1SQBJ

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqbJ00
1KYOI 4U3FJ 1L0NJ 1SQPJ 3CX5I 1PP9J 1NTKJ 3L72J 3CXHI 1EZVI 1SQXJ 3L73J 1NTMJ 1SQQJ 3TGUJ 1BGYJ 2IBZI 3CWBJ 3H1HJ 3H1JJ 1L0LJ 2BCCJ 1BCCJ 1KB9I 2FYUJ 3H1LJ 3L71J 3BCCJ 3H1IJ 1NU1J 3H1KJ 1NTZJ 4PD4I 4D6TJ 3L74J 1P84I 5KLVJ 1SQBJ 3L75J 3L70J 1SQVJ 1BE3J
chains in the Genus database with same CATH superfamily
1USDA 2VRSA 2A45H 1IFJA 1KILE 1P84D 1AFOA 3TGUD 1JMMA 2N1TD 4XE5B 3PTZA 3RK2B 4H13B 1HWTC 2JKVA 3E1RA 2QM8A 2A06G 4PD4H 4ZMDA 1YIJP 3L70D 3H1HD 3LW5H 2D2CC 2IX7C 3CX5E 2QIWA 4N78E 1W2EA 1FZEA 3L75G 3LIEA 2JP3A 2OQQA 1S3JA 5CCGA 1IZNB 3AE5C 1OIPA 2ZXXA 4I2LC 1SQVK 3GW6A 3KXDA 3MTUE 3P8CE 2E76B 1S72P 2V7QH 5L8RJ 2JEEA 1EDJA 2D2CB 5AVRB 1SQPE 1YTZI 3FWNA 1FZCA 4JYCA 1RE3C 4YPCA 5AW6B 1NTZG 5TISH 3L74G 2P1JA 1N8RQ 3BCCE 1OVUA 1RE4A 2NPSC 5APUA 1A02F 1J1DB 3CCMP 4LC1A 3TGUG 2MKVA 2AEFA 1QL2A 3MHVA 5DJTB 4YXDC 3W67A 5AW3B 2Z5HA 1SFCA 3B71A 3V5BA 1JTHA 3OAKA 4I6MC 1FZFA 4PV1D 5GTHE 3L70G 3VMZA 1PZQA 2OGUA 1WT6A 1KQLA 2ZYDA 2YO2A 2ZYGA 4RKUJ 3AEBC 1JY3N 3H6PA 1IFPA 1GL2D 1X9VA 2ZVNB 1VQMP 2C0WA 1NU1K 5CCHA 2NPSB 2O3JA 1S9KE 2LXCB 3R4YA 3B5NA 3E7KA 3Q5PA 1T8ZA 1JY2P 1EZVD 3FX0A 2QJPC 3SWFA 2W90A 3Q2YA 2IYPA 1FS0E 1BGYE 1GK6A 1NYHA 1LTAC 4WB4A 1NTMD 2WITA 4C46A 5CBOA 1LTIC 1AA0A 1SP4A 5AVSB 1IFDA 2KIKA 2H89C 3WU2H 1P84E 5APWA 4PJ0H 2AEJA 2QJPB 1OWAA 1SQQJ 4W80A 1L0LE 1KB9I 1GU5A 1ZLLA 2HLOA 1RH5B 2C0XA 3EWKA 5AW1B 3H1HE 1URQC 2YNYA 2LR2A 1S5LH 3EFFK 3PRJA 2KYVA 3NMDA 1L4AD 1K8AQ 1ZRTD 3CCQP 3KYQA 1DD4A 1DIPA 5CMZA 4JBZA 2KI7B 1KYOH 4JYBA 2IPPA 1EZVG 3OA7A 3L72D 2E74D 5KJ7A 4H13D 3N7NA 4IFMA 1L0NK 1KTMA 1PIXA 2K9JB 3CXHD 2Q6QA 1URQB 3WUVA 1OX3A 1T3JA 1Z56A 4U3FE 4LLHA 4OVNF 1SQVD 2SPZA 2C9LY 2O01J 2H8PD 1NKNA 2BCCD 1OW6A 3KPEA 4OGQC 3CC2P 3PH0A 3MIWA 2POHA 1M1JC 3RL0C 2E75C 3P32A 3CMAP 1PPJE 4I7ZB 2QM7A 5CJ0A 1SQPJ 1LT9C 2QEXP 2MJZA 1S5LX 3RK3C 3H1JJ 3TDKA 2D2CD 1BCCD 4YTPC 3BCCJ 3IAOA 2FYUK 3CWBG 1XTGB 3CX5H 3T97B 3A0BE 5APQA 2W83C 3RL0B 2QJYB 2E75B 1N73B 2OYHC 1YHQP 2Z5IA 2WVRA 3M9BA 1NU1D 2OTLP 1EDLA 3VMAA 1SQXG 5CBNA 1RF0C 1HH0A 2A45I 3TK1A 3SFEC 4CPGA 1NTME 1NTZK 5GTIE 3KDPB 1Q81Q 2K1AA 1SQVG 2K9YA 1BGYJ 2NPSD 1LNQA 1Q90D 2BCCG 1NH4A 3MUDC 3H1IG 3L73D 1G1JA 1U7MA 3AE6C 2PRRA 1ZW0A 3L71D 2M0BA 3L74J 4XFJA 4D6TD 4R4LA 3GF7A 2R3SA 3BATA 1BE3D 1BCCG 3CC4P 2WT7B 2QJKB 5AVUB 3TYYA 5GTHH 1OFCX 1N7SB 2K3RA 5APSA 2WSEJ 1JY3O 4ZKPA 3H1KD 3L70J 3H1HJ 1KORA 1AQTA 5AW0B 3L72E 4U7JA 3CLQA 3W68A 3A0HE 1NU1G 1W5CE 3BASA 3N4XA 2JJLA 3M9QA 3CCJP 2IFMA 3OW2O 2ZAEB 1U7JA 2HPCB 1L0ND 1LTSC 1SQBK 2FY8A 1J2JB 5EFWB 4HH2A 3PJSK 2IBZE 2QA4P 1YI2P 3M9HA 4ASWA 4DCKA 3IN6A 4N3YB 5KKZB 3RGUA 4U3FJ 3VMYA 4WY4A 3L35A 2M3BA 3S4RA 1KQFB 5KLVK 1N73A 1URQD 4D6TG 5AVQB 1VQNP 1LWUB 1SFCC 1BE3G 