3G3ZA

The structure of nmb1585, a marr family regulator from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
MNQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of NMB1585, a MarR-family regulator from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g3zA02
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3g3zA01
2STTA 2XIGA 2JT1A 2EFOA 5DYMA 4NHJA 2Y48A 2XRNA 2L02A 3ZP5A 1SD6A 3R4KA 1UFMA 5AONA 3W6KB 4R79A 2UXNA 2GA1A 1HW2A 3I53A 1TQMA 3L09A 1EH6A 3ECOA 1BN5A 2ESHA 3EETA 3ZMUA 3LA7A 3J80Z 3RI4A 4I0BA 3O2PE 2EFPA 2BGCA 1ZLJA 2MLKA 3C7JA 2DI3A 3WGIA 2GZWA 4A0XA 4NQWA 3TDUC 3ULQB 1GXQA 4GO1A 1IXSB 3VOEA 1OKRA 4I2OA 2GA2A 1ZAOA 1S6LA 4HV5A 1FYKA 2HEOA 4M9SA 1KU3A 1DPRA 1QO0D 4JQFA 4EJVA 4WX9A 2XHKA 2HKXA 3IC7A 2P7CB 1G3WA 2RV8A 5AIQA 4QLCU 2HOEA 2PJPA 4HW0A 3F23A 2EFNA 2A6EF 5L3BA 4A6EA 1B9MA 1FBQA 2ACJA 5BQTA 2F5FA 1QBJA 1TTYA 4CYDA 1O3SA 2L4MA 2Y0MA 1D8KA 4BH9A 2QBYA 1XSVA 2WTEA 3KP7A 2RQPA 5BMZA 3EYYA 2O8XA 2P8TA 2F5CA 4G7HF 2IPQX 2OAZA 1E17A 3MZYA 1IN7A 4WWCA 1O3TA 1LQ1A 1TLHB 2FOKA 4LB5A 3F8FA 1S7AA 4L0ZB 3F8CA 2XAFA 3IKVA 4DNCA 2XV4S 5DD4A 5LHIA 2P6SA 2ISYA 1FT9A 5CVIA 3EYIA 2DBBA 5CYVA 2GAUA 1YW7A 1Z1DA 1XMAA 4OIPF 1R00A 2VN2A 5H6RA 4HYEA 1F1ZA 1FWZA 1YQAA 2KIMA 3GZ5A 4BHPA 1ZGJA 1C0WA 2EB7A 3D5LA 1W5SA 4L9TA 4IRGA 2XKOA 4GYGA 3QOPA 5K5OA 1S3JA 2XUBA 1SQXK 3FX3A 5CVVA 4HLXA 1R1TA 4UHTA 1J9IA 1SQPK 2D45A 2ZNYA 3TO6A 4PCQA 3LFKA 3DPLC 4L5IA 1JHHA 4OMZA 4HZFA 5F64A 1QNTA 3GVAA 4ON0A 4AVPA 1P4WA 3H92A 1KA8A 1CF7B 3T8TA 1XN7A 2CW0F 4EM2A 1KU9A 4CHUA 1SD7A 1SFXA 2HTSA 2OQRA 5HLIA 2EA4A 4ETSA 4OMYA 4ESJA 4M6YA 3TO9A 2XROA 1S29A 1R5HA 1JE8A 5JR3A 5D5WB 2HFHA 5ICCA 2NAZA 1IN8A 5HS8A 2Z3YA 5HOOA 2ZMEB 4MTDA 2ZBKA 4LJZF 3ISPA 2IP2A 1SFUA 2E1NA 3E5QA 2K02A 4O3MA 4ZYHA 4EMSA 2QQ9A 2VOPA 1Z6TA 2PN6A 1NTZK 1OMIA 3HUGA 1FLIA 4BHCA 3GZ6A 2BV6A 2FBKA 2ZCWA 2Q2EA 3R0AA 3RPQA 1I1GA 3RTRA 1BJAA 4A0ZA 4YIFA 3C1DA 2IW5A 2DT5A 4B8XA 1ODDA 2PQ8A 3BROA 4XLPF 1G3SA 2A5YB 1SMYF 4TV7A 2XAHA 4H0EA 4IF4A 2YPRA 5CVRA 3RYPA 1TNTA 2CG4A 1QPMA 2STWA 3T0YA 2MC3A 1B9NA 1HKSA 2VBZA 1TBXA 1YG2A 1QQIA 4WXDA 2HZTA 2OQGA 4AWXB 1FP2A 1R5GA 1MJ9A 1MD0A 4E70A 3BJOA 4JK1X 5D5XB 4MNUA 2G7UA 2QM3A 2NS0A 4M74A 1LVAA 5D4RA 3VEPA 2KJBA 2D1VA 5HS9A 4KNYA 3M1EA 4F7ZA 4HAMA 5K1YA 3MZHA 3IWFA 4RGRA 3F8MA 1JHFA 2DK5A 4ENKA 4CDGA 3G3ZA 2FYUK 1Y0UA 2DO7A 2F2EA 1NHAA 3BP8A 4M72A 1S7OA 4HOBA 2HYGD 2VBWA 4P9UA 2L4AA 5TRDA 3K1PA 4DQ2A 3MWMA 3RKYA 4Q47A 1P4AA 5CJ9A 4G94A 4P9FA 1R22A 3WGGA 3BOQA 5IT3A 3IRRA 4UVBA 3QPTA 2BEOA 1W4MA 1NU1K 2WSEH 3KLOA 1OYIA 3P7NA 4HX7A 4BNCA 4M6XA 4OOIA 4FX4A 1JGSA 1KU7A 4I01A 2PEXA 1F4KA 3MFKA 4KIFA 3KLNA 3HSFA 4JBAA 2NNYA 2Z5UA 5DDGA 2H6CA 4I7HA 3LAPA 1FNNA 2FQ3A 1L3LA 2DPUA 4IJAA 3QPHA 1RUOA 3ZMVA 4L9NA 2K4BA 3VB2A 4R1HA 4IXAA 2EV0A 4KA4A 3CUQC 1FYLA 3ML6A 1RNLA 2UZKA 4G8XA 3L9FA 3V7RA 2ZJ2A 5JI6A 3FHZA 3BPXA 3S2WA 4CO8A 3WTVC 2WV0A 