1N7LA

Solution nmr structure of phospholamban in detergent micelles
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
53
structure length
53
Chain Sequence
AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR solution structure and topological orientation of monomeric phospholamban in dodecylphosphocholine micelles.
pubmed rcsb
source organism Oryctolagus cuniculus
molecule tags Signaling protein
molecule keywords Cardiac phospholamban
total genus 22
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7lA00
1N7LA 1FJKA 2KB7P 1ZLLA 2HYNA 2KYVA 1FJPA 2M3BA
chains in the Genus database with same CATH superfamily
1BGYJ 2IPPA 2JR8A 2H8PD 2KI7B 1M57D 2KZIA 1SQPG 2NPSC 3CXHI 1RF1C 2A45G 5AVQB 4RKUJ 2QEXP 2HPCA 2PFXA 1BE3E 1MV8A 3CWBE 3AE8C 3G3ZA 4K35A 3G6EP 1LTBC 3K5BA 5CJ0A 3H1JD 3MUDC 1LTIC 3WUUA 1BE3D 3CWBD 1WT6A 2JWAA 2WPQA 1LP1A 4WVZA 5KAIH 2IX7C 1L0LJ 2V4HA 3A7OA 2RMZA 3H1JE 3IR9A 2B9BA 3USSA 1FJKA 1XTGB 4N3YB 3RL0g 1JCDA 3B5NA 1ZR2A 1OW7A 4RESB 1RF1A 1SQQJ 1S9KD 4PJ0E 2WSEH 3TK1A 2KK7A 2HODA 2WSCH 3A0BH 2FY8A 3AE2C 3B4SA 3BCCJ 3GG2A 3GF7A 5CJ4A 3MGNA 5KLVG 4UB8H 1VQMP 1OVVA 2AXCA 2QVAA 3SWYA 3HUSC 4YXWH 2IFNA 3H1LG 1OW6A 2B89A 2WPSA 5APWA 4NPFX 5AW8B 2LR2A 4H0LD 5CCHD 1DEEG 1P84D 1W2EA 3CX5I 3TNUB 3AEAC 4Z1MH 4PD4H 1X79B 2AEFA 3F5HA 3TGUG 4PV1D 1NTZD 2B87A 3B5NC 5B66E 4MN4C 1KQLA 1FDMA 4I7ZC 2W90A 3JC22 4OWFA 2O1KA 1GMJA 1L0NJ 3S1KA 3RK3D 3OJAB 3VYIA 1NTZE 3PTZA 2QJPC 2OTKE 3U1CA 1QL1A 1NTMG 3B5ND 3FGAD 3M9QA 5KTBA 1N7SD 5TISH 4EOTA 1KYOH 2VRSA 4UB8E 1Q7YQ 3CCUP 3H1IE 3L37A 2IBZG 2ZXXA 2KNCA 2NPSA 3AE3C 4OGQB 3AEGC 1SP4A 1BGYG 2ZYAA 1EZVG 2H7HA 3B71A 3WU2E 2M0BA 4DZOA 2AXTH 2WSEJ 3L72G 5L8RJ 1M1KQ 3O6QB 1KD1Q 2KP8A 3VOPA 4PD4D 2FBWC 2K3RA 1PFIA 4W7ZA 1OXZA 1EQ7A 2FYNB 3V2PA 3I55P 1S2EA 2YIUC 3BCCG 3KZIH 2QJKC 1BSNA 1S5LE 3L75E 1T2KD 1IFPA 2LKMA 3P8CD 2O01H 1URQC 4C7RA 3A0HH 4EIJA 5TJHA 3MP7B 2E75B 1SQQG 2WSFH 2Y9YA 5APSA 1VQLP 2Q5UA 1BCCG 3F89A 1KB9I 2QSIA 3P32A 5H2FE 1SFCA 4OVNF 3TF5A 3EQ2A 5KLVD 4PJ0H 1PZQA 2MKVA 2PRRA 5BU8B 5KKZC 1Q86Q 1VQNP 1HBWA 4Y99B 1FZCC 1QGKB 3TSIA 3MZWB 1J2JB 3RK3C 4U7JA 2R3CA 4L73A 2M8RA 2BCCE 2FYUD 1N7SA 1IFNA 2E76D 2WMMA 5AVZB 2P7JA 4K3AA 2OQQA 1ZR4A 1VQPP 1JNMA 3I56P 3Q2YA 3PRJA 1LWUB 4N78E 1IFJA 3HUSB 3RK3B 2JO1A 1ZV8A 2WVRA 4HKZH 4BRYB 4AQRD 1W5CE 5CHXA 3HE5B 2ZVOB 3L72J 4I2LC 3H6PA 5AVSB 1MFTA 1EC5A 1EDJA 3H1JJ 1GK4A 1OX3A 4OGQD 2H88C 3L71G 5BVZA 1URQB 3LIEA 4I1LA 1M90Q 2FYUG 1P84H 1GL2C 2FKWB 1JY3N 3FX0A 1RE3C 1PP9E 2LXCB 1ZN5A 4JPZB 3SSUA 3TDKA 3WMM0 1LTTC 3FWLA 3OA7A 1AA0A 1T6AA 1NU1J 2HODB 3H1KE 3VTPC 2Q9IA 1LNQA 3AE6C 3IFMA 2Z4EA 1T8ZA 1KYOI 1PPJG 2P2UA 1QLED 4WBAA 5AVTB 5KJ7A 1LTJA 1IZNB 3AEFC 2ZT9B 1AVYA 1GDTA 2WTYA 2D2CB 1NTZK 3CLQA 2ZFCA 3GF3A 2FFDA 3Q5PA 2KB7P 4WB4A 1SQVE 1SQBJ 3OAKA 3W67A 1JUNA 1L4AD 1LT9A 4IFDK 1G2CB 1WMKA 5B5EE 2QA4P 4TT3H 3RK2B 4N6JA 4D6TE 4R4MA 1G1JA 2QJYC 3EWKA 4WY4B 5GTIH 1NU1D 2Y9ZA 3H1HE 2J58A 2YNYA 3CCQP 2QM7A 5CCGC 3NFQA 1N7LA 1USEA 2JJLA 1KZUB 1SQQK 2M5AB 1YYCA 2QM8A 5AW5B 3E1IA 1M7LA 2W27A 3CL3D 1X22A 2E43A 3H1HJ 5APVA 3M0AA 1G2CA 1HJ0A 2XV5A 3AEEC 3BASA 4IOIH 1LT1A 5E79E 3A5TA 1M1JB 1S9KE 1JY2N 1VL2A 3CCVP 2M3EA 5AW2B 4GOFA 4WY4A 1LTSC 3CPWO 2YKPA 2FFDC 1SFCD 2WSSH 2P67A 3N4XA 1VQ7P 1VQ9P 2C0XA 2KS1A 1SQQE 2RKLA 3BCCD 2O01J 3L35A 4AYCA 2KYVA 1P84E 1N7SC 1HJBA 1FJPA 2ZT9D 1RE4A 1SLQA 2PP6A 1SQVJ 2L5GB 2QJYB 2QG4A 3BCCE 3L75G 2I1JA 4RO0A 3L74J 2K88A 3E7KA 3Q5SA 3T97B 1NJIQ 2AEMA 1NOHA 5KLVJ 5KJ7D 3TGUJ 1IFMA 2PAJA 1GL2A 3H1LJ 3RK2D 4EYYQ 3CXHE 3HD7B 1X8YA 1IFDA 1JTHA 3H32B 5CCHC 3PLNA 2QJKB 1KYOE 1NH4A 1FZGA 2E75D 2YIUB 1HVVA 2OYOA 4W7YA 1K73Q 1AJYA 3CXHD 4PV1C 4QMAA 1L4AA 1NTMD 1LWUA 2R44A 3L75D 1LTJC 4JQ0D 4L76A 1OMIA 1SQXJ 3A3YB 4UB6H 2ZYGA 3CC4P 1DD3A 3QH9A 4PD4E 4DJGA 