3G3ZA

The structure of nmb1585, a marr family regulator from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
b'MNQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, MarR family
publication title The structure of NMB1585, a MarR-family regulator from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g3zA02
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3g3zA01
5HLHA 2XKOA 4LD5A 1ODDA 3T8TA 2JTVA 1LEBA 2IPQX 3ABUA 3DF8A 4HLYA 2ZBKA 2VC0A 1F9NA 5D4SA 3F8NA 4MQVA 4L0YB 2NNNA 3H92A 2OQRA 4B8XA 5A2QZ 1ZRDA 2ZJ2A 1JHHA 3QP5A 3RKXA 3VEPA 3WG9A 1O3TA 2ISZA 3FM3A 4EGYA 2RNJA 2R7FA 3ULQB 3N4MA 1IUYA 2J5OA 3V4GA 1BI3A 2STTA 2PG4A 2WSFH 4M9SA 3I59A 3RKYA 3HYIA 4XBFA 1ON1A 2JPCA 1K78A 1UHMA 1WKMA 2XAQA 5LEKA 3QU3A 4KNYA 3IL2A 5F1RA 3WTWC 2IA1A 2YSRA 3MFKA 3RPUA 5BOXA 2LF7A 4NQWA 2IA0A 1PP8F 4BXUA 4GCVA 1LDJA 5E18F 1L3LA 2C6YA 3LAJA 5HS9A 3KP6A 3HHGA 3KZZA 4L5JA 4L9TA 1LNWA 5D6FA 1FPQA 3WU0A 4IPAA 2ISYA 5H6QA 5HS7A 1ZRFA 2RC4A 1KU2A 2GA1A 3LA3A 3J7AO 4YFXF 2XROA 5E8GA 1TW2A 1LEAA 3F8MA 4AIHA 2NS0A 3Q9VA 1J59A 2XVCA 3M8FA 1U2WA 3ZMZA 3HRSA 4I0AA 5DUIA 5TJJA 3VOEA 4RB1A 4RGXA 1MD0A 4M9ZA 3E6BA 1F5TA 1R22A 5E1ZB 4A0ZA 1IN7A 1R1UA 5E17F 4A2UA 2HR3A 1S3JA 3P9CA 4LLLA 5E1XA 2DQLA 1WRJA 3WGIA 3TO9A 3WTUC 5DV5A 4HF1A 3GXOA 4L9VA 1OYYA 5DD8A 1MDMA 4FT8A 1C0WA 2QBYB 2OD5A 3IRQA 3CO7C 1B59A 2YU3A 5L3EA 1BIBA 4M74A 5CVRA 3LA2A 3HTUA 3WTVC 3F8CA 5FD5A 3E97A 2P7CB 1P92A 1CGPA 4FX4A 2XKPA 4ENKA 1KQ0A 1R23A 1YLFA 3EUHA 1ZLKA 4WX9A 1QBJA 2LKMA 2PBIA 1I1GA 5LGNA 2TDXA 2XGXA 4L5IA 4D0PA 3ERED 3M9AA 2VBWA 2M8EA 2MH2A 3WE3A 3FHZA 3I5UA 1YS7A 4RAZA 5LHHA 3JW4A 2E7XA 4IRIA 3FX3A 1D8JA 2ZXJA 4WCGA 1SMYF 2F2EA 1FYMA 3NRVA 4EMSA 3TKYA 1S7AA 5L3CA 2NRAC 4I0BA 1O3SA 2EA2A 3CTAA 2M5WA 3ML6A 1XGSA 3HSFA 3NEUA 2EJRA 2FRHA 2HDCA 4EV0A 4ZH4F 4I09A 4MNUA 4M73A 4L0ZB 5LLQA 2HGCA 2H94A 4KMFA 2UXNA 5JVTA 1IN6A 2CYYA 2QQ9A 3I0TA 4IFDK 4LG0B 1D5VA 3GFMA 4CDGA 2JRTA 3KE2A 3I54A 3HOSA 1FNNA 1W7PD 2K7LA 3P9IA 4KN4X 2E7WA 1Z1DA 3HHHA 4GO1A 1ZG5A 2ZCWA 4MEXF 2ESHA 3J80K 1EH6A 3RKWA 2O3FA 4NHJA 3V7CA 4LK0F 3KP2A 3S2WA 1O7FA 2Z5UA 1SMTA 2O8XA 3DFGA 2CQKA 4UVBA 5DCFA 1LDKB 1ZG3A 4WXCA 4WWCA 5J8FA 4EJOA 1BBYA 3C7JA 4P9FA 5HLIA 1A04A 2F5CA 3KP5A 4G6QA 2DK5A 2QLZA 3K9TA 3L9FA 4EJTA 3LFKA 3TO7A 2V1DA 4Q48A 2QUFA 3PFIA 1L0OC 3RIRA 4IXAA 2EFQA 5TRDA 3E6DA 3I53A 5J8CA 2A3SA 1FP1D 2QZ8A 1Z6RA 3R0AA 2K4BA 1FSEA 1OPCA 2A07F 1V4RA 1YTYA 5FLXZ 4CICA 4WXDA 2M30A 1UCRA 4PCQA 4U88A 1YW9A 5FGMA 2DPDA 2XV4S 2EB7A 2BYVE 4QLCU 1G4DA 4LMYA 1YYVA 2VBYA 3KFWX 5K1YA 2WTEA 3SHFA 2COMA 2AXLA 2LKPA 1IXRC 2DPUA 2NAZA 5AIPA 1U6GA 2JT1A 4YFKF 1PP7U 1SQBK 2Z3YA 1V3FA 3HRMA 2J59M 2PEXA 1T98A 2CFXA 5E20A 5CVVA 3D5LA 1OMIA 5HDGA 1QGPA 5IT3A 1ZGJA 2BBYA 1W7PB 1VTNC 5AONA 4IJAA 1EV7A 4BHCA 2PMUA 4HW0A 2GXGA 2OZ6A 1S7OA 4Z2YA 4MGRA 4HAMA 5BQTA 2DW4A 3QRFF 3I4PA 2X0LA 4KDPA 3K2ZA 1XDUA 1XB4A 4CYDA 3I58A 2Z99A 5DCMA 4AVPA 5IT9Z 4HQEA 1T38A 3TOAA 1KU3A 3GLXA 4EGZA 1CF7B 5EEHA 3TOBA 2P5LC 3M9QA 5LRSA 3D0SA 2V1XA 3JTHA 1JHFA 1R00A 2A6HF 4U7BA 5H20A 3O2PE 1FBSA 5DEQA 4A12A 2ZMEA 4O3MA 3L7WA 1F4KA 3CUQC 1USTA 3RYRA 4OU0A 2OA4A 2RN7A 4S05A 3KP3A 3MQ0A 3BOQA 2A61A 3V7RA 2LF8A 3I64A 5L3GA 4P5OA 4GYIA 3J81Z 2E1NA 4DQ2A 4EJUA 4EVIA 4P55A 2M45A 4OMZA 4ZYGA 1AWCA 4HV6A 2MLGA 4BHBA 2A6EF 1J9IA 5FFZA 4M6YA 3SZTA 3KCCA 4LLGF 3GO5A 2XAGA 2CSOA 5LRRA 1HW5A 2UWMA 5DD4A 3CUQB 4P9UA 5ICGA 2HKOA 2XAJA 5J6XA 2AS5F 1NHAA 1G3WA 4LG0A 4ASNA 5ERIA 2HZTA 1Z91A 5CLSA 2L01A 1TBXA 1WI9A 2QYOA 1LB2A 4CZZA 1YG2A 2ZNZA 1J2XA 1IXCA 4M9XA 4YFNF 2F5FA 2YX4A 3HTSB 4UV8A 3F6VA 1IF1A 1DPUA 2EFWA 3MEXA 2FMYA 4RB0A 3SFZA 4XSZF 1RUNA 2KIMA 3WODF 3RPQA 3FXUA 3M8EA 1LQ1A 2EV0A 1IXSB 4Y15A 1BM9A 3E3VA 5A2QK 5D5XB 3IKVA 1GHCA 1KQ9A 5JI6A 1J7KA 3CDHA 3CLOA 2H27A 4OINF 1TW3A 3R61A 1U8RA 3JAMZ 2VBXA 2HS5A 3RYPA 3WGGA 3EYYA 3BY6A 2H09A 5F64A 3SQNA 2EFNA 2IP2A 1ZREA 1SQVK 1IN4A 1HKQA 3BDDA 2DQRA 2DFIA 2QVOA 1J75A 5HDKA 2EV6A 1PDNC 3F72A 4BH9A 4IHTA 3LSTA 4KIFA 5D5UB 2ELHA 3T8RA 2G7UA 1QO0D 2PLYA 1E17A 4OIRF 3HIFA 2O61A 2WV0A 4YIIA 2VT2A 3DV8A 2HEOA 4EJVA 3FMSA 1W7PA 2R3SA 3TDUC 1SQPK 4JBAA 1B1BA 1BOAA 3C1DA 3QPTA 4I02A 2LDUA 3QU6A 1MJBA 4M72A 4JK1X 1F1ZA 2G7HA 3DPTA 1SD6A 5JFRA 3WTYC 1GXQA 4HA8A 2DT5A 1BI0A 2A68F 1ZLJA 3RI4A 2OZUA 4IRGA 5JHUA 1KYZA 1HSTA 3QPHA 3PQJA 4EQQA 1Z6TA 2DU9A 3ZMDA 1CF7A 2EFOA 1W5TA 5KLVK 3CJNA 3V8LA 2RGVA 3VB2A 2ZKZA 1UFMA 2HKXA 4RGUA 2Z9OA 1PUEE 3MAJA 2KRFA 1B6AA 4S04A 1E2XA 3WTXC 2VXZA 2XAFA 1TQMA 1X3UA 2FBIA 3ZMUA 4OOIA 1NTKK 3KLOA 3K1MA 1AOYA 1MKMA 1W4MA 2XUBA 5DUKA 4Q4ZF 3HOTA 4LB5A 4UNOA 5LHIA 3IWFA 1T0FA 2UZKA 4G9YA 4LFUA 3KLNA 1RI7A 5ILVA 4OMYA 1LDDA 4GGGA 2PFBA 2DAOA 1FC3A 2P6TA 2QENA 4KN7X 2IT0A 4OIPF 3QP6A 4R1HA 3R60A 2WSEH 2D2WA 3DXJF 1Y0UA 4UV9A 2NYXA 2Q0OA 1RZ4A 1EH7A 2EA4A 5KVRA 4N0BA 4AIKA 1K7AA 2MLKA 1G6NA 2FMLA 1HKSA 2W24A 2A5YB 3HSEA 3F21A 2O6GE 1MJ9A 1I5ZA 3FXQA 1QQIA 2DBBA 3Q5FA 1XGMA 1H0MA 1D3YA 3ECHA 4RAYA 1K6OA 4O6JA 2QWWA 2FEZA 2VOOA 5CVIA 2HYGD 4CO8A 4BNCA 4G7OF 2GZWA 2DTRA 2OARA 4G8XA 3JSPA 