1N7LA

Solution nmr structure of phospholamban in detergent micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles.
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Signaling protein
molecule keywords Cardiac phospholamban
total genus 22
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7lA00
1FJKA 2M3BA 2KYVA 1FJPA 1ZLLA 2HYNA 1N7LA 2KB7P
chains in the Genus database with same CATH superfamily
3CXHH 3OAKA 4IFDK 1L0LK 1Y47A 1RE3C 2E76D 3T97A 1EDIA 3I55P 1ZR2A 3IN6A 2ZJSE 1URQA 3B4SA 3H1KD 3CWBJ 3L73D 5AW9B 2AXTH 1L0LD 1L4AC 2M3EA 3FXEA 3H1IG 5AVQB 5AVYB 3VMZA 1T6AA 1DH3A 1FE6A 1LT1A 1NU1K 1Y9BA 2JWAA 4R4LA 2B89A 3TDKA 1HUCA 1LT9C 1L0LG 2KZIA 3H1ID 2KLUA 3AECC 1N7LA 4D6TD 1Q82Q 1CW5A 5KKZC 3CD6P 3AE2C 1M1JA 3E1RA 5CCGC 3A0HH 2YO2A 3LW5H 3TNUA 4I7ZB 1ZV8A 2W27A 1N7SA 1VPCA 2W6JH 3HTKB 4XA4A 1Z56A 3RK3E 4C46A 4D6TG 1KORA 4EI2A 2ZT9D 4RJTA 2CPSA 2YKOA 3F5HA 3G4SP 4OGQB 1XTCC 2KOGA 2RH0A 3A7OA 2Q3IA 3NTNA 3JC22 5AVXB 1FZCA 5AW8B 2A45I 1JB0J 1IZNB 1T8ZA 2QE7H 3IF4A 3JSVC 3LIDA 2V4HA 3MP7B 3MTUE 1NJIQ 2ZT9C 1OW8A 3R4YA 3M0DC 3EFFK 1JUNA 1QVGO 2MJZA 4WB4A 2FYUD 1N2DC 3HE5B 1TU3F 2IYPA 3AE6C 3G3ZA 3H32B 3HRNA 3HUSB 4W80A 4WY4C 5CCGD 5CCHC 1M1KQ 3G71P 2GM4A 3CC2P 2FFDC 1SVFA 2D2CB 3V4QA 3H1LD 5APYA 1YJNP 3AE3C 1NU1E 2OARA 3SFEC 1SQBE 2ZFCA 1NKNA 3Q5SA 1BCCD 2HPCA 1VF5D 3CI9A 1NGMB 3TGUD 2QA4P 1KB9E 2IBZI 2LXCB 3KDPB 2E75B 1BCCG 3FXDA 1QL1A 1YTZT 4L73A 5CMZA 3D6ZA 2O01H 2JDIH 3NMDA 1L0NJ 1FAVA 3C1LA 3L75D 3GMAA 4GDOA 4L74A 3TGUG 3WUTA 2ZVOB 2WT7B 2Q1KA 1BGYJ 3BRVB 2VRSA 3B5ND 3L74G 4D6TJ 5CBOA 2WSEH 4ZKPA 1RH5B 3L75G 1NO4A 1SQQE 1JTHA 1H0TB 3VMXA 5CJ4A 3H1KJ 2BCCE 1L0LJ 1CSBA 1S9KE 2I1KA 1OVUA 2OYIB 3SWKA 1H0TA 2YNYA 1M56D 2R5DA 1FZCC 1RQUA 2R5BA 1AQ5A 3H1IJ 3L71J 4JYBA 2B88A 2E75D 1L4AA 3KZIE 5KLIC 4C7RA 2QIWA 1EXJA 4LGDE 1FJKA 2N1TD 1SS1A 2C0WA 3MIWA 2POHA 2OTJP 1R5SA 3Q1MA 2IZ0A 2NRGA 1LTJB 1LTTC 1XTGB 4U3FJ 2WSEJ 4DCKA 2O01J 3CCUP 1A02F 5AW6B 4N3YB 1CI6B 1YBKA 3PP5A 3Q5RA 1JY3O 1JM0A 1P84E 1QGKB 1SQVG 1T3JA 1SQXE 1JMBA 2KNCA 3L35A 2HLOA 1LT9B 1KILE 4H13C 4YTPC 3VP9A 3CCLP 5AVUB 2OYOA 4GKGA 4I2LC 1KFMA 3BCCE 1SQVD 2LXBA 5KLVD 2M8RA 2G8YA 2O1JA 2ZAEB 4I7ZC 4EOTA 1VQ5P 3II6A 1EZVD 1S1CX 3M0DA 1GU4A 2RKLA 1HJ0A 1GW4A 3CWBD 4PD4D 5AVSB 1J1EC 2WSFJ 4CPGA 2YKPA 5AW7B 2HODB 2PGDA 2P10A 1AQTA 4NPEA 1PV3A 3H1HE 4OH8B 5AVWB 1RF0C 1DEBA 1IFPA 1MUUA 2MKVA 2YKQA 4DT0A 3H1HD 3H1LJ 2I1JA 1LTIC 2PP6A 2Y9YA 1HGVA 2NPSD 2CK3H 5APVA 4DZOA 5KJ7A 2WT7A 1M1JC 2FKWB 2XNDH 2XNXA 3BCCJ 2W83C 5AVZB 3VOPA 3N4XA 4PV1B 1FZAA 1LTBC 2KNCB 4RESB 1ZW0A 3ABVC 1SQXK 3RL0D 1KYOH 1WMKA 1X0TA 2E5YA 5K5GB 1PZQA 1CI6A 2KB7P 3L71G 3TGUE 3RGUA 1SP4A 1BSHA 2AEMA 1VF5C 3H1JD 4U3FE 2JO1A 5KAIE 3L74E 2FYUE 2WPSA 3V2PA 4YXDC 3L71D 3A2AA 4C7NB 4IL6X 3WU2E 3L73G 3H1KG 1LTJA 4PJ0E 2NZ2A 4HH2A 4N78D 4OWFA 1Q86Q 2P58A 1DD4A 2K3RA 1KV4A 2KYVA 3L71E 1VDFA 2QM7A 1BGYG 5B5EE 3MHVA 3RK2B 4JF7A 2WSCH 2LKMA 2N9BA 1SQBK 3PRJA 2BCCJ 4AYCA 1VQMP 2OYIA 1J1EB 1IFIA 1EDKA 2L91A 2WMMA 4K35A 5AW5B 1AVOA 3UIAA 1NYHA 2Q9IA 1VQ7P 4D6TE 4OGQC 1VQKP 1AV1A 1BE3E 1P84H 3O6QA 1S9KD 2OTLP 3AE7C 1LNQA 1LTJC 4HB1A 1IO4A 2W90A 3AEDC 4H0LB 5CHXA 1GL2A 2YIUB 3CCVP 1S3JA 4PD4E 2BCCD 3RK2D 2HPCB 1KILA 2YMKA 1S5LX 3V2RA 2BEQD 4MN4C 1BE3G 3JCUE 1HGZA 1SQPK 5DJUB 3S4RA 1EDLA 1SQBJ 3AE9C 1NU1J 3AEFC 1QL2A 3H1LG 5GTIH 3L70E 1NTZE 3AE1C 3PH0A 2JR8A 1RY3A 5APTA 2JEEA 3SSUA 4ZNCA 1VQ8P 1MV8A 2WPQA 2GUSA 4H44D 4BRYB 4JPZB 1KB9D 1S5LH 1PGPA 2J59M 1G2CA 1SFCC 2O01N 3TSIA 1NH4A 3RL0B 3CCEP 3BRTB 3MUDA 3EWKA 1P84D 3M0AA 1NVOA 3WMM0 2C9NY 1VQLP 2QJPC 3EQ2A 3RL0g 1PGJA 2AXTE 4ASVA 2Q6QA 1WRGA 2KK7A 1MFZA 4H44B 2FFDB 2Q3EA 1L0NK 2H8PD 1ZRTD 5CJ0A 1OXZA 2UWJE 3H6PA 4DOJA 1NTKE 4C7NA 3MGNA 4HJGH 2JP3A 1NTZK 1IC2A 3HD7C 4YPCA 