3G3ZA

The structure of nmb1585, a marr family regulator from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
MNQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title The structure of NMB1585, a MarR-family regulator from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g3zA02
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3g3zA01
5DCFA 1Z9CA 2RVCA 1H0MA 1F5TA 1OMIA 4GGGA 3W6KB 2OU2A 5LHGA 4GXOA 1KA8A 3T0YA 1KYWA 4WXCA 3WGGA 4LB5A 5DDGA 1YS6A 2ZBKA 4ENNA 2A07F 1UFMA 2R3SA 3ERED 5AIQA 1T0FA 4AIJA 1TQPA 4ESJA 3I0TA 1I1GA 2NRAC 2Z9OA 5FGMA 3QAHA 3LFKA 5FO5A 2QWWA 4P9UA 2GQQA 3KP7A 1T6SA 3HTSB 1D3YA 2FMLA 1SFEA 1Z1DA 1K6OA 1XMKA 1ZRDA 1Z7UA 1ZGAA 3JTHA 2C6YA 3M8EA 1O3TA 1SAXA 1O57A 3R61A 4ENKA 4HF2A 2E1NA 3PQKA 1IN8A 1YYVA 2X4HA 4KIBA 3I54A 3F6OA 5HDGA 2COMA 3G73A 2FE3A 2EFPA 4RGRA 1U78A 1GHCA 5LRSA 1G3WA 4ENJA 3BJ6A 3HYIA 4UNOA 5L3CA 3WODF 1RUOA 1E17A 3GF2A 2WSCH 5JR3A 4A5MA 2ISYA 4KFCA 4D0PA 2KIFA 2V6CA 3BPVA 1NHAA 1SFXA 5K5QA 4OIQF 4HLYA 2FMYA 3U2RA 4GYGA 1NU1K 3HRMA 3PQJA 2IA2A 3JW4A 2YX4A 1MDMA 4U0VA 1U5TB 4EJVA 4S05A 1YTYA 4EJOA 1FYMA 1QBJA 5LHHA 4CXFA 3FMQA 3TQNA 1MD0A 4L5IA 1IZ1A 4LD5A 5LGTA 1NTKK 4EM0B 3HIFA 3EQLF 5HS8A 1W7PD 2Q2EA 3RKWA 1G4DA 5DCMB 3KP3A 5F1RA 1HW5A 4P5OA 4S04A 4OIRF 2HKOA 2IW5A 2KIMA 3F8FA 4PCQA 2NS0A 3FMRA 1FX7A 1D5VA 3V7SA 5TJJA 2M8EA 1P6RA 2M30A 4FHTA 2HKXA 1WKMA 3RJPA 1XSDA 3VFZA 5CLSA 4I7HA 2FYUK 1FY7A 1B6AA 1HSTA 1HW1A 1HKQA 2LF8A 1USSA 2L4MA 1UHWA 4U0YA 3DF8A 4CO8A 2QBYB 5E17F 4IF4A 4PZJA 1XGOA 5A2QZ 4U0WA 1FWZA 3M7GA 1XGMA 1PDNC 2WWYA 3C1DA 2E7WA 1TNTA 1HSJA 1QZYA 2GXBA 1YFHA 1KU9A 1XN7A 3RPUA 2QZ8A 4I09A 3TGNA 3M1EA 2PI0A 1YLFA 1BI2A 2LDUA 3TOBA 1BI1A 2OQGA 5D6FA 2QYOA 1ZRFA 3WE3A 2Q8KA 2PBIA 5H6QA 5IT9Z 2EFQA 1TQMA 3HRUA 1MKMA 3RKYA 5DYMA 1QNTA 2OZUA 2ZCWA 2XASA 5CVVA 3F72A 5JFRA 4UHTA 3L00A 2A6HF 4L9NA 4RB2C 3SZTA 5AONA 4EM2A 3EDPA 2MBFA 4KNYA 2P4WA 3GVAA 3M8FA 2CFXA 1O3SA 3I71A 2V1XA 4BAYA 3E5QA 3HSFA 2FOKA 3B73A 4GYIA 4M73A 3QRFF 2EB7A 2F5CA 1J2XA 5FFXA 2P6SA 2W85A 4YIFA 1FBUA 3ZMSA 1U6GA 3CTAA 1ZYRF 2QVOA 2STTA 5LEJA 3WGIA 3T1BA 5CYVA 1B1BA 2GA1A 1G3TA 1R7JA 3P9KA 4M71A 4ZZDA 2EK5A 3LW5H 4UUVA 3HUGA 2W84A 3FMSA 4U88A 5FLXZ 2STWA 2JPBA 3GFJA 3SXYA 2HZTA 4YG2F 4G7OF 2KJCA 1OYYA 5AIPA 1BI3A 2IRFG 4HF0A 1MGTA 1REPC 3DPTA 3FXRA 3LSTA 4Q5SF 1LDDA 2J59M 2CG4A 4IHSA 1GVJA 1LEBA 2R7DA 2DQLA 2GIVA 2E7XA 1ON2A 2NNNA 3Q9VA 3BJOA 4RAZA 4XRFA 4A6EA 1R1UA 1EH6A 5HLHA 4HF1A 4EQQA 5L3EA 4O5VA 1EV7A 5HDKA 2NNYA 2H6CA 4BHBA 2ADUA 5ICCA 1FNNA 2GWRA 4AWXB 1T39A 3IHUA 1FZPB 4HAMA 4HW0A 3MWMA 3KEOA 3TO7A 3GUDA 1YG2A 2VXZA 3O6BB 1QZZA 2MA3A 2YSRA 3E6MA 4BQAA 4WK8F 3V7RA 3MZYA 5ED4A 2K86A 5IT9K 2B0LA 1H9GA 3REOA 1SMTA 4L18B 3F8CA 1CGPA 3CUQC 1RI7A 1T98A 4ZYHA 3FM3A 2VT3A 1LDKB 3ZPLA 4DQ2A 2EV5A 1S3JA 2QLZA 4XLNF 1BI0A 1IF1A 3DQVC 4Y13A 3KLNA 1LVAA 4JBAA 2LKPA 3KCCA 3WTUC 1BJAA 5ILUA 3ZN0A 1LJ9A 2D45A 2J5PA 1Y0UA 2EFWA 2A61A 3BY6A 3GZ6A 1OYIA 1HKTA 4WXHA 4NB5A 1DP7P 3T5XA 2P5LC 2VE8A 1BIAA 3KP6A 1FYLA 1S29A 5FLXK 3OOPA 1MDMB 1WSUA 4CGZA 3T8TA 3K1PA 1BOAA 2A68F 4YFXF 2HQNA 2WTEA 4MTEA 5E1ZB 1QO0D 4EJWA 3C7JA 2P5KA 2NAZA 2L4AA 3WTTC 1R5GA 3HHGA 1ON1A 2FA5A 2ZXJA 3ULQB 2EA2A 4A12A 1IRGA 4IRHA 4LMYA 2V79A 5ERIA 5EEHA 4HX8A 4PGHA 1ZHFA 2FF4A 1R1VA 2W24A 3WTVC 2KJBA 3BP8A 3L2CA 1BN5A 2KKOA 2FU4A 1KQ9A 2DW4A 3BDDA 1KYZA 1J7KA 3K9TA 3M9AA 3ZQ7A 2EWNA 4HV5A 4G9YA 2HOEA 2VT2A 3QOPA 1IW7F 2RKHA 1J75A 5JI6A 4MNUA 4UVAA 2JRTA 3WG9A 5BPIA 1FYKA 4AIHA 1BC8C 4IJAA 3BJAA 5K5RA 4A0XA 2Z99A 2RQPA 2EFNA 1K7AA 4NQWA 1T2KA 1J0RA 1UB9A 3P7NA 1YO5C 5HLGA 1NTMK 3KZYA 4G6DA 1ZREA 2MLKA 1KU3A 1ODDA 4IFDK 1QGPA 4TV7A 3WGHA 3WU0A 4M9ZA 2RDPA 1XGSA 1IAWA 2XHKA 3QU6A 2HYGD 1A04A 3O2PE 1MZBA 2HQRA 1TW3A 2CO5A 3KP2A 5DD8A 4FX4A 4BNCA 2H09A 2DI3A 3KFWX 3VEPA 5LEKA 4WWCA 2W25A 2EJRA 3ABTA 2P7CB 4LLGF 4E70A 1K78B 1D8KA 3C18A 3CJNA 4MEYF 1HBXG 4MTDA 3HRTA 4G94A 1WQ2A 2HFHA 1EH7A 1U5TC 4FX0A 5BS6A 4L5JA 2JT1A 3S2WA 4LB6B 1IN4A 4G6QA 1R00A 1ZLJA 4Q48A 1KGSA 2BV6A 1B9MA 3U9GA 3D0SA 1USTA 5D4SA 4CZZA 1F4KA 4R79A 3H92A 2XKPA 2XGXA 3BWGA 3P9IA 3R0AA 2J5OA 4UXNA 3V7CA 3QP6A 1LNWA 2CW0F 3ECOA 4WF2A 1PP8F 3GFMA 1E2XA 2A69F 2FSWA 2HYFA 5HVQC 4RAYA 3I59A 2DQRA 2LNBA 3DKWA 2ZNYA 4GCVA 1XSVA 1IXCA 3MCZA 3JAMZ 2ETHA 2UXNA 3Q9SA 1P4WA 1LB2A 4LK1F 5EEGA 3KP5A 2VC0A 4EGYA 2HEOA 3ZP5A 2VE9A 2BBYA 4OIOF 1XDUA 2O61A 5ICEA 3L9FA 4MHGA 1R36A 1DUXC 2XAHA 1UCRA 2R7FA 3I64A 1OR7A 1FBSA 3E5UA 4JK1X 1R1TA 2RN7A 2P7VB 1FT9A 3LWFA 4A6DA 2X0LA 3K0LA 3LA7A 1R5HA 3BZ6A 3JSOA 3FHZA 4AVPA 5BMZA 1OYWA 1S6LA 2XAFA 1MJAA 2IP2A 5F64A 4ZH4F 3RYPA 3MAJA 4U7BA 4A5NA 1D8JA 1FOKA 3CLQA 4XSZF 1FP1D 4ON0A 3HOTA 3EUHA 2H6BA 4YIIA 2GZWA 5DD4A 3GWZA 1Q1HA 2WV0A 4LK0F 1FSHA 2K4JA 3IRRA 5HS7A 4R1HA 1FP2A 3KETA 2JZYA 3MZHA 2PJPA 1F1ZA 2OARA 4HDVA 4HX7A 3TO6A 5LHIA 2FNPA 2ZKZA 2QUFA 3DXJF 1J59A 1KU7A 5ICGA 1XSXA 1F9NA 1IXSB 5L3FA 1RUNA 3GLXA 4ZYEA 1AOYA 3W6JB 1W7PA 1ZG1A 1R23A 2FBKA 3LA2A 2VBZA 2Z3YA 4F7ZA 3E6DA 2FBIA 5HS9A 2XUBA 4ASNA 3LA3A 4XSXF 3TDUC 4KIGA 1U8RA 