1SQBJ

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
b'VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqbJ00
1EZVI 3H1HJ 4PD4I 3TGUJ 3CXHI 1SQQJ 4D6TJ 1BE3J 1SQXJ 1NTMJ 1NU1J 1SQPJ 1BGYJ 2FYUJ 3L74J 3L73J 3BCCJ 1L0LJ 1PP9J 3H1IJ 1NTKJ 1BCCJ 3CX5I 3L70J 3H1JJ 4U3FJ 3L72J 3H1KJ 3CWBJ 3H1LJ 3L75J 2BCCJ 1P84I 1SQVJ 1KB9I 1SQBJ 5KLVJ 1NTZJ 2IBZI 3L71J 1KYOI 1L0NJ
chains in the Genus database with same CATH superfamily
4YPCA 3CCUP 4PV1D 4WVZA 1OW8A 3BRVB 3HE5A 1HF9A 1ZP0C 3L74J 4BXLA 3CD6P 5L8RJ 1YBKA 1BSNA 4OGQD 3MIWA 4GT1A 1H89A 1VQ7P 3E7KA 3CPWO 2XNXA 1PIXA 1X8YA 3KXDA 1J1EB 3T97A 2KB7P 1T3UA 1D7MA 3KPEA 3AE2C 1KQFB 4WWIA 1OVVA 2E74B 5GTIH 3Q2YA 4JPZB 1IK9A 2KK7A 1RE4C 2Y9YA 2LKMA 3H1JE 2OTKE 1NYHA 1UIIA 1KILE 1EDKA 3H1JG 3N7NA 5GTHH 1L0NE 1VQ5P 5KJ7A 1FZFA 5E79H 2WT7A 3IF4A 3HTKB 2M5AA 1BE3D 1U7JA 2IZ1A 1GZLA 3HRNA 4JYCA 2LXCB 1KYOH 1EDJA 4YTPC 1Q90D 4LLHA 2NPSB 4YXWH 1LTJB 2ZXEB 3JCUH 5KLVJ 2B87A 2JJLA 4L75A 2WPRA 3HD7B 5AW5B 1FDMA 2N1TC 1URQD 5APXA 2BEZF 3MGNA 1VQOP 2Z5HA 3BVHA 1XTGB 3L71E 3V2RA 2ZYDA 4EYYQ 1AVYA 3LIDA 1S3JA 2JO1A 4C7NB 3IAOA 1SQPD 2Z4EA 5KTBA 1TU3F 3VTPC 4C46A 1GU4A 2AXTE 3H1KD 3L70E 1CW5A 3L70G 4EI2A 3G71P 1LT9C 2W6BA 3H32B 2L5GB 1FZEA 2OYIA 3GHGB 2FYNB 4WY4D 1H0TA 3CX5I 1RF1C 1RE3A 2KP8A 5CJ4A 2E5TA 2ZT9C 1BCCE 2JP3A 1KYOE 3HTKA 1EDIA 2WZ7A 1EQ7A 1M56D 3JCUE 1NTZD 5C39A 3V2QA 2K9YA 1UIXA 1VQ6P 1YTZT 1GL2D 1AQTA 1OMIA 2RKLA 2GUSA 2E75B 1W5CE 2WSEH 2W6AA 3L73D 4H13C 4DZOA 1L0NJ 5DJTB 3F89A 4IOIH 2RN0A 2W27A 2UWJE 2K37A 4L73A 1RQVA 4AQRD 1NU1D 1R5SA 5CMZA 2A45H 4R4LA 2BASA 1W2EA 1IJDB 1M8OB 5H2FH 1G1IA 4H44D 1Z56A 3OAKA 2OYHA 1VF5C 4XFJA 3H32A 1EZVD 3L71J 3SFDC 2H89C 3GF7A 4NPDA 2WSCH 1JNMA 2R44A 3CCQP 1JY3P 3L70J 2C9NY 3LW5H 1K9MQ 1NHLA 4ZNCA 3WU2E 3A0BH 3U1AA 3CXHI 4KT0J 5AVSB 1FZBA 3PH0A 3O8ZA 3EFFK 1MFTA 5APTA 2QM7A 4BWNA 1KQSO 1BE3E 3M0AA 2HPCA 1BCCJ 1BE3G 2WTYA 3P32A 3L4FA 1KB9E 2QSIA 2WMMA 3R2PA 3TF5A 2BCCE 3PJSK 1NOHA 5KLVD 1A02J 2A45G 4UB6H 1JM0A 2OQQA 1IC2A 4JYBA 1S72P 3RL0g 3RL0D 1LT9B 2IFMA 2AEMA 1VQNP 1RE4A 3B5ND 2KIKA 3QWOC 2E43A 4TLFA 1GD2E 2O01H 3FWLA 3S1KA 2WSFJ 5B66E 1N2DC 3AEEC 5KAFH 2E42A 2K9JA 2FXOA 5TISE 1SQPE 4NPFX 2WITA 1SQPG 3NMDA 1JY3N 2QJKC 2KLVA 3H1KE 1S1CX 5CCGD 3H1KG 2N1TA 5AW6B 1N7SC 2HLOA 3I55P 3A0BE 4GDOA 1CZQA 2Q5UA 3HUSB 4OVNF 5KKZB 1QX8A 3KZIH 3L72D 3M9HA 3GW6A 4GOFA 1LWUB 3WUUA 2IDBA 1JY3O 1NTZG 2VRSA 3M0DC 5AW1B 1HVVA 1YQ3C 2QJYB 1IFDA 3AEGC 2ZYGA 1URQB 2B88A 3Q3DA 2N9BA 3L36A 1T6AA 2KLUA 3L73G 3D70A 5CBOA 3L75E 1LTBC 4I6MC 1LT9A 1M1JB 2WSSH 3L75G 1L0ND 1H88A 1KMIZ 1SFCB 3VMZA 1LGHB 1RF1A 1VQLP 1NU1E 2R3SA 3EWKA 4ZKPA 1OX3A 1NU1G 1LT1A 2BCCJ 1J1EC 1OFCX 1GU5A 5AW9B 1FOSE 1NGMB 1JCCA 2JDIH 2E74C 4Y99B 1FDIA 3GG2A 1LP1A 4WY4B 1EZVE 4N3YB 1SQVE 2JWDA 1MKMA 2ZVOB 