1SQBJ

Crystal structure analysis of bovine bc1 with azoxystrobin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 19
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1sqbJ00
3L70J 1BE3J 3TGUJ 1SQXJ 1EZVI 2FYUJ 2IBZI 3L72J 3BCCJ 1PP9J 1KB9I 3L74J 5KLVJ 4U3FJ 1L0LJ 1KYOI 1NTMJ 1NU1J 3L71J 1BCCJ 2BCCJ 3H1HJ 3H1IJ 3H1JJ 3H1LJ 4D6TJ 1NTZJ 1P84I 3CWBJ 3CX5I 1BGYJ 1SQQJ 1SQPJ 1SQVJ 1SQBJ 3H1KJ 4PD4I 1L0NJ 3CXHI 3L73J 1NTKJ 3L75J
chains in the Genus database with same CATH superfamily
2OTKE 1N73C 1KYOH 1BE3J 3CWBE 3RL0B 3GG2A 2NZ2A 1HUCA 3P8MC 1FJPA 3BRTB 1BE3D 3P7KA 4I7ZB 1L0NG 1ZW0A 2QIWA 4H0LD 5CCGD 1VQPP 2KNCB 2WTYA 5E79E 1NTME 3ABVC 1LJ2A 1KYOE 2E75B 2J5UA 3E7KA 1IC2A 2CPBA 3GLMA 1VDFA 1SQPD 2NPSA 1S9KE 1OVRA 2O01J 4JPZB 2KZIA 1L0LD 5CJ4A 2OQQA 1NU1E 2N1TB 2YMKA 1VL2A 3V4QA 1P84I 5B5EH 1LWUC 4XFJA 4GKGA 4YPCA 1A02F 2A06G 2E5YA 3OAKA 1ZR4A 2BCCG 2YMYA 3BATA 1JTHB 3RL0D 1N7SB 1S72P 3L74D 1X8YA 2WMMA 1YJNP 1S2EA 3L74G 4PD4E 4Z1MH 3H1LE 3O6QA 1SQVK 1YTZI 2YO3A 2JWDA 3F89A 4D6TD 1FDOA 3AE1C 3AEFC 3GF7A 4NPEA 3TNUA 3CCEP 2QSIA 2YIUC 1ZN5A 4JYCA 2E75D 1EZVI 1MZ9A 1SQBK 1BE3E 1ZMEC 3V2RA 1KILA 1NKNA 2L91A 2M0BA 1E5WA 2V4HA 2ZT9B 3L73G 3MIWA 3MP7B 1GW3A 2QEXP 1T2KD 1W2BO 2Z4EA 3L72E 1H0TA 4O9BA 1KYOD 3AEGC 3Q5SA 4OGQC 1BGYG 1PV3A 2GA1A 2QRXA 2CPSA 4XE5B 2OTLP 1NTMJ 3H1ID 3G71P 1Q2NA 2Q3EA 2P2UA 3CC2P 5KJ7D 1BCCJ 1L0LE 3A0BH 3H1IJ 1L0NK 2KI7B 1N7SD 1OVVA 2K9JA 1JY2O 3L71E 2W27A 1NTZG 3JC22 3MGNA 3RGUA 2W6BA 1XTCC 1EXIA 1IFJA 1JOCA 1TU3F 2A45G 2JKVA 4H0LC 5AW9B 3JCUE 2QM8A 1CI6B 2IYPA 3H1LD 4D6TE 3OJAB 1VQKP 1KFNA 2C0XA 4K3AA 1S5LH 2QVAA 1FC2C 1OMIA 3BCCE 4QMAA 1KN7A 1PGPA 1PGQA 1SQXJ 1DEBA 2E5TA 3R4YA 3AE9C 1RQVA 5M1BA 5APQA 1Y8AA 2WQYC 5KJ7A 2KLVA 2QJPC 1JTHA 3B8EB 3H1KG 1H89A 2RH0A 3VMYA 2WSFJ 1FZCB 1IO4A 3MTUE 1M90Q 1J1DC 2JR8A 3HRNA 5APVA 1DX7A 5L8RJ 3AE8C 2N9BA 3I5CA 1M56D 4EOTA 2M8RA 3AE6C 1KILE 1S5LX 1R8EA 1FZBA 1HVVA 3FXEA 5AVRB 1YJ9P 2FYZA 1JMBA 3H32A 4Y28J 1URQC 1OVUA 1ZP0C 1RF1C 2LKMA 1KC8Q 3NTNA 3PJSK 5AW3B 2N1TD 3L73J 4EI2A 1N7SC 5CBOA 1QX8A 3TGUG 3A5TA 1YQ3C 3WU2E 1L0LG 4U7JA 2OYIA 1LWUB 3PHLA 3D71A 1LTJB 1NO4A 4YTPC 3JCUH 3L74J 1YBKA 3OA7A 5CCHD 2FFDC 4U3FJ 3Q5RA 1H8AA 3H1JE 3L75D 2H8PD 2B87B 2FYNC 2QJPB 1RY3A 2KZJA 2Y0CA 4U3FD 3TDKA 3TNUB 3USSA 1N2DC 2C0WA 1T3UA 1JY3N 5B66E 2Y9ZA 3AE7C 2OYOA 1K04A 3H1IG 4BRYB 1RE4A 1NU1G 1KILD 1W2EA 2FBWC 3JSVC 3H1HJ 2LXBA 3VMAA 4UB6H 2FXOA 2PP6A 3L70E 1T8ZA 1HGVA 5AVTB 2OYIB 1IFDA 3IFMA 2B9BA 2YO2A 2FXPA 3EFGA 3M0AA 1MKMA 1Q86Q 2IBZE 5AVXB 1FZGA 1S3JA 4JF7A 1AV1A 3S9OA 4PJ0H 2YNYA 4WY4C 1BE3G 1M7LA 1K05A 3B5NC 2E43A 1KQSO 2KS1B 1JMMA 3EFFK 2ZVNB 1BDDA 1NTMK 5H2FE 5CBNA 3H1JD 1AFOA 1FU1A 1GW4A 1L4AC 3WMM0 4U3FE 2HR3A 2KB7P 2HODB 1GD2E 5AW6B 1WRGA 2Q7CA 1SQBE 1K9MQ 3S4RA 1Y9BA 3CX5E 2WVRA 