3OJAB 1VQNP 2WPRA 1OIPA 4IOIH 4W7ZA 2RMZA 3W67A 1N73C 3VYIA 2XKMA 2ZXEB 1RF1C 1EC5A 1OVRA 1RF1A 1LTGC 4I6MC 4N6JA 1PL5A 1KTMA 2A45G 2QJKB 5AW1B 1AA0A 2Z5HA 1PGOA 4H0LD 1U7MA 4L75A 3BATA 5GTIE 2E43A 1M90Q 2QG4A 2K88A 2QJYC 3HD7A 3L36A 5KLVG 1DIPA 3BVHA 1K05A 1S4XA 1HWTC 1EZVG 3D71A 2Y0DA 2M0BA 3CC4P 3CX5D 3V6IA 1K04A 3IAOA 5H2FH 1M8OB 1N7SD 1OVVA 3L72G 2B9BA 1ZLLA 3CX5I 3H1HG 4JBZA 3GG2A 1KC8Q 3HD7B 1R5LA 1OFCX 5DJTB 1OWAA 2NPSA 3A0BH 1DEEG 3CXHI 1EZVI 3G9RA 3NFQA 2IDBA 1SFCA 3O8ZA 3T97B 3P8CE 4A7PA 3H25A 2QRXA 1AFOA 1K73Q 1LGHB 2D2CD 3CCRP 3Q2YA 1X22A 2PFXA 1OX3A 1FS0E 2PAJA 1URQD 2KUBA 1BSNA 3H1JG 3OW2O 1YI2P 1FU1A 5B66H 1GU5A 1T2KD 3P8MC 1PPJE 5AW3B 3RK3D 3WUVA 1RQVA 3H32A 2FXMA 2HFED 2WWWA 3HUSA 4LLHA 1KILC 5KJ7C 2XZRA 3KPEA 2Y0CA 1SQPJ 3L73E 1H8AA 3SFDC 2ZYGA 2WTYA 1YTZI 2GUVA 2IPPA 3AEAC 2G3AA 5TISE 1BGYD 1H89A 1EQ7A 1X79B 2A45H 4PD4I 1PPJG 1MFTA 2R3CA 1PFIA 1KB9H 2HG5D 3L70D 4WY4B 3V2NA 3HE4B 3L75E 3TF5A 3OA7A 3Q3DA 3H1JJ 2LR2A 1PPJD 1U7JA 3TNUB 1FOSE 2K1AA 1AVYA 1W5CE 2E74C 2Y0EA 2K37A 2WSFH 4H44C 3V4WA 3QH9A 3CCJP 1YQ3C 1BCCE 4Y99B 3CCSP 1URQC 5KLVK 1NTKD 2PRRA 1W2BO 1IK7A 1RE3A 1HH0A 1OW7A 2BCCG 2FBWC 1DX7A 4IL6H 1RE4A 3EFGA 1MZ9A 1YJ9P 1BE3D 2FXOA 1RE4C 3GHGB 1LTSC 5KLVJ 2IBZG 2QEXP 1VQ4P 1SQXD 2L5GB 1NAFA 2QJYB 3IR9A 3L72J 4PD4H 2E74D 1PGQA 1FOSF 2IBZD 1GMJA 1FZBA 2FFDA 3CMEP 1SQXG 4AUWA 1GDTA 2KSEA 1NTKJ 3P8CD 4IFMA 5GTHE 2WSSH 1PP9E 5APSA 2N1TB 1YQ4C 1QEXA 1NKZB 3HE4A 5AW4B 1K9MQ 2HODA 2OTKE 3L37A 2P7JA 3ITKA 3M06A 2W8ZA 4RO0A 1KFNA 1VQ6P 2GA1A 4JQ0D 3BCCG 1VQ9P 3SWYA 1G1JA 3TYYA 2IX7C 1Q81Q 1T2KC 3MD0A 4UB6E 3L4FA 1A02J 2SPZA 4BXLA 2M3BA 1ZMEC 5CCGA 1IFMA 2E42A 4I1LA 1NHLA 2R44A 1HBWA 2QVAA 3GLMA 2W6AA 3RBXA 4PV1C 1LT9A 3GF3A 2KI7B 1SLQA 1LWUC 1L2PA 2D2CC 2E76B 5H2FE 1NTZJ 2ITAA 2J5UA 3L70J 3U1AA 2V7QH 3CLQA 2AEFA 5CBNA 1GZLA 2K9JB 2YXRB 1KILB 3C9IA 2ZVNB 3FX0A 5CCHA 1FJPA 1ZRTE 3VN0A 5B5EH 3A5TA 2O3JA 2IYOA 3HE5A 2IFNA 1NTME 1SQVJ 1JCDA 3RBZA 4PV1D 1J1DB 1FBMA 3M9QA 2DW3A 3AE5C 4W7YA 5AVVB 1EXIA 1BE3J 1JY3N 2ZT9B 3C8VA 4U3FG 2Q7CA 5KAIH 3JCUH 1VQOP 1KYOE 1FZFA 3A3YB 1N7SC 1UIIA 3D6YA 3AEEC 3VMAA 2E74B 4U3FD 5C39A 1KYOD 2OYHB 1W2EA 4N78E 3FGAD 1N8RQ 3VP8A 1M1JB 1E79H 1SQQK 2A06E 3KHUA 1KD1Q 1MKMA 5BU8B 3L72D 3U59A 5AVRB 1HTLC 1NU1G 1YITP 1RF1B 1KQGB 1SQVK 2QSIA 1SQPG 2WSCJ 3NXSA 1KQSO 3IFMA 4XE5B 2FYUJ 3I5CA 3L74J 1PP9G 1OMIA 1YYCA 1RHZB 2A06G 3LW5J 1SQQG 1HJBA 1VF5B 2HR3A 1NTZD 2KIKA 3TGUJ 1LP1B 1NTMK 5L8RJ 4ZKUA 2N1TC 1YJWP 3GHGC 2C9LY 3P7KA 1X8YA 2FYUK 2WPVB 1GW3A 1SQQD 1Q7YQ 1NTZG 3VMYA 3CMAP 2BEZF 2IZ1A 1GL2B 2AEJA 2C0XA 2O1KA 3QWOC 1KZUB 2AXCA 3BASA 3WUUA 1T3UA 1U57A 4WY4A 3CPWO 1G1IA 3I56P 3CCQP 1S5LE 1EDJA 3H1LE 2I8DA 3GF7A 1CZQA 4EDFA 4DJGA 3Q5PA 1GTWA 2R32A 3H1HJ 1FC2C 1P84I 3MZWB 1IK9A 3B5NA 4Y28J 1KILD 1YIJP 1NWQA 3N7NA 4PJ0H 4XFJA 3MUDC 3KQGA 2KS1B 2Z4EA 1SQVE 1NTMJ 1JY2P 1OW6A 2WZ7A 1GK6A 2YMYA 2ZXXA 3B8EB 1J2JB 3L70G 4WVZA 4B86A 4YXWH 5KLIB 4UB6H 1VQPP 1QVFO 2JWDA 3AE8C 3RK3B 2YIUC 2H43A 3HUSC 1FDMA 1KQFB 4M3LA 5KTBA 2JJLA 1NTMD 1IFNA 5KJ7D 1Q90D 1N73A 4IFFA 2ZYAA 1BDCA 1NTKG 4GIFA 1KYOI 1SQXJ 1ZP0C 3PJSK 1NTMG 2KLVA 1ZN5A 1IJDB 1SFCB 3W68A 1IFJA 2Y9ZA 2H89C 2NPSB 2WVRA 1UIXA 5TJHA 2QJKC 4KT0J 1FDOA 3AEBC 4KJMA 2E5TA 2K9YA 2QJPB 1J1DC 2NPSC 4GOFA 2FYNB 3V2QA 5KKZB 2OYHA 3S9OA 3PLNA 3H1IE 4LC1A 2JKVA 4KHXA 1ZXGA 2H7HA 1YHQP 1GK4A 3P32A 3WU2H 4WWIA 5APXA 3FWNA 2OYIC 3KXDA 1L0LE 3CXHD 4Z1MH 3H1KE 3VTPC 1EZVE 4UB8H 4ZMDA 4AQRD 3TK1A 1SQQJ 5CCHD 1PP9J 3KZIH 1SQBD 1D7MA 2FYUG 2BASA 3BCCD 1BGYE 2N1TA 2H88C 2OYHC 1JY3P 2P1JA 1L0NE 1L4AD 1S72P 1SQBG 3AEGC 3E7KA 4GT1A 3L72E 2XDJA 4L76A 1KN7A 2N9YB 2WITA 1JOCA 5KLVE 5E79H 2E76C 4H0LC 4NPDA 1HF9A 1LP1A 1PIXA 1ZR4A 1LWUB 1JNMA 1QX8A 1M7LA 2FXPA 1GL2C 4H13B 4GOEA 