1EZVG 5KAIE 3L71D 1HGZA 1SQPJ 1NKNA 2YKQA 3GMAA 2NPSC 1LTJC 3H1KJ 1SQPK 1ZV8A 4ASVA 1S5LX 4WBAA 3HD7C 1DX7A 2A45I 3CL3D 1JTHB 5B5EE 1K73Q 1NTME 1EDLA 4IFDK 2M0BA 3MHVA 1Q2NA 1PGPA 1BCCD 3QH9A 3GLMA 3MUDC 4HH2A 5AVUB 5AVYB 2JEEA 3H1LD 2N9YB 2MKVA 4NPEA 3RK3E 5KLVG 2H88C 1NTZK 1PGOA 4IL6E 1QVFO 1XTCC 3L75J 2HODB 1J2JB 3CWBD 2IBZI 3SWFA 1OXZA 1KILC 4CPGA 2K1AA 3NXSA 3GHGC 1NU1J 2FYNC 1VQPP 2XNDH 1DD4A 1G2CA 3A2AA 2PP6A 1M7LA 3C1LA 2PAJA 3NTNA 1HGVA 1IFPA 4U3FD 3JC22 1NU1K 2E76D 2FYUJ 5APSA 1KC8Q 2KOGA 3MP7B 2WPVB 3OJAB 2PFXA 2KZIA 4RO0A 2IZ0A 2E75C 2ZAEB 2K88A 3HE4B 4DCKA 3OA7A 3CLQA 1SQVJ 1AQ5A 4LC1A 3L72E 4HJGH 3SFEC 4RJTA 5AW7B 3L72G 2HYNA 2RH0A 2G3AA 1SQVK 3U59A 3D6YA 2NRGA 2AXTH 2YMKA 5KLIC 3RL0B 2WPQA 2HG5D 1N7SA 1HH0A 1OVUA 2M3EA 3B5NB 4D6TJ 3CCEP 3FGAD 3CCRP 1NTMJ 1L0NG 1MUUA 5CCHC 1EXIA 5AW0B 1KB9D 3VMYA 4HYTB 1GK6A 2BCCD 3EQ2A 3MTUE 5K5GB 3M0DA 2A06E 2IYOA 3D6ZA 3CC4P 1ZLLA 4RESB 5KLVK 1FU1A 4AUWA 1FZAA 3CCSP 1NH4A 3KDPB 5AVVB 1YJNP 5CHXA 3WUVA 1BDCA 1J1DB 1WMKA 3H1HJ 2WSFH 2SPZA 2HR3A 3L71G 3H6PA 2O01N 3C9IA 2YKOA 1WRGA 1S4XA 2J5UA 1X0TA 1NKZB 1JOCA 1KILB 1BSHA 3FXEA 3L72J 3AE4C 2QJPB 4M3LA 3F5HA 4PD4D 1AJYA 4H0LD 1ZOYC 1BCCG 3H1LE 1L4AD 3H1LG 2QM8A 2NPSA 1KV4A 1LTJA 2AXCA 2I8DA 3FXDA 3HD7A 3Q5RA 1L0LE 1P84I 3WU2H 2QRXA 3CWBE 3L75D 2BEQD 2G8YA 3CWBG 1ZMEC 3B8EB 3M9BA 1KZUB 3HUSC 4ASWA 4DT0A 5KKZC 2QE7H 3N4XA 1L0NK 1KB9H 4W7ZA 3MUDA 1N73C 3KHUA 4U3FE 1LWUC 4IFFA 4C7NA 5KLIB 4U3FG 1SQQJ 3CMAP 1CSBA 2FYUD 2QJYC 1N8RQ 3P7KA 1URQC 2V4HA 4BRYB 1KFNA 3Q1MA 5BU8B 1M1JC 1N7SD 1KILA 5B66H 3CCVP 1SQVD 2ITAA 2XU6A 4HB1A 3GHGA 1SFCC 5KJ7D 5TISH 1SQXJ 3ZDMA 1AA0A 1Y9BA 2KSJA 5CBNA 3CI9A 3UIAA 3Q5PA 1VDFA 3SWKA 3G4SP 1Q86Q 1FAVA 2P67A 2C9LY 4D6TD 1NTMD 1LJ2A 4Y99C 5APVA 4PD4H 2QVAA 4GOEA 4WY4C 2LXBA 2Q3EA 5APYA 3H1LJ 1FC2C 1SQBD 1YTZI 2W83C 2D2CD 2BCCG 2KSEA 2XDJA 1QL1A 3RK3D 2E76B 2W6JH 4K35A 1GL2C 3RK2D 2YO2A 1L0LJ 4PV1B 5TJHA 3CWBJ 2FYZA 3VMXA 1VQ9P 4OGQB 4R4MA 2L91A 4ZMDA 3H1HD 4XE5B 3II6A 5CCHA 1A02F 3B71A 1YQ4C 1MZ9A 4U3FJ 2NZ2A 1Y8AA 1KYOI 3GF3A 1GW3A 4O9BA 3LIEA 1JCDA 4B86A 5KAIH 1VPCA 4PD4E 3TNUB 1N73B 2AEJA 3IR9A 2I1KA 2Q7CA 1JY2O 3P8CD 4GIFA 2Q9IA 1JB0J 4UB8E 2FFDB 3WUTA 1JO5A 1OW7A 1G1JA 3FX0A 3G3ZA 1IZNB 5B5EH 1PGQA 2H8PD 4IL6X 1KORA 4JQ0D 5AW8B 1BGYE 3V6IA 4JBZA 1T2KD 3H1IE 1HJBA 3AE1C 2KUBA 3A5TA 2A06D 2FYUE 1SQQD 2ZXXA 3C8VA 1RF0C 2FYUG 4IL6H 1K8AQ 2R5BA 2GUVA 2KI7B 1FZCB 3S9OA 3RL0C 3B5NC 1VL2A 2Y0DA 3HUSA 2YXRB 1SQVG 3V4WA 3AECC 1YIJP 1SQXD 1L4AB 1N73A 1GL2B 1LWUA 3BCCE 1KB9I 5CCGC 4PJ0E 5AVZB 1USEA 1URQA 3BATA 1SP4A 1MV8A 4D6TE 4D6TG 1M1JA 1NTMG 1J1DC 3SWYA 1PPJD 1SFCA 4I7ZB 2J59M 1ZN5A 3TGUJ 1SQBE 2I1JA 2V7QJ 1SQBG 2OYOA 2ZYAA 1M57D 3T97B 1GMJA 4H44B 1L0LD 3TDKA 1FZGA 1HJ0A 2KXPB 2N1TD 3BRTB 3V5BA 1DD3A 1BDDA 3H1HE 