4ON0A 2CWEA 4WK8F 2JZYA 3FMQA 2Y75A 2O03A 3L09A 4ENMA 3ROUA 2VT3A 3LAPA 2JSCA 3TO6A 1UHWA 3WTTC 4HLXA 3EQLF 4ESFA 3CUOA 1XMAA 3V8KA 1TLHB 3KEQA 1B9NA 3I59B 2K4JA 4R8HA 4HF0A 1K78B 3LWFA 4LGWA 4N9HA 3WTZA 3IRRA 2ACJA 2YPRA 4EM2A 3RDIA 1RIOH 2ESNA 2LNBA 4O5VA 3IHUA 3FM5A 3E6MA 3WE2A 1SFEA 4ZYHA 2LSOA 1JXSA 1R1VA 1FLIA 5E1WA 1BN5A 1FYLA 2BV6A 2Y48A 4L18B 3M7GA 3WTSC 2QM3A 4XRFA 1XSXA 1GVJA 4ESJA 3EYIA 5FLXK 2PN6A 2HTJA 4OIOF 3REOA 2NNYA 1T2KA 3K69A 1BJAA 1J0RA 1BC8C 2E1CA 1O3QA 1D8KA 5CVJA 1B4AA 1G3TA 1QNTA 1EH8A 5ICEA 2FNAA 2ZFWA 4BQAA 1HQCA 4HDUA 2RVCA 2QBYA 2V79A 5KK1A 2EFPA 3GW2A 4P96A 5LGUA 3R6SA 3G73A 1HW1A 3ZMVA 2EWNA 2Y0MA 5D6EA 1IAWA 1S6LA 3FXRA 3T0YA 2VE8A 1P6RA 3U1DA 1HBXG 1YS6A 3P9KA 4I01A 3IWZA 2R7DA 2IVMA 2HYFA 1BIAA 1LVAA 5CJ9A 4G7HF 1SD7A 3HRTA 1S8NA 2KJCA 4TV7A 1I6XA 5HLGA 2MA3A 2DK8A 2FXAA 1WSUA 1U5TC 1FWZA 1TNTA 5D5VB 4KFCA 2GQQA 1L0NK 3CO6C 5L3FA 5IT9K 3I71A 2O0YA 3FZVA 3K1PA 1FT9A 4G6DA 3H3UA 4HYEA 4F7ZA 1IN5A 1YIOA 4MTEA 3GFIA 4RGSA 2FF4A 5L3BA 3TQNA 4B09A 1STZA 2VOPA 2FNPA 3BZ6A 3O3KA 2OU2A 1QZZA 5HS8A 3ZN0A 1HKTA 4WXHA 2UXXA 3Q9SA 2RKHA 4IHSA 4PGGA 5BMZA 1IW7F 1U5TB 1U3EM 3ZPLA 4M6XA 4PGHA 2WWYA 2P8TA 4KYWA 4BYYA 4IRHA 2GIVA 3GZ5A 4ZZDA 1IZ1A 4HF2A 1B9MA 1LJ9A 1SD5A 3J81K 1IRGA 2PI0A 2GWRA 1DPRA 3K1NA 4XLPF 5F6FA 4ENJA 1H9TA 1SQXK 1MZBA 1WWXA 3MZYA 2V1UA 5ED4A 1ZAOA 4HZFA 4OIQF 3DPLC 2Q2EA 1QPMA 4MTDA 1ZYRF 1R36A 5CVUA 3PQKA 2MH9A 3JTGA 1KU7A 3GX4X 3F22A 2K86A 4AIJA 4U7DA 3OOPA 2XAHA 3CLQA 2FU4A 4UUVA 1G3YA 4EM1A 1SAXA 1I27A 1NTZK 2D45A 1SFXA 3K0LA 1FY7A 4HQMA 3BJOA 2D1HA 3ZP5A 3VFZA 2HOEA 2XASA 5ILUA 5BPIA 1YW8A 2KIFA 2STWA 2L54A 1RUOA 3C18A 2IW5A 1ON2A 4UXNA 4ESBA 2Q8KA 3QAHA 1O57A 3ECOA 5DDGA 4MEYF 3F8BA 4A5MA 2Z33A 4L9NA 5JR3A 5CYVA 3B73A 3IC7A 1R5GA 3MZHA 2HFHA 1R1TA 2M1BA 1XD7A 2XIGA 5HDNA 2V6CA 4IVNA 2YR2A 3E5QA 3BPXA 3T5XA 4RS8A 3BWGA 3C3WA 3HRUA 2JPBA 2DLLA 3BPVA 4DNCA 2RV8A 2VC1A 3SZPA 3TGNA 4UVCA 3JAMK 1T39A 3B02A 3DQVC 2L02A 4LLNA 3H3ZA 4RB3C 3GEZA 2QQBA 5H6RA 1YW7A 1ZN2A 2FBKA 2P4WA 1FZPB 4CXFA 4RB2C 2DI3A 2W25A 4U0VA 4CHUA 4A6DA 4L9JA 1YO5C 2IA2A 4JQFA 1MJAA 1BI1A 2RQPA 1XGOA 2OBPA 5FB2A 1DUXC 3BROA 1WQ2A 5L3DA 3KZYA 1T6SA 2F5DA 1JE8A 4BHPA 1DDNA 3GZ6A 2P5VA 4EM0B 2KJBA 4Q47A 1KGSA 1P4AA 3GUDA 3OV8A 5DCMB 1FSHA 3ZMTA 2VODA 2FYUK 4YIFA 2MD5A 2BE5F 3GWZA 1OR7A 1HSJA 3EETA 2XRNA 3LA7A 3DEUA 3BJAA 3E5XA 1OYIA 2K27A 2GAUA 1JGSA 2MBFA 2ZMEB 4G94A 2W84A 5D5WB 4PZJA 2CO5A 5LBQA 4U0YA 4HX4A 4GXOA 5FFXA 4R79A 2PJPA 3P7NA 2P6SA 1ZG1A 2VBZA 1U5TA 4UVAA 1R5HA 3F3XA 5D4RA 1FOKA 3CUQA 1ZHFA 1R7JA 3FWEA 1SD4A 4G7ZF 4Y17A 3MWMA 4HX7A 4HX8A 1OYWA 3F23A 4ZYDA 1SFUA 4PDKA 3KEOA 1NTMK 3ISPA 4U0WA 4LB6B 1ZGAA 4RGRA 5LEJA 2ZNYA 5HOOA 1Q1HA 2D1VA 1ONVA 5ICCA 5LGTA 2FA5A 3J80Z 3F6OA 2K02A 3GFJA 5K5RA 1NU1K 3FMRA 3LQRA 4HBLA 1ZH5A 1XGNA 1P2FA 3HUGA 1XSVA 3U2RA 4LJZF 1IRFA 1USSA 4N9IA 2FSWA 6PAXA 3TDZC 1ZARA 2A69F 4AWXB 1SQQK 4H0EA 2RDPA 4KIGA 1G3SA 3ZN1A 1ZRCA 4HV5A 2V9VA 4FHTA 1OKRA 4XLNF 4I2OA 4UHTA 1P4WA 1K79A 2HWVA 1TQPA 3QOPA 5ILSA 4BAYA 2P5KA 2ZO4A 3MCZA 5BS6A 2KKOA 1O3RA 1R58A 3RJPA 3HSRA 5AIQA 5EEGA 2W57A 3DKWA 2VE9A 1FP2A 2L4MA 2XHKA 3LQQA 2H6CA 1YQAA 3U9GA 3R4KA 1H9GA 2HTSA 3V8JA 1BC7C 1XSDA 1I1SA 1FX7A 4K2EA 3L2CA 5HVQC 1REPC 3KP7A 2H6BA 1KA8A 2P7VB 2W85A 1BI2A 2FOKA 2PMHA 2KIUA 3ZMSA 1S29A 1TTYA 3ELKA 4Q5SF 2OQGA 4MHGA 1Z05A 1DP7P 1ULYA 3BP8A 4KUMA 2QQAA 2ADUA 3IKTA 1O7LA 2CG4A 2HQNA 4ZZLA 2PQ8A 4I7HA 4CGZA 1TNSA 4A0YA 3FF5A 4KICA 2VONA 5DYMA 1XMKA 5FO5A 3EDPA 3GVAA 4MQ9F 4QWQA 4HOBA 1L0LK 2BGCA 3WU1B 2OAZA 2DO7A 3T1BA 3R0JA 1UB9A 2FQ3A 1KYWA 4A0XA 3F8FA 4IF4A 1W5SA 1GXPA 4WF2A 3AAFA 1QZYA 4GYGA 3W6KB 2L3DA 5K5QA 1FYKA 1XCBA 3COAC 4A6EA 3KP4A 5E8IA 4ETSA 1MDMB 4I98B 3O6BB 2EV5A 2IJLA 2IRFG 3VODA 4ENNA 5FD6A 2CGPA 1IN8A 3L00A 4FX0A 1MGTA 3SXYA 3N97A 3DP7A 2F5EA 4E70A 1XDSA 1TQIA 2J5PA 3GYHX 2B0LA 2CW0F 1HW2A 1XN7A 5BPDA 2L4AA 1Z9CA 3JSOA 4HDVA 3E5UA 2GA2A 3M1EA 2BEOA 5D8KB 5D8LB 1KU9A 4A5NA 4KMUX 2FBHA 2M87A 3ABTA 3E6CC 1KQ8A 1J5YA 2HQRA 2VN2A 2WSCH 4M71A 5K5OA 1XCVA 2YX7A 2EK5A 2X4HA 4YG2F 3NQOA 3W6JB 3BJ6A 4EJWA 2FE3A 5LHGA 1HXDA 2GXBA 1FBQA 1YFHA 4Y13A 3G3ZA 1Z7UA 3RTRA 4KA4A 5ICFA 1U78A 4XSXF 1FBUA 4AD9A 2O01H 3WGHA 4ZYEA 3GFLA 4KT5C 3LW5H 4KIBA 1RNLA 3GF2A 4NB5A 1P4XA 2ETHA 3ZQ7A 2WC2A 3V7SA 2MC3A 3KETA 4LK1F 2G9WA
chains in the Genus database with same CATH superfamily