4RGXA 2EFQA 3ROUA 2ISZA 1WWXA 5LHGA 4YFKF 1B1BA 1H9TA 2OARA 4M73A 2PI0A 4ESFA 3K69A 3WE3A 1DUXC 2H27A 2DAOA 1ZGAA 3QP5A 3TO7A 3I58A 4LLLA 1P6RA 3QU6A 2LSOA 3GXOA 2CSOA 4HF2A 4YG2F 4BQAA 4P55A 2IA1A 4Q48A 2O01H 3LSTA 2EWNA 5E1ZB 1HKTA 4OIOF 2KJCA 5LGUA 3HSRA 1O7LA 1XCBA 1IN5A 1TQIA 1U6GA 2QYOA 2CO5A 3K2ZA 4HF1A 2E7XA 3T1BA 4MHGA 3SHFA 4EVIA 3KEOA 3FMSA 1GHCA 1ZG5A 2VBYA 3F3XA 2GIVA 4AD9A 1USSA 2IT0A 3KP5A 1SQVK 1ZREA 2LF7A 1T98A 5E8IA 3SXYA 1WKMA 3K9TA 2HKOA 4Y13A 4I02A 3I5UA 3WG9A 2FU4A 4U7BA 1U5TA 3T5XA 4M9ZA 1T39A 3E6CC 1D3YA 3I54A 2K7LA 4LGWA 4UUVA 5DCMA 3TKYA 2PMHA 3DXJF 3F6OA 5K5RA 4CGZA 4MEYF 4ZH4F 2L3DA 1SD4A 1A04A 3LA2A 1XB4A 2P6TA 4O5VA 4GGGA 5L3EA 2FA5A 4A5MA 4Y17A 4EJUA 2YR2A 5KK1A 4G9YA 3QRFF 3IRQA 4ZZLA 1UCRA 2FNAA 2IRFG 4MTEA 4U0VA 3R60A 2W57A 2RGVA 3ECHA 5K5QA 1XDUA 1IW7F 4IFDK 2HS5A 5HS7A 4WCGA 5D8LB 5A2QZ 1RUNA 3RKWA 2V79A 2CQKA 4HX4A 1WQ2A 1MDMB 2QLZA 4KFCA 1FBUA 4G7ZF 1PUEE 2JPBA 4R8HA 4Y15A 3LA3A 3CJNA 3GFIA 4EGYA 2PLYA 1YLFA 3KZYA 2M30A 1J2XA 1RI7A 1MJBA 4L9JA 3MQ0A 1SMTA 3HTUA 4HBLA 2Y75A 3J81Z 5LRRA 3WE2A 3SFZA 1YIOA 2PG4A 2QBYB 1QZYA 3KE2A 3I71A 3KEQA 4UXNA 4D0PA 1EV7A 4KN7X 1I5ZA 3I4PA 3F8NA 3CLQA 2V1XA 2E1CA 2YX4A 2FF4A 2FBIA 1J59A 1UHMA 5EEHA 3JTHA 3F21A 2B0LA 1R36A 1R7JA 5KVRA 2QWWA 2VT2A 5LEKA 2LDUA 5JVTA 1IF1A 5D6EA 2OD5A 2AS5F 4ENNA 2RDPA 3DV8A 3PFIA 3L00A 2HYFA 3P9CA 3B73A 4A6DA 3RDIA 4HQEA 1XGSA 3I0TA 2QQAA 3G73A 5D6FA 2GXBA 1H0MA 5E20A 4RAYA 5FLXK 3FXRA 2DTRA 2KKOA 4XSZF 1ZH5A 1FX7A 4I0AA 4BAYA 4ESBA 3GFMA 1YW8A 1FOKA 3M8FA 4HF0A 2EV5A 5IT9Z 1ZHFA 4ENMA 3M7GA 1TW2A 3FXUA 2DPDA 1XCVA 5DV5A 5DUKA 2FMYA 2XGXA 3U9GA 2A69F 2QZ8A 3HRMA 3LQRA 2P4WA 2OZUA 3VODA 2BE5F 5FFZA 1FZPB 1OR7A 5D4SA 2W84A 1VTNC 4ENJA 2AXLA 4B09A 1NTMK 4G6DA 3DQVC 2O3FA 4IRHA 4XBFA 3J7AO 2A61A 1QZZA 2OU2A 2RN7A 3TGNA 3AAFA 3O3KA 2DK8A 1XDSA 4RGUA 4PGGA 1RIOH 2Z9OA 3HIFA 4Q5SF 1KU2A 2GWRA 2VBXA 1ZYRF 3F6VA 5LLQA 2YSRA 1P4XA 3CUQA 1YS6A 2ADUA 3IL2A 3HHGA 4S05A 3J81K 3KP4A 2YU3A 3E97A 4LK1F 4N0BA 4NB5A 2WSFH 1YYVA 1U5TB 4PZJA 5ICEA 3NEUA 1TQPA 2K27A 1CGPA 3I59A 1HBXG 2A6HF 2ESNA 1QGPA 4A2UA 1D5VA 1BI2A 2MH2A 2W25A 1XSXA 3N97A 5BS6A 2TDXA 1J75A 3QAHA 2VE8A 4BYYA 1SFEA 3QU3A 1L0LK 1SQQK 1G6NA 5IT9K 3FF5A 4UVCA 2QQBA 1GXPA 3E6BA 3EQLF 1PP8F 3ERED 1SQBK 4KN4X 1ON2A 1K6OA 2MA3A 1J5YA 2VODA 1DPUA 3TQNA 2RC4A 4KICA 3RPUA 2FNPA 3K0LA 3TOBA 2J5PA 5E1XA 5LGTA 1R58A 1X3UA 2FE3A 1O7FA 1BBYA 2COMA 3MEXA 1K78B 5HVQC 3V7SA 1WI9A 3TDZC 4KIBA 2A68F 5HDKA 3WU0A 1T38A 3FZVA 3EDPA 1XMKA 4LG0B 4G6QA 4KIGA 3I64A 3GX4X 2EJRA 5J6XA 1IZ1A 4GYIA 3ZN1A 3CLOA 1W5TA 2P5LC 1F9NA 1SD5A 4RGSA 3COAC 2LKMA 5A2QK 1LJ9A 2MH9A 1I6XA 3U2RA 3HOTA 3RIRA 4ASNA 2WC2A 1HSTA 4KMFA 3F8BA 3QP6A 2X0LA 3DEUA 5HLHA 1IRGA 1KQ8A 2X4HA 1PDNC 2J5OA 1NTKK 3FWEA 3C3WA 3U1DA 3F22A 3OV8A 1IXRC 2K86A 3H3ZA 4LLNA 3KP3A 3GF2A 1B4AA 4XRFA 3PQKA 3Q9SA 5F6FA 3RJPA 1V4RA 1MJAA 3HRUA 4S04A 