2N1TA 3EQ2A 2G3AA 1R5SA 3L75D 3O6QA 2YKPA 3WUUA 1G2CA 2M5AB 1YYCA 3H1KG 4NPEA 2FYUD 3M0DA 1ZP0C 2GUVA 1KB9D 4JPZB 2IZ0A 2W6JH 1GD2E 4OH8B 2RKLA 5AVWB 2YMKA 3Q5SA 1SQQE 2IBZI 5AVZB 3TF5A 4L73A 4EI2A 2W6AA 3MZWB 3V6IA 1NTZD 3MD0A 2Q1KA 1ZXGA 3HTKB 3RL0D 1AVYA 2E75D 3G9RA 3L73E 1NTMJ 1Y47A 2WSCH 3E1IA 1N7SA 1X8YA 2FYNC 2IYOA 3L71E 2E74B 3RK3D 1H0TB 1DEBA 4DT0A 1LTJA 1X22A 1KYOI 3CL3D 1J1EC 1BSNA 2KS1B 3FWLA 3TSIA 3L36A 3S1KA 4ZKUA 2GA1A 3UIAA 1BDDA 2PFXA 2QSIA 1SQXK 3HE4A 1BSHA 1NOHA 3U1AA 2FYNB 3A0BH 2HPCA 2KNCB 3I5CA 1T6AA 3VN0A 2FYUG 1GL2A 4EIJA 5AW9B 2Q5UA 1FOSE 3C1LA 3HUSC 3GHGC 1YJ9P 1QL1A 1VQ6P 1IFMA 1OW8A 1L0NE 3AEDC 1EXJA 1EQ7A 1IK9A 5E79E 3L72J 3CPWO 3AE9C 2PGDA 4H0LC 1N7SD 3H1JE 2Q9IA 3AE8C 3D70A 1LWUA 4UB6E 1QVGO 1IFNA 1NGMB 2LXBA 3PP5A 1SQBD 1SQVJ 1YJNP 3CX5I 2L5GB 3L37A 2A06E 2AXTE 3BVHA 4HJGH 2B9BA 2WSSH 2BCCJ 4BWNA 3QH9A 3H32B 3U59A 1AJYA 1M7LA 4H0LB 3L75E 1SS1A 1KILC 3QWOC 1HTLC 1PP9D 2FFDA 3I55P 4PD4D 1Q82Q 1GU4A 2KUBA 1JY2O 4H44C 1CZQA 1BCCJ 4TT3H 1L4AA 3HD7C 3CI9A 3CCUP 1USEA 1GW4A 4GOFA 2R5DA 3A0HH 5KLIC 2IZ1A 3V2NA 4GIFA 1FDMA 1W2BO 1VQ5P 1KILB 2K88A 1M90Q 1FJKA 1NU1J 3CCEP 1NTZE 5CHXA 4WBAA 3L74E 5M1BA 4RESB 2IFNA 2KS1A 2O01N 3TGUE 1KN7A 2ITAA 2WMMA 5H2FE 3HD7B 2B89A 1SQBG 4L76A 3D6ZA 2FXMA 3L70E 2KNCA 2HYNA 2A45G 3A3YB 4KJMA 3L73J 2R5BA 3CWBD 2JWDA 5KLVG 1ZV8A 3L71J 4W7ZA 2ZVOB 1PP9G 4D6TJ 1VQ4P 1BE3J 1T3UA 1KFNA 1IO4A 2C9NY 1SQXD 1FE6A 3GMAA 5AVYB 5DJUB 1RF1C 3M06A 2FYZA 4IFFA 3V2RA 3H1KJ 2QRXA 1NTKG 1P84I 3SWKA 4JF7A 1VQPP 3VP9A 1ZMEC 1HBWA 1SQPK 3B4SA 4WWIA 1SVFA 1RE3A 3H1ID 3AEFC 1FU1A 1NVOA 3JSVC 3JCUE 1L0NJ 3OJAB 2NPSA 3CC7P 1Q7YQ 2GUSA 2WPVB 5KAIE 4L75A 2FBWC 2E42A 3MGNA 3FXEA 2CPSA 4KHXA 2JO1A 2WPSA 2HG5D 4L74A 4PD4E 4EDFA 2WPQA 4OGQB 2JR8A 1PGPA 5AW8B 1M1JB 1EZVE 2HR3A 3H25A 3H1LD 1LT9B 3RL0g 5APXA 2R32A 3L75J 1HJ0A 3RK3B 2L91A 2O01H 2KOGA 3Q3DA 4I1LA 2ZT9C 1VQ9P 1KYOD 3NXSA 1KZUB 2OYIC 3A2AA 2FYUJ 4H0LD 4LGDE 2WQYC 3V4WA 2ZYAA 5B5EE 5E79H 1CI6B 2P67A 3AE2C 2H88C 4W7YA 2OYHB 3FGAD 5APVA 1CW5A 5APTA 3KZIE 4UB6H 2Y0DA 1VF5C 1H8AA 1FC2C 1FDIA 2J59M 3WMM0 1NTZJ 4AQRD 1NKZB 2ZT9B 1L0LK 2AXTH 1K05A 2OYOA 1YBKA 1LP1B 1GW3A 1BDCA 2LKMA 2B87B 3TGUJ 2IBZG 1KILD 3CWBE 1LTJC 1ZRTE 1UIXA 2K9JA 1PGJA 1YQ3C 1M1KQ 1URQA 1JY2N 1MZ9A 2B88A 5AVXB 5CJ4A 1DD3A 1VF5B 3HD7D 4PV1C 3H1LG 3USSA 2O1JA 3CXHE 3V2PA 5CCGC 4UB8E 1HJBA 4Z1MH 5TJHA 1JY3P 2FKWB 1SQVE 2FXPA 1T2KC 2YMYA 3ZDMA 4K3AA 1EC5A 4KT0J 1ZR4A 2BCCE 3ITKA 1FZCC 1Q86Q 3H1IE 3L4FA 1RQUA 3BRVB 1HGVA 1SQQG 1P84H 2RH0A 2GM4A 2YO3A 1MUUA 5K5GB 1SQPD 2BEQD 2J58A 5H2FH 1RE4C 3T97A 2KXPB 1M1JA 2HFED 1KMIZ 2I8DA 1M56D 2WSEH 2J5UA 1BCCE 2KZIA 4Y99C 1NAYA 1X79B 3I56P 1N2DC 3G6EP 5AW2B 1KC8Q 1DH3A 1FZCB 3CXHI 4JQ0D 3C8VA 1GTWA 1NTKK 5AVVB 2P58A 5CCHC 1NU1E 1RHZB 2KSJA 