3G3ZA

The structure of nmb1585, a marr family regulator from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
MNQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of NMB1585, a MarR-family regulator from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g3zA02
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3g3zA01
5DV5A 4AVPA 3KLNA 1SQPK 3GX4X 4ESJA 2ZNYA 3FMRA 2XVCA 3EQLF 3MFKA 2EFNA 3CO6C 4N0BA 1F4KA 1TQIA 3ABTA 4HX8A 3GXOA 1FBUA 2K4BA 2LKMA 4ZH4F 4QLCU 3DKWA 1BJAA 2Z9OA 2MLGA 5KLVK 2PJPA 3U9GA 2BBYA 1YLFA 1QBJA 1O3TA 1EH7A 2L54A 1H9TA 1U5TC 5CVRA 3T0YA 3LAPA 3K2ZA 2ZNZA 3JSPA 1SD4A 3KEQA 4PZJA 3SQNA 3V7RA 3HHHA 2X0LA 2YX4A 1REPC 1HXDA 3KP2A 3CLQA 1RIOH 1Z9CA 3RYRA 1CF7A 4K2EA 4I02A 4LFUA 1MDMA 4IPAA 4UVCA 4HX4A 1ZG1A 3I0TA 3IKVA 2DLLA 3FXUA 1FP2A 3J7AO 2JPCA 1QGPA 3BPXA 2O01H 3NQOA 2PG4A 4G7OF 2XAJA 2EFQA 1DP7P 2DFIA 1IXCA 3I59A 4HA8A 2RDPA 5LLQA 4EJVA 2Q0OA 2COMA 2J5PA 3I58A 4M6XA 1BIAA 2HYFA 2P6TA 5FB2A 4G94A 5K1YA 4MTEA 1MZBA 3GZ5A 3R61A 3KE2A 4EMSA 2FRHA 5DYMA 1C0WA 1KQ0A 2EFPA 3K1MA 4M9XA 5HS9A 4OMYA 1U8RA 1R00A 2DQLA 2V6CA 3MAJA 4YIIA 1LB2A 2HGCA 5H20A 4AIHA 4CYDA 1DUXC 3HTUA 3Q5FA 1IXRC 1D8JA 5ICCA 2K4JA 2RV8A 2ZO4A 1BI1A 5CLSA 2XKOA 1FZPB 4MEYF 3WTZA 4G6QA 5ICGA 5IT9Z 4B09A 4ZYGA 1W7PB 1VTNC 4WXCA 2IRFG 2Z33A 1CF7B 3HUGA 4LMYA 4RB1A 5LEJA 3TOAA 4S05A 5ICFA 3REOA 3JAMZ 1G3SA 2BEOA 1MDMB 3AAFA 1S29A 4PDKA 1TLHB 4MHGA 4B8XA 5KVRA 3CUQC 2A5YB 3GO5A 3LFKA 1V3FA 5D5UB 2K7LA 3DF8A 6PAXA 5FLXK 1I27A 1E17A 4N9HA 4KN7X 1MJBA 2XRNA 3JSOA 2BV6A 4G9YA 4UHTA 2HFHA 2IW5A 5D8LB 3JW4A 3KZYA 4R1HA 1YS6A 1JXSA 1USTA 3J81K 1G3TA 2H09A 1L0LK 1SMTA 5FFXA 1QZZA 4EM0B 1J75A 2NRAC 1R1VA 4EQQA 4ENMA 1I6XA 2XROA 4YFKF 3ZMSA 2R3SA 1XCBA 4P9UA 3BJ6A 1ZLKA 3CO7C 2QBYA 4BNCA 1BM9A 3KP5A 2HDCA 2WSEH 2CW0F 2EK5A 2EA2A 2KIFA 4M71A 4ENKA 2FNAA 4LB5A 2QENA 4IXAA 3C3WA 1W7PA 4BYYA 2VE8A 5CVJA 3ROUA 1NTMK 4ZYEA 1KYWA 4IRIA 4BH9A 2EFOA 1S8NA 4UV9A 3BJAA 1J2XA 1OKRA 2DPUA 2QLZA 3RPUA 3TGNA 2VT3A 3CUQA 2V1XA 4HDVA 4HF2A 2FBIA 4BAYA 2XIGA 2UWMA 2Q8KA 4HQMA 3U1DA 5HDNA 3U2RA 1FYLA 4BHCA 3WTXC 1F1ZA 3GF2A 5D5XB 1DDNA 2QQAA 4IFDK 3GFJA 1Z7UA 2RC4A 1PDNC 5HOOA 4HOBA 2A6EF 2IVMA 3VFZA 4EJOA 3HSEA 3R4KA 3MZHA 2PBIA 2DK5A 4UV8A 3S2WA 3E6DA 2HEOA 2CYYA 4L9NA 2PMUA 5J6XA 5JVTA 3WTTC 1BIBA 4LK1F 3BROA 1GXPA 2Y75A 3WGIA 2DAOA 2BGCA 4KDPA 2MH2A 2DBBA 5LRSA 5DD4A 2AXLA 1Z91A 2O8XA 4RB3C 3QU3A 4BQAA 3VODA 1ZRFA 3JTHA 2VODA 2PN6A 4IJAA 4AD9A 3F3XA 2PEXA 1P4WA 5HLIA 4LJZF 2ISZA 1P4AA 1SD5A 1BOAA 3ELKA 1I1GA 3K1PA 5JHUA 3GYHX 3N4MA 4UUVA 1RUNA 1XMKA 3FMSA 3M1EA 5CVUA 4KNYA 1IAWA 4LG0B 4KIFA 4RB0A 2WSFH 2O0YA 3TO9A 1Z05A 5HDGA 4HW0A 1XDSA 4KIGA 1OYWA 5IT9K 4MEXF 2NS0A 4O3MA 2RQPA 5AIQA 5D5WB 2ACJA 2FYUK 4GGGA 3M7GA 2IT0A 2WV0A 4ZYDA 4L0YB 2JZYA 2D2WA 1FSEA 1YW9A 1CGPA 5E1XA 1JHFA 3HSFA 4P9FA 2G7HA 5EEGA 2OZ6A 1B4AA 3ZMDA 5DD8A 2M45A 2EV5A 3SFZA 1UHMA 1NTKK 4EJWA 2FEZA 1BI2A 2IP2A 2L01A 1EH8A 2ZCWA 4A12A 3R0JA 1MJAA 1TW3A 2HOEA 3H3UA 3O6BB 1IRFA 1SFUA 3C1DA 2WWYA 3F8MA 1J7KA 5JI6A 1J0RA 3IHUA 2M1BA 2V9VA 2P5LC 1L0OC 1IN7A 4M9ZA 3FXQA 3PQKA 1EV7A 1T0FA 2XAHA 5DCFA 3ECOA 1YFHA 2KJCA 1BC8C 1T2KA 4EJUA 1QZYA 2Z99A 4L0ZB 1B59A 3TO7A 4HZFA 1R22A 3KZZA 2W84A 1ODDA 5BPDA 5BQTA 5HS8A 3FXRA 3QU6A 1WSUA 4CZZA 1KGSA 4G6DA 1Q1HA 3ZP5A 2EWNA 1YW7A 5ILUA 3HOTA 3JAMK 1RUOA 4D0PA 1U5TB 4WX9A 3JTGA 1GVJA 4P5OA 3KP6A 3K9TA 2DI3A 3G73A 1F9NA 2VOPA 3DEUA 2F5DA 1XSVA 1B9MA 3SZTA 4JQFA 3MCZA 4M73A 1LDJA 4I98B 3TKYA 4G7ZF 2Z5UA 2FE3A 2H27A 3V8JA 4ZYHA 1S7AA 2GIVA 2VC1A 1ZHFA 1NHAA 1SD7A 4PCQA 2WSCH 4FT8A 3GW2A 2NNYA 2W57A 1XDUA 3IKTA 5BOXA 4S04A 2Y48A 1LDKB 1EH6A 3GUDA 3ZMUA 2ZMEA 1KQ8A 3BDDA 1TQPA 2HS5A 2ZBKA 5DEQA 4L9JA 2VC0A 3WTVC 1IUYA 3L00A 4HQEA 3ERED 1ZG5A 1KQ9A 3KFWX 2O6GE 5LHHA 3B73A 2ZMEB 3WTWC 4BHBA 4KA4A 2XAGA 2X4HA 5E1WA 3WODF 3F72A 1KYZA 2FQ3A 3CUQB 2WTEA 4MNUA 3RKXA 3O2PE 2P7VB 1ZG3A 4EVIA 1T38A 1KU7A 5D5VB 2IA0A 1PP8F 4ESFA 2OD5A 2H6CA 4Z2YA 4RGXA 1R1TA 2CG4A 5K5QA 4YG2F 3M9AA 2EV6A 2STWA 4FX4A 4XRFA 2QBYB 3WTSC 3FM3A 2EB7A 2EFWA 1R58A 1ZREA 4RS8A 3M8EA 3E97A 4AIJA 5FFZA 1XGMA 3V7CA 3V8KA 2PQ8A 2A3SA 2VOOA 2QZ8A 5FGMA 4RB2C 1IRGA 2J5OA 2MBFA 4O6JA 5ED4A 3E5QA 1U78A 3M9QA 4ZZLA 4EJTA 1KU2A 2L4AA 4KUMA 4LLNA 1FC3A 4AIKA 2E1CA 3RDIA 1I5ZA 1SAXA 3WE3A 2ADUA 3KCCA 1KU3A 2OARA 2BE5F 2QWWA 2EV0A 4NB5A 4A2UA 2XAQA 1D5VA 2R7FA 3VOEA 5BPIA 3LA3A 1W7PD 5H6RA 5ILVA 2FSWA 5HS7A 1R36A 5J8FA 4Q48A 4GO1A 3MZYA 2ZXJA 5JR3A 1IN5A 4HDUA 3HHGA 4JK1X 4KN4X 3ZN1A 1J5YA 2FA5A 3HTSB 4EV0A 4ESBA 5LHGA 2XAFA 1SQBK 3KLOA 1UCRA 1S7OA 1JE8A 3ZPLA 3EYIA 4Y17A 3DQVC 3WE2A 2V1DA 1YW8A 2XUBA 4HV6A 2A6HF 5F6FA 5D8KB 4ASNA 1MGTA 4RGSA 4R79A 4GXOA 2PFBA 3IRRA 1R1UA 4U0WA 1XGNA 1RI7A 2PMHA 3BJOA 4M9SA 2Z3YA 4L9VA 3ZMZA 4ZZDA 2JRTA 5FO5A 1UB9A 1IF1A 3ABUA 3LW5H 4ETSA 1HSJA 5K5RA 5ILSA 1LEBA 1FBQA 5DCMA 2A07F 3N97A 3HYIA 1U3EM 3KETA 2GA2A 1HW5A 2NAZA 3TDUC 2B0LA 4A6EA 2IA1A 4IRHA 1UFMA 3B02A 1YG2A 2A69F 5L3EA 2QM3A 1IN4A 3SXYA 3Q9VA 3RIRA 1XB4A 1SMYF 2ZFWA 3P9KA 3MWMA 5AONA 2GZWA 1K7AA 