2MKVA 1Z56A 1EDJA 3L70D 1QVGO 1Q82Q 3H1JG 2IZ1A 2RKLA 2PGDA 3V2NA 1T2KC 1OFCX 3HD7D 1SQXK 3TF5A 1SLQA 2VRSA 4IL6H 1PGOA 3CWBD 3AEEC 1YHQP 1SQPK 1KMIZ 1LTIC 2FYUJ 2QM7A 1L4AD 1EZVE 1DEEG 1RF0C 3M9QA 1K73Q 1LP1A 1NTMD 3KZIH 3CCUP 1DD3A 1L2PA 1PGJA 2IBZG 3ZDMA 2WSSH 4ASVA 5AVYB 3AEDC 1YYCA 1SP4A 1P84H 1J1EB 1SQPE 1SQQD 1NYHA 2AEMA 1NU1J 2R3SA 2QG4A 1RQUA 2ZYDA 1VQ7P 2H7HA 3NXSA 1VQNP 4XA4A 1YJWP 3CX5D 4PV1B 2PFXA 1NU1D 2Q5UA 3AEAC 3HD7B 1LTGC 2K3RA 2KLUA 3KPEA 2L5GB 1WMKA 2W83C 4IFFA 1VQ8P 3CMEP 1G1JA 4OWFA 1NTKK 1LTTC 2HLOA 4U3FG 1SQBJ 2K37A 1USEA 4HB1A 3U59A 4ZMDA 3H1KJ 2O01H 1H88A 3AEBC 1PPJG 3RK2C 3EWKA 4PD4D 3TGUE 1VF5B 2R3CA 5AVQB 3RK2D 4TT3H 2OARA 2V7QH 3LW5H 4W7YA 5AW0B 3VOPA 1SQVD 1OIPA 1YIJP 1FZCA 1BSHA 2OGUA 1E79H 1EZVD 3L72J 5KLVJ 4KHXA 3U1CA 3PP5A 3M0DC 3RBZA 1AQTA 3II6A 2N1TA 3GW6A 3L72D 3SFEC 3E1IA 3W68A 1M1KQ 2WSEJ 1HJBA 1J1EC 4C46A 1HBWA 1ZV8A 1SQQE 2KSEA 1R5LA 2FYUE 3H1IE 3CLQA 3LW5J 1QL1A 1FZFA 1QGKB 2W8ZA 3L71J 5EFWB 3AE3C 3V5BA 3PLNA 1HTLC 1FDMA 2A45H 5KAIE 3L71D 2J59M 4HKZH 3TSIA 3KYQA 1DIPA 3L71G 4N6JA 1VF5D 1SQPJ 1L0NE 3L73D 1OXZA 4B86A 1FJKA 1RE4C 1KILC 2NPSD 1J2JB 1EC5A 3TGUD 1KV4A 3IR9A 4C7NB 4WWIA 4UB8H 3TGUJ 2POHA 3G3ZA 3MD0A 3BCCG 5APYA 3L36A 1OW8A 1SQVE 3CXHE 4A7PA 1NGMB 1YTZT 1NTKG 1PP9J 3CCRP 5AW8B 2OYHC 3VMXA 4YXDC 3D6YA 3FWLA 5KLIB 2M5AB 2AXTH 3OW2O 1CI6A 3V4WA 4BWNA 3M06A 5AVSB 2WT7A 1QL2A 3M91A 4PJ0E 1BCCG 1G2CA 1SFCD 2E74C 2FYUD 3H1HD 4JBZA 4KJMA 3T97B 5AW5B 2KYVA 1VQ4P 1ZR2A 2QJYC 1NTKD 5GTHE 4GOEA 5KTBA 2XNDH 3KDPB 1NAYA 2QA4P 2IFMA 2WZ7A 1SQQJ 1L0ND 3KHUA 3L73E 4ASWA 5K5GB 3V2QA 1CW5A 1BCCD 1M8OB 1L0NJ 2D2CC 1KB9H 2FYUG 3E1RA 1JY3O 3PTZA 1SQQK 2JDIH 1XTGB 3QH9A 5B66H 3M9BA 1U57A 3D70A 3VN0A 3C8VA 1NAFA 2M3BA 2IDBA 1R5SA 3A0HE 3RK3C 3CXHD 2R5BA 2XNXA 2GUSA 3H1KD 3HE5B 4H13B 2ZAEB 1GZLA 1WT6A 1SVFA 2SPZA 2XZRA 2BASA 4L73A 4OGQB 4ZKUA 2BEQD 2E76C 2I8DA 4GIFA 4MN4C 1DD4A 5KAIH 1GK6A 2ZT9D 1HH0A 3AECC 2FYNB 2E76D 1NHLA 3CI9A 2YXRB 3H1HE 4WBAA 1PP9E 5KLVD 1EXJA 1EDLA 1JUNA 4M3LA 4HYTB 4LLHA 1SQVG 1GU4A 2XU6A 1JY3P 2FFDB 1AVYA 1FBMA 1NTKE 1LTJC 3MUDA 2KK7A 1KZUB 3N4XA 2ITAA 3W67A 1U7MA 3I56P 1T6AA 2B87A 1M1JC 3FX0A 2K88A 1M1JB 1OZHA 2KS1A 1LTSC 2HG5D 2WPRA 3B5NA 3IN6A 2Y0EA 1BCCE 5KAFE 3WUVA 1NJIQ 1OW6A 1HJ0A 4H44D 5DJTB 3CCMP 1USDA 2HYNA 2N1TC 2ZFCA 3BRVB 1YITP 3M0DA 1L4AA 3PH0A 1FZEA 3T97A 1AQ5A 3A2AA 1NKZB 2J58A 2WPSA 3CXHH 3O8ZA 3A7OA 4RKUJ 3G6EP 4W80A 2E76B 4K35A 2FYUK 2KUBA 1NTZK 4UB8E 3D6ZA 1NWQA 3A0HH 1SQQG 1CSBA 2ZVOB 1KB9D 4GDOA 5CMZA 1S5LE 4LGDE 1GK4A 1M1JA 3B5NB 3GHGA 3HUSC 3RBXA 1GTWA 4WB4A 4WY4B 1SQBG 1GL2A 3B4SA 3PRJA 1P84E 3Q2YA 1UIXA 2WPQA 3CX5I 4N78E 3WUTA 1YI2P 1MV8A 1NTZD 3CC4P 4IFDK 1SFCA 1VF5C 2OYIC 2H89C 4Y99C 4ZNCA 1LT9A 3HE4A 5KKZB 2AEJA 4GT1A 4Y99B 1NTKJ 1FE6A 1OX3A 1PP9G 1RH5B 