1CI6A 3IFMA 3B5NC 2Y9YA 2OYHA 3VP8A 1SFCB 3F5HA 5BVZA 3LW5J 1RF0A 1EDIA 1FZGA 1OVRA 5B66E 3RK2C 4H13C 4OWFA 4OGQD 1HVVA 1LP1A 4IL6E 2I1KA 2B87A 2WT7A 1QVFO 3HE5B 3CCSP 1FOSF 3TNUB 1SQPG 3JCUH 4D6TE 1RY3A 3MUDA 3CD6P 3PLNA 2OTJP 1BE3E 2K37A 3H1JG 2O1KA 5KAIH 1OW7A 3BCCG 4GODA 5C39A 2KZJA 4QMAA 1L0LD 1IJDB 2Y9ZA 3H1KE 2AEMA 2E76C 1XTCC 1LT1A 2WSFJ 1DEEG 1JCCA 3CWBJ 1FZBA 2ZXEB 3RBZA 2W27A 3Q5RA 3IF4A 2ZT9D 1J1EB 5KJ7C 2H7HA 1S4XA 1KV4A 1JEKA 3P7KA 1WMKA 3CMEP 3MP7B 1VQ7P 1J1DC 5GTIH 3NFQA 1SQXJ 1PL5A 3SWYA 1OMIA 2Q3IA 1H89A 3O8ZA 5B5EH 1BGYG 1QLED 3AEEC 4BRYB 2QVAA 1VF5D 1GZLA 2PAJA 4U3FD 3KZIH 1YITP 3HRNA 3VYIA 2W8ZA 1LTTC 3HUSB 3GHGB 1NWQA 2M5AA 1KD1Q 1MKMA 2OARA 3K5BA 4MN4C 1M57D 3H1IJ 4HYTB 2WSFH 2Q7CA 1PPJD 5KLVD 1OXZA 2Q3EA 1L0LG 1LTBC 3D71A 2XZRA 3B8EB 4RJTA 2QG4A 2FYUE 2BEZF 5KAFE 3H1HG 3Q1MA 2R44A 2YKQA 1KB9E 5CCGD 1DX7A 3HTKA 1NTKD 3CXHH 1R5LA 1KQGB 3CCLP 3HE5A 2DW3A 4UB8H 5BU5A 1T2KD 1N86A 3H1LJ 3TNUA 4AUWA 1H0TA 2KK7A 1SQQK 1NJIQ 4DJGA 4GDOA 4H44B 2YIUC 4Y28J 1KFMA 4DZOA 2Y0EA 1FDOA 1IFIA 3M91A 1OZHA 3RK3E 4U3FG 2NZ2A 5KLIB 1JUNA 4B86A 1SFCD 2KB7P 3LIDA 4C7NB 2YIUB 1PPJG 2WTYA 3WUTA 2M8RA 1PV3A 4K35A 2XU6A 2XNDH 5CCHD 1HF9A 3B5ND 3D6YA 1IC2A 1AQ5A 3AE1C 4XA4A 2P10A 2XNXA 1AV1A 4BRYA 3FXDA 2AXCA 4O9BA 1VL2A 1S2EA 4R4MA 3VMXA 1PGOA 3HUSA 3GHGA 3RK2D 1QX8A 4I7ZC 3BRTB 4GT1A 4ASVA 5B66H 1X0TA 3A5TA 3H32A 2RN0A 1GDTA 4IL6H 2WWWA 3F89A 1PGQA 1SQBE 1GK4A 1NTMG 2JWAA 1ZR2A 3AE7C 1AVOA 1E79H 4ZNCA 4IFDK 1RF1B 2M3EA 3RBXA 1R8EA 1E5WA 2YXRB 2KLUA 2XKMA 4WY4C 5KTBA 5AW4B 1G1IA 2WPRA 2IBZD 1ZN5A 2QJYC 1N73C 5KLVE 4HKZH 2HODB 1HUCA 1M8OB 1PP9E 3R2PA 2N1TC 2XV5A 2E76D 1JOCA 1EXIA 2CK3H 2KSEA 2I1JA 1KILA 1VQOP 5AW7B 4WVZA 3AECC 2KLVA 1YTZT 1IK7A 4IOIH 4DOJA 5KJ7D 1NTKE 4WY4B 2E5YA 4BXLA 3M0DC 3VTPC 1UIIA 1S1CX 3M0AA 3HD7A 3JC22 1NAFA 1HGZA 1YJWP 2N1TB 2XDJA 3L72G 1CSBA 4IL6X 3A7OA 1VQ8P 2N9BA 3O6QB 1K04A 5AVTB 2KP8A 4C7NA 1G2CB 1Y8AA 4YXWH 4AYCA 1SQQD 1JO5A 2RMZA 4A7PA 2QJKC 5TISE 1A02J 1SLQA 4PD4I 5AW5B 2ZJSE 1N7SC 2H43A 1U57A 2OYIB 1MFTA 2YXQB 1EZVI 2ZFCA 3GLMA 2P2UA 1FBMA 2PP6A 2Z4EA 2N9YB 4H44D 1ZOYC 3AE3C 3C9IA 1L2PA 3VOPA 3AE4C 2Y0CA 1JCDA 1LGHB 2UWJE 1SQXE 2E43A 1YQ4C 1JMBA 5KAFH 1L0LJ 3CX5D 4N78D 1KQSO 1KB9H 1H88A 3P8MC 1GMJA 3G3ZA 1GL2C 1PFIA 3PHLA 1FAVA 1VPCA 1JB0J 1LTJB 1EDKA 1VDFA 1RF1A 4EYYQ 1Q2NA 3KQGA 5KKZC 3G4SP 2R3CA 3II6A 2JDIH 1Y9BA 4HB1A 3V2QA 2OTKE 3P8CD 3AEGC 5BU8B 4NPDA 2CPBA 3HE4B 4PV1B 2HODA 1QGKB 1LWUC 1LTGC 1K73Q 1NO4A 2YKOA 1GL2B 4EOTA 3WU2E 1WRGA 4PJ0E 4GOEA 2FXOA 3H1JD 2BASA 4GKGA 1LT9A 1MV8A 3BCCD 4C7RA 4M3LA 3G71P 1SQBJ 3L73G 4NPFX 1TU3F 4TLFA 3L71G 2A06D 3AEAC 3GG2A 2V4HA 1QEXA 1S5LE 3IR9A 1LJ2A 3H1LE 2WSCJ 1FJPA 3NTNA 1D7MA 3CCVP 2FFDC 2NRGA 2W6BA 1JM0A 4RO0A 5KLVJ 1JNMA 3S9OA 1OVVA 1PP9J 1L4AC 1NHLA 1K9MQ 3CCRP 1VQKP 1KYOE 3SFDC 3U1CA 4Y99B 2G8YA 1JTHB 1S9KD 2P7JA 2IDBA 5APYA 3SSUA 4N6JA 3V4QA 3GF3A 1NTMK 2E5TA 1N7LA 3ABVC 2E74C 2OYIA 2QE7H 2WZ7A 1BGYD 1VQLP 1NTKJ 2FFDB 3EFGA 1MFZA 1RQVA 3B5NB 1FZAA 3KHUA 1L4AB 1L0NG 2V7QJ 4WY4D 3L74D