2M8EA 3LAJA 1WRJA 5LEJA 4WF2A 4EGZA 1O57A 2QVOA 3NRVA 2M5WA 4YFXF 2FEZA 2XAQA 1J7KA 4RB0A 2IA2A 2XAGA 4HDUA 1OYYA 1W7PB 1L0NK 2MBFA 3IKTA 2V6CA 1S8NA 1G3TA 3C18A 4OINF 1IRFA 1XD7A 2UXXA 4XLNF 1WSUA 2R7FA 2P7VB 2OZ6A 4EV0A 1ZRDA 3FMRA 5CVUA 2E7WA 3FM3A 1STZA 1ZG3A 3BJAA 5FLXZ 4EM0B 4FT8A 2NNNA 4IPAA 1I27A 3B02A 3CDHA 4LD5A 4HQMA 2D2WA 1MDMA 1K7AA 4U0WA 1KYZA 1DDNA 3KP2A 1DP7P 2O61A 1W7PA 5D8KB 1U5TC 4LK0F 1BC7C 1LDJA 1O3RA 1UB9A 2L54A 3V7CA 2F5EA 4ZYEA 2H6BA 4UV9A 5ILUA 4RS8A 4EJOA 2WWYA 3SZPA 3P9KA 2CWEA 1B59A 2O03A 3BDDA 4LB6B 3CO7C 3KETA 3ZQ7A 2OBPA 1K79A 1U8RA 3WTWC 3CO6C 1E2XA 3SQNA 2HDCA 5FO5A 3CTAA 1KQ9A 1F5TA 1GVJA 1JXSA 2LNBA 2C6YA 3JW4A 2RNJA 2IA0A 1RZ4A 3P9IA 3ZN0A 3IWZA 2HQRA 2ZNZA 2EA2A 1FPQA 5E1WA 2HWVA 2FRHA 2ZMEA 1FC3A 5J8FA 1LB2A 1J0RA 4AIJA 3K1NA 2DQRA 2HTJA 4I98B 1L0OC 1LDDA 2O6GE 4MGRA 3ZMDA 4HLYA 3H3UA 1K78A 3R0JA 1BIAA 2EFWA 1P92A 2MLGA 1O3QA 2CFXA 2NYXA 2M45A 4IVNA 1Z7UA 1P2FA 3JSPA 5DEQA 3E6DA 3GFLA 2K4JA 2PBIA 3VFZA 5JFRA 3GWZA 3JAMK 5E18F 1Q1HA 2IVMA 1R23A 4KT5C 5KLVK 5J8CA 2L01A 1XGNA 2OA4A 4GCVA 3W6JB 3F72A 1BIBA 2ZO4A 3KZZA 4L18B 2Z99A 1IUYA 4EQQA 2FMLA 3GFJA 1MGTA 1LDKB 6PAXA 4I09A 4KYWA 3GYHX 5FD6A 3IHUA 3Q5FA 3BZ6A 5BOXA 2P5KA 3WGHA 3V4GA 5LBQA 2R3SA 2H09A 5H6QA 3N4MA 4UNOA 1OPCA 1BI3A 2RKHA 4IHSA 3KP6A 3FM5A 2DQLA 3ZMZA 2ELHA 5E8GA 4WXCA 5L3FA 1IAWA 3GW2A 2VT3A 4YFNF 2H94A 2V1DA 3CUOA 1B6AA 3WTZA 3CUQB 1IN6A 5LHHA 3L2CA 4G7OF 3WTUC 1USTA 1PP7U 4O6JA 3R61A 2FXAA 4HA8A 1LEAA 4LFUA 2XKPA 3LWFA 2D1HA 1HKQA 4QWQA 3FMQA 1MZBA 4LMYA 1BI0A 3BY6A 2V1UA 2PFBA 2CGPA 2HR3A 4AIHA 2MD5A 3JAMZ 2KRFA 1HQCA 2KIFA 3O6BB 1HXDA 5DCFA 2ZKZA 4EJWA 3GEZA 3DF8A 4CICA 4ZYDA 1BC8C 5L3CA 1UHWA 2BYVE 2A07F 4ZZDA 1YFHA 4EM1A 1YO5C 4FHTA 2FSWA 2CYYA 4IHTA 2JTVA 4XSXF 3JSOA 2EV6A 2BBYA 1KYWA 2V9VA 4M9XA 2ETHA 4MEXF 1AOYA 3TOAA 5FGMA 1KQ0A 2P5VA 1YS7A 5ILSA 5CLSA 4IRIA 4YIIA 2UWMA 2A3SA 3HTSB 3PQJA 1G3YA 2M1BA 2XVCA 3WTYC 1BM9A 2NRAC 1I1SA 2IJLA 3R6SA 1ZRCA 4L0YB 5H20A 2GXGA 3DKWA 3HHHA 1T0FA 4L9VA 5EEGA 2VONA 4L5JA 4AIKA 2ZFWA 5TJJA 2R7DA 1BOAA 5FD5A 4OU0A 2Q8KA 1OYWA 3M9QA 3T8RA 3MAJA 1Z05A 5FFXA 2JPCA 2JZYA 3K1MA 1U3EM 4KUMA 3LW5H 3GO5A 3M9AA 2O0YA 4N9IA 1H9GA 1G4DA 4HDVA 2VC1A 1D8JA 1ON1A 2J59M 3V8KA 2DW4A 1V3FA 1ONVA 1IN4A 4UV8A 1Z9CA 2LKPA 2M87A 2QENA 3E5UA 2F5DA 1ZLKA 3ELKA 3ZPLA 4N9HA 3WU1B 2DLLA 3WODF 1SAXA 4Q4ZF 3KFWX 2DU9A 3WTXC 4UVAA 1TNSA 1ZG1A 1YW9A 1W7PD 4RB2C 4EJTA 3BPVA 1U2WA 3EUHA 1R1VA 2ZXJA 3E3VA 4MQVA 4LG0A 2Z33A 1HW5A 1FYMA 2LF8A 4CZZA 5ICFA 5F1RA 2KIUA 5FB2A 1BI1A 1EH7A 4HV6A 3RYRA 5HDNA 1ZARA 3MCZA 5BPIA 2WSCH 1HSJA 5ERIA 5L3DA 4ZYGA 5L3GA 1XGOA 1Z6RA 2VXZA 2GQQA 1HW1A 2G7HA 1CF7A 3HRTA 3ZMTA 5D5VB 4PGHA 3E5XA 4CXFA 2VC0A 4M71A 4MQ9F 3ZMSA 1AWCA 5DD8A 3ABUA 1R1UA 1FBSA 3M8EA 4WK8F 3REOA 1Z91A 5ILVA 5DCMB 3WTTC 3GUDA 4HX8A 4BHBA 3LQQA 5HLGA 1XSDA 4WXHA 2EK5A 4RAZA 4GXOA 3DP7A 3JTGA 5HDGA 2W24A 4FX0A 3Q9VA 