2FYUG 3L75D 3SYTA 5HLHA 2XKOA 3M4OJ 1SQXD 3FBIB 2K9JA 2KFDA 2BY1A 4LD5A 5CCHD 3HUSA 1ZMEC 1ODDA 3L72G 3T8TA 2JTVA 1LEBA 1KILB 2IPQX 4UB8H 3ABUA 2BW3A 2W83C 5FJ8J 2H43A 5AW9B 3IV5A 3DF8A 4HLYA 1JUNA 4C7NB 2ZBKA 2VC0A 3IAOA 5CQEA 2HOTA 4YELA 1PGQA 1F9NA 2OC6A 1ZK8A 3K4CA 5D4SA 2KL4A 3HOXJ 2DN0A 1JY2O 3F8NA 5TISC 4MQVA 3RK2D 1F36A 2R5ZA 1NK3P 2HFED 2VJJA 4L0YB 2R5BA 4X0GA 1S5LC 2LR2A 2NNNA 5F1JA 4ZMDA 1JY2P 2I10A 3L1PA 3ABMH 3H92A 3ZQCA 4PJLA 1YITP 1MBFA 5AVXB 1T6AA 2OQRA 2PMZN 5AW8B 3ABLH 2I1KA 1P9QC 2WV1A 4B8XA 3B4SA 5A2QZ 1NTZD 1ZRDA 3TYYA 2ZJ2A 1JHHA 3QP5A 3RKXA 2E1MB 3VEPA 2R5YB 1HF9A 3WG9A 1O3TA 2O1JA 1E3PA 2ISZA 3FM3A 3AECC 3A4CA 4EGYA 1LTJB 3L75J 2DOAA 2RNJA 2R7FA 5EZHA 3ULQB 3N4MA 1MSEC 2VUMJ 1IUYA 2QKLB 3WU2E 1JY3O 2CUFA 3KYLA 1GDTA 3VPRA 4C3JJ 3V4QA 4IOAF 1W1WE 1X1CA 1FTZA 2J5OA 1MMNA 2LY9A 3V4GA 3B6CA 1BI3A 2STTA 4PJ0E 2PG4A 2WSFH 3BZKA 3JRFA 4M9SA 5J1RA 1V5FA 1WFXA 4BGDA 2CJJA 3I59A 3P8CD 4JQ0D 3RKYA 3HYIA 4CSWA 5DS9A 1WJDA 1JTYA 1HGVA 3IFMA 3WMM0 4XBFA 1ON1A 2JPCA 1NTMG 1K78A 1UHMA 2Y69H 1WKMA 2XAQA 4HNUA 5LEKA 3QU3A 2UV1A 5IOZA 4N4NB 4KNYA 3IL2A 3FWLA 5F1RA 4UUTA 3WTWC 2IA1A 2YSRA 4KISA 3MFKA 3RPUA 4BXFA 4RO0A 3VP9A 5BOXA 2LF7A 4EI2A 4NQWA 2IA0A 3DLLF 1PP8F 2CU7A 1NTZJ 4BXUA 1OISA 1JTHB 2JWDA 4GCVA 2FJ1A 1LDJA 2ZC2A 4DBQA 5E18F 1KB9D 1KYOI 2XKMA 1SFCD 2VJIA 2JK3A 2KZVA 1L3LA 2C6YA 3LAJA 3TGUD 1ZQ3P 3GTKJ 1X4OA 4AM3A 1CI6B 4L75A 2DTZA 1V55H 3S2DJ 3FK7A 5HS9A 1TWFJ 3KP6A 3HHGA 2E2JJ 3RK2C 3KZZA 4N4OB 2WT7A 3Q0WA 2KDZA 4L5JA 3L36A 3G71P 4L9TA 3NARA 1LNWA 1G2CA 5D6FA 1ZRTD 1FPQA 3WU0A 3AEFC 4IPAA 1T2KC 2ISYA 3HKZN 5H6QA 2L5QA 3PNTA 1W5CC 5HS7A 1ZRFA 1WJFA 2RC4A 1KU2A 2XSJC 1R71A 5B66H 1K6YA 3FXKA 3IH3A 1VQPP 2KP6A 4PFOA 3C1LA 2GA1A 1KONA 3LA3A 3J7AO 2IX7C 2OGUA 1I50J 1PPJE 3M06A 3PNYA 4YFXF 2XROA 5GTIE 2KLVA 5E8GA 1JNMA 1TW2A 3JRCA 4LC1A 4HYTB 1LEAA 1BR4A 4BE1A 3LIDA 1X2NA 3F8MA 4AIHA 5APXA 2NS0A 4CYCA 4GFBA 3Q9VA 5B5EE 3GG2A 1J59A 2XVCA 1HBWA 2LFBA 3CJTB 1H89C 3M8FA 1U2WA 3ZMZA 1N7SA 3M0DC 3HRSA 2JWTA 1OFCX 4I0AA 3M91A 5DUIA 3BVHA 1XS9A 2K9YA 4H44C 3X2QH 2MABA 3H0GJ 3I3LA 3I9V2 3S1RJ 2DW3A 3K5BA 2AHQA 5TJJA 4W7ZA 3VOEA 1AQ5A 1DX7A 2HQAA 3MMYB 4RB1A 3ITKA 4RGXA 1MD0A 4M9ZA 3E6BA 4II2A 1F5TA 5KKZC 4KT0J 1SC7A 4I2LC 1ZR4A 3FK6A 1LTGC 3RK2B 1K8AQ 1R22A 5E1ZB 4A0ZA 3L73D 2P10A 1IN7A 1R1UA 1T3UA 2LH9A 3M3YJ 2F48A 5E17F 3BTJA 1X79B 4A2UA 1YE9A 2HVQA 2IBZI 2HR3A 2QJKC 4IEJA 5FROA 1S3JA 3P9CA 4LLLA 1ZLLA 3MHVA 4DJGA 1VQ4P 4HSTA 5E1XA 5M5WJ 1N7LA 2IS6A 2DQLA 2UWJE 4W1UA 2V9PA 4U3FJ 1WH7A 1Z0XA 1OQYA 2LVSA 4M3GA 4XK4A 1WRJA 3WGIA 4RJTA 3TO9A 3JR9A 3WTUC 5DV5A 1S72I 4HF1A 3RZDJ 3GXOA 3DEWA 4L9VA 4XN0A 2R92J 1BOBA 1OYYA 3S3MA 3B5NA 3CCYA 4TT3H 2M0CA 3O6QA 2WBMA 4IKFA 3IH4A 5DD8A 3CCSI 2CFOA 4XE5B 1MDMA 2FYUD 4FT8A 2NPSA 1C0WA 2QBYB 2OD5A 3IRQA 2MG4A 4ZTJA 3BCBA 3CO7C 3OMYA 3L72D 1B59A 2YU3A 5L3EA 1BIBA 3SJMA 4M74A 5CVRA 2XF6A 3GBGA 4XRSG 1ERDA 1JMBA 2Z5HA 5KKZB 3LA2A 1GK6A 3OYIA 3HTUA 1YI2I 3II6A 3SFEC 3T97B 3OSGA 1M8OB 5GTHH 2OTLP 1PZQA 3PUFA 2OQQA 2XB5A 3WTVC 3F8CA 2IBZG 5FD5A 2W82A 1D5YA 3E97A 2P7CB 1P92A 1CGPA 4FX4A 4B48A 3BR0A 2L0KA 2XKPA 2KT0A 1KQ0A 4ENKA 1R23A 4JYKA 2CV2A 3L2UA 4A3LJ 1FTTA 2QJKB 3PUBA 3L74G 4HB1A 1YLFA 5C4XJ 1KORA 4JF7A 3G4SP 3OYJA 3EUHA 1TWAJ 1ZLKA 2HODB 4WX9A 1QBJA 1BJZA 2KIQA 2QSHX 2K88A 4BBRJ 2XF7A 2ECBA 3PHLA 2YMKA 4RESB 2K37A 2LKMA 2JUGA 2PBIA 3HOWJ 1EZVG 3DCFA 1D0YA 1I1GA 1RETA 2HZDA 5LGNA 1BGYJ 2TDXA 1LP1A 2XGXA 1L0LG 1HWTC 5EFWB 4L5IA 2R7TA 4H13D 2JKVA 2M8RA 1PUFB 1QVUA 4D0PA 3ERED 3VYUB 3HGGA 3KXDA 3TEDA 4D7NA 3M9AA 3K6GA 2VBWA 1ZXGA 3OYEA 2M8EA 5CPRB 2MH2A 1BE3E 2EZLA 1YBKA 1J09A 2LY1A 3S9OA 3IH2A 3OSFA 3WE3A 3CMAP 3V2NA 3OYCA 1D1BA 1D7MA 1TT5B 3FHZA 2ZJRF 3I5UA 4WY4C 3CCVP 1YS7A 4RAZA 1JTXA 1L0NE 5LHHA 1VQNP 3JW4A 2E7XA 4M6VA 1GD2E 4IRIA 2ZYAA 3FX3A 3HE5B 1NTMD 1L4AD 1FZGA 1D8JA 1E5WA 2ZXJA 2QA4P 1FZEA 3TBIA 1NG7A 4WCGA 5EYRA 2FXPA 2X6XA 1SMYF 2BY3A 3K70D 2F2EA 3PFYA 1Q82Q 2E71A 1FYMA 3NRVA 1FZCA 4EMSA 3IAM2 1BR1A 1WMKA 1NU1D 3TKYA 5K7FA 1S7AA 1RKTA 5L3CA 2WSEJ 2X6WA 1K4TA 2NRAC 1VQ8P 2KYVA 1TL8A 4XLEA 4I0BA 2HG5D 1O3SA 3RQIA 2HNHA 2EA2A 3CTAA 3C9IA 5AVSB 3O8ZA 2M5WA 4CCOA 2EH3A 2DA6A 3ML6A 1IRXA 4N78D 1XGSA 2KPMA 1LPQA 2XC7A 3HSFA 3NEUA 3OS2A 2EJRA 4EEFG 1BE3G 2FRHA 2HDCA 4EV0A 4ZH4F 1NH3A 1BCCE 2KOGA 3CC7P 4I09A 1PP9J 3HEFA 4MNUA 2JQ7A 4M73A 5CBOA 4L0ZB 3L71G 5LLQA 2XDJA 3TMOA 4LIVA 2HGCA 2H94A 4KMFA 1YHQP 1GTWA 2UXNA 5JVTA 1M7LA 1IN6A 2GXAA 5L8RJ 4OWRB 2CYYA 2QQ9A 2NVUB 3H1CA 3I0TA 4IFDK 2JEEA 4WY4B 3HL2A 4LG0B 1ETKA 1Z21A 3GFMA 1D5VA 4CDGA 1H8AA 1SQQD 2JRTA 3KE2A 2PAJA 3I54A 4JOMA 4B86A 5FKOA 3KEYA 3HOSA 1FNNA 1W7PD 2QCOA 2XGEA 2K7LA 3P9IA 1NU1J 4KN4X 1Z1DA 2E7WA 5E79H 4XR6A 1VFCA 2E34A 3HHHA 3H1IE 4GO1A 4C9YA 1ZG5A 4YTPC 4TLFA 2ZCWA 4RAGA 4MEXF 2ESHA 2Y31A 4KT6A 4A3KJ 3CCJI 1YRNB 3J80K 3CXHD 2KRHA 3BTIA 1MFZA 1WCMJ 4MFEA 1FC2C 4ZJZA 1EH6A 2CQXA 2O3FA 3RKWA 4NHJA 3V7CA 1SLQA 4LK0F 1SQXE 3C2BA 2Q2EB 2QEXP 3KP2A 1GL2C 4BE0A 5KLIC 1FDMA 3S2WA 3SSUA 1O7FA 2Z5UA 2LC2A 2YUSA 2KISA 1ETYA 1SMTA 2O8XA 3DFGA 2QSIA 4XMYA 2NVYJ 3H1LD 3PO3J 2IS2A 2CQKA 4UVBA 2AXTE 1H0TB 1LE8A 1TZLA 3ZRGA 2F4OB 1SVFA 5DCFA 5CCGD 1BSHA 2CK3H 1LDKB 2OV7A 2P2UA 1ZG3A 4WXCA 4WWCA 1KMIZ 1SQQJ 2KSJA 1OJLA 2CUZA 5J8FA 3I55P 1RR7A 4EJOA 1BBYA 3C7JA 4ASVA 2YU9J 2GM4A 4P9FA 5HLIA 2FOWA 5H2FC 2LTPA 4E7KA 3HB9A 1K83J 1A04A 1AQTA 2Q9IA 3CDLA 3KX2A 2F5CA 3LSJA 4YEJA 2KS1B 2R3CA 3KP5A 3DPUA 2CW8A 4G6QA 2DK5A 2QLZA 3K9TA 5EJCA 2J58A 3H1JD 3L9FA 4EJTA 2AEMA 1GVDA 3LFKA 3W3CA 1R5SA 2DYRH 2QGUA 2XDVA 2MSYA 4XNFA 3TO7A 3VYIA 2KDOA 2V1DA 1LFBA 3CCMP 3OL4A 1CI6A 5CMZA 4Q48A 2QUFA 3PFIA 1L0OC 2EILH 3RIRA 1W0TA 4IXAA 3L75G 2RMZA 2EFQA 1DU6A 