1S4XA 2DW3A 2P10A 2QJYB 2WSEH 4L76A 4NPFX 5TISE 3RK3D 1VQ6P 3VYIA 5GTIH 4I2LC 1ZOYC 3SWFA 3TK1A 4PV1C 2V7QJ 5CJ0A 1EDIA 1EZVG 1L0LJ 2R5DA 1SQXG 2AEFA 1NH4A 2I1KA 2LR2A 5KLIC 5C39A 3I55P 1Y47A 2QJKC 4WY4D 1VQ5P 1JB0J 1UIIA 2JO1A 3H1LG 2KXPB 4I1LA 1N7LA 2LXCB 2W90A 2NRGA 1SQPG 2Q6QA 1PZQA 3SWYA 3A3YB 2BCCJ 4IL6X 3VMZA 3H1JJ 4D6TJ 2Q9IA 2B88A 2KNCA 3GHGC 3HUSA 2Y9YA 2BCCD 1LT1A 1KILB 5CCGC 2K1AA 1KTMA 2CK3H 2C9LY 2M3EA 5CHXA 4BRYA 1JY2P 1Q90D 2IPPA 2R44A 5TJHA 3VP9A 2Z5IA 5AW1B 3CCVP 1DH3A 1JO5A 3CCJP 2Y0DA 3L70J 1ZLLA 4DOJA 3Q3DA 2BEZF 3KZIE 3FGAD 3H25A 3NMDA 1Q7YQ 2IBZI 1GL2B 3GF3A 2B89A 1JCDA 3HD7A 5AW7B 4WY4A 3CCQP 2I1JA 4NPDA 3Q1MA 2QJKB 3VTPC 1N7SA 2WWWA 2FXMA 3IF4A 4PV1D 2K9JB 3HTKA 5BVZA 3L75G 2YKOA 4RESB 4D6TG 5KKZC 1VQOP 1L0LK 1RE3A 2Q1KA 3B71A 3L37A 1URQA 4N3YB 4UB6E 5AW2B 5AVUB 2WT7B 1S9KD 2K9YA 1FOSE 2ZYAA 2XDJA 5BU5A 2Q3IA 4H13C 2YXQB 2KIKA 1QVFO 2A06E 4C7RA 4OVNF 3RK2B 1K8AQ 3UIAA 2BCCE 3G4SP 4AUWA 2JWAA 5AVVB 3P32A 4JYBA 1N73B 4TLFA 2HPCB 1H0TB 1AJYA 3L74E 2YKPA 4HJGH 2D2CB 3CCLP 2OYHA 3KXDA 1GL2D 2M5AA 3HD7C 4DCKA 1MFTA 2WPVB 2H88C 5H2FH 2MJZA 3HUSB 4KT0J 1A02J 1HWTC 1IZNB 1BSNA 1LT9C 1JCCA 1KYOI 2FKWB 1KQGB 4L74A 2OTJP 2E74B 4I6MC 3CD6P 4R4MA 1KORA 2RN0A 1IFPA 2YKQA 1FOSF 3IAOA 1KQLA 3U1AA 3SWKA 3AE5C 2YIUB 4IOIH 1T3JA 1LTAC 1U7JA 3CL3D 1RE3C 1FS0E 5APTA 4EIJA 1VQMP 2AXTE 1N73A 2OYHB 3CPWO 2A06D 3BVHA 2GM4A 1S1CX 3V6IA 4EYYQ 4RJTA 1FZAA 2PRRA 1MUUA 3NFQA 2KOGA 3GMAA 1GDTA 2WSCH 3S1KA 1KD1Q 1IFNA 2O01N 3L75J 3HTKB 1URQB 3BCCD 3N7NA 3QWOC 1MFZA 2G3AA 3WUUA 3L70G 1G2CB 1NVOA 2ZXEB 4GOFA 2PAJA 1SFCB 3BCCJ 4H44C 3H1KE 4HH2A 1PFIA 1SQXE 4LC1A 1M57D 2O1JA 1VPCA 4R4LA 1EQ7A 2E75C 3LIDA 4W7ZA 2FY8A 5APSA 4CPGA 2ZXXA 4ZKPA 1AVOA 1YQ4C 3C1LA 1BGYD 2QE7H 5KAFH 3CCSP 2IZ0A 2HPCA 1LTJA 1D7MA 1PIXA 1PP9D 1X0TA 2XV5A 1LWUA 3H1HG 3KQGA 3VP8A 4AYCA 5KLVE 2C9NY 5DJUB 3O6QB 5CCHC 1IFMA 1NTZJ 3FWNA 5AVWB 5BU8B 2W6JH 2IFNA 2NPSC 2E42A 3G9RA 1LGHB 2O3JA 2ZYGA 1URQD 3H6PA 2N9YB 4JQ0D 1FDIA 1NOHA 1RF0A 2P67A 2WSFH 4H0LB 1GMJA 5AW4B 3C9IA 4AQRD 3AE2C 2HFED 1JM0A 2JJLA 2NPSB 3LIEA 2IX7C 4YXWH 1IK7A 1FAVA 2IYOA 1KB9I 2D2CD 2Z5HA 1ZXGA 1SQXD 2WITA 2XKMA 1KQFB 2RMZA 3SFDC 1HGZA 1QLED 4DZOA 3P8CE 2GUVA 1BDCA 3L75E 3WU2H 2G8YA 1PPJD 3L35A 4WVZA 1X22A 2O1KA 3V2PA 4BXLA 1KB9E 1BGYE 1EDKA 1GL2C 4IFMA 2UWJE 1N86A 2ZT9C 3CWBG 4GODA 2H43A 1P84D 1OW7A 1SFCC 2E74D 3ITKA 4H44B 4L75A 1GU5A 4EDFA 3CWBJ 5GTHH 1JY2N 4N78D 1SS1A 3L4FA 1ZRTE 2KSJA 1CZQA 1NTZE 1LNQA 3EQ2A 2P58A 3HE5A 5E79H 2HODA 1NTMG 1RF1B 1LTBC 2IBZD 2JP3A 3GHGB 5KLVG 4IL6E 1IJDB 3RK3E 3TYYA 3CC7P 5KJ7C 1G1IA 4OH8B 1AA0A 1JEKA 3BASA 1X79B 1NU1K 4DJGA 1J1DB 1RHZB 3B5ND 3MHVA 1X9VA 2P7JA 2R32A 3FXDA 1OWAA 4RO0A 3SSUA 3P8CD 3F5HA 5CCHA 5KLVK 1VQLP 1PPJE 3K5BA 3CMAP 1FZCC 3CX5H 4DT0A 1KFMA 3H32B 3MUDC 4H13D 4PD4H 2A45I 1PL5A 1L4AB 4OGQD 2ZJSE 1SQBD 2AXCA 1W5CE 1RF1A 1LP1B 1HF9A 1LT9B 3HE4B 3RL0g 3MZWB 2WSCJ 4I7ZC 5CCGA 1N8RQ 1IK9A 2P1JA 3H1LJ 3AE4C 1VQ9P 5B5EE 5AVZB 3RK3B 2KP8A 1BGYJ 1IFIA 1ZRTD 2JEEA 3R2PA 5APWA 3RL0C 1SQVJ 4C7NA 3Q5PA 5APXA 3A0BE 5GTIE 1QEXA 3L72G 4PD4I 2W6AA 3CXHI 1Q81Q 2FFDA 1JNMA 5APUA 5TISH 3M9HA