3D0SA 1T6SA 4LLGF 3FXQA 3HOSA 1TW3A 3I59B 1LEBA 3GLXA 2QUFA 1ZRFA 3ABTA 1MKMA 2W85A 5JHUA 3E6MA 2DFIA 3J80K 1KGSA 3BJ6A 5DUIA 1IXCA 2PMUA 5ED4A 1FSEA 1REPC 1FY7A 2VE9A 4OIQF 5E17F 3HSEA 4U88A 4OIRF 3SZTA 2G9WA 5BPDA 1T2KA 2RVCA 4RB3C 4RB1A 4Z2YA 4A12A 4K2EA 1ULYA 4U0YA 3L7WA 4A0YA 2JRTA 3HYIA 4P5OA 3KCCA 3NQOA 5CVJA 1EH8A 2FBHA 3V8LA 2JSCA 4BXUA 2YX7A 1ZN2A 3DPTA 2HQNA 3V8JA 1FP1D 3OOPA 1XGMA 2XAJA 3BWGA 4KMUX 5LGNA 3DFGA 1YTYA 5D5UB 3HRSA 4U7DA 4KDPA 2HGCA 4PDKA 1FSHA 2XASA 3WTSC 3RKXA 4P96A 5ICGA 2VOOA 4A5NA 5LRSA 5AIPA 2Q0OA 1U78A 1LNWA
chains in the Genus database with same CATH superfamily
4C30A 2XIGA 2JT1A 3G1OA 1VQ7I 2EFOA 5DYMA 2STTA 2QG4A 2EPFA 3PO3J 3L75J 1X0TA 4NHJA 2Y48A 1URQD 1S9KD 2XRNA 4KHXA 1MSFC 3OIOA 4QSHA 2L02A 2O01N 2CK3H 3ZP5A 1SQPG 1SD6A 3R4KA 1UFMA 5AONA 3M4OJ 3I4MJ 1QL2A 3W6KB 1G2HA 4R79A 5BVZA 2UXNA 3LSMA 2GA1A 2KP6A 1USDA 1HW2A 1Z3YA 3I53A 2BVLA 1TQMA 4KITB 2K9LA 3LNQA 3RK3D 1RC9A 3L09A 4NC6A 3OR2C 3OA7A 1EH6A 3ECOA 5BU8B 1K4TA 1BN5A 4RA2A 4C3JJ 4G12A 3G4SP 2JK3A 2ESHA 3EETA 2KB7P 5JVGF 2COBA 3ZMUA 3LA7A 2MC4A 2R92J 5B5EH 4P1WA 2Y2ZA 1KILD 4C7NB 2H1LA 2H7HA 3J80Z 3JRIA 2L9RA 3RI4A 3H0DA 4BQNA 2R93J 4I0BA 3O2PE 1JNMA 2EFPA 2BGCA 1ZLJA 2MGQA 3CX5E 2MLKA 4H13C 1X1AA 5KLIC 2ZXWH 3HL2A 2JJ7A 3C7JA 2QA4I 2DI3A 3WGIA 2E35A 2GZWA 4ZDPA 1YI2I 2VUMJ 2D2CC 1F43A 4A0XA 1IV8A 4XFJA 2HQAA 2X48A 1H8AA 4NQWA 1WJBA 2NS8A 3TDUC 3JC22 3ULQB 2KPMA 4XN3A 2H8PD 3TL4X 2NPSA 1MBEA 1GXQA 1WH7A 3OYKA 4GO1A 1LTAC 3P8MC 1IXSB 3CXHH 5FRNA 5AVTB 4U3FJ 5IYCJ 1MMSA 1SS1A 2P67A 2P2UA 3VOEA 3CWBG 1QVFO 1OKRA 2L0KA 1FTZA 1BGYG 2LBFB 4I2OA 3G71P 4TT3H 5CJ0A 2GA2A 5K7FA 1S2EA 3FGAD 1ZAOA 1S6LA 3BASA 4HV5A 1FYKA 4IHYA 1RR8C 1YITI 2HEOA 4XLEA 1NTMJ 2PMZN 3TYYA 4M9SA 5GTIC 1Y47A 1KU3A 1DPRA 2DCEA 1A6IA 5EYRA 1QO0D 4CCKA 1IUFA 2GUVA 1GK6A 2WAQA 3CC7I 5IY5H 4JQFA 1L0NG 4EJVA 2LLKA 4WX9A 2XHKA 2HKXA 3IC7A 2P7CB 1G3WA 2RV8A 2IYOA 3HE4A 1VQ7P 3K70D 3IH3A 2IS1A 3C1LA 4KT0J 5AIQA 4QLCU 4MO7A 1DGRM 2HOEA 1GV2A 2PJPA 2DA2A 4DBRA 1MSEC 4QMAA 3B4SA 3OMYA 2O1KA 4HW0A 1HC8A 5AVWB 3F23A 2EFNA 3LFUA 4HPQA 1CQTA 4GIFA 1Y56A 1L4AC 1VQNI 3HUSA 2A6EF 4N4OB 2HLOA 3HOWJ 5J4YA 3MP7B 3AEBC 5L3BA 4A6EA 1B9MA 1FBQA 1AHDP 3KDPB 3Q0WA 2ACJA 1BCCJ 5BQTA 2F5FA 4JF7A 3VMYA 4FE4A 2C9LY 3AE9C 4IEJA 1QBJA 1TTYA 2CQQA 1X2NA 4CYDA 2L4MA 2RAEA 1NH3A 1O3SA 5TGTA 2JA6J 3H1LE 1T95A 2Y0MA 1D8KA 4BH9A 2QBYA 1XSVA 2WTEA 2BCCJ 2YKQA 4W7ZA 4IQJA 3KP7A 5APYA 2PX9A 2RQPA 4F3QA 5BMZA 3AE5C 1PIXA 1SAUA 2W48A 3EYYA 2ZXXA 2HVSA 2O8XA 2MABA 3V4QA 4PFPA 9ANTA 2P8TA 2PRRA 4AUWA 2F5CA 4G7HF 2IPQX 2OAZA 1E17A 3S1KA 3MZYA 1IN7A 4WWCA 3U1AA 4C7RA 2HXOA 1N75A 2DW3A 1ZMEC 3QPLA 2HVRA 2NVQJ 4B3XA 3HOXJ 1KORA 1VI0A 2BEZF 2N8GA 1O3TA 1G8XA 1LQ1A 1P84E 1PP9G 5CCHA 2G8YA 1TLHB 2FYUJ 5F27A 2E19A 2FOKA 1IG7A 1LKXA 1SFCA 4LB5A 3CCEP 3PIPF 3F8FA 3GTOJ 1IK9A 1QZEA 3B5ND 1S7AA 2CQ7A 3B5NB 3HE5B 4L0ZB 