3S1KA 2Q5UA 2CPBA 1LJ2A 4RKUJ 1BCCJ 1R8EA 3U1CA 1N86A 4HKZH 4JYCA 2E75C 3PTZA 3G6EP 3L74D 2Z5IA 4O9BA 2P2UA 3HD7D 1JY2O 2KXPB 1L4AB 3H1JE 2KSJA 3M9HA 5AW2B 3LIEA 3RL0C 1L0ND 3L75J 4GODA 2OQQA 2M5AB 1H88A 3B5NB 1NAYA 4ASWA 3SWFA 5GTHH 2FY8A 3M91A 1DD3A 1KMIZ 4HYTB 1L0NG 3HTKA 1M57D 3B5NC 1NOHA 1SFCD 2M5AA 4U7JA 1S2EA 1FZCB 2J58A 4TLFA 1SQPE 3L73J 2FYZA 4K3AA 5KAFE 1IFDA 4UB8E 1LTAC 3FWLA 2XV5A 3K5BA 1USEA 5BU5A 3D70A 1VL2A 4BWNA 1JO5A 3PHLA 5APWA 4EIJA 2IFMA 5APUA 5AVTB 1NU1D 1ZOYC 3E1IA 1QLED 3GHGA 2B87B 1LWUA 1JY2N 1HVVA 1SQPD 2KP8A 2WQYC 3CWBE 3GW6A 1OZHA 1Y8AA 2XU6A 3A0HE 4H13D 1URQB 4R4MA 2RN0A 5TISH 1NTKK 1PP9D 2B87A 4WY4D 2A06D 3V5BA 1E5WA 1N73B 2P67A 2QM8A 2YXQB 5APQA 1FZGA 2HYNA 1X9VA 1RF0A 3CWBG 4EYYQ 1JMMA 3CL3D 4TT3H 3O6QB 1USDA 3RK2C 3ZDMA 1WT6A 5B66E 3KYQA 2V7QJ 5BVZA 2FYNC 2R3SA 1JCCA 2KS1A 1Q2NA 2OGUA 1KB9I 2IBZE 3R2PA 1JTHB 3M9BA 3USSA 1AJYA 4OVNF 4OGQD 4IL6E 4WBAA 5E79E 4Y99C 2ZYDA 3CCMP 1FDIA 2YO3A 4QMAA 1N7SB 4NPFX 1JEKA 5EFWB 1K8AQ 1G2CB 3A0BE 2W6BA 1BDDA 3F89A 5AW0B 5KAFH 3CC7P 3B71A 3CX5E 1KQLA 5M1BA 4BRYA 3CX5H 1GL2D 2KZJA 3CXHE 1FZEA 3RK3C 1GD2E 2K9JA 3AE4C
chains in the Genus database with same CATH topology
3OAKA 1L0LK 3T97A 1RE3C 1ZR2A 1URQA 5AW9B 1A02J 5AVQB 1L4AC 5AVYB 3VMZA 1DH3A 1NU1K 1LT9C 1HUCA 1N7LA 1CW5A 1M1JA 5CCGC 5CCHD 3TNUA 2YO2A 3LW5H 4XA4A 1ZV8A 2W27A 1N7SA 1VPCA 3HTKB 2E42A 1Z56A 4C46A 2CPSA 2YKOA 1XTCC 2KOGA 3A7OA 3NTNA 2Q3IA 1FZCA 5AVXB 5AW8B 2A45I 3LIDA 1T8ZA 3MTUE 1JUNA 3M0DC 2MJZA 4WB4A 1N2DC 3HE5B 4W80A 3G3ZA 3H32B 3HUSB 4WY4C 3HRNA 5CCGD 5CCHC 2GM4A 2FFDC 1SVFA 3V4QA 5APYA 2OARA 2ZFCA 1NKNA 2HPCA 3CI9A 3KDPB 1QL1A 1YTZT 5CMZA 2O01H 3NMDA 1FAVA 2FFDA 2WT7B 1GU5A 3BRVB 2VRSA 3B5ND 2WSEH 4ZKPA 1NO4A 1JTHA 3VMXA 5CJ4A 1CSBA 1S9KE 2I1KA 2OYIB 2YNYA 2R5DA 1FZCC 2R5BA 1AQ5A 4JYBA 4C7RA 1L4AA 4LGDE 1FJKA 2N1TD 2C0WA 3MIWA 2POHA 1LTJB 1LTTC 1XTGB 1A02F 5AW6B 4N3YB 1CI6B 3PP5A 1JY3O 1T3JA 3L35A 3VP9A 2HLOA 1LT9B 5AVUB 4GKGA 4I2LC 1KFMA 2M8RA 2O1JA 4EOTA 3II6A 3M0DA 1GU4A 1GW4A 5AVSB 1J1EC 2YKPA 5AW7B 2HODB 5AVWB 4OH8B 1RF0C 1DEBA 1MUUA 2YKQA 4IFDK 2I1JA 1LTIC 2PP6A 5KJ7A 1HGVA 2NPSD 4DZOA 5APVA 2WT7A 1M1JC 2FKWB 2XNXA 5AVZB 3VOPA 3N4XA 1FZAA 1LTBC 4RESB 3RL0D 1SQXK 1CI6A 2KB7P 1SP4A 2WPSA 3V2PA 3A2AA 4C7NB 1LTJA 4HH2A 4N78D 2KYVA 1VDFA 2QM7A 3RK2B 4JF7A 2WSCH 2LKMA 2N9BA 1SQBK 4AYCA 2OYIA 1J1EB 1IFIA 5AW5B 3UIAA 1S9KD 1LTJC 1IO4A 5CHXA 1GL2A 3RK2D 2HPCB 1KILA 3V2RA 1HGZA 1SQPK 1QL2A 1RY3A 5APTA 2JEEA 1MV8A 2WPQA 2GUSA 2J59M 1G2CA 1SFCC 3TSIA 1NH4A 3RL0B 3BRTB 3MUDA 3M0AA 3WMM0 3EQ2A 1WRGA 1MFZA 2FFDB 1L0NK 2H8PD 5CJ0A 1OXZA 3H6PA 4DOJA 4C7NA 3MGNA 1NTZK 1IC2A 3HD7C 3OJAB 2WPRA 4W7ZA 1N73C 3VYIA 2XKMA 2ZXEB 1RF1C 1RF1A 1LTGC 4I6MC 4N6JA 2A45G 5AW1B 2Z5HA 3BATA 2E43A 3HD7A 3L36A 3BVHA 1HWTC 1N7SD 1ZLLA 3HD7B 1OWAA 2NPSA 4AUWA 3NFQA 3O8ZA 1SFCA 3P8CE 1AFOA 1LGHB 2PAJA 1URQD 1FU1A 1T2KD 3P8MC 5AW3B 3RK3D 3HUSA 3H32A 2FXMA 2HFED 2WWWA 4LLHA 5KJ7C 1KILC 2Q9IA 2XZRA 3KPEA 1H8AA 2WTYA 2GUVA 1YTZI 2IPPA 1H89A 1EQ7A 1X79B 2A45H 2R3CA 1PFIA 2HG5D 4WY4B 3V2NA 3HE4B 3OA7A 1FOSE 3TNUB 3V4WA 2WSFH 4Y99B 1URQC 5KLVK 1RE3A 1HH0A 1DX7A 1RE4A 3EFGA 1MZ9A 1RE4C 3GHGB 1LTSC 2L5GB 1NAFA 3IR9A 1FOSF 1FZBA 1GDTA 3P8CD 4IFMA 5APSA 2N1TB 3HE4A 1NKZB 5AW4B 2HODA 3L37A 2P7JA 3M06A 1KFNA 3SWYA 1G1JA 3TYYA 2IX7C 1T2KC 3MD0A 3L4FA 1HBWA 2M3BA 5CCGA 1IFMA 4I1LA 1NHLA 2W6AA 1LT9A 1SLQA 1LWUC 3U1AA 3CLQA 1GZLA 3C9IA 1KILB 5CCHA 1FJPA 3VN0A 3A5TA 3HE5A 2IFNA 1JCDA 1J1DB 1FBMA 3M9QA 4W7YA 5AVVB 1JY3N 2Q7CA 1FZFA 3A3YB 1N7SC 2OYHB 1W2EA 4N78E 3VP8A 1M1JB 1SQQK 5BU8B 3U59A 5AVRB 1HTLC 1RF1B 1SQVK 3NXSA 3IFMA 4XE5B 3I5CA 1YYCA 1HJBA 4ZKUA 1NTMK 2N1TC 3GHGC 2C9LY 3P7KA 1X8YA 2FYUK 1GW3A 3VMYA 2O1KA 1GL2B 2C0XA 1KZUB 3BASA 1T3UA 