chains in the Genus database with same CATH topology
1KYOI 4U3FJ 1L0NJ 1SQPJ 3CX5I 1PP9J 1NTKJ 3L72J 3CXHI 1EZVI 1SQXJ 3L73J 1NTMJ 1SQQJ 3TGUJ 1BGYJ 2IBZI 3CWBJ 3H1HJ 3H1JJ 1L0LJ 2BCCJ 1BCCJ 1KB9I 2FYUJ 3H1LJ 3L71J 3BCCJ 3H1IJ 1NU1J 3H1KJ 1NTZJ 4PD4I 4D6TJ 3L74J 1P84I 5KLVJ 1SQBJ 3L75J 3L70J 1SQVJ 1BE3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  4U3F J;  1L0N J;  1SQP J;  3CX5 I;  1PP9 J;  1NTK J;  3L72 J;  3CXH I;  1EZV I;  1SQX J;  3L73 J;  1NTM J;  1SQQ J;  3TGU J;  1BGY J;  2IBZ I;  3CWB J;  3H1H J;  3H1J J;  1L0L J;  2BCC J;  1BCC J;  1KB9 I;  2FYU J;  3H1L J;  3L71 J;  3BCC J;  3H1I J;  1NU1 J;  3H1K J;  1NTZ J;  4PD4 I;  4D6T J;  3L74 J;  1P84 I;  5KLV J;  1SQB J;  3L75 J;  3L70 J;  1SQV J;  1BE3 J; 
#chains in the Genus database with same CATH topology
 1USD A;  2VRS A;  2A45 H;  1IFJ A;  1KIL E;  1P84 D;  1AFO A;  3TGU D;  1JMM A;  2N1T D;  4XE5 B;  3PTZ A;  3RK2 B;  4H13 B;  1HWT C;  2JKV A;  3E1R A;  2QM8 A;  2A06 G;  4PD4 H;  4ZMD A;  1YIJ P;  3L70 D;  3H1H D;  3LW5 H;  2D2C C;  2IX7 C;  3CX5 E;  2QIW A;  4N78 E;  1W2E A;  1FZE A;  3L75 G;  3LIE A;  2JP3 A;  2OQQ A;  1S3J A;  5CCG A;  1IZN B;  3AE5 C;  1OIP A;  2ZXX A;  4I2L C;  1SQV K;  3GW6 A;  3KXD A;  3MTU E;  3P8C E;  2E76 B;  1S72 P;  2V7Q H;  5L8R J;  2JEE A;  1EDJ A;  2D2C B;  5AVR B;  1SQP E;  1YTZ I;  3FWN A;  1FZC A;  4JYC A;  1RE3 C;  4YPC A;  5AW6 B;  1NTZ G;  5TIS H;  3L74 G;  2P1J A;  1N8R Q;  3BCC E;  1OVU A;  1RE4 A;  2NPS C;  5APU A;  1A02 F;  1J1D B;  3CCM P;  4LC1 A;  3TGU G;  2MKV A;  2AEF A;  1QL2 A;  3MHV A;  5DJT B;  4YXD C;  3W67 A;  5AW3 B;  2Z5H A;  1SFC A;  3B71 A;  3V5B A;  1JTH A;  3OAK A;  4I6M C;  1FZF A;  4PV1 D;  5GTH E;  3L70 G;  3VMZ A;  1PZQ A;  2OGU A;  1WT6 A;  1KQL A;  2ZYD A;  2YO2 A;  2ZYG A;  4RKU J;  3AEB C;  1JY3 N;  3H6P A;  1IFP A;  1GL2 D;  1X9V A;  2ZVN B;  1VQM P;  2C0W A;  1NU1 K;  5CCH A;  2NPS B;  2O3J A;  1S9K E;  2LXC B;  3R4Y A;  3B5N A;  3E7K A;  3Q5P A;  1T8Z A;  1JY2 P;  1EZV D;  3FX0 A;  2QJP C;  3SWF A;  2W90 A;  3Q2Y A;  2IYP A;  1FS0 E;  1BGY E;  1GK6 A;  1NYH A;  1LTA C;  4WB4 A;  1NTM D;  2WIT A;  4C46 A;  5CBO A;  1LTI C;  1AA0 A;  1SP4 A;  5AVS B;  1IFD A;  2KIK A;  2H89 C;  3WU2 H;  1P84 E;  5APW A;  4PJ0 H;  2AEJ A;  2QJP B;  1OWA A;  1SQQ J;  4W80 A;  1L0L E;  1KB9 I;  1GU5 A;  1ZLL A;  2HLO A;  1RH5 B;  2C0X A;  3EWK A;  5AW1 B;  3H1H E;  1URQ C;  2YNY A;  2LR2 A;  1S5L H;  3EFF K;  3PRJ A;  2KYV A;  3NMD A;  1L4A D;  1K8A Q;  1ZRT