1EC5A 3H1HG 1R8EA 1BGYJ 4WY4A 3H1IJ 2QJPC 2WT7B 2M5AB 2QA4P 1WT6A 1Q81Q 1RQUA 3AE9C 3KQGA 4N78D 3AEFC 2O1JA 5AVWB 2B87B 1GL2A 3VMAA 3TYYA 1RH5B 1ZXGA 2FYUK 3TSIA 4N6JA 1JTHA 2P58A 1H8AA 1AFOA 1FOSF 1T3JA 1E79H 1YJWP 2Q1KA 2D2CB 3P8CE 5AVTB 4I1LA 1K04A 4YXDC 3BCCJ 3RK3B 2YO3A 2ZT9D 1NTKD 2FXPA 3RK2B 2OGUA 1LNQA 5APUA 1S5LE 5CJ0A 1LTTC 4DJGA 3A3YB 2M3BA 2KS1B 2YKPA 1N7LA 2HODA 1YJ9P 4H13D 2M8RA 4QMAA 2Q3IA 2OYIB 3EFGA 4I2LC 1SQBJ 2H7HA 1PL5A 1NTMK 2IPPA 3AE6C 1EZVI 1H0TB 1K05A 2P1JA 2DW3A 1SQQE 2A06G 3VP8A 1SQBK 1QVGO 1SQQG 3E1IA 3IN6A 2WPSA 1PZQA 2XKMA 3I56P 1PFIA 4HKZH 3CXHE 3HE4A 3AEAC 2K3RA 1VQ8P 5M1BA 3RBZA 1CI6B 1VF5D 3RGUA 2C0XA 1ZR2A 3PP5A 1SQXE 2FY8A 1SQXG 1NJIQ 3I5CA 1RHZB 4IFMA 2KYVA 2Y0EA 1SFCD 2JR8A 2E5YA 2E76C 1RF0A 4C7RA 3E1RA 4PV1C 1L2PA 4TT3H 1OW6A 1JEKA 3B5NA 2IX7C 3OW2O 2YIUB 1X22A 2IBZD 2OYHB 4OGQC 5GTIE 1T8ZA 3V2NA 1PPJE 2KS1A 1PPJG 1YYCA 1KQGB 5AW2B 3TGUD 5GTHE 3JSVC 1QEXA 5E79E 1QLED 2OTJP 1SS1A 2Y0CA 1Y47A 3A0HH 2CK3H 1L0LG 5CCGA 1IK7A 3AE7C 1YITP 1DEEG 2QIWA 4WB4A 3W68A 3AE8C 1FS0E 1BGYD 1QGKB 4EDFA 3H1JJ 1PP9D 1PGJA 1YHQP 3H1ID 3W67A 1M1KQ 2HPCB 1CI6A 1S9KD 2Z5IA 2IFNA 4N78E 3MZWB 2FBWC 3CCJP 1USDA 3VOPA 1U57A 2B9BA 1GK4A 1KTMA 1FE6A 2FFDC 2B89A 1OVRA 1SQQK 4KJMA 4OWFA 1ZRTD 3S4RA 4LGDE 1E5WA 5BU5A 1HUCA 1MFZA 4EIJA 2J58A 2O3JA 3D71A 3L74D 3P8MC 1R5LA 1JY2P 3BCCD 1HBWA 2Y9ZA 2K9JB 1NTKE 1SQXK 1NTKG 3AE3C 2ZJSE 3A0HE 2ZFCA 5APQA 1FZCC 1NWQA 2N1TB 4W7YA 2XV5A 3G9RA 1HWTC 2POHA 1DEBA 1SLQA 4H0LC 2QG4A 2V7QH 2QEXP 1OZHA 3R4YA 1L4AC 4UB8H 3M06A 1IO4A 1JMMA 3V4QA 3NFQA 4DOJA 3FWNA 2KNCB 2IYPA 1L0LK 1FJKA 1FJPA 4BRYA 2CPSA 2E74D 5H2FE 2C0WA 1SVFA 4MN4C 1ZW0A 4GKGA 3PLNA 1NO4A 1W2BO 3CX5D 4XA4A 4ZKUA 2GA1A 4I7ZC 1OIPA 2KZJA 1RF1B 1AVOA 3MD0A 1JY2N 2ZT9B 4RKUJ 1QL2A 2P7JA 3SSUA 1S2EA 1KN7A 1Q82Q 4W80A 2HFED 3O6QB 2NPSD 2YNYA 4H44C 2Q6QA 3VYIA 3BASA 1P84D 5AW4B 3HD7D 1OWAA 1LTSC 1DH3A 1HTLC 2IBZE 4H13B 1Q7YQ 2IBZG 3AEBC 2JWAA 3V2PA 1FBMA 1LP1B 3TGUE 2ZVNB 2R3CA 5KJ7C 3TGUG 2W90A 2XZRA 3U1CA 1NTKJ 2OARA 2WVRA 1KQLA 2AEFA 5BVZA 1JUNA 1N86A 4PJ0H 1VQ4P 1LTIC 4Z1MH 2RMZA 1NTZE 3PHLA 1NTKK 2JKVA 2R32A 2GM4A 4UB6E 2FXMA 2KNCA 2YXQB 1RY3A 2WSEJ 1GDTA 3L73E 1PP9E 1BGYG 1VF5B 3H1JD 1PP9G 3IFMA 2PRRA 1KILD 3TK1A 1LTAC 3H1IG 1X79B 1S9KE 5AVQB 4EOTA 1BE3J 2D2CC 3RK3C 3PRJA 5KAFE 1PV3A 3CC2P 1NAYA 4GODA 2WWWA 3RK2C 1GTWA 4KHXA 3PTZA 4OH8B 1ZRTE 3O6QA 3CXHD 2E75D 4H0LB 3CX5H 4L74A 1FDOA 3G6EP 3TNUA 2OYIC 3L74E 4U7JA 3KYQA 1G2CB 3L74G 2H43A 1NAFA 3BCCG 1IFIA 1RE3C 1IFMA 3WMM0 3KZIE 3VN0A 3M9QA 1IFNA 2YMYA 2WSCJ 2FFDA 1VQKP 1KFMA 1P84H 1NVOA 3A7OA 5DJUB 1YI2P 3HE5B 3L70D 4AYCA 2R5DA 3LW5J 4L76A 1ZR4A 3VP9A 3M91A 1VQMP 1M90Q 4Y28J 5AW3B 5CCHD 5APWA 2P10A 1DIPA 5AVRB 2WQYC 3CCLP 3H25A 3RBXA 1AV1A 1KYOD 4JF7A 1S5LH 3CC7P 1GW4A 1NTZJ 1IFJA 1U7MA 2QJKB 5AVXB 5KLVE 1FZCA 2P2UA 2FKWB 4K3AA 1JMBA 1N7SB 3L35A 3L37A 2CPBA 3ITKA 3L73J 2YIUC 1PP9J 1X9VA 2OYHC 3K5BA 5EFWB 3CMEP 3CX5E 3AEDC 3CCMP 3USSA 2O01J 3ABVC 1T2KC 3AE5C 4PD4I 2MJZA 2W8ZA 2O1KA 1L4AA 4A7PA 2PGDA 3B4SA 1LTGC 3Q5SA 1EXJA 1KD1Q 2LR2A 2OTLP 1P84E 3CXHH