1SFUA 4CHUA 2XAQA 5TRDA 3TKYA 2ZFWA 4EM1A 2TDXA 3KE2A 4KN7X 4EMSA 1R22A 2QQAA 3TDZC 1BC7C 4QLCU 4IVNA 3RI4A 2LF7A 3ML6A 5H6RA 1YQAA 3JAMK 3IKTA 1DDNA 4I2OA 1CF7A 1T38A 5K5OA 2YPRA 4WCGA 2L02A 4G8XA 4KN4X 4HYEA 3V8KA 2MH9A 2EA4A 1U5TA 4I0BA 3BOQA 1JHHA 1XDSA 1IN6A 1QPMA 1X3UA 4YFKF 2RNJA 5BPDA 2V1DA 2ZMEA 4ESBA 4ETSA 5KK1A 1SD6A 3I53A 1C0WA 2QQ9A 4A0ZA 5KLVK 4U7DA 3Q5FA 2HTSA 5A2QK 5BOXA 1ZGJA 2CQKA 5DUIA 3WTXC 4EV0A 4Q47A 1KQ0A 4I98B 1HKSA 1W4MA 5CJ9A 2F2EA 1L0NK 4P9FA 1IUYA 1LDJA 1JXSA 2XV4S 2BE5F 4CICA 3I4PA 1DPUA 4EJTA 1HW2A 1UHMA 2DTRA 1SD5A 2MC3A 1KQ8A 4MEXF 1BM9A 1MJ9A 3RPQA 1SD4A 2JSCA 5E18F 1U2WA 4M6XA 4PDKA 1ZARA 3IC7A 2WSFH 3E5XA 4OU0A 1Z6RA 4I0AA 3WU1B 1I1SA 4RB1A 4HQMA 3CDHA 4OMZA 1EH8A 4EVIA 3R6SA 5HDNA 1SQXK 3ZMVA 5E8GA 1O7LA 4LFUA 3HHHA 5FD6A 3K1MA 5J8FA 2P5VA 3SFZA 1HQCA 2H27A 2XAJA 2HGCA 1IN5A 1B9NA 2F5FA 5CVIA 3N97A 4RGUA 2OD5A 4Z2YA 3WE2A 5FD5A 4LLNA 2O01H 3DFGA 5CVUA 4UV9A 2ELHA 1STZA 1FPQA 4N9HA 4LG0A 3I59B 1SQPK 3D5LA 3ROUA 2PN6A 3GX4X 1I27A 3HSRA 3I5UA 1H9TA 2F5EA 4O6JA 3QU3A 2BYVE 1ULYA 5JVTA 5LGNA 2DK8A 5J8CA 2A3SA 1L3LA 2G7UA 4ZYDA 3J81Z 2Q0OA 2K02A 3E3VA 2IA0A 3ECHA 2KRFA 2BEOA 3F8NA 5F6FA 4IHTA 4BHPA 3QPHA 4G7HF 3VODA 3FXUA 4IXAA 1BIBA 4JQFA 1O3QA 3R4KA 3WTYC 2L01A 3GFLA 1YW8A 1IXRC 3IWZA 1LEAA 3H3UA 4HX4A 3GXOA 5D5WB 3RIRA 2K27A 3NEUA 1GXPA 3HSEA 2DLLA 1B59A 3EETA 4RGSA 5CVRA 2AXLA 3ZMTA 4XBFA 2FNAA 3J7AO 4FT8A 2VN2A 3LQQA 2O3FA 2OQRA 2IT0A 3WTWC 4BH9A 3P9CA 2XAGA 5D5UB 3F8MA 4OINF 1JE8A 4XLPF 3RKXA 2OBPA 4P96A 1YW9A 2DO7A 2ESNA 1Z05A 3SZPA 1W5SA 1RZ4A 2IJLA 3NQOA 4LLLA 4B09A 1Z6TA 5HLIA 1I5ZA 3JTGA 1W7PB 2D2WA 3ZN1A 2GAUA 5E1WA 1SQQK 1J9IA 2V9VA 3FF5A 3PFIA 3ZMUA 4Y17A 1OKRA 3DPLC 4P55A 4DNCA 1YS7A 2A5YB 1YIOA 5LGUA 2M1BA 3CUQA 4M9SA 2K7LA 1TW2A 2IPQX 5E8IA 1J5YA 1L0OC 1NTZK 5ILVA 3WTZA 1S7AA 2LSOA 1P2FA 2KIUA 2VODA 3F6VA 1K79A 4BXUA 3TOAA 1ZLKA 1CF7B 2DT5A 4O3MA 2M45A 2QENA 4QWQA 2Z33A 3GEZA 5FB2A 3G3ZA 3J81K 1XMAA 2FEZA 4CYDA 2A6EF 2OA4A 3IL2A 1G6NA 2ZMEB 3EYYA 5J6XA 2P6TA 3OV8A 1P4XA 3M9QA 2HS5A 4H0EA 1BBYA 2O8XA 2M5WA 1SMYF 4OOIA 4AIKA 3F21A 4I01A 1MJBA 2WC2A 2Y48A 5LRRA 3V4GA 5HOOA 4OIPF 2PFBA 2DPUA 3RTRA 3HRSA 2O6GE 4L0ZB 3AAFA 4EJUA 3DEUA 4L9JA 3NRVA 5DEQA 1SQVK 5E20A 2VBXA 3IRQA 2EV0A 3CLOA 2YX7A 2FRHA 4Y15A 2PEXA 2HDCA 2YU3A 4B8XA 2Y0MA 5KVRA 5CVJA 3ZMDA 4RB0A 2MD5A 3QPTA 2Y75A 1B4AA 2FQ3A 4L9TA 1TBXA 2HWVA 4HA8A 1ZAOA 4HBLA 3F22A 2XIGA 1XGNA 3KP4A 1R58A 3FZVA 3B02A 3MEXA 3T8RA 4K2EA 2DFIA 2V1UA 2VOOA 5JHUA 1WWXA 2O0YA 1ZG3A 1YW7A 2DAOA 4ZYGA 4HOBA 2DU9A 3J80Z 4KYWA 4UV8A 3EYIA 3KEQA 2OZ6A 2UXXA 3ABUA 4IPAA 5L3DA 4KIFA 2E1CA 2UZKA 2VBYA 5ICFA 2YR2A 3GZ5A 1G3YA 2FBHA 1O3RA 5H20A 2IVMA 3N4MA 4LG0B 1FC3A 2CGPA 3K1NA 3KZZA 5K1YA 2QM3A 1I6XA 1K78A 2ZNZA 4G7ZF 1TNSA 5D8KB 3L09A 4M9XA 2XVCA 5D4RA 3U1DA 2L3DA 2HTJA 3E6CC 2DPDA 1TLHB 1SD7A 3KLOA 2VONA 5IT3A 4L0YB 1V4RA 1ONVA 2CSOA 3SQNA 2XROA 3JSPA 4RGXA 1ZH5A 2K4BA 1XD7A 2O03A 2RV8A 3F23A 4Q4ZF 3MFKA 3C3WA 4UVBA 2DBBA 1P92A 2ZJ2A 3DV8A 2UWMA 3O3KA 2EFOA 3F8BA 3R60A 2G9WA 2G7HA 4HZFA 4ZZLA 6PAXA 5BQTA 5DV5A 3K69A 5L3BA 4N0BA 4KDPA 3SHFA 2ZO4A 5DCMA 3FX3A 4HQEA 4BYYA 4A0YA 2MLGA 1WI9A 3GO5A 2LKMA 2HR3A 3ELKA 5ILSA 4RB3C 3V8LA 2D1HA 4KA4A 1ZG5A 1ZN2A 2BGCA 2XRNA 2PQ8A 2CYYA 2F5DA 3L7WA 4OMYA 1QQIA 1FSEA 5E1XA 3E6BA 2PLYA 2WSEH 2M87A 4MQVA 4PGGA 4KMUX 5LBQA 4HV6A 4KICA 2GA2A 3QP5A 3R0JA 2QBYA 2W57A 1TQIA 5FFZA 1FLIA 1W5TA 3H3ZA 2ACJA 3VOEA 1RIOH 1S7OA 3BPXA 4ESFA 2RGVA 4LGWA 3RDIA 2XKOA 2NYXA 2VC1A 1VTNC 4YFNF 2CWEA 4I02A 5D5VB 3LAJA 4KMFA 3J80K 2VBWA 4WX9A 4AD9A 3VB2A 1WRJA 4ENMA 4M72A 1DPRA 1V3FA 1RNLA 5L3GA 4KT5C 3V8JA 2QQBA 3FXQA 1HXDA 2PMHA 3WTSC 3CO6C 1LQ1A 3CUQB 2D1VA 4HDUA 4BHCA 2FXAA 2OAZA 1S8NA 2EV6A 3CUOA 1OPCA 2JPCA 3GYHX 2PG4A 4RS8A 4HLXA 3RYRA 4NHJA 3F3XA 3COAC 1P4AA 1Z91A 2ESHA 1XCBA 1GXQA 2AS5F 3FM5A 4MGRA 2VOPA 3IWFA 1ZRCA 3FWEA 3I58A 2H94A 3MQ0A 2RC4A 1U3EM 3IKVA 2P8TA 3GW2A 2ISZA 5D6EA 4GO1A 3HOSA 5D8LB 1JHFA 1G3SA 3E97A 4MQ9F 1KU2A 4A2UA 3ZMZA 2PMUA 1TTYA 1IRFA 1XB4A 1O7FA 4KUMA 4IRIA 4L9VA 1JGSA 2IA1A 5LLQA 3GFIA 3HTUA 3ISPA 4N9IA 1FBQA 1IN7A 4IRGA 4UVCA 4WXDA 4M6YA 4EGZA 1L0LK 2DK5A 3LAPA 2JTVA 3DP7A 4M74A 4CDGA 2MH2A 3BROA 3K2ZA 1SQBK 3TO9A 4R8HA 2GXGA 5D5XB 1AWCA 1PP7U 1XCVA 5DUKA 4LJZF 2L54A 2Z5UA 3LQRA 1PUEE 3CO7C
chains in the Genus database with same CATH superfamily