4GKGA 3RBZA 3MUDA 2ZXHA 1RF1B 3F8CA 2XAFA 4E7JA 1JKPC 3AEDC 2RKLA 3IKVA 4BWNA 1LE8A 3S4RA 3FHNA 2XV4S 4DNCA 2M0BA 5DD4A 1HJBA 3G71I 5CBNA 3SYTA 5GPCA 5EZGA 5LHIA 2P6SA 2ISYA 1FT9A 5CVIA 3ABLH 2HYNA 3CCSP 1NYHA 2LMDA 2IYPA 3HB9A 4S0HB 4N3YB 2OPTA 3EYIA 2DBBA 5CYVA 2GAUA 2AXTH 2ZT9C 1DD3A 1TZLA 1SVOA 1YW7A 5F0HA 3L74E 1N73A 2ZJRF 1Z1DA 1XMAA 4JYCA 4OIPF 3OOUA 3WG7H 1VL2A 5B66E 1R00A 2YIUC 2VN2A 5H6RA 2M4KA 3N05A 1OW7A 3PRJA 2MFZA 4HYEA 1F1ZA 4UB6C 3U21A 3S1QJ 1ZKGA 4XL9A 2E1MC 3S8PA 4ZC3A 1FWZA 1CI6A 1L0ND 2PFXA 2QM8A 4ZTJA 1U8BA 1OCOH 1YQAA 2KIMA 4EEFG 2OC6A 3GZ5A 5B5EC 4BHPA 4RO0A 1ZGJA 3RK2D 1AVYA 1C0WA 2OQQA 2EB7A 1BCCD 2M0MA 3D5LA 1W5SA 4L9TA 4IRGA 1KYOD 1JT6A 2P1JA 3H32A 2XKOA 4GYGA 3QOPA 1N25A 5K5OA 1RPWA 3AE7C 4A3DJ 2XDVA 3Q5RA 2KOGA 1SQVE 2XU6A 5TISE 1WVRA 4EOTA 3K4KA 1S3JA 4NBQA 2XUBA 1BE3E 3HKZA 1XG1A 3VPRA 2EZIA 3FX3A 5CVVA 3OYHA 4U87A 1SP4A 1SQXK 2K88A 4HLXA 1R1TA 4RLQA 4UHTA 1IK7A 2BCCD 1HGZA 1X79B 5AW2B 1J9IA 1SQPK 2D45A 1VQ4I 2QE7H 3AFHA 2ZNYA 3TO6A 1OLTA 4PCQA 4X1EA 3LFKA 2K9JB 2NOGA 3DPLC 4L5IA 4JP0A 1JHHA 1R9TJ 4OMZA 1UIIA 4HZFA 5F64A 2E74C 2KSEA 4L75A 3D71A 1K6YA 1R49A 3E1RA 3EPZA 4G6TB 1QNTA 2ELKA 1LJ2A 3GVAA 3GZNB 1M1KQ 4ON0A 4AVPA 1SVLA 3BTLA 3BZCA 1P4WA 4UB6H 5CBOA 2CS3A 3HUGB 2HPCB 2EZHA 2QSGX 4U3FD 1KYOH 2M34A 3BQZA 1WJ5A 3OIPA 1FZCA 1HJ0A 1KILA 3H92A 2I5UA 5H2FH 2AXCA 1KA8A 1CF7B 2CMPA 3T8TA 3WU2H 3QYEA 4BY1J 2WV1A 1XN7A 2KYVA 3OJAB 3DCFA 2AO9A 1NTMD 2EQRA 2CW0F 4EM2A 3V2PA 3MTUE 2DMTA 5CCHD 2TCTA 2WQYC 1KU9A 5CQEA 4CHUA 5GAEJ 1UG0A 1RF0C 3IAS2 3CX5I 5APUA 3Q5SA 3CMAI 1SD7A 3B8EB 2I1KA 1SFXA 2HTSA 3PFYA 3H1LJ 4GDOA 3W2VA 2OQRA 1Q2NA 5HLIA 1Z7LA 1WPKA 2EA4A 5FRMA 4E7HA 4ETSA 4OMYA 2LKSA 5B66H 1JTYA 2C9NY 2KT0A 3AG2H 4JX5A 4PJ0E 1N78A 5BU5A 2OTJP 3CD6P 4D1QA 4ESJA 3RL0C 4M6YA 3TO9A 2ZXIA 1G2CB 2XROA 1S29A 3L73D 1R5HA 1JE8A 1HOMA 5JR3A 2HFHA 5D5WB 5ICCA 3HJEA 2NAZA 2WBMA 1IN8A 4BJTA 5HS8A 2FD5A 2Z3YA 3NMDA 2GXAA 5HOOA 2ZMEB 3HEFA 4MTDA 2EBIA 2ZBKA 4LJZF 2YIUB 3NWTA 3CX5H 1JY3P 3ISPA 3AL0B 2J5UA 2IP2A 2FYUE 2ZVOB 3G1LA 1RR7A 1SFUA 1GZLA 1AQ5A 2E1NA 4PSWA 3T97A 3DLAA 1OFCX 3JCUE 3E5QA 2K02A 2K3PA 3ZQIA 4O3MA 1IFPA 4ZYHA 1U9OA 3N7NA 4EMSA 4ZTFA 1LWUC 2QQ9A 2VOPA 1Z6TA 1OR7C 1SQBE 2PN6A 4BBRJ 2CV1A 1NTZK 1OMIA 3HUGA 1NVOA 1FLIA 1EA3A 2AEMA 1W5CE 4XMYA 1N7SB 4BHCA 1Z21A 1RKWA 2Z2SB 2BV6A 2FBKA 2ZCWA 3GZ6A 2Q2EA 3R0AA 3CCEI 1M1JB 3RPQA 1I1GA 3RTRA 1JUMA 1YOVB 1BJAA 4A0ZA 3L74J 4YIFA 3C1DA 3SSUA 2IW5A 4YPCA 2DT5A 4M3DA 4B8XA 2K9JA 1ODDA 2HPIA 2PQ8A 3JSVC 5KAIH 3BROA 4XLPF 2K40A 1G3SA 2A5YB 3BLYA 1SMYF 2IPPA 3P8CE 1QLED 1LTBC 2VQCA 3K5BA 4TV7A 2KDOA 5GAGJ 2BASA 2VL8A 5GTIH 4FASD 3VP9A 2XAHA 1D0YA 3HGYA 1V5GA 5DTDA 4H0EA 2QEXP 4IF4A 1FJKA 2YPRA 4DW6A 1Y39A 3GHGA 4LOCA 2R7ZJ 2JA7J 5CVRA 2LOOA 1SFCD 4V2GA 3RYPA 2IZ0A 2M3BA 2JO1A 1TNTA 2R5BA 4GOEA 1UIXA 1U0JA 2CG4A 1QPMA 3H9JA 2R32A 1X1PA 3LSJA 4CCMA 3A1YA 2STWA 2MYSA 