1SQBJ

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqbJ00
3L72J 1KB9I 3H1IJ 2IBZI 1P84I 1SQQJ 3L71J 1L0LJ 3CWBJ 3H1JJ 1PP9J 3H1HJ 5KLVJ 4PD4I 1NU1J 1SQVJ 3L75J 1SQPJ 1EZVI 3BCCJ 3CXHI 3L74J 4D6TJ 1NTZJ 4U3FJ 1SQXJ 3H1LJ 3TGUJ 1BE3J 3L73J 1L0NJ 2BCCJ 1SQBJ 3CX5I 1BCCJ 1NTKJ 1BGYJ 3L70J 1NTMJ 3H1KJ 2FYUJ 1KYOI
chains in the Genus database with same CATH superfamily
1DEBA 2M3BA 2A06E 2L91A 2W27A 3RK3D 5AVQB 1AFOA 2HYNA 2V7QJ 1VQ4P 1VPCA 2QJKC 2OGUA 1L4AB 2FYUG 2WPSA 3CCUP 3ZDMA 2E76B 5B5EE 1NKZB 2ZVNB 3H25A 2Q5UA 3A0BH 3TGUG 1KYOE 1PP9E 5KLVJ 2G3AA 4BWNA 3O6QA 3MTUE 1FJPA 3JCUH 1IJDB 1VQLP 1USEA 2HR3A 1KTMA 1GU4A 3HD7A 3F89A 1LT1A 3AE5C 1QX8A 4HJGH 3CCLP 4L76A 1DIPA 2AXCA 3BVHA 3KZIE 1TU3F 1RE3C 4I6MC 3Q5SA 3IR9A 1NU1G 3T97B 2OARA 4LLHA 4H13C 1VQ7P 1L0LJ 1R5LA 1JTHA 1FDIA 1P84E 4PD4H 3L75J 1VF5C 1RF0C 1SQVK 3H1LJ 2WSCJ 1KYOD 2PRRA 1N73A 1FE6A 1OVVA 2LXCB 4RKUJ 4MN4C 1BGYJ 1L0NK 3CPWO 1NVOA 4Z1MH 1MZ9A 1JY3N 3FXEA 1HBWA 5H2FH 1SQQK 3NMDA 2V7QH 1EXJA 1KZUB 3GHGC 3TGUJ 3L72G 2SPZA 2M5AB 3LW5H 1YJWP 2HFED 4WY4A 1S9KD 1KORA 2WT7A 1IK9A 1MV8A 2JEEA 3N7NA 2N9YB 2B9BA 3A0BE 2OYHA 4YTPC 1QVGO 5CMZA 1LTBC 1M1JB 2HODA 1N7LA 2YO3A 3OA7A 2C0WA 2BCCJ 1G1IA 2KS1B 3CCMP 3IN6A 2Q1KA 3O6QB 2QM7A 1NU1J 2QSIA 3U1CA 3P7KA 3SSUA 1PGPA 1GD2E 5CCHC 2FKWB 3VMYA 4UB6H 3S9OA 5AW5B 4CPGA 5AW7B 4LGDE 3EFFK 1RY3A 2WTYA 2YNYA 3HTKA 4L74A 5DJTB 3L71J 1ZR4A 3TYYA 1SQBD 1M7LA 1FS0E 2WSCH 1HVVA 5CCGD 4PD4E 1SQXE 1L4AC 2HPCA 4K3AA 1KFMA 4L73A 3M9BA 2NPSB 3L72J 3V2QA 3M9HA 1NHLA 2E74B 3D6ZA 4IOIH 2B89A 3H6PA 1NKNA 3HUSA 1BCCG 4H13D 1N73B 2WPRA 2FFDB 1VQMP 1YTZI 2ZYAA 1JB0J 1FOSF 3TF5A 1VF5D 5AVSB 2WMMA 3A2AA 3RL0B 1AQ5A 3H32A 3JC22 2OYIA 2IFNA 1N86A 3AEGC 1NWQA 2ZXXA 2M0BA 4U3FE 3SWFA 1NAFA 4PD4D 1LTJB 1SQXD 2A06G 1GTWA 3D6YA 3B5NC 1QLED 1RHZB 5BU5A 2HODB 2QRXA 1SQPE 1PIXA 1IFPA 4I1LA 4AUWA 3WU2E 2YXQB 2IZ1A 2Q7CA 1EDIA 1T3UA 1NOHA 4UB6E 1PP9G 2H88C 3WUTA 3VN0A 2N1TB 5AVUB 3L75E 4C7NB 1FZGA 2WSEJ 3H1LE 4EI2A 3MIWA 2G8YA 1VQ6P 4U3FD 1IO4A 5CCHD 1BGYE 1RE3A 3H1KJ 1LT9B 1ZRTE 1LNQA 2WSFH 3NTNA 1LWUA 1SP4A 5GTIH 3AEDC 4W7ZA 1R8EA 3TGUE 4JPZB 1RF0A 2O01H 1SQPD 3LIEA 4WVZA 1LTTC 1L4AD 2K9JB 1EC5A 3I5CA 3MZWB 3SFDC 3GHGA 3Q5PA 3L4FA 1DX7A 3BCCG 2KNCB 1VQ8P 2KZJA 3CWBJ 2OYIB 2XU6A 1SQVJ 1NU1E 1X9VA 2O1JA 2FYUD 3CXHI 1KILB 4GDOA 2WPQA 1T2KC 3AE6C 1ZRTD 1IK7A 5APVA 1L0NJ 3Q3DA 4H0LB 1YHQP 2NPSC 3TGUD 3FX0A 1SFCA 1SQQJ 2BASA 2E74C 3E7KA 5C39A 1HUCA 1G2CB 3B5ND 3V5BA 1N73C 2FFDC 5CCHA 3OAKA 3CX5I 2K37A 3M9QA 5AVWB 4HB1A 2LKMA 2QA4P 1RF1A 1PGJA 1CI6A 2UWJE 3L72E 3V2PA 1DH3A 3TNUA 3RL0C 3LIDA 4EDFA 1Y9BA 5KJ7C 1KFNA 5GTIE 1DD3A 1NU1D 4WY4C 1LTJC 1JY2N 1L4AA 2W6BA 3M0DC 1NTZG 3NFQA 1LWUB 1MUUA 1Q2NA 1Q86Q 4JBZA 5AVYB 2WWWA 2IDBA 1EDLA 3GMAA 2N1TC 4D6TG 1K05A 3RK2B 