2CPBA 1KILD 3HTKB 3JSVC 4U3FJ 1VDFA 2W6BA 2E5TA 2WITA 3O8ZA 1VF5B 1LT9C 1NTKG 2Q7CA 3H1LD 4H13C 1NYHA 1U7MA 3IAOA 3V2RA 3GHGB 5BU5A 2JP3A 1L0NE 1L4AC 1PV3A 1SQPJ 3KQGA 4JYCA 4ASVA 2OYHC 1JY3P 3V4QA 2B88A 3M0DC 2B87B 2MJZA 1VQ6P 2E74D 2GM4A 3AE9C 1E79H 3H1HG 5KLVE 1QVGO 1GZLA 3PP5A 3Q1MA 3M9BA 1FOSF 2IDBA 4D6TG 1P84I 3CCJP 1MFZA 3CCSP 2ZAEB 1OW8A 1FZEA 1SQPK 3NXSA 2BASA 2P1JA 1PP9G 3L36A 5APQA 2R5BA 3PHLA 2N9YB 1L0NK 2ZJSE 2BCCJ 3H1JG 1E5WA 3L73D 1BDDA 4Y28J 3CCMP 1CSBA 1CZQA 2KSJA 1QEXA 1IJDB 1MUUA 3L71E 4L74A 4Y99C 3RL0D 1YHQP 1GU4A 1SQPD 2XDJA 3AE5C 4JF7A 5CCGD 1W2BO 4WY4D 4BRYA 3CX5H 3AE4C 3O6QA 5CCHA 2SPZA 3GHGC 3M9HA 2RH0A 1VQ8P 4GT1A 3ITKA 1FU1A 2WSFJ 5E79H 4WY4C 3HE5A 5AVVB 1KILB 3SWFA 2E76C 4YTPC 5B66H 2HFED 1DX7A 1JMBA 1NTMJ 1OVRA 1AQTA 3GMAA 2WSCJ 1L0NG 1Q90D 1YQ4C 4KHXA 1BE3J 3CWBJ 3I5CA 5APXA 3NMDA 2K9YA 5CBNA 1GW4A 1NTKE 1HF9A 4H44C 4HYTB 2D2CC 2OARA 1JB0J 3GLMA 5KAIE 1YJ9P 1OWAA 1KQGB 2E74C 1CI6A 2ZT9C 1EXIA 2KXPB 1DIPA 1NTKD 4JBZA 3HD7C 4OGQC 3SFDC 1HGZA 1FDIA 3KDPB 4GODA 3D70A 4A7PA 1RE3A 3PH0A 3U1AA 3H1IJ 1GK6A 1EDIA 1G1IA 4NPEA 2O1JA 5KAFE 3D6ZA 2H89C 1SQVD 2BCCG 5AVUB 3CCEP 1NTKK 2QIWA 4M3LA 2E76B 3T97A 1KILC 3MD0A 3U59A 2QE7H 1Q82Q 3B5NB 2YMKA 1EZVD 1YTZI 4D6TD 2IZ1A 3RGUA 1JCCA 1KFNA 2Q3EA 3EFFK 3HD7A 2YKOA 5AVXB 2OYIB 3H1HD 1KQFB 3ABVC 3L73J 2FFDB 2IBZD 1ZMEC 1BCCE 1EZVE 2Z5HA 1BSHA 5APTA 5AW4B 1FZAA 1KORA 3L70G 2WZ7A 5KLIB 2M3BA 2WT7B 4OH8B 1X0TA 2N9BA 4KT0J 3WUVA 1GU5A 2DW3A 1LTAC 1LWUC 4AUWA 5AW3B 3M0DA 3PJSK 1GTWA 1YIJP 2J59M 1BCCJ 2W83C 5CCGA 1YBKA 1KQSO 3VMXA 1HGVA 1NTZG 1OIPA 3V6IA 3RK3E 4JYBA 3AE1C 1Y9BA 5DJTB 1YITP 2M5AA 5EFWB 1NAYA 1DD4A 3B8EB 2L91A 3LIDA 4HH2A 1KILA 3GHGA 3HE4A 2KSEA 1BGYE 1ZRTE 2POHA 1IK7A 2Q1KA 3P8MC 3RK2C 2Y0EA 3V5BA 3S9OA 5CMZA 1ZOYC 3LW5J 2OYHA 1VPCA 1KYOD 2E75C 3H1IG 1AV1A 3KPEA 1NU1K 3CX5E 1LT9B 4H0LB 5GTHE 1YI2P 1SQXE 1NTME 3L75J 4DOJA 3CC7P 2K9JB 2IZ0A 3CX5D 2HG5D 1LJ2A 2AEJA 4KJMA 1PIXA 1ZW0A 3Q5RA 1JEKA 1Y47A 2V7QJ 4C7NB 1NTKJ 1N73B 3TGUE 1FOSE 1SQVG 2JDIH 1IC2A 1HTLC 3G4SP 1N86A 2XZRA 4IL6E 3D71A 3H1LE 3BATA 1D7MA 1GL2B 1UIXA 2Y0DA 2R32A 1N73A 1M56D 1PPJE 1H88A 2OYIA 4YPCA 1S5LX 3BRVB 3H1KG 2XKMA 2HYNA 1NHLA 5B5EH 3BVHA 2QJPB 4WWIA 2KS1B 3VMYA 3L70D 4LGDE 3C8VA 1T3JA 1JY2P 2FYUE 1L0ND 4R4LA 1VQ4P 3NTNA 1QX8A 2CPSA 2FXPA 2IFMA 1S5LH 1SVFA 5DJUB 1SQBG 1JMMA 2FYZA 4XE5B 1LGHB 3HUSA 4GDOA 2Q6QA 1FAVA 1BE3G 3CWBG 3VP9A 1M1JC 1KB9E 1SQPE 3CMAP 1JM0A 3AEDC 3WU2H 2KUBA 2YMYA 3SWKA 2QRXA 3G71P 1FZBA 1NWQA 2FYUK 3G9RA 3JCUE 2H43A 1KB9D 3TYYA 3BRTB 2YXQB 3CXHH 2OYHB 3VMAA 2C0WA 2OYIC 1L4AB 2Y0CA 2JEEA 1J1DB 5AW6B 1PP9D 2R5DA 2WPVB 1VF5C 2LXBA 2ZYDA 1L0LD 1L2PA 1J1EB 1K05A 1SFCB 1SQBD 2J5UA 3L4FA 3VMZA 1N2DC 2E42A 3EFGA 4RJTA 5K5GB 1OZHA 1K8AQ 2Z5IA 1H8AA 2W6JH 3TNUA 5CBOA 1NTMK 2FXMA 1LTJB 2YKQA 3W68A 3CCLP 2OTLP 2GUVA 5TISE 1N73C 2NRGA 3RL0C 5APYA 1MZ9A 4PV1B 3N7NA 1M1JA 1NKNA 5AVWB 2E74B 1EXJA 3II6A 1ZXGA 1DEBA 2YO2A 1S72P 1A02J 1H89A 1PP9J 4C7NA 1GD2E 3RL0B 4ASWA 1HH0A 2NZ2A 2ITAA 1SQBK 2XNXA 2XNDH 4PD4I 3WUTA 4EDFA 1FZCB 1RH5B 1IK9A 1PGJA 1S4XA 1NU1E 2KLUA 1NTZJ 3AEBC 3H1KJ 3HRNA 3L72E 4LC1A 3UIAA 1RQVA 3L73G 2GUSA 2IYPA 1N8RQ 2C9NY 1SFCC 4GIFA 1J1EC 3P7KA 3LW5H 2N1TD 3CI9A 2WWWA 3L72D 4C46A 4BWNA 3A0BE 5GTIE 1OFCX 2IBZE 4XFJA 4NPDA 3CD6P 1IO4A 1J1DC 2D2CD 3RBXA 3V2QA 3KZIE 1RHZB 5AW7B 1FS0E 3FWNA 1JTHB 1ZLLA 3H32A 2P58A 1FE6A 3FXEA 1VQ5P 4TLFA 1YJWP 1YTZT 3HD7D 2OGUA 1NKZB 2I1KA 1IFIA 3L74D 1X9VA 3GW6A 3HTKA 3CC2P 2A06D 3OW2O 4U3FG 2XU6A 2P10A 1BCCD 5AW1B 2AXTE 2ZVNB 3L74E 1SQQD 5KLIC 3D6YA 1SQVK 4ZNCA 2A06E 1M8OB 1SS1A 1PGPA 4IL6H 2WT7A 5M1BA 3C9IA 5C39A 1Q81Q 1H0TA 2FXOA 3FXDA 1HUCA 1RQUA 2CK3H 2G3AA 2YXRB 3L71J 4UB6E 3VN0A 3MUDA 1JY3O 1AVOA 4ZKUA 1NGMB 5APUA 5GTHH 1A02F 4IFMA 1KC8Q 1TU3F 1LP1B 