3T0YA 2QSIA 2MC3A 3A4CA 1B9NA 2LH9A 1HKSA 2ZMEC 3FBIB 2VBZA 1TBXA 1YG2A 5HLTA 1VQLI 1M57D 1GL2B 1RF0A 1ZLLA 1QQIA 4WXDA 1LFPA 2HZTA 4AU7A 2F4OB 2OQGA 4AWXB 1M7LA 2V4HA 3OAKA 1WJEA 2ZFCA 1FP2A 1R5GA 4QPQA 1MJ9A 3V2NA 2E34A 1MD0A 5FKKA 2HZDA 4E70A 1YX5A 3VMXA 2A05A 2FJ1A 3BJOA 2I10A 4JK1X 1RF1C 5D5XB 3OYMA 1RE3A 5B5EE 4LGDE 4IL6C 3MZWB 4MNUA 2G7UA 3JRAA 2D5VA 2NVUB 2WY7Q 2QM3A 1N7SD 2NS0A 3DTKA 1ZP0C 4CH7A 2VQGA 3OR1C 4M74A 2VIXA 4C9YA 5AW6B 1FDOA 1WFXA 4PFOA 1LTTC 1OX3A 4C46A 1LVAA 5D4RA 3VEPA 3L70G 2KJBA 4UB8C 2D1VA 4XNFA 5HS9A 4KNYA 4I6MC 3M1EA 2VPLA 4F7ZA 3AEGC 4HAMA 5K1YA 4NPFX 3K70C 3RK3C 5GTHC 3MZHA 1POGA 3IWFA 5AW5B 2B88A 2OTLP 2M7AA 4RGRA 1GV5A 3GTPJ 2N9YB 3II6A 5AVVB 3F8MA 4PJ0H 3A0BH 3C9IA 2O1JA 3CMMA 1JHFA 2DK5A 3PL8A 4ENKA 3M0DA 4CDGA 1NJIQ 2D2CB 1T8IA 2VKHA 3G3ZA 1EQ7A 2FYUK 2Y9ZA 3G4SI 4Y28J 1Y0UA 4DZPA 3H1LG 3BR2A 2DO7A 4D6TE 3VYSB 1S5LX 2F2EA 1VQ5P 3H1ID 2E74B 1JM0A 1QHHD 3PLNA 4II3A 2XGDA 4BS9A 1NHAA 3BP8A 3H5RA 3FXMA 4M72A 4BL0B 4BDYA 1B8IA 2Y0EA 1NG6A 2XGEA 5HNHA 2ZB9A 3CX5D 1S7OA 4HOBA 2HYGD 3BZKA 3ZQLA 3PP5A 1VQ8I 2VBWA 3A0HH 3BR1A 4P9UA 5M3MJ 5KNLA 3SJMA 3L72E 2ZSIB 1B72B 1GVDA 2L4AA 5TRDA 3BATA 3K1PA 1N8RQ 4DQ2A 2AEJA 2KIQA 3H1KG 3VMAA 3MWMA 3L71G 2GBYA 3RKYA 1VQLP 4Q47A 1B72A 1P4AA 4PV1C 2DDAA 5CJ9A 2W7NA 1I3QJ 3HOUJ 4G94A 2BY3A 1JY3N 2HFED 4P9FA 5KCMA 3MKYB 1R22A 1OCRH 2R5DA 1VQPP 3WGGA 3SDBA 1MNMC 3QWOC 4YTPC 3BOQA 2H8WA 2CQNA 4E6KG 5IT3A 2FKWB 3IRRA 4IKFA 4UVBA 1T3UA 4R4LA 2JSPA 3QPTA 5AW1B 4DZOA 5KTBA 2R0QC 1NTCA 2LKXA 5EZHA 4PJJA 3IF4A 3V5BA 3CF2A 1AKHB 2BEOA 3K6GA 2QCOA 4AYBA 4A3CJ 2ZT9D 1W4MA 3CDIA 2R7TA 3IAM2 2KISA 3S3NA 1NU1K 3S2DJ 2WSEH 3KLOA 1RY3A 4YXWH 5KLIB 1RE3C 3KPHA 2NPSB 1OYIA 3P7NA 4HX7A 2BZTA 4M6XA 4BNCA 4OOIA 2FQ4A 1JGSA 2CUFA 4XN0A 3OYBA 4FX4A 1KU7A 1PFIA 4I01A 4NQWB 2PEXA 1F4KA 1V54H 2XF6A 3KEYA 4XR6A 1NU1D 3CCUI 1VF5B 1URQC 4J01A 1SVMA 3MFKA 3CC2I 1N86A 2IGNA 4KIFA 2E43A 3KLNA 3HSFA 4JBAA 4YEJA 3V4WA 3OYGA 2CW8A 1AV1A 1U7MA 3BCCD 3SWKA 1TL8A 1T8ZA 2NNYA 2Z5UA 5DDGA 3S2HJ 2H6CA 1XTCC 3NTNA 2P81A 2OYOA 1YYCA 2N9BA 2Z5IA 3D70A 4C7NA 4I7HA 2LC2A 4IX7A 3LAPA 2RNGA 1VPCA 1FNNA 4RDUA 2FQ3A 2OTKE 1L3LA 1VF5C 1E3OC 2X6WA 4IJAA 2DPUA 2L5GB 5FKNA 1VQ5I 1D5YA 2R7VA 1KB9D 1YRNB 4CUGA 3QPHA 1RUOA 3MMYB 2W83C 3ZMVA 4L9NA 2K4BA 4NPDA 5DJTB 3BVHA 3VB2A 4R1HA 1WT6A 4DYQA 2Y69H 4IXAA 1X1DA 3S1RJ 2EV0A 4KA4A 2FYNC 3CUQC 1FYLA 2CW7A 4KJMA 2IBZG 3ML6A 2VXDA 1RNLA 2UZKA 4N78D 4G8XA 3RKQA 3GHGC 2A06G 5AVSB 1WH5A 3L70D 3L9FA 1PYVA 3V7RA 3CCJI 4GT1A 4IOCF 3DTIA 2MG4A 2ZJ2A 1GT0C 1IC2A 3L1PA 3VYRB 2CRGA 5JI6A 1NK3P 1E3HA 3FHZA 1QL1A 1PL5A 3L2WA 3BPXA 3S2WA 1G1JA 4CO8A 3WTVC 2L7FP 5TISC 2WV0A 2ZFUA 3H1HJ 4RGXA 4BXLA 2EFQA 2WY8Q 3UIAA 3I56I 3ROUA 1L0NJ 2ISZA 1WWXA 3ZXSA 4I2LC 1P84D 1MMGA 5LHGA 3B71A 1NHLA 1FAVA 1VQKI 4YFKF 4EDFA 1B1BA 1H9TA 2QGUA 1KC8Q 2OARA 4M73A 4MLOA 2PI0A 1R8EA 3ZQCA 3BQYA 5JLXA 1ZXGA 