2P7JA 3CCQP 2WQYC 1GL2A 3L72D 3V2RA 2CPSA 4Y99B 1BDDA 2I1KA 1OVRA 2GUVA 1NAYA 1JY2P 5KLVG 1NTMJ 1Q90D 2H8PD 2DW3A 2WITA 3T97A 3VYIA 4U7JA 1IFMA 1LT9C 4PV1B 3KXDA 5APUA 2QG4A 1EZVI 1NJIQ 2FYZA 1E5WA 1JCDA 2E42A 1BCCE 3AEAC 1GW4A 2E75B 3H1KE 1T2KD 3H1IJ 1FZCB 1P84H 1URQA 3Q5RA 3A5TA 3GF7A 2WVRA 2H89C 2XDJA 1PZQA 1H88A 2A45I 1XTGB 2E74D 5TISE 5M1BA 4XA4A 3OJAB 1L0LG 2M5AA 3W68A 3L75G 2IBZI 2OYIC 3H1LG 3CCRP 1KILC 4ZKPA 4D6TJ 5AW4B 3RL0D 1BGYG 2GM4A 1M1JA 4H0LC 3AEFC 1NTKK 2FXOA 2KS1A 1KB9H 4WY4D 2WPVB 1BCCD 2M8RA 1KQLA 4EIJA 4K35A 1FJKA 2KUBA 3R4YA 1PGQA 1T3JA 3P8CE 2Z4EA 1IFIA 4TLFA 2OYOA 3G9RA 2Y0CA 1USDA 2P1JA 1SQQE 4OH8B 1GL2B 3SFEC 2BCCG 4IL6H 3GLMA 1H0TB 2A06D 2RH0A 1VQNP 2HLOA 4GODA 2FYNB 1A02J 3KPEA 1BSHA 2NPSA 1LWUC 1SLQA 3CC4P 2J59M 3UIAA 3KHUA 3SWKA 1XTCC 2VRSA 3HE4B 1H8AA 1KILE 1PP9D 3L71G 5CJ0A 2FFDA 2Z5HA 4GIFA 2KSEA 3CCSP 1HH0A 3P8CD 5EFWB 2V4HA 1URQB 3RK2C 1JY3O 4HYTB 2M3EA 3MGNA 2B87B 4H44B 2NRGA 3PLNA 3BCCE 3QWOC 3M06A 3FWNA 5KJ7A 2ITAA 1IFNA 1LTJA 1W2EA 3I56P 1K73Q 1FAVA 3M0DA 4PV1C 3H1HJ 2YIUB 1KB9E 2QJPB 1JOCA 1IZNB 1OVUA 1JMBA 4DCKA 3M0AA 1BE3J 1P84D 1PPJG 2Y9YA 1KILD 2Q9IA 1SFCC 5APWA 1S2EA 2E75C 1NTME 1FZCC 1FC2C 1FOSE 5APQA 2N1TA 3H1JJ 2O3JA 3B4SA 4W7YA 2NZ2A 1JY3P 2OTLP 2R3SA 3WU2H 4IL6E 4C7NA 2HG5D 3C9IA 1RF1C 1W5CE 3BCCD 2H43A 3G4SP 1UIIA 4WB4A 4WBAA 2BEZF 1OMIA 4GOFA 3H1IE 3CI9A 2YO2A 3AE7C 4A7PA 1AA0A 3HRNA 3L74J 1LT9A 1NTZE 1KB9D 3RL0g 1Y47A 2XKMA 3WUUA 2Q3IA 2E76C 3CC2P 1VQKP 1U7MA 3L37A 1KQSO 1AQTA 2IPPA 1SQBK 1PFIA 1NYHA 2K9JA 4D6TE 2YMKA 4R4MA 3H1KG 4XFJA 3A3YB 3L70J 4DJGA 2OTJP 1GL2C 1K8AQ 2KNCA 3C8VA 5KLVE 3P32A 3H1ID 3USSA 1RQUA 3Q2YA 1KILA 3RK2D 1K04A 1QL2A 5KAFH 2YKOA 2R32A 2FYNC 3RK3B 1JM0A 1NTZD 1OFCX 1EDKA 3BATA 4IFDK 2MKVA 2P2UA 2FBWC 4DZOA 4UB8H 1SQXK 1G2CA 1AV1A 4D6TD 1NTKJ 1Z56A 3CWBG 2P67A 1VQ9P 1SQVG 5CBNA 2C0XA 1URQC 1L0LE 5DJUB 1SFCD 1X8YA 3B71A 3B8EB 2E75D 1L0NG 2J5UA 3EQ2A 1OX3A 5KLVD 2KB7P 1SQQG 1RH5B 3ITKA 3L36A 4KJMA 3IAOA 1KYOI 3F5HA 2I8DA 2FY8A 2P58A 2YIUC 2QJPC 1M57D 2K1AA 5AW1B 5AW6B 3O8ZA 4OWFA 2YMYA 1M1JC 1ZLLA 2KYVA 1ZV8A 3VP9A 1GK6A 3M91A 3AEBC 3U1AA 2XNDH 2IX7C 3HE5B 2E76D 3H1HE 1EXIA 3PH0A 1S3JA 1M8OB 3AE4C 1DD4A 1L0LD 1SQPK 4IL6X 2CK3H 1N7SB 4EYYQ 1OXZA 5BU8B 1A02F 3L75D 2BCCE 5KAFE 1YBKA 2PAJA 3H1LD 4W80A 1KC8Q 2ZFCA 3N4XA 1DEEG 2KOGA 1BGYD 1MFZA 2Y0EA 2PFXA 1FDMA 1GL2D 4UB8E 5KAIH 4NPDA 4OGQB 1YQ4C 2ZVOB 2ZXEB 1QGKB 2D2CB 3L71E 2FYUK 1OIPA 1GZLA 3QH9A 1FZCA 1ZN5A 1UIXA 2IYPA 2WSEH 1ZMEC 1FZAA 1GW3A 2QJKB 2JDIH 1NTMG 2W90A 4O9BA 3IF4A 2KP8A 3OW2O 2C9LY 4RESB 2JR8A 1QL1A 2W83C 2BCCD 5AW8B 4QMAA 2JO1A 2ZJSE 2ZYGA 3VMXA 1T6AA 3KDPB 3VOPA 1H89A 1X0TA 3CCVP 3S4RA 2KK7A 1URQD 5TISH 1YIJP 4N78E 1ZOYC 2KI7B 1KQGB 3H1IG 1JY2O 3L70E 4NPEA 4BXLA 2RMZA 1W2BO 1PPJE 