2K37A 2A45I 4ZMDA 4D6TJ 4U3FD 1SQXD 2A06G 1PGQA 1QVFO 1KV4A 3L74G 1R5SA 1T2KC 2C9LY 2G8YA 1BGYD 1ZRTD 3JCUH 1RF1B 1AFOA 1KTMA 4U3FE 4H13D 2WPRA 2I8DA 3AE7C 1YQ3C 1URQA 3H1ID 1WRGA 1Y8AA 2N1TC 3C1LA 2UWJE 2O01N 5KLVK 4EI2A 1SQXG 3MIWA 2KOGA 1FC2C 2NPSD 3MTUE 1BDCA 2HR3A 3KHUA 1S1CX 3HE4B 1YJNP 1PL5A 1U57A 2HLOA 1RF0C 1KMIZ 1VQOP 3P8CE 5AVYB 1FZFA 1FZCA 1Q2NA 1RY3A 2KLVA 3IF4A 4GKGA 4H44D 2N1TB 5AW0B 1QL2A 3TGUD 1T3UA 3E1RA 1AQ5A 3CMEP 1UIIA 4H0LC 1KILE 1KFMA 1USDA 4LLHA 2IBZI 1PPJD 2KIKA 3KYQA 3A0HE 5KAFH 1ZP0C 1K04A 3M06A 1GW3A 1CW5A 4I7ZB 1JO5A 1N7SB 2Q3IA 3A2AA 2PGDA 1EDKA 4O9BA 4GOEA 3SFEC 1JOCA 3KXDA 1FDOA 1FBMA 1NO4A 1NVOA 2GA1A 3L73E 1R5LA 3L70E 4W80A 4IFFA 3V4WA 1L0LG 2KZJA 3AECC 4DT0A 1NU1G 3Q3DA 2E5YA 1JY2O 2YO3A 3V2NA 3L70J 2WQYC 1Z56A 3L71D 3IN6A 2BCCD 3H25A 2JKVA 1HWTC 2BEZF 2V7QH 2BEQD 4I6MC 1EDLA 2IYOA 2K9JA 4N78D 2OTJP 2FYUJ 3VP8A 2W6AA 5KKZB 1U7JA 1VF5D 1RE4C 4HJGH 2W8ZA 2K1AA 1L0LE 1OVUA 1SQXK 5KJ7C 1R8EA 1DH3A 1H0TB 4H13B 1VQKP 1XTCC 4YXDC 4ZKPA 2KNCB 4L75A 1K9MQ 2JWDA 3QWOC 1KN7A 3S4RA 4DCKA 1RF0A 3CCRP 2O3JA 4BXLA 1URQD 1LTGC 2HPCB 3RBZA 1PGOA 2FYNC 2RN0A 1SQBE 3M91A 4B86A 1S3JA 1GL2D 4XA4A 1EZVI 2NPSB 1CI6B 1L0LK 2N1TA 2ZXEB 4HB1A 3R2PA 5AVRB 1NAFA 3R4YA 1KB9H 1MKMA 2A45H 3H1KD 5AW9B 3ZDMA 3MHVA 2R3SA 4CPGA 5H2FH 4IL6X 4H44B
chains in the Genus database with same CATH topology
2IPPA 2H8PD 2NPSC 1RF1C 2A45G 5AVQB 2HPCA 3G3ZA 1MV8A 1LTBC 5CJ0A 1LTIC 1WT6A 2WPQA 2IX7C 3A7OA 3IR9A 1FJKA 1XTGB 4N3YB 1ZR2A 1JCDA 3B5NA 4RESB 1RF1A 1S9KD 2WSEH 3TK1A 1A02J 2HODA 2WSCH 5CJ4A 3MGNA 3SWYA 3HUSC 2IFNA 2WPSA 5APWA 5AW8B 5CCHD 1W2EA 3TNUB 1X79B 3B5NC 1FDMA 1KQLA 2O1KA 3VYIA 3RK3D 3OJAB 3U1CA 1QL1A 3B5ND 3M9QA 5KTBA 1N7SD 4EOTA 2VRSA 3L37A 2NPSA 1SP4A 2H7HA 2KP8A 3VOPA 1PFIA 4W7ZA 1OXZA 1EQ7A 3V2PA 1T2KD 2LKMA 3P8CD 2O01H 1URQC 4C7RA 4EIJA 5APSA 2WSFH 2Q5UA 3P32A 1SFCA 3EQ2A 5BU8B 1HBWA 4Y99B 1FZCC 3TSIA 1J2JB 3RK3C 2R3CA 2M8RA 1N7SA 1IFNA 5AVZB 2P7JA 1ZR4A 1JNMA 1LWUB 4N78E 1IFJA 3HUSB 3RK3B 1ZV8A 4AQRD 5CHXA 3HE5B 4I2LC 3H6PA 5AVSB 1GK4A 1URQB 3LIEA 4I1LA 1GL2C 2FKWB 1JY3N 1RE3C 3WMM0 1ZN5A 1LTTC 3OA7A 2HODB 3VTPC 2Q9IA 3IFMA 2Z4EA 1T8ZA 2P2UA 4WBAA 5AVTB 5KJ7A 1LTJA 1GDTA 2WTYA 1NTZK 3CLQA 2ZFCA 2FFDA 2KB7P 4WB4A 3OAKA 1JUNA 1L4AD 1LT9A 4IFDK 1G2CB 3RK2B 4N6JA 1G1JA 4WY4B 2J58A 2YNYA 2QM7A 5CCGC 3NFQA 1N7LA 2JJLA 1KZUB 1SQQK 2QM8A 1YYCA 5AW5B 3E1IA 1M7LA 2W27A 3CL3D 2E43A 5APVA 3M0AA 1G2CA 3BASA 2XV5A 1S9KE 1NWQA 3A5TA 1M1JB 1JY2N 5AW2B 2FFDC 4WY4A 1LTSC 2YKPA 1SFCD 3N4XA 2P67A 2C0XA 3L35A 4AYCA 2KYVA 1N7SC 1HJBA 1FJPA 1RE4A 1SLQA 2PP6A 1AFOA 2L5GB 2I1JA 1NOHA 5KJ7D 1IFMA 2PAJA 1GL2A 3RK2D 3HD7B 1X8YA 1IFDA 1JTHA 3H32B 5CCHC 1NH4A 1FZGA 1HVVA 4W7YA 1L4AA 1LWUA 1LTJC 3A3YB 2CPBA 1KILD 3HTKB 1VDFA 2W6BA 2WITA 3O8ZA 1LT9C 2Q7CA 3V2RA 3GHGB 5BU5A 1L4AC 3KQGA 4JYCA 2OYHC 1JY3P 3V4QA 3M0DC 2MJZA 2GM4A 1GZLA 3PP5A 3M9BA 1FOSF 1MFZA 5APQA 1FZEA 1SQPK 3NXSA 2BASA 2P1JA 3L36A 2R5BA 1L0NK 1E5WA 1CSBA 1CZQA 2KSJA 4Y99C 1IJDB 1MUUA 3RL0D 1GU4A 3BVHA 1DH3A 2XDJA 5CCGD 4JF7A 4WY4D 5CCHA 3GHGC 3M9HA 4GT1A 1FU1A 4WY4C 3HE5A 5AVVB 1KILB 3SWFA 1DX7A 2HFED 4KHXA 3I5CA 5APXA 3NMDA 1GW4A 4HYTB 2OARA 1OWAA 1CI6A 3HD7C 1HGZA 3KDPB 1RE3A 3U1AA 1GK6A 1G1IA 2O1JA 5AVUB 1NTKK 4M3LA 3T97A 1KILC 3MD0A 3U59A 3B5NB 1YTZI 1JCCA 1KFNA 5AVXB 3HD7A 2YKOA 2OYIB 2FFDB 2Z5HA 5APTA 5AW4B 1FZAA 2WZ7A 2M3BA 2WT7B 4OH8B 2N9BA 1GU5A 1LTAC 1LWUC 4AUWA 5AW3B 3M0DA 1GTWA 2J59M 5CCGA 3VMXA 1HGVA 4JYBA 3B8EB 3LIDA 4HH2A 1KILA 3GHGA 3HE4A 3RK2C 2POHA 3P8MC 3V5BA 5CMZA 2OYHA 1VPCA 3KPEA 1NU1K 1LT9B 4DOJA 2HG5D 4C7NB 1N73B 1FOSE 1IC2A 1HTLC 1N86A 2XZRA 3BATA 1GL2B 2R32A 1N73A 1H88A 2OYIA 3BRVB 2XKMA 2HYNA 1NHLA 3VMYA 4LGDE 1T3JA 1JY2P 3NTNA 2CPSA 2IFMA 1SVFA 1JMMA 2FYZA 4XE5B 1LGHB 3HUSA 1FAVA 3VP9A 