1Q2NA 5TRDA 4XN3A 3E6DA 3Q3SA 2ME6A 3G6EI 1JM0A 3I53A 5J8CA 3EWKA 4CCMA 1RR8C 2A3SA 5B66E 1FP1D 2QZ8A 1Z6RA 4F92B 1KYOH 1GL2B 3R0AA 5KLIB 2K4BA 1FSEA 1OPCA 2DYSH 3H1LJ 2HOAA 2A07F 2L7KA 2OCEA 4I6MC 4NPDA 1V4RA 1YTYA 1U8BA 5FLXZ 5APYA 4DIQA 5AVTB 1A02F 3FDYA 2C9NY 4CICA 1T33A 4D6TD 5M5XJ 4WXDA 2M30A 2WY8Q 1WT6A 1UCRA 4PCQA 5AVYB 4U88A 1SS1A 2PGDA 2X6OA 1YW9A 5FGMA 2DPDA 2XV4S 2EB7A 3ESWB 3P8CE 2WITA 4MN4C 4BBSJ 3I56P 2BYVE 4QLCU 1G4DA 4DZJA 5E3OA 2WWWA 4LMYA 3I4NJ 3HZJA 5EZGA 2KXPB 2DMQA 3MUDA 1YYVA 2VBYA 3OYKA 1IJWC 3KFWX 5K1YA 3H1JJ 2WTEA 2R44A 5CCHA 3CD6P 5FKKA 3SHFA 3CMYA 2R7QA 1EZVD 2COMA 2AXLA 2LKPA 1NTZG 1IXRC 2DPUA 4WBAA 2NAZA 5AIPA 1U6GA 2JT1A 4YFKF 1PP7U 1MSFC 1L0LD 1OW7A 1B72B 2GBYA 1SQBK 2M7BA 3BRVB 5GTIH 2EZHA 2LG4A 2Z3YA 1V3FA 1VQMI 1KB9I 1WJEA 1BR2A 1JKRC 3PNVA 1KB9E 3NXSA 2XV5A 5CCGC 3HRMA 2J59M 2TCTA 5B5EH 2PEXA 2I5UA 3TGUE 1T98A 4I6ZA 3S1QJ 2CFXA 1VPCA 2HPMA 4BRYB 5E20A 2AO9A 4QSHA 5CVVA 1JUPA 3D5LA 3PRJA 1OMIA 5HDGA 1QGPA 2D2CD 1OCCH 1FOYA 2H8RA 2EQRA 2Y0SA 5HODA 4ZTFA 1AKHA 1ZV8A 5IT3A 2POHA 5HLTA 2VJ4A 4D6TJ 1ZGJA 3OYMA 1KILD 1ZRTE 1CW5A 2BBYA 4XLAA 1POGA 1W7PB 3SDBA 2JA7J 4AVZA 2IS4A 1QHHD 5BU5A 1VTNC 5AONA 3KPEA 1SQBJ 1DU0A 1RE4C 3CMEI 2LRDA 4IJAA 2YNYA 2QJYC 1EV7A 4BHCA 5K7ZA 2I8DA 3RCOA 1FZBA 2CQQA 2RAEA 4W97A 5F0CA 3UKGA 2PMUA 3FKJA 4HW0A 2N9YB 3BATA 3W6VA 2HXIA 1QA6A 3RK3D 3GTPJ 2GXGA 2OZ6A 3KZIC 2BXYA 1S7OA 2W27A 4Z2YA 2LBFB 4MGRA 3AE3C 3BG6A 2ZSIB 4HAMA 5BQTA 2QM7A 2DW4A 4A3IJ 5AVQB 2BCCJ 1BW6A 3QRFF 3I4PA 2KHMA 4LG3A 3S2HJ 2X0LA 4KDPA 3K2ZA 3AE8C 1XDUA 5GTHE 2EIMH 1XB4A 3CP2A 1NHLA 3DLAA 1OR7C 3OYGA 2B7EA 3H35A 4CYDA 1BDDA 3I58A 4A3DJ 3P32A 2Z99A 5DCMA 3K4NA 4H0LD 4DOJA 1JJ6C 2MD0A 5FKLA 4AVPA 1MNMC 1G2HA 5IT9Z 2G0EA 3L71D 4ZDPA 3R4YA 3PSIA 2E74D 4HQEA 1T38A 3TOAA 4IHYA 3QYEA 1NKZB 1Q90D 3IUOA 1KU3A 1USDA 1WRGA 3GLXA 3K10A 4EGZA 1FOXA 3L73E 2KUBA 1CF7B 2EINH 1OVUA 1CZQA 3HOVJ 3MTUE 2QM8A 2HQ5A 1GU5A 1OVRA 3GF3A 5EEHA 3A01A 5J3LA 4B44A 3RL0C 2B87B 1X3ZB 3TOBA 1ZELA 2N8GA 2P5LC 5LRSA 3M9QA 3D0SA 4WB4A 4DCKA 1X58A 4MLOA 2KK7A 1SFCA 2KZJA 2V1XA 4CH7A 2HODA 3JTHA 1SEUA 3G1MA 1OX3A 3RGUA 1JHFA 1R00A 3H25A 4U3FG 2A6HF 4U7BA 4BY1J 5H20A 4UUSA 3O2PE 3S8PA 1FBSA 2YO2A 2K85A 5DEQA 4GOEA 4K35A 3RBXA 2BZTA 2F6CA 5DM7F 1JY2N 1PV3A 4YXDC 2D2CC 1EJ9A 4CPGA 4A12A 2ZMEA 1IFDA 5CQGA 4O3MA 3GTQJ 3GMAA 4C2MJ 3L7WA 1F4KA 1VF5C 3CUQC 2HPCA 2FYUE 3B6AA 2JA5J 2OTKE 3GHGB 3CP8A 3TSIA 1USTA 3RYRA 3LIEA 4DYRA 1EF4A 4KJZA 1U9OA 2OA4A 4OU0A 2TRTA 3HD7C 3L72E 4Y28J 1EDLA 2RN7A 4S05A 2AEJA 3KP3A 2H7HA 1LT1A 3MQ0A 3QWLA 4GKGA 2VQGA 4Y4RA 3BOQA 2A61A 2KRCA 3V7RA 2LF8A 4NC8A 3CDIA 1ZGWA 3I64A 3RK3C 5L3GA 1S4XA 2GUSA 3DBHB 4P5OA 3HE5A 5JLXA 4BDYA 4GYIA 2Y0EA 3J81Z 2ZXHA 2E1NA 4DQ2A 2QIWA 4C46A 4EJUA 1QU3A 1MZ9A 4EVIA 2FY8A 5TJHA 4P55A 2M45A 4OMZA 4DYQA 4ZYGA 1AWCA 3BQYA 4HV6A 2MLGA 4BHBA 2JRMA 3HTKA 1RF1A 2A6EF 4PD4D 1B8IA 5KJ7C 4P1WA 4A3FJ 1J9IA 2P58A 4H0LC 5FFZA 3K4LA 4M6YA 2NXNB 3FXDA 4OWFA 1XTAA 1OCRH 3SZTA 1DEBA 3KCCA 4LLGF 3OL3A 4ZYAA 3RBZA 3GO5A 2XAGA 2E74C 2YKQA 1BGYG 1FOSE 2E42A 3J7ZI 2CSOA 3GZNB 4Y3OA 3HDDA 2DODA 5LRRA 4B47A 1TWGJ 2D2CB 2BVLA 1QZEA 4Y7NJ 1HW5A 2UWMA 1FMWA 4ZDOA 1Y1VJ 4AYBA 2MC4A 5DD4A 2FD5A 1T8ZA 3CUQB 4P9UA 3H1KD 1MFTA 1TWHJ 3A0BC 1RKWA 3G1OA 4C3HJ 5KAIE 4XKVA 5ICGA 2HKOA 3HD7B 2XAJA 5J6XA 2L7FP 2IXSA 3CCUP 1S5LH 4I76A 2AS5F 1NHAA 4CCNA 1G3WA 4RM3A 1S2EA 3S17J 4LG0A 2MGQA 4ASNA 5ERIA 3AE6C 2HZTA 3MKYB 1IO4A 2R7UA 3RK3B 1Z91A 1X22A 5E79E 5CLSA 2L01A 1TBXA 2CUEA 4DGWB 1WI9A 2QYOA 1LB2A 2M34A 3FISA 4CZZA 1YG2A 3RZOJ 1J1EC 1FDIA 2ZNZA 4L76A 1J2XA 4BUPA 1IXCA 4M9XA 1NTME 4YFNF 3GLMA 2WPQA 1T2KD 2F5FA 3QPSA 2YX4A 3HTSB 1FZFA 4AC0A 3HUGB 4UV8A 3F6VA 3ZR8X 3OYDA 1IF1A 1DPUA 2KI7B 2PP6A 2KNCB 3L70J 4B1RA 1R6RA 2EFWA 3GLLA 4H0LB 3MEXA 2FMYA 4UB8C 1GW4A 1YRNA 4GIFA 1NU1E 1M1JA 4RB0A 4G6TB 3SFZA 5F04A 3BRTB 2MW8A 1VQ9P 2E74B 1MMSA 4A3GJ 4XKWA 3U1CA 5F08A 2M0BA 4XSZF 3S93A 4UB6C 1RUNA 1ZW0A 3BCCJ 2E76C 4N78E 3H1KJ 4IQ4A 3WUTA 4BE2A 5BVZA 1PP9G 4Y99C 1JT0A 4C7RA 5M3MJ 2J5UA 2ZXIA 4H44D 3OAKA 2P7JA 4KJMA 2IZ0A 1H0TA 3SDGA 1JY3P 2KIMA 3WODF 3RPQA 4QMAA 1YI2P 4OAYA 3FXOA 2B63J 1ZOYC 3FXUA 3M8EA 1N73C 1LQ1A 1IUFA 4F93B 2YS9A 3GTLJ 1JCCA 1X9VA 2EV0A 4IL6C 1OWAA 2OF7A 2AXTH 2D5VA 1IXSB 4AQRD 3GTJJ 4Y15A 1BM9A 4RLQA 3E3VA 1MBEA 1J1EB 3V2QA 3L2RA 1UIXA 5GP9A 5A2QK 5D5XB 3IKVA 3PIPF 1GHCA 1KQ9A 5JI6A 1NU1G 4JYBA 3ZDMA 1E3OC 2M5AB 1J7KA 3CDHA 1H88A 1KYOE 4XOTA 3CLOA 3A03A 2H27A 4OINF 1TW3A 3AEAC 2H88C 3OYHA 4W80A 3CXHI 3R61A 1N75A 1X1PA 1U8RA 3CXHE 1W36C 3HPGA 1KTMA 2VRSA 3JAMZ 2E1OA 2E76B 3C8VA 1L4AA 4BS9A 4BXXJ 1N86A 4Y99B 1AFOA 1VQLI 2K5CA 4FETA 2VBXA 3K4MA 3AG1H 2K1AA 2HS5A 3L4FA 3RYPA 3WGGA 3EYYA 3BY6A 3H1LE 2H09A 5F64A 4L5EA 3SQNA 5B1AH 2EFNA 2FFDA 3CCEP 2YKPA 1X19A 1J1DC 2A06G 1SQQG 2IP2A 1X1DA 3LSMA 5E3MA 1ZREA 4X6AJ 1SQVK 2OYIA 1N73B 4DW6A 1RE3C 3LSPA 1IN4A 3H36A 2LLKA 2IZ1A 3AEBC 1HKQA 3BDDA 1X1BA 2DQRA 4U3FD 2DFIA 2QVOA 1S7EA 2WTYA 1J75A 1KFNA 1YX3A 5HDKA 4PJJA 2EV6A 2WAQN 4IOCF 1NGMB 2A45G 1PDNC 2QKMB 