5DCFA 5CKTA 1Z9CA 2EH3A 2ME0A 2RVCA 2VXDA 3EUHC 1H0MA 3W2AA 2W48A 3TMOA 1F5TA 1SQXD 4TLFA 1OMIA 1XTCC 1EF4A 1SVMA 1IV8A 2CUZA 3PUBA 2O1JA 1PPJG 1K8AQ 4GGGA 4IHWA 3CX5H 3W6KB 4H0LB 2OU2A 3TNUA 1YHQP 4C9YA 2ZJRF 3MP7B 2V26A 5LHGA 2E34A 1NTKJ 1LFPA 3G9RA 4GXOA 1KA8A 3D71A 3FDYA 4YIRX 1V55H 3T0YA 3HOWJ 2N1TA 1D1AA 1KYWA 5B66C 4WXCA 1WZ2A 3I4NJ 3WGGA 4LB5A 5DDGA 2JUCA 2IYPA 1YS6A 2ZBKA 3RL0B 1VQOI 5C39A 3PRJA 4ENNA 2A07F 2LP0A 3D5SC 1UFMA 2Z16A 1B72A 2R3SA 1S4XA 3A0HE 3ERED 5EG0A 2W1OA 5AIQA 1T0FA 1CZQA 3TSIA 4AIJA 1RF1A 1TQPA 2JA7J 1RHZB 1D5YA 1R8EA 3OYAA 1Q7YQ 1KZUB 3S1QJ 4AYBA 2RKLA 1FDOA 4ESJA 2FYUG 1RKTA 2E42A 3PFYA 2VUMJ 1EDJA 5GAEJ 3I0TA 4CZCA 2R7SA 1I1GA 2JSPA 2NRAC 1NU1E 2WA0A 2Z9OA 2JN6A 3PUFA 3I5CA 5FGMA 3OMYA 3QAHA 2ID3A 3LFKA 1VQ6P 5FO5A 4E6KG 2QWWA 4I2LC 4P9UA 4J19A 4M3LA 4M6VA 3SEZA 3BR2A 2FYUJ 2GQQA 3ZQFA 1Z21A 1T6SA 3KP7A 2D2CD 4GIFA 3HTSB 3GHGA 3HC7A 1D3YA 2FMLA 1SFEA 1SQPD 1Z1DA 1K6OA 1XMKA 3AE6C 4WWIA 1ZRDA 2VJIA 1CSBA 3H1IG 1JY3N 3M9HA 1Z7UA 1ZGAA 3BR3A 3JTHA 2C6YA 4JYCA 3RK2B 3M8EA 1O3TA 1U9OA 1SAXA 1O57A 3I3LA 2NVXJ 3R61A 4BS9A 1EA3A 4ENKA 4HF2A 1Q86Q 1DIPA 2E1NA 3PQKA 1QU3A 1D0YA 3ZCOA 1IN8A 1YYVA 2X4HA 2WT7B 4KIBA 3I54A 4IO9F 2HPCB 3CF5F 2V6EA 1I39A 3F6OA 5HDGA 4M3DA 5M5YJ 3AE9C 3H1IJ 3GHGC 2COMA 1XS9A 1EZVI 1PPJE 3G73A 1T3JA 3A0HH 2FE3A 1VF5B 1RF0A 2EFPA 5EEAA 4RGRA 5KKZC 1U78A 1HBWA 1DD4A 2OGUA 1GHCA 4AYBN 2ZSIB 4ZDLA 5LRSA 1G3WA 2A6TA 4ENJA 4RO0A 4L73A 4ZDOA 3BJ6A 3D70A 3HYIA 2WY7Q 4UNOA 4H13C 5AW4B 4XFJA 5L3CA 3VPRA 4PJ0E 4WB4A 3WODF 1RUOA 1E17A 1TT5B 3HUSA 5K7FA 3GF2A 1KYOD 2CV1A 2PP6A 3V2QA 2CK3H 2N8GA 2DYSH 2WSCH 5JR3A 2KZIA 3SEQA 4A5MA 1VQ9I 1JUMA 2ICWG 2ISYA 1PGPA 4KFCA 1Z7LA 4D0PA 4IHXA 3HDDA 2KIFA 3V6IA 2V6CA 1XX5A 3BPVA 4IZZA 1YITI 3CWBD 2FYUE 3K10A 1SQVE 1NHAA 1X4OA 5C3EJ 1SFXA 3BTIA 4NBQA 5K5QA 4OIQF 5EYRA 4HLYA 1LP1B 3GMEA 2FMYA 3U2RA 1IZNB 4GYGA 3KDPB 4C3IJ 1V5FA 3U21A 1Y0NA 1NU1K 1PL5A 1ZRTE 2VJ5A 2GUVA 2ZMEC 3K4NA 1VQ4P 3HRMA 2DA3A 1EDKA 2BHYA 3PQJA 2IA2A 3SWFA 5C4XJ 2BVMA 5TISH 3JW4A 1X3ZB 2YX4A 2NVUB 5HNHA 1KILC 2AXTE 1YIJI 1MDMA 4U0VA 3OSGA 3H1LG 3ZQQA 1U5TB 4EJVA 4S05A 1YTYA 4EJOA 4XOPA 1K4TA 2L9VA 1FYMA 4EI2A 2XGDA 2JA5J 1QBJA 5LHHA 2ZXHA 3CMMA 4CXFA 3FMQA 1MFTA 3TQNA 2VQHA 1MD0A 2CJJA 4L5IA 5B5EC 1NK2P 2YU9J 3EQ2A 4V19K 1RPWA 3C2BA 1BOBA 1IZ1A 4LD5A 5LGTA 2XB5A 3GTLJ 3H1LJ 1NTKK 4PJMA 2X1EA 1HWTC 4EM0B 1WCMJ 4DYCA 3HIFA 3D1NI 1LWUB 3EQLF 2Q9IA 3H1HG 5HS8A 1W7PD 2Q2EA 2WAEA 4E7SA 3RKWA 1CQTA 1G4DA 1M7LA 5DCMB 3M0DA 3KP3A 5F1RA 1HW5A 4P5OA 5TISC 4S04A 3HEFA 4OIRF 3KYCB 1IK9A 1Y6IA 2HKOA 1X22A 2DMPA 4JQ0D 2IW5A 2KIMA 1P7JA 3DBLB 2RNGA 3F8FA 2GBYA 4PCQA 2OTJI 3CCMI 2ZJPF 3H1HJ 5DJUB 2NS0A 3FMRA 1FX7A 2COBA 2GOXB 2Z2SB 2KRCA 2BOLA 4XA4A 1ETVA 1D5VA 3AFHA 3V7SA 1M1JC 1JO5A 2JVHA 3PHLA 4BE2A 5TJJA 3CXHD 1X9VA 4C7NB 2DFEA 2M8EA 1P6RA 2M30A 4FHTA 2HKXA 1WKMA 1QHGA 3RJPA 2AXTH 3B5NC 5CJ0A 1XSDA 4YXWH 3BTJA 3MKYB 3VFZA 4PK4A 5CLSA 1SEUA 2L7MP 2OV7A 1PP9D 1PZQA 3OAKA 4I7HA 1S72I 2XSDC 1YE9A 4GDFA 2FYUK 1FY7A 1QZEA 3Q3DA 1NHLA 1B6AA 1LE8B 2Z4EA 2E5YA 4V2FA 4CCLA 1K04A 2HG5D 1HSTA 1HW1A 3O8HA 4KT0J 2BCCD 2HPMA 1HKQA 2X6OA 1TWGJ 2LF8A 2XPWA 5B1AH 1H88C 1I6HJ 2FXPA 2OF7A 1USSA 1TWAJ 2L4MA 2KLVA 1WJFA 1XPXA 5FRMA 1UHWA 3A02A 4U0YA 3DF8A 4CO8A 2QBYB 5FLVA 5E17F 2YKQA 2OYIC 3H1LE 3L72D 3S93A 3SFIA 3TL4X 1X3WB 2O1KA 4IF4A 4E7JA 3NAUA 4GDOA 1IO2A 4PZJA 4H13D 1XGOA 2L7KA 2XPVA 1SFOJ 5A2QZ 4U0WA 1FWZA 3M7GA 1DD3A 1XGMA 1DGWY 5KAFE 1PDNC 2WWYA 3C1DA 2QF7A 2E7WA 3MGNA 3H1CA 3QPLA 2FYZA 2XB0X 3FIWA 1TNTA 1AKHB 2O5RA 2KZVA 1HSJA 3H5NA 2P7JA 3L2WA 1MH4A 1QZYA 2KSEA 5AVYB 3LMMA 2GXBA 1KONA 3OS0A 1W1WE 2R7QA 1KU9A 1YFHA 1RR8C 1XN7A 2R32A 3GTPJ 1FOYA 3RPUA 1TT0A 2QZ8A 4CA0A 4I09A 9ANTA 3H1HE 3TGNA 4KJZA 3M1EA 1P84D 2PI0A 4LC1A 3TEDA 1NTZD 3WMM0 5APXA 2OJED 1MW7A 1YLFA 4Y33A 1BI2A 4A3FJ 3Q3SA 2LDUA 1LTJB 3OYKA 3TOBA 1E5WA 3CC2P 4J00A 1GUUA 1YJNP 1BI1A 2OQGA 1A31A 5D6FA 1KILD 2QYOA 4B43A 5J3LA 1ZRFA 3AL0C 3WE3A 2Q8KA 4ZDPA 4L76A 4W7YA 2PBIA 5H6QA 2W6AA 3SYTA 5IT9Z 3H1KD 2EFQA 1TQMA 3HRUA 1MKMA 3RKYA 1M57D 5DYMA 1QNTA 2W27A 1LT1A 1J09A 2OZUA 3DEWA 1BE3E 2ZCWA 3QOEA 2EPFA 2H89C 2CFOA 2HYJA 2XASA 5CVVA 5BNGA 5K7ZA 2ZFCA 4Y99B 3F72A 1LKXA 5JFRA 3OYNA 4A3EJ 4UHTA 2BASA 5BVZA 3L00A 2A6HF 5GADJ 3KPEA 3JCUH 4L9NA 3R2PA 3BG7A 4C3JJ 1Q90D 2POHA 2QG4A 1ZGWA 3AG3H 4RB2C 3SZTA 5AONA 3ZQGA 1VI0A 2ZJQF 3L71G 5KAFH 3G1MA 1X58A 1MNEA 2L9SA 3EDPA 2NVYJ 4EM2A 1GT0C 2D5VA 1CI6B 2EZLA 2MBFA 4KNYA 3OA7A 3RZOJ 4I99C 2P4WA 3GVAA 3M8FA 2CFXA 4RAFA 1O3SA 3S17J 3PM1A 4UUTA 2X9DA 4B44A 3I71A 2QA4I 1R71A 1QEXA 2V1XA 2P2UA 4BAYA 5EZGA 3E5QA 4DZPA 3HSFA 2MKVA 1B8IA 4GODA 3CMAP 2XPUA 2VKEA 1IDZA 3NWSA 3L75E 4XKWA 2XDJA 1BR4A 1R4MB 2FOKA 4IL6E 1QVTA 3FK6A 3B73A 4GYIA 2HI3A 2R3CA 3L71J 4M73A 3QRFF 2EB7A 2F5CA 2XF6A 1J2XA 5FFXA 3CCVI 2P6SA 2QEXP 1AFOA 2W85A 1NK3P 4YIFA 1FBUA 2F48A 3ZMSA 3J7AY 3HD7A 2V7QH 1U6GA 3E7LA 3CTAA 1ZYRF 2OYHA 3B5ND 2QVOA 3CCUP 2STTA 1RQVA 3BC8A 1FAVA 3L37A 2YO2A 5M5XJ 5LEJA 2KFDA 3WGIA 3T1BA 5CYVA 5CJ4A 1B1BA 2GA1A 3WHCA 3G71P 1G3TA 2QJYC 1XC5A 1R7JA 3P9KA 1RY3A 3L70D 1EXIA 2M3AA 3G6EI 4M71A 4ZZDA 1WJ5A 3H5AA 3OOUA 1N86A 2EK5A 3VYUB 3LW5H 4UUVA 3F9KA 3HUGA 1N78A 2KS1B 2W84A 2QSFX 3FMSA 4U88A 2MGQA 1FJPA 4BQNA 2DA6A 3P7KA 4FTHA 5FLXZ 2STWA 2JPBA 3GFJA 2WSFJ 4KHXA 4D5FA 2JA2A 3SXYA 1QGKB 4DYQA 1APLC 2SPZA 2HZTA 2MABA 2MG4A 4YG2F 2IFMA 4G7OF 1T8IA 2KI7B 2KJCA 1Z3YA 4A69C 4C30A 1BCCE 1ZMEC 3GTJJ 4RMNA 1OYYA 3Q2YA 5AIPA 2M8GX 2NVQJ 3C2GA 1JTXA 1OVVA 1BI3A 1D0ZA 1L4AB 1NKZB 3BG9A 1YRNA 2IRFG 4I7ZC 3NWTA 1KORA 3MN2A 5APUA 4HF0A 1MGTA 3HE5B 3ASOH 4W1UA 1REPC 2X85A 3CX5I 3DPTA 1EQ7A 3H1JD 1TWHJ 4BY1J 2ZYGA 4DW6A 1GU4A 1LT9B 1WHUA 3FXRA 3LSTA 3L71E 