chains in the Genus database with same CATH topology
1EZVI 3H1HJ 4PD4I 3TGUJ 3CXHI 1SQQJ 4D6TJ 1BE3J 1SQXJ 1NTMJ 1NU1J 1SQPJ 1BGYJ 2FYUJ 3L74J 3L73J 3BCCJ 1L0LJ 1PP9J 3H1IJ 1NTKJ 1BCCJ 3CX5I 3L70J 3H1JJ 4U3FJ 3L72J 3H1KJ 3CWBJ 3H1LJ 3L75J 2BCCJ 1P84I 1SQVJ 1KB9I 1SQBJ 5KLVJ 1NTZJ 2IBZI 3L71J 1KYOI 1L0NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV I;  3H1H J;  4PD4 I;  3TGU J;  3CXH I;  1SQQ J;  4D6T J;  1BE3 J;  1SQX J;  1NTM J;  1NU1 J;  1SQP J;  1BGY J;  2FYU J;  3L74 J;  3L73 J;  3BCC J;  1L0L J;  1PP9 J;  3H1I J;  1NTK J;  1BCC J;  3CX5 I;  3L70 J;  3H1J J;  4U3F J;  3L72 J;  3H1K J;  3CWB J;  3H1L J;  3L75 J;  2BCC J;  1P84 I;  1SQV J;  1KB9 I;  1SQB J;  5KLV J;  1NTZ J;  2IBZ I;  3L71 J;  1KYO I;  1L0N J; 
#chains in the Genus database with same CATH topology
 4YPC A;  3CCU P;  4PV1 D;  4WVZ A;  1OW8 A;  3BRV B;  3HE5 A;  1HF9 A;  1ZP0 C;  3L74 J;  4BXL A;  3CD6 P;  5L8R J;  1YBK A;  1BSN A;  4OGQ D;  3MIW A;  4GT1 A;  1H89 A;  1VQ7 P;  3E7K A;  3CPW O;  2XNX A;  1PIX A;  1X8Y A;  3KXD A;  1J1E B;  3T97 A;  2KB7 P;  1T3U A;  1D7M A;  3KPE A;  3AE2 C;  1KQF B;  4WWI A;  1OVV A;  2E74 B;  5GTI H;  3Q2Y A;  4JPZ B;  1IK9 A;  2KK7 A;  1RE4 C;  2Y9Y A;  2LKM A;  3H1J E;  2OTK E;  1NYH A;  1UII A;  1KIL E;  1EDK A;  3H1J G;  3N7N A;  5GTH H;  1L0N E;  1VQ5 P;  5KJ7 A;  1FZF A;  5E79 H;  2WT7 A;  3IF4 A;  3HTK B;  2M5A A;  1BE3 D;  1U7J A;  2IZ1 A;  1GZL A;  3HRN A;  4JYC A;  2LXC B;  1KYO H;  1EDJ A;  4YTP C;  1Q90 D;  4LLH A;  2NPS B;  4YXW H;  1LTJ B;  2ZXE B;  3JCU H;  5KLV J;  2B87 A;  2JJL A;  4L75 A;  2WPR A;  3HD7 B;  5AW5 B;  1FDM A;  2N1T C;  1URQ D;  5APX A;  2BEZ F;  3MGN A;  1VQO P;  2Z5H A;  3BVH A;  1XTG B;  3L71 E;  3V2R A;  2ZYD A;  4EYY Q;  1AVY A;  3LID A;  1S3J A;  2JO1 A;  4C7N B;  3IAO A;  1SQP D;  2Z4E A;  5KTB A;  1TU3 F;  3VTP C;  4C46 A;  1GU4 A;  2AXT E;  3H1K D;  3L70 E;  1CW5 A;  3L70 G;  4EI2 A;  3G71 P;  1LT9 C;  2W6B A;  3H32 B;  2L5G B;  1FZE A;  2OYI A;  3GHG B;  2FYN B;  4WY4 D;  1H0T A;  3CX5 I;  1RF1 C;  1RE3 A;  2KP8 A;  5CJ4 A;  2E5T A;  2ZT9 C;  1BCC E;  2JP3 A;  1KYO E;  3HTK A;  1EDI A;  2WZ7 A;  1EQ7 A;  1M56 D;  3JCU E;  1NTZ D;  5C39 A;  3V2Q A;  2K9Y A;  1UIX A;  1VQ6 P;  1YTZ T;  1GL2 D;  1AQT A;  1OMI A;  2RKL A;  2GUS A;  2E75 B;  1W5C E;  2WSE H;  2W6A A;  3L73 D;  4H13 C;  4DZO A;  1L0N J;  5DJT B;  3F89 A;  4IOI H;  2RN0 A;  2W27 A;  2UWJ E;  2K37 A;  4L73 A;  1RQV A;  4AQR D;  1NU1 D;  