1B72A 1OXZA 4CZCA 3H1JE 1KQLA 2A5WA 3F72A 5KHDA 3WHCA 4XIDA 2WSSH 4BH9A 3JRDA 4IHTA 1ZTRA 3LSTA 4KIFA 5D5UB 1P84D 2W00A 1KQFB 2ELHA 2B9BA 4BL0B 2E19A 2AQFA 3CC4I 3T8RA 2ZXWH 2L7ZA 2G7UA 3L37A 1QO0D 2VQCA 1VQ5I 1RY3A 2PLYA 2IGNA 3FBNB 1E17A 4OIRF 1DD4A 3CX5I 3HIFA 3B8EB 3MD0A 2O61A 4GOFA 2E75C 2ZB9A 1M1KQ 1YJWP 2WV0A 4E7LA 1XTCC 1G8XA 4YIIA 3AKZA 2L7MP 1KB9H 3H1LG 5AVZB 2VT2A 3DV8A 2HEOA 4EJVA 4IQJA 4JX4A 1LJ2A 3FMSA 1W7PA 1VQ6P 2R3SA 2R7ZJ 1MUUA 3TDUC 2VKVA 2IBZE 3E7LA 1SQPK 2Q5UA 4GODA 4JBAA 1B1BA 5GAGJ 1UAAA 1BOAA 3C1DA 1J1DB 4D7MA 3QPTA 4I02A 2LDUA 3S32A 3CWBJ 3QU6A 2MYSA 1MJBA 3KYCB 3L74E 4PSXA 4WY4D 3D5RC 3S15J 4M72A 1YTZI 4JK1X 4XL9A 1F1ZA 1XC5A 1U7JA 1EDKA 3H1JG 1Z67A 2G7HA 2LKXA 1MBJA 1MBKA 2DA2A 2Z16A 1O4XA 1PGOA 2IEKA 2EZKA 3DPTA 1SD6A 5JFRA 3WTYC 5JLWA 1BGYD 1EZVI 1GXQA 1S9KE 2Q1ZB 1EZVE 4HA8A 2QQ8A 1S5LX 2DMTA 2DT5A 1U57A 2ZVOB 1RF0C 1SP4A 4H44B 1YIJP 2B9SA 4FASD 1YITI 1JKOC 2H1KA 1L0LE 1BI0A 1QHGA 2A68F 1ZLJA 3RI4A 2OZUA 4LITA 4IRGA 1HDDC 2VPLA 3A1YA 5JHUA 1KYZA 2BHZA 4BJ6C 3P7KA 1HSTA 3QPHA 1URQC 3PQJA 4EQQA 1Z6TA 2DU9A 3ZMDA 2L2OA 2WB1N 4E7IA 4HH2A 4GRIA 1HVVA 3MD2A 3E0JB 5DJUB 5J1YA 1CF7A 2EFOA 2E75B 2QSGX 4J00A 1W5TA 4YXWH 3CJNA 1LT9A 3A0HC 2FQ4A 2OYOA 5KLVK 3V8LA 4D6TG 4EYYQ 3PO2J 2RGVA 5EGOB 3VB2A 2ZKZA 2X1CA 1UFMA 2CH0A 1KILE 2HKXA 2X48A 4RGUA 2XB0X 1D0XA 1UG0A 1NYHA 4J19A 1SQBG 2IGOA 2Z9OA 3JCUE 1PUEE 3MAJA 5KAFE 4DZPA 2KRFA 1B6AA 3VP8A 5GPAA 4S04A 2ZJQF 4J01A 1E79H 1NWQA 1LVKA 3IP4B 1E2XA 4XRSA 2CW7A 2VXZA 3WTXC 3OS0A 3K7AJ 2XAFA 3OIPA 2GOXB 3U1KA 2CQ7A 1IJDB 1TQMA 1X3UA 3VYTB 2Q3EA 4BU2A 4D1QA 2YXRB 4PK4A 2BCCG 4M3DA 2FBIA 3ZMUA 2LKSA 2NOJB 4OOIA 1NTKK 2H8PD 3BT9A 3GHGA 5BU8B 5KLVJ 3LL7A 4LIUA 1T08B 5EG0B 2HDWA 3KLOA 1WVRA 3K1MA 1AOYA 1PP9D 1LNQA 1MKMA 1D1CA 2E36A 2ZYDA 1MBGA 3DKYA 2W6BA 1W4MA 2XUBA 3ASNH 1URQB 5DUKA 4M3EA 4I7ZC 4Q4ZF 1U9NA 3L71E 1RH5B 1X0TA 3HOTA 4LB5A 1A5JA 4UNOA 3H32B 1LWUA 5LHIA 5M1BA 3IWFA 3OYAA 3WUVA 4KHXA 1I39A 1VQ7P 1GL2D 1T0FA 3HUSC 4EOTA 3BZCA 4YIRX 2UZKA 3HJEA 3G71I 2QRXA 4G9YA 3DTEA 4LFUA 1Y39A 2V6EA 1NTKJ 2Z2SB 2K9QA 2M4KA 4BEHB 4HNTA 1UHSA 5IYBJ 1V5EA 1TP4A 3I5CA 3D1NI 2HXOA 1AU7A 3KLNA 1RI7A 5ILVA 2OUMA 1VQPI 4OMYA 4FE4A 2JSPA 1LDDA 4GGGA 2QJPC 1Y6IA 5TISE 3R2PA 1Y9BA 2PFBA 3FXJA 3ONQA 2HPIA 2E60A 3TNUB 4I99C 1S5LE 3OR2C 2DAOA 1FC3A 3ZCOA 2X51A 4DJAA 2X85A 2PJRB 2E5YA 3QH9A 2P6TA 2VI6A 1AVOA 4Z1MH 1YJ9P 2QENA 1MMAA 1WHUA 1KILA 4KN7X 1VQMP 2IT0A 4OIPF 3EUKL 1A36A 2DMUA 3Q0UA 4C7NA 4JX5A 3S1KA 3QP6A 1Q81Q 4R1HA 1Q86Q 3OYBA 2W6AA 4XONA 3R60A 2WSEH 2D2WA 4M3FA 3DXJF 1Y0UA 1VQKP 2RREA 4UV9A 2NYXA 2Q0OA 2IGMA 4I7ZB 3BTLA 3A7OA 1N77A 5AW3B 1RZ4A 2A06D 1EH7A 1JJ8C 2EA4A 1HGZA 5KAIH 5KVRA 3LSKA 2K9JB 4N0BA 2WADA 4AIKA 1K7AA 1N25A 1G6NA 2MLKA 3HUSB 2FMLA 2ZJSE 1HKSA 2W24A 5FLMJ 2A5YB 1X2MA 3HSEA 3F21A 3K4KA 1OIPA 3QYBA 3A3YB 2O6GE 1JUSA 4MO7A 3GTMJ 2BW3B 1MJ9A 5F27A 5KLVG 1UELB 1I5ZA 1HOMA 3AE4C 3CCLP 3FXQA 1CSBA 3H5AA 3VMZA 3VOPA 2R5YA 1QQIA 4PD4I 2DBBA 5AVRB 1AVYA 2LR8A 2C9LY 3Q5FA 2JUCA 1XGMA 1H0MA 1LTJA 1VQ4I 1KZUB 5AW2B 1D3YA 3ECHA 3DKXA 2EZIA 1LFUP 4RAYA 2R5ZB 1K6OA 4O6JA 1FDOA 3DU6A 1FU1A 2DA1A 2QWWA 3D6YA 2FEZA 1A02J 3KYDB 3L75E 2VOOA 4PJNA 5CVIA 3ERMA 1VQOP 2HYGD 4CO8A 1R9TJ 2HYNA 4BNCA 3H9JA 4G7OF 2GZWA 2WPRA 4C2TA 2DTRA 4RBOA 4RA2A 2OARA 4G8XA 3HM5A 4CA0A 1VDFA 2Y0DA 5APVA 1IGNA 1GMJA 3JSPA 3M8JA 2HYJA 3CL3D 4ON0A 2CS3A 5IYCJ 1YJNP 1GLNA 2PMZA 2CWEA 3S16J 1EDJA 2WAEA 4WK8F 3E1SA 2JZYA 3FMQA 1QVGO 1Z7LA 4CCLA 2Y75A 2O03A 3L09A 4M3LA 1MNEA 1TC3C 4ENMA 4HNVA 3ROUA 2KIKA 3EQ2A 4L74A 2VT3A 2OTLI 3VYRB 4K3AA 5FKMA 3LAPA 1Y47A 2JSCA 2OJED 3TO6A 1UHWA 1QL1A 4IFFA 1JTHA 3BLYA 3WTTC 2JVGA 3RQ4A 1W2BO 1JMMA 2M5AA 1DH3A 4HLXA 3EQLF 5J47A 3CC2P 1UZCA 2W90A 1W5CE 4ESFA 3L70G 3CUOA 1AA7A 1XMAA 1TLHB 3V8KA 1ETWA 3KEQA 1B9NA 1NTZE 2XGCA 1HJ0A 2W48A 2Q6QA 3I59B 1NAFA 2K4JA 4R8HA 3H6PA 3G4SI 3PSFA 4A3JJ 3ZXSA 4HF0A 2DDAA 2HVRA 3WU2C 3C2HA 1K78B 2KB7P 3CX5D 3LWFA 2DFHA 3BCCG 4ZNCA 3H1KG 4LGWA 1ORKA 4N9HA 3MKLA 4AUWA 1QEXA 3CCRP 4NPFX 1HUCA 2OTJP 1NOHA 3WTZA 3K4JA 1W0UA 3D6ZA 3IRRA 2ACJA 3AL0C 2Q1KA 4PJ0C 2P1JA 2YPRA 4NQWB 1U0JA 3CF2A 5DTDA 1VL2A 1FS0E 4N3YB 4EM2A 3RDIA 3CXHH 1R5LA 1RIOH 1EQ7A 3N05A 2ESNA 2KZIA 2HLOA 2LNBA 4O5VA 2V7QJ 3IHUA 3QYFA 4II3A 1USEA 2JJLA 2E43A 1SQBD 3GF7A 5GPCA 3FM5A 3CMAI 3E6MA 3WE2A 4A93J 3TK1A 1M57D 2GUVA 1SFEA 2WT7B 1V5GA 1ZR2A 3BG9A 4ZYHA 3CCVI 2LSOA 2GLOA 4OGQC 1JXSA 3HOUJ 1R1VA 2L5GB 1VQNI 1FLIA 2JDIH 5E1WA 1XPXA 2SPZA 3RL0D 4L73A 2LOOA 3CCQP 2IBDA 1BN5A 1OW8A 3USSA 1IK7A 1FYLA 3H3VK 2BCCD 2BV6A 3ZQIA 2QA4I 2CPSA 2IFNA 2Y48A 4F52A 4L18B 2NRGA 3FWNA 2JJ7A 3M7GA 3HKZA 2K3PA 3WTSC 2QM3A 2M3BA 5LD2C 2X6YA 3LFUA 4XRFA 3A02A 1XSXA 1GVJA 2YMYA 2A05A 1VQ8I 4ESJA 3ZQHA 3EYIA 2V9KA 2P67A 1U7MA 5FLXK 4CYCB 2PN6A 2HTJA 3BR6A 3JRBA 3REOA 4OIOF 3B5NC 2NNYA 3AL0B 1T2KA 1VF5D 1JOCA 3BR1A 1NKNA 3K69A 1BJAA 2NPSC 1MMDA 2DCEA 3Q5PA 1J0RA 3CC7I 1BC8C 2R7VA 3JSVC 1N73A 3HD7D 2E1CA 1IV8A 3KZIH 3PTZA 3CX5H 1O3QA 5APWA 2M3EA 2O8KA 1D8KA 3H9QA 5CVJA 5GTIC 3UIAA 2WZ7A 1B4AA 