1U6GA 3HSRA 4OINF 3PQJA 2ETHA 2UXXA 4AWXB 2JSCA 4IF4A 2HKXA 3WTYC 1WRJA 4ON0A 4QWQA 3RKWA 1FYMA 3RYPA 1T98A 1BC7C 3HRTA 4P55A 4Y15A 1ZLJA 4U0VA 1IN6A 4IVNA 3KEOA 1GXQA 3CJNA 5BMZA 3E3VA 4CXFA 2HTJA 1QO0D 1ZRDA 1FWZA 2RN7A 3PFIA 3M8FA 4KICA 3F6OA 3V8LA 2DU9A 4HLYA 3T8RA 1K78A 2EA4A 4GCVA 3VEPA 2K02A 4MGRA 2W25A 2XASA 4CO8A 2NYXA 5LRRA 4FX0A 4A0XA 2E1NA 4O5VA 2L4MA 4HLXA 3DFGA 4MTDA 1IZ1A 3V7SA 1ON2A 2CWEA 1O57A 4N9IA 1IW7F 4Q5SF 3EDPA 2IJLA 3T1BA 2ZJ2A 3FF5A 3TO6A 1FP1D 4OU0A 4KFCA 2LNBA 1XMAA 2HR3A 3CDHA 2M8EA 2DTRA 1LNWA 5ICEA 3KP7A 3LQRA 5D6EA 1O3RA 2JTVA 1TTYA 2HZTA 4RGRA 1ZGJA 2QYOA 5LGNA 3QAHA 4A5NA 4A5MA 2R7DA 3IRQA 4HX7A 1AOYA 3I64A 1K79A 2RGVA 3R6SA 2BYVE 5E20A 5K5OA 3I59B 4CDGA 3L7WA 4IRGA 4YFNF 2J59M 1R7JA 4LGWA 1FY7A 4EM2A 4OMZA 1G6NA 2DK8A 1QQIA 2O3FA 3T5XA 1E2XA 3E5UA 4GYIA 1V4RA 3CUOA 3J80K 4I09A 5IT3A 1IN8A 2KRFA 1SQVK 4HYEA 1P2FA 3F8BA 4RAYA 3I53A 1G3WA 3GFIA 5D4RA 4EGZA 4H0EA 3L09A 4LK0F 1UHWA 2H6BA 1TW2A 5HLGA 2OA4A 4NQWA 3IWZA 3L2CA 1G4DA 4OIPF 4YIFA 3COAC 4A0YA 2VT2A 2GXGA 3LSTA 1TBXA 4A0ZA 2YSRA 3H3ZA 5DUKA 4KIBA 2LF7A 3IWFA 1HKQA 1W5SA 5CVVA 2YPRA 4CGZA 3W6JB 4I2OA 4GYGA 1IXSB 4MQ9F 4RGUA 2VE9A 3IC7A 5FLXZ 4PGHA 5DCMB 4JBAA 5HLHA 2QUFA 2VN2A 3BZ6A 5KK1A 3BY6A 1LEAA 3F6VA 4WK8F 2O03A 2PI0A 4U7BA 1ONVA 3L9FA 1USSA 2OQRA 2P6SA 1ULYA 4U7DA 4LLGF 3FX3A 3IL2A 1XSXA 3F8CA 4XSXF 4NHJA 3D5LA 3HRMA 3QPHA 3E6CC 1P6RA 3TQNA 1YIOA 1MKMA 4IHSA 1I1SA 2HTSA 1D3YA 5D4SA 4L18B 5D6FA 1FPQA 3F8NA 4MQVA 2FF4A 2MLKA 4RAZA 5JFRA 2K27A 2D1VA 3Q9SA 2V79A 2RKHA 1R5GA 5AIPA 2FXAA 2GQQA 3TDZC 1HKTA 2FOKA 1WKMA 4WCGA 2ESNA 1SFEA 3BPVA 2ELHA 1ON1A 1T6SA 1H9GA 4P96A 4XLPF 3H92A 2F5CA 3W6KB 2DO7A 1HQCA 1DPUA 3LQQA 5A2QK 1YQAA 2TDXA 2FU4A 3LWFA 2P5VA 1Z6RA 3RTRA 4HF0A 3SHFA 1QPMA 4DNCA 3HIFA 5H6QA 1K6OA 2YU3A 1R23A 1LDDA 1Y0UA 1H0MA 2VBWA 2IPQX 5A2QZ 2H94A 2VBXA 1U5TA 3D0SA 4CHUA 2FNPA 3T8TA 5L3FA 1J59A 4I0AA 3RJPA 3GLXA 2IA2A 4HF1A 2QQBA 2L3DA 4I01A 1X3UA 2GA1A 1OYYA 2VONA 2XGXA 1FYKA 4KMUX 1FT9A 2LDUA 3J80Z 2CSOA 3BP8A 5FD5A 2DQRA 1FSHA 2OU2A 1ZGAA 1W5TA 1S3JA 1YTYA 4OIOF 1WWXA 3CTAA 3R60A 3QRFF 2QVOA 4Q4ZF 1XSDA 1HSTA 1F5TA 1SQXK 4IHTA 1XD7A 4LD5A 2WC2A 1YO5C 1QNTA 1TQMA 1OMIA 3C18A 2VBYA 1S6LA 2JT1A 3K69A 2HYGD 1KU9A 1XCVA 4BHPA 1J9IA 3DPLC 4WWCA 1FOKA 2M87A 4CICA 4XSZF 3I71A 1DPRA 1KA8A 4U0YA 3ZQ7A 5EEHA 4M74A 2MC3A 2OQGA 2EJRA 3ZMVA 3NEUA 1Z1DA 2F5EA 1ZN2A 5TJJA 3MQ0A 2YR2A 3P7NA 5F64A 2HWVA 2STTA 4HAMA 4Q47A 5ERIA 3NRVA 3HRSA 3LAJA 3ZN0A 4OIRF 2LKPA 5E17F 3DP7A 1NTZK 2CQKA 2GAUA 2KIUA 2MA3A 2W85A 3ECHA 4PGGA 2LF8A 1BI0A 1JHHA 1ZRCA 2HKOA 5CVIA 3KP4A 1HKSA 3QPTA 3WTUC 3GEZA 3F22A 2CO5A 2OAZA 1O7FA 3BOQA 2PLYA 2KIMA 2G9WA 2OZUA 1YYVA 3GZ6A 4UVAA 5L3DA 2KJBA 2P4WA 2V1UA 2F5FA 2MH9A 2UXNA 3VB2A 2AS5F 3F8FA 2FBHA 2YX7A 5CJ9A 1RZ4A 4OOIA 4R8HA 2Q2EA 3I5UA 3HOSA 4WXHA 3DV8A 3FM5A 5J8CA 3RI4A 1HW1A 5DUIA 1HW2A 2F2EA 3K1NA 4XBFA 3DXJF 2D45A 2E7XA 5LEKA 4HBLA 2FBKA 4M72A 2A61A 1SFXA 3LA2A 4M6YA 1O3QA 2O61A 2VXZA 1L0NK 2DT5A 1R5HA 1WQ2A 1A04A 2OBPA 2FMYA 5E1ZB 3ISPA 4WXDA 3FWEA 3SZPA 4G7HF 1ZH5A 1PUEE 2GXBA 3WG9A 3P9CA 2W24A 2RNJA 3I4PA 3ZMTA 1D8KA 5LBQA 3E5XA 1LVAA 4L5IA 3TOBA 2QQ9A 2C6YA 3KP3A 4ENNA 1U2WA 2K86A 2NNNA 3FMQA 1AWCA 1FBSA 3LA7A 1XGOA 2G7UA 1RNLA 4HV5A 4WF2A 4LLLA 1G3YA 5L3BA 2FMLA 3WU1B 2P5KA 5LGUA 1WI9A 2XV4S 4TV7A 4KMFA 4OIQF 1W4MA 2CFXA 3GVAA 2P7CB 5E8GA 2MD5A 1BI3A 1O3SA 4UVBA 3WGGA 1ZYRF 3GFLA 3GWZA 1ZARA 4UXNA 2DPDA 4KYWA 1OPCA 1YS7A 3F21A 1XGSA 1FLIA 3EETA 3FZVA 5TRDA 2P8TA 4DQ2A 1B9NA 1STZA 5L3GA 3QP6A 5DDGA 3ULQB 1P92A 4E70A 3HRUA 4YFXF 3C7JA 4KT5C 1B6AA 1SQQK 1P4XA 3GFMA 4G8XA 3K0LA 4Y13A 1XN7A 4XLNF 3QP5A 2ZKZA 2ISYA 5CYVA 3R0AA 3ML6A 1NU1K 4UNOA 2KKOA 5FD6A 1T39A 5HVQC 5BS6A 1OR7A 1GHCA 1JGSA 4EGYA 5E8IA 1TNTA 4EM1A 1HBXG 5HDKA 3E6MA 5F1RA 4BXUA 1LJ9A 1OYIA 2UZKA 3QOPA 5L3CA 2LSOA 4I0BA 1LQ1A 5LGTA 3OOPA 1TNSA 3OV8A 2HQRA 4ENJA 2ESHA 3RKYA 4FHTA 4U88A 1Z6TA 1SD6A 3WU0A 2JPBA 1FNNA 3E6BA 4A6DA 1B1BA 3I54A 4F7ZA 4LB6B 4L9TA 5LHIA 1BBYA 2RVCA 3CLOA 3EUHA 3DPTA 3O3KA 2D1HA 2M30A 1PP7U 3V4GA 3P9IA 2A68F 1BN5A 1K78B 2XKPA 2XHKA 4L5JA 3G3ZA 5E18F 2Y0MA 4I7HA 3RPQA 3FHZA 2DW4A 2VBZA 1O7LA 1FX7A 3BWGA 2HQNA 4LG0A 2E7WA 2CGPA 1MD0A 3J81Z 2L02A 2M5WA 1MJ9A 2GWRA 1ZAOA 1L3LA 3EYYA 3MEXA 3F23A 3WGHA
chains in the Genus database with same CATH superfamily