4WY4A 1G1IA 1CZQA 1GTWA 2R32A 1IK9A 3B5NA 1KILD 1NWQA 3N7NA 3KQGA 2Z4EA 2WZ7A 2YMYA 1JY2P 3B8EB 1GK6A 2C9NY 1J2JB 4B86A 3RK3B 2H43A 3HUSC 1FDMA 4M3LA 5KTBA 2JJLA 1IFNA 5KJ7D 1N73A 4IFFA 4GIFA 2KLVA 1ZN5A 1IJDB 1SFCB 1IFJA 2NPSB 1J1DC 2NPSC 3V2QA 2OYHA 4LC1A 4KHXA 2H7HA 1GK4A 3P32A 5APXA 2OYIC 3VTPC 4AQRD 3TK1A 2BASA 2N1TA 2OYHC 1JY3P 2P1JA 1L4AD 4GT1A 2XDJA 2WITA 1JOCA 1ZR4A 1LWUB 1JNMA 1M7LA 1GL2C 2Q5UA 2CPBA 3U1CA 1N86A 4JYCA 2Z5IA 4O9BA 2P2UA 3HD7D 1JY2O 5AW2B 1L4AB 3RL0C 2KSJA 3M9HA 3LIEA 1H88A 3B5NB 3SWFA 3M91A 4HYTB 3HTKA 3B5NC 1NOHA 1SFCD 1FZCB 2J58A 2FYZA 1IFDA 1LTAC 2XV5A 5BU5A 1JO5A 5APWA 4EIJA 2IFMA 5APUA 5AVTB 3E1IA 3GHGA 1LWUA 1JY2N 1HVVA 2KP8A 3KYQA 2XU6A 1URQB 1NTKK 4WY4D 3V5BA 1E5WA 1N73B 2P67A 2QM8A 5APQA 1FZGA 2HYNA 1X9VA 1RF0A 1JMMA 3CL3D 3RK2C 1WT6A 5BVZA 1JCCA 3R2PA 1JTHB 3M9BA 4WBAA 4Y99C 2YO3A 1N7SB 1G2CB 2W6BA 5AW0B 1KQLA 1GL2D 1FZEA 3RK3C 1GD2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJK A;  2M3B A;  2KYV A;  1FJP A;  1ZLL A;  2HYN A;  1N7L A;  2KB7 P; 
#chains in the Genus database with same CATH topology
 3CXH H;  3OAK A;  4IFD K;  1L0L K;  1Y47 A;  1RE3 C;  2E76 D;  3T97 A;  1EDI A;  3I55 P;  1ZR2 A;  3IN6 A;  2ZJS E;  1URQ A;  3B4S A;  3H1K D;  3CWB J;  3L73 D;  5AW9 B;  2AXT H;  1L0L D;  1L4A C;  2M3E A;  3FXE A;  3H1I G;  5AVQ B;  5AVY B;  3VMZ A;  1T6A A;  1DH3 A;  1FE6 A;  1LT1 A;  1NU1 K;  1Y9B A;  2JWA A;  4R4L A;  2B89 A;  3TDK A;  1HUC A;  1LT9 C;  1L0L G;  2KZI A;  3H1I D;  2KLU A;  3AEC C;  1N7L A;  4D6T D;  1Q82 Q;  1CW5 A;  5KKZ C;  3CD6 P;  3AE2 C;  1M1J A;  3E1R A;  5CCG C;  3A0H H;  2YO2 A;  3LW5 H;  3TNU A;  4I7Z B;  1ZV8 A;  2W27 A;  1N7S A;  1VPC A;  2W6J H;  3HTK B;  4XA4 A;  1Z56 A;  3RK3 E;  4C46 A;  4D6T G;  1KOR A;  4EI2 A;  2ZT9 D;  4RJT A;  2CPS A;  2YKO A;  3F5H A;  3G4S P;  4OGQ B;  1XTC C;  2KOG A;  2RH0 A;  3A7O A;  2Q3I A;  3NTN A;  3JC2 2;  5AVX B;  1FZC A;  5AW8 B;  2A45 I;  1JB0 J;  1IZN B;  1T8Z A;  2QE7 H;  3IF4 A;  3JSV C;  3LID A;  2V4H A;  3MP7 B;  3MTU E;  1NJI Q;  2ZT9 C;  1OW8 A;  3R4Y A;  3M0D C;  3EFF K;  1JUN A;  1QVG O;  2MJZ A;  4WB4 A;  2FYU D;  1N2D C;  3HE5 B;  1TU3 F;  2IYP A;  3AE6 C;  3G3Z A;  3H32 B;  3HRN A;  3HUS B;  4W80 A;  4WY4 C;  5CCG D;  5CCH C;  1M1K Q;  3G71 P;  2GM4 A;  3CC2 P;  2FFD C;  1SVF A;  2D2C B;  3V4Q A;  3H1L D;  5APY A;  1YJN P;  3AE3 C;  1NU1 E;  2OAR A;  3SFE C;  1SQB E;  2ZFC A;  1NKN A;  3Q5S A;  1BCC D;  2HPC A;  1VF5 D;  3CI9 A;  1NGM B;  3TGU D;  2QA4 P;  1KB9 E;  2IBZ I;  2LXC B;  3KDP B;  2E75 B;  1BCC G;  3FXD A;  1QL1 A;  1YTZ T;  4L73 A;  5CMZ A;  3D6Z A;  2O01 H;  2JDI H;  3NMD A;  1L0N J;  1FAV A;  3C1L A;  3L75 D;  3GMA A;  4GDO A;  4L74 A;  3TGU G;  3WUT A;  2ZVO B;  2WT7 B;  2Q1K A;  1BGY J;  3BRV B;  2VRS A;  3B5N D;  3L74 G;  4D6T J;  5CBO A;  2WSE H;  4ZKP A;  1RH5 B;  3L75 G;  1NO4 A;  1SQQ E;  1JTH A;  1H0T B;  3VMX A;  5CJ4 A;  3H1K J;  2BCC E;  1L0L J;  1CSB A;  1S9K E;  2I1K A;  1OVU A;  2OYI B;  3SWK A;  1H0T A;  2YNY A;  1M56 D;  2R5D A;  1FZC C;  1RQU A;  2R5B A;  1AQ5 A;  3H1I J;  3L71 J;  4JYB A;  2B88 A;  2E75 D;  1L4A A;  3KZI E;  5KLI C;  4C7R A;  2QIW A;  1EXJ A;  4LGD E;  1FJK A;  2N1T D;  1SS1 A;  2C0W A;  3MIW A;  2POH A;  2OTJ P;  1R5S A;  3Q1M A;  2IZ0 A;  2NRG A;  1LTJ B;  1LTT C;  1XTG B;  4U3F J;  2WSE J;  4DCK A;  2O01 J;  3CCU P;  1A02 F;  5AW6 B;  4N3Y B;  1CI6 B;  1YBK A;  3PP5 A;  3Q5R A;  1JY3 O;  1JM0 A;  1P84 E;  1QGK B;  1SQV G;  1T3J A;  1SQX E;  1JMB A;  2KNC A;  3L35 A;  2HLO A;  1LT9 B;  1KIL E;  4H13 C;  4YTP C;  3VP9 A;  3CCL P;  5AVU B;  2OYO A;  4GKG A;  4I2L C;  1KFM A;  3BCC E;  1SQV D;  2LXB A;  5KLV D;  2M8R A;  2G8Y A;  2O1J A;  2ZAE B;  4I7Z C;  4EOT