1G3TA 1QNTA 2DDBA 1YHQI 5FRNA 2ME0A 1W2EA 1EH8A 5B5EC 3LSRA 5ICEA 4U3FE 4OGQB 2FNAA 2ZFWA 4N6JA 2LREA 3AEDC 2JVHA 1QGKB 1GT0C 1H89A 1D0ZA 3M0DA 2F4MB 4AIDA 4BQAA 3MKWB 1FE6A 1HQCA 2M7AA 2ZT9D 4HDUA 2RVCA 2QBYA 3SWYA 2V79A 5KK1A 2DJIA 2EFPA 1LKXA 2LY2A 3OYLA 2QVAA 2LYCA 3MGNA 2CMPA 4O9BA 3NFQA 3GW2A 4P96A 1P84I 5KJ7D 2DFFA 3TP0A 3EUHC 2V7FA 5LGUA 2O7OA 3R6SA 3T97A 1HJBA 1XMXA 2H8WA 3G73A 1HW1A 4F3QA 2CQNA 1SQVG 4M3BA 2EWNA 3ZMVA 2Y0MA 5D6EA 1IAWA 1S6LA 2ITAA 3AE1C 1IDZA 4AYCA 1Q1VA 3FXRA 2K9NA 3T0YA 1JGGA 2N9BA 3U59A 3GTGJ 1K05A 2VE8A 1L2PA 1A6IA 3B5NB 5AW0B 4LOCA 1P6RA 3O6QB 2BEZF 3S3OA 5AVVB 2QEXI 5CKTA 3U1DA 2NPSB 1HBXG 1YS6A 3P9KA 4I01A 3IWZA 2R7DA 2IVMA 2HI3A 5EF6A 3CWBG 2HYFA 1BIAA 1LVAA 2CV1A 4YPCA 5CJ9A 5C44J 4G7HF 1YQ4C 3CESA 1BA5A 2K40A 2QJYB 2ZAEB 1SD7A 3AEGC 4IFMA 4BWNA 4ZKUA 1YQ3C 3HRTA 2I1JA 1S8NA 2KJCA 2DA7A 4TV7A 1I6XA 2KMUA 2KZGA 3GCMA 5HLGA 2OYHC 1G1IA 2MA3A 2K9LA 2FKWB 1SVMA 2WAFA 3I55I 1PUFA 2DK8A 2FXAA 1Y1WJ 3JCUH 1WSUA 1U5TC 1DQUA 4IX7A 1FWZA 1GZLA 1PIXA 2UUZA 5FKNA 5KAFH 1TNTA 5D5VB 4GDOA 5EG0A 1BGYE 4KFCA 2GQQA 1L0NK 3CO6C 1Z56A 5L3FA 5IT9K 3I71A 2AEFA 4I1LA 3MZ8A 3HG9A 1FZCC 2WSCJ 1SQPG 2Q7CA 2O0YA 3FZVA 3KYQA 3K1PA 1FT9A 4G6DA 3CCMI 3H3UA 2VB6A 4HYEA 4F7ZA 1BSNA 2BY2A 3H9GA 1IN5A 3H32A 1YIOA 1DEEG 2Z1DA 4MTEA 4RAFA 3AG4H 3GFIA 4RGSA 2R4GA 2FF4A 5L3BA 4E7HA 2E5NA 3WG7H 3TQNA 3U21A 1LP1B 4B09A 1STZA 3HOZJ 5IY5H 2E76D 3H1HD 3HRNA 2COBA 2VOPA 2FNPA 2R7RA 3BZ6A 3Q2YA 1JY3N 1LTBC 3O3KA 2O3JA 2OU2A 2ZT9C 3RL0B 3D5SC 2DMPA 4BEHA 2O01J 4XA4A 1UIIA 1QZZA 2Y30A 5HS8A 2GOMA 3ZN0A 4BJ5C 1HKTA 3MKZA 1L0NJ 3LW5J 3BC8A 2N1TD 3W68A 2G8YA 3LOCA 4WXHA 4XOPA 2FBWC 3L70D 5APQA 2UXXA 5JVGF 4B43A 2VASA 2R7SA 3Q9SA 2OYHB 3A0BH 3I56I 3KIOA 3HGYA 2IGKA 1H8AC 1IV6A 2RKHA 2W4SA 4IHSA 1E0EA 4QPQA 4PGGA 5BMZA 3J7YJ 1IW7F 1U5TB 1U3EM 2K3FA 4ASWA 1K61A 3BTCA 3BCAA 5EDNA 3ZPLA 3BR5A 3PJSK 1PVEA 1VF5B 3BCCD 4M6XA 3V2RA 1NH4A 3CD6I 3FXEA 4JX6A 4PGHA 5KCMA 2P8TA 2WWYA 4KYWA 5TISH 4BYYA 4IRHA 2GIVA 3GZ5A 1RHZB 1GK4A 1PP9E 2LMDA 4ABZA 4ZZDA 1IZ1A 1SAUA 1R49A 1PGPA 4HKZH 4HF2A 5CJ0A 4WY4A 1B9MA 1LJ9A 1SD5A 3RSNA 3J81K 1IRGA 2PI0A 3L2WA 1BCCJ 4F91B 5IP7J 1W36D 5KNLA 3H1HJ 2X1EA 3AG2H 1HC8A 4NDLA 2GWRA 1NAYA 1DPRA 1XTGB 4DOZA 4PUSA 3K1NA 4XLPF 1Y8QB 1FJKA 2O01N 3LSIA 2DOEA 2ZT9B 1IFMA 5GAEJ 5F6FA 3DTKA 4FE7A 4ENJA 1NTKG 1H9TA 4HRIA 3MZWB 2XSDC 5KTBA 3OR1C 2RQQA 2JA2A 2LP0A 1SQXK 2XNDH 1MZBA 4EATA 4UB6H 2JMWA 1WWXA 1FJPA 3MZYA 1S72P 3AEEC 2V1UA 2Y9YA 5ED4A 1ZAOA 4HZFA 4BJTA 2JP3A 4OIQF 3CCSP 1F43A 3HPHA 3PJRA 1M56D 1I3AA 3DPLC 4RM2A 2Q2EA 5H2FE 1QPMA 4MTDA 4NUBA 5HNFA 3Q5RA 2X9DA 1ZYRF 4PD4H 2VKHA 1R36A 5CVUA 3PQKA 3H1IJ 2MH9A 2DJNA 3FGAD 1WGXA 5DM6F 3B71A 3JTGA 1KU7A 3GX4X 1ENHA 3F22A 1X8YA 2K86A 2WSFJ 1PL5A 4IL6H 2ELJA 2BY0A 2R7OA 4AIJA 1HF0A 4U87A 4U7DA 2CV0A 3OOPA 2XAHA 4D5CA 3CLQA 3LSGA 9ANTA 2FU4A 2N1TC 3SFIA 1SQXJ 4ZC3A 3HE4B 4UUVA 1G3YA 3L2VA 4IHXA 1IFJA 1RC9A 4EM1A 4E7ZA 1SAXA 5FLVA 1M90Q 3UNGC 3CJQB 1I27A 3JRAA 1G59A 1NTZK 3SEQA 2A06E 2E75D 2D45A 3EFGA 1SFXA 1SQQE 2KS1A 3K0LA 1FY7A 5AW4B 3WUUA 4HQMA 3JREA 1OCZH 2WA0A 2WMMA 3TL4X 3BJOA 2D1HA 1V54H 3ZP5A 3VFZA 2HOEA 3GW6A 4HPQA 2XASA 5ILUA 2A45I 3W2AA 1EXIA 1PFIA 3GTOJ 1X3WB 1LE8B 5BPIA 1YW8A 2YXQB 3BQZA 4HG2A 3VSKA 2ZSHB 2ID6A 1K04A 3AFHA 2KIFA 2STWA 3MN2A 2L54A 3ZQLA 2NOGA 4PV1C 1RUOA 1RESA 1DP3A 3N4XA 1NJIQ 2ZVNB 3VDXA 3C18A 1JCDA 3A0BE 2M3AA 3N7NA 2IW5A 2JA8J 3VYSB 3MUDC 1JB0J 1ON2A 4UXNA 1AA0A 4IOIH 4ESBA 1GL2A 3F0CA 2PFXA 2Q8KA 2ZXXA 2PX9A 3QAHA 5CCHC 1O57A 1SQVD 3BASA 3ECOA 3FKIJ 1I6HJ 5DDGA 4MEYF 1ZN5A 3F8BA 4LLHA 4A5MA 2Z33A 4L9NA 5JR3A 3V5BA 2AXTC 5CYVA 2L9SA 3AE7C 3BG5A 1APLC 3B73A 3IC7A 5EEAA 1R5GA 1OCPA 5M3FJ 2HFHA 1WPKA 2DA5A 3MZHA 3H0DA 1R1TA 2M1BA 2W7NA 1URQD 5BNGA 2N1TB 1XD7A 2XIGA 4RDUA 3M9BA 1N2DC 4WWIA 2K3RA 2RN0A 3CWBD 1OLTA 2R93J 5HDNA 2V6CA 1SFKA 2A6TA 4GDFA 2MJZA 2Y0CA 3E1IA 1YX5A 4IVNA 2YR2A 3E5QA 3BPXA 3S4RA 3T5XA 1ETVA 4RS8A 4B3AA 1RQUA 3A5TA 3BWGA 3C3WA 3HRUA 1QX8A 1LFPA 5TGTA 1UG2A 2JPBA 1I3QJ 3BG3A 4KITB 2XU6A 2DLLA 3BPVA 4DNCA 5IPAA 3VMAA 2RV8A 2VC1A 2HDDA 3SZPA 3D70A 1ZKGA 3TGNA 2ZYGA 4UVCA 4FTHA 2IPPA 4BRYA 3PM1A 2Y0SN 3SWFA 4PV1B 2HPCB 3JAMK 4HSRA 1MH3A 1T39A 3B02A 3MP7B 4XLHA 1NO4A 5B66C 3DQVC 1SQPD 1XX5A 2L02A 1SQVJ 1RRJA 3KZIE 4LLNA 1N8RQ 3H3ZA 4RB3C 4IO9F 3GEZA 3FXMA 2ID3A 2QQBA 1LGHB 3CX5E 3OA7A 4DT0A 2AQEA 4RLFA 5H6RA 1TT0A 5E3NA 3OYNA 1LUJB 1ETXA 3BG7A 3DWLE 3LMMA 3W67A 3TGUJ 3K2AA 3FIWA 3KDPB 2L9RA 3FX0A 1YW7A 3JC22 3JRGA 2YKOA 1CQTA 1ZN2A 2CRGA 4D6TE 4A69C 4IHVA 2FBKA 2P4WA 1FZPB 2XRLA 4XORA 4CXFA 2DT6A 4RB2C 4A3BJ 4XICA 1JO5A 2DI3A 3CCUI 2VQLA 2W25A 4U0VA 4V2FA 4V19K 2L91A 1KV4A 1HH0A 3ABKH 1SQBE 3SWKA 3ABVC 4B3XA 1ETQA 2LBFA 5JHFA 4CHUA 1J2JB 1IFPA 4R4MA 3DTIA 1AKHB 2IYPA 3FXLA 4A6DA 4L9JA 1YO5C 2IA2A 4JQFA 1MH4A 1VNDA 1PPJG 1SVOA 2FYZA 1IRZA 2V26A 1MJAA 3DBLB 4ZDLA 4BKXA 4BQNA 3NWTA 2GIZA 3H5RA 1BI1A 1SFCC 2BCCE 5KLVD 2H1LA 5CCGA 3CCJP 2KSEA 2RQPA 4Z6YA 1XGOA 2OBPA 5FB2A 1DUXC 3BROA 2LXBA 1SQPJ 2ZXEB 3A0HH 1WQ2A 5L3DA 3KZYA 