3E1IA 2R5DA 2AEFA 4C7RA 1NU1K 1Y8AA 3L71D 1LTIC 2I1JA 1GDTA 1Q7YQ 5AW0B 2R3CA 3V2NA 1ZR2A 3SWYA 1IFDA 2K88A 4NPFX 2LR2A 1LJ2A 1K9MQ 1KN7A 5KKZB 4N3YB 4GOEA 3A0HH 2PP6A 1H0TA 1SQBJ 2CPBA 1NTKE 1OW8A 5KAIE 1BSNA 3AE1C 1ZW0A 1EZVG 2QEXP 5AVTB 1YI2P 1PPJD 1R5SA 1JEKA 3CCJP 3HE4A 5AW2B 2YKPA 5APXA 1FZBA 2QE7H 4HH2A 1YTZT 2A45G 2NPSD 2W8ZA 2B87A 1T8ZA 1N7SC 2IBZG 1PGOA 3AE2C 4EOTA 2Q3EA 1SS1A 3EFGA 3G71P 1L2PA 3CXHH 3V4WA 4DT0A 2O1KA 1X22A 2KLVA 1J1DB 4OGQC 1LP1A 3CCEP 1HF9A 2Z5IA 5KJ7D 1VQOP 2D2CC 2K3RA 4ZMDA 1G1JA 1IC2A 3CWBE 4GKGA 3L73G 1CW5A 3RGUA 2AEMA 3H1KD 1YQ3C 1SQVE 3TDKA 1ZXGA 1LTAC 4BRYB 1FZEA 3A0HE 1L0NE 3CX5H 2KZIA 2IYOA 1HGZA 3H1HG 3LW5J 4ASVA 1BE3G 4L75A 1VQ5P 1LTSC 4I2LC 2JKVA 2N1TD 4U3FJ 2PGDA 3RBZA 2GUSA 3H1JG 1U57A 5CCGC 3PHLA 1OW6A 3WUVA 1D7MA 3GW6A 3GF3A 3PRJA 5GTHE 3KQGA 3GG2A 1S5LH 1SQPJ 1GK4A 2J58A 4JF7A 5AVXB 4YPCA 1OW7A 1S9KE 1EQ7A 3CWBD 1SQVD 1KMIZ 3PP5A 2N9BA 1HWTC 3B5NB 3L74G 1L0ND 2O01N 1JO5A 4KT0J 5KKZC 1SQQD 4Y99C 2E43A 5E79E 3L73J 3CXHE 4ZKUA 5APYA 1SVFA 4PJ0H 2JP3A 2FYUJ 2XV5A 2Q6QA 1N7SD 3D71A 3CC7P 1FDOA 2QVAA 1RE4C 2POHA 3L70G 1YITP 1FBMA 1LP1B 5K5GB 3VTPC 1S72P 1SQBE 5KLIB 3CX5E 3R2PA 1WRGA 3MHVA 1N8RQ 4H0LD 4OGQD 4TT3H 2D2CD 3JCUE 2A45H 3G3ZA 3CXHD 4C46A 3TK1A 1JUNA 3BASA 2OTKE 1LTGC 2ZT9B 3NXSA 5BVZA 2JJLA 1NTKG 1S5LE 3JSVC 3HD7B 4N6JA 3CL3D 1J1DC 4RO0A 1NO4A 2QIWA 1J1EB 3HE5A 1NTMD 3CX5D 3AECC 1QVFO 5AW9B 1WT6A 2E5YA 1N7SA 5B66H 2W6AA 3AE8C 4XE5B 4PJ0E 1NTMK 1JTHB 5H2FE 2WSFJ 3EWKA 2RKLA 2B88A 3CMAP 1EZVE 5AVZB 1AJYA 2GA1A 1S4XA 2YXRB 2O01J 2YKQA 3MD0A 1M56D 2XZRA 3S1KA 3I55P 3KYQA 1NTZK 4PV1D 4KHXA 4WY4B 3G6EP 1YYCA 2WT7B 1N2DC 1PL5A 2OYHB 3CD6P 2IBZE 4OVNF 3VMAA 4AQRD 4H44C 3CMEP 3IFMA 1VDFA 4HKZH 2QM8A 1ZP0C 1EZVD 2Y9ZA 1OWAA 1PV3A 2IZ0A 5CCGA 3FXDA 2JWAA 5CBOA 4YXWH 2KLUA 5KLVK 2W6JH 2E5TA 2QJYB 4M3LA 3L73E 3MUDC 4I7ZB 2ZAEB 3V4QA 5KLIC 2H7HA 1BCCJ 1WMKA 5AVRB 3AEEC 1GU5A 3HTKB 2AXTH 2FYUE 5B66E 1AVOA 3ABVC 1VQPP 2WZ7A 3K5BA 5CHXA 2HPCB 1LGHB 2C9NY 1NGMB 2IBZD 1FU1A 1BE3E 1NH4A 5APSA 4B86A 1CSBA 2ZT9C 1P84I 1X79B 5APTA 1AVYA 3H1JE 4YXDC 3HUSB 1L0LK 3BRVB 4IFFA 2L5GB 1CZQA 1M1KQ 4ZNCA 3HD7C 1S5LX 1GMJA 1RQVA 1RE4A 2R44A 3TSIA 3L73D 3H32B 1FZFA 1J1EC 1PP9J 1J2JB 1JNMA 5CJ4A 1SQBG 3L74E 1MFTA 3II6A 3H1HD 4JYCA 4R4LA 1KB9I 1BE3D 4JQ0D 3U59A 2WSSH 3FWLA 2ZYDA 1E79H 1HTLC 3H1JD 3PTZA 3CLQA 4H44D 3VMZA 3RK3C 2KIKA 2KXPB 4ASWA 3V6IA 2AXTE 2OQQA 3WMM0 3Q1MA 4LC1A 1S1CX 1YJ9P 1Q81Q 4DOJA 2FXMA 5TJHA 4BRYA 3L74D 3BRTB 5L8RJ 2RN0A 3MP7B 1SQXG 4H13B 2OYHC 2IFMA 4PD4I 2JWDA 3BCCJ 5KTBA 1IFJA 2R5BA 1VF5B 5B5EH 2BEQD 5AVVB 4N78D 1YJNP 1OZHA 1KYOH 1KD1Q 4Y28J 4AYCA 3L70D 1EDJA 2FXPA 2ZT9D 2QJYC 2P10A 3GHGB 2MJZA 4I7ZC 2Y0DA 4JYBA 1JMMA 3FGAD 3RK3E 3AE3C 3HD7D 4WWIA 3W67A 1HJ0A 4U3FG 1MKMA 5GTHH 1BDCA 3PJSK 3B5NA 1HGVA 3KZIH 5AW3B 1JCCA 2LXBA 1U7JA 1KV4A 2K9YA 1Q82Q 1M90Q 1SFCB 4RJTA 3D70A 1SQPG 3RBXA 3AE9C 1VL2A 1HJBA 1KQFB 1NTKD 3HUSC 3L35A 2AEJA 1NTZJ 2KSJA 1SQXJ 5E79H 3E1RA 4GT1A 2XNXA 1QEXA 3P8MC 4IFMA 1RF1B 3C1LA 1CI6B 3MUDA 3TNUB 3A7OA 3VP8A