chains in the Genus database with same CATH topology
3L70J 1BE3J 3TGUJ 1SQXJ 1EZVI 2FYUJ 2IBZI 3L72J 3BCCJ 1PP9J 1KB9I 3L74J 5KLVJ 4U3FJ 1L0LJ 1KYOI 1NTMJ 1NU1J 3L71J 1BCCJ 2BCCJ 3H1HJ 3H1IJ 3H1JJ 3H1LJ 4D6TJ 1NTZJ 1P84I 3CWBJ 3CX5I 1BGYJ 1SQQJ 1SQPJ 1SQVJ 1SQBJ 3H1KJ 4PD4I 1L0NJ 3CXHI 3L73J 1NTKJ 3L75J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 J;  1BE3 J;  3TGU J;  1SQX J;  1EZV I;  2FYU J;  2IBZ I;  3L72 J;  3BCC J;  1PP9 J;  1KB9 I;  3L74 J;  5KLV J;  4U3F J;  1L0L J;  1KYO I;  1NTM J;  1NU1 J;  3L71 J;  1BCC J;  2BCC J;  3H1H J;  3H1I J;  3H1J J;  3H1L J;  4D6T J;  1NTZ J;  1P84 I;  3CWB J;  3CX5 I;  1BGY J;  1SQQ J;  1SQP J;  1SQV J;  1SQB J;  3H1K J;  4PD4 I;  1L0N J;  3CXH I;  3L73 J;  1NTK J;  3L75 J; 
#chains in the Genus database with same CATH topology
 2OTK E;  1N73 C;  1KYO H;  1BE3 J;  3CWB E;  3RL0 B;  3GG2 A;  2NZ2 A;  1HUC A;  3P8M C;  1FJP A;  3BRT B;  1BE3 D;  3P7K A;  4I7Z B;  1L0N G;  1ZW0 A;  2QIW A;  4H0L D;  5CCG D;  1VQP P;  2KNC B;  2WTY A;  5E79 E;  1NTM E;  3ABV C;  1LJ2 A;  1KYO E;  2E75 B;  2J5U A;  3E7K A;  1IC2 A;  2CPB A;  3GLM A;  1VDF A;  1SQP D;  2NPS A;  1S9K E;  1OVR A;  2O01 J;  4JPZ B;  2KZI A;  1L0L D;  5CJ4 A;  2OQQ A;  1NU1 E;  2N1T B;  2YMK A;  1VL2 A;  3V4Q A;  1P84 I;  5B5E H;  1LWU C;  4XFJ A;  4GKG A;  4YPC A;  1A02 F;  2A06 G;  2E5Y A;  3OAK A;  1ZR4 A;  2BCC G;  2YMY A;  3BAT A;  1JTH B;  3RL0 D;  1N7S B;  1S72 P;  3L74 D;  1X8Y A;  2WMM A;  1YJN P;  1S2E A;  3L74 G;  4PD4 E;  4Z1M H;  3H1L E;  3O6Q A;  1SQV K;  1YTZ I;  2YO3 A;  2JWD A;  3F89 A;  4D6T D;  1FDO A;  3AE1 C;  3AEF C;  3GF7 A;  4NPE A;  3TNU A;  3CCE P;  2QSI A;  2YIU C;  1ZN5 A;  4JYC A;  2E75 D;  1EZV I;  1MZ9 A;  1SQB K;  1BE3 E;  1ZME C;  3V2R A;  1KIL A;  1NKN A;  2L91 A;  2M0B A;  1E5W A;  2V4H A;  2ZT9 B;  3L73 G;  3MIW A;  3MP7 B;  1GW3 A;  2QEX P;  1T2K D;  1W2B O;  2Z4E A;  3L72 E;  1H0T A;  4O9B A;  1KYO D;  3AEG C;  3Q5S A;  4OGQ C;  1BGY G;  1PV3 A;  2GA1 A;  2QRX A;  2CPS A;  4XE5 B;  2OTL P;  1NTM J;  3H1I D;  3G71 P;  1Q2N A;  2Q3E A;  2P2U A;  3CC2 P;  5KJ7 D;  1BCC J;  1L0L E;  3A0B H;  3H1I J;  1L0N K;  2KI7 B;  1N7S D;  1OVV A;  2K9J A;  1JY2 O;  3L71 E;  2W27 A;  1NTZ G;  3JC2 2;  3MGN A;  3RGU A;  2W6B A;  1XTC C;  1EXI A;  1IFJ A;  1JOC A;  1TU3 F;  2A45 G;  2JKV A;  4H0L C;  5AW9 B;  3JCU E;  2QM8 A;  1CI6 B;  2IYP A;  3H1L D;  4D6T E;  3OJA B;  1VQK P;  1KFN A;  2C0X A;  