A;  1VQ5 P;  3II6 A;  1EZV D;  1S1C X;  3M0D A;  1GU4 A;  2RKL A;  1HJ0 A;  1GW4 A;  3CWB D;  4PD4 D;  5AVS B;  1J1E C;  2WSF J;  4CPG A;  2YKP A;  5AW7 B;  2HOD B;  2PGD A;  2P10 A;  1AQT A;  4NPE A;  1PV3 A;  3H1H E;  4OH8 B;  5AVW B;  1RF0 C;  1DEB A;  1IFP A;  1MUU A;  2MKV A;  2YKQ A;  4DT0 A;  3H1H D;  3H1L J;  2I1J A;  1LTI C;  2PP6 A;  2Y9Y A;  1HGV A;  2NPS D;  2CK3 H;  5APV A;  4DZO A;  5KJ7 A;  2WT7 A;  1M1J C;  2FKW B;  2XND H;  2XNX A;  3BCC J;  2W83 C;  5AVZ B;  3VOP A;  3N4X A;  4PV1 B;  1FZA A;  1LTB C;  2KNC B;  4RES B;  1ZW0 A;  3ABV C;  1SQX K;  3RL0 D;  1KYO H;  1WMK A;  1X0T A;  2E5Y A;  5K5G B;  1PZQ A;  1CI6 A;  2KB7 P;  3L71 G;  3TGU E;  3RGU A;  1SP4 A;  1BSH A;  2AEM A;  1VF5 C;  3H1J D;  4U3F E;  2JO1 A;  5KAI E;  3L74 E;  2FYU E;  2WPS A;  3V2P A;  4YXD C;  3L71 D;  3A2A A;  4C7N B;  4IL6 X;  3WU2 E;  3L73 G;  3H1K G;  1LTJ A;  4PJ0 E;  2NZ2 A;  4HH2 A;  4N78 D;  4OWF A;  1Q86 Q;  2P58 A;  1DD4 A;  2K3R A;  1KV4 A;  2KYV A;  3L71 E;  1VDF A;  2QM7 A;  1BGY G;  5B5E E;  3MHV A;  3RK2 B;  4JF7 A;  2WSC H;  2LKM A;  2N9B A;  1SQB K;  3PRJ A;  2BCC J;  4AYC A;  1VQM P;  2OYI A;  1J1E B;  1IFI A;  1EDK A;  2L91 A;  2WMM A;  4K35 A;  5AW5 B;  1AVO A;  3UIA A;  1NYH A;  2Q9I A;  1VQ7 P;  4D6T E;  4OGQ C;  1VQK P;  1AV1 A;  1BE3 E;  1P84 H;  3O6Q A;  1S9K D;  2OTL P;  3AE7 C;  1LNQ A;  1LTJ C;  4HB1 A;  1IO4 A;  2W90 A;  3AED C;  4H0L B;  5CHX A;  1GL2 A;  2YIU B;  3CCV P;  1S3J A;  4PD4 E;  2BCC D;  3RK2 D;  2HPC B;  1KIL A;  2YMK A;  1S5L X;  3V2R A;  2BEQ D;  4MN4 C;  1BE3 G;  3JCU E;  1HGZ A;  1SQP K;  5DJU B;  3S4R A;  1EDL A;  1SQB J;  3AE9 C;  1NU1 J;  3AEF C;  1QL2 A;  3H1L G;  5GTI H;  3L70 E;  1NTZ E;  3AE1 C;  3PH0 A;  2JR8 A;  1RY3 A;  5APT A;  2JEE A;  3SSU A;  4ZNC A;  1VQ8 P;  1MV8 A;  2WPQ A;  2GUS A;  4H44 D;  4BRY B;  4JPZ B;  1KB9 D;  1S5L H;  1PGP A;  2J59 M;  1G2C A;  1SFC C;  2O01 N;  3TSI A;  1NH4 A;  3RL0 B;  3CCE P;  3BRT B;  3MUD A;  3EWK A;  1P84 D;  3M0A A;  1NVO A;  3WMM 0;  2C9N Y;  1VQL P;  2QJP C;  3EQ2 A;  3RL0 g;  1PGJ A;  2AXT E;  4ASV A;  2Q6Q A;  1WRG A;  2KK7 A;  1MFZ A;  4H44 B;  2FFD B;  2Q3E A;  1L0N K;  2H8P D;  1ZRT D;  5CJ0 A;  1OXZ A;  2UWJ E;  3H6P A;  4DOJ A;  1NTK E;  4C7N A;  3MGN A;  4HJG H;  2JP3 A;  1NTZ K;  1IC2 A;  3HD7 C;  4YPC A;  3OJA B;  1VQN P;  2WPR A;  1OIP A;  4IOI H;  4W7Z A;  2RMZ A;  3W67 A;  1N73 C;  3VYI A;  2XKM A;  2ZXE B;  1RF1 C;  1EC5 A;  1OVR A;  1RF1 A;  1LTG C;  4I6M C;  4N6J A;  1PL5 A;  1KTM A;  2A45 G;  2QJK B;  5AW1 B;  1AA0 A;  2Z5H A;  1PGO A;  4H0L D;  1U7M A;  4L75 A;  3BAT A;  5GTI E;  2E43 A;  1M90 Q;  2QG4 A;  2K88 A;  2QJY C;  3HD7 A;  3L36 A;  5KLV G;  1DIP A;  3BVH A;  1K05 A;  1S4X A;  1HWT C;  1EZV G;  3D71 A;  2Y0D A;  2M0B A;  3CC4 P;  3CX5 D;  3V6I A;  1K04 A;  3IAO A;  5H2F H;  1M8O B;  1N7S D;  1OVV A;  3L72 G;  2B9B A;  1ZLL A;  3CX5 I;  3H1H G;  4JBZ A;  3GG2 A;  1KC8 Q;  3HD7 B;  1R5L A;  1OFC X;  5DJT B;  1OWA A;  2NPS A;  3A0B H;  1DEE G;  3CXH I;  1EZV I;  3G9R A;  3NFQ A;  2IDB A;  1SFC A;  3O8Z A;  3T97 B;  3P8C E;  4A7P A;  3H25 A;  2QRX A;  1AFO A;  1K73 Q;  1LGH B;  2D2C D;  3CCR P;  3Q2Y A;  1X22 A;  2PFX A;  1OX3 A;  1FS0 E;  2PAJ A;  1URQ D;  2KUB A;  1BSN A;  3H1J G;  3OW2 O;  1YI2 P;  1FU1 A;  5B66 H;  1GU5 A;  1T2K D;  3P8M C;  1PPJ E;  5AW3 B;  3RK3 D;  3WUV A;  1RQV A;  3H32 A;  2FXM A;  2HFE D;  2WWW A;  3HUS A;  4LLH A;  1KIL C;  5KJ7 C;  2XZR A;  3KPE A;  2Y0C A;  1SQP J;  3L73 E;  1H8A A;  3SFD C;  2ZYG A;  2WTY A;  1YTZ I;  2GUV A;  2IPP A;  3AEA C;  2G3A A;  5TIS E;  1BGY D;  1H89 A;  1EQ7 A;  1X79 B;  2A45 H;  4PD4 I;  1PPJ G;  1MFT A;  2R3C A;  1PFI A;  1KB9 H;  2HG5 D;  3L70 D;  4WY4 B;  