1M1JC 2YMYA 1FZCB 1FZBA 2FYUK 2H43A 3TYYA 3BRTB 2OYHB 2C0WA 2OYIC 1L4AB 2JEEA 1J1DB 5AW6B 2R5DA 3L4FA 1J1EB 1SFCB 2E42A 3VMZA 1N2DC 3EFGA 2Z5IA 1H8AA 3TNUA 1NTMK 2FXMA 1LTJB 2YKQA 2GUVA 1N73C 3RL0C 5APYA 1MZ9A 3N7NA 1M1JA 1NKNA 5AVWB 3II6A 1DEBA 2YO2A 1H89A 4C7NA 1GD2E 3RL0B 1HH0A 1SQBK 2XNXA 1IK9A 3HRNA 4LC1A 3UIAA 2GUSA 2C9NY 1SFCC 4GIFA 1J1EC 3P7KA 3LW5H 2N1TD 3CI9A 2WWWA 4C46A 1IO4A 1J1DC 3V2QA 5AW7B 1JTHB 1ZLLA 3H32A 1YTZT 3HD7D 1NKZB 2I1KA 1IFIA 1X9VA 3HTKA 2XU6A 5AW1B 1SQVK 2WT7A 3C9IA 1HUCA 3VN0A 3MUDA 1JY3O 4ZKUA 5APUA 1A02F 4IFMA 2A45I 1T2KC 2C9LY 1RF1B 2WPRA 1URQA 1WRGA 2N1TC 5KLVK 3MIWA 2KOGA 2NPSD 3MTUE 3HE4B 2HLOA 1RF0C 1FZCA 3P8CE 5AVYB 1FZFA 5AW0B 1RY3A 2KLVA 4GKGA 2N1TB 1QL2A 1T3UA 1AQ5A 1KFMA 4LLHA 3KYQA 3M06A 1GW3A 1CW5A 1JO5A 1N7SB 2Q3IA 3A2AA 4O9BA 4DZOA 1JOCA 5BVZA 1NO4A 1FBMA 4W80A 3V4WA 4IFFA 1JY2O 2YO3A 3V2NA 1Z56A 1HWTC 4I6MC 4N78D 3VP8A 2W6AA 1RE4C 5KJ7C 1SQXK 1XTCC 4ZKPA 1RF0A 2HPCB 1URQD 1LTGC 3M91A 4B86A 1GL2D 4XA4A 2NPSB 1CI6B 1L0LK 2N1TA 2ZXEB 5AVRB 3R2PA 1NAFA 2A45H 5AW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7L A;  1FJK A;  2KB7 P;  1ZLL A;  2HYN A;  2KYV A;  1FJP A;  2M3B A; 
#chains in the Genus database with same CATH topology
 1BGY J;  2IPP A;  2JR8 A;  2H8P D;  2KI7 B;  1M57 D;  2KZI A;  1SQP G;  2NPS C;  3CXH I;  1RF1 C;  2A45 G;  5AVQ B;  4RKU J;  2QEX P;  2HPC A;  2PFX A;  1BE3 E;  1MV8 A;  3CWB E;  3AE8 C;  3G3Z A;  4K35 A;  3G6E P;  1LTB C;  3K5B A;  5CJ0 A;  3H1J D;  3MUD C;  1LTI C;  3WUU A;  1BE3 D;  3CWB D;  1WT6 A;  2JWA A;  2WPQ A;  1LP1 A;  4WVZ A;  5KAI H;  2IX7 C;  1L0L J;  2V4H A;  3A7O A;  2RMZ A;  3H1J E;  3IR9 A;  2B9B A;  3USS A;  1FJK A;  1XTG B;  4N3Y B;  3RL0 g;  1JCD A;  3B5N A;  1ZR2 A;  1OW7 A;  4RES B;  1RF1 A;  1SQQ J;  1S9K D;  4PJ0 E;  2WSE H;  3TK1 A;  2KK7 A;  2HOD A;  2WSC H;  3A0B H;  2FY8 A;  3AE2 C;  3B4S A;  3BCC J;  3GG2 A;  3GF7 A;  5CJ4 A;  3MGN A;  5KLV G;  4UB8 H;  1VQM P;  1OVV A;  2AXC A;  2QVA A;  3SWY A;  3HUS C;  4YXW H;  2IFN A;  3H1L G;  1OW6 A;  2B89 A;  2WPS A;  5APW A;  4NPF X;  5AW8 B;  2LR2 A;  4H0L D;  5CCH D;  1DEE G;  1P84 D;  1W2E A;  3CX5 I;  3TNU B;  3AEA C;  4Z1M H;  4PD4 H;  1X79 B;  2AEF A;  3F5H A;  3TGU G;  4PV1 D;  1NTZ D;  2B87 A;  3B5N C;  5B66 E;  4MN4 C;  1KQL A;  1FDM A;  4I7Z C;  2W90 A;  3JC2 2;  4OWF A;  2O1K A;  1GMJ A;  1L0N J;  3S1K A;  3RK3 D;  3OJA B;  3VYI A;  1NTZ E;  3PTZ A;  2QJP C;  2OTK E;  3U1C A;  1QL1 A;  1NTM G;  3B5N D;  3FGA D;  3M9Q A;  5KTB A;  1N7S D;  5TIS H;  4EOT A;  1KYO H;  2VRS A;  4UB8 E;  1Q7Y Q;  3CCU P;  3H1I E;  3L37 A;  2IBZ G;  2ZXX A;  2KNC A;  2NPS A;  3AE3 C;  4OGQ B;  3AEG C;  1SP4 A;  1BGY G;  2ZYA A;  1EZV G;  2H7H A;  3B71 A;  3WU2 E;  2M0B A;  4DZO A;  2AXT H;  2WSE J;  3L72 G;  5L8R J;  1M1K Q;  3O6Q B;  1KD1 Q;  2KP8 A;  3VOP A;  4PD4 D;  2FBW C;  2K3R A;  1PFI A;  4W7Z A;  1OXZ A;  1EQ7 A;  2FYN B;  3V2P A;  3I55 P;  1S2E A;  2YIU C;  3BCC G;  3KZI H;  2QJK C;  1BSN A;  1S5L E;  3L75 E;  1T2K D;  1IFP A;  2LKM A;  3P8C D;  2O01 H;  1URQ C;  4C7R A;  3A0H H;  4EIJ A;  5TJH A;  3MP7 B;  2E75 B;  1SQQ G;  2WSF H;  2Y9Y A;  5APS A;  1VQL P;  2Q5U A;  1BCC G;  3F89 A;  1KB9 I;  2QSI A;  3P32 A;  5H2F E;  1SFC A;  4OVN F;  3TF5 A;  3EQ2 A;  5KLV D;  4PJ0 H;  1PZQ A;  2MKV A;  2PRR A;  5BU8 B;  5KKZ C;  1Q86 Q;  1VQN P;  1HBW A;  4Y99 B;  1FZC C;  1QGK B;  3TSI A;  3MZW B;  1J2J B;  3RK3 C;  4U7J A;  2R3C A;  4L73 A;  2M8R A;  2BCC E;  2FYU D;  1N7S A;  1IFN A;  2E76 D;  2WMM A;  5AVZ B;  2P7J A;  4K3A A;  2OQQ A;  1ZR4 A;  1VQP P;  1JNM A;  3I56 P;  3Q2Y A;  3PRJ A;  1LWU B;  4N78 E;  1IFJ A;  3HUS B;  3RK3 B;  2JO1 A;  1ZV8 A;  2WVR A;  4HKZ H;  4BRY B;  4AQR D;  1W5C E;  5CHX A;  3HE5 B;  2ZVO