1KILB 2IZ0A 2YIUB 4H0LC 1IO4A 3AE8C 2G0EA 5DV5A 1GW4A 1J1EB 3CP2A 2F5VA 4AVPA 3KLNA 4XRSG 5AW9B 1SQPK 3GX4X 4ESJA 3KPEA 3W2AA 1EDJA 2ZNYA 3FMRA 2KP6A 2IYOA 4BDZA 1EDLA 3W6VA 2DT7B 4ABZA 2XB5A 2XVCA 2V26A 3EQLF 3MFKA 3TMOA 1SP4A 2EFNA 2P10A 3ITKA 4EIJA 2H7HA 1Z77A 2F4IA 4Y3OA 3CO6C 3DBRB 4N0BA 4UB8C 1TQIA 1F4KA 1SQBE 1B8IB 5CCGA 1FOYA 3ABTA 5IP6A 2BHZA 4HX8A 2M4GA 5EGOB 3GXOA 1FBUA 1YQ4C 2K4BA 4RAFA 1NTCA 2LKMA 1L0LJ 2O3JA 3M91A 2VJJA 3D6ZA 5HODA 3SJMA 4ZH4F 4QLCU 1X79B 1LUJB 2MFZA 3DKWA 4J00A 3MUDA 2PFXA 1YTZI 3D71A 2R5YB 1P7JA 1L2PA 1AA7A 1BJAA 3KYCB 2Z9OA 3H1HJ 2N1TD 2MLGA 3EWKA 3CD6P 1ITYA 2WTYA 5EG0B 1USDA 5KLVK 2PJPA 2JVHA 1Y8AA 4OAYA 3CCLI 5F04A 3BG7A 2AEJA 1VQNI 3CMEP 3U9GA 3RK3C 4YXWH 1MBJA 5HNFA 4FQGA 2BBYA 3ZQCA 1YLFA 2ITAA 2ZXEB 1QBJA 2K9NA 1FDOA 4IOAF 1O3TA 3GF3A 3H25A 3U59A 3MKLA 1T33A 3V4WA 1KFMA 3RL0B 1EH7A 3S4RA 2L54A 4Y99C 1LWUC 3L70J 4BY1J 2O1JA 2OYHB 1H9TA 2FYUE 1U5TC 5CVRA 3T0YA 1FZEA 3LAPA 3K2ZA 3WHBA 2ZNZA 3HOZJ 3K6GA 3JSPA 1SD4A 2O5RA 3KEQA 4PZJA 3SQNA 3V7RA 1BGYJ 3HHHA 2X0LA 3PUBA 2YX4A 4RLQA 4UUTA 4BE1A 3PH0A 1VF5C 2N9BA 3VYUB 3KPHA 1REPC 1HXDA 2L7MP 3M1CA 2IS1A 1JY3P 4OGQB 3CLQA 2F4MB 3KP2A 3JRCA 1RIOH 1JNMA 1Z9CA 2E74C 3RYRA 1CF7A 3I5CA 3A01B 4K2EA 4I02A 3K4MA 1SVFA 2W6BA 4LFUA 1MDMA 4IPAA 3JSVC 2A5WA 3TEDA 1OCOH 4UVCA 2XNXA 3FWNA 3PP5A 2O7OA 4BE2A 5APYA 2IGKA 3FXKA 4PK4A 1CI6A 4HX4A 1ZG1A 2KIQA 3I0TA 3IKVA 5EDNA 4GDFA 3IAOA 1YITP 2ZXIA 3S9OA 2DLLA 3PSIA 3FXUA 1JGGA 3IH4A 5C4XJ 5J4YA 2KZIA 1FP2A 1UJ8A 1HGVA 1ETVA 3J7AO 2XRLA 1BW5A 2JPCA 1QGPA 3CCJI 3BPXA 2LMDA 5JLWA 2O01H 1RE4A 3C1LA 3JRHA 4D6TG 5CCGD 2DMPA 1R5SA 2OTJI 1Z3XA 4H44D 3NQOA 2PG4A 3BTLA 2Y2ZA 3SDBA 2I10A 1OQYA 1YJNP 1SVMA 4G7OF 2XAJA 3A0BC 2EFQA 1DP7P 2GLOA 1TT5B 3L72E 3VMZA 2DFIA 1WI3A 1IXCA 3I59A 5IYCJ 1XS9A 3N4XA 4M3LA 1RETA 2L7KA 4OH8B 1YHQP 4L5EA 4HA8A 1BGYG 3BATA 2RDPA 1E5WA 1WH7A 5LLQA 1K04A 2W27A 4BACA 5AW6B 2DA5A 4EJVA 3ASOH 1KILE 2BVMA 2JUGA 1LT9C 5DJUB 1PUFB 3GHGC 2Q0OA 2COMA 2IXSA 2RQQA 3I56I 1U7MA 1QVTA 3B5NC 1FMWA 2J5PA 3I58A 1TWFJ 4M6XA 4CPGA 1BIAA 2HYFA 3H6PA 2L0KA 4E7SA 2P6TA 2IYPA 5FB2A 4YRVA 5KHDA 4G94A 3ZQLA 4HSTA 2F6CA 2DJNA 5GTHH 1K6YA 5K1YA 4MTEA 2P81A 1MMSA 2R3CA 1MZBA 4DBRA 1XX5A 3GZ5A 2JP3A 1T2KC 2MABA 3M8JA 3R61A 2R7SA 3IN6A 3KE2A 5EZGA 4EMSA 1OCCH 5GTIC 3M3YJ 1KORA 2WB1A 2X85A 2DA4A 2FRHA 5DYMA 1C0WA 2HVRA 3SWKA 1OW6A 1KQ0A 1T0FC 1YE9A 2EFPA 3I56P 2CQXA 3K1MA 5IOYA 1N7SB 4M9XA 1SQVJ 5HS9A 4LGDE 2DN0A 2CS3A 4OMYA 3E1RA 1U8RA 4WY4C 1R00A 1V55H 1OVUA 1W5CC 2DQLA 2B88A 3TK1A 2DMQA 4Z6YA 1FZAA 2O01N 3H1JD 2V7QH 2V6CA 1FJKA 4LLHA 3G4SI 3MAJA 1SQQE 2OJED 4YIIA 5J1YA 1LB2A 3FDYA 2HGCA 5H20A 4AIHA 4CYDA 4IFFA 5JLXA 1B72A 3HM5A 1GZLA 2JQ7A 1DUXC 1X9VA 1L0LG 3HTUA 3Q5FA 3PL8A 1BCCE 1IXRC 2JWTA 4P1WA 1D8JA 5ICCA 2K4JA 5KJ7D 4V2FA 1FEXA 3BQZA 1H88A 2PJRB 2RV8A 2DA7A 3CCEI 2ZO4A 1BI1A 2AHQA 5CLSA 2BXZA 1RQUA 4PV1B 1KTMA 2XKOA 4XKBA 2QM8A 1M90Q 2LREA 1YQ3C 3B71A 1FZPB 4MEYF 3G9RA 3LSKA 1RE4C 3WTZA 4CCOA 4G6QA 5ICGA 1JT0A 3SYTA 2HYNA 1L0NE 5IT9Z 2L7ZA 4B09A 4ZYGA 4LOCA 4AUWA 3KZIC 5KAIE 5CBOA 1F36A 2WVRA 1VQ5I 3FKIJ 3TGUJ 1Y8RB 1VQKP 1YJWI 1DU6A 1W7PB 1VTNC 2E42A 2H88C 3RQ4A 4WXCA 2IRFG 2Z33A 1CF7B 4OGQD 3ZRGA 1NTZD 2HXIA 2HPIA 3HUGA 4LMYA 5J1RA 4RB1A 1AU7A 1HLVA 3HD7D 5LEJA 3TOAA 3QPSA 3OSFA 1A02J 5FKKA 4S05A 2V9KA 3G6EI 3BCCD 5ICFA 2Q7CA 2VKEA 1UELB 3REOA 2NS8A 2NOGA 3JAMZ 1G3SA 3VYIA 3IAS2 2BEOA 2V1NA 1MDMB 3L71G 4M3FA 3AAFA 2PAJA 3H1LJ 2YXRB 4I2LC 1S29A 2DA6A 3A5TA 4PDKA 1TLHB 4MHGA 2ECCA 1KZHA 2K9SA 4B8XA 3I4MJ 5KVRA 4E7LA 3CUQC 1M57D 4Y7NJ 4BEHA 1P84H 2A5YB 2FKWB 4IOIH 3GO5A 1V5GA 1JY2P 4ZKPA 3LFKA 1V3FA 5D5UB 2K7LA 1E3HA 3DKYA 3DF8A 2Z4EA 4C2TA 1FIPA 6PAXA 5FLXK 3OYBA 1H89A 3GF7A 1YTZT 1I27A 1WJFA 3ZQHA 1Q82Q 5DM7F 1UG2A 1E17A 1GMJA 4N9HA 3OYEA 1S9HA 2DA1A 4UUSA 4KN7X 3CCMI 1AV1A 5KCMA 2VKHA 3A4CA 1W1WE 1LTJB 1N86A 4WWIA 1MJBA 2XRNA 4C2UA 5APUA 3L74E 3V2QA 2WT7B 3JSOA 2A06G 1BDDA 1S5LE 2BV6A 4G9YA 1PP9G 1IFMA 1DP3A 2HFHA 4UHTA 2IW5A 3OS1A 1ETYA 1AA0A 2E5TA 2ECBA 4A93J 5D8LB 5B1AH 1I3QJ 3JW4A 4E7JA 2H1KA 1BE3E 4EOTA 3KZYA 4R1HA 5B66H 1YS6A 2W90A 3CXHE 3SZGA 4CUGA 1JXSA 3OYDA 1USTA 3J81K 3VSLA 2KNCA 4DJAA 1MSFC 1WMKA 4N6JA 3CCMP 1G3TA 2H09A 1MBFA 1L0LK 3BZCA 4ZDPA 1D5YA 5M1BA 2KZJA 1SMTA 4V2GA 3HZJA 4Y52J 5FFXA 1QZZA 4EM0B 4H13D 1ZTRA 5CCGC 1J75A 2NRAC 2JA6J 2LBFA 1R1VA 4EQQA 4ENMA 4II2A 3WU2C 2V6EA 3O6QB 1KQFB 1I6XA 1JT6A 2TRTA 1W2EA 2XAUA 1GD2E 2CV1A 2RAEA 2EH3A 3AG3H 5TGTA 1VQNP 2XROA 3L2WA 4YFKF 4LG3A 2IS6A 3ZMSA 4KITB 4WY4B 2R3SA 5B66C 2AQEA 1XCBA 1L0ND 1RR7A 4DOZA 4FCYA 1OCZH 4P9UA 3DKXA 2E35A 1Z56A 3BJ6A 2CPSA 3KX2A 2WY7Q 3HEFA 4XN0A 1NTME 1HF9A 1ZLKA 3CO7C 2P7JA 1VI0A 5M5WJ 1U9NA 4HH2A 2QBYA 1BM9A 4BNCA 1KB9H 3KP5A 3JRGA 2HDCA 2WSEH 2CW0F 2X6YA 1YX5A 4B4CA 2EK5A 1N7LA 3OJAB 4RM2A 2EA2A 1KB9E 2KIFA 1LTBC 4M71A 4ENKA 2FNAA 1A5JA 3DPUA 5KAIH 3BCCE 1N73A 3K5BA 1SFCB 4C7NA 1GTWA 4QIWN 4LB5A 4L75A 2QENA 4IXAA 2YKQA 3H1LE 3I55P 1W5CE 1FZCA 2H8WA 3RKQA 3C3WA 1W7PA 3CDIA 2XB0X 4BYYA 1K61A 2VE8A 5CVJA 3GHGB 3ROUA 3RPUD 1NTMK 4ZYEA 4ZTJA 1KYWA 1NTMG 2IBZE 2XF5A 4BH9A 4IRIA 1AHDP 2BVLA 5C39A 1OCPA 2WQYC 3NXSA 2EFOA 1S8NA 2KFDA 4UV9A 1JOCA 3BJAA 1J2XA 2HQAA 1OKRA 3H9JA 2QLZA 3RPUA 2DPUA 1WCMJ 3TGNA 2VT3A 3CUQA 2V1XA 2LLKA 4HDVA 4BXXJ 1SAUA 5GPAA 2Z5IA 1G1JA 2HU9A 2RMZA 2MC4A 4HF2A 2FBIA 1R4NB 3DBLB 2KDOA 4BAYA 1Q2NA 2XIGA 5F0FA 2HVSA 2OTKE 2BHYA 2Y69H 2UWMA 3W68A 1ETKA 2Q8KA 4HQMA 3U1DA 5HDNA 3LSRA 1LPQA 5AVRB 3T97B 3U2RA 5B66E 1EXJA 1AJYA 2NVUB 1FYLA 3LSJA 1ZRTE 4BHCA 3WTXC 1F1ZA 3DLLF 3GF2A 5D5XB 1IG7A 2WADA 4D1QA 1DDNA 2E76D 2QQAA 1M8OB 5APTA 4IFDK 2JA5J 4RA2A 2IBDA 3GFJA 1A36A 2QJKB 3AE5C 3GMEA 1Q81Q 1Z7UA 2QKLB 1OCTC 2RC4A 5HOOA 1PDNC 5KLIC 4HOBA 