chains in the Genus database with same CATH topology
3L72J 1KB9I 3H1IJ 2IBZI 1P84I 1SQQJ 3L71J 1L0LJ 3CWBJ 3H1JJ 1PP9J 3H1HJ 5KLVJ 4PD4I 1NU1J 1SQVJ 3L75J 1SQPJ 1EZVI 3BCCJ 3CXHI 3L74J 4D6TJ 1NTZJ 4U3FJ 1SQXJ 3H1LJ 3TGUJ 1BE3J 3L73J 1L0NJ 2BCCJ 1SQBJ 3CX5I 1BCCJ 1NTKJ 1BGYJ 3L70J 1NTMJ 3H1KJ 2FYUJ 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 J;  1KB9 I;  3H1I J;  2IBZ I;  1P84 I;  1SQQ J;  3L71 J;  1L0L J;  3CWB J;  3H1J J;  1PP9 J;  3H1H J;  5KLV J;  4PD4 I;  1NU1 J;  1SQV J;  3L75 J;  1SQP J;  1EZV I;  3BCC J;  3CXH I;  3L74 J;  4D6T J;  1NTZ J;  4U3F J;  1SQX J;  3H1L J;  3TGU J;  1BE3 J;  3L73 J;  1L0N J;  2BCC J;  1SQB J;  3CX5 I;  1BCC J;  1NTK J;  1BGY J;  3L70 J;  1NTM J;  3H1K J;  2FYU J;  1KYO I; 
#chains in the Genus database with same CATH topology
 1DEB A;  2M3B A;  2A06 E;  2L91 A;  2W27 A;  3RK3 D;  5AVQ B;  1AFO A;  2HYN A;  2V7Q J;  1VQ4 P;  1VPC A;  2QJK C;  2OGU A;  1L4A B;  2FYU G;  2WPS A;  3CCU P;  3ZDM A;  2E76 B;  5B5E E;  1NKZ B;  2ZVN B;  3H25 A;  2Q5U A;  3A0B H;  3TGU G;  1KYO E;  1PP9 E;  5KLV J;  2G3A A;  4BWN A;  3O6Q A;  3MTU E;  1FJP A;  3JCU H;  1IJD B;  1VQL P;  1USE A;  2HR3 A;  1KTM A;  1GU4 A;  3HD7 A;  3F89 A;  1LT1 A;  3AE5 C;  1QX8 A;  4HJG H;  3CCL P;  4L76 A;  1DIP A;  2AXC A;  3BVH A;  3KZI E;  1TU3 F;  1RE3 C;  4I6M C;  3Q5S A;  3IR9 A;  1NU1 G;  3T97 B;  2OAR A;  4LLH A;  4H13 C;  1VQ7 P;  1L0L J;  1R5L A;  1JTH A;  1FDI A;  1P84 E;  4PD4 H;  3L75 J;  1VF5 C;  1RF0 C;  1SQV K;  3H1L J;  2WSC J;  1KYO D;  2PRR A;  1N73 A;  1FE6 A;  1OVV A;  2LXC B;  4RKU J;  4MN4 C;  1BGY J;  1L0N K;  3CPW O;  1NVO A;  4Z1M H;  1MZ9 A;  1JY3 N;  3FXE A;  1HBW A;  5H2F H;  1SQQ K;  3NMD A;  2V7Q H;  1EXJ A;  1KZU B;  3GHG C;  3TGU J;  3L72 G;  2SPZ A;  2M5A B;  3LW5 H;  1YJW P;  2HFE D;  4WY4 A;  1S9K D;  1KOR A;  2WT7 A;  1IK9 A;  1MV8 A;  2JEE A;  3N7N A;  2N9Y B;  2B9B A;  3A0B E;  2OYH A;  4YTP C;  1QVG O;  5CMZ A;  1LTB C;  1M1J B;  2HOD A;  1N7L A;  2YO3 A;  3OA7 A;  2C0W A;  2BCC J;  1G1I A;  2KS1 B;  3CCM P;  3IN6 A;  2Q1K A;  3O6Q B;  2QM7 A;  1NU1 J;  2QSI A;  3U1C A;  3P7K A;  3SSU A;  1PGP A;  1GD2 E;  5CCH C;  2FKW B;  3VMY A;  4UB6 H;  3S9O A;  5AW5 B;  4CPG A;  5AW7 B;  4LGD E;  3EFF K;  1RY3 A;  2WTY A;  2YNY A;  3HTK A;  4L74 A;  5DJT B;  3L71 J;  1ZR4 A;  3TYY A;  1SQB D;  1M7L A;  1FS0 E;  2WSC H;  1HVV A;  5CCG D;  4PD4 E;  1SQX E;  1L4A C;  2HPC A;  4K3A A;  1KFM A;  4L73 A;  3M9B A;  2NPS B;  3L72 J;  3V2Q A;  