2KZGA 2WB1A 2HG5D 2W6JH 1YJNP 4H0LD 4HEA2 2LRDA 4ESFA 3K69A 2KNCA 4MN4C 3WE3A 1DUXC 1SQPE 4GODA 1EXJA 2H27A 2E76D 2DAOA 1ZGAA 3QP5A 3TO7A 3BG9A 4CA0A 1ZRTD 2QJKC 5CCGD 3O8GA 4CYCA 5C3EJ 1NWQA 3I58A 4LLLA 3I4NJ 1P6RA 4UUSA 1LTSC 3OSGA 3QU6A 2Z4EA 2LSOA 3GXOA 1N7SA 5CCGC 2JN6A 2XB0X 2XGCA 4B86A 4NUBA 1D7MA 2CSOA 4HF2A 1TWHJ 4YG2F 3FX0A 4LLHA 4BQAA 4IHVA 4P55A 2IA1A 1ZV8A 3OS1A 2VI6A 1IRZA 4Q48A 2W27A 1T2KD 1DU0A 3LSTA 2O01H 3L73E 2EWNA 5E1ZB 4BQOA 1HKTA 3V42A 4OIOF 1DH3A 3PTZA 2KJCA 4HNVA 4A3MJ 3DWLE 1GU4A 5LGUA 2WMMA 1GTWA 3HSRA 1R5SA 4PD4H 2M8GX 1V5FA 1VNDA 3VYUB 1O7LA 1XCBA 3W6VA 4GOFA 1VQ8P 2N1TB 2NRGA 1IN5A 1TQIA 4WY4B 1U6GA 2QYOA 3GMEA 2CO5A 1MMAA 5B66C 3BG3A 3K2ZA 4OWRB 2E7XA 3TMOA 4HF1A 1IO4A 2ELJA 3BR6A 3T1BA 2DDBA 3AE3C 4MHGA 2KLOA 3SHFA 4AUXA 1IDZA 1P84I 4PD4E 4EVIA 1LTJA 3KEOA 3FMSA 1GHCA 1APLC 1ZG5A 2VBYA 3HTKB 3F3XA 1JCCA 1RE4C 3GTMJ 2GIVA 1ACIA 4AD9A 1USSA 4AVZA 2IT0A 1MFZA 4MFDA 5KAIC 4M3LA 3OYAA 3OYFA 3D5SC 2VJ5A 1SQXE 3AE2C 2JEEA 2HDDA 1SQBJ 1EJ9A 2H89C 3KP5A 1SQVK 1EZVG 1ZREA 3JCUH 2E1MB 2LF7A 1T98A 1EDJA 2PGDA 1GL2C 5E8IA 5AW8B 3PJSK 3SXYA 1WKMA 3K9TA 2KDZA 2HKOA 3HD7C 2M0CA 1HLVA 3SEQA 4Y13A 4I02A 1GL2D 2L7KA 3I5UA 3A2AA 4JX4A 2ZYDA 1RHZB 1MH4A 2FU4A 3WG9A 4U7BA 1DEBA 2R7OA 1U5TA 4W80A 3KQGA 5IOYA 1WCMJ 1KILB 3T5XA 4M9ZA 2VQLA 4W7YA 3H1IG 2HOSA 3Q0VA 1KMIZ 3A0BC 2OTJI 1T39A 3E6CC 1KV4A 1D3YA 3I54A 1Q82Q 5K7ZA 1WJDA 2EILH 2R7QA 1FZAA 2K7LA 4LGWA 1M8OB 4UUVA 5DCMA 3FISA 3TKYA 1GMJA 1VQNP 2PMHA 3DXJF 3F6OA 3F5HA 4ANJA 3OYJA 2X9DA 5K5RA 1A5JA 2JQ7A 2KK7A 2Q1KA 3PIOF 4CGZA 2E71A 2DYRH 4MEYF 4ZH4F 2LY1A 3ZQGA 2YMKA 2L3DA 2HNHA 1J1EB 5GP9A 1IZNB 1SD4A 5APTA 1AA7A 2DXIA 1KYOE 4PK4A 1A04A 3LA2A 2OGUA 1XB4A 2P6TA 1LT9B 2XNDH 3FBNB 3H1CA 4O5VA 2K9QA 4GGGA 5L3EA 2QEXI 2FA5A 1N7SC 1URQB 2FBWC 4A5MA 3H1HE 4A3IJ 4Y17A 2QKMB 4D6TG 5EFWB 1MBKA 2YR2A 4EJUA 5KK1A 3SEZA 2E5TA 2CH0A 4G9YA 1BCCE 3KPEA 2DMQA 2DJIA 2XNXA 2QKLB 3H9QA 3K7AJ 4RM2A 1G59A 1QRYA 2IBDA 4IFMA 3QRFF 3IRQA 1PP9E 4Y52J 2WADA 4ZZLA 5M5XJ 2JUCA 1UCRA 4FTHA 2PJRB 2W6AA 4U3FG 2FNAA 3HD7B 5J1YA 5KLVJ 2IRFG 2CQXA 3S16J 1BJZA 4MTEA 1VDFA 2IFNA 3SDGA 1KQGB 2ME6A 1LTIC 4U0VA 1QVTA 2KZJA 3HUSC 1YHQP 2K9SA 2QSFX 2JVGA 1CI6B 2JKVA 3R60A 2W57A 3MVPA 5FROA 2RGVA 3ECHA 1A6QA 2DOFA 2W1OA 3BG5A 1YJ9I 3CC4I 1NTMG 4OH8B 1QU3A 1U57A 4NPEA 2M8RA 1N73B 4BY7J 5K5QA 1XDUA 4I1LA 2LY2A 1IW7F 3PJRA 4IFDK 1WI3A 2HS5A 3BTCA 5HS7A 4WCGA 3G6EI 2ICWG 2WPSA 2ZT9B 1A31A 2BY0A 5D8LB 5A2QZ 5C44J 1RUNA 4WVZA 1HBWA 3RKWA 4QTRA 2WT7B 2V4JC 2V79A 4DJGA 3GLLA 3CD6I 4H0LC 3CJRB 3KYCB 1BSHA 2QIWA 4BRYB 2CQKA 4HX4A 1WQ2A 2E2HJ 1MDMB 3AG4H 4WY4C 2E76C 1DEEG 1RF1A 1S7EA 2QLZA 2Y9YA 4KFCA 5GTHE 1FBUA 4G7ZF 1E3PA 1PUEE 2G0EA 2YS9A 3B5NA 3HE5A 2JPBA 1KQLA 4R8HA 4Y15A 1OW8A 3IUOA 1M90Q 3LA3A 2RMZA 3BRTB 1QVUA 3CJNA 3GFIA 4EGYA 2PLYA 4A3BJ 2KL4A 1YLFA 3TGUG 1L2PA 3KZYA 2M30A 1J2XA 1RI7A 4L74A 1MJBA 3CMEI 