D;  3CCQ P;  3KYQ A;  1DD4 A;  1DIP A;  5CMZ A;  4JBZ A;  2KI7 B;  1KYO H;  4JYB A;  2IPP A;  1EZV G;  3OA7 A;  3L72 D;  2E74 D;  5KJ7 A;  4H13 D;  3N7N A;  4IFM A;  1L0N K;  1KTM A;  1PIX A;  2K9J B;  3CXH D;  2Q6Q A;  1URQ B;  3WUV A;  1OX3 A;  1T3J A;  1Z56 A;  4U3F E;  4LLH A;  4OVN F;  1SQV D;  2SPZ A;  2C9L Y;  2O01 J;  2H8P D;  1NKN A;  2BCC D;  1OW6 A;  3KPE A;  4OGQ C;  3CC2 P;  3PH0 A;  3MIW A;  2POH A;  1M1J C;  3RL0 C;  2E75 C;  3P32 A;  3CMA P;  1PPJ E;  4I7Z B;  2QM7 A;  5CJ0 A;  1SQP J;  1LT9 C;  2QEX P;  2MJZ A;  1S5L X;  3RK3 C;  3H1J J;  3TDK A;  2D2C D;  1BCC D;  4YTP C;  3BCC J;  3IAO A;  2FYU K;  3CWB G;  1XTG B;  3CX5 H;  3T97 B;  3A0B E;  5APQ A;  2W83 C;  3RL0 B;  2QJY B;  2E75 B;  1N73 B;  2OYH C;  1YHQ P;  2Z5I A;  2WVR A;  3M9B A;  1NU1 D;  2OTL P;  1EDL A;  3VMA A;  1SQX G;  5CBN A;  1RF0 C;  1HH0 A;  2A45 I;  3TK1 A;  3SFE C;  4CPG A;  1NTM E;  1NTZ K;  5GTI E;  3KDP B;  1Q81 Q;  2K1A A;  1SQV G;  2K9Y A;  1BGY J;  2NPS D;  1LNQ A;  1Q90 D;  2BCC G;  1NH4 A;  3MUD C;  3H1I G;  3L73 D;  1G1J A;  1U7M A;  3AE6 C;  2PRR A;  1ZW0 A;  3L71 D;  2M0B A;  3L74 J;  4XFJ A;  4D6T D;  4R4L A;  3GF7 A;  2R3S A;  3BAT A;  1BE3 D;  1BCC G;  3CC4 P;  2WT7 B;  2QJK B;  5AVU B;  3TYY A;  5GTH H;  1OFC X;  1N7S B;  2K3R A;  5APS A;  2WSE J;  1JY3 O;  4ZKP A;  3H1K D;  3L70 J;  3H1H J;  1KOR A;  1AQT A;  5AW0 B;  3L72 E;  4U7J A;  3CLQ A;  3W68 A;  3A0H E;  1NU1 G;  1W5C E;  3BAS A;  3N4X A;  2JJL A;  3M9Q A;  3CCJ P;  2IFM A;  3OW2 O;  2ZAE B;  1U7J A;  2HPC B;  1L0N D;  1LTS C;  1SQB K;  2FY8 A;  1J2J B;  5EFW B;  4HH2 A;  3PJS K;  2IBZ E;  2QA4 P;  1YI2 P;  3M9H A;  4ASW A;  4DCK A;  3IN6 A;  4N3Y B;  5KKZ B;  3RGU A;  4U3F J;  3VMY A;  4WY4 A;  3L35 A;  2M3B A;  3S4R A;  1KQF B;  5KLV K;  1N73 A;  1URQ D;  4D6T G;  5AVQ B;  1VQN P;  1LWU B;  1SFC C;  1BE3 G;  2N1T A;  3EQ2 A;  2G3A A;  1R5S A;  3L75 D;  3O6Q A;  2YKP A;  3WUU A;  1G2C A;  2M5A B;  1YYC A;  3H1K G;  4NPE A;  2FYU D;  3M0D A;  1ZP0 C;  2GUV A;  1KB9 D;  4JPZ B;  2IZ0 A;  2W6J H;  1GD2 E;  4OH8 B;  2RKL A;  5AVW B;  2YMK A;  3Q5S A;  1SQQ E;  2IBZ I;  5AVZ B;  3TF5 A;  4L73 A;  4EI2 A;  2W6A A;  3MZW B;  3V6I A;  1NTZ D;  3MD0 A;  2Q1K A;  1ZXG A;  3HTK B;  3RL0 D;  1AVY A;  2E75 D;  3G9R A;  3L73 E;  1NTM J;  1Y47 A;  2WSC H;  3E1I A;  1N7S A;  1X8Y A;  2FYN C;  2IYO A;  3L71 E;  2E74 B;  3RK3 D;  1H0T B;  1DEB A;  4DT0 A;  1LTJ A;  1X22 A;  1KYO I;  3CL3 D;  1J1E C;  1BSN A;  2KS1 B;  3FWL A;  3TSI A;  3L36 A;  3S1K A;  4ZKU A;  2GA1 A;  3UIA A;  1BDD A;  2PFX A;  2QSI A;  1SQX K;  3HE4 A;  1BSH A;  1NOH A;  3U1A A;  2FYN B;  3A0B H;  2HPC A;  2KNC B;  3I5C A;  1T6A A;  3VN0 A;  2FYU G;  1GL2 A;  4EIJ A;  5AW9 B;  2Q5U A;  1FOS E;  3C1L A;  