3M9H A;  1NHL A;  2E74 B;  3D6Z A;  4IOI H;  2B89 A;  3H6P A;  1NKN A;  3HUS A;  1BCC G;  4H13 D;  1N73 B;  2WPR A;  2FFD B;  1VQM P;  1YTZ I;  2ZYA A;  1JB0 J;  1FOS F;  3TF5 A;  1VF5 D;  5AVS B;  2WMM A;  3A2A A;  3RL0 B;  1AQ5 A;  3H32 A;  3JC2 2;  2OYI A;  2IFN A;  1N86 A;  3AEG C;  1NWQ A;  2ZXX A;  2M0B A;  4U3F E;  3SWF A;  1NAF A;  4PD4 D;  1LTJ B;  1SQX D;  2A06 G;  1GTW A;  3D6Y A;  3B5N C;  1QLE D;  1RHZ B;  5BU5 A;  2HOD B;  2QRX A;  1SQP E;  1PIX A;  1IFP A;  4I1L A;  4AUW A;  3WU2 E;  2YXQ B;  2IZ1 A;  2Q7C A;  1EDI A;  1T3U A;  1NOH A;  4UB6 E;  1PP9 G;  2H88 C;  3WUT A;  3VN0 A;  2N1T B;  5AVU B;  3L75 E;  4C7N B;  1FZG A;  2WSE J;  3H1L E;  4EI2 A;  3MIW A;  2G8Y A;  1VQ6 P;  4U3F D;  1IO4 A;  5CCH D;  1BGY E;  1RE3 A;  3H1K J;  1LT9 B;  1ZRT E;  1LNQ A;  2WSF H;  3NTN A;  1LWU A;  1SP4 A;  5GTI H;  3AED C;  4W7Z A;  1R8E A;  3TGU E;  4JPZ B;  1RF0 A;  2O01 H;  1SQP D;  3LIE A;  4WVZ A;  1LTT C;  1L4A D;  2K9J B;  1EC5 A;  3I5C A;  3MZW B;  3SFD C;  3GHG A;  3Q5P A;  3L4F A;  1DX7 A;  3BCC G;  2KNC B;  1VQ8 P;  2KZJ A;  3CWB J;  2OYI B;  2XU6 A;  1SQV J;  1NU1 E;  1X9V A;  2O1J A;  2FYU D;  3CXH I;  1KIL B;  4GDO A;  2WPQ A;  1T2K C;  3AE6 C;  1ZRT D;  1IK7 A;  5APV A;  1L0N J;  3Q3D A;  4H0L B;  1YHQ P;  2NPS C;  3TGU D;  3FX0 A;  1SFC A;  1SQQ J;  2BAS A;  2E74 C;  3E7K A;  5C39 A;  1HUC A;  1G2C B;  3B5N D;  3V5B A;  1N73 C;  2FFD C;  5CCH A;  3OAK A;  3CX5 I;  2K37 A;  3M9Q A;  5AVW B;  4HB1 A;  2LKM A;  2QA4 P;  1RF1 A;  1PGJ A;  1CI6 A;  2UWJ E;  3L72 E;  3V2P A;  1DH3 A;  3TNU A;  3RL0 C;  3LID A;  4EDF A;  1Y9B A;  5KJ7 C;  1KFN A;  5GTI E;  1DD3 A;  1NU1 D;  4WY4 C;  1LTJ C;  1JY2 N;  1L4A A;  2W6B A;  3M0D C;  1NTZ G;  3NFQ A;  1LWU B;  1MUU A;  1Q2N A;  1Q86 Q;  4JBZ A;  5AVY B;  2WWW A;  2IDB A;  1EDL A;  3GMA A;  2N1T C;  4D6T G;  1K05 A;  3RK2 B;  2P7J A;  3CCQ P;  2WQY C;  1GL2 A;  3L72 D;  3V2R A;  2CPS A;  4Y99 B;  1BDD A;  2I1K A;  1OVR A;  2GUV A;  1NAY A;  1JY2 P;  5KLV G;  1NTM J;  1Q90 D;  2H8P D;  2DW3 A;  2WIT A;  3T97 A;  3VYI A;  4U7J A;  1IFM A;  1LT9 C;  4PV1 B;  3KXD A;  5APU A;  2QG4 A;  1EZV I;  1NJI Q;  2FYZ A;  1E5W A;  1JCD A;  2E42 A;  1BCC E;  3AEA C;  1GW4 A;  2E75 B;  3H1K E;  1T2K D;  3H1I J;  1FZC B;  1P84 H;  1URQ A;  3Q5R A;  3A5T A;  3GF7 A;  2WVR A;  2H89 C;  2XDJ A;  1PZQ A;  1H88 A;  2A45 I;  1XTG B;  2E74 D;  5TIS E;  5M1B A;  4XA4 A;  3OJA B;  1L0L G;  2M5A A;  3W68 A;  3L75 G;  2IBZ I;  2OYI C;  3H1L G;  3CCR P;  1KIL C;  4ZKP A;  4D6T J;  5AW4 B;  3RL0 D;  1BGY G;  2GM4 A;  1M1J A;  4H0L C;  3AEF C;  1NTK K;  2FXO A;  2KS1 A;  1KB9 H;  4WY4 D;  2WPV B;  1BCC D;  2M8R A;  1KQL A;  4EIJ A;  4K35 A;  1FJK A;  2KUB A;  3R4Y A;  1PGQ A;  1T3J A;  3P8C E;  2Z4E