4K3A A;  1S5L H;  2QVA A;  1FC2 C;  1OMI A;  3BCC E;  4QMA A;  1KN7 A;  1PGP A;  1PGQ A;  1SQX J;  1DEB A;  2E5T A;  3R4Y A;  3AE9 C;  1RQV A;  5M1B A;  5APQ A;  1Y8A A;  2WQY C;  5KJ7 A;  2KLV A;  2QJP C;  1JTH A;  3B8E B;  3H1K G;  1H89 A;  2RH0 A;  3VMY A;  2WSF J;  1FZC B;  1IO4 A;  3MTU E;  1M90 Q;  1J1D C;  2JR8 A;  3HRN A;  5APV A;  1DX7 A;  5L8R J;  3AE8 C;  2N9B A;  3I5C A;  1M56 D;  4EOT A;  2M8R A;  3AE6 C;  1KIL E;  1S5L X;  1R8E A;  1FZB A;  1HVV A;  3FXE A;  5AVR B;  1YJ9 P;  2FYZ A;  1JMB A;  3H32 A;  4Y28 J;  1URQ C;  1OVU A;  1ZP0 C;  1RF1 C;  2LKM A;  1KC8 Q;  3NTN A;  3PJS K;  5AW3 B;  2N1T D;  3L73 J;  4EI2 A;  1N7S C;  5CBO A;  1QX8 A;  3TGU G;  3A5T A;  1YQ3 C;  3WU2 E;  1L0L G;  4U7J A;  2OYI A;  1LWU B;  3PHL A;  3D71 A;  1LTJ B;  1NO4 A;  4YTP C;  3JCU H;  3L74 J;  1YBK A;  3OA7 A;  5CCH D;  2FFD C;  4U3F J;  3Q5R A;  1H8A A;  3H1J E;  3L75 D;  2H8P D;  2B87 B;  2FYN C;  2QJP B;  1RY3 A;  2KZJ A;  2Y0C A;  4U3F D;  3TDK A;  3TNU B;  3USS A;  1N2D C;  2C0W A;  1T3U A;  1JY3 N;  5B66 E;  2Y9Z A;  3AE7 C;  2OYO A;  1K04 A;  3H1I G;  4BRY B;  1RE4 A;  1NU1 G;  1KIL D;  1W2E A;  2FBW C;  3JSV C;  3H1H J;  2LXB A;  3VMA A;  4UB6 H;  2FXO A;  2PP6 A;  3L70 E;  1T8Z A;  1HGV A;  5AVT B;  2OYI B;  1IFD A;  3IFM A;  2B9B A;  2YO2 A;  2FXP A;  3EFG A;  3M0A A;  1MKM A;  1Q86 Q;  2IBZ E;  5AVX B;  1FZG A;  1S3J A;  4JF7 A;  1AV1 A;  3S9O A;  4PJ0 H;  2YNY A;  4WY4 C;  1BE3 G;  1M7L A;  1K05 A;  3B5N C;  2E43 A;  1KQS O;  2KS1 B;  1JMM A;  3EFF K;  2ZVN B;  1BDD A;  1NTM K;  5H2F E;  5CBN A;  3H1J D;  1AFO A;  1FU1 A;  1GW4 A;  1L4A C;  3WMM 0;  4U3F E;  2HR3 A;  2KB7 P;  2HOD B;  1GD2 E;  5AW6 B;  1WRG A;  2Q7C A;  1SQB E;  1K9M Q;  3S4R A;  1Y9B A;  3CX5 E;  2WVR A;  2MKV A;  1Z56 A;  1EDJ A;  3L70 D;  1QVG O;  1Q82 Q;  3H1J G;  2IZ1 A;  2RKL A;  2PGD A;  3V2N A;  1T2K C;  1OFC X;  3HD7 D;  1SQX K;  3TF5 A;  1SLQ A;  2VRS A;  4IL6 H;  1PGO A;  3CWB D;  3AEE C;  1YHQ P;  1SQP K;  1KMI Z;  1LTI C;  2FYU J;  2QM7 A;  1L4A D;  1EZV E;  1DEE G;  1RF0 C;  3M9Q A;  1K73 Q;  1LP1 A;  1NTM D;  3KZI H;  3CCU P;  1DD3 A;  1L2P A;  1PGJ A;  2IBZ G;  3ZDM A;  2WSS H;  4ASV A;  5AVY B;  3AED C;  1YYC A;  1SP4 A;  1P84 H;  1J1E B;  1SQP E;  1SQQ D;  1NYH A;  2AEM A;  1NU1 J;  2R3S A;  2QG4 A;  1RQU A;  2ZYD A;  1VQ7 P;  2H7H A;  3NXS A;  1VQN P;  4XA4 A;  1YJW P;  3CX5 D;  4PV1 B;  2PFX A;  1NU1 D;  2Q5U A;  3AEA C;  3HD7 B;  1LTG C;  2K3R A;  2KLU A;  3KPE A;  2L5G B;  1WMK A;  2W83 C;  4IFF A;  1VQ8 P;  3CME P;  1G1J A;  4OWF A;  1NTK K;  1LTT C;  2HLO A;  4U3F G;  1SQB J;  2K37 A;  1USE A;  4HB1 A;  3U59 A;  4ZMD A;  3H1K J;  2O01 H;  1H88 A;  3AEB C;  1PPJ G;  3RK2 C;  3EWK A;  4PD4 D;  3TGU E;  1VF5 B;  2R3C A;  5AVQ B;  3RK2 D;  