4Q5SF 4KISA 4RAGA 1HVVA 2FXMA 4IOAF 2IDBA 5GTHE 2ZT9C 4BEHA 1LDDA 2R92J 2J59M 5B3SH 4HH2A 2CG4A 4I6MC 3CMYA 4IHSA 1GVJA 2YO3A 1LEBA 3P8CE 2R7DA 2DQLA 2GIVA 3VMAA 1T2KC 1DQUA 1E3OC 1DH3A 2E7XA 5IYBJ 1ON2A 5J4YA 2Q3IA 2NNNA 3Q9VA 2LRDA 3MKWB 3HPGA 3ZDMA 1OX3A 3OYJA 2VASA 2E71A 3BJOA 3VOPA 3L2VA 3TNUB 4RAZA 4XRFA 2Z1DA 3KX2A 4A6EA 2CW8A 1VQ5I 1GMJA 1YTZT 1R1UA 3AE1C 1EH6A 2LY9A 3LSPA 2R5BA 3SZGA 5HLHA 2KISA 4HF1A 2N1TB 2MSYA 3CESA 4EQQA 2V9PA 1BSHA 5EZHA 3KYLA 5L3EA 4AM3A 4O5VA 1UIIA 1EV7A 1Y39A 2HNHA 4G6TB 4PD4I 3CC4P 2W6BA 3OYEA 5HDKA 4XMYA 4K3AA 3CD6P 3AEGC 2NNYA 1A02J 2H6CA 2JJ7A 1B72B 1Q82Q 2JQ7A 4BHBA 2ADUA 4JOMA 2F4OB 5EG0B 4D1QA 3H9QA 1EC5A 4BRYB 5GP9A 5ICCA 3A5TA 1FNNA 1GW3A 1RF1B 2GWRA 4AWXB 1T39A 3IHUA 1UIXA 1FZPB 1VQOP 2K9MA 3FXLA 4HAMA 4F3QA 4HW0A 3MWMA 3KEOA 3TO7A 4XR6A 3GUDA 4BJTA 1N73C 4XLAA 5GTIC 1YG2A 2LBFA 2VXZA 2IPPA 3O6BB 5AW2B 1QZZA 2MA3A 2YSRA 3BLYA 2VLAA 2Q5UA 1G2CA 3E6MA 4BQAA 4C46A 4WK8F 1JUNA 1RRJA 3V7RA 2B9SA 1IC2A 3MZYA 2BXYA 1VDFA 2C0XA 5ED4A 1OZHA 3D6YA 3GHGB 5DM6F 1OCOH 2K86A 1G1IA 5IYCJ 5IT9K 3OR1C 2B0LA 4E7KA 4W7ZA 1H9GA 3REOA 5FKNA 1NG7A 1SMTA 4B4CA 4BACA 1M1JA 1SFCC 3RK3E 4QIWN 4L18B 3F8CA 4RLQA 1CGPA 4E7ZA 4W97A 1BA5A 4U3FD 5AW6B 3CUQC 2BHZA 1RI7A 1T98A 4ZYHA 3U1CA 3FM3A 2E74C 2VT3A 1LDKB 3HOXJ 1J1DB 3UKGA 4WY4C 4UB6H 4NPFX 1FDIA 3ZPLA 2DYRH 4DQ2A 2EV5A 4UY8I 5IOYA 1S3JA 5APWA 3SJMA 2QLZA 3WU2H 4XLNF 1BI0A 2YMYA 3EUAA 1IF1A 3DQVC 4BY7J 4Y13A 1OVUA 2HYNA 3M4OJ 4E7HA 3KLNA 3M07A 3ZRGA 1JCCA 5KCMA 1PUFB 1LVAA 2LVSA 1H89C 3RL0g 4BWNA 2MC4A 2E1MB 2H1LA 3H5RA 4JBAA 4JX6A 1FMWA 5EGOA 1IV6A 2LKPA 3BQZA 1UJ8A 3KCCA 3MTUE 4IFMA 3S32A 4YPCA 4QSHA 4JX4A 1O4XA 5J1YA 1NTMG 5M5WJ 3FGAD 3HUSB 2B9BA 1AVOA 3WTUC 1BJAA 1EZVD 2BEQD 3TYYA 1CW5A 5ILUA 3KHUA 1HUCA 1IDYA 3E1SA 1LJ9A 3ZN0A 4L74A 2E76B 2D45A 1LVKA 1BE3D 1XTGB 5E79C 2ZT9D 4RKUJ 2J5PA 1Y0UA 1RC9A 2EFWA 4LLHA 2A61A 1WH5A 3BY6A 1OYIA 1Z3XA 3GZ6A 1GU5A 1NTMJ 5JVGF 4UB6C 4YRVA 1HKTA 3AKZA 1T2KD 2PX9A 2JUGA 4WXHA 1BR2A 1ZR4A 3WU2C 4NB5A 1YITP 1IFIA 4XRSA 1DP7P 3K7AJ 5AW5B 3T5XA 1MIJA 5AW3B 2P5LC 2VE8A 2VKDA 4JP0A 1BIAA 3KP6A 4NC6A 1S29A 1FYLA 2M7AA 2K9SA 1IGNA 5FLXK 4U3FG 3OOPA 1MDMB 1WSUA 2DXIA 2R7WA 4CGZA 3BCBA 2KDOA 1N7SD 1PGJA 4PSWA 3T8TA 1MMGA 3D5RC 3M1CA 4BL0B 3K1PA 1BOAA 2A68F 4YFXF 4XIDA 1ZKGA 1ZP0C 1U57A 2NPSA 2DJIA 5FROA 4E7LA 2E2HJ 3V42A 1S2EA 1TC3C 3W67A 1L0ND 1YIJP 2ZXIA 2HQNA 2KSJA 2WADA 2WTEA 3K2AA 4MTEA 4XLFA 1X19A 5E1ZB 1QO0D 3DTIA 4EJWA 2C0WA 3C7JA 3ERMA 5GAGJ 1U7MA 2LREA 2W90A 3O6QA 1OR7C 2LXBA 2P5KA 2NAZA 1NWQA 3HOVJ 2RAEA 2FYNC 2L4AA 3WTTC 3L74G 1R5GA 3HHGA 3TW7A 3RKQA 2QJPB 1ON1A 2FA5A 2KZJA 2ZXJA 4MFEA 1TWCJ 1VQKP 4A3JJ 3ULQB 2EA2A 2AO9A 2ZXWH 3A1YA 4A12A 2R93J 3HTKA 4D6TD 1IRGA 4BXFA 1USEA 4W80A 2QQ8A 4IRHA 1GL2A 4LMYA 5KTBA 5FLMJ 1T3UA 2V79A 5ERIA 1W36C 1DX7A 1NTME 1YTZI 3OL4A 5EFWB 1K73Q 5EEHA 5H2FE 1K83J 3L2UA 4HX8A 4E4HA 1JGGA 2Z5IA 4PGHA 2N9YB 3L74J 3USSA 2FY8A 3V2NA 1ZHFA 2LOOA 2FF4A 1R1VA 2W24A 3QYEA 4WVZA 3H0DA 5AW9B 3WTVC 4XRMA 2XNDH 2KJBA 3BP8A 3L2CA 3S3NA 5FRNA 4A3MJ 1SFCD 2MYSA 2PFXA 3K5BA 1BN5A 4H0LC 3LSKA 2G0EA 3GF7A 3JCUE 2I8DA 4HSTA 3RK3B 3CCMP 3N7NA 2IS2A 1A5JA 2TCTA 2KKOA 3L2RA 2FU4A 2E74D 1KQ9A 2MD0A 2VJ4A 2DW4A 3BDDA 4GOEA 3KEYA 4UUSA 5B1BH 4WY4D 5CCHD 2M0MA 1H8AA 2E76D 2W4SA 5E3NA 1KYZA 1SFKA 1MNMC 3RL0C 3ABLH 1J7KA 1W5CC 3K9TA 1U9NA 3M9AA 4ZKPA 3ZQ7A 2F4MB 2LC2A 1S72P 4ZTJA 1IC8A 2W83C 5AVZB 2EWNA 4X0GA 3AG1H 4FISA 1JJ8C 1VQLP 3KZIE 4HV5A 1EJ9A 2VL8A 4G9YA 2HOEA 2XGEA 2XGCA 2VT2A 3QOPA 3KYQA 1L2PA 1IW7F 2F6CA 3NMDA 2RKHA 1J75A 2EILH 1NH3A 4NPEA 1F36A 1UELB 3LIEA 5JI6A 2JR8A 3RBXA 3JRGA 1UG0A 4MNUA 1HH0A 4HPQA 3AEFC 2Y2ZA 4UVAA 5KAIC 2JRTA 3S8PA 2K9YA 1DU6A 1YOVB 3LSGA 3EUKL 3WG9A 5BPIA 4IQ4A 1VNDA 1FYKA 1WJCA 5H2FH 4F93B 2YS9A 3DWLE 4AIHA 2A05A 4M3EA 1WRGA 3DTEA 1BC8C 4IJAA 3BJAA 3AEBC 3L74E 5EJCA 4UB8E 1KN7A 4LGDE 1X1DA 2HPIA 3HJEA 5K5RA 4A0XA 3BASA 3BR6A 2Z99A 2RQPA 1PIXA 2L5QA 2H1KA 2EFNA 1KQLA 2Q3EA 1K7AA 2QSIA 4N78E 3RK2C 2TRTA 2BW3A 2JEEA 5E3OA 4NQWA 2JWAA 3MUDA 3A01A 4ZTFA 1T2KA 4PD4H 1J0RA 3JC22 2NVTJ 1UB9A 3P7NA 4AUWA 1ENHA 3WG7H 1JUSA 2WPQA 1YO5C 5HLGA 1NTMK 3OJAB 2R7ZJ 3KZYA 3W3CA 3TGUD 4G6DA 2O7OA 3OY9A 2A45G 1JTHA 1ZREA 1VF5C 2MLKA 3DKYA 1KU3A 1ODDA 3KZIH 4IFDK 3FBIB 1AA7A 1RH5B 3CDIA 2ZJSE 3L4FA 1QGPA 2KT0A 3LSJA 3CF2A 4TV7A 3WGHA 1URQA 1Z56A 4JPZB 1X1BA 2K85A 3HE4A 3WU0A 2AEMA 2E43A 2CQNA 3ESWB 4M9ZA 3HL2A 2DDBA 3HOZJ 2BY3A 1ZTRA 2RDPA 1NTKE 1ZQ3P 1XGSA 2OTLI 3L75G 1ETKA 1IAWA 1KB9D 3NXSA 2XHKA 3QU6A 2HXIA 3LL7A 2KZGA 3MZ8A 4XQFA 2HYGD 1A04A 3O2PE 2YXQB 2HOSA 4H44B 1MZBA 2HQRA 5CQEA 1TW3A 2CO5A 1BJZA 3KP2A 5DD8A 4FX4A 1B8IB 2HOTA 2H09A 4BNCA 2DI3A 1YQ3C 1W36D 2Y0DA 4II3A 3GBGA 3Q5RA 4ZC3A 1N77A 1GW4A 3KFWX 1T08B 3VEPA 4XRSG 4UB8H 5LEKA 3L75J 2QA4P 4WWCA 2W25A 2EJRA 2VI6A 5BU5A 3HOUJ 3ABTA 3QPSA 2P7CB 2CH0A 4LLGF 4E70A 3KYDB 1K78B 3S9OA 1D8KA 1JKRC 1OCPA 3K4MA 3C18A 1L0LD 3HD7B 2LFBA 3CJNA 4CUGA 1JTYA 4H0LD 2OYHB 1YX5A 4MEYF 1FS0E 3H1JJ 3JSVC 1HBXG 4MTDA 1JCDA 3A7OA 5L8RJ 1HDDC 3HRTA 