2A6EF 2IVMA 4H13C 1S72I 5GADJ 3VFZA 4PD4I 4EJOA 2FFDB 3HSEA 2IGNA 4N4OB 1UIIA 2KZVA 3R4KA 3MZHA 5GTHE 2LOOA 2PBIA 2DK5A 4UV8A 4IFMA 2LH9A 3S2WA 3L71D 2N1TA 3E6DA 1BGYE 2HEOA 2CYYA 3OYLA 1W36C 3H1IE 4L9NA 3A02A 2OYIA 1SQVE 1I3AA 1WJ5A 1DX7A 2PMUA 5M5YJ 3G6EP 4BL0B 4CA0A 4XRSA 5J6XA 3L73J 3CC2P 5JVTA 1X2MA 3WTTC 5BU5A 1BIBA 3ZQIA 4LK1F 3A3YB 5DS9A 2E2HJ 1SQXJ 1YRNA 1L4AB 2WPVB 3BROA 1WH5A 1GXPA 2Y75A 2K88A 1OR7C 3OSGA 2QM7A 2X6WA 3IH3A 3WGIA 3L75E 1HWTC 2DAOA 3H1HG 4PSWA 1RE3A 5KTBA 3AE6C 3OR2C 5IP9J 2W7NA 2JJLA 1VNDA 2BGCA 3S1RJ 4KDPA 5FKLA 3K4CA 2MH2A 2DBBA 2XSJC 5LRSA 3RK2B 1G2CB 5DD4A 4HNUA 5AVTB 1VQOI 3L2QA 2AXLA 1Z91A 3FXDA 2O8XA 4RB3C 1J1DB 3QU3A 3TYYA 1I6HJ 1MFTA 1YRNB 4BQAA 3VODA 1ZRFA 4FE4A 2JUCA 3JTHA 2VODA 2R7TA 3ZCOA 2PN6A 3H5AA 3H9QA 1FMVA 1BE3J 1RC9A 4IJAA 4AD9A 2ELKA 2I1JA 3CCUI 1NHLA 3F3XA 3AECC 2PEXA 2D2CC 1P4WA 5HLIA 1DU0A 4B48A 5DTDA 4LJZF 2ISZA 4K35A 1S7EA 1P4AA 1SD5A 4XLEA 3B8EB 1BOAA 3ELKA 2FY8A 3EFFK 1I1GA 1KILA 3K1PA 5JHUA 2A05A 4E7HA 3GYHX 1AKHB 1PP9J 1Y1WJ 3A0BE 3B5ND 3HTKA 2VRSA 3IF4A 2V9PA 1JKPC 4KT6A 2R7VA 3N4MA 4UUVA 3RBZA 1RUNA 4XL9A 3FHNA 3DU6A 1NTKJ 4GODA 3GTOJ 5APQA 1Y56A 2P0WA 1XMKA 1Z67A 3G2BA 3FMSA 3CD6I 3M1EA 2GM4A 1NU1D 1LFBA 3EQ2A 5FKOA 5CVUA 1E3PA 1IAWA 4KNYA 4LG0B 3L2VA 2K37A 2WPQA 3NMDA 4BXLA 4EDFA 4KIFA 4RB0A 3OY9A 3HPHA 2WSFH 3AEBC 3D70A 1H89C 1DIPA 3E1IA 2F48A 2O0YA 1IFPA 3I4NJ 3TO9A 1Z05A 1WZ2A 3J7AY 2W82A 5E79C 5HDGA 1YJ9I 4HW0A 1YI2P 1XDSA 4KIGA 1HCRA 2BCCJ 4ASVA 4JYKA 4ZNCA 3HL2A 1OYWA 5IT9K 1LE8A 1LFUP 4MEXF 2NS0A 1OVRA 3VDXA 2P2UA 3L71J 1KQLA 4O3MA 3G1LA 2RQPA 2PJRA 5AIQA 4CH7A 2R7RA 4I76A 1JTXA 5D5WB 2ACJA 4GGGA 3M7GA 2FYUK 2IT0A 2OTLI 1BGYD 2X51A 4A69C 3H0DA 3A2KA 2OV7A 2WV0A 4ZYDA 1MBGA 2BEQD 2FXPA 3ABLH 2BY0A 2JZYA 4L0YB 1LTAC 2HODB 2D2WA 2A45H 1FSEA 2FD5A 2Y0SN 2NPSA 1YW9A 3L2RA 3D5SC 2R92J 1CGPA 2NZ2A 5E1XA 3X2QH 1JHFA 3HSFA 2M9HA 4P9FA 3ONQA 1VFCA 2G7HA 1TC3C 3BT9A 5EEGA 3W3CA 1N73B 1EJ9A 2DMTA 3S8PA 1E0EA 3Q5SA 1BSHA 1ETWA 2OZ6A 2F4OB 1G2HA 1OW7A 1B4AA 3ZMDA 5J1UA 5DD8A 1VQLI 2M45A 4D7MA 2EV5A 1PGJA 3SFZA 2E19A 5KLVE 1UHMA 4XLAA 2OTLP 1NTKK 2IPPA 3FKJA 4EJWA 2N9YB 2FEZA 1BI2A 2DXIA 4HEA2 2IP2A 2L01A 2FYNC 3Q5RA 1EH8A 2ZCWA 4A12A 4A3BJ 3R0JA 2HOTA 1MJAA 1TW3A 3CF2A 2HOEA 3H3UA 3N7NA 1IGNA 1MH3A 3O6BB 1IRFA 3MKZA 1SFUA 3C1DA 3EFGA 3BLYA 2WAQA 2Y0CA 3C8VA 4GIFA 1NTKG 2WWYA 3AG2H 3HUSA 3F8MA 1J7KA 1LGHB 5JI6A 1J0RA 5HLTA 3RK3D 1HH0A 1TZLA 2NRGA 3IHUA 2LD5A 1FOXA 2OC6A 1QEXA 3VP9A 2M1BA 1NU1J 1YOVB 2V9VA 2W48A 2WY8Q 2P5LC 1L4AD 2QSHX 3DEWA 4QSHA 2DCEA 1MBHA 1L0OC 3ZQGA 1IN7A 4M9ZA 2BCCE 3FXQA 4C2MJ 4ZMDA 1HBWA 1JUNA 3PQKA 1EV7A 1T0FA 2EILH 3CMMA 1PP9D 2IDBA 2A06D 2VJ5A 2XAHA 4H13B 5AW4B 5DCFA 3ECOA 2B89A 1YFHA 1E3OC 3WUTA 2KJCA 4BQQA 1BC8C 2L9NA 3AL0B 1S1CX 1T95A 4B43A 1T2KA 3BG5A 1QZYA 2Y31A 3VPRA 4EJUA 2Q3IA 2Z99A 1BR4A 4IQ4A 4L0ZB 1B59A 3TO7A 2K3RA 3F0CA 4HZFA 3HC7A 1R22A 3KZZA 2W84A 1VZ0A 1KMIZ 1ODDA 5BPDA 2FOWA 5BQTA 2E34A 3B5NA 3A0HC 5HS8A 3OYNA 3FXRA 3QWLA 3QU6A 1WSUA 4KJMA 1P7IA 2JN6A 2ZT9C 2JA8J 1RF0A 2R7OA 4CZZA 2JO1A 2GBYA 4DZPA 1KGSA 4JBZA 3S1NJ 4F52A 1WJCA 4G6DA 4XMYA 1OFCX 1Q1HA 3K70C 4A3LJ 3ZP5A 3N05A 2EWNA 2K9LA 4DJGA 1URQD 1YW7A 2HPCA 5ILUA 4MFEA 3HOTA 3FIWA 1W0TA 3JAMK 2N1TC 2E5YA 1AKHA 5AVWB 3T97A 1NG6A 1RUOA 2X6OA 2B9BA 1ZP0C 4D0PA 5BU8B 3BVHA 1U5TB 4WX9A 3JTGA 1JTHA 2O01J 1JJ8C 4XKCA 3KIOA 1GVJA 1FDIA 1IFNA 2XNDH 4P5OA 3KP6A 2ZSHB 1NKZB 2Y0SA 3K9TA 2DI3A 2BW3B 2KQRA 3G73A 1VQPI 3VMYA 5IY5H 1F9NA 2VOPA 3Q0VA 3DEUA 2F5DA 1XSVA 2K9QA 1R9TJ 1B9MA 3SZTA 1O4XA 1N78A 4JQFA 1U57A 3MCZA 4M73A 3CMAP 1N8RQ 1LDJA 4I98B 2EQRA 3CX5E 2KS1B 3TKYA 4GDOA 2NPSD 2JVGA 4G7ZF 2Z5UA 2IFNA 2R5DA 4I7ZB 2FE3A 2VQHA 2XPWA 2H27A 1FE6A 4A3GJ 3V8JA 2LR2A 5CCHD 3JCUH 4ZYHA 1S7AA 1IRXA 2GIVA 4H0LD 2VC1A 1S9KE 1ZHFA 3H5NA 1S5LX 4ANJA 4CCJA 1UZCA 4Y33A 2HVQA 4NBQA 2RN0A 1NHAA 1SD7A 2OCEA 4PCQA 2WSCH 2CV0A 3FWLA 4FT8A 2LY2A 3GW2A 1BR1A 2L2OA 2NNYA 3L4FA 2W57A 3CC2I 2QJPC 1XDUA 4ZC3A 1JKOC 3HXLA 3JRAA 2E75C 1JUPA 3IKTA 5BOXA 3AE2C 3BTCA 4S04A 2Y48A 1B8IA 1LWUA 1LDKB 9ANTA 3A0HE 4NPFX 4WBAA 1EH6A 3GUDA 3ZMUA 5J4VA 2BZTA 2KDZA 4YTPC 1NAYA 2WSEJ 2ZMEA 1KQ8A 3HUSB 1Z0XA 2Y0DA 3KXDA 2JMWA 3BDDA 4E6KG 1PGQA 1TWHJ 3CPWO 3H1HE 4ZJZA 5K7HA 1TQPA 3CF5F 3WMM0 3PNTA 4A3IJ 2IAIA 1IRZA 2HS5A 1DD4A 2NVQJ 2R5ZB 3S3OA 2K1AA 2FX0A 2ZBKA 4G6TB 5DEQA 1VL2A 2FXOA 3NARA 1L0LE 2M2EA 4L9JA 2VC0A 3WTVC 3BG3A 4H0LB 3LNQA 3L00A 1IUYA 4HQEA 3ERED 3ZOBA 3IAM2 3OIQA 1ZG5A 1BSNA 1DQUA 3Q0WA 1KQ9A 3KFWX 2R5ZA 2QEXI 3PTZA 2B9SA 2O6GE 2LY9A 5LHHA 1J09A 2XGDA 3CCYA 5H2FC 1KYOI 2UV1A 2QGUA 4GRIA 4OVNF 3B73A 4XIDA 3RBXA 1QVUA 3RK2C 1BL0A 2ZMEB 2WB1N 3WTWC 4RJTA 4BHBA 4KA4A 2FXMA 2ZJSE 2L9RA 2XAGA 4BJTA 2X4HA 5E1WA 3W67A 3LIDA 3WODF 3QPLA 4RO0A 3PIPF 3F72A 4BU2A 1KYZA 4E7ZA 4UB6H 2FQ3A 3CUQB 2WTEA 4MNUA 4NQWB 3RKXA 2XF6A 2R7XA 3O2PE 1HF0A 3CCSP 1GV5A 1ZG3A 2P7VB 4EVIA 3S15J 2CK3H 3KDPB 1LKXA 4PD4E 5AW2B 1T38A 1KU7A 5AW8B 5D5VB 2G8YA 4HG2A 5F27A 4NC8A 2IA0A 2LXBA 1PP8F 4M3EA 1IDZA 3OW2O 4ESFA 3U21A 2OD5A 