B;  3L72 J;  4I2L C;  3H6P A;  5AVS B;  1MFT A;  1EC5 A;  1EDJ A;  3H1J J;  1GK4 A;  1OX3 A;  4OGQ D;  2H88 C;  3L71 G;  5BVZ A;  1URQ B;  3LIE A;  4I1L A;  1M90 Q;  2FYU G;  1P84 H;  1GL2 C;  2FKW B;  1JY3 N;  3FX0 A;  1RE3 C;  1PP9 E;  2LXC B;  1ZN5 A;  4JPZ B;  3SSU A;  3TDK A;  3WMM 0;  1LTT C;  3FWL A;  3OA7 A;  1AA0 A;  1T6A A;  1NU1 J;  2HOD B;  3H1K E;  3VTP C;  2Q9I A;  1LNQ A;  3AE6 C;  3IFM A;  2Z4E A;  1T8Z A;  1KYO I;  1PPJ G;  2P2U A;  1QLE D;  4WBA A;  5AVT B;  5KJ7 A;  1LTJ A;  1IZN B;  3AEF C;  2ZT9 B;  1AVY A;  1GDT A;  2WTY A;  2D2C B;  1NTZ K;  3CLQ A;  2ZFC A;  3GF3 A;  2FFD A;  3Q5P A;  2KB7 P;  4WB4 A;  1SQV E;  1SQB J;  3OAK A;  3W67 A;  1JUN A;  1L4A D;  1LT9 A;  4IFD K;  1G2C B;  1WMK A;  5B5E E;  2QA4 P;  4TT3 H;  3RK2 B;  4N6J A;  4D6T E;  4R4M A;  1G1J A;  2QJY C;  3EWK A;  4WY4 B;  5GTI H;  1NU1 D;  2Y9Z A;  3H1H E;  2J58 A;  2YNY A;  3CCQ P;  2QM7 A;  5CCG C;  3NFQ A;  1N7L A;  1USE A;  2JJL A;  1KZU B;  1SQQ K;  2M5A B;  1YYC A;  2QM8 A;  5AW5 B;  3E1I A;  1M7L A;  2W27 A;  3CL3 D;  1X22 A;  2E43 A;  3H1H J;  5APV A;  3M0A A;  1G2C A;  1HJ0 A;  2XV5 A;  3AEE C;  3BAS A;  4IOI H;  1LT1 A;  5E79 E;  3A5T A;  1M1J B;  1S9K E;  1JY2 N;  1VL2 A;  3CCV P;  2M3E A;  5AW2 B;  4GOF A;  4WY4 A;  1LTS C;  3CPW O;  2YKP A;  2FFD C;  1SFC D;  2WSS H;  2P67 A;  3N4X A;  1VQ7 P;  1VQ9 P;  2C0X A;  2KS1 A;  1SQQ E;  2RKL A;  3BCC D;  2O01 J;  3L35 A;  4AYC A;  2KYV A;  1P84 E;  1N7S C;  1HJB A;  1FJP A;  2ZT9 D;  1RE4 A;  1SLQ A;  2PP6 A;  1SQV J;  2L5G B;  2QJY B;  2QG4 A;  3BCC E;  3L75 G;  2I1J A;  4RO0 A;  3L74 J;  2K88 A;  3E7K A;  3Q5S A;  3T97 B;  1NJI Q;  2AEM A;  1NOH A;  5KLV J;  5KJ7 D;  3TGU J;  1IFM A;  2PAJ A;  1GL2 A;  3H1L J;  3RK2 D;  4EYY Q;  3CXH E;  3HD7 B;  1X8Y A;  1IFD A;  1JTH A;  3H32 B;  5CCH C;  3PLN A;  2QJK B;  1KYO E;  1NH4 A;  1FZG A;  2E75 D;  2YIU B;  1HVV A;  2OYO A;  4W7Y A;  1K73 Q;  1AJY A;  3CXH D;  4PV1 C;  4QMA A;  1L4A A;  1NTM D;  1LWU A;  2R44 A;  3L75 D;  1LTJ C;  4JQ0 D;  4L76 A;  1OMI A;  1SQX J;  3A3Y B;  4UB6 H;  2ZYG A;  3CC4 P;  1DD3 A;  3QH9 A;  4PD4 E;  4DJG A;  2CPB A;  1KIL D;  3HTK B;  3JSV C;  4U3F J;  1VDF A;  2W6B A;  2E5T A;  2WIT A;  3O8Z A;  1VF5 B;  1LT9 C;  1NTK G;  2Q7C A;  3H1L D;  4H13 C;  1NYH A;  1U7M A;  3IAO A;  3V2R A;  3GHG B;  5BU5 A;  2JP3 A;  1L0N E;  1L4A C;  1PV3 A;  1SQP J;  3KQG A;  4JYC A;  4ASV A;  2OYH C;  1JY3 P;  3V4Q A;  2B88 A;  3M0D C;  2B87 B;  2MJZ A;  1VQ6 P;  2E74 D;  2GM4 A;  3AE9 C;  1E79 H;  3H1H G;  5KLV E;  1QVG O;  1GZL A;  3PP5 A;  3Q1M A;  3M9B A;  1FOS F;  2IDB A;  4D6T G;  1P84 I;  3CCJ P;  1MFZ A;  3CCS P;  2ZAE B;  1OW8 A;  1FZE A;  1SQP K;  3NXS A;  2BAS A;  2P1J A;  1PP9 G;  3L36 A;  5APQ A;  2R5B A;  3PHL A;  2N9Y B;  1L0N K;  2ZJS E;  2BCC J;  3H1J G;  1E5W A;  3L73 D;  1BDD A;  4Y28 J;  3CCM P;  1CSB A;  1CZQ A;  2KSJ A;  1QEX A;  1IJD B;  1MUU A;  3L71 E;  4L74 A;  4Y99 C;  3RL0 D;  1YHQ P;  1GU4 A;  1SQP D;  2XDJ A;  3AE5 C;  4JF7 A;  5CCG D;  1W2B O;  4WY4 D;  4BRY A;  3CX5 H;  3AE4 C;  3O6Q A;  5CCH A;  2SPZ A;  3GHG C;  3M9H A;  2RH0 A;  1VQ8 P;  4GT1 A;  3ITK A;  1FU1 A;  2WSF J;  5E79 H;  4WY4 C;  3HE5 A;  5AVV B;  1KIL B;  3SWF A;  2E76 C;  4YTP C;  5B66 H;  2HFE D;  1DX7 A;  1JMB A;  1NTM J;  1OVR A;  1AQT A;  3GMA A;  2WSC J;  1L0N G;  1Q90 D;  1YQ4 C;  4KHX A;  1BE3 J;  3CWB J;  3I5C A;  5APX A;  3NMD A;  2K9Y A;  5CBN A;  1GW4 A;  1NTK E;  1HF9 A;  4H44 C;  4HYT B;  2D2C C;  2OAR A;  1JB0 J;  3GLM A;  5KAI E;  1YJ9 P;  1OWA A;  1KQG B;  2E74 C;  1CI6 A;  2ZT9 C;  1EXI A;  2KXP B;  1DIP A;  1NTK D;  4JBZ A;  3HD7 C;  4OGQ C;  3SFD C;  1HGZ A;  1FDI A;  3KDP B;  4GOD A;  3D70 A;  4A7P A;  1RE3 A;  3PH0 A;  3U1A A;  3H1I J;  