2QKLB 3OIOA 1D0XA 4G94A 3U59A 3ZOBA 3KQGA 2UUZA 1VQPI 1SQBD 2RREA 1WQ2A 2HFHA 2MFZA 3W2VA 1Y56A 1ZV8A 2RQQA 4A3GJ 1EH7A 3P5JA 1W0TA 1NYHA 1U5TC 4FX0A 1FZCA 4XONA 2OC6A 1MSFC 1VQNI 4NUBA 4L75A 5IOZA 5BS6A 4MN4C 3RL0D 3SFDC 1YX3A 3HUGB 4BJ5C 4L5JA 3A0HC 2O8KA 1Y9BA 2JT1A 3S2WA 1AHDP 3BR0A 4N3YB 4LB6B 3G6EP 1IN4A 4EEFG 3Q0VA 4P1WA 1USDA 4G6QA 1R00A 1I3AA 1ZLJA 3UR3C 4Q48A 1KGSA 2BV6A 1VQMI 2C9NY 4XL9A 5AVWB 1X8YA 1B9MA 3U9GA 3D0SA 4A3LJ 3S3OA 1USTA 1LWUC 3DLAA 2JWTA 2X6WA 3LSRA 5D4SA 4CZZA 1F4KA 3FXOA 1YRNB 1T8ZA 3E1RA 1S9KD 4R79A 3H1IE 4WBAA 5F04A 2LTPA 1MH3A 3H92A 2XKPA 2XGXA 3BWGA 3P9IA 3R0AA 2QRXA 3BCCD 2Q7CA 2J5OA 4UXNA 3K4LA 3V7CA 3QP6A 2CRGA 1LNWA 3B4SA 2CW0F 3ECOA 4WF2A 3BTLA 5K5GB 1PP8F 3GFMA 1I50J 1E2XA 2A69F 2FSWA 3LNQA 5FKKA 1NO4A 3CI9A 2HYFA 5HVQC 3J7YJ 3CCQI 3ZQLA 3EWKA 4BEHB 2M3EA 4PJ0H 3V4QA 5KJ7C 1Y8RB 4RAYA 3I59A 3RK2D 2DQRA 3PNTA 2P58A 1BDCA 2LNBA 1VFCA 2IS4A 3DKWA 1OFCX 3R4YA 4F91B 3CX5D 4DOJA 2DTZA 2ZNYA 4GCVA 2B87A 1XSVA 4IKFA 2Q1KA 2R7VA 4Y52J 1UMQA 1IXCA 1N7LA 4J01A 2FUG2 3MCZA 1BGYG 3SWKA 1FMVA 2L5GB 2M0BA 3JAMZ 1MMDA 2H88C 2J58A 1VF5D 2ETHA 2UXNA 1Y8AA 2K9NA 1P4WA 3Q9SA 1LB2A 3A3YB 3PJSK 3OW2O 4LK1F 5EEGA 2Y69H 3KP5A 1SC7A 2VC0A 4EGYA 1VQ5P 5FKOA 2HEOA 3ZP5A 2JRMA 2VE9A 3SSUA 1RQUA 4DT0A 5KLIB 2OCEA 2BBYA 4OIOF 3L73D 5AW8B 1XDUA 2FJ1A 2O61A 1NJIQ 2DT6A 1FOWA 4XLHA 5ICEA 1WFXA 2M2EA 5IP9J 3L9FA 4MHGA 1IJWC 4PJ0C 1BGYJ 2ZVNB 2R7RA 4BDYA 1R36A 2A06D 1DUXC 4JF7A 4PJNA 2XAHA 1SQQD 2PMZA 1UCRA 2R7FA 3I64A 4BXLA 1MMNA 1OR7A 4PD4D 1FBSA 3OYLA 3E5UA 4JK1X 1SVOA 1R1TA 2RN7A 3DCFA 2QKMB 2P7VB 1QA6A 1FT9A 3LWFA 2LBFB 4A6DA 1ZW0A 1Q2NA 2GM4A 2X0LA 1KMIZ 3OYBA 3K0LA 3LA7A 1Z77A 3G4SI 4DJGA 3A4CA 1X1AA 2W82A 1R5HA 1ETOA 3BZ6A 1G2CB 1JM0A 3AEDC 3JSOA 3HRNA 3OYHA 5DJTB 2ZFUA 3PO3J 4B3XA 3FHZA 4AVPA 1LTJC 2E60A 5BMZA 2ZSHB 1VQ8I 4OGQB 1YHQI 5KLVG 2CQ7A 4ZNCA 1GVDA 3BG3A 2AXTC 1PFIA 2XC7A 3DTKA 1OYWA 3V4WA 2ELKA 4DYRA 1S6LA 2XAFA 1MJAA 1M1JB 2WB1A 2WPRA 2IP2A 3OYMA 5F64A 2VPLA 4XLEA 2GUSA 2QJKB 3A0BE 1IUFA 3C8VA 2HQ5A 2X51A 2GXAA 3G4SP 4ZH4F 3RYPA 2HXOA 1QVGO 3MAJA 4U7BA 5APSA 3MMYB 4Y99C 5KLVJ 1NVOA 2IBZG 1JMBA 4A5NA 1IRXA 4AVZA 1D8JA 3IF4A 1L0NG 1FOKA 3BG6A 3CLQA 2RN0A 4XSZF 1FP1D 4ON0A 2L9RA 3HOTA 3EUHA 2H6BA 3IAS2 4YIIA 1BGYE 1NU1D 2GZWA 2PMZN 2RH0A 5DD4A 2H7HA 5EGOB 2O01N 1MNDA 2R44A 4QMAA 3PNVA 3GWZA 2X1DA 1Q1HA 2WV0A 4LK0F 1R49A 1U7JA 2K88A 1P7IA 1FSHA 2IAIA 2K4JA 1FE6A 5LFAA 3GTKJ 2KQRA 1L0NJ 3IRRA 5HS7A 4R1HA 2E2IJ 1FP2A 3KETA 2JZYA 3MZHA 2PJPA 1AQ5A 1F1ZA 2OARA 4HDVA 1MMAA 3TBIA 4HX7A 3GLMA 1SVLA 5KJ7D 4CCKA 3TO6A 4BDZA 3S3MA 5LHIA 2FNPA 2ZKZA 4KT6A 1S5LE 1PGQA 1DU0A 3RGUA 2ID6A 2QUFA 3DXJF 1J59A 2YIUB 1KU7A 5ICGA 2FKWB 3TF5A 3L1PA 3NFQA 2IFNA 1XSXA 1IK7A 1F9NA 1IXSB 1RE3C 1X4PA 5L3FA 1IFMA 2JP3A 1RUNA 3BATA 4MIMA 3GLXA 3II6A 4GOFA 5CCGC 2DFHA 1YJ9P 4ZYEA 1AOYA 3SWYA 1PPJD 4R4MA 3W6JB 1HGZA 1W7PA 4YEJA 1ZG1A 1OVRA 2KNCA 3VMYA 1R23A 1JUPA 2FBKA 3CCSI 1ZN5A 2PRRA 1EDLA 2EIJH 2KIKA 3LA2A 4HNVA 4ASWA 5KLVE 2VBZA 1YI2I 4R4LA 2WY8Q 2Z3YA 4F7ZA 3S1NJ 3S16J 2NPSB 1SQXG 3E6DA 2FBIA 2B7EA 1R5ID 5HS9A 2XUBA 4ASNA 3LA3A 4XSXF 4B47A 1RE4C 4PSXA 3DEEA 3TDUC 3OS1A 5CPRB 4KITB 3LSHA 5KAFC 2WSSH 2JK3A 4KIGA 5HODA 1JI8A 1U8RA 1FC2C 3VSKA 1L4AC 1TP4A 4Y4RA 2QCOA 3RCOA 3VYTB 1SFUA 5F0CA 2KP6A 4II2A 2XAQA 4CHUA 2EZIA 5TRDA 2WSEJ 4JYBA 2IBZE 3IH3A 3TKYA 1RR7A 2HU9A 2ZFWA 5F08A 4EM1A 1SQXJ 1JY2P 2FYUD 2TDXA 3KE2A 4KN7X 1XTAA 1SQVD 3RBZA 2GLOA 1LT9C 3IN6A 4EMSA 1OJLA 1S5LH 3O6QB 1GL2B 1R22A 3FISA 5E3LA 2QQAA 3TDZC 1BC7C 1ZRTD 4I76A 2ZC2A 2FFDB 4QLCU 3AEEC 1H0TB 5GTIE 4IVNA 3RI4A 1VQ4I 2R4GA 2KDZA 3K6GA 2HODA 2LF7A 4BBRJ 1R6RA 3ML6A 5H6RA 2P81A 4IHVA 1YQAA 3IV5A 3E7KA 3EPZA 2FX0A 4IL6H 4CCNA 3JAMK 2E5ZA 1X2NA 2ECBA 3IKTA 1DDNA 2K3PA 4I2OA 2V9KA 2Y9YA 4MO7A 1CF7A 5J1UA 1EXJA 1K61A 1T38A 2WVRA 5K5OA 2KPMA 2YPRA 4WCGA 2L02A 4G8XA 4KN4X 4UUSB 4HYEA 3V8KA 2MH9A 2EA4A 1RETA 3FKJA 1PJRA 2WAQA 1U5TA 3U1AA 4C2MJ 1SQPG 4I0BA 3BOQA 2R7OA 1JHHA 5J1RA 2BVLA 2FXOA 2HFED 1XDSA 1IN6A 1QPMA 1X3UA 2LH9A 1T0FC 4NC7A 4YFKF 1RF1C 2RNJA 5BPDA 2V1DA 3H6PA 3IAOA 1MBFA 2ZMEA 3TP0A 4ESBA 1GLNA 4ETSA 5KK1A 1SD6A 2CUFA 1LTBC 4FCYA 3FKIJ 2Z5HA 3HG9A 3I53A 2BZTA 2EZHA 3H0GJ 1C0WA 2QQ9A 1KILA 4A0ZA 1SQPJ 1SQXE 5KLVK 1N7SC 4IL6C 1FDMA 1QLED 4U7DA 4Y7NJ 3Q5FA 4XKVA 1OXZA 1X79B 2HTSA 2E2JJ 5A2QK 4C3HJ 5BOXA 2O01J 1ZGJA 1ACIA 2QE7H 5APVA 3WUUA 2CQKA 1S5LX 3G1LA 3FXEA 1KD1Q 2K3FA 5DUIA 4BKXA 4EV0A 3WTXC 4HG2A 1LGHB 4XE5B 4Q47A 4AYCA 1JY2O 1QX8A 2NOJB 1KQ0A 3GTMJ 3KIOA 1HKSA 3BCAA 1W4MA 4I98B 4PJJA 2KYVA 3PH0A 5CJ9A 1M56D 1WI3A 2F2EA 3IH2A 2J5UA 2UWJE 2VRSA 1L0NK 5CCGD 3S2DJ 5KHDA 2YKOA 4P9FA 1N2DC 1IUYA 1WT6A 1Y47A 4AU7A 3PP5A 1LPQA 4MFDA 4NQWB 4IL6X 3A01B 1LDJA 1JXSA 2XV4S 4C7NA 2BE5F 3GF3A 5GTHH 3UNGC 4CICA 1G1JA 2M34A 1MMSA 2WAQN 3CWBG 1NKNA 4XKCA 1HDPA 3I4PA 2ME6A 4EJTA 1DPUA 1J1DC 4HB1A 5J4VA 1HW2A 1PGOA 2XAUA 1UHMA 2DTRA 2KLUA 1SD5A 3H1LD 4B3AA 3HGGA 2IGOA 1GZLA 1JTHB 1NH4A 1RF0C 2MC3A 2NS8A 2DMUA 1LE8A 1MBEA 4HRIA 1KQ8A 4LITA 1IFPA 4MEXF 1WPKA 