4V2GA 1R5ID 3OWTA 2XAUA 1T6SA 1WH5A 2F5DA 4BHPA 1JE8A 1DDNA 3M07A 3O8GA 5B3SH 2O1KA 1VZ0A 1VQ9I 1KQGB 3AE5C 2BOLA 4NC7A 3GZ6A 4DZOA 2ZMEC 1P84H 3IR9A 2P5VA 1JKQC 4EM0B 4YRVA 3PL8A 5IYDJ 2B87A 3NMDA 2M9HA 2KJBA 4Q47A 3P5JA 3ASOH 1EC5A 4E4HA 1KGSA 3O8HA 1P4AA 3GUDA 1LTIC 1WI3A 1RE4A 1PGJA 3OV8A 5DCMB 1FSHA 2C0XA 2BXZA 3ZMTA 1NTKD 3F9KA 3ZQFA 2AXCA 3L73J 5K5GB 2VODA 2FYUK 4RMNA 2MKVA 4RKUJ 2EPFA 2B89A 4YIFA 2CUJA 3HXLA 1JUMA 1IC2A 2MD5A 5AVWB 3RK3E 2NS7A 1MIJA 2PRRA 1T8IA 2JR8A 4AU7A 2FXOA 3AE9C 3VWBA 2BEQD 2CPBA 3HC7A 4IL6X 1OCOH 1E3HA 2BE5F 5GTHC 1FBMA 1K4SA 1MBHA 1HCRA 3GWZA 3A01B 1OR7A 5AVUB 2F5VA 1HSJA 1Y56A 1AHDP 3V42A 3Q1MA 3EETA 1SFCB 3CI9A 2XRNA 3LA7A 5APSA 3OY9A 2JN6A 3V4WA 1RF1C 3DEUA 3OOUA 3G6EP 3BJAA 3OS1A 2V4JC 3E5XA 4OVNF 3V2PA 1SVLA 1TWCJ 2H89C 1FOWA 1OYIA 3M1CA 4UUSB 2DXIA 2K27A 3QOEA 2GAUA 1MV8A 2O5RA 3OIQA 1WJCA 2FYUJ 1DGRM 3F5HA 2VKEA 1JGSA 1R4MB 1JT6A 2MBFA 2OCCH 1QL2A 2ZMEB 2E2IJ 2W8ZA 1Y8RB 1N78A 3L72J 3OJAB 3OW2O 3RPUD 4G94A 2W84A 3L35A 5D5WB 4PZJA 3QODA 2CO5A 2K9SA 1QVTA 1QRYA 1WJBA 2KQRA 2W1OA 3CMMA 1KZHA 4B4CA 2VJ5A 5LBQA 4D9JA 4U0YA 2NZ2A 4HX4A 4GXOA 1HA8A 3CJRB 5FFXA 3JRHA 4R79A 2E2HJ 1EXJA 2VLAA 2PJPA 3P7NA 3CCEI 2OYHA 4AYBN 3S1NJ 2IFMA 2P6SA 2Q3IA 2E5ZA 1ZG1A 2VBZA 2Z5IA 1EDIA 1U5TA 2IYOA 4UVAA 1R5HA 3F3XA 5D4RA 1OVVA 3V6IA 4E7SA 1FOKA 1AJYA 3CUQA 3MIWA 3KHUA 1QLED 3TDKA 1ZHFA 1R7JA 3FWEA 1SD4A 2WY7Q 4G7ZF 3M9HA 4Y17A 3MWMA 2KP8A 4HX7A 3HD7A 1RF1B 3HTKB 4HX8A 4QTRA 1OYWA 1ITYA 2W6JH 2M0MA 3F23A 2F4IA 1YOVB 1B8IB 4HJGH 4ZYDA 1SFUA 4PDKA 3KEOA 4MFDA 1NTMK 4UB8E 1EKEA 4CCJA 3ISPA 4U0WA 1IK9A 4LB6B 2HVSA 1ZGAA 4RGRA 2VKDA 5LEJA 2BVMA 2ZNYA 1M1JC 3QWOC 5HOOA 1Q1HA 1RPWA 1MNDA 1ONVA 2D1VA 5ICCA 5LGTA 2FA5A 3G1LA 3J80Z 2K9MA 3F6OA 2K02A 3GFJA 4UB6E 5K5RA 1NU1K 2Z4EA 3FMRA 3H1HE 3LQRA 4HBLA 4F55A 1YJWI 4X1EA 3IAS2 1OW6A 1N7SD 2QG4A 3NAUA 1XGNA 1ZH5A 3CMEP 1P2FA 3HUGA 1VQ6I 1XSVA 5GAHJ 3U2RA 1VI0A 2KNCA 5KJ7A 2G3AA 1L0NG 4ITVA 2R7XA 1IG7A 4LJZF 1IRFA 4FCYA 1USSA 3L2QA 4PD4E 4PSWA 3RL0g 2JWAA 3I4MJ 1SANA 3EUAA 1FIAA 3L70E 4H4KC 2FSWA 4N9IA 2QJPB 3OIOA 5DJTB 1NTMJ 4CCKA 4XQFA 3F89A 4FISA 4IL6E 6PAXA 4OGQD 3C2GA 2BASA 4H13C 3U1AA 2R32A 2OPTA 3TDZC 1ZARA 3CZ6A 2A69F 5KAIC 2RH0A 1R4NB 3BCCE 2B88A 4AWXB 1KYOD 3S1MJ 3H1KE 5APTA 3PLNA 1SQQK 4H0EA 2RDPA 1X4PA 4KIGA 5AW5B 5CJ4A 1G3SA 1YIJI 2YIUC 1H88C 3ZN1A 1A31A 3PH0A 5H2FH 4ANJA 4AUXA 3HE4A 1ZRCA 4HV5A 3H5NA 1M1JB 1BCCG 2FXMA 2V9VA 3CPWO 3H1HG 5AW1B 3SZGA 1Y8AA 1FOSF 4FHTA 5E79C 2HOSA 1OKRA 4XLNF 4I2OA 4BXLA 2LXCB 4UHTA 1P4WA 4XLFA 1K79A 5APUA 2HWVA 1TQPA 1JEKA 3QOPA 3B5ND 1L4AC 4C2UA 2XNXA 4Y33A 1YTZT 1QVFO 2DT7B 1GV2A 1S9HA 5ILSA 4BAYA 2NPSD 3ZQQA 2V1NA 2P5KA 3K70C 2IS1A 4NPEA 2ZO4A 3MCZA 3E7KA 3VMXA 1BDCA 3WU2H 4NC6A 2FFDC 2ICWG 3IN6A 1PPJD 5BS6A 2DMNA 2JO1A 3OYFA 2KKOA 5J1UA 1O3RA 1IC8A 1R58A 2OYIC 1KQSO 3RJPA 4PJ0H 4JYCA 3HSRA 3TF5A 5AIQA 5EEGA 2KLOA 2W57A 3DKWA 4H13B 2VE9A 2A45H 1FP2A 2R0QC 3P8MC 2EBIA 3DU5A 2L4MA 2XHKA 3LQQA 3H1IG 3JRIA 2EIKH 2H6CA 4D5FA 1LTTC 2WQYC 1YQAA 2NS8A 1A35A 1FZAA 1BW5A 1M1EB 3U9GA 1N7SC 3GMEA 3R4KA 1H9GA 3MVPA 2HTSA 3SEZA 3V8JA 1BC7C 1XSDA 2YIUB 1I1SA 1FX7A 1G1JA 2C0WA 2N1TA 4K2EA 5IP9J 3NWSA 3W2WA 2QSFX 3L2CA 4R4LA 1SQXG 1Q7YQ 5HVQC 1REPC 2XPUA 3KP7A 2Y2ZA 2H6BA 2NVXJ 1KC8Q 1UJ8A 2XZRA 1KA8A 5CBNA 1KN7A 1MMGA 1JKPC 3PP5A 1WJAA 2E35A 2P7VB 4MIMA 2W85A 2X1DA 1L4AB 3ZOBA 1BI2A 1G2CB 2IBZD 1NG6A 2FOKA 3A2KA 2PMHA 2KIUA 1VQ7I 1DIPA 3ZMSA 2RNGA 1S29A 1TTYA 3ELKA 3QPLA 5FRMA 4OH8B 3VMYA 2V7QH 4JBZA 5J4YA 2FFDB 4E7JA 4FQGA 3L74D 4Q5SF 2OQGA 4MHGA 2O9LA 1Z05A 1DP7P 1ULYA 4BY7J 2WPSA 3KQGA 4EDFA 3PIOF 1VF9A 3ZQGA 5IP6A 2RKLA 2OYIB 2IDBA 2VXDA 1QPIA 2P0WA 3BP8A 2M8GX 4KUMA 5E3LA 1LTAC 4LGDE 3HOYJ 4BQQA 2QQAA 4C30A 2ADUA 3IKTA 1O7LA 2CG4A 4XFJA 1S9KD 1HDPA 2HQNA 2ZFUA 3J7AY 3EFFK 4ZZLA 2PQ8A 2Y9ZA 4I7HA 3TW6A 1SQVE 4CGZA 4A7PA 1TNSA 4A0YA 1N7SB 3FF5A 2YO3A 2DFEA 2VIXA 1YJ9I 3Q3DA 3G2BA 4KICA 2WAQA 3LNQA 3G9RA 4U7JA 2VONA 5DYMA 1HTLC 5CHXA 1GV5A 1XMKA 5FO5A 4XLCA 1X1AA 4ZKPA 1FIPA 3EDPA 3GVAA 1AV1A 1S1CX 1RE3A 2L9VA 1GW3A 1FMVA 5F0HA 4MQ9F 4QWQA 1VQKI 4HOBA 1L0LK 2BGCA 3VN0A 3WU1B 3CQZJ 1Z77A 2OAZA 4UY8I 3AE2C 3CWBE 1P7IA 2DO7A 3HBLA 5F0FA 3R0JA 3T1BA 1UB9A 4BACA 3RKQA 3ZGKA 2QF7A 1LT9C 4CUGA 3A0HE 5HNHA 2FQ3A 1KYWA 4A0XA 3F8FA 4IF4A 1HLVA 1W5SA 1GXPA 5C3EJ 1NTCA 4XKBA 4WF2A 3L74J 3AAFA 1QZYA 2P81A 4GYGA 3W6KB 1KD1Q 3CCLI 1P84E 4XRMA 1T95A 5M5YJ 1PJRA 2L3DA 5K5QA 2LK2A 4NNJA 1FYKA 1DD3A 1XCBA 5LFAA 3COAC 4A6EA 2VPRA 2ELKA 2XPWA 4IHWA 2NVQJ 3KP4A 3TW7A 5E8IA 3S14J 1SQPE 3DEEA 2EIJH 4QIWN 1IFNA 4GT1A 4BDZA 1L0LJ 1IO2A 4XM3A 4NBQA 1RQVA 4ETSA 5EGOA 1T3JA 4OAZA 4A3MJ 3TGUG 4DBRA 4WVZA 3KPHA 4JP0A 1MDMB 1BE3D 3GHGC 1VQOI 5AW6B 3BR2A 4I98B 1WJ5A 3O6BB 2MFZA 3SFDC 1K73Q 2EV5A 2L9NA 1OCTC 2IJLA 2IRFG 3VODA 3Q5SA 4ENNA 1TU3F 5FD6A 4E6KG 2CGPA 4G12A 3FHNA 1IN8A 2FYNC 2M2EA 3L00A 4FX0A 1MGTA 3SXYA 5GADJ 1YJNI 3N97A 1L0ND 3VTPC 3DP7A 2F5EA 2XPVA 4Y52J 4E70A 1ACIA 2M4GA 1XDSA 3IF4A 1LWUC 1TQIA 4IZZA 5J40A 2J5PA 3GYHX 1NK2P 2B0LA 1UMQA 2CW0F 