2H6CA 2E1MC 4LIUA 3SFDC 3KYLA 2L9VA 1MV8A 4Z2YA 3BR5A 3G1OA 4RGXA 2QKMB 3TGUG 1R1TA 2CG4A 5AW5B 1EKEA 3PIOF 5K5QA 4YG2F 2ME6A 2VQCA 3M9AA 2EV6A 1YIJP 2STWA 1OJLA 4FX4A 4XRFA 2QBYB 2B87A 3SWFA 3WTSC 1FU1A 1OZHA 4BGDA 3FM3A 2EB7A 2EFWA 1WRGA 1R58A 4LIVA 1ZREA 2BY1A 3M8EA 3BR0A 4RS8A 3JRIA 3E97A 3S1MJ 2L7FP 4AIJA 4AC0A 2V7QJ 3DTEA 5FFZA 4AYBN 1XGMA 5FROA 5AVSB 3V7CA 3ESWB 3V8KA 3I55I 1PGOA 2HDDA 2ZMEC 5CQGA 2KXPB 2PQ8A 2IBZI 2A3SA 2NVYJ 2VOOA 1EZVI 3A2AA 1T08B 3HTKB 2IX7C 2QZ8A 2M4KA 3WUVA 1D0XA 5FGMA 4RB2C 1IRGA 2J5OA 1T3JA 3KYQA 3PLNA 2WA0A 3VMXA 2MBFA 4O6JA 3HBLA 5ED4A 2R7UA 2CUZA 3E5QA 1U78A 4A3JJ 1Y39A 3M9QA 4ZZLA 4EJTA 1SFCD 4PJ0H 4W7YA 1PPJG 1KU2A 3GTGJ 1YYCA 3RL0g 1EZVG 3FXJA 2FYNB 3CMYA 3VYRB 2L4AA 3TP0A 1ZELA 2QSFX 1SVOA 1LNQA 2YO3A 4D6TE 3RL0D 4KUMA 1Y8QB 3K10A 4M3BA 2M3BA 4Y99B 4LLNA 1FC3A 4AIKA 4ITVA 2E1CA 1YIJI 3RDIA 1I5ZA 2AXTE 2LTPA 1R5ID 1SAXA 2KSEA 3WE3A 1K4TA 1GU4A 2ADUA 3LSHA 3AEDC 3O8GA 2M7AA 3KCCA 2BCCD 1KU3A 2XDVA 5GAEJ 2OARA 1G2CA 2QIWA 5H2FE 2BE5F 3H1JG 2QWWA 3GTJJ 2R0QC 1Q7YQ 2EV0A 4NB5A 2CUJA 4RAGA 4A2UA 2XAQA 1NTMJ 3SDGA 1D5VA 2R7FA 3VOEA 5BPIA 3LA3A 2JR8A 1W7PD 5H6RA 4G12A 2M3AA 5ILVA 2K3FA 3WG7H 4EATA 2FSWA 4TT3H 2I5UA 2KS1A 5APVA 4NUBA 1LVKA 1X4OA 2PMZN 5HS7A 1BE3G 2RH0A 3EUKL 1AQTA 1R36A 3M0DC 2MW8A 3PNVA 3B6AA 5J8FA 4BRYA 3B6CA 4Q48A 3M9HA 2XZRA 2E75B 4GO1A 2LR8A 4RBOA 3MZYA 3RZOJ 5FLMJ 2E76B 3AE1C 1GL2D 2H43A 5GTIH 2ZXJA 1TWGJ 4S0HB 5JR3A 2KLVA 3M9BA 1IN5A 1QHHD 1FTZA 2ZYGA 3H1JJ 4HDUA 3QH9A 4U3FD 3HHGA 1SQPG 1VQOP 4JK1X 1KYOH 2LKXA 1LT9B 4KN4X 3ZN1A 1J5YA 4U3FG 5JVGF 4ZKUA 3D1NI 1TU3F 2L9SA 1WGXA 2X1DA 1GL2A 3MVPA 4U7JA 1HC8A 2FA5A 2KB7P 3HTSB 2KK7A 4R4LA 2JK3A 4EV0A 4ESBA 5IPAA 2XAFA 5LHGA 2QE7H 2VL8A 3CXHD 3DEEA 4R4MA 4X6AJ 1SQBK 3KLOA 3HD7B 1L0LD 1UCRA 1S7OA 1JE8A 4DIQA 1NJIQ 3ZPLA 2LG4A 2GXAA 3L72J 3EYIA 1X1CA 4Y17A 1OLTA 5LD2C 1W0UA 3L75D 1QVGO 3UNGC 3DQVC 1JCCA 4BQNA 3WE2A 2V1DA 1YW8A 4C3HJ 2XUBA 1VQKI 5B1BH 2YU9J 1JUSA 3II6A 4HV6A 3QODA 1SQBD 2C9NY 2VXDA 3J7YJ 3GHGA 2JWDA 2A6HF 1AVYA 5F6FA 5EFWB 1RF1B 2MKVA 1URQC 1DEBA 4AYBA 3M4OJ 5D8KB 1EDIA 1SQXD 1IC8A 2E43A 3L74D 1NAFA 1XC5A 4ASNA 4XLFA 1FS0E 3M0AA 5L8RJ 1MGTA 4FISA 2XF7A 4RGSA 2X6XA 4H44C 4R79A 2W1OA 4GXOA 3Q3DA 2PFBA 1PPJD 2QJYB 3OYFA 2QA4I 1EXIA 3IRRA 1R1UA 5F08A 4U0WA 1XGNA 2A45I 3KZIH 4C7RA 3GTKJ 1NOHA 1RI7A 3AEGC 2HXOA 2PMHA 3BJOA 3OR1C 4M9SA 4MN4C 2Z3YA 4RKUJ 1NK2P 2E2IJ 4L9VA 3L70G 3ZMZA 1ZW0A 3CCSI 1KB9D 1X19A 3VWBA 3ERMA 3H9GA 4A7PA 1FZFA 4A3CJ 4ZZDA 5IYBJ 2JRTA 5FO5A 4F91B 1QL1A 2FFDC 3RL0C 1GUUA 1M1EB 1UB9A 2EIKH 1IF1A 3L73E 2M34A 2R4GA 3ABUA 5E79E 1D0ZA 1T56A 2KT0A 3PFYA 2R7WA 3LW5H 1M1KQ 4ETSA 3QOEA 2O1KA 1HSJA 5K5RA 4X0GA 4JF7A 2ID3A 5ILSA 1LEBA 4Y28J 1FBQA 3CWBG 1ETXA 2L5QA 1D7MA 5DCMA 4JYBA 3TL4X 2A07F 5BNGA 2KMUA 1CSBA 3N97A 3HYIA 1U3EM 1X3WB 3KETA 1IJDB 4KHXA 3VN0A 1ZQ3P 5AW7B 4BQOA 2GA2A 5B3SH 4AIDA 2E74D 1HW5A 2ICWG 3FK7A 2NAZA 3V2RA 1LTSC 1QGKB 3TDUC 3CMEI 1FOSF 2B0LA 2C0WA 2Q5UA 4A6EA 4D6TJ 2IA1A 1IK7A 4IRHA 2V4JC 3TGUD 2CJJA 3HE5B 1UFMA 3B02A 4HYTB 1YG2A 2A69F 5L3EA 2QM3A 4F55A 1IN4A 3SXYA 2WT7A 3Q9VA 3RIRA 1XB4A 1XPXA 1Z7LA 1SMYF 2ZFWA 3P9KA 1OWAA 3G1MA 3GG2A 1FTTA 4AQRD 1VQLP 3MWMA 1JB0J 5AONA 4IL6H 1BR2A 2GZWA 1H0TB 2Q3EA 1Y47A 4PD4D 1K7AA 1FOWA 1NWQA 4W97A 1U6GA 3HSRA 3HOUJ 4PV1D 4OINF 3PQJA 2JJ7A 3MD0A 4H4KC 4OAZA 3S14J 4AUXA 2ETHA 2UXXA 2W6AA 4XKVA 2DJIA 4AWXB 3PJSK 2CFOA 1LTJA 3Q2YA 3L75J 2JSCA 4IF4A 3JRDA 3L71E 2VI6A 4UUSB 2HKXA 3WTYC 3WU2H 1WRJA 3V6IA 5KAIC 4F3QA 2E5ZA 1A35A 3HJEA 1UAAA 4GOEA 1J1DC 1NU1E 1DGRM 4ON0A 3H1KE 4QWQA 1R6RA 2J5UA 3CJRB 3RKWA 1FYMA 3RYPA 1T98A 3L70E 5M3FJ 3OYGA 4L74A 1BC7C 4I99C 2L91A 2AQFA 3H1IJ 3HRTA 4P55A 4Y15A 3RK3E 3BC8A 1ZLJA 3BR6A 4U0VA 1N77A 5E79H 1IN6A 5CPRB 4IVNA 2FJ1A 3KEOA 2K9JB 3WUUA 1ORKA 3ZDMA 5GAHJ 1GXQA 3CJNA 5BMZA 2FQ4A 3E3VA 3GW6A 3HD7C 4CXFA 5B5EH 4XORA 1SEUA 2XGCA 1EZVE 4I1LA 4N3YB 1T2KD 2HTJA 1Q86Q 1QO0D 2XKMA 5KAFC 1VQ7I 1ZRDA 1FWZA 1IFIA 2SPZA 2RN7A 3PFIA 1NG7A 3M8FA 5FLVA 5KAFH 4KICA 3C2GA 3F6OA 3VP8A 4IL6X 3PSFA 3FXMA 3V8LA 2CH0A 2DU9A 4HLYA 3L37A 4DGWB 1MH4A 4B3XA 3T8RA 4JP0A 3L36A 2WWWA 4KT0J 1K78A 4RESB 4C9YA 2EA4A 5K7ZA 1XMXA 4DYRA 4GCVA 3UIAA 2EBIA 3VEPA 3H1ID 2K3PA 2K02A 1JKQC 4JYCA 4MGRA 2WZ7A 1RKWA 2W25A 5KLVG 1M1JC 2XASA 2WAFA 2KUBA 1ZGWA 3L75G 3RK2D 4CO8A 2VUMJ 2NYXA 1RRJA 5CBNA 4WB4A 3TP3A 1SC7A 5LRRA 4NPEA 1Y0NA 3Q0UA 3CCRI 2ZVOB 4M3GA 3Q3SA 4FX0A 1RPWA 4A0XA 3OA7A 2PP6A 4QPQA 1EQ7A 2E1NA 3HE5A 4WY4D 4O5VA 3SEQA 2L4MA 4WVZA 2FYUD 5CJ4A 4HLXA 3DFGA 2M0CA 4MTDA 3BG9A 3NTNA 1IZ1A 3BR1A 2LFBA 3V7SA 5EGOA 3L35A 4HJGH 3TNUA 1JI8A 4XA4A 1BOBA 1ON2A 2CWEA 3FXLA 3P8CE 3A03A 4W1UA 1VQMI 1O57A 2GIZA 1MIJA 1IW7F 3HGYA 4N9IA 3IUOA 4A3EJ 4Q5SF 1SQXE 3BASA 4OWFA 5TISH 3QYBA 1D1BA 1BW6A 5E3MA 2OYIB 3EDPA 1DD3A 2XDJA 3USSA 2IJLA 5CCHC 3QYFA 3GTQJ 1DEEG 3MTUE 3T1BA 4XLCA 2ZJ2A 3FF5A 3TO6A 1PYVA 2WSCJ 1FP1D 4XRMA 4OU0A 4KFCA 1PZQA 2LNBA 1XMAA 4BXFA 3NWTA 1FIAA 1WVRA 2HR3A 3CDHA 3S32A 2AXTC 2M8EA 1RH5B 2DTRA 3HOYJ 1LNWA 2IS2A 5ICEA 1L4AC 2FBWC 