1GK6 A;  1EDI A;  1G1I A;  4NPE A;  2O1J A;  5KAF E;  3D6Z A;  2H89 C;  1SQV D;  2BCC G;  5AVU B;  3CCE P;  1NTK K;  2QIW A;  4M3L A;  2E76 B;  3T97 A;  1KIL C;  3MD0 A;  3U59 A;  2QE7 H;  1Q82 Q;  3B5N B;  2YMK A;  1EZV D;  1YTZ I;  4D6T D;  2IZ1 A;  3RGU A;  1JCC A;  1KFN A;  2Q3E A;  3EFF K;  3HD7 A;  2YKO A;  5AVX B;  2OYI B;  3H1H D;  1KQF B;  3ABV C;  3L73 J;  2FFD B;  2IBZ D;  1ZME C;  1BCC E;  1EZV E;  2Z5H A;  1BSH A;  5APT A;  5AW4 B;  1FZA A;  1KOR A;  3L70 G;  2WZ7 A;  5KLI B;  2M3B A;  2WT7 B;  4OH8 B;  1X0T A;  2N9B A;  4KT0 J;  3WUV A;  1GU5 A;  2DW3 A;  1LTA C;  1LWU C;  4AUW A;  5AW3 B;  3M0D A;  3PJS K;  1GTW A;  1YIJ P;  2J59 M;  1BCC J;  2W83 C;  5CCG A;  1YBK A;  1KQS O;  3VMX A;  1HGV A;  1NTZ G;  1OIP A;  3V6I A;  3RK3 E;  4JYB A;  3AE1 C;  1Y9B A;  5DJT B;  1YIT P;  2M5A A;  5EFW B;  1NAY A;  1DD4 A;  3B8E B;  2L91 A;  3LID A;  4HH2 A;  1KIL A;  3GHG A;  3HE4 A;  2KSE A;  1BGY E;  1ZRT E;  2POH A;  1IK7 A;  2Q1K A;  3P8M C;  3RK2 C;  2Y0E A;  3V5B A;  3S9O A;  5CMZ A;  1ZOY C;  3LW5 J;  2OYH A;  1VPC A;  1KYO D;  2E75 C;  3H1I G;  1AV1 A;  3KPE A;  1NU1 K;  3CX5 E;  1LT9 B;  4H0L B;  5GTH E;  1YI2 P;  1SQX E;  1NTM E;  3L75 J;  4DOJ A;  3CC7 P;  2K9J B;  2IZ0 A;  3CX5 D;  2HG5 D;  1LJ2 A;  2AEJ A;  4KJM A;  1PIX A;  1ZW0 A;  3Q5R A;  1JEK A;  1Y47 A;  2V7Q J;  4C7N B;  1NTK J;  1N73 B;  3TGU E;  1FOS E;  1SQV G;  2JDI H;  1IC2 A;  1HTL C;  3G4S P;  1N86 A;  2XZR A;  4IL6 E;  3D71 A;  3H1L E;  3BAT A;  1D7M A;  1GL2 B;  1UIX A;  2Y0D A;  2R32 A;  1N73 A;  1M56 D;  1PPJ E;  1H88 A;  2OYI A;  4YPC A;  1S5L X;  3BRV B;  3H1K G;  2XKM A;  2HYN A;  1NHL A;  5B5E H;  3BVH A;  2QJP B;  4WWI A;  2KS1 B;  3VMY A;  3L70 D;  4LGD E;  3C8V A;  1T3J A;  1JY2 P;  2FYU E;  1L0N D;  4R4L A;  1VQ4 P;  3NTN A;  1QX8 A;  2CPS A;  2FXP A;  2IFM A;  1S5L H;  1SVF A;  5DJU B;  1SQB G;  1JMM A;  2FYZ A;  4XE5 B;  1LGH B;  3HUS A;  4GDO A;  2Q6Q A;  1FAV A;  1BE3 G;  3CWB G;  3VP9 A;  1M1J C;  1KB9 E;  1SQP E;  3CMA P;  1JM0 A;  3AED C;  3WU2 H;  2KUB A;  2YMY A;  3SWK A;  2QRX A;  3G71 P;  1FZB A;  1NWQ A;  2FYU K;  3G9R A;  3JCU E;  2H43 A;  1KB9 D;  3TYY A;  3BRT B;  2YXQ B;  3CXH H;  2OYH B;  3VMA A;  2C0W A;  2OYI C;  1L4A B;  2Y0C A;  2JEE A;  1J1D B;  5AW6 B;  1PP9 D;  2R5D A;  2WPV B;  1VF5 C;  2LXB A;  2ZYD A;  1L0L D;  1L2P A;  1J1E B;  1K05 A;  1SFC B;  1SQB D;  2J5U A;  3L4F A;  3VMZ A;  1N2D C;  2E42 A;  3EFG A;  4RJT A;  5K5G B;  1OZH A;  1K8A Q;  2Z5I A;  1H8A A;  2W6J H;  3TNU A;  5CBO A;  1NTM K;  2FXM A;  1LTJ B;  2YKQ A;  3W68 A;  3CCL P;  2OTL P;  2GUV A;  5TIS E;  1N73 C;  2NRG A;  3RL0 C;  5APY A;  1MZ9 A;  4PV1 B;  3N7N A;  1M1J A;  1NKN A;  5AVW B;  2E74 B;  1EXJ A;  3II6 A;  1ZXG A;  1DEB A;  2YO2 A;  1S72 P;  1A02 J;  1H89 A;  1PP9 J;  4C7N A;  1GD2 E;  3RL0 B;  4ASW A;  1HH0 A;  2NZ2 A;  2ITA A;  1SQB K;  2XNX A;  2XND H;  4PD4 I;  3WUT A;  4EDF A;  1FZC B;  1RH5 B;  1IK9 A;  1PGJ A;  1S4X A;  1NU1 E;  2KLU A;  1NTZ J;  3AEB C;  3H1K J;  3HRN A;  3L72 E;  4LC1 A;  3UIA A;  1RQV A;  3L73 G;  2GUS A;  2IYP A;  1N8R Q;  2C9N Y;  1SFC C;  4GIF A;  1J1E C;  3P7K A;  3LW5 H;  2N1T D;  3CI9 A;  2WWW A;  3L72 D;  4C46 A;  4BWN A;  3A0B E;  5GTI E;  1OFC X;  2IBZ E;  4XFJ A;  4NPD A;  3CD6 P;  1IO4 A;  1J1D C;  2D2C D;  3RBX A;  3V2Q A;  3KZI E;  1RHZ B;  5AW7 B;  1FS0 E;  3FWN A;  1JTH B;  1ZLL A;  3H32 A;  2P58 A;  1FE6 A;  3FXE A;  1VQ5 P;  4TLF A;  1YJW P;  1YTZ T;  3HD7 D;  2OGU A;  1NKZ B;  2I1K A;  1IFI A;  3L74 D;  1X9V A;  3GW6 A;  3HTK A;  3CC2 P;  2A06 D;  3OW2 O;  4U3F G;  2XU6 A;  2P10 A;  1BCC D;  5AW1 B;  2AXT E;  2ZVN B;  3L74 E;  1SQQ D;  5KLI C;  3D6Y A;  1SQV K;  4ZNC A;  2A06 E;  1M8O B;  1SS1 A;  1PGP A;  4IL6 H;  