3HUS C;  3GHG C;  1YJ9 P;  1QL1 A;  1VQ6 P;  1IFM A;  1OW8 A;  1L0N E;  3AED C;  1EXJ A;  1EQ7 A;  1IK9 A;  5E79 E;  3L72 J;  3CPW O;  3AE9 C;  2PGD A;  4H0L C;  1N7S D;  3H1J E;  2Q9I A;  3AE8 C;  3D70 A;  1LWU A;  4UB6 E;  1QVG O;  1IFN A;  1NGM B;  2LXB A;  3PP5 A;  1SQB D;  1SQV J;  1YJN P;  3CX5 I;  2L5G B;  3L37 A;  2A06 E;  2AXT E;  3BVH A;  4HJG H;  2B9B A;  2WSS H;  2BCC J;  4BWN A;  3QH9 A;  3H32 B;  3U59 A;  1AJY A;  1M7L A;  4H0L B;  3L75 E;  1SS1 A;  1KIL C;  3QWO C;  1HTL C;  1PP9 D;  2FFD A;  3I55 P;  4PD4 D;  1Q82 Q;  1GU4 A;  2KUB A;  1JY2 O;  4H44 C;  1CZQ A;  1BCC J;  4TT3 H;  1L4A A;  3HD7 C;  3CI9 A;  3CCU P;  1USE A;  1GW4 A;  4GOF A;  2R5D A;  3A0H H;  5KLI C;  2IZ1 A;  3V2N A;  4GIF A;  1FDM A;  1W2B O;  1VQ5 P;  1KIL B;  2K88 A;  1M90 Q;  1FJK A;  1NU1 J;  3CCE P;  1NTZ E;  5CHX A;  4WBA A;  3L74 E;  5M1B A;  4RES B;  2IFN A;  2KS1 A;  2O01 N;  3TGU E;  1KN7 A;  2ITA A;  2WMM A;  5H2F E;  3HD7 B;  2B89 A;  1SQB G;  4L76 A;  3D6Z A;  2FXM A;  3L70 E;  2KNC A;  2HYN A;  2A45 G;  3A3Y B;  4KJM A;  3L73 J;  2R5B A;  3CWB D;  2JWD A;  5KLV G;  1ZV8 A;  3L71 J;  4W7Z A;  2ZVO B;  1PP9 G;  4D6T J;  1VQ4 P;  1BE3 J;  1T3U A;  1KFN A;  1IO4 A;  2C9N Y;  1SQX D;  1FE6 A;  3GMA A;  5AVY B;  5DJU B;  1RF1 C;  3M06 A;  2FYZ A;  4IFF A;  3V2R A;  3H1K J;  2QRX A;  1NTK G;  1P84 I;  3SWK A;  4JF7 A;  1VQP P;  3VP9 A;  1ZME C;  1HBW A;  1SQP K;  3B4S A;  4WWI A;  1SVF A;  1RE3 A;  3H1I D;  3AEF C;  1FU1 A;  1NVO A;  3JSV C;  3JCU E;  1L0N J;  3OJA B;  2NPS A;  3CC7 P;  1Q7Y Q;  2GUS A;  2WPV B;  5KAI E;  4L75 A;  2FBW C;  2E42 A;  3MGN A;  3FXE A;  2CPS A;  4KHX A;  2JO1 A;  2WPS A;  2HG5 D;  4L74 A;  4PD4 E;  4EDF A;  2WPQ A;  4OGQ B;  2JR8 A;  1PGP A;  5AW8 B;  1M1J B;  1EZV E;  2HR3 A;  3H25 A;  3H1L D;  1LT9 B;  3RL0 g;  5APX A;  2R32 A;  3L75 J;  1HJ0 A;  3RK3 B;  2L91 A;  2O01 H;  2KOG A;  3Q3D A;  4I1L A;  2ZT9 C;  1VQ9 P;  1KYO D;  3NXS A;  1KZU B;  2OYI C;  3A2A A;  2FYU J;  4H0L D;  4LGD E;  2WQY C;  3V4W A;  2ZYA A;  5B5E E;  5E79 H;  1CI6 B;  2P67 A;  3AE2 C;  2H88 C;  4W7Y A;  2OYH B;  3FGA D;  5APV A;  1CW5 A;  5APT A;  3KZI E;  4UB6 H;  2Y0D A;  1VF5 C;  1H8A A;  1FC2 C;  1FDI A;  2J59 M;  3WMM 0;  1NTZ J;  4AQR D;  1NKZ B;  2ZT9 B;  1L0L K;  2AXT H;  1K05 A;  2OYO A;  1YBK A;  1LP1 B;  1GW3 A;  1BDC A;  2LKM A;  2B87 B;  3TGU J;  2IBZ G;  1KIL D;  3CWB E;  1LTJ C;  1ZRT E;  1UIX A;  2K9J A;  1PGJ A;  1YQ3 C;  1M1K Q;  1URQ A;  1JY2 N;  1MZ9 A;  2B88 A;  5AVX B;  5CJ4 A;  1DD3 A;  1VF5 B;  3HD7 D;  4PV1 C;  3H1L G;  3USS A;  2O1J A;  3CXH E;  3V2P A;  5CCG C;  4UB8 E;  1HJB A;  4Z1M H;  5TJH A;  1JY3 P;  2FKW B;  1SQV E;  2FXP A;  1T2K C;  2YMY A;  3ZDM A;  4K3A A;  1EC5 A;  4KT0 J;  1ZR4 A;  