A;  1IFI A;  4TLF A;  2OYO A;  3G9R A;  2Y0C A;  1USD A;  2P1J A;  1SQQ E;  4OH8 B;  1GL2 B;  3SFE C;  2BCC G;  4IL6 H;  3GLM A;  1H0T B;  2A06 D;  2RH0 A;  1VQN P;  2HLO A;  4GOD A;  2FYN B;  1A02 J;  3KPE A;  1BSH A;  2NPS A;  1LWU C;  1SLQ A;  3CC4 P;  2J59 M;  3UIA A;  3KHU A;  3SWK A;  1XTC C;  2VRS A;  3HE4 B;  1H8A A;  1KIL E;  1PP9 D;  3L71 G;  5CJ0 A;  2FFD A;  2Z5H A;  4GIF A;  2KSE A;  3CCS P;  1HH0 A;  3P8C D;  5EFW B;  2V4H A;  1URQ B;  3RK2 C;  1JY3 O;  4HYT B;  2M3E A;  3MGN A;  2B87 B;  4H44 B;  2NRG A;  3PLN A;  3BCC E;  3QWO C;  3M06 A;  3FWN A;  5KJ7 A;  2ITA A;  1IFN A;  1LTJ A;  1W2E A;  3I56 P;  1K73 Q;  1FAV A;  3M0D A;  4PV1 C;  3H1H J;  2YIU B;  1KB9 E;  2QJP B;  1JOC A;  1IZN B;  1OVU A;  1JMB A;  4DCK A;  3M0A A;  1BE3 J;  1P84 D;  1PPJ G;  2Y9Y A;  1KIL D;  2Q9I A;  1SFC C;  5APW A;  1S2E A;  2E75 C;  1NTM E;  1FZC C;  1FC2 C;  1FOS E;  5APQ A;  2N1T A;  3H1J J;  2O3J A;  3B4S A;  4W7Y A;  2NZ2 A;  1JY3 P;  2OTL P;  2R3S A;  3WU2 H;  4IL6 E;  4C7N A;  2HG5 D;  3C9I A;  1RF1 C;  1W5C E;  3BCC D;  2H43 A;  3G4S P;  1UII A;  4WB4 A;  4WBA A;  2BEZ F;  1OMI A;  4GOF A;  3H1I E;  3CI9 A;  2YO2 A;  3AE7 C;  4A7P A;  1AA0 A;  3HRN A;  3L74 J;  1LT9 A;  1NTZ E;  1KB9 D;  3RL0 g;  1Y47 A;  2XKM A;  3WUU A;  2Q3I A;  2E76 C;  3CC2 P;  1VQK P;  1U7M A;  3L37 A;  1KQS O;  1AQT A;  2IPP A;  1SQB K;  1PFI A;  1NYH A;  2K9J A;  4D6T E;  2YMK A;  4R4M A;  3H1K G;  4XFJ A;  3A3Y B;  3L70 J;  4DJG A;  2OTJ P;  1GL2 C;  1K8A Q;  2KNC A;  3C8V A;  5KLV E;  3P32 A;  3H1I D;  3USS A;  1RQU A;  3Q2Y A;  1KIL A;  3RK2 D;  1K04 A;  1QL2 A;  5KAF H;  2YKO A;  2R32 A;  2FYN C;  3RK3 B;  1JM0 A;  1NTZ D;  1OFC X;  1EDK A;  3BAT A;  4IFD K;  2MKV A;  2P2U A;  2FBW C;  4DZO A;  4UB8 H;  1SQX K;  1G2C A;  1AV1 A;  4D6T D;  1NTK J;  1Z56 A;  3CWB G;  2P67 A;  1VQ9 P;  1SQV G;  5CBN A;  2C0X A;  1URQ C;  1L0L E;  5DJU B;  1SFC D;  1X8Y A;  3B71 A;  3B8E B;  2E75 D;  1L0N G;  2J5U A;  3EQ2 A;  1OX3 A;  5KLV D;  2KB7 P;  1SQQ G;  1RH5 B;  3ITK A;  3L36 A;  4KJM A;  3IAO A;  1KYO I;  3F5H A;  2I8D A;  2FY8 A;  2P58 A;  2YIU C;  2QJP C;  1M57 D;  2K1A A;  5AW1 B;  5AW6 B;  3O8Z A;  4OWF A;  2YMY A;  1M1J C;  1ZLL A;  2KYV A;  1ZV8 A;  3VP9 A;  1GK6 A;  3M91 A;  3AEB C;  3U1A A;  2XND H;  2IX7 C;  3HE5 B;  2E76 D;  3H1H E;  1EXI A;  3PH0 A;  1S3J A;  1M8O B;  3AE4 C;  1DD4 A;  1L0L D;  1SQP K;  4IL6 X;  2CK3 H;  1N7S B;  4EYY Q;  1OXZ A;  5BU8 B;  1A02 F;  3L75 D;  2BCC E;  5KAF E;  1YBK A;  2PAJ A;  3H1L D;  4W80 A;  1KC8 Q;  2ZFC A;  3N4X A;  1DEE G;  2KOG A;  1BGY D;  1MFZ A;  2Y0E A;  2PFX A;  1FDM A;  1GL2 D;  4UB8 E;  5KAI H;  4NPD A;  4OGQ B;  1YQ4 C;  2ZVO B;  2ZXE B;  1QGK B;  2D2C B;  3L71 E;  2FYU K;  1OIP A;  1GZL