2WT7 A;  5M1B A;  3C9I A;  5C39 A;  1Q81 Q;  1H0T A;  2FXO A;  3FXD A;  1HUC A;  1RQU A;  2CK3 H;  2G3A A;  2YXR B;  3L71 J;  4UB6 E;  3VN0 A;  3MUD A;  1JY3 O;  1AVO A;  4ZKU A;  1NGM B;  5APU A;  5GTH H;  1A02 F;  4IFM A;  1KC8 Q;  1TU3 F;  1LP1 B;  2K37 A;  2A45 I;  4ZMD A;  4D6T J;  4U3F D;  1SQX D;  2A06 G;  1PGQ A;  1QVF O;  1KV4 A;  3L74 G;  1R5S A;  1T2K C;  2C9L Y;  2G8Y A;  1BGY D;  1ZRT D;  3JCU H;  1RF1 B;  1AFO A;  1KTM A;  4U3F E;  4H13 D;  2WPR A;  2I8D A;  3AE7 C;  1YQ3 C;  1URQ A;  3H1I D;  1WRG A;  1Y8A A;  2N1T C;  3C1L A;  2UWJ E;  2O01 N;  5KLV K;  4EI2 A;  1SQX G;  3MIW A;  2KOG A;  1FC2 C;  2NPS D;  3MTU E;  1BDC A;  2HR3 A;  3KHU A;  1S1C X;  3HE4 B;  1YJN P;  1PL5 A;  1U57 A;  2HLO A;  1RF0 C;  1KMI Z;  1VQO P;  3P8C E;  5AVY B;  1FZF A;  1FZC A;  1Q2N A;  1RY3 A;  2KLV A;  3IF4 A;  4GKG A;  4H44 D;  2N1T B;  5AW0 B;  1QL2 A;  3TGU D;  1T3U A;  3E1R A;  1AQ5 A;  3CME P;  1UII A;  4H0L C;  1KIL E;  1KFM A;  1USD A;  4LLH A;  2IBZ I;  1PPJ D;  2KIK A;  3KYQ A;  3A0H E;  5KAF H;  1ZP0 C;  1K04 A;  3M06 A;  1GW3 A;  1CW5 A;  4I7Z B;  1JO5 A;  1N7S B;  2Q3I A;  3A2A A;  2PGD A;  1EDK A;  4O9B A;  4GOE A;  3SFE C;  1JOC A;  3KXD A;  1FDO A;  1FBM A;  1NO4 A;  1NVO A;  2GA1 A;  3L73 E;  1R5L A;  3L70 E;  4W80 A;  4IFF A;  3V4W A;  1L0L G;  2KZJ A;  3AEC C;  4DT0 A;  1NU1 G;  3Q3D A;  2E5Y A;  1JY2 O;  2YO3 A;  3V2N A;  3L70 J;  2WQY C;  1Z56 A;  3L71 D;  3IN6 A;  2BCC D;  3H25 A;  2JKV A;  1HWT C;  2BEZ F;  2V7Q H;  2BEQ D;  4I6M C;  1EDL A;  2IYO A;  2K9J A;  4N78 D;  2OTJ P;  2FYU J;  3VP8 A;  2W6A A;  5KKZ B;  1U7J A;  1VF5 D;  1RE4 C;  4HJG H;  2W8Z A;  2K1A A;  1L0L E;  1OVU A;  1SQX K;  5KJ7 C;  1R8E A;  1DH3 A;  1H0T B;  4H13 B;  1VQK P;  1XTC C;  4YXD C;  4ZKP A;  2KNC B;  4L75 A;  1K9M Q;  2JWD A;  3QWO C;  1KN7 A;  3S4R A;  4DCK A;  1RF0 A;  3CCR P;  2O3J A;  4BXL A;  1URQ D;  1LTG C;  2HPC B;  3RBZ A;  1PGO A;  2FYN C;  2RN0 A;  1SQB E;  3M91 A;  4B86 A;  1S3J A;  1GL2 D;  4XA4 A;  1EZV I;  2NPS B;  1CI6 B;  1L0L K;  2N1T A;  2ZXE B;  4HB1 A;  3R2P A;  5AVR B;  1NAF A;  3R4Y A;  1KB9 H;  1MKM A;  2A45 H;  3H1K D;  5AW9 B;  3ZDM A;  3MHV A;  2R3S A;  4CPG A;  5H2F H;  4IL6 X;  4H44 B; 
#chains in the Genus database with same CATH homology
 2IPP A;  2H8P D;  2NPS C;  1RF1 C;  2A45 G;  5AVQ B;  2HPC A;  3G3Z A;  1MV8 A;  1LTB C;  5CJ0 A;  1LTI C;  1WT6 A;  2WPQ A;  2IX7 C;  3A7O A;  3IR9 A;  1FJK A;  1XTG B;  4N3Y B;  1ZR2 A;  1JCD A;  3B5N A;  4RES B;  1RF1 A;  1S9K D;  2WSE H;  3TK1 A;  1A02 J;  2HOD A;  2WSC H;  5CJ4 A;  3MGN A;  3SWY A;  3HUS C;  2IFN A;  2WPS A;  5APW A;  5AW8 B;  5CCH D;  1W2E A;  3TNU B;  1X79 B;  3B5N C;  1FDM A;  1KQL A;  2O1K A;  3VYI A;  3RK3 D;  3OJA B;  3U1C A;  1QL1 A;  3B5N D;  3M9Q A;  5KTB A;  1N7S D;  4EOT A;  2VRS A;  3L37 A;  2NPS A;  1SP4 A;  2H7H A;  2KP8 A;  3VOP A;  1PFI A;  4W7Z A;  1OXZ A;  1EQ7 A;  3V2P A;  1T2K D;  2LKM A;  3P8C D;  2O01 H;  1URQ C;  4C7R A;  4EIJ A;  5APS A;  2WSF H;  2Q5U A;  3P32 A;  1SFC A;  3EQ2 A;  5BU8 B;  1HBW A;  4Y99 B;  1FZC C;  3TSI A;  1J2J B;  3RK3 C;  2R3C A;  2M8R A;  1N7S A;  1IFN A;  5AVZ B;  2P7J A;  1ZR4 A;  1JNM A;  1LWU B;  4N78 E;  1IFJ A;  3HUS B;  3RK3 B;  1ZV8 A;  4AQR D;  5CHX A;  3HE5 B;  4I2L C;  3H6P A;  5AVS B;  1GK4 A;  1URQ B;  3LIE A;  4I1L A;  1GL2 C;  2FKW B;  1JY3 N;  1RE3 C;  3WMM 0;  1ZN5 A;  1LTT C;  3OA7 A;  2HOD B;  3VTP C;  2Q9I A;  3IFM A;  2Z4E A;  1T8Z A;  2P2U A;  4WBA A;  5AVT B;  5KJ7 A;  1LTJ A;  1GDT A;  2WTY A;  1NTZ K;  3CLQ A;  2ZFC A;  2FFD A;  2KB7 P;  4WB4 A;  3OAK A;  1JUN A;  1L4A D;  1LT9 A;  4IFD K;  1G2C B;  3RK2 B;  4N6J A;  1G1J A;  4WY4 B;  2J58 A;  2YNY A;  2QM7 A;  5CCG C;  3NFQ A;  1N7L A;  2JJL A;  