1R5S A;  5CMZ A;  2A45 H;  4R4L A;  2BAS A;  1W2E A;  1IJD B;  1M8O B;  5H2F H;  1G1I A;  4H44 D;  1Z56 A;  3OAK A;  2OYH A;  1VF5 C;  4XFJ A;  3H32 A;  1EZV D;  3L71 J;  3SFD C;  2H89 C;  3GF7 A;  4NPD A;  2WSC H;  1JNM A;  2R44 A;  3CCQ P;  1JY3 P;  3L70 J;  2C9N Y;  3LW5 H;  1K9M Q;  1NHL A;  4ZNC A;  3WU2 E;  3A0B H;  3U1A A;  3CXH I;  4KT0 J;  5AVS B;  1FZB A;  3PH0 A;  3O8Z A;  3EFF K;  1MFT A;  5APT A;  2QM7 A;  4BWN A;  1KQS O;  1BE3 E;  3M0A A;  2HPC A;  1BCC J;  1BE3 G;  2WTY A;  3P32 A;  3L4F A;  1KB9 E;  2QSI A;  2WMM A;  3R2P A;  3TF5 A;  2BCC E;  3PJS K;  1NOH A;  5KLV D;  1A02 J;  2A45 G;  4UB6 H;  1JM0 A;  2OQQ A;  1IC2 A;  4JYB A;  1S72 P;  3RL0 g;  3RL0 D;  1LT9 B;  2IFM A;  2AEM A;  1VQN P;  1RE4 A;  3B5N D;  2KIK A;  3QWO C;  2E43 A;  4TLF A;  1GD2 E;  2O01 H;  3FWL A;  3S1K A;  2WSF J;  5B66 E;  1N2D C;  3AEE C;  5KAF H;  2E42 A;  2K9J A;  2FXO A;  5TIS E;  1SQP E;  4NPF X;  2WIT A;  1SQP G;  3NMD A;  1JY3 N;  2QJK C;  2KLV A;  3H1K E;  1S1C X;  5CCG D;  3H1K G;  2N1T A;  5AW6 B;  1N7S C;  2HLO A;  3I55 P;  3A0B E;  4GDO A;  1CZQ A;  2Q5U A;  3HUS B;  4OVN F;  5KKZ B;  1QX8 A;  3KZI H;  3L72 D;  3M9H A;  3GW6 A;  4GOF A;  1LWU B;  3WUU A;  2IDB A;  1JY3 O;  1NTZ G;  2VRS A;  3M0D C;  5AW1 B;  1HVV A;  1YQ3 C;  2QJY B;  1IFD A;  3AEG C;  2ZYG A;  1URQ B;  2B88 A;  3Q3D A;  2N9B A;  3L36 A;  1T6A A;  2KLU A;  3L73 G;  3D70 A;  5CBO A;  3L75 E;  1LTB C;  4I6M C;  1LT9 A;  1M1J B;  2WSS H;  3L75 G;  1L0N D;  1H88 A;  1KMI Z;  1SFC B;  3VMZ A;  1LGH B;  1RF1 A;  1VQL P;  1NU1 E;  2R3S A;  3EWK A;  4ZKP A;  1OX3 A;  1NU1 G;  1LT1 A;  2BCC J;  1J1E C;  1OFC X;  1GU5 A;  5AW9 B;  1FOS E;  1NGM B;  1JCC A;  2JDI H;  2E74 C;  4Y99 B;  1FDI A;  3GG2 A;  1LP1 A;  4WY4 B;  1EZV E;  4N3Y B;  1SQV E;  2JWD A;  1MKM A;  2ZVO B;  1EZV G;  5KAI E;  3L71 D;  1HGZ A;  1SQP J;  1NKN A;  2YKQ A;  3GMA A;  2NPS C;  1LTJ C;  3H1K J;  1SQP K;  1ZV8 A;  4ASV A;  1S5L X;  4WBA A;  3HD7 C;  1DX7 A;  2A45 I;  3CL3 D;  1JTH B;  5B5E E;  1K73 Q;  1NTM E;  1EDL A;  4IFD K;  2M0B A;  3MHV A;  1Q2N A;  1PGP A;  1BCC D;  3QH9 A;  3GLM A;  3MUD C;  4HH2 A;  5AVU B;  5AVY B;  2JEE A;  3H1L D;  2N9Y B;  2MKV A;  4NPE A;  3RK3 E;  5KLV G;  2H88 C;  1NTZ K;  1PGO A;  4IL6 E;  1QVF O;  1XTC C;  3L75 J;  2HOD B;  1J2J B;  3CWB D;  2IBZ I;  3SWF A;  1OXZ A;  1KIL C;  4CPG A;  2K1A A;  3NXS A;  3GHG C;  1NU1 J;  2FYN C;  1VQP P;  2XND H;  1DD4 A;  1G2C A;  3A2A A;  2PP6 A;  1M7L A;  3C1L A;  2PAJ A;  3NTN A;  1HGV A;  1IFP A;  4U3F D;  3JC2 2;  1NU1 K;  2E76 D;  2FYU J;  5APS A;  1KC8 Q;  2KOG A;  3MP7 B;  2WPV B;  3OJA B;  2PFX A;  2KZI A;  4RO0 A;  2IZ0 A;  2E75 C;  2ZAE B;  2K88 A;  3HE4 B;  4DCK A;  3OA7 A;  3CLQ A;  1SQV J;  1AQ5 A;  4LC1 A;  