3KP7A 2ZXWH 3GTMJ 1AVOA 4NDLA 1M7LA 3LQRA 5D6EA 1PUFA 2BXYA 3E1SA 3ZGKA 2JTVA 1O3RA 5B5EE 1TTYA 2HZTA 4RGRA 2KZGA 4I6ZA 1VQ8I 2R7ZJ 1SQXG 1ZGJA 2H8PD 1R71A 1LP1B 1QX8A 1T6AA 2HYJA 1T3UA 2QYOA 5LGNA 3OYJA 2NPSB 2O9LA 3QAHA 1U7JA 2KNCB 4A5NA 4A5MA 2DOEA 2JA2A 2R7DA 2QJPB 2QA4P 3IRQA 4HX7A 1AOYA 3I64A 2HPMA 1KILD 2WSSH 4L73A 1K79A 2RGVA 1ZR4A 3R6SA 3PO2J 2R5BA 3GBGA 3C2HA 2J58A 2EPFA 3WU2E 1N75A 4HNTA 2QEXP 5IP7J 5M3MJ 1R5LA 1EZVD 5F1JA 1JCDA 1MMDA 2WMMA 2BYVE 2ZVNB 2JSPA 4X1EA 3G4SP 5E20A 5K5OA 4CYCB 1H8AC 2Q9IA 3I59B 4CDGA 2PGDA 1IFJA 2H89C 1M1JA 3HE4A 2N8GA 1RF0C 3JRBA 4UB6C 3CCQP 2IZ1A 3L7WA 1MMNA 1USEA 2HI3A 3A1YA 1EF4A 3BCAA 1NTZE 3FX0A 4IRGA 1TT0A 4K3AA 5GP9A 4QPOA 4YFNF 4GOFA 2GUSA 2E1MB 2J59M 4NNJA 2E76C 3BR2A 2C9LY 3PM1A 1R7JA 3LL7A 3FISA 3HD7A 3TW7A 4LGWA 4PJ0E 1VQ8P 1SFCA 4C7NB 1BE3D 3LSPA 1FY7A 5TISE 4II3A 3JC22 3H1LG 4EM2A 1KYOD 4XE5B 2E71A 2Y9ZA 3A0HH 4DCKA 2H1LA 4OMZA 4D7NA 2VQLA 2CQ7A 1G6NA 4IHXA 4IHVA 2W6JH 5C4JJ 1J2JB 3DTKA 2DK8A 1QQIA 2O3FA 3T5XA 3OAKA 1E2XA 4BWNA 2E5NA 2OYHA 3E5UA 5KLVD 1X3ZB 4GYIA 3ABVC 1P9QC 1V4RA 5E3OA 3OOUA 3CUOA 1ERDA 1RF1C 3LW5J 3J80K 1LTJC 4I09A 3JCUE 1GT0C 5AVZB 3NFQA 4RLFA 2M7BA 3P7KA 3AG4H 5IT3A 3JREA 1IN8A 2KRFA 2ZFUA 3CP8A 2DDAA 3U1AA 1H0TA 2YS9A 1JO5A 1SQVK 4HYEA 1P2FA 3F8BA 3OYKA 3GTLJ 4RAYA 2Q1ZB 4FTHA 1MFZA 1WFXA 3LSGA 5EG0A 3I53A 3S16J 1VQ9P 3CL3D 1G3WA 3GFIA 5D4RA 4EGZA 4H0EA 3L09A 1GVDA 4LK0F 4W7ZA 1UHWA 3CJTB 1EDKA 2H6BA 1OCRH 1TW2A 4FE7A 2OA4A 4NQWA 5HLGA 3TDKA 4DT0A 3IWZA 5KAFE 1KD1Q 2WAEA 3FBIB 3L2CA 3TGUE 1G4DA 3H1LD 3H32B 4OIPF 4YIFA 5AVVB 4M6VA 3COAC 4A0YA 2VT2A 2LC2A 1VQ7P 1X22A 1G8XA 1JY3N 3ASNH 3P5JA 2GXGA 3LSTA 1OXZA 3G71P 1TBXA 3H36A 4B47A 3RZDJ 2M5AA 3SWYA 1K4SA 3QQAA 4A0ZA 2YSRA 1X1BA 2XU6A 3H3ZA 5DUKA 2KP8A 3VMAA 4KIBA 2R5YA 1YI2I 4MIMA 2RNGA 1AFOA 5F0HA 2LF7A 3RCOA 3IWFA 3HOXJ 1NTZJ 1HKQA 2LXCB 3IFMA 1W5SA 5EEAA 5DJTB 5CVVA 4BKXA 2JEEA 3VTPC 2QJKC 2YPRA 4CGZA 1ZOYC 3W6JB 3FXEA 2NPSC 1MW7A 2CRGA 4I2OA 4F93B 1BCCJ 4GYGA 1LFPA 1IXSB 3BCCJ 2CMPA 5AVXB 3QYEA 4MQ9F 4RGUA 3G71I 2VE9A 3IC7A 1BJZA 1HOMA 1VDFA 5FLXZ 4PGHA 5DCMB 4JBAA 2COBA 1HGZA 2HOAA 3BRTB 4YPCA 2QSIA 5HLHA 1IV8A 2QF7A 2QUFA 2CQNA 3IR9A 4RDUA 2DW3A 3H1CA 2OPTA 2VN2A 2BY2A 1KN7A 5AVYB 2M8RA 3BZ6A 5B5EC 3AKZA 3NWSA 5KK1A 3BY6A 3HG9A 1MMGA 1LEAA 3F6VA 1OIPA 4WK8F 1LWUB 2O03A 3ZXSA 1S2EA 4JX4A 2LVSA 3LIEA 1AQ5A 2YMYA 2PI0A 1KYOE 2Q1KA 4DZJA 1NYHA 3PRJA 1YHQI 1PFIA 2IEKA 4U7BA 3BCCG 1ONVA 2QQ8A 3HUGB 1MNEA 1ETOA 1USSA 2OQRA 1ULYA 2P6SA 3L9FA 4Y4RA 1EA3A 4LLGF 4U7DA 3MMYB 2UUZA 4XNFA 2XSDC 1RR8C 3BR3A 1MBKA 3E7KA 4AM3A 2KIKA 1URQA 1GU5A 2HODA 2FYUJ 3FX3A 3KHUA 3BZKA 3IL2A 1XSXA 3F8CA 2QJYC 3H1HD 3R4YA 1SS1A 4XSXF 2KSJA 4DYQA 3S2HJ 4NHJA 1JY2O 1N7SD 3D5LA 3HRMA 3QPHA 1RESA 3E6CC 3HE4B 1P6RA 1APLC 4CYCA 4IKFA 2DA3A 3TQNA 2R93J 5CMZA 2FYUG 1YIOA 4IX7A 2A45G 5CQEA 1MKMA 3RQIA 1JM0A 2BY3A 2LRDA 4IHSA 1NTKE 1I1SA 2HTSA 1FZCB 1RF1A 1D3YA 4PJ0C 2YUSA 3TW6A 5D4SA 2YO2A 4L18B 4YXDC 5D6FA 1XTAA 1FPQA 4CCKA 1YJNI 3F8NA 4CCLA 2NXNB 4F92B 4MQVA 4B1RA 1IV6A 1UG0A 2KPMA 4PUSA 2FF4A 2W00A 1IC2A 2MLKA 3ABMH 4RAZA 2POHA 5JFRA 3HKZN 1U8BA 3K4JA 1LP1A 5AVUB 3L74G 2K27A 1ZXGA 1GV2A 2D1VA 3Q9SA 2V79A 1I50J 2RKHA 3CQZJ 3W2WA 3P8CD 1R5GA 3OYIA 1ZK8A 5AIPA 2FXAA 3KZIE 2EIJH 2GQQA 4A3MJ 1D1AA 3TDZC 4V19K 1HKTA 2FOKA 4OWRB 1X0TA 3HPGA 1I39A 1LT9A 3O6QA 2UWJE 3HUSC 1WKMA 1G59A 4HRIA 3M0DA 4EI2A 1Y9BA 2OQQA 4WCGA 2ESNA 3LMMA 3H1KJ 1WJAA 3L2UA 4I7ZC 1SFEA 3BPVA 2VPLA 2ELHA 2VKVA 1ON1A 1BCCD 5AW1B 3OL4A 1K9MQ 1T6SA 2L5GB 1H9GA 4P96A 3OYCA 3OYHA 2ZYAA 4XR6A 3SFEC 4KISA 4BRYB 4XLPF 3H92A 4CCNA 3HDDA 1JY3O 4XQFA 4Z1MH 2F5CA 3W6KB 1Z21A 2MG4A 1CQTA 2DO7A 3TNUB 3M07A 3EPZA 2Z2SB 3H32A 3A7OA 1HQCA 3H5RA 2OYOA 4CCMA 3CC7P 1POGA 2DFFA 1DPUA 3LQQA 5A2QK 4IL6C 4XFJA 1YQAA 5CJ0A 3PO3J 2C0XA 2W83C 2TDXA 2FU4A 3LWFA 4JX5A 1HVVA 1V5EA 1VF5B 2P5VA 1Z6RA 2D2CB 4YIRX 3RTRA 1PPJE 3TF5A 4HF0A 2AO9A 2LKSA 3SHFA 1QPMA 1A31A 4E7KA 3A0BH 4DNCA 3HIFA 5H6QA 1Z3YA 1Y6IA 1OISA 2CQQA 2ZXHA 2X48A 5LFAA 2O8KA 1K6OA 4BBSJ 2EZKA 1L4AA 3CI9A 1X2NA 2KISA 1ENHA 5FJ8J 2VLAA 4E7IA 3K4BA 4NC7A 1KB9I 1JTYA 3CC4P 4HB1A 2YU3A 1A6QA 2CUFA 1R23A 1LDDA 1X4PA 4MFDA 1R49A 1Y0UA 1WJEA 3HB9A 5J47A 1H0MA 3BTIA 2JWAA 2VBWA 4IHYA 2A6TA 4PD4H 3CCEP 1MBEA 1QPIA 2IPQX 5A2QZ 4C3JJ 1ZR2A 2H94A 2YXQB 1DH3A 2VBXA 3CXHI 2WITA 4XOTA 3WHCA 1BDCA 1U5TA 1JTHB 3D0SA 4CHUA 2FNPA 3T8TA 2M0MA 4PJLA 2VB6A 1NKNA 5TISC 1SQBJ 5L3FA 1U0JA 1J59A 2K85A 1WT6A 3KEYA 3CC4I 1FOSE 3A01A 4I0AA 1VQ9I 3RJPA 3CC7I 3GLXA 2IA2A 5HNHA 3JR9A 3RGUA 4HF1A 2QQBA 1WJDA 1NO4A 1ZMEC 3QWOC 2IBZD 2WBMA 5K7FA 1RQVA 3L72D 2L3DA 4I01A 2JA7J 1X3UA 5FKNA 4BS9A 1KC8Q 2GA1A 2HZDA 5TJHA 5H2FH 1OYYA 4B3AA 3ZQFA 2VONA 2E74B 2XGXA 2ZJRF 1FYKA 3U1KA 3K70D 4KMUX 1HA8A 2M8GX 2NVXJ 1P84E 2WPRA 3EUAA 3CCQI 1FT9A 2LP0A 2ZT9D 2LDUA 2Y30A 2DA2A 2X9DA 3J80Z 2CSOA 3BP8A 1XG1A 4KJZA 2HLOA 3SSUA 2IFMA 4JQ0D 3HKZA 1WJBA 2JKVA 2JDIH 3CCVP 3MUDC 5FD5A 2BOLA 2DQRA 1WPKA 5DM6F 3S3MA 1FSHA 3MP7B 1OVVA 1E79H 1LE8B 3AEFC 2OU2A 4IOCF 1ZGAA 