3DBRB 2DA4A 1XN7A 2HU9A 2VL8A 2WB1A 5BPDA 2L4AA 1HW2A 1LT9B 1T0FC 3K4BA 1Z9CA 4DYCA 1RF0A 2R7WA 3JSOA 2V4HA 4HDVA 3E5UA 2GA2A 1BL0A 3M1EA 2QE7H 1GUUA 3VSLA 2BEOA 2FUG2 3NTNA 5D8KB 2DA3A 5D8LB 2ZJPF 2XF5A 1SFOJ 1XG1A 3CC2I 1OZHA 1URQA 5KLVE 3AG3H 3CF5F 4A3EJ 1KU9A 2VQHA 4A5NA 4KMUX 2DOFA 1Z3YA 2FBHA 1D1AA 1WZ2A 1IZNB 2M87A 4JPZB 5C4JJ 4PFPA 1VQLP 3BR3A 4S0HB 3ABTA 1IDYA 1BCCD 3QQAA 3E6CC 1P7JA 1BE3J 3UR3C 1Y0NA 1KILC 1GU4A 1KQ8A 3CCRI 5C39A 1IFIA 1J5YA 2OTJI 2HQRA 2VN2A 4HEA2 2NVTJ 3Q0VA 2WSCH 4M71A 4PJMA 3JCUC 5K5OA 3L71J 2KLUA 1XCVA 4EIJA 2YX7A 2EK5A 2X4HA 5KAFC 4YG2F 3NQOA 3W6JB 2BHYA 3BJ6A 3L73G 3TP3A 3S3NA 4EJWA 1K9MQ 2FE3A 5K7HA 4C3IJ 2ECCA 2FYNB 4W7YA 1NTKE 5LHGA 1HXDA 1T56A 2WVRA 1LTSC 2GXBA 1PYVA 3EPZA 1FBQA 1Z3XA 2JA6J 5J4VA 3TNUA 3WHBA 2LD5A 1LWUB 1EA3A 1YFHA 4Y13A 3G3ZA 1A6QA 1Z7UA 2XGDA 3RTRA 1DGWY 4KA4A 2PJRA 4XKCA 1FAVA 2R5DA 1R8EA 5ICFA 1U78A 1ETOA 1FJLA 1JI8A 4XSXF 1FBUA 4AD9A 1FEXA 1KFMA 2O01H 2WPVB 1YYCA 3WGHA 1ZP0C 5IOYA 4ZYEA 3GFLA 4QPOA 3M0AA 4KT5C 3LW5H 2E5TA 3CC4P 4KIBA 3CCQI 1RNLA 2FX0A 3GF2A 3H1ID 4NB5A 1P4XA 4BQOA 3D71A 4A3CJ 2ETHA 2E1MC 3E1RA 1FZCB 1VQ5P 3LSHA 3ZQ7A 5AW7B 2WC2A 3V7SA 3W2VA 2ZFCA 2MC3A 4PV1D 3KETA 1NVOA 2IAIA 1LTJC 3A2AA 1MW7A 4LK1F 5B1BH 2G9WA
chains in the Genus database with same CATH topology
5HLHA 2XKOA 4LD5A 5CCHD 3HUSA 1ODDA 3T8TA 2JTVA 1LEBA 1KILB 2IPQX 3ABUA 2H43A 5AW9B 1JUNA 3DF8A 4HLYA 4C7NB 2ZBKA 2VC0A 1F9NA 5D4SA 1JY2O 3F8NA 4MQVA 3RK2D 2HFED 4L0YB 2R5BA 2NNNA 1JY2P 3H92A 5AVXB 2OQRA 5AW8B 2I1KA 4B8XA 5A2QZ 1ZRDA 3TYYA 2ZJ2A 1JHHA 3QP5A 3RKXA 3VEPA 3WG9A 1O3TA 2O1JA 2ISZA 3FM3A 4EGYA 1LTJB 2RNJA 2R7FA 3ULQB 3N4MA 1IUYA 1JY3O 1GDTA 3V4QA 2J5OA 3V4GA 1BI3A 2STTA 2PG4A 2WSFH 4M9SA 3I59A 3P8CD 3RKYA 3HYIA 1HGVA 3IFMA 3WMM0 4XBFA 1ON1A 2JPCA 1K78A 1UHMA 1WKMA 2XAQA 5LEKA 3QU3A 4KNYA 3IL2A 5F1RA 3WTWC 2IA1A 2YSRA 3MFKA 3RPUA 3VP9A 5BOXA 2LF7A 4NQWA 2IA0A 1PP8F 4BXUA 1JTHB 4GCVA 1LDJA 5E18F 2XKMA 1SFCD 1L3LA 2C6YA 3LAJA 1CI6B 5HS9A 3KP6A 3HHGA 3RK2C 3KZZA 2WT7A 3L36A 4L5JA 4L9TA 1LNWA 1G2CA 5D6FA 1FPQA 3WU0A 4IPAA 1T2KC 2ISYA 5H6QA 5HS7A 1ZRFA 2RC4A 1KU2A 2GA1A 3LA3A 3J7AO 2IX7C 3M06A 4YFXF 2XROA 2KLVA 5E8GA 1JNMA 1TW2A 4LC1A 4HYTB 1LEAA 3LIDA 3F8MA 4AIHA 5APXA 2NS0A 1HBWA 3Q9VA 1J59A 2XVCA 3M8FA 1U2WA 3ZMZA 1N7SA 3M0DC 3HRSA 3M91A 4I0AA 5DUIA 3BVHA 5TJJA 4W7ZA 3VOEA 1AQ5A 1DX7A 4RB1A 4RGXA 1MD0A 4M9ZA 3E6BA 1F5TA 4I2LC 1ZR4A 1LTGC 3RK2B 1R22A 5E1ZB 4A0ZA 1IN7A 1R1UA 1T3UA 5E17F 1X79B 4A2UA 2HR3A 1S3JA 3P9CA 4LLLA 1ZLLA 1N7LA 5E1XA 2DQLA 1WRJA 3WGIA 3TO9A 3WTUC 5DV5A 4HF1A 3GXOA 4L9VA 1OYYA 3B5NA 5DD8A 4XE5B 1MDMA 4FT8A 2NPSA 1C0WA 2QBYB 2OD5A 3IRQA 3CO7C 1B59A 2YU3A 5L3EA 1BIBA 4M74A 5CVRA 2Z5HA 3LA2A 1GK6A 3HTUA 3II6A 3WTVC 3F8CA 5FD5A 3E97A 2P7CB 1P92A 1CGPA 4FX4A 2XKPA 4ENKA 1KQ0A 1R23A 1YLFA 4JF7A 3EUHA 1ZLKA 2HODB 4WX9A 1QBJA 4RESB 2LKMA 2PBIA 1I1GA 5LGNA 2TDXA 2XGXA 1HWTC 4L5IA 2M8RA 4D0PA 3ERED 3M9AA 2VBWA 2M8EA 2MH2A 3WE3A 3V2NA 3FHZA 3I5UA 4WY4C 1YS7A 4RAZA 5LHHA 3JW4A 2E7XA 1GD2E 4IRIA 3FX3A 3HE5B 1L4AD 1D8JA 1E5WA 2ZXJA 1FZEA 4WCGA 1SMYF 2F2EA 1FYMA 3NRVA 1FZCA 4EMSA 3TKYA 1S7AA 5L3CA 2NRAC 2KYVA 4I0BA 2HG5D 1O3SA 2EA2A 3CTAA 3C9IA 5AVSB 3O8ZA 2M5WA 3ML6A 4N78D 1XGSA 3HSFA 3NEUA 2EJRA 2FRHA 2HDCA 4EV0A 4ZH4F 2KOGA 4I09A 4MNUA 4M73A 4L0ZB 5LLQA 2XDJA 2HGCA 2H94A 4KMFA 1GTWA 2UXNA 5JVTA 1M7LA 1IN6A 2CYYA 2QQ9A 3I0TA 4IFDK 2JEEA 4WY4B 4LG0B 1D5VA 3GFMA 4CDGA 1H8AA 2JRTA 3KE2A 2PAJA 3I54A 4B86A 3HOSA 1FNNA 1W7PD 2K7LA 3P9IA 4KN4X 2E7WA 1Z1DA 3HHHA 4GO1A 1ZG5A 2ZCWA 4MEXF 2ESHA 3J80K 1MFZA 1EH6A 3RKWA 2O3FA 4NHJA 3V7CA 1SLQA 4LK0F 1FDMA 3KP2A 1GL2C 3S2WA 1O7FA 2Z5UA 1SMTA 2O8XA 3DFGA 2CQKA 4UVBA 1SVFA 5CCGD 5DCFA 1LDKB 2P2UA 1ZG3A 4WXCA 4WWCA 2KSJA 5J8FA 4EJOA 1BBYA 3C7JA 2GM4A 4P9FA 5HLIA 2Q9IA 1A04A 2F5CA 2R3CA 3KP5A 4G6QA 2J58A 2DK5A 2QLZA 3K9TA 3L9FA 4EJTA 3LFKA 3TO7A 3VYIA 2V1DA 1CI6A 5CMZA 4Q48A 2QUFA 3PFIA 1L0OC 3RIRA 4IXAA 2EFQA 5TRDA 3E6DA 3I53A 5J8CA 2A3SA 1FP1D 2QZ8A 1Z6RA 1GL2B 3R0AA 2K4BA 1FSEA 1OPCA 2A07F 5APYA 4I6MC 5AVTB 1V4RA 1YTYA 2C9NY 5FLXZ 1A02F 4CICA 4WXDA 2M30A 1WT6A 1UCRA 4PCQA 5AVYB 4U88A 1YW9A 5FGMA 2DPDA 2XV4S 2EB7A 3P8CE 2WITA 2BYVE 4QLCU 1G4DA 2WWWA 4LMYA 3MUDA 1YYVA 2VBYA 3KFWX 5K1YA 2WTEA 5CCHA 3SHFA 2COMA 2AXLA 2LKPA 1IXRC 2DPUA 4WBAA 2NAZA 5AIPA 1U6GA 2JT1A 4YFKF 1PP7U 1SQBK 3BRVB 2Z3YA 1V3FA 3NXSA 2XV5A 5CCGC 3HRMA 2J59M 2PEXA 1T98A 2CFXA 1VPCA 5E20A 5CVVA 3D5LA 1OMIA 5HDGA 1QGPA 1ZV8A 5IT3A 2POHA 1ZGJA 1KILD 1CW5A 2BBYA 1W7PB 5BU5A 1VTNC 5AONA 3KPEA 1RE4C 4IJAA 2YNYA 1EV7A 4BHCA 1FZBA 1FZGA 2PMUA 3BATA 4HW0A 3RK3D 2GXGA 2OZ6A 1S7OA 2W27A 4Z2YA 4MGRA 4HAMA 5BQTA 2QM7A 2DW4A 5AVQB 3QRFF 3I4PA 2X0LA 4KDPA 3K2ZA 1XDUA 1XB4A 1NHLA 4CYDA 3I58A 3P32A 2Z99A 5DCMA 4DOJA 4AVPA 5IT9Z 4HQEA 1T38A 3TOAA 1WRGA 3I5CA 1NKZB 1KU3A 3GLXA 4EGZA 1CF7B 1CZQA 3MTUE 2QM8A 1GU5A 5EEHA 3RL0C 3TOBA 2P5LC 3M9QA 5LRSA 3D0SA 4WB4A 1SFCA 2V1XA 2HODA 3JTHA 1JHFA 1R00A 2A6HF 4U7BA 5H20A 3O2PE 1FBSA 2YO2A 5DEQA 1JY2N 4A12A 2ZMEA 1IFDA 4O3MA 3L7WA 1F4KA