A;  3QH9 A;  1FZC A;  1ZN5 A;  1UIX A;  2IYP A;  2WSE H;  1ZME C;  1FZA A;  1GW3 A;  2QJK B;  2JDI H;  1NTM G;  2W90 A;  4O9B A;  3IF4 A;  2KP8 A;  3OW2 O;  2C9L Y;  4RES B;  2JR8 A;  1QL1 A;  2W83 C;  2BCC D;  5AW8 B;  4QMA A;  2JO1 A;  2ZJS E;  2ZYG A;  3VMX A;  1T6A A;  3KDP B;  3VOP A;  1H89 A;  1X0T A;  3CCV P;  3S4R A;  2KK7 A;  1URQ D;  5TIS H;  1YIJ P;  4N78 E;  1ZOY C;  2KI7 B;  1KQG B;  3H1I G;  1JY2 O;  3L70 E;  4NPE A;  4BXL A;  2RMZ A;  1W2B O;  1PPJ E;  3E1I A;  2R5D A;  2AEF A;  4C7R A;  1NU1 K;  1Y8A A;  3L71 D;  1LTI C;  2I1J A;  1GDT A;  1Q7Y Q;  5AW0 B;  2R3C A;  3V2N A;  1ZR2 A;  3SWY A;  1IFD A;  2K88 A;  4NPF X;  2LR2 A;  1LJ2 A;  1K9M Q;  1KN7 A;  5KKZ B;  4N3Y B;  4GOE A;  3A0H H;  2PP6 A;  1H0T A;  1SQB J;  2CPB A;  1NTK E;  1OW8 A;  5KAI E;  1BSN A;  3AE1 C;  1ZW0 A;  1EZV G;  2QEX P;  5AVT B;  1YI2 P;  1PPJ D;  1R5S A;  1JEK A;  3CCJ P;  3HE4 A;  5AW2 B;  2YKP A;  5APX A;  1FZB A;  2QE7 H;  4HH2 A;  1YTZ T;  2A45 G;  2NPS D;  2W8Z A;  2B87 A;  1T8Z A;  1N7S C;  2IBZ G;  1PGO A;  3AE2 C;  4EOT A;  2Q3E A;  1SS1 A;  3EFG A;  3G71 P;  1L2P A;  3CXH H;  3V4W A;  4DT0 A;  2O1K A;  1X22 A;  2KLV A;  1J1D B;  4OGQ C;  1LP1 A;  3CCE P;  1HF9 A;  2Z5I A;  5KJ7 D;  1VQO P;  2D2C C;  2K3R A;  4ZMD A;  1G1J A;  1IC2 A;  3CWB E;  4GKG A;  3L73 G;  1CW5 A;  3RGU A;  2AEM A;  3H1K D;  1YQ3 C;  1SQV E;  3TDK A;  1ZXG A;  1LTA C;  4BRY B;  1FZE A;  3A0H E;  1L0N E;  3CX5 H;  2KZI A;  2IYO A;  1HGZ A;  3H1H G;  3LW5 J;  4ASV A;  1BE3 G;  4L75 A;  1VQ5 P;  1LTS C;  4I2L C;  2JKV A;  2N1T D;  4U3F J;  2PGD A;  3RBZ A;  2GUS A;  3H1J G;  1U57 A;  5CCG C;  3PHL A;  1OW6 A;  3WUV A;  1D7M A;  3GW6 A;  3GF3 A;  3PRJ A;  5GTH E;  3KQG A;  3GG2 A;  1S5L H;  1SQP J;  1GK4 A;  2J58 A;  4JF7 A;  5AVX B;  4YPC A;  1OW7 A;  1S9K E;  1EQ7 A;  3CWB D;  1SQV D;  1KMI Z;  3PP5 A;  2N9B A;  1HWT C;  3B5N B;  3L74 G;  1L0N D;  2O01 N;  1JO5 A;  4KT0 J;  5KKZ C;  1SQQ D;  4Y99 C;  2E43 A;  5E79 E;  3L73 J;  3CXH E;  4ZKU A;  5APY A;  1SVF A;  4PJ0 H;  2JP3 A;  2FYU J;  2XV5 A;  2Q6Q A;  1N7S D;  3D71 A;  3CC7 P;  1FDO A;  2QVA A;  1RE4 C;  2POH A;  3L70 G;  1YIT P;  1FBM A;  1LP1 B;  5K5G B;  3VTP C;  1S72 P;  1SQB E;  5KLI B;  3CX5 E;  3R2P A;  1WRG A;  3MHV A;  1N8R Q;  4H0L D;  4OGQ D;  4TT3 H;  2D2C D;  3JCU E;  2A45 H;  3G3Z A;  3CXH D;  4C46 A;  3TK1 A;  1JUN A;  3BAS A;  2OTK E;  1LTG C;  2ZT9 B;  3NXS A;  5BVZ A;  2JJL A;  1NTK G;  1S5L E;  3JSV C;  3HD7 B;  4N6J A;  3CL3 D;  1J1D C;  4RO0 A;  1NO4 A;  2QIW A;  1J1E B;  3HE5 A;  1NTM D;  3CX5 D;  3AEC C;  1QVF O;  5AW9 B;  1WT6 A;  2E5Y A;  1N7S A;  5B66 H;  2W6A A;  3AE8 C;  4XE5 B;  4PJ0 E;  1NTM K;  1JTH B;  5H2F E;  2WSF J;  3EWK A;  2RKL A;  2B88 A;  3CMA P;  1EZV E;  