1KZU B;  1SQQ K;  2QM8 A;  1YYC A;  5AW5 B;  3E1I A;  1M7L A;  2W27 A;  3CL3 D;  2E43 A;  5APV A;  3M0A A;  1G2C A;  3BAS A;  2XV5 A;  1S9K E;  1NWQ A;  3A5T A;  1M1J B;  1JY2 N;  5AW2 B;  2FFD C;  4WY4 A;  1LTS C;  2YKP A;  1SFC D;  3N4X A;  2P67 A;  2C0X A;  3L35 A;  4AYC A;  2KYV A;  1N7S C;  1HJB A;  1FJP A;  1RE4 A;  1SLQ A;  2PP6 A;  1AFO A;  2L5G B;  2I1J A;  1NOH A;  5KJ7 D;  1IFM A;  2PAJ A;  1GL2 A;  3RK2 D;  3HD7 B;  1X8Y A;  1IFD A;  1JTH A;  3H32 B;  5CCH C;  1NH4 A;  1FZG A;  1HVV A;  4W7Y A;  1L4A A;  1LWU A;  1LTJ C;  3A3Y B;  2CPB A;  1KIL D;  3HTK B;  1VDF A;  2W6B A;  2WIT A;  3O8Z A;  1LT9 C;  2Q7C A;  3V2R A;  3GHG B;  5BU5 A;  1L4A C;  3KQG A;  4JYC A;  2OYH C;  1JY3 P;  3V4Q A;  3M0D C;  2MJZ A;  2GM4 A;  1GZL A;  3PP5 A;  3M9B A;  1FOS F;  1MFZ A;  5APQ A;  1FZE A;  1SQP K;  3NXS A;  2BAS A;  2P1J A;  3L36 A;  2R5B A;  1L0N K;  1E5W A;  1CSB A;  1CZQ A;  2KSJ A;  4Y99 C;  1IJD B;  1MUU A;  3RL0 D;  1GU4 A;  3BVH A;  1DH3 A;  2XDJ A;  5CCG D;  4JF7 A;  4WY4 D;  5CCH A;  3GHG C;  3M9H A;  4GT1 A;  1FU1 A;  4WY4 C;  3HE5 A;  5AVV B;  1KIL B;  3SWF A;  1DX7 A;  2HFE D;  4KHX A;  3I5C A;  5APX A;  3NMD A;  1GW4 A;  4HYT B;  2OAR A;  1OWA A;  1CI6 A;  3HD7 C;  1HGZ A;  3KDP B;  1RE3 A;  3U1A A;  1GK6 A;  1G1I A;  2O1J A;  5AVU B;  1NTK K;  4M3L A;  3T97 A;  1KIL C;  3MD0 A;  3U59 A;  3B5N B;  1YTZ I;  1JCC A;  1KFN A;  5AVX B;  3HD7 A;  2YKO A;  2OYI B;  2FFD B;  2Z5H A;  5APT A;  5AW4 B;  1FZA A;  2WZ7 A;  2M3B A;  2WT7 B;  4OH8 B;  2N9B A;  1GU5 A;  1LTA C;  1LWU C;  4AUW A;  5AW3 B;  3M0D A;  1GTW A;  2J59 M;  5CCG A;  3VMX A;  1HGV A;  4JYB A;  3B8E B;  3LID A;  4HH2 A;  1KIL A;  3GHG A;  3HE4 A;  3RK2 C;  2POH A;  3P8M C;  3V5B A;  5CMZ A;  2OYH A;  1VPC A;  3KPE A;  1NU1 K;  1LT9 B;  4DOJ A;  2HG5 D;  4C7N B;  1N73 B;  1FOS E;  1IC2 A;  1HTL C;  1N86 A;  2XZR A;  3BAT A;  1GL2 B;  2R32 A;  1N73 A;  1H88 A;  2OYI A;  3BRV B;  2XKM A;  2HYN A;  1NHL A;  3VMY A;  4LGD E;  1T3J A;  1JY2 P;  3NTN A;  2CPS A;  2IFM A;  1SVF A;  1JMM A;  2FYZ A;  4XE5 B;  1LGH B;  3HUS A;  1FAV A;  3VP9 A;  1M1J C;  2YMY A;  1FZC B;  1FZB A;  2FYU K;  2H43 A;  3TYY A;  3BRT B;  2OYH B;  2C0W A;  2OYI C;  1L4A B;  2JEE A;  1J1D B;  5AW6 B;  2R5D A;  3L4F A;  1J1E B;  1SFC B;  2E42 A;  3VMZ A;  1N2D C;  3EFG A;  2Z5I A;  1H8A A;  3TNU A;  1NTM K;  2FXM A;  1LTJ B;  2YKQ A;  2GUV A;  1N73 C;  3RL0 C;  5APY A;  1MZ9 A;  3N7N A;  1M1J A;  1NKN A;  5AVW B;  3II6 A;  1DEB A;  2YO2 A;  1H89 A;  4C7N A;  1GD2 E;  3RL0 B;  1HH0 A;  1SQB K;  2XNX A;  1IK9 A;  3HRN A;  4LC1 A;  3UIA A;  2GUS A;  2C9N Y;  1SFC C;  4GIF A;  1J1E C;  3P7K A;  3LW5 H;  2N1T D;  3CI9 A;  2WWW A;  4C46 A;  1IO4 A;  1J1D C;  3V2Q A;  5AW7 B;  1JTH B;  1ZLL A;  3H32 A;  1YTZ T;  3HD7 D;  1NKZ B;  2I1K A;  1IFI A;  1X9V A;  3HTK A;  2XU6 A;  5AW1 B;  1SQV K;  2WT7 A;  3C9I A;  1HUC A;  3VN0 A;  3MUD A;  1JY3 O;  4ZKU A;  5APU A;  1A02 F;  4IFM A;  2A45 I;  1T2K C;  2C9L Y;  1RF1 B;  2WPR A;  1URQ A;  1WRG A;  2N1T C;  5KLV K;  3MIW A;  2KOG A;  2NPS D;  3MTU E;  3HE4 B;  2HLO A;  1RF0 C;  1FZC A;  3P8C E;  5AVY B;  1FZF A;  5AW0 B;  1RY3 A;  2KLV A;  4GKG A;  2N1T B;  1QL2 A;  1T3U A;  1AQ5 A;  1KFM A;  4LLH A;  3KYQ A;  3M06 A;  1GW3 A;  1CW5 A;  1JO5 A;  1N7S B;  2Q3I A;  3A2A A;  4O9B A;  4DZO A;  1JOC A;  5BVZ A;  1NO4 A;  1FBM A;  4W80 A;  3V4W A;  4IFF A;  1JY2 O;  2YO3 A;  3V2N A;  1Z56 A;  1HWT C;  4I6M C;  4N78 D;  3VP8 A;  2W6A A;  1RE4 C;  5KJ7 C;  1SQX K;  1XTC C;  4ZKP A;  1RF0 A;  2HPC B;  1URQ D;  1LTG C;  3M91 A;  4B86 A;  1GL2 D;  4XA4 A;  2NPS B;  1CI6 B;  1L0L K;  2N1T A;  2ZXE B;  5AVR B;  3R2P A;  1NAF A;  2A45 H;  5AW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...