4TT3 H;  2OAR A;  2V7Q H;  3LW5 H;  4W7Y A;  5AW0 B;  3VOP A;  1SQV D;  1OIP A;  1YIJ P;  1FZC A;  1BSH A;  2OGU A;  1E79 H;  1EZV D;  3L72 J;  5KLV J;  4KHX A;  3U1C A;  3PP5 A;  3M0D C;  3RBZ A;  1AQT A;  3II6 A;  2N1T A;  3GW6 A;  3L72 D;  3SFE C;  3E1I A;  3W68 A;  1M1K Q;  2WSE J;  1HJB A;  1J1E C;  4C46 A;  1HBW A;  1ZV8 A;  1SQQ E;  2KSE A;  1R5L A;  2FYU E;  3H1I E;  3CLQ A;  3LW5 J;  1QL1 A;  1FZF A;  1QGK B;  2W8Z A;  3L71 J;  5EFW B;  3AE3 C;  3V5B A;  3PLN A;  1HTL C;  1FDM A;  2A45 H;  5KAI E;  3L71 D;  2J59 M;  4HKZ H;  3TSI A;  3KYQ A;  1DIP A;  3L71 G;  4N6J A;  1VF5 D;  1SQP J;  1L0N E;  3L73 D;  1OXZ A;  4B86 A;  1FJK A;  1RE4 C;  1KIL C;  2NPS D;  1J2J B;  1EC5 A;  3TGU D;  1KV4 A;  3IR9 A;  4C7N B;  4WWI A;  4UB8 H;  3TGU J;  2POH A;  3G3Z A;  3MD0 A;  3BCC G;  5APY A;  3L36 A;  1OW8 A;  1SQV E;  3CXH E;  4A7P A;  1NGM B;  1YTZ T;  1NTK G;  1PP9 J;  3CCR P;  5AW8 B;  2OYH C;  3VMX A;  4YXD C;  3D6Y A;  3FWL A;  5KLI B;  2M5A B;  2AXT H;  3OW2 O;  1CI6 A;  3V4W A;  4BWN A;  3M06 A;  5AVS B;  2WT7 A;  1QL2 A;  3M91 A;  4PJ0 E;  1BCC G;  1G2C A;  1SFC D;  2E74 C;  2FYU D;  3H1H D;  4JBZ A;  4KJM A;  3T97 B;  5AW5 B;  2KYV A;  1VQ4 P;  1ZR2 A;  2QJY C;  1NTK D;  5GTH E;  4GOE A;  5KTB A;  2XND H;  3KDP B;  1NAY A;  2QA4 P;  2IFM A;  2WZ7 A;  1SQQ J;  1L0N D;  3KHU A;  3L73 E;  4ASW A;  5K5G B;  3V2Q A;  1CW5 A;  1BCC D;  1M8O B;  1L0N J;  2D2C C;  1KB9 H;  2FYU G;  3E1R A;  1JY3 O;  3PTZ A;  1SQQ K;  2JDI H;  1XTG B;  3QH9 A;  5B66 H;  3M9B A;  1U57 A;  3D70 A;  3VN0 A;  3C8V A;  1NAF A;  2M3B A;  2IDB A;  1R5S A;  3A0H E;  3RK3 C;  3CXH D;  2R5B A;  2XNX A;  2GUS A;  3H1K D;  3HE5 B;  4H13 B;  2ZAE B;  1GZL A;  1WT6 A;  1SVF A;  2SPZ A;  2XZR A;  2BAS A;  4L73 A;  4OGQ B;  4ZKU A;  2BEQ D;  2E76 C;  2I8D A;  4GIF A;  4MN4 C;  1DD4 A;  5KAI H;  1GK6 A;  2ZT9 D;  1HH0 A;  3AEC C;  2FYN B;  2E76 D;  1NHL A;  3CI9 A;  2YXR B;  3H1H E;  4WBA A;  1PP9 E;  5KLV D;  1EXJ A;  1EDL A;  1JUN A;  4M3L A;  4HYT B;  4LLH A;  1SQV G;  1GU4 A;  2XU6 A;  1JY3 P;  2FFD B;  1AVY A;  1FBM A;  1NTK E;  1LTJ C;  3MUD A;  2KK7 A;  1KZU B;  3N4X A;  2ITA A;  3W67 A;  1U7M A;  3I56 P;  1T6A A;  2B87 A;  1M1J C;  3FX0 A;  2K88 A;  1M1J B;  1OZH A;  2KS1 A;  1LTS C;  2HG5 D;  2WPR A;  3B5N A;  3IN6 A;  2Y0E A;  1BCC E;  5KAF E;  3WUV A;  1NJI Q;  1OW6 A;  1HJ0 A;  4H44 D;  5DJT B;  3CCM P;  1USD A;  2HYN A;  2N1T C;  2ZFC A;  3BRV B;  1YIT P;  3M0D A;  1L4A A;  3PH0 A;  1FZE A;  3T97 A;  1AQ5 A;  3A2A A;  1NKZ B;  2J58 A;  2WPS A;  3CXH H;  3O8Z A;  3A7O A;  4RKU J;  3G6E P;  4W80 A;  2E76 B;  4K35 A;  2FYU K;  2KUB A;  1NTZ K;  4UB8 E;  3D6Z A;  1NWQ A;  3A0H H;  1SQQ G;  1CSB A;  2ZVO B;  1KB9 D;  4GDO A;  5CMZ A;  1S5L E;  4LGD E;  1GK4 A;  