3L72 E;  4HJG H;  3SFE C;  4RJT A;  5AW7 B;  3L72 G;  2HYN A;  2RH0 A;  2G3A A;  1SQV K;  3U59 A;  3D6Y A;  2NRG A;  2AXT H;  2YMK A;  5KLI C;  3RL0 B;  2WPQ A;  2HG5 D;  1N7S A;  1HH0 A;  1OVU A;  2M3E A;  3B5N B;  4D6T J;  3CCE P;  3FGA D;  3CCR P;  1NTM J;  1L0N G;  1MUU A;  5CCH C;  1EXI A;  5AW0 B;  1KB9 D;  3VMY A;  4HYT B;  1GK6 A;  2BCC D;  3EQ2 A;  3MTU E;  5K5G B;  3M0D A;  2A06 E;  2IYO A;  3D6Z A;  3CC4 P;  1ZLL A;  4RES B;  5KLV K;  1FU1 A;  4AUW A;  1FZA A;  3CCS P;  1NH4 A;  3KDP B;  5AVV B;  1YJN P;  5CHX A;  3WUV A;  1BDC A;  1J1D B;  1WMK A;  3H1H J;  2WSF H;  2SPZ A;  2HR3 A;  3L71 G;  3H6P A;  2O01 N;  3C9I A;  2YKO A;  1WRG A;  1S4X A;  2J5U A;  1X0T A;  1NKZ B;  1JOC A;  1KIL B;  1BSH A;  3FXE A;  3L72 J;  3AE4 C;  2QJP B;  4M3L A;  3F5H A;  4PD4 D;  1AJY A;  4H0L D;  1ZOY C;  1BCC G;  3H1L E;  1L4A D;  3H1L G;  2QM8 A;  2NPS A;  1KV4 A;  1LTJ A;  2AXC A;  2I8D A;  3FXD A;  3HD7 A;  3Q5R A;  1L0L E;  1P84 I;  3WU2 H;  2QRX A;  3CWB E;  3L75 D;  2BEQ D;  2G8Y A;  3CWB G;  1ZME C;  3B8E B;  3M9B A;  1KZU B;  3HUS C;  4ASW A;  4DT0 A;  5KKZ C;  2QE7 H;  3N4X A;  1L0N K;  1KB9 H;  4W7Z A;  3MUD A;  1N73 C;  3KHU A;  4U3F E;  1LWU C;  4IFF A;  4C7N A;  5KLI B;  4U3F G;  1SQQ J;  3CMA P;  1CSB A;  2FYU D;  2QJY C;  1N8R Q;  3P7K A;  1URQ C;  2V4H A;  4BRY B;  1KFN A;  3Q1M A;  5BU8 B;  1M1J C;  1N7S D;  1KIL A;  5B66 H;  3CCV P;  1SQV D;  2ITA A;  2XU6 A;  4HB1 A;  3GHG A;  1SFC C;  5KJ7 D;  5TIS H;  1SQX J;  3ZDM A;  1AA0 A;  1Y9B A;  2KSJ A;  5CBN A;  3CI9 A;  3UIA A;  3Q5P A;  1VDF A;  3SWK A;  3G4S P;  1Q86 Q;  1FAV A;  2P67 A;  2C9L Y;  4D6T D;  1NTM D;  1LJ2 A;  4Y99 C;  5APV A;  4PD4 H;  2QVA A;  4GOE A;  4WY4 C;  2LXB A;  2Q3E A;  5APY A;  3H1L J;  1FC2 C;  1SQB D;  1YTZ I;  2W83 C;  2D2C D;  2BCC G;  2KSE A;  2XDJ A;  1QL1 A;  3RK3 D;  2E76 B;  2W6J H;  4K35 A;  1GL2 C;  3RK2 D;  2YO2 A;  1L0L J;  4PV1 B;  5TJH A;  3CWB J;  2FYZ A;  3VMX A;  1VQ9 P;  4OGQ B;  4R4M A;  2L91 A;  4ZMD A;  3H1H D;  4XE5 B;  3II6 A;  5CCH A;  1A02 F;  3B71 A;  1YQ4 C;  1MZ9 A;  4U3F J;  2NZ2 A;  1Y8A A;  1KYO I;  3GF3 A;  1GW3 A;  4O9B A;  3LIE A;  1JCD A;  4B86 A;  5KAI H;  1VPC A;  4PD4 E;  3TNU B;  1N73 B;  2AEJ A;  3IR9 A;  2I1K A;  2Q7C A;  1JY2 O;  3P8C D;  4GIF A;  2Q9I A;  1JB0 J;  4UB8 E;  2FFD B;  3WUT A;  1JO5 A;  1OW7 A;  1G1J A;  3FX0 A;  3G3Z A;  1IZN B;  5B5E H;  1PGQ A;  2H8P D;  4IL6 X;  1KOR A;  4JQ0 D;  5AW8 B;  1BGY E;  3V6I A;  4JBZ A;  1T2K D;  3H1I E;  1HJB A;  3AE1 C;  2KUB A;  3A5T A;  2A06 D;  2FYU E;  1SQQ D;  2ZXX A;  3C8V A;  1RF0 C;  2FYU G;  4IL6 H;  1K8A Q;  2R5B A;  2GUV A;  2KI7 B;  1FZC B;  3S9O A;  3RL0 C;  3B5N C;  1VL2 A;  2Y0D A;  3HUS A;  2YXR B;  1SQV G;  3V4W A;  3AEC C;  1YIJ P;  1SQX