1W5TA 3MIWA 3H35A 1S3JA 1YTYA 3FGAD 3BQYA 4OIOF 1WWXA 3CDLA 3CTAA 3R60A 1PJRA 5K5GB 3QRFF 2QVOA 3VSKA 4Q4ZF 2D5VA 1URQB 1XSDA 1PP9E 1HSTA 1TWCJ 1F5TA 1SQXK 2HOSA 4IHTA 1SFCC 1XD7A 4LD5A 2WC2A 5KLVJ 1U9OA 1YO5C 3CX5D 1RE3C 1QNTA 3OL3A 4XKWA 3L73D 4JX6A 1G1IA 1TQMA 1OMIA 3C18A 2VBYA 1YITI 4DZOA 2ZSIB 1GL2B 1S6LA 2EZHA 2JT1A 3K69A 1RKTA 2HNHA 2ZJQF 5KJ7A 2HYGD 1KU9A 1XCVA 4BHPA 1J9IA 1FBMA 3C9IA 3DPLC 4IQJA 2M3EA 1H8AA 2R32A 3K4NA 4WWCA 1FOKA 4QMAA 2M87A 2R44A 4CICA 4XSZF 2B7EA 3AG1H 3P8MC 1YX3A 2NOJB 3I71A 3B4SA 1DPRA 1HTLC 1KA8A 2VASA 1JEKA 1S5LC 4U0YA 3ZQ7A 1RY3A 5EEHA 4M74A 1PIXA 2DFHA 3S93A 3VYSB 2MC3A 2P1JA 3RSNA 2LBFB 2Z5HA 2G3AA 2OQGA 4U87A 1FC2C 2EJRA 2E75D 3ZMVA 1QA6A 1KQGB 3RK3B 2QCOA 2AEMA 3NEUA 3AEEC 1Z1DA 2F5EA 5E3LA 2D2CD 2MYSA 4CSWA 3K4KA 2DDBA 1ZKGA 4RMNA 4TLFA 1ZN2A 2DT6A 4A3KJ 5TJJA 3MQ0A 3JRFA 4NC6A 2LY1A 2YR2A 3EUHC 3FBNB 4BY7J 3P7NA 1NH3A 5F64A 2HWVA 2STTA 1QU3A 1NU1G 2M5AB 2EINH 5GTHC 3PHLA 4HAMA 4MO7A 4Q47A 5ERIA 3NRVA 4C3IJ 2I8DA 3E0JB 3HRSA 3LSMA 4GFBA 2P58A 3K2AA 3O8HA 4PJNA 3ZR8X 4EEFG 3LAJA 1SFOJ 3ZN0A 1BCCG 4OIRF 3E7LA 2XGEA 3KYDB 2B63J 2LKPA 1RHZB 2IS4A 5E17F 1GLNA 3GTPJ 1IZNB 1SQQG 3DP7A 1NTZK 5BVZA 2Q2EB 3H1IG 3MN2A 1UHSA 2CQKA 4D9JA 2GAUA 2KIUA 2MA3A 2W85A 3ECHA 1TP4A 4PGGA 1MNDA 3BRVB 2LF8A 1BI0A 1JHHA 1J1EC 2FFDA 2IGOA 3V42A 5C44J 1MUUA 1ZRCA 1UIXA 2HKOA 1S9KD 1R8EA 5CVIA 4PSXA 1VQ4P 4XK4A 2LYCA 2Y9YA 2HPCB 1FZCC 4C30A 2QG4A 2QRXA 2RREA 2OGUA 1SFKA 2DMUA 2BW3A 2PRRA 4DYCA 2FUG2 2GUVA 2OTJP 3KP4A 1K73Q 1X1AA 1JMBA 2VJIA 1IDYA 1HKSA 1N7SC 4BBRJ 3QPTA 3WTUC 3GEZA 3F22A 4ZTFA 2CO5A 3S2DJ 2B87B 1HJBA 4HPQA 2OAZA 1L0NJ 1O7FA 1QHGA 3BOQA 3I3LA 4PJJA 2KIMA 2MSYA 3IH2A 2PLYA 3IP4B 4U3FE 1VQMP 2G9WA 5EZHA 2OZUA 2A06E 2YNYA 5IOZA 5AVQB 1YYVA 3GZ6A 2QVAA 1N2DC 3K4LA 1D1CA 4UVAA 2VIXA 3LFUA 2I1KA 2NS7A 5KLIB 5L3DA 2KJBA 2P4WA 3OIOA 2V1UA 2F5FA 1FZBA 2MH9A 2WAQN 3ABKH 3AFHA 1X8YA 2WV1A 4N78E 5EYRA 3R2PA 2UXNA 3VB2A 2AS5F 2ZB9A 2EZIA 1QL2A 2HQ5A 3BG6A 3F8FA 3H1JE 2FBHA 2W4SA 2YX7A 5CJ9A 1JMMA 1RZ4A 2VKDA 4OOIA 1ZV8A 3B5NB 1KQSO 4R8HA 2Q2EA 1A02F 3I5UA 3HOSA 1M1JB 4WXHA 3CWBE 3L72G 3GCMA 3DV8A 2MD0A 3FM5A 4FASD 2IBZG 1CZQA 3LSIA 5J8CA 2AXTH 3RI4A 4IZZA 3PNYA 1HW1A 4ZDLA 5DUIA 1HW2A 1NVOA 1TWAJ 1MZ9A 2F2EA 3K1NA 5EF6A 4PFPA 1P84D 3VOPA 3FK6A 1GW3A 2E1OA 4XBFA 5AW3B 1T8IA 1DGWY 1N25A 3D6YA 2DYRH 5JHFA 3DXJF 4DOJA 4QTRA 4A3DJ 3MKWB 4C46A 4I6MC 2D45A 1S72P 4HSRA 2E7XA 5C3EJ 1IK9A 5LEKA 3S3NA 4JOMA 4AU7A 3V4QA 4HBLA 2CV2A 1K05A 1X58A 2YIUC 3DBHB 2FBKA 3TBIA 4M72A 2XC7A 1M56D 2A61A 3L73G 4ASWA 4D6TD 2DOFA 2VQGA 1SFXA 3PJRA 1L0NG 3LA2A 4M6YA 1O3QA 1NH4A 2O61A 2DYSH 4BJ6C 2VXZA 1L0NK 2DT5A 4PV1C 1R5HA 2E2JJ 1WHUA 1WQ2A 1A04A 3H1KG 3F5HA 1K8AQ 2OBPA 4RM3A 2P67A 2FMYA 2XPUA 3CZ6A 5E1ZB 5EJCA 3OS2A 3ISPA 4WXDA 3FWEA 3GZNB 1QRYA 4HNVA 4W80A 4NPDA 2X1CA 3SZPA 4ZYAA 2R7QA 1Q90D 2EZLA 2MGQA 4J01A 4G7HF 1ZH5A 2YMKA 1YJWP 1PUEE 2KRHA 2V4HA 2GXBA 4GKGA 3H0GJ 5GAGJ 1JKRC 3WG9A 3MKYB 3MHVA 4XOPA 4LITA 3BCBA 3JCUC 3P9CA 2X1EA 2DMNA 2W24A 2H8RA 2RNJA 2QSGX 2WSFJ 1SLQA 4CZCA 1R4MB 2LK2A 3I4PA 1HJ0A 4DBQA 2DFEA 3ZMTA 3CCLP 2CUEA 1D8KA 2JRMA 3I9V2 5LBQA 2YKPA 3E5XA 1LVAA 4L5IA 3TOBA 1NTMD 2QQ9A 2AEFA 4B86A 1VQ5P 2KYVA 3OMYA 3NAUA 2C6YA 2TCTA 3HOVJ 3KP3A 4ENNA 1KV4A 3MZ8A 3AE7C 1U2WA 3DWLE 3Q1MA 4XONA 4AVZA 2K86A 2NNNA 3CXHH 3FMQA 2XPVA 1AWCA 3S17J 1F43A 1FBSA 3LA7A 1XGOA 2G7UA 1RNLA 4HV5A 1IO2A 4WF2A 2OUMA 4LLLA 1QZEA 1G3YA 1A6IA 2DTZA 5L3BA 4UY8I 1SQPE 1QLED 1FJPA 1JJ6C 2FMLA 4PJMA 1S5LH 3WU1B 2P5KA 1OX3A 2EIMH 4N78D 4DW6A 5LGUA 5J40A 1SQBG 1WI9A 3OYMA 2K5CA 3VYTB 1IFDA 1PVEA 2AXCA 3CCVI 3UKGA 1JUMA 2VPRA 4IEJA 2XV4S 3C2BA 5M5XJ 1ZN5A 2BASA 2E60A 4TV7A 3OWTA 1H88C 1W4MA 4KMFA 4OIQF 2CFXA 2E36A 3GVAA 1D0YA 1XTGB 1Y1VJ 2P7CB 5E8GA 1CI6B 1X1DA 2MD5A 1IJWC 1LJ2A 1BI3A 2Q6QA 1O3SA 2DODA 2ZYDA 1T8ZA 4PFOA 4UVBA 1TL8A 4D5CA 3WGGA 3ZQQA 3CCRP 1NK3P 3D5RC 1Q1VA 1YJ9P 2K9MA 1ZYRF 3GFLA 3CESA 3GWZA 3SEZA 2K9JA 3CCJP 1ZARA 4UXNA 2YKOA 3J7ZI 2DPDA 4KYWA 1OPCA 4IL6E 1YS7A 3L70D 4WY4A 3F21A 3S1QJ 5IYDJ 5CKTA 4U3FJ 1XGSA 4N4NB 5KNLA 1VQ6I 1KILC 1FLIA 3EETA 3FZVA 2OYHC 5TRDA 3UR3C 1NGMB 3L74J 2P8TA 4DQ2A 1B9NA 2ZC2A 3CX5I 1STZA 5L3GA 5AW0B 1FJLA 3QP6A 2KRCA 5DDGA 3HGGA 1VQ4I 1S4XA 3ULQB 3CJQB 1P92A 4E70A 3V2PA 3HRUA 4YFXF 3C7JA 4KT5C 1HUCA 1B6AA 1SQQK 1P4XA 3DCFA 3OIPA 4OGQC 3GFMA 1W2BO 4G8XA 3K0LA 2ZFCA 1LT1A 4Y13A 1ETQA 1GL2C 1X1PA 1XN7A 2V7FA 3HOWJ 1KFNA 3AEAC 1SQVD 3V2NA 4UB8H 4XLNF 2PMZA 3DTIA 4O9BA 2HFED 1ACIA 3GMAA 3QP5A 1EC5A 4EYYQ 2ZKZA 2ISYA 1BA5A 2GOXB 2KLUA 2ZT9B 5CYVA 3R0AA 1SQQD 3ML6A 3AL0C 1MNMC 1SQPJ 3CX5H 2KL4A 1NU1K 4UNOA 3M06A 2KKOA 2Z1DA 5FD6A 1T39A 5HVQC 4ZDOA 5BS6A 1OR7A 5APSA 1GHCA 1KONA 1W36D 2FYZA 4GT1A 4AYCA 1SQVG 1JGSA 2N1TB 4EGYA 1VQ6P 5E8IA 1TNTA 3V5BA 3CWBD 1JY2N 3U1CA 4EM1A 4BE0A 1PL5A 1VPCA 1HBXG 5KKZB 1SVLA 5HDKA 4D5FA 1HDDC 5FRNA 3E6MA 5F1RA 5E3NA 1N7SA 4BXUA 1LJ9A 2DOAA 4XICA 1OYIA 1PV3A 5F0CA 1YBKA 2OYIC 3FXOA 2ZXXA 2Z16A 1VF9A 2UZKA 3QOPA 5L3CA 5APXA 1SANA 1ZLLA 1FDMA 2PX9A 4BEHB 2LSOA 5GPCA 