3V2N A;  3HE4 B;  3L75 E;  3TF5 A;  3OA7 A;  3Q3D A;  3H1J J;  2LR2 A;  1PPJ D;  1U7J A;  3TNU B;  1FOS E;  2K1A A;  1AVY A;  1W5C E;  2E74 C;  2Y0E A;  2K37 A;  2WSF H;  4H44 C;  3V4W A;  3QH9 A;  3CCJ P;  1YQ3 C;  1BCC E;  4Y99 B;  3CCS P;  1URQ C;  5KLV K;  1NTK D;  2PRR A;  1W2B O;  1IK7 A;  1RE3 A;  1HH0 A;  1OW7 A;  2BCC G;  2FBW C;  1DX7 A;  4IL6 H;  1RE4 A;  3EFG A;  1MZ9 A;  1YJ9 P;  1BE3 D;  2FXO A;  1RE4 C;  3GHG B;  1LTS C;  5KLV J;  2IBZ G;  2QEX P;  1VQ4 P;  1SQX D;  2L5G B;  1NAF A;  2QJY B;  3IR9 A;  3L72 J;  4PD4 H;  2E74 D;  1PGQ A;  1FOS F;  2IBZ D;  1GMJ A;  1FZB A;  2FFD A;  3CME P;  1SQX G;  4AUW A;  1GDT A;  2KSE A;  1NTK J;  3P8C D;  4IFM A;  5GTH E;  2WSS H;  1PP9 E;  5APS A;  2N1T B;  1YQ4 C;  1QEX A;  1NKZ B;  3HE4 A;  5AW4 B;  1K9M Q;  2HOD A;  2OTK E;  3L37 A;  2P7J A;  3ITK A;  3M06 A;  2W8Z A;  4RO0 A;  1KFN A;  1VQ6 P;  2GA1 A;  4JQ0 D;  3BCC G;  1VQ9 P;  3SWY A;  1G1J A;  3TYY A;  2IX7 C;  1Q81 Q;  1T2K C;  3MD0 A;  4UB6 E;  3L4F A;  1A02 J;  2SPZ A;  4BXL A;  2M3B A;  1ZME C;  5CCG A;  1IFM A;  2E42 A;  4I1L A;  1NHL A;  2R44 A;  1HBW A;  2QVA A;  3GLM A;  2W6A A;  3RBX A;  4PV1 C;  1LT9 A;  3GF3 A;  2KI7 B;  1SLQ A;  1LWU C;  1L2P A;  2D2C C;  2E76 B;  5H2F E;  1NTZ J;  2ITA A;  2J5U A;  3L70 J;  3U1A A;  2V7Q H;  3CLQ A;  2AEF A;  5CBN A;  1GZL A;  2K9J B;  2YXR B;  1KIL B;  3C9I A;  2ZVN B;  3FX0 A;  5CCH A;  1FJP A;  1ZRT E;  3VN0 A;  5B5E H;  3A5T A;  2O3J A;  2IYO A;  3HE5 A;  2IFN A;  1NTM E;  1SQV J;  1JCD A;  3RBZ A;  4PV1 D;  1J1D B;  1FBM A;  3M9Q A;  2DW3 A;  3AE5 C;  4W7Y A;  5AVV B;  1EXI A;  1BE3 J;  1JY3 N;  2ZT9 B;  3C8V A;  4U3F G;  2Q7C A;  5KAI H;  3JCU H;  1VQO P;  1KYO E;  1FZF A;  3A3Y B;  1N7S C;  1UII A;  3D6Y A;  3AEE C;  3VMA A;  2E74 B;  4U3F D;  5C39 A;  1KYO D;  2OYH B;  1W2E A;  4N78 E;  3FGA D;  1N8R Q;  3VP8 A;  1M1J B;  1E79 H;  1SQQ K;  2A06 E;  3KHU A;  1KD1 Q;  1MKM A;  5BU8 B;  3L72 D;  3U59 A;  5AVR B;  1HTL C;  1NU1 G;  1YIT P;  1RF1 B;  1KQG B;  1SQV K;  2QSI A;  1SQP G;  2WSC J;  3NXS A;  1KQS O;  3IFM A;  4XE5 B;  2FYU J;  3I5C A;  3L74 J;  1PP9 G;  1OMI A;  1YYC A;  1RHZ B;  2A06 G;  3LW5 J;  1SQQ G;  1HJB A;  1VF5 B;  2HR3 A;  1NTZ D;  2KIK A;  3TGU J;  1LP1 B;  1NTM K;  5L8R J;  4ZKU A;  2N1T C;  1YJW P;  3GHG C;  2C9L Y;  3P7K A;  1X8Y A;  2FYU K;  2WPV B;  1GW3 A;  1SQQ D;  1Q7Y Q;  1NTZ G;  3VMY A;  3CMA P;  2BEZ F;  2IZ1 A;  1GL2 B;  2AEJ A;  2C0X A;  2O1K A;  3QWO C;  1KZU B;  2AXC A;  3BAS A;  3WUU A;  1T3U A;  1U57 A;  4WY4 A;  3CPW O;  1G1I A;  3I56 P;  3CCQ P;  1S5L E;  1EDJ A;  3H1L E;  2I8D A;  3GF7 A;  1CZQ A;  4EDF A;  4DJG A;  3Q5P A;  1GTW A;  2R32 A;  3H1H J;  1FC2 C;  1P84 I;  3MZW B;  1IK9 A;  3B5N A;  4Y28 J;  1KIL D;  1YIJ P;  1NWQ A;  3N7N A;  4PJ0 H;  4XFJ A;  3MUD C;  3KQG A;  2KS1 B;  2Z4E A;  1SQV E;  1NTM J;  1JY2 P;  1OW6 A;  2WZ7 A;  1GK6 A;  2YMY A;  2ZXX A;  3B8E B;  1J2J B;  3L70 G;  4WVZ A;  4B86 A;  4YXW H;  5KLI B;  4UB6 H;  1VQP P;  1QVF O;  2JWD A;  3AE8 C;  3RK3 B;  2YIU C;  2H43 A;  3HUS C;  1FDM A;  1KQF B;  4M3L A;  5KTB A;  2JJL A;  1NTM D;  1IFN A;  5KJ7 D;  1Q90 D;  1N73 A;  4IFF A;  2ZYA A;  1BDC A;  1NTK G;  4GIF A;  1KYO I;  1SQX J;  1ZP0 C;  3PJS K;  1NTM G;  2KLV A;  1ZN5 A;  1IJD B;  1SFC B;  3W68 A;  1IFJ A;  2Y9Z A;  2H89 C;  2NPS B;  2WVR A;  1UIX A;  5TJH A;  2QJK C;  4KT0 J;  1FDO A;  3AEB C;  4KJM A;  2E5T A;  2K9Y A;  2QJP B;  1J1D C;  2NPS C;  4GOF A;  2FYN B;  3V2Q A;  5KKZ B;  2OYH A;  3S9O A;  3PLN A;  3H1I E;  4LC1 A;  2JKV A;  4KHX A;  1ZXG A;  2H7H A;  1YHQ P;  1GK4 A;  3P32 A;  3WU2 H;  4WWI A;  5APX A;  3FWN A;  2OYI C;  3KXD A;  1L0L E;  3CXH D;  4Z1M H;  3H1K E;  3VTP C;  1EZV E;  