1M1J A;  3B5N B;  3GHG A;  3HUS C;  3RBX A;  1GTW A;  4WB4 A;  4WY4 B;  1SQB G;  1GL2 A;  3B4S A;  3PRJ A;  1P84 E;  3Q2Y A;  1UIX A;  2WPQ A;  3CX5 I;  4N78 E;  3WUT A;  1YI2 P;  1MV8 A;  1NTZ D;  3CC4 P;  4IFD K;  1SFC A;  1VF5 C;  2OYI C;  2H89 C;  4Y99 C;  4ZNC A;  1LT9 A;  3HE4 A;  5KKZ B;  2AEJ A;  4GT1 A;  4Y99 B;  1NTK J;  1FE6 A;  1OX3 A;  1PP9 G;  1RH5 B;  1S4X A;  2DW3 A;  2P10 A;  2QJY B;  2WSE H;  4L76 A;  4NPF X;  5TIS E;  3RK3 D;  1VQ6 P;  3VYI A;  5GTI H;  4I2L C;  1ZOY C;  3SWF A;  3TK1 A;  4PV1 C;  2V7Q J;  5CJ0 A;  1EDI A;  1EZV G;  1L0L J;  2R5D A;  1SQX G;  2AEF A;  1NH4 A;  2I1K A;  2LR2 A;  5KLI C;  5C39 A;  3I55 P;  1Y47 A;  2QJK C;  4WY4 D;  1VQ5 P;  1JB0 J;  1UII A;  2JO1 A;  3H1L G;  2KXP B;  4I1L A;  1N7L A;  2LXC B;  2W90 A;  2NRG A;  1SQP G;  2Q6Q A;  1PZQ A;  3SWY A;  3A3Y B;  2BCC J;  4IL6 X;  3VMZ A;  3H1J J;  4D6T J;  2Q9I A;  2B88 A;  2KNC A;  3GHG C;  3HUS A;  2Y9Y A;  2BCC D;  1LT1 A;  1KIL B;  5CCG C;  2K1A A;  1KTM A;  2CK3 H;  2C9L Y;  2M3E A;  5CHX A;  4BRY A;  1JY2 P;  1Q90 D;  2IPP A;  2R44 A;  5TJH A;  3VP9 A;  2Z5I A;  5AW1 B;  3CCV P;  1DH3 A;  1JO5 A;  3CCJ P;  2Y0D A;  3L70 J;  1ZLL A;  4DOJ A;  3Q3D A;  2BEZ F;  3KZI E;  3FGA D;  3H25 A;  3NMD A;  1Q7Y Q;  2IBZ I;  1GL2 B;  3GF3 A;  2B89 A;  1JCD A;  3HD7 A;  5AW7 B;  4WY4 A;  3CCQ P;  2I1J A;  4NPD A;  3Q1M A;  2QJK B;  3VTP C;  1N7S A;  2WWW A;  2FXM A;  3IF4 A;  4PV1 D;  2K9J B;  3HTK A;  5BVZ A;  3L75 G;  2YKO A;  4RES B;  4D6T G;  5KKZ C;  1VQO P;  1L0L K;  1RE3 A;  2Q1K A;  3B71 A;  3L37 A;  1URQ A;  4N3Y B;  4UB6 E;  5AW2 B;  5AVU B;  2WT7 B;  1S9K D;  2K9Y A;  1FOS E;  2ZYA A;  2XDJ A;  5BU5 A;  2Q3I A;  4H13 C;  2YXQ B;  2KIK A;  1QVF O;  2A06 E;  4C7R A;  4OVN F;  3RK2 B;  1K8A Q;  3UIA A;  2BCC E;  3G4S P;  4AUW A;  2JWA A;  5AVV B;  3P32 A;  4JYB A;  1N73 B;  4TLF A;  2HPC B;  1H0T B;  1AJY A;  3L74 E;  2YKP A;  4HJG H;  2D2C B;  3CCL P;  2OYH A;  3KXD A;  1GL2 D;  2M5A A;  3HD7 C;  4DCK A;  1MFT A;  2WPV B;  2H88 C;  5H2F H;  2MJZ A;  3HUS B;  4KT0 J;  1A02 J;  1HWT C;  1IZN B;  1BSN A;  1LT9 C;  1JCC A;  1KYO I;  2FKW B;  1KQG B;  4L74 A;  2OTJ P;  2E74 B;  4I6M C;  3CD6 P;  4R4M A;  1KOR A;  2RN0 A;  1IFP A;  2YKQ A;  1FOS F;  3IAO A;  1KQL A;  3U1A A;  3SWK A;  3AE5 C;  2YIU B;  4IOI H;  1T3J A;  1LTA C;  1U7J A;  3CL3 D;  1RE3 C;  1FS0 E;  5APT A;  4EIJ A;  1VQM P;  2AXT E;  1N73 A;  2OYH B;  3CPW O;  2A06 D;  3BVH A;  2GM4 A;  1S1C X;  3V6I A;  4EYY Q;  4RJT A;  1FZA A;  2PRR A;  1MUU A;  3NFQ A;  2KOG A;  3GMA A;  1GDT A;  2WSC H;  3S1K A;  1KD1 Q;  1IFN A;  2O01 N;  3L75 J;  3HTK B;  1URQ B;  3BCC D;  3N7N A;  3QWO C;  1MFZ A;  2G3A A;  3WUU A;  3L70 G;  1G2C B;  1NVO A;  2ZXE B;  4GOF A;  2PAJ A;  1SFC B;  3BCC J;  