D;  1L4A B;  1N73 A;  1GL2 B;  1LWU A;  3BCC E;  1KB9 I;  5CCG C;  4PJ0 E;  5AVZ B;  1USE A;  1URQ A;  3BAT A;  1SP4 A;  1MV8 A;  4D6T E;  4D6T G;  1M1J A;  1NTM G;  1J1D C;  3SWY A;  1PPJ D;  1SFC A;  4I7Z B;  2J59 M;  1ZN5 A;  3TGU J;  1SQB E;  2I1J A;  2V7Q J;  1SQB G;  2OYO A;  2ZYA A;  1M57 D;  3T97 B;  1GMJ A;  4H44 B;  1L0L D;  3TDK A;  1FZG A;  1HJ0 A;  2KXP B;  2N1T D;  3BRT B;  3V5B A;  1DD3 A;  1BDD A;  3H1H E;  1EC5 A;  3H1H G;  1R8E A;  1BGY J;  4WY4 A;  3H1I J;  2QJP C;  2WT7 B;  2M5A B;  2QA4 P;  1WT6 A;  1Q81 Q;  1RQU A;  3AE9 C;  3KQG A;  4N78 D;  3AEF C;  2O1J A;  5AVW B;  2B87 B;  1GL2 A;  3VMA A;  3TYY A;  1RH5 B;  1ZXG A;  2FYU K;  3TSI A;  4N6J A;  1JTH A;  2P58 A;  1H8A A;  1AFO A;  1FOS F;  1T3J A;  1E79 H;  1YJW P;  2Q1K A;  2D2C B;  3P8C E;  5AVT B;  4I1L A;  1K04 A;  4YXD C;  3BCC J;  3RK3 B;  2YO3 A;  2ZT9 D;  1NTK D;  2FXP A;  3RK2 B;  2OGU A;  1LNQ A;  5APU A;  1S5L E;  5CJ0 A;  1LTT C;  4DJG A;  3A3Y B;  2M3B A;  2KS1 B;  2YKP A;  1N7L A;  2HOD A;  1YJ9 P;  4H13 D;  2M8R A;  4QMA A;  2Q3I A;  2OYI B;  3EFG A;  4I2L C;  1SQB J;  2H7H A;  1PL5 A;  1NTM K;  2IPP A;  3AE6 C;  1EZV I;  1H0T B;  1K05 A;  2P1J A;  2DW3 A;  1SQQ E;  2A06 G;  3VP8 A;  1SQB K;  1QVG O;  1SQQ G;  3E1I A;  3IN6 A;  2WPS A;  1PZQ A;  2XKM A;  3I56 P;  1PFI A;  4HKZ H;  3CXH E;  3HE4 A;  3AEA C;  2K3R A;  1VQ8 P;  5M1B A;  3RBZ A;  1CI6 B;  1VF5 D;  3RGU A;  2C0X A;  1ZR2 A;  3PP5 A;  1SQX E;  2FY8 A;  1SQX G;  1NJI Q;  3I5C A;  1RHZ B;  4IFM A;  2KYV A;  2Y0E A;  1SFC D;  2JR8 A;  2E5Y A;  2E76 C;  1RF0 A;  4C7R A;  3E1R A;  4PV1 C;  1L2P A;  4TT3 H;  1OW6 A;  1JEK A;  3B5N A;  2IX7 C;  3OW2 O;  2YIU B;  1X22 A;  2IBZ D;  2OYH B;  4OGQ C;  5GTI E;  1T8Z A;  3V2N A;  1PPJ E;  2KS1 A;  1PPJ G;  1YYC A;  1KQG B;  5AW2 B;  3TGU D;  5GTH E;  3JSV C;  1QEX A;  5E79 E;  1QLE D;  2OTJ P;  1SS1 A;  2Y0C A;  1Y47 A;  3A0H H;  2CK3 H;  1L0L G;  5CCG A;  1IK7 A;  3AE7 C;  1YIT P;  1DEE G;  2QIW A;  4WB4 A;  3W68 A;  3AE8 C;  1FS0 E;  1BGY D;  1QGK B;  4EDF A;  3H1J J;  1PP9 D;  1PGJ A;  1YHQ P;  3H1I D;  3W67 A;  1M1K Q;  2HPC B;  1CI6 A;  1S9K D;  2Z5I A;  2IFN A;  4N78 E;  3MZW B;  2FBW C;  3CCJ P;  1USD A;  3VOP A;  1U57 A;  2B9B A;  1GK4 A;  1KTM A;  1FE6 A;  2FFD C;  2B89 A;  1OVR A;  1SQQ K;  4KJM A;  4OWF A;  1ZRT D;  3S4R A;  4LGD E;  1E5W A;  5BU5 A;  1HUC A;  1MFZ A;  4EIJ A;  2J58 A;  2O3J A;  3D71 A;  3L74 D;  3P8M C;  1R5L A;  1JY2 P;  3BCC D;  1HBW A;  2Y9Z A;  2K9J B;  1NTK E;  1SQX K;  1NTK G;  3AE3 C;  2ZJS E;  3A0H E;  2ZFC A;  5APQ A;  1FZC C;  1NWQ A;  2N1T B;  4W7Y A;  2XV5 A;  3G9R A;  1HWT C;  2POH A;  1DEB A;  1SLQ A;  4H0L C;  2QG4 A;  2V7Q H;  2QEX P;  1OZH A;  3R4Y A;  1L4A C;  4UB8 H;  3M06 A;  1IO4 A;  1JMM