4UB8 H;  4ZMD A;  4AQR D;  3TK1 A;  1SQQ J;  5CCH D;  1PP9 J;  3KZI H;  1SQB D;  1D7M A;  2FYU G;  2BAS A;  3BCC D;  1BGY E;  2N1T A;  2H88 C;  2OYH C;  1JY3 P;  2P1J A;  1L0N E;  1L4A D;  1S72 P;  1SQB G;  3AEG C;  3E7K A;  4GT1 A;  3L72 E;  2XDJ A;  4L76 A;  1KN7 A;  2N9Y B;  2WIT A;  1JOC A;  5KLV E;  5E79 H;  2E76 C;  4H0L C;  4NPD A;  1HF9 A;  1LP1 A;  1PIX A;  1ZR4 A;  1LWU B;  1JNM A;  1QX8 A;  1M7L A;  2FXP A;  1GL2 C;  4H13 B;  4GOE A;  3S1K A;  2Q5U A;  2CPB A;  1LJ2 A;  4RKU J;  1BCC J;  1R8E A;  3U1C A;  1N86 A;  4HKZ H;  4JYC A;  2E75 C;  3PTZ A;  3G6E P;  3L74 D;  2Z5I A;  4O9B A;  2P2U A;  3HD7 D;  1JY2 O;  2KXP B;  1L4A B;  3H1J E;  2KSJ A;  3M9H A;  5AW2 B;  3LIE A;  3RL0 C;  1L0N D;  3L75 J;  4GOD A;  2OQQ A;  2M5A B;  1H88 A;  3B5N B;  1NAY A;  4ASW A;  3SWF A;  5GTH H;  2FY8 A;  3M91 A;  1DD3 A;  1KMI Z;  4HYT B;  1L0N G;  3HTK A;  1M57 D;  3B5N C;  1NOH A;  1SFC D;  2M5A A;  4U7J A;  1S2E A;  1FZC B;  2J58 A;  4TLF A;  1SQP E;  3L73 J;  2FYZ A;  4K3A A;  5KAF E;  1IFD A;  4UB8 E;  1LTA C;  3FWL A;  2XV5 A;  3K5B A;  1USE A;  5BU5 A;  3D70 A;  1VL2 A;  4BWN A;  1JO5 A;  3PHL A;  5APW A;  4EIJ A;  2IFM A;  5APU A;  5AVT B;  1NU1 D;  1ZOY C;  3E1I A;  1QLE D;  3GHG A;  2B87 B;  1LWU A;  1JY2 N;  1HVV A;  1SQP D;  2KP8 A;  2WQY C;  3CWB E;  3GW6 A;  1OZH A;  1Y8A A;  2XU6 A;  3A0H E;  4H13 D;  1URQ B;  4R4M A;  2RN0 A;  5TIS H;  1NTK K;  1PP9 D;  2B87 A;  4WY4 D;  2A06 D;  3V5B A;  1E5W A;  1N73 B;  2P67 A;  2QM8 A;  2YXQ B;  5APQ A;  1FZG A;  2HYN A;  1X9V A;  1RF0 A;  3CWB G;  4EYY Q;  1JMM A;  3CL3 D;  4TT3 H;  3O6Q B;  1USD A;  3RK2 C;  3ZDM A;  1WT6 A;  5B66 E;  3KYQ A;  2V7Q J;  5BVZ A;  2FYN C;  2R3S A;  1JCC A;  2KS1 A;  1Q2N A;  2OGU A;  1KB9 I;  2IBZ E;  3R2P A;  1JTH B;  3M9B A;  3USS A;  1AJY A;  4OVN F;  4OGQ D;  4IL6 E;  4WBA A;  5E79 E;  4Y99 C;  2ZYD A;  3CCM P;  1FDI A;  2YO3 A;  4QMA A;  1N7S B;  4NPF X;  1JEK A;  5EFW B;  1K8A Q;  1G2C B;  3A0B E;  2W6B A;  1BDD A;  3F89 A;  5AW0 B;  5KAF H;  3CC7 P;  3B71 A;  3CX5 E;  1KQL A;  5M1B A;  4BRY A;  3CX5 H;  1GL2 D;  2KZJ A;  3CXH E;  1FZE A;  3RK3 C;  1GD2 E;  2K9J A;  3AE4 C; 
#chains in the Genus database with same CATH homology
 3OAK A;  1L0L K;  3T97 A;  1RE3 C;  1ZR2 A;  1URQ A;  5AW9 B;  1A02 J;  5AVQ B;  1L4A C;  5AVY B;  3VMZ A;  1DH3 A;  1NU1 K;  1LT9 C;  1HUC A;  1N7L A;  1CW5 A;  1M1J A;  5CCG C;  5CCH D;  3TNU A;  2YO2 A;  3LW5 H;  4XA4 A;  1ZV8 A;  2W27 A;  1N7S A;  1VPC A;  3HTK B;  2E42 A;  1Z56 A;  4C46 A;  2CPS A;  2YKO A;  1XTC C;  2KOG A;  3A7O A;  3NTN A;  2Q3I A;  1FZC A;  5AVX B;  5AW8 B;  2A45 I;  3LID A;  1T8Z A;  3MTU E;  1JUN A;  3M0D C;  2MJZ A;  4WB4 A;  1N2D C;  3HE5 B;  4W80 A;  3G3Z A;  3H32 B;  3HUS B;  4WY4 C;  3HRN A;  5CCG D;  5CCH C;  2GM4 A;  2FFD C;  1SVF A;  3V4Q A;  5APY A;  2OAR A;  2ZFC A;  1NKN A;  2HPC A;  3CI9 A;  3KDP B;  1QL1 A;  1YTZ T;  5CMZ A;  2O01 H;  3NMD A;  1FAV A;  2FFD A;  2WT7 B;  1GU5 A;  3BRV B;  2VRS A;  3B5N D;  2WSE H;  4ZKP A;  1NO4 A;  1JTH A;  3VMX A;  5CJ4 A;  1CSB A;  1S9K E;  2I1K A;  2OYI B;  2YNY A;  2R5D A;  1FZC C;  2R5B A;  1AQ5 A;  4JYB A;  4C7R A;  1L4A A;  4LGD E;  1FJK A;  2N1T D;  2C0W A;  3MIW A;  2POH A;  1LTJ B;  1LTT C;  1XTG B;  1A02 F;  5AW6 B;  4N3Y B;  1CI6 B;  3PP5 A;  1JY3 O;  1T3J A;  3L35 A;  3VP9 A;  2HLO A;  1LT9 B;  5AVU B;  4GKG A;  4I2L C;  1KFM A;  2M8R A;  2O1J A;  4EOT A;  3II6 A;  3M0D A;  1GU4 A;  1GW4 A;  5AVS B;  1J1E C;  2YKP A;  5AW7 B;  2HOD B;  5AVW B;  4OH8 B;  1RF0 C;  1DEB A;  1MUU A;  2YKQ A;  4IFD K;  2I1J A;  1LTI C;  2PP6 A;  5KJ7 A;  1HGV A;  2NPS D;  4DZO A;  5APV A;  2WT7 A;  1M1J C;  2FKW B;  2XNX A;  5AVZ B;  3VOP A;  3N4X A;  1FZA