4UB8E 4I0BA 1LQ1A 3AE3C 1MMAA 2OCCH 5LGTA 3OOPA 1XTCC 3MZWB 1TNSA 3HRNA 2XV5A 1LTGC 4B44A 3W2VA 3OV8A 5FRMA 3P32A 5FKMA 2HQRA 1ZRTD 4ENJA 4LC1A 4UB6E 1QVFO 2ESHA 3RKYA 2ID6A 4FETA 4FHTA 4U88A 2OF7A 1LTIC 1Z6TA 1OW8A 1SD6A 3KQGA 3MD2A 4XLHA 5CHXA 2W8ZA 3WU0A 3S1KA 4XN3A 4YELA 2IGMA 2JPBA 3LOCA 1K83J 4BUPA 4A3FJ 1FNNA 3CCUP 3F89A 3E6BA 4A6DA 5J3LA 2RKLA 2ZAEB 1B1BA 3H1KD 2K9YA 2CW7A 3I54A 4F7ZA 2CPBA 2MJZA 1GK4A 4LB6B 1NTKD 5CCHA 4L9TA 2ELJA 4XM3A 2ZJPF 5KKZC 5LHIA 4IO9F 1GK6A 1BBYA 1CW5A 2CW8A 2RVCA 3CLOA 2NVTJ 2BCCG 3EUHA 3DPTA 1V5FA 2ME0A 3O3KA 1VF5D 2KOGA 2D1HA 3DLAA 2KI7B 3AE4C 2KLOA 3F9KA 3K7AJ 2M30A 1KZUB 3MGNA 1UMQA 1GDTA 4HKZH 1PP7U 3V4GA 3L1PA 2BEZF 1VQPP 3P9IA 2A68F 1BN5A 1K78B 4YEJA 2XKPA 1FAVA 2XHKA 4L5JA 3H3VK 1LTTC 1P84I 3AE9C 3G3ZA 5E18F 1FZGA 1HDPA 2HG5D 2WPSA 4L76A 4BDYA 2Y0MA 4I7HA 3PUFA 4H44B 2KHMA 1N73C 3RPQA 3FHZA 4MLOA 1V54H 3CMAI 2GOMA 1SQQJ 2Y0EA 5APWA 1PGPA 2DW4A 1IUFA 3BTJA 3O8ZA 5GTIE 2VBZA 3Q5PA 2K40A 4IHWA 3TSIA 1O7LA 1B72B 3SFIA 1FX7A 3CWBJ 3BWGA 4J19A 4JPZB 4E4HA 1NTZG 2HQNA 4LG0A 3DU5A 2M0BA 3IV5A 2E7WA 2CGPA 1MD0A 3GLMA 3OS0A 1MSEC 3J81Z 2L02A 1SQPD 3GLLA 2M5WA 1MJ9A 2CU7A 4M3DA 2GWRA 2HDWA 1ZAOA 1L3LA 5KJ7C 3EYYA 3MEXA 2VJ4A 3OYAA 3F23A 4BJ5C 3WGHA
chains in the Genus database with same CATH topology
1KILB 1IO4A 5DV5A 1GW4A 1J1EB 4AVPA 3KLNA 5AW9B 1SQPK 3GX4X 4ESJA 3KPEA 2ZNYA 3FMRA 2XVCA 3EQLF 3MFKA 1SP4A 2EFNA 4EIJA 2H7HA 3CO6C 4N0BA 1F4KA 1TQIA 5CCGA 3ABTA 4HX8A 3GXOA 1FBUA 2K4BA 2LKMA 3M91A 4ZH4F 4QLCU 1X79B 3DKWA 3MUDA 1YTZI 1BJAA 2Z9OA 2N1TD 2MLGA 2WTYA 5KLVK 2PJPA 3U9GA 3RK3C 2BBYA 2ZXEB 1YLFA 1QBJA 1O3TA 3U59A 3V4WA 1KFMA 3RL0B 1EH7A 2L54A 4Y99C 1LWUC 2O1JA 2OYHB 1H9TA 1U5TC 5CVRA 3T0YA 1FZEA 3LAPA 3K2ZA 2ZNZA 3JSPA 1SD4A 3KEQA 4PZJA 3SQNA 3V7RA 3HHHA 2X0LA 2YX4A 2N9BA 1REPC 1HXDA 1JY3P 1JNMA 3KP2A 3CLQA 1RIOH 1Z9CA 3RYRA 1CF7A 3I5CA 4K2EA 4I02A 1SVFA 2W6BA 4LFUA 1MDMA 4IPAA 4UVCA 2XNXA 3PP5A 5APYA 1CI6A 4HX4A 1ZG1A 3I0TA 3IKVA 2DLLA 3FXUA 1FP2A 1HGVA 3J7AO 2JPCA 1QGPA 3BPXA 2O01H 1RE4A 5CCGD 3NQOA 2PG4A 4G7OF 2XAJA 2EFQA 1DP7P 3VMZA 2DFIA 1IXCA 3I59A 3N4XA 4M3LA 4OH8B 4HA8A 3BATA 2RDPA 1E5WA 2W27A 5LLQA 5AW6B 4EJVA 1LT9C 3GHGC 2Q0OA 2COMA 3B5NC 2J5PA 3I58A 4M6XA 1BIAA 2HYFA 3H6PA 2P6TA 5FB2A 4G94A 5K1YA 4MTEA 2R3CA 1MZBA 3GZ5A 1T2KC 3R61A 3KE2A 4EMSA 2FRHA 5DYMA 1C0WA 1KQ0A 2EFPA 3K1MA 1N7SB 4M9XA 5HS9A 4LGDE 4OMYA 1U8RA 4WY4C 1R00A 2DQLA 3TK1A 1FZAA 2V6CA 1FJKA 4LLHA 3MAJA 4YIIA 1LB2A 2HGCA 5H20A 4AIHA 4CYDA 4IFFA 1GZLA 1DUXC 1X9VA 3HTUA 3Q5FA 1IXRC 1D8JA 5ICCA 2K4JA 5KJ7D 1H88A 2RV8A 2ZO4A 1BI1A 5CLSA 2XKOA 2QM8A 1FZPB 4MEYF 1RE4C 3WTZA 4G6QA 5ICGA 2HYNA 5IT9Z 4B09A 4ZYGA 4AUWA 1W7PB 1VTNC 2E42A 4WXCA 2IRFG 2Z33A 1CF7B 3HUGA 4LMYA 4RB1A 3HD7D 5LEJA 3TOAA 1A02J 4S05A 5ICFA 2Q7CA 3REOA 3JAMZ 1G3SA 3VYIA 2BEOA 1MDMB 3AAFA 2PAJA 4I2LC 1S29A 3A5TA 4PDKA 1TLHB 4MHGA 4B8XA 5KVRA 3CUQC 2FKWB 2A5YB 3GO5A 1JY2P 3LFKA 1V3FA 5D5UB 2K7LA 3DF8A 2Z4EA 6PAXA 5FLXK 1H89A 1YTZT 1I27A 1E17A 4N9HA 4KN7X 1LTJB 1N86A 1MJBA 2XRNA 5APUA 3V2QA 2WT7B 3JSOA 2BV6A 4G9YA 1IFMA 4UHTA 2HFHA 2IW5A 5D8LB 3JW4A 4EOTA 3KZYA 4R1HA 1YS6A 1JXSA 1USTA 3J81K 4N6JA 1G3TA 2H09A 1L0LK 1SMTA 5FFXA 1QZZA 4EM0B 5CCGC 1J75A 2NRAC 1R1VA 4EQQA 4ENMA 1GD2E 1I6XA 1W2EA 2XROA 4YFKF 3ZMSA 4WY4B 2R3SA 1XCBA 4P9UA 1Z56A 3BJ6A 2CPSA 1ZLKA 3CO7C 2P7JA 4HH2A 2QBYA 4BNCA 1BM9A 3KP5A 2HDCA 2WSEH 2CW0F 1N7LA 3OJAB 2EK5A 2EA2A 1LTBC 2KIFA 4M71A 4ENKA 2FNAA 1N73A 1SFCB 4C7NA 1GTWA 4LB5A 2QENA 4IXAA 2YKQA 1FZCA 3C3WA 1W7PA 4BYYA 2VE8A 5CVJA 3GHGB 3ROUA 1NTMK 4ZYEA 1KYWA 4IRIA 4BH9A 3NXSA 2EFOA 1S8NA 4UV9A 1JOCA 3BJAA 1J2XA 1OKRA 2DPUA 2QLZA 3RPUA 3TGNA 2VT3A 3CUQA 2V1XA 4HDVA 2Z5IA 1G1JA 4HF2A 2FBIA 4BAYA 2XIGA 2UWMA 2Q8KA 4HQMA 3U1DA 5HDNA 5AVRB 3U2RA 1FYLA 4BHCA 3WTXC 1F1ZA 3GF2A 5D5XB 1DDNA 2QQAA 5APTA 4IFDK 3GFJA 1Z7UA 2RC4A 1PDNC 5HOOA 4HOBA 2A6EF 2IVMA 2FFDB 3VFZA 4EJOA 3HSEA 3R4KA 3MZHA 2PBIA 2DK5A 4UV8A 4IFMA 3S2WA 2N1TA 3E6DA 2HEOA 2CYYA 4L9NA 2OYIA 1DX7A 2PMUA 5J6XA 5JVTA 3WTTC 5BU5A 1BIBA 3A3YB 4LK1F 1L4AB 3BROA 1GXPA 2Y75A 2QM7A 3WGIA 1HWTC 2DAOA 1RE3A 5KTBA 2JJLA 2BGCA 4KDPA 2MH2A 2DBBA 5LRSA 3RK2B 1G2CB 5DD4A 5AVTB 2AXLA 1Z91A 2O8XA 4RB3C 1J1DB 3QU3A 3TYYA 4BQAA 3VODA 1ZRFA 3JTHA 2VODA 2PN6A 4IJAA 4AD9A 2I1JA 1NHLA 3F3XA 2PEXA 1P4WA 5HLIA 4LJZF 2ISZA 1P4AA 1SD5A 3B8EB 1BOAA 3ELKA 1I1GA 1KILA 3K1PA 5JHUA 3GYHX 3B5ND 3HTKA 2VRSA 3N4MA 4UUVA 1RUNA 5APQA 1XMKA 3FMSA 3EQ2A 3M1EA 2GM4A 3NMDA 5CVUA 4KNYA 1IAWA 2WPQA 4LG0B 4KIFA 4RB0A 2WSFH 3E1IA 2O0YA 3TO9A 1Z05A 5HDGA 4HW0A 1XDSA 4KIGA 1OYWA 5IT9K 4MEXF 2NS0A 2P2UA 1KQLA 4O3MA 2RQPA 5AIQA 5D5WB 2ACJA 2FYUK 4GGGA 3M7GA 2IT0A 2WV0A 4ZYDA 4L0YB 2JZYA 1LTAC 2HODB 2D2WA 2A45H 1FSEA 2NPSA 1YW9A 1CGPA 5E1XA 1JHFA 3HSFA 4P9FA 2G7HA 5EEGA 1N73B 2OZ6A 1B4AA 3ZMDA 5DD8A 2M45A 2EV5A 3SFZA 1UHMA 1NTKK 2IPPA 4EJWA 2FEZA 1BI2A 2IP2A 2L01A 1EH8A 2ZCWA 4A12A 3R0JA 1MJAA 1TW3A 2HOEA 3H3UA 3N7NA 3O6BB 1IRFA 1SFUA 3C1DA 3EFGA 4GIFA 2WWYA 3HUSA 3F8MA 1J7KA 1LGHB 5JI6A 1J0RA 3RK3D 1HH0A