;  4WY4 D;  3IFM A;  1N86 A;  3TNU B;  2YKO A;  5APY A;  3GHG A;  1MZ9 A;  1T8Z A;  2KYV A;  1N7S C;  3BRV B;  1T2K C;  3VMZ A;  4KHX A;  3LW5 H;  2I1K A;  3P8C D;  5APS A;  3GHG C;  1FZG A;  5KJ7 A;  1LTS C;  5AVQ B;  1J1D B;  1JY3 P;  2GUV A;  1JY3 O;  1LT9 A;  1SFC B;  2WSE H;  2IFM A;  1FOS E;  2A45 I;  5KJ7 C;  3B8E B;  1HH0 A;  5CCG D;  4M3L A;  1VDF A;  5AW1 B;  2C9L Y;  1J2J B;  4EOT A;  2YKP A;  1HTL C;  5CJ4 A;  1SLQ A;  5AVY B;  5AW0 B;  2R5D A;  1ZLL A;  2VRS A;  2FFD B;  2M8R A;  2YO2 A;  1NKN A;  4C7N A;  1IFI A;  2J58 A;  2O1J A;  3CI9 A;  4JYB A;  3I5C A;  2L5G B;  1YTZ T;  1ZV8 A;  4ZKP A;  2QM8 A;  3M0D A;  1FJK A;  3RL0 B;  3VN0 A;  2FYZ A;  3HE5 A;  1H88 A;  4OH8 B;  3HTK A;  1KIL D;  2QM7 A;  3MD0 A;  1H89 A;  2WZ7 A;  3M0D C;  2Q5U A;  1HGZ A;  2BAS A;  2C0W A;  1RF1 A;  1URQ A;  2W6A A;  1RF0 A;  4I2L C;  1RY3 A;  3M9Q A;  5APX A;  1OWA A;  1GL2 C;  2FKW B;  1IFN A;  4WY4 A;  1JMM A;  3HUS A;  1MV8 A;  2M3B A;  1URQ C;  1RF0 C;  2WPR A;  3EQ2 A;  3A2A A;  5AVW B;  2H43 A;  1N7L A;  2YMY A;  3P8M C;  3RK3 B;  3HUS C;  1SFC D;  3NFQ A;  1NKZ B;  1LTJ B;  1JY3 N;  2PP6 A;  3V2Q A;  3N4X A;  3H6P A;  1DH3 A;  5AW4 B;  1N73 A;  2KP8 A;  3VMY A;  3OA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...