A;  1LTB C;  4RES B;  3RL0 D;  1SQX K;  1CI6 A;  2KB7 P;  1SP4 A;  2WPS A;  3V2P A;  3A2A A;  4C7N B;  1LTJ A;  4HH2 A;  4N78 D;  2KYV A;  1VDF A;  2QM7 A;  3RK2 B;  4JF7 A;  2WSC H;  2LKM A;  2N9B A;  1SQB K;  4AYC A;  2OYI A;  1J1E B;  1IFI A;  5AW5 B;  3UIA A;  1S9K D;  1LTJ C;  1IO4 A;  5CHX A;  1GL2 A;  3RK2 D;  2HPC B;  1KIL A;  3V2R A;  1HGZ A;  1SQP K;  1QL2 A;  1RY3 A;  5APT A;  2JEE A;  1MV8 A;  2WPQ A;  2GUS A;  2J59 M;  1G2C A;  1SFC C;  3TSI A;  1NH4 A;  3RL0 B;  3BRT B;  3MUD A;  3M0A A;  3WMM 0;  3EQ2 A;  1WRG A;  1MFZ A;  2FFD B;  1L0N K;  2H8P D;  5CJ0 A;  1OXZ A;  3H6P A;  4DOJ A;  4C7N A;  3MGN A;  1NTZ K;  1IC2 A;  3HD7 C;  3OJA B;  2WPR A;  4W7Z A;  1N73 C;  3VYI A;  2XKM A;  2ZXE B;  1RF1 C;  1RF1 A;  1LTG C;  4I6M C;  4N6J A;  2A45 G;  5AW1 B;  2Z5H A;  3BAT A;  2E43 A;  3HD7 A;  3L36 A;  3BVH A;  1HWT C;  1N7S D;  1ZLL A;  3HD7 B;  1OWA A;  2NPS A;  4AUW A;  3NFQ A;  3O8Z A;  1SFC A;  3P8C E;  1AFO A;  1LGH B;  2PAJ A;  1URQ D;  1FU1 A;  1T2K D;  3P8M C;  5AW3 B;  3RK3 D;  3HUS A;  3H32 A;  2FXM A;  2HFE D;  2WWW A;  4LLH A;  5KJ7 C;  1KIL C;  2Q9I A;  2XZR A;  3KPE A;  1H8A A;  2WTY A;  2GUV A;  1YTZ I;  2IPP A;  1H89 A;  1EQ7 A;  1X79 B;  2A45 H;  2R3C A;  1PFI A;  2HG5 D;  4WY4 B;  3V2N A;  3HE4 B;  3OA7 A;  1FOS E;  3TNU B;  3V4W A;  2WSF H;  4Y99 B;  1URQ C;  5KLV K;  1RE3 A;  1HH0 A;  1DX7 A;  1RE4 A;  3EFG A;  1MZ9 A;  1RE4 C;  3GHG B;  1LTS C;  2L5G B;  1NAF A;  3IR9 A;  1FOS F;  1FZB A;  1GDT A;  3P8C D;  4IFM A;  5APS A;  2N1T B;  3HE4 A;  1NKZ B;  5AW4 B;  2HOD A;  3L37 A;  2P7J A;  3M06 A;  1KFN A;  3SWY A;  1G1J A;  3TYY A;  2IX7 C;  1T2K C;  3MD0 A;  3L4F A;  1HBW A;  2M3B A;  5CCG A;  1IFM A;  4I1L A;  1NHL A;  2W6A A;  1LT9 A;  1SLQ A;  1LWU C;  3U1A A;  3CLQ A;  1GZL A;  3C9I A;  1KIL B;  5CCH A;  1FJP A;  3VN0 A;  3A5T A;  3HE5 A;  2IFN A;  1JCD A;  1J1D B;  1FBM A;  3M9Q A;  4W7Y A;  5AVV B;  1JY3 N;  2Q7C A;  1FZF A;  3A3Y B;  1N7S C;  2OYH B;  1W2E A;  4N78 E;  3VP8 A;  1M1J B;  1SQQ K;  5BU8 B;  3U59 A;  5AVR B;  1HTL C;  1RF1 B;  1SQV K;  3NXS A;  3IFM A;  4XE5 B;  3I5C A;  1YYC A;  1HJB A;  4ZKU A;  1NTM K;  2N1T C;  3GHG C;  2C9L Y;  3P7K A;  1X8Y A;  2FYU K;  1GW3 A;  3VMY A;  2O1K A;  1GL2 B;  2C0X A;  1KZU B;  3BAS A;  1T3U A;  4WY4 A;  1G1I A;  1CZQ A;  1GTW A;  2R32 A;  1IK9 A;  3B5N A;  1KIL D;  1NWQ A;  3N7N A;  3KQG A;  2Z4E A;  2WZ7 A;  2YMY A;  1JY2 P;  3B8E B;  1GK6 A;  2C9N Y;  1J2J B;  4B86 A;  3RK3 B;  2H43 A;  3HUS C;  1FDM A;  4M3L A;  5KTB A;  2JJL A;  1IFN A;  5KJ7 D;  1N73 A;  4IFF A;  4GIF A;  2KLV A;  1ZN5 A;  1IJD B;  1SFC B;  1IFJ A;  2NPS B;  1J1D C;  2NPS C;  3V2Q A;  2OYH A;  4LC1 A;  4KHX A;  2H7H A;  1GK4 A;  3P32 A;  5APX A;  2OYI C;  3VTP C;  4AQR D;  3TK1 A;  2BAS A;  2N1T A;  2OYH C;  1JY3 P;  2P1J A;  1L4A D;  4GT1 A;  2XDJ A;  2WIT A;  1JOC A;  1ZR4 A;  1LWU B;  1JNM A;  1M7L A;  1GL2 C;  2Q5U A;  2CPB A;  3U1C A;  1N86 A;  4JYC A;  2Z5I A;  4O9B A;  2P2U A;  3HD7 D;  1JY2 O;  5AW2 B;  1L4A B;  3RL0 C;  2KSJ A;  3M9H A;  3LIE A;  1H88 A;  3B5N B;  3SWF A;  3M91 A;  4HYT B;  3HTK A;  3B5N C;  1NOH A;  1SFC D;  1FZC B;  2J58 A;  2FYZ A;  1IFD A;  1LTA C;  2XV5 A;  5BU5 A;  1JO5 A;  5APW A;  4EIJ A;  2IFM A;  5APU A;  5AVT B;  3E1I A;  3GHG A;  1LWU A;  1JY2 N;  1HVV A;  2KP8 A;  3KYQ A;  2XU6 A;  1URQ B;  1NTK K;  4WY4 D;  3V5B A;  1E5W A;  1N73 B;  2P67 A;  2QM8 A;  5APQ A;  1FZG A;  2HYN A;  1X9V A;  1RF0 A;  1JMM A;  3CL3 D;  3RK2 C;  1WT6 A;  5BVZ A;  1JCC A;  3R2P A;  1JTH B;  3M9B A;  4WBA A;  4Y99 C;  2YO3 A;  1N7S B;  1G2C B;  2W6B A;  5AW0 B;  1KQL A;  1GL2 D;  1FZE A;  3RK3 C;  1GD2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...