A;  3V4Q A;  3NFQ A;  4DOJ A;  3FWN A;  2KNC B;  2IYP A;  1L0L K;  1FJK A;  1FJP A;  4BRY A;  2CPS A;  2E74 D;  5H2F E;  2C0W A;  1SVF A;  4MN4 C;  1ZW0 A;  4GKG A;  3PLN A;  1NO4 A;  1W2B O;  3CX5 D;  4XA4 A;  4ZKU A;  2GA1 A;  4I7Z C;  1OIP A;  2KZJ A;  1RF1 B;  1AVO A;  3MD0 A;  1JY2 N;  2ZT9 B;  4RKU J;  1QL2 A;  2P7J A;  3SSU A;  1S2E A;  1KN7 A;  1Q82 Q;  4W80 A;  2HFE D;  3O6Q B;  2NPS D;  2YNY A;  4H44 C;  2Q6Q A;  3VYI A;  3BAS A;  1P84 D;  5AW4 B;  3HD7 D;  1OWA A;  1LTS C;  1DH3 A;  1HTL C;  2IBZ E;  4H13 B;  1Q7Y Q;  2IBZ G;  3AEB C;  2JWA A;  3V2P A;  1FBM A;  1LP1 B;  3TGU E;  2ZVN B;  2R3C A;  5KJ7 C;  3TGU G;  2W90 A;  2XZR A;  3U1C A;  1NTK J;  2OAR A;  2WVR A;  1KQL A;  2AEF A;  5BVZ A;  1JUN A;  1N86 A;  4PJ0 H;  1VQ4 P;  1LTI C;  4Z1M H;  2RMZ A;  1NTZ E;  3PHL A;  1NTK K;  2JKV A;  2R32 A;  2GM4 A;  4UB6 E;  2FXM A;  2KNC A;  2YXQ B;  1RY3 A;  2WSE J;  1GDT A;  3L73 E;  1PP9 E;  1BGY G;  1VF5 B;  3H1J D;  1PP9 G;  3IFM A;  2PRR A;  1KIL D;  3TK1 A;  1LTA C;  3H1I G;  1X79 B;  1S9K E;  5AVQ B;  4EOT A;  1BE3 J;  2D2C C;  3RK3 C;  3PRJ A;  5KAF E;  1PV3 A;  3CC2 P;  1NAY A;  4GOD A;  2WWW A;  3RK2 C;  1GTW A;  4KHX A;  3PTZ A;  4OH8 B;  1ZRT E;  3O6Q A;  3CXH D;  2E75 D;  4H0L B;  3CX5 H;  4L74 A;  1FDO A;  3G6E P;  3TNU A;  2OYI C;  3L74 E;  4U7J A;  3KYQ A;  1G2C B;  3L74 G;  2H43 A;  1NAF A;  3BCC G;  1IFI A;  1RE3 C;  1IFM A;  3WMM 0;  3KZI E;  3VN0 A;  3M9Q A;  1IFN A;  2YMY A;  2WSC J;  2FFD A;  1VQK P;  1KFM A;  1P84 H;  1NVO A;  3A7O A;  5DJU B;  1YI2 P;  3HE5 B;  3L70 D;  4AYC A;  2R5D A;  3LW5 J;  4L76 A;  1ZR4 A;  3VP9 A;  3M91 A;  1VQM P;  1M90 Q;  4Y28 J;  5AW3 B;  5CCH D;  5APW A;  2P10 A;  1DIP A;  5AVR B;  2WQY C;  3CCL P;  3H25 A;  3RBX A;  1AV1 A;  1KYO D;  4JF7 A;  1S5L H;  3CC7 P;  1GW4 A;  1NTZ J;  1IFJ A;  1U7M A;  2QJK B;  5AVX B;  5KLV E;  1FZC A;  2P2U A;  2FKW B;  4K3A A;  1JMB A;  1N7S B;  3L35 A;  3L37 A;  2CPB A;  3ITK A;  3L73 J;  2YIU C;  1PP9 J;  1X9V A;  2OYH C;  3K5B A;  5EFW B;  3CME P;  3CX5 E;  3AED C;  3CCM P;  3USS A;  2O01 J;  3ABV C;  1T2K C;  3AE5 C;  4PD4 I;  2MJZ A;  2W8Z A;  2O1K A;  1L4A A;  4A7P A;  2PGD A;  3B4S A;  1LTG C;  3Q5S A;  1EXJ A;  1KD1 Q;  2LR2 A;  2OTL P;  1P84 E;  3CXH H; 
#chains in the Genus database with same CATH homology
 1EZV I;  3H1H J;  4PD4 I;  3TGU J;  3CXH I;  1SQQ J;  4D6T J;  1BE3 J;  1SQX J;  1NTM J;  1NU1 J;  1SQP J;  1BGY J;  2FYU J;  3L74 J;  3L73 J;  3BCC J;  1L0L J;  1PP9 J;  3H1I J;  1NTK J;  1BCC J;  3CX5 I;  3L70 J;  3H1J J;  4U3F J;  3L72 J;  3H1K J;  3CWB J;  3H1L J;  3L75 J;  2BCC J;  1P84 I;  1SQV J;  1KB9 I;  1SQB J;  5KLV J;  1NTZ J;  2IBZ I;  3L71 J;  1KYO I;  1L0N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...