1BM9A 3QYFA 2PJRA 3VP9A 5BU8B 3D6ZA 1MJ9A 3RPQA 1SD4A 2JSCA 5E18F 4U87A 1URQB 1L4AD 1U2WA 2E1MC 3CWBJ 4M6XA 3HE4B 4PDKA 1ZARA 1ZR2A 1Z0XA 3BTCA 3IC7A 3PIPF 2E75B 3B5NA 4PUSA 3NARA 1FJLA 4X1EA 3HUSC 1M1KQ 2WSFH 3E5XA 5IP6A 1SQPE 4OU0A 1HTLC 2DA7A 4MLOA 1AQTA 2AHQA 1Z6RA 5CCHC 4I0AA 3H1HD 1GV5A 3WU1B 2E76C 4LG3A 3C1LA 1S9HA 3CJQB 1I1SA 3K4JA 4HQMA 4RB1A 2OTLP 1PYVA 1AKHA 1JB0J 3CDHA 4XN3A 2HLOA 2DN0A 2MW8A 4OMZA 1MFZA 4IOIH 1I3QJ 1H88A 1EH8A 4GT1A 4DJAA 3F89A 2LKSA 2OQQA 1JY3P 4EVIA 2XF5A 4PV1B 4AIDA 3R6SA 5HDNA 2JMWA 2OYIA 3HB9A 4DZJA 3FX0A 3FWLA 1FOSE 2Y9ZA 1SQXK 3ZMVA 2H8PD 5E8GA 2IGMA 2L0KA 2KL4A 2V4JC 2G8YA 1GTWA 1O7LA 4LFUA 3FK7A 1LFUP 2W6JH 3ZR8X 5J47A 3HHHA 3I9V2 1LTJA 2KP8A 2DOEA 5FD6A 2X1CA 3PO2J 3RZDJ 3K1MA 1ITYA 2N1TD 2R7TA 3BZKA 5J8FA 1FZCB 1GK4A 5IPAA 2P5VA 3CCLI 3SFZA 2WPSA 2M0CA 2OCCH 5TJHA 1KYOE 1VQ9P 1HQCA 3CCEI 1X0TA 3A2AA 1VQPP 2H27A 2XAJA 1FZGA 2HGCA 1IN5A 4HEA2 2BXZA 1B9NA 4B48A 2CV2A 1WJDA 2L91A 3BQYA 2F5FA 3TW6A 3CWBE 5CVIA 3HKZA 4RGUA 3N97A 1NAFA 2WTYA 2QVAA 3P32A 2OD5A 4Z2YA 4FE4A 3OL3A 1ETQA 3WE2A 1PP9G 3FHNA 5FD5A 2QJPC 1E3PA 1LTGC 4FE7A 4LLNA 2O01H 4ZJZA 4XN0A 2Q1ZB 3DFGA 3QYBA 3M0DC 1VQMP 4NNJA 2BCCG 5CVUA 3QQAA 4UV9A 3AE4C 1M90Q 2ELHA 1MBGA 4G12A 4C2UA 1MV8A 1STZA 3JRAA 3OIQA 5GAHJ 4OWFA 4ASVA 1FPQA 1PP9J 3L72G 5B66E 4QPQA 2DA5A 3DU6A 2CS3A 4N9HA 4LG0A 3OYFA 2YMKA 3CC7I 5KAIE 4RM2A 3I59B 1SQPK 1SLQA 2ZB9A 4DBRA 2BCCJ 2M4KA 4RJTA 3H9GA 2ECCA 2Q2EB 3D5LA 2FQ4A 3ROUA 1FJKA 3RK3C 3H9JA 2XF7A 1EKEA 4CH7A 5FJ8J 3CCQP 2A45I 2PN6A 5CQGA 1I27A 3GX4X 1GV2A 4HKZH 3S15J 3HSRA 3I5UA 2QSGX 1H9TA 1JY3O 1NG6A 2B87B 3L72J 2F5EA 3CDLA 4C2TA 2K9JA 4F92B 1G59A 4F55A 3I55P 4O6JA 4QPOA 2V7FA 2M4GA 1OCTC 1OW8A 1BCCD 3QU3A 1SVFA 1NTZG 2BYVE 3VWBA 3T97A 1ULYA 2F5VA 4M3FA 4XK4A 5JVTA 3SDBA 5LGNA 4RBOA 4EOTA 2C9LY 2DK8A 3WHBA 5J8CA 3M9BA 2A3SA 2LLKA 5F27A 3MHVA 1WH7A 3GTOJ 3X2QH 3S1MJ 2LK2A 1L3LA 2G7UA 4ZYDA 3VDXA 5AVQB 3J81Z 2D2CB 2Q0OA 4ITVA 2K02A 3H1KG 1M8OB 3E3VA 1MBJA 2IA0A 1WGXA 3ECHA 1NTZJ 3L71D 3AE2C 1N8RQ 2KRFA 3IR9A 2BEOA 3F8NA 5F6FA 4IHTA 1R5LA 3CXHE 2V1NA 4BHPA 3CPWO 1AVYA 3QPHA 4DCKA 4G7HF 1WJEA 4JX5A 2BEZF 4IX7A 2WQYC 3P8CD 2P67A 1PP9E 3DKXA 4RM3A 1WJBA 3HZJA 1DEBA 3VODA 3FXUA 4IXAA 1BIBA 1LT9A 3H1KJ 4JQFA 1O3QA 1K4SA 2VQGA 3LIDA 3FXDA 2WSCJ 2EINH 3R4KA 2IZ0A 1N25A 3W68A 3WTYC 2L01A 1YJWI 2WZ7A 3CCRI 2BCCE 3GFLA 1BR1A 1YW8A 4EATA 1HF0A 1J1EB 3KXDA 1IXRC 3IWZA 2X6XA 1LEAA 4BGDA 3H3UA 4HX4A 2W7NA 1VQ7I 1VPCA 3GXOA 5FKMA 3PL8A 5D5WB 3M3YJ 3L72E 4BQOA 4JBZA 2IYOA 1X1PA 3QH9A 2FOWA 3G2BA 3RIRA 1VQ8P 2K27A 3B6CA 3NEUA 1GXPA 3L35A 4YXDC 2BY0A 5JLWA 1IFNA 3CC4I 2RMZA 3J7ZI 3HSEA 3CD6I 2DLLA 2HOAA 3TP3A 2Y31A 3Q5PA 1BDDA 1B59A 3W6VA 3EETA 1LUJB 4RGSA 3PSIA 5CVRA 2AXLA 3ZMTA 4XBFA 5EDNA 2FNAA 1XMXA 3J7AO 4CYCA 2OTKE 1NGMB 2YKPA 4FT8A 3KPHA 4LIVA 1KV4A 2VN2A 4HJGH 2XU6A 4A3KJ 3MKZA 3L70G 1ZOYC 1P84E 4BRYA 2IBDA 4RESB 3CXHH 3LQQA 1NTZE 2O3FA 2OQRA 2IT0A 2AQEA 4XNFA 2G3AA 4H44C 3VN0A 1V5EA 3DBHB 1JKOC 4BXXJ 1SQVG 1KILE 2B88A 1FIAA 1DEEG 4KJMA 3WTWC 1KQSO 4H4KC 1PVEA 3PTZA 5CMZA 2E1OA 5H2FC 5KNLA 2R5YA 1N7SA 4BH9A 1D7MA 3H1KE 2ELJA 1ETXA 2LR8A 3P9CA 3L70J 2XAGA 5D5UB 3F8MA 3ZQCA 4OINF 3RQ4A 1W0UA 3C2HA 1M1EB 4D7MA 1JE8A 3HD7C 1JMMA 1IFDA 5B5EE 4XLPF 3RK3D 1LTAC 2OYHC 3RKXA 3JCUC 1GDTA 1SQVJ 2OBPA 4P96A 1UZCA 1YW9A 2DO7A 4BBSJ 4EDFA 3JRDA 2ESNA 1Z05A 3SZPA 1W5SA 3BRVB 2VQLA 1RZ4A 2IJLA 1JKPC 3NQOA 4LLLA 4ABZA 4B09A 1Z6TA 5HLIA 1I5ZA 1JEKA 1N73A 3JTGA 3S1RJ 2ZXEB 1W7PB 2D2WA 2KNCB 1VL2A 2HDDA 3M06A 3ZN1A 2GAUA 5E1WA 1SQQK 3S4RA 1FZBA 2XKMA 3CMEI 4NC8A 5TISE 2NZ2A 2E5NA 1J9IA 1D1CA 3FXMA 2DA1A 2V9VA 3AG4H 1E79H 3KZIC 3LOCA 3HBLA 1ZK8A 3SDGA 4IOCF 3FF5A 4U7JA 3PFIA 3ZMUA 2P1JA 1A6IA 4ANJA 4Y17A 3CCSP 3CCVP 1OKRA 3DPLC 4P55A 4DNCA 1P84H 1FZFA 5IP7J 2Q6QA 1YS7A 2A5YB 1YI2P 1ZELA 4N4NB 1HJ0A 2IGNA 1Y1VJ 1PUFA 1YIOA 1SFCA 4C7RA 3UIAA 5LGUA 2M1BA 3JR9A 2F4IA 3K4KA 3CUQA 2VIXA 3ONQA 3JRIA 4Y28J 5AVTB 2XV5A 4M9SA 2VJJA 4DOZA 2K7LA 3RPUD 4DBQA 1LTIC 4WY4A 1DP3A 1TW2A 1JKQC 5CCHA 3AE3C 2DODA 1Y1WJ 3L70E 4UB8C 2ZVOB 2IPQX 2OPTA 3PSFA 2DMTA 5E8IA 5B5EH 1J5YA 3JRHA 1Q81Q 1L0OC 2IEKA 4GRIA 1HCRA 5KKZB 2CQQA 1NTZK 5ILVA 3M8JA 3WTZA 1S7AA 2LSOA 3CP8A 1P2FA 2HODB 2KIUA 1H89A 1OCZH 2VODA 1PV3A 5AW7B 3OIPA 3F6VA 1NOHA 3CJTB 1K79A 4H13B 4BXUA 3CL3D 5HLTA 3TOAA 1R9TJ 3IUOA 2YXRB 2IBZI 4K35A 1ZLKA 1KQGB 5M3FJ 2DT5A 1CF7B 2OUMA 3ZQHA 4O3MA 2M45A 1OQYA 2AEFA 2QENA 2R5ZA 4QWQA 2Z33A 1TZLA 3ZXSA 3GEZA 2EQRA 2DOFA 2DOAA 5FB2A 4JYKA 5F1JA 3G3ZA 3J81K 1UAAA 1E0EA 2VQCA 1XMAA 3B8EB 2FEZA 1OCCH 1GK6A 2WITA 3H1JE 2R5DA 1Z67A 5KLIC 1FU1A 4CYDA 3GMAA 3QODA 2A6EF 2IXSA 5F0FA 2HVRA 2KK7A 2LXCB 2OA4A 3MD2A 3IL2A 3V5BA 2K3RA 1OIPA 1G6NA 2DJNA 2ZMEB 1MUUA 1N75A 1V54H 3EYYA 4L5EA 1LTSC 1VQKI 5J6XA 2M5AA 3A03A 2Y0EA 3IFMA 3K4BA 4H44D 3I4MJ 2P6TA 3VYIA 3OV8A 5CBOA 1KILB 2IS6A 1DGRM 4HSRA 1P4XA 3Q0WA 1NTMD 3M9QA 1ORKA 2HS5A 4H0EA 5E3MA 2O9LA 1BBYA 2O8XA 2R7XA 2EBIA 2QGUA 3MD0A 3AE5C 2JKVA 4D5CA 1AV1A 4LOCA 3CCJI 1QVUA 2M5WA 2B63J 2A45H 4U3FJ 4A3BJ 4N6JA 