4H44 C;  3H1K E;  4HH2 A;  1PFI A;  1SQX E;  4LC1 A;  1M57 D;  2O1J A;  1VPC A;  4R4L A;  1EQ7 A;  2E75 C;  3LID A;  4W7Z A;  2FY8 A;  5APS A;  4CPG A;  2ZXX A;  4ZKP A;  1AVO A;  1YQ4 C;  3C1L A;  1BGY D;  2QE7 H;  5KAF H;  3CCS P;  2IZ0 A;  2HPC A;  1LTJ A;  1D7M A;  1PIX A;  1PP9 D;  1X0T A;  2XV5 A;  1LWU A;  3H1H G;  3KQG A;  3VP8 A;  4AYC A;  5KLV E;  2C9N Y;  5DJU B;  3O6Q B;  5CCH C;  1IFM A;  1NTZ J;  3FWN A;  5AVW B;  5BU8 B;  2W6J H;  2IFN A;  2NPS C;  2E42 A;  3G9R A;  1LGH B;  2O3J A;  2ZYG A;  1URQ D;  3H6P A;  2N9Y B;  4JQ0 D;  1FDI A;  1NOH A;  1RF0 A;  2P67 A;  2WSF H;  4H0L B;  1GMJ A;  5AW4 B;  3C9I A;  4AQR D;  3AE2 C;  2HFE D;  1JM0 A;  2JJL A;  2NPS B;  3LIE A;  2IX7 C;  4YXW H;  1IK7 A;  1FAV A;  2IYO A;  1KB9 I;  2D2C D;  2Z5H A;  1ZXG A;  1SQX D;  2WIT A;  2XKM A;  1KQF B;  2RMZ A;  3SFD C;  1HGZ A;  1QLE D;  4DZO A;  3P8C E;  2GUV A;  1BDC A;  3L75 E;  3WU2 H;  2G8Y A;  1PPJ D;  3L35 A;  4WVZ A;  1X22 A;  2O1K A;  3V2P A;  4BXL A;  1KB9 E;  1BGY E;  1EDK A;  1GL2 C;  4IFM A;  2UWJ E;  1N86 A;  2ZT9 C;  3CWB G;  4GOD A;  2H43 A;  1P84 D;  1OW7 A;  1SFC C;  2E74 D;  3ITK A;  4H44 B;  4L75 A;  1GU5 A;  4EDF A;  3CWB J;  5GTH H;  1JY2 N;  4N78 D;  1SS1 A;  3L4F A;  1ZRT E;  2KSJ A;  1CZQ A;  1NTZ E;  1LNQ A;  3EQ2 A;  2P58 A;  3HE5 A;  5E79 H;  2HOD A;  1NTM G;  1RF1 B;  1LTB C;  2IBZ D;  2JP3 A;  3GHG B;  5KLV G;  4IL6 E;  1IJD B;  3RK3 E;  3TYY A;  3CC7 P;  5KJ7 C;  1G1I A;  4OH8 B;  1AA0 A;  1JEK A;  3BAS A;  1X79 B;  1NU1 K;  4DJG A;  1J1D B;  1RHZ B;  3B5N D;  3MHV A;  1X9V A;  2P7J A;  2R32 A;  3FXD A;  1OWA A;  4RO0 A;  3SSU A;  3P8C D;  3F5H A;  5CCH A;  5KLV K;  1VQL P;  1PPJ E;  3K5B A;  3CMA P;  1FZC C;  3CX5 H;  4DT0 A;  1KFM A;  3H32 B;  3MUD C;  4H13 D;  4PD4 H;  2A45 I;  1PL5 A;  1L4A B;  4OGQ D;  2ZJS E;  1SQB D;  2AXC A;  1W5C E;  1RF1 A;  1LP1 B;  1HF9 A;  1LT9 B;  3HE4 B;  3RL0 g;  3MZW B;  2WSC J;  4I7Z C;  5CCG A;  1N8R Q;  1IK9 A;  2P1J A;  3H1L J;  3AE4 C;  1VQ9 P;  5B5E E;  5AVZ B;  3RK3 B;  2KP8 A;  1BGY J;  1IFI A;  1ZRT D;  2JEE A;  3R2P A;  5APW A;  3RL0 C;  1SQV J;  4C7N A;  3Q5P A;  5APX A;  3A0B E;  5GTI E;  1QEX A;  3L72 G;  4PD4 I;  2W6A A;  3CXH I;  1Q81 Q;  2FFD A;  1JNM A;  5APU A;  5TIS H;  3M9H A; 
#chains in the Genus database with same CATH homology
 3L70 J;  1BE3 J;  3TGU J;  1SQX J;  1EZV I;  2FYU J;  2IBZ I;  3L72 J;  3BCC J;  1PP9 J;  1KB9 I;  3L74 J;  5KLV J;  4U3F J;  1L0L J;  1KYO I;  1NTM J;  1NU1 J;  3L71 J;  1BCC J;  2BCC J;  3H1H J;  3H1I J;  3H1J J;  3H1L J;  4D6T J;  1NTZ J;  1P84 I;  3CWB J;  3CX5 I;  1BGY J;  1SQQ J;  1SQP J;  1SQV J;  1SQB J;  3H1K J;  4PD4 I;  1L0N J;  3CXH I;  3L73 J;  1NTK J;  3L75 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...