5AVZ B;  1AJY A;  2GA1 A;  1S4X A;  2YXR B;  2O01 J;  2YKQ A;  3MD0 A;  1M56 D;  2XZR A;  3S1K A;  3I55 P;  3KYQ A;  1NTZ K;  4PV1 D;  4KHX A;  4WY4 B;  3G6E P;  1YYC A;  2WT7 B;  1N2D C;  1PL5 A;  2OYH B;  3CD6 P;  2IBZ E;  4OVN F;  3VMA A;  4AQR D;  4H44 C;  3CME P;  3IFM A;  1VDF A;  4HKZ H;  2QM8 A;  1ZP0 C;  1EZV D;  2Y9Z A;  1OWA A;  1PV3 A;  2IZ0 A;  5CCG A;  3FXD A;  2JWA A;  5CBO A;  4YXW H;  2KLU A;  5KLV K;  2W6J H;  2E5T A;  2QJY B;  4M3L A;  3L73 E;  3MUD C;  4I7Z B;  2ZAE B;  3V4Q A;  5KLI C;  2H7H A;  1BCC J;  1WMK A;  5AVR B;  3AEE C;  1GU5 A;  3HTK B;  2AXT H;  2FYU E;  5B66 E;  1AVO A;  3ABV C;  1VQP P;  2WZ7 A;  3K5B A;  5CHX A;  2HPC B;  1LGH B;  2C9N Y;  1NGM B;  2IBZ D;  1FU1 A;  1BE3 E;  1NH4 A;  5APS A;  4B86 A;  1CSB A;  2ZT9 C;  1P84 I;  1X79 B;  5APT A;  1AVY A;  3H1J E;  4YXD C;  3HUS B;  1L0L K;  3BRV B;  4IFF A;  2L5G B;  1CZQ A;  1M1K Q;  4ZNC A;  3HD7 C;  1S5L X;  1GMJ A;  1RQV A;  1RE4 A;  2R44 A;  3TSI A;  3L73 D;  3H32 B;  1FZF A;  1J1E C;  1PP9 J;  1J2J B;  1JNM A;  5CJ4 A;  1SQB G;  3L74 E;  1MFT A;  3II6 A;  3H1H D;  4JYC A;  4R4L A;  1KB9 I;  1BE3 D;  4JQ0 D;  3U59 A;  2WSS H;  3FWL A;  2ZYD A;  1E79 H;  1HTL C;  3H1J D;  3PTZ A;  3CLQ A;  4H44 D;  3VMZ A;  3RK3 C;  2KIK A;  2KXP B;  4ASW A;  3V6I A;  2AXT E;  2OQQ A;  3WMM 0;  3Q1M A;  4LC1 A;  1S1C X;  1YJ9 P;  1Q81 Q;  4DOJ A;  2FXM A;  5TJH A;  4BRY A;  3L74 D;  3BRT B;  5L8R J;  2RN0 A;  3MP7 B;  1SQX G;  4H13 B;  2OYH C;  2IFM A;  4PD4 I;  2JWD A;  3BCC J;  5KTB A;  1IFJ A;  2R5B A;  1VF5 B;  5B5E H;  2BEQ D;  5AVV B;  4N78 D;  1YJN P;  1OZH A;  1KYO H;  1KD1 Q;  4Y28 J;  4AYC A;  3L70 D;  1EDJ A;  2FXP A;  2ZT9 D;  2QJY C;  2P10 A;  3GHG B;  2MJZ A;  4I7Z C;  2Y0D A;  4JYB A;  1JMM A;  3FGA D;  3RK3 E;  3AE3 C;  3HD7 D;  4WWI A;  3W67 A;  1HJ0 A;  4U3F G;  1MKM A;  5GTH H;  1BDC A;  3PJS K;  3B5N A;  1HGV A;  3KZI H;  5AW3 B;  1JCC A;  2LXB A;  1U7J A;  1KV4 A;  2K9Y A;  1Q82 Q;  1M90 Q;  1SFC B;  4RJT A;  3D70 A;  1SQP G;  3RBX A;  3AE9 C;  1VL2 A;  1HJB A;  1KQF B;  1NTK D;  3HUS C;  3L35 A;  2AEJ A;  1NTZ J;  2KSJ A;  1SQX J;  5E79 H;  3E1R A;  4GT1 A;  2XNX A;  1QEX A;  3P8M C;  4IFM A;  1RF1 B;  3C1L A;  1CI6 B;  3MUD A;  3TNU B;  3A7O A;  3VP8 A; 
#chains in the Genus database with same CATH homology
 3L72 J;  1KB9 I;  3H1I J;  2IBZ I;  1P84 I;  1SQQ J;  3L71 J;  1L0L J;  3CWB J;  3H1J J;  1PP9 J;  3H1H J;  5KLV J;  4PD4 I;  1NU1 J;  1SQV J;  3L75 J;  1SQP J;  1EZV I;  3BCC J;  3CXH I;  3L74 J;  4D6T J;  1NTZ J;  4U3F J;  1SQX J;  3H1L J;  3TGU J;  1BE3 J;  3L73 J;  1L0N J;  2BCC J;  1SQB J;  3CX5 I;  1BCC J;  1NTK J;  1BGY J;  3L70 J;  1NTM J;  3H1K J;  2FYU J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...