3HD7D 2I1JA 1A6QA 2I10A 1SMYF 4CSWA 3I56I 1F43A 2FBWC 2YUSA 4OOIA 1YBKA 2JDIH 4AIKA 2JA8J 3F21A 3AE8C 1K05A 4DIQA 1KTMA 4GFBA 4I01A 1MJBA 2A5WA 2WC2A 2Y48A 5LRRA 3JRBA 3S2HJ 3V4GA 1T6AA 4OGQC 5HOOA 1EZVG 3H32A 3S1KA 4OIPF 5AVUB 2PFBA 4V2GA 5C44J 2JA6J 2DPUA 3RTRA 4I1LA 1MSEC 3HRSA 2CPBA 2O6GE 2DMQA 2WWWA 4L0ZB 1AA0A 3AAFA 3VYRB 2CMPA 2JJLA 1BE3G 2KUBA 2QJKC 1OLTA 1G8XA 4EJUA 2V7QJ 3Q1MA 3DEUA 1X1CA 4L9JA 1TU3F 2E35A 3DU5A 3NRVA 5DEQA 4F52A 5E20A 3CCYA 1SQVK 1VQLI 2VBXA 2M7BA 4XM3A 3HOYJ 3VP8A 3IRQA 2EV0A 4NDLA 3H3VK 3VMZA 2PJRB 3BVHA 2XZRA 3CLOA 1JJ6C 2YX7A 2FRHA 4RA2A 4Y15A 4ZYAA 1BE3J 2WMMA 3LW5J 2PEXA 2KIQA 2VPRA 2HDCA 2YU3A 4B8XA 3VYSB 4OAZA 4O9BA 2Y0MA 5KVRA 5CVJA 3B5NB 4DZOA 4BU2A 3ZMDA 3Q0UA 2JVGA 4RB0A 3O8ZA 1Y8QB 2MD5A 2HZDA 2AQFA 3K70C 3QPTA 2Y75A 3L74D 1B4AA 2FQ3A 4CCJA 1YQ4C 3AG2H 4L9TA 3OWTA 4U3FE 1LJ2A 1TBXA 2HWVA 3LFUA 4HA8A 4IHYA 2KB7P 3C9IA 4NPDA 2CPSA 3A2KA 1ZAOA 4N78D 1ETWA 4HBLA 2KHMA 2KLOA 2XIGA 3F22A 2HVQA 4AUXA 4EYYQ 1LNQA 2HDWA 2YIUC 3F5HA 1XGNA 5IY5H 3KP4A 1HF9A 1R58A 2LR2A 2OYIB 1WJAA 4RLFA 3FZVA 5JHFA 3B02A 1KQFB 2YNYA 3V2PA 3OYIA 1VQ6I 2K9QA 3MEXA 3RQIA 4D6TG 3T8RA 4K2EA 2IS1A 2XSJC 2L7FP 2DFIA 3IH4A 2V1UA 1KZHA 1IO4A 2VOOA 1FTTA 5AVVB 5JHUA 1WWXA 3N05A 3H1JG 1QL1A 1BCCG 1EZVE 2O0YA 1ZG3A 4LIUA 2DW3A 3LSIA 4GKGA 2NPSC 1YW7A 2DAOA 4ZYGA 1NTKD 2LYCA 4HOBA 2DU9A 1T33A 2WB1N 4OAYA 4UV8A 3J80Z 4KYWA 1KB9I 2EZKA 2PGDA 4D6TJ 4FETA 2W00A 3EYIA 1K9MQ 3CCLP 1A02F 3KEQA 4E7IA 2ITAA 2OZ6A 3HXLA 5CHXA 2UV1A 3A0BH 2UXXA 1OCRH 1IFJA 2KMUA 3ASNH 1ZXGA 2QM8A 3CCEP 3ABUA 1BCCJ 4OVNF 4IPAA 4CCOA 3AL0B 2K5CA 5L3DA 3H25A 4KIFA 3S14J 1FOSF 2E1CA 4N4OB 2M3BA 3ITKA 2WT7A 2HPCA 3WUVA 2BY2A 5M3MJ 4TT3H 2UZKA 1GL2C 2VBYA 5ICFA 2B89A 1KYOI 1LTTC 4B86A 2YR2A 4BE1A 2FFDC 3GZ5A 3CZ6A 1G3YA 2FBHA 3AE7C 1O3RA 2QIWA 5H20A 4A3DJ 5AW0B 2IVMA 2DFFA 3GLLA 4OGQD 3N4MA 1UG2A 4LG0B 4I6ZA 1FC3A 3HGYA 3HM5A 2CGPA 3K1NA 2QSHX 1JNMA 3OYDA 1POGA 3CQZJ 3KZZA 1ERDA 5K1YA 2QM3A 3EFGA 3M91A 3H35A 2P0WA 1I6XA 2NS7A 1K78A 1L0NE 2ZNZA 3BR5A 4G7ZF 1TNSA 3A0BC 5GPAA 5D8KB 3HTKB 2KOGA 1P9QC 3L09A 3CC7P 4M9XA 2XVCA 2K9JB 1H8AC 5D4RA 3U1DA 4S0HB 2L3DA 3ZQIA 2HTJA 3E6CC 2DPDA 1TLHB 1JOCA 2K37A 3GTGJ 3T97B 3ABVC 1SD7A 2XNXA 3GZNB 3KLOA 2VONA 2M9HA 5IT3A 3VTPC 4L0YB 4D6TE 1LP1A 1BL0A 1V4RA 1U0JA 1ONVA 2L2OA 2CSOA 4XOTA 3SQNA 3H1ID 2XROA 2E36A 2IZ1A 3JSPA 3AECC 4HNUA 2X48A 3JREA 1BW5A 3MZWB 3ABKH 4RGXA 1ZH5A 2K4BA 1XD7A 3K70D 2N1TC 2O03A 2RV8A 4DGWB 3F23A 3BR1A 5AVRB 2QJYB 2KXPB 4Q4ZF 3TGUG 3O8GA 3L75D 3MFKA 5IYDJ 1E3HA 3C3WA 4UVBA 2DBBA 4XICA 1P92A 2ZJ2A 2HVSA 3DV8A 5C4JJ 1S5LC 2UWMA 2CV0A 1QRYA 1U8BA 2LY2A 3O3KA 3TK1A 2EFOA 1NAYA 3AEAC 2KRHA 4Z1MH 3F8BA 3R60A 1V5GA 2G9WA 2H43A 1XG1A 1SP4A 2M8RA 3TGUJ 2E5TA 3GTQJ 2G7HA 3MKLA 4HZFA 4RDUA 1FBMA 1KC8Q 4ZZLA 6PAXA 5BQTA 1LWUA 1VZ0A 5DV5A 2DT7B 3K69A 1MZ9A 3MUDC 3PLNA 5L3BA 4B1RA 2CUEA 3I55I 1R4NB 4N0BA 4KDPA 5J40A 4I7ZB 1YJWP 3SHFA 2ZO4A 5DCMA 1TL8A 3CP2A 3FXKA 3FX3A 2R0QC 4HQEA 3CCRP 4A93J 3CXHI 5CBNA 4BYYA 1MBKA 5GTIH 4OH8B 3OYGA 4A0YA 3FXJA 1KFMA 2MLGA 2NPSD 1Q1VA 1WI9A 4AC0A 2VKHA 3GO5A 1VQ7P 2LKMA 4A7PA 3CCUI 2K40A 2HR3A 1ZLLA 1QPIA 1HC8A 2L7ZA 3ELKA 5ILSA 1L0LG 2ZYDA 2ZT9B 5E79E 4RB3C 3V8LA 5KJ7A 1SS1A 1URQC 2D1HA 1A35A 1WMKA 2BW3B 4CYCB 2DA4A 4KA4A 1ZG5A 4UB6E 5AW1B 3ZGKA 2Y0SA 1SQBG 5TGTA 4FASD 3OSFA 1ZN2A 2BGCA 2E75C 3WU2E 2IGKA 2BY1A 1HOMA 1G2HA 2XRNA 2PQ8A 2AXCA 1UHSA 5LD2C 2CYYA 1L0LJ 5F0HA 1AU7A 5JLXA 3H36A 2F5DA 5APTA 1GL2D 2P10A 3L7WA 2W8ZA 4OMYA 1QQIA 1FOXA 4X6AJ 2XRLA 3PNYA 2ZAEB 2N9BA 1FSEA 2I5UA 5E1XA 3E6BA 1SQBJ 1HLVA 4Z6YA 5EF6A 2R5YB 1WVRA 2PLYA 1N7SB 2WSEH 2M87A 4Y3OA 4MQVA 4PGGA 4KMUX 2CU7A 5LBQA 3MIWA 1YYCA 2ZXXA 1OW7A 4HV6A 4KICA 3EFFK 3NTNA 4PV1C 2GA2A 3QP5A 3R0JA 2QBYA 3TGUE 2FD5A 3OYCA 2W57A 1TQIA 5FFZA 3K4CA 1FLIA 1W5TA 1QHHD 3H3ZA 3WUTA 3BZCA 2ACJA 3VOEA 1S7EA 1RIOH 1S7OA 4M3BA 2Y30A 3BCCG 3CJRB 1P84I 3BPXA 4XORA 1NTCA 2DA2A 4ESFA 4EIJA 2RGVA 4LGWA 3RDIA 5GTHC 2XKOA 2NYXA 2VC1A 1VTNC 2CW7A 3HPHA 4YFNF 2CWEA 1FZCC 4I02A 4YELA 1N73B 1TWFJ 2WV1A 5D5VB 3LAJA 4KMFA 3J80K 3IAM2 1KB9E 2LD5A 3FBNB 2V4HA 4D9JA 1BSNA 2VBWA 5E79H 5DM7F 3E0JB 1IJDB 5APQA 3CC2I 2AEJA 1BGYD 2H8WA 1YJNI 2VB6A 4WX9A 2QM7A 3BCCJ 2ZYAA 2Y0SN 3PIOF 3JRCA 4AD9A 2K1AA 3GG2A 3VB2A 1WRJA 4XLCA 1FEXA 5DTDA 4ENMA 4M72A 1IRZA 1DPRA 1V3FA 4AQRD 2LG4A 1W2BO 3CMEP 1RKWA 1RNLA 3E1IA 1HA8A 3B71A 1K6YA 4BUPA 1FZAA 3V2RA 5M1BA 5L3GA 2NOGA 2Y0CA 3GW6A 3IP4B 4KT5C 3VMXA 4CPGA 2O3JA 3V8JA 4HNTA 2QQBA 2VKVA 2EIMH 5GPCA 1L0LE 3FXQA 1HXDA 3G1OA 2X6YA 1T95A 1SFCB 2PMHA 2WAFA 3WTSC 4OWRB 3CO6C 3SFEC 4IFFA 3ABMH 1LQ1A 3TDKA 1EDIA 3CUQB 2D1VA 3OS2A 3DBRB 2GIZA 4HDUA 2E74B 2JO1A 3GCMA 4PFOA 4BHCA 1SQBE 4WY4B 2FXAA 1VQNP 4FQGA 2OAZA 4A3CJ 3L73G 1QL2A 1S8NA 3DPUA 2EV6A 2OYOA 3CUOA 1OPCA 2CUJA 2JPCA 3VSLA 3LSMA 3GYHX 3P8MC 2PG4A 1W5CE 3Q5SA 2A06G 1SANA 4RS8A 1BW6A 4PJLA 2I1KA 1IG7A 1T56A 4HLXA 1GD2E 1S1CX 1FZEA 2MJZA 3RYRA 1SQQG 3QWLA 3CMAI 1YJ9I 1W2EA 4NHJA 4ZMDA 1CI6A 3F3XA 5AVSB 4YTPC 1FIPA 3COAC 1P4AA 3L73J 2WBMA 4IQJA 