2BCC E;  3ITK A;  1FZC C;  1Q86 Q;  3H1I E;  3L4F A;  1RQU A;  3BRV B;  1HGV A;  1SQQ G;  1P84 H;  2RH0 A;  2GM4 A;  2YO3 A;  1MUU A;  5K5G B;  1SQP D;  2BEQ D;  2J58 A;  5H2F H;  1RE4 C;  3T97 A;  2KXP B;  1M1J A;  2HFE D;  1KMI Z;  2I8D A;  1M56 D;  2WSE H;  2J5U A;  1BCC E;  2KZI A;  4Y99 C;  1NAY A;  1X79 B;  3I56 P;  1N2D C;  3G6E P;  5AW2 B;  1KC8 Q;  1DH3 A;  1FZC B;  3CXH I;  4JQ0 D;  3C8V A;  1GTW A;  1NTK K;  5AVV B;  2P58 A;  5CCH C;  1NU1 E;  1RHZ B;  2KSJ A;  1CI6 A;  3IFM A;  3B5N C;  2Y9Y A;  2OYH A;  3VP8 A;  1SFC B;  3F5H A;  5BVZ A;  3LW5 J;  1RF0 A;  1EDI A;  1FZG A;  1OVR A;  5B66 E;  3RK2 C;  4H13 C;  4OWF A;  4OGQ D;  1HVV A;  1LP1 A;  4IL6 E;  2I1K A;  2B87 A;  2WT7 A;  1QVF O;  3HE5 B;  3CCS P;  1FOS F;  3TNU B;  1SQP G;  3JCU H;  4D6T E;  1RY3 A;  3MUD A;  3CD6 P;  3PLN A;  2OTJ P;  1BE3 E;  2K37 A;  3H1J G;  2O1K A;  5KAI H;  1OW7 A;  3BCC G;  4GOD A;  5C39 A;  2KZJ A;  4QMA A;  1L0L D;  1IJD B;  2Y9Z A;  3H1K E;  2AEM A;  2E76 C;  1XTC C;  1LT1 A;  2WSF J;  1DEE G;  1JCC A;  3CWB J;  1FZB A;  2ZXE B;  3RBZ A;  2W27 A;  3Q5R A;  3IF4 A;  2ZT9 D;  1J1E B;  5KJ7 C;  2H7H A;  1S4X A;  1KV4 A;  1JEK A;  3P7K A;  1WMK A;  3CME P;  3MP7 B;  1VQ7 P;  1J1D C;  5GTI H;  3NFQ A;  1SQX J;  1PL5 A;  3SWY A;  1OMI A;  2Q3I A;  1H89 A;  3O8Z A;  5B5E H;  1BGY G;  1QLE D;  3AEE C;  4BRY B;  2QVA A;  1VF5 D;  1GZL A;  2PAJ A;  4U3F D;  3KZI H;  1YIT P;  3HRN A;  3VYI A;  2W8Z A;  1LTT C;  3HUS B;  3GHG B;  1NWQ A;  2M5A A;  1KD1 Q;  1MKM A;  2OAR A;  3K5B A;  4MN4 C;  1M57 D;  3H1I J;  4HYT B;  2WSF H;  2Q7C A;  1PPJ D;  5KLV D;  1OXZ A;  2Q3E A;  1L0L G;  1LTB C;  3D71 A;  2XZR A;  3B8E B;  4RJT A;  2QG4 A;  2FYU E;  2BEZ F;  5KAF E;  3H1H G;  3Q1M A;  2R44 A;  2YKQ A;  1KB9 E;  5CCG D;  1DX7 A;  3HTK A;  1NTK D;  3CXH H;  1R5L A;  1KQG B;  3CCL P;  3HE5 A;  2DW3 A;  4UB8 H;  5BU5 A;  1T2K D;  1N86 A;  3H1L J;  3TNU A;  4AUW A;  1H0T A;  2KK7 A;  1SQQ K;  1NJI Q;  4DJG A;  4GDO A;  4H44 B;  2YIU C;  4Y28 J;  1KFM A;  4DZO A;  2Y0E A;  1FDO A;  1IFI A;  3M91 A;  1OZH A;  3RK3 E;  4U3F G;  2NZ2 A;  5KLI B;  1JUN A;  4B86 A;  1SFC D;  2KB7 P;  3LID A;  4C7N B;  2YIU B;  1PPJ G;  2WTY A;  3WUT A;  2M8R A;  1PV3 A;  4K35 A;  2XU6 A;  2XND H;  5CCH D;  1HF9 A;  3B5N D;  3D6Y A;  1IC2 A;  1AQ5 A;  3AE1 C;  4XA4 A;  2P10 A;  2XNX A;  1AV1 A;  4BRY A;  3FXD A;  2AXC A;  4O9B A;  1VL2 A;  1S2E A;  4R4M A;  3VMX A;  1PGO A;  3HUS A;  3GHG A;  3RK2 D;  1QX8 A;  4I7Z C;  3BRT B;  4GT1 A;  4ASV A;  5B66 H;  1X0T A;  3A5T A;  3H32 A;  2RN0 A;  1GDT A;  4IL6 H;  2WWW A;  3F89 A;  1PGQ A;  1SQB E;  1GK4 A;  1NTM G;  2JWA A;  1ZR2 A;  3AE7 C;  1AVO A;  1E79 H;  4ZNC A;  4IFD K;  1RF1 B;  2M3E A;  3RBX A;  1R8E A;  1E5W A;  2YXR