1Z91A 2ESHA 5KLVD 1KB9H 4CCMA 4XKBA 2QEXI 1XCBA 1GXQA 2AS5F 2JWDA 3FM5A 1ETYA 2R5ZB 2HQAA 4MGRA 1JY2N 1KFNA 2VOPA 1D1BA 3IWFA 3OR2C 1ZRCA 3FWEA 3I58A 1JT6A 3BRTB 3FWNA 1S9KE 1SQQJ 2H94A 1R5SA 3BG5A 3BCCE 3JRFA 3MQ0A 3MVPA 2RC4A 2CQXA 1U3EM 3QWOC 5AVXB 1URQD 3IKVA 4M3GA 2DDAA 2P8TA 3G71I 3GW2A 2ISZA 5D6EA 4GO1A 3HOSA 5D8LB 2IBZD 1JHFA 2DMNA 2D2CC 2E19A 2E75D 1G3SA 2PAJA 2NXNB 3E97A 4MQ9F 3L36A 5K7HA 1A36A 2NRGA 1KU2A 3U1KA 1RE3A 1HJBA 4A2UA 3ZMZA 2M5AB 1KYOH 5APYA 2PMUA 5CCGA 3B6AA 4D7NA 1TTYA 1MBHA 3F0CA 1IRFA 3L2QA 1XB4A 1O7FA 1HGVA 4KUMA 3CX5E 1SAUA 4IRIA 3HKZN 4L9VA 2KS1A 1JGSA 2IA1A 5FKLA 5LLQA 4QTRA 3GFIA 1J2JB 3HTUA 1QVFO 2DCEA 4BJ6C 2LKXA 4PV1D 3W2WA 3ISPA 1NU1G 1LFBA 3BT9A 2K9LA 4N9IA 1OWAA 1RESA 1FBQA 1IN7A 4IRGA 1OISA 4UVCA 2H8RA 2WPVB 1J1EC 4WXDA 2FFDA 4HYTB 1RE4A 2LMDA 4M6YA 4EGZA 1L0LK 1OW6A 1H0TA 3CCJP 2DK5A 1L4AA 3H32B 1AJYA 3PJRA 2JTVA 4PFPA 3LAPA 3DP7A 4M74A 3L73E 3I56P 4CDGA 4A3IJ 2LY1A 2FYNB 2MH2A 3BROA 3K2ZA 1SQBK 3RSNA 3HE5A 5B66H 1NU1J 4ZKUA 5DS9A 3TO9A 4BQQA 3DLLF 4BE0A 4R8HA 2A06E 5KAIH 3M0AA 2GXGA 1VF9A 2EIKH 2L9NA 2XDVA 2R7UA 5D5XB 2GOMA 2OTJP 5HNFA 1AWCA 1SQQE 3N4XA 1PP7U 1XCVA 5DUKA 1JT0A 4LJZF 4PD4E 4IEJA 2L54A 2Z5UA 3LQRA 1PUEE 3CO7C 1X2MA 1FTZA 1NTKG 2IX7C
chains in the Genus database with same CATH topology
5DCFA 1Z9CA 2RVCA 1H0MA 1F5TA 1OMIA 1XTCC 2O1JA 4GGGA 3W6KB 3TNUA 2OU2A 5LHGA 4GXOA 1KA8A 2N1TA 3T0YA 1KYWA 4WXCA 3WGGA 4LB5A 5DDGA 1YS6A 2ZBKA 3RL0B 4ENNA 2A07F 1UFMA 2R3SA 3ERED 5AIQA 1T0FA 1CZQA 3TSIA 4AIJA 1RF1A 1TQPA 1KZUB 4ESJA 2E42A 3I0TA 1I1GA 2NRAC 2Z9OA 3I5CA 5FGMA 3QAHA 3LFKA 5FO5A 2QWWA 4I2LC 4P9UA 4M3LA 2GQQA 3KP7A 1T6SA 4GIFA 3HTSB 3GHGA 1D3YA 2FMLA 1SFEA 1Z1DA 1K6OA 1XMKA 1ZRDA 1CSBA 3M9HA 1JY3N 1Z7UA 1ZGAA 3JTHA 2C6YA 4JYCA 3RK2B 3M8EA 1O3TA 1SAXA 1O57A 3R61A 4ENKA 4HF2A 2E1NA 3PQKA 1IN8A 1YYVA 2X4HA 2WT7B 4KIBA 3I54A 2HPCB 3F6OA 5HDGA 2COMA 1T3JA 3G73A 2FE3A 1RF0A 2EFPA 4RGRA 1U78A 1HBWA 1GHCA 5LRSA 1G3WA 4ENJA 3BJ6A 3HYIA 4UNOA 5AW4B 5L3CA 4WB4A 3WODF 1RUOA 1E17A 3HUSA 2PP6A 3GF2A 3V2QA 2WSCH 5JR3A 4A5MA 2ISYA 4KFCA 4D0PA 2KIFA 2V6CA 3BPVA 1NHAA 1SFXA 5K5QA 4OIQF 4HLYA 2FMYA 3U2RA 3KDPB 4GYGA 1NU1K 2GUVA 3HRMA 3PQJA 2IA2A 3SWFA 3JW4A 2YX4A 1KILC 1MDMA 4U0VA 1U5TB 4EJVA 4S05A 1YTYA 4EJOA 1FYMA 1QBJA 5LHHA 4CXFA 3FMQA 3TQNA 1MD0A 4L5IA 3EQ2A 1IZ1A 4LD5A 5LGTA 1NTKK 1HWTC 4EM0B 3HIFA 1LWUB 3EQLF 2Q9IA 5HS8A 1W7PD 2Q2EA 3RKWA 1G4DA 1M7LA 5DCMB 3M0DA 3KP3A 5F1RA 1HW5A 4P5OA 4S04A 4OIRF 1IK9A 2HKOA 2IW5A 2KIMA 3F8FA 4PCQA 2NS0A 3FMRA 1FX7A 4XA4A 1D5VA 3V7SA 1M1JC 5TJJA 1X9VA 4C7NB 2M8EA 1P6RA 2M30A 4FHTA 2HKXA 1WKMA 3RJPA 3B5NC 5CJ0A 1XSDA 3VFZA 5CLSA 3OAKA 4I7HA 2FYUK 1FY7A 1NHLA 1B6AA 2Z4EA 2HG5D 1HSTA 1HW1A 1HKQA 2LF8A 1USSA 2L4MA 2KLVA 1UHWA 4U0YA 3DF8A 4CO8A 2QBYB 5E17F 2YKQA 2OYIC 4IF4A 4PZJA 1XGOA 5A2QZ 4U0WA 1FWZA 3M7GA 1XGMA 1PDNC 2WWYA 3C1DA 2E7WA 3MGNA 2FYZA 1TNTA 1HSJA 2P7JA 1QZYA 5AVYB 2GXBA 1YFHA 1KU9A 2R32A 1XN7A 3RPUA 2QZ8A 4I09A 3TGNA 3M1EA 4LC1A 2PI0A 3WMM0 5APXA 1YLFA 1BI2A 1LTJB 2LDUA 3TOBA 1E5WA 1BI1A 2OQGA 5D6FA 1KILD 2QYOA 1ZRFA 3WE3A 2Q8KA 4W7YA 2PBIA 5H6QA 2W6AA 5IT9Z 2EFQA 1TQMA 3HRUA 1MKMA 3RKYA 5DYMA 1QNTA 2W27A 2OZUA 2ZCWA 2XASA 5CVVA 2ZFCA 4Y99B 5BVZA 3F72A 5JFRA 4UHTA 2BASA 3L00A 2A6HF 3KPEA 4L9NA 2POHA 4RB2C 3SZTA 5AONA 4EM2A 3EDPA 1CI6B 2MBFA 4KNYA 3OA7A 2P4WA 3GVAA 3M8FA 2CFXA 1O3SA 2YO2A 1PFIA 2P2UA 3I71A 2V1XA 4BAYA 3E5QA 3HSFA 2XDJA 2FOKA 3B73A 4GYIA 2R3CA 4M73A 3QRFF 2EB7A 2F5CA 1J2XA 5FFXA 2P6SA 1AFOA 2W85A 4YIFA 1FBUA 3ZMSA 3HD7A 1U6GA 3CTAA 1ZYRF 2OYHA 3B5ND 2QVOA 2STTA 1FAVA 3L37A 5LEJA 3WGIA 3T1BA 5CYVA 5CJ4A 1B1BA 2GA1A 1G3TA 1R7JA 3P9KA 1RY3A 4M71A 4ZZDA 1N86A 2EK5A 3LW5H 4UUVA 3HUGA 2W84A 3FMSA 4U88A 1FJPA 3P7KA 5FLXZ 2STWA 2JPBA 3GFJA 4KHXA 3SXYA 2HZTA 2IFMA 4YG2F 4G7OF 2KJCA 1OYYA 5AIPA 1BI3A 1L4AB 1NKZB 2IRFG 5APUA 4HF0A 1MGTA 3HE5B 1REPC 3DPTA 1EQ7A 1GU4A 1LT9B 3FXRA 3LSTA 4Q5SF 1HVVA 2FXMA 1LDDA 2J59M 4HH2A 2CG4A 4I6MC 4IHSA 1GVJA 2YO3A 1LEBA 3P8CE 2R7DA 2DQLA 2GIVA 1T2KC 1DH3A 2E7XA 1ON2A 2Q3IA 2NNNA 3Q9VA 3VOPA 3BJOA 3TNUB 4RAZA 4XRFA 4A6EA 1YTZT 1R1UA 1EH6A 2R5BA 5HLHA 4HF1A 2N1TB 4EQQA 5L3EA 4O5VA 1EV7A 2W6BA 5HDKA 2NNYA 1A02J 2H6CA 4BHBA 2ADUA 3A5TA 5ICCA 1FNNA 1GW3A 1RF1B 2GWRA 4AWXB 1T39A 3IHUA 1FZPB 4HAMA 4HW0A 3MWMA 3KEOA 3TO7A 3GUDA 1N73C 1YG2A 2VXZA 2IPPA 3O6BB 5AW2B 1QZZA 2MA3A 2YSRA 2Q5UA 1G2CA 3E6MA 4BQAA 4C46A 4WK8F 1JUNA 3V7RA 1IC2A 1VDFA 3MZYA 2C0XA 5ED4A 3GHGB 2K86A 1G1IA 5IT9K 2B0LA 4W7ZA 1H9GA 3REOA 1SMTA 1SFCC 1M1JA 4L18B 3F8CA 1CGPA 5AW6B 3CUQC 1RI7A 1T98A 4ZYHA 3U1CA 3FM3A 2VT3A 1LDKB 1J1DB 4WY4C 3ZPLA 4DQ2A 2EV5A 5APWA 1S3JA 2QLZA 4XLNF 1BI0A 2YMYA 1IF1A 3DQVC 4Y13A 2HYNA 3KLNA 1JCCA 1LVAA 4JBAA 2O1KA 2LKPA 3KCCA 3MTUE 4IFMA 3HUSB 3WTUC 1BJAA 3TYYA 1CW5A 5ILUA 1HUCA 3ZN0A 1LJ9A 2D45A 1XTGB 2J5PA 1Y0UA 2EFWA 4LLHA 2A61A 3BY6A 3GZ6A 1OYIA 1GU5A 1HKTA 1T2KD 4WXHA 1ZR4A 4NB5A 1IFIA 1DP7P 5AW5B 3T5XA 5AW3B 2P5LC 2VE8A 1BIAA 3KP6A 1FYLA 1S29A 5FLXK 3OOPA 1MDMB 1WSUA 4CGZA 1N7SD 3T8TA 3K1PA 1BOAA