B;  2KLU A;  2XKM A;  4WY4 C;  5KTB A;  5AW4 B;  1G1I A;  2WPR A;  2IBZ D;  1ZN5 A;  2QJY C;  1N73 C;  5KLV E;  4HKZ H;  2HOD B;  1HUC A;  1M8O B;  1PP9 E;  3R2P A;  2N1T C;  2XV5 A;  2E76 D;  1JOC A;  1EXI A;  2CK3 H;  2KSE A;  2I1J A;  1KIL A;  1VQO P;  5AW7 B;  4WVZ A;  3AEC C;  2KLV A;  1YTZ T;  1IK7 A;  4IOI H;  4DOJ A;  5KJ7 D;  1NTK E;  4WY4 B;  2E5Y A;  4BXL A;  3M0D C;  3VTP C;  1UII A;  1S1C X;  3M0A A;  3HD7 A;  3JC2 2;  1NAF A;  1HGZ A;  1YJW P;  2N1T B;  2XDJ A;  3L72 G;  1CSB A;  4IL6 X;  3A7O A;  1VQ8 P;  2N9B A;  3O6Q B;  1K04 A;  5AVT B;  2KP8 A;  4C7N A;  1G2C B;  1Y8A A;  4YXW H;  4AYC A;  1SQQ D;  1JO5 A;  2RMZ A;  4A7P A;  2QJK C;  5TIS E;  1A02 J;  1SLQ A;  4PD4 I;  5AW5 B;  2ZJS E;  1N7S C;  2H43 A;  1U57 A;  2OYI B;  1MFT A;  2YXQ B;  1EZV I;  2ZFC A;  3GLM A;  2P2U A;  1FBM A;  2PP6 A;  2Z4E A;  2N9Y B;  4H44 D;  1ZOY C;  3AE3 C;  3C9I A;  1L2P A;  3VOP A;  3AE4 C;  2Y0C A;  1JCD A;  1LGH B;  2UWJ E;  1SQX E;  2E43 A;  1YQ4 C;  1JMB A;  5KAF H;  1L0L J;  3CX5 D;  4N78 D;  1KQS O;  1KB9 H;  1H88 A;  3P8M C;  1GMJ A;  3G3Z A;  1GL2 C;  1PFI A;  3PHL A;  1FAV A;  1VPC A;  1JB0 J;  1LTJ B;  1EDK A;  1VDF A;  1RF1 A;  4EYY Q;  1Q2N A;  3KQG A;  5KKZ C;  3G4S P;  2R3C A;  3II6 A;  2JDI H;  1Y9B A;  4HB1 A;  3V2Q A;  2OTK E;  3P8C D;  3AEG C;  5BU8 B;  4NPD A;  2CPB A;  3HE4 B;  4PV1 B;  2HOD A;  1QGK B;  1LWU C;  1LTG C;  1K73 Q;  1NO4 A;  2YKO A;  1GL2 B;  4EOT A;  3WU2 E;  1WRG A;  4PJ0 E;  4GOE A;  2FXO A;  3H1J D;  2BAS A;  4GKG A;  1LT9 A;  1MV8 A;  3BCC D;  4C7R A;  4M3L A;  3G71 P;  1SQB J;  3L73 G;  4NPF X;  1TU3 F;  4TLF A;  3L71 G;  2A06 D;  3AEA C;  3GG2 A;  2V4H A;  1QEX A;  1S5L E;  3IR9 A;  1LJ2 A;  3H1L E;  2WSC J;  1FJP A;  3NTN A;  1D7M A;  3CCV P;  2FFD C;  2NRG A;  2W6B A;  1JM0 A;  4RO0 A;  5KLV J;  1JNM A;  3S9O A;  1OVV A;  1PP9 J;  1L4A C;  1NHL A;  1K9M Q;  3CCR P;  1VQK P;  1KYO E;  3SFD C;  3U1C A;  4Y99 B;  2G8Y A;  1JTH B;  1S9K D;  2P7J A;  2IDB A;  5APY A;  3SSU A;  4N6J A;  3V4Q A;  3GF3 A;  1NTM K;  2E5T A;  1N7L A;  3ABV C;  2E74 C;  2OYI A;  2QE7 H;  2WZ7 A;  1BGY D;  1VQL P;  1NTK J;  2FFD B;  3EFG A;  1MFZ A;  1RQV A;  3B5N B;  1FZA A;  3KHU A;  1L4A B;  1L0N G;  2V7Q J;  4WY4 D;  3L74 D; 
#chains in the Genus database with same CATH homology
 1KYO I;  4U3F J;  1L0N J;  1SQP J;  3CX5 I;  1PP9 J;  1NTK J;  3L72 J;  3CXH I;  1EZV I;  1SQX J;  3L73 J;  1NTM J;  1SQQ J;  3TGU J;  1BGY J;  2IBZ I;  3CWB J;  3H1H J;  3H1J J;  1L0L J;  2BCC J;  1BCC J;  1KB9 I;  2FYU J;  3H1L J;  3L71 J;  3BCC J;  3H1I J;  1NU1 J;  3H1K J;  1NTZ J;  4PD4 I;  4D6T J;  3L74 J;  1P84 I;  5KLV J;  1SQB J;  3L75 J;  3L70 J;  1SQV J;  1BE3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...