4L9JA 2A45G 3MQ0A 2CU7A 1SMTA 2FUG2 3HTUA 1JTHB 2WSCJ 4HBLA 2O7OA 1X22A 1ETQA 2DMNA 3KX2A 3U1CA 1AA0A 3JRCA 3GTKJ 4HH2A 2Y75A 1HVVA 4HRIA 4BJ5C 4DOZA 3J81Z 2O3JA 1BDDA 3RGUA 2Q3IA 5LRRA 3OS2A 4PD4D 1X3ZB 3SFZA 3WE2A 1WZ2A 1YIOA 1JTXA 2PG4A 3TW6A 4C3HJ 2QBYB 3G1MA 1QZYA 3HC7A 3I71A 3KE2A 1N77A 2UUZA 2QJYC 3VTPC 3KEQA 4UXNA 4D0PA 4CPGA 2QQ8A 1J1DB 3FK6A 1EV7A 4KN7X 4N4NB 1I5ZA 4PJMA 3M0DC 4W97A 2Q7CA 4DIQA 1HA8A 3I4PA 4DCKA 2OYHC 5CHXA 3CLQA 3F8NA 4PSXA 4PJNA 2V1XA 1A02F 2OTLI 1BA5A 1KONA 2E1CA 4UY8I 5KJ7D 1EXIA 2YX4A 4B48A 2FF4A 2FBIA 5E3LA 1J59A 2VASA 1UHMA 4JX6A 1Q86Q 5EEHA 3JTHA 4UB6E 3F21A 3CCLI 2L9VA 2X6OA 1SQXD 3CCJP 1FEXA 2B0LA 3MN2A 4DGWB 1R36A 1S9HA 5AVUB 1R7JA 5L8RJ 3LMMA 5KVRA 4V2FA 2QWWA 3VYTB 2VT2A 1K8AQ 2DA1A 5LEKA 3K10A 1MBHA 2LDUA 3HD7D 5JVTA 1R5ID 1IF1A 2M3EA 3CCRI 2E5NA 1WMKA 1P7IA 4H4KC 4XORA 2W82A 3UR3C 3HPHA 2W6BA 2KZVA 1MW7A 1BGYE 2HXIA 2OD5A 2Z1DA 5D6EA 2AS5F 4B44A 1UAAA 2IGMA 4IZZA 1HDPA 2QVAA 2RDPA 4ENNA 3DV8A 4GDFA 1LWUB 1NTKE 3H1IJ 2VPRA 3CQZJ 3PFIA 2KMUA 5M1BA 3L00A 1YIJI 2HYFA 5IYBJ 2H88C 3S14J 5AVYB 3P9CA 2E2JJ 1I39A 1BR4A 1LNQA 2C0WA 3Q5PA 1XTGB 2TRTA 3B73A 3HXLA 4A6DA 3RDIA 4HQEA 1XGSA 2VJJA 3KZIE 1CW5A 3PSIA 2BCCG 3I0TA 1JCDA 3E1IA 2QQAA 1JY3O 3BR0A 4Z1MH 3V2RA 3G73A 5D6FA 2GXBA 1FZCC 2L7ZA 1DGWY 1EKEA 3ERMA 1H0MA 2CPSA 2IX7C 5E20A 3FXJA 3L75D 3M07A 4RAYA 3I55I 1X2MA 4IO9F 2X1EA 5KLVE 5FLXK 4RJTA 3KZIC 3VSKA 4RESB 2DA7A 3FXRA 2DTRA 3BCCE 1PGQA 2QM7A 2X51A 2KKOA 3CF5F 4ZDLA 1JJ6C 4XSZF 5AVRB 1ZH5A 1YE9A 5CPRB 1JGGA 4HYTB 1DQUA 1FX7A 4I0AA 1ORKA 4Y99B 3DEEA 4BAYA 1S5LH 2NXNB 1S9KE 4ESBA 3AKZA 3GFMA 1ZTRA 5F1JA 1YW8A 1FOKA 3M8FA 1FMWA 1RKTA 2R4GA 1IJDB 4HF0A 4Y3OA 2R5ZA 2EV5A 2V7FA 3AE1C 1QA6A 3L72D 2YKOA 5IT9Z 1HH0A 2WAFA 1ZHFA 4E7KA 4ENMA 4QPOA 2A45I 1WJCA 4NDLA 3M7GA 4XK4A 3MD0A 3B6CA 2AXTE 1TW2A 2DYSH 3FXUA 4V19K 3GTLJ 3AL0C 4OGQC 2AHQA 2DPDA 1XCVA 2SPZA 2DOAA 2LR8A 3BCAA 2C0XA 2H8RA 5DV5A 5DUKA 2DFEA 4RAFA 2MKVA 3H1HG 2FMYA 2XGXA 3U9GA 2A69F 2QZ8A 1TWFJ 2ZJQF 4J19A 2PAJA 3WHCA 2WT7A 3OL4A 2DMPA 3HRMA 1JKOC 3CCRP 4H44B 4XRSG 1BCCG 3LQRA 1DX7A 1UJ8A 4J00A 1OVUA 2GOXB 2A5WA 2P4WA 3S3MA 1ZR2A 4C2UA 2R44A 1MNEA 2OZUA 3VODA 2E36A 2BE5F 5FFZA 1Y0NA 1Y1WJ 4BEHB 1FZPB 4NC8A 1X4PA 2E1OA 1OR7A 3F9KA 4EIJA 4UB8E 5D4SA 2Y31A 2W84A 3KYLA 1L4AA 1U7JA 3CWBE 4XRMA 3V2QA 4ZKUA 1VTNC 4ENJA 5EF6A 5E3NA 3MKZA 1KB9H 2AXLA 4D9JA 4B09A 1NTMK 4I7ZB 3L71D 4ZJZA 4G6DA 5KKZC 1W5CC 3CCYA 2O8KA 3RZDJ 3DQVC 4XM3A 3HD7A 1ETXA 4TLFA 2HODB 2O3FA 1X8YA 2V7QH 4IRHA 4XBFA 3BC8A 3J7AO 2A61A 1QZZA 4E7ZA 2OU2A 4RLFA 2RN7A 3TGNA 1NKNA 3LW5J 3AAFA 1EF4A 3O3KA 2DK8A 1MUUA 1PJRA 4BXXJ 4RAGA 1J09A 3ABVC 3K4JA 2O5RA 4F93B 4BKXA 1MH3A 1XDSA 2MD0A 2FOWA 1SQQG 2XZRA 4I76A 3SWYA 1LT9A 1FOYA 4RGUA 4PGGA 4XKVA 3WHBA 1FS0E 3BR3A 1NKZB 3MHVA 1RIOH 4WBAA 2I8DA 2LP0A 2LR2A 2JA5J 3WUUA 2Z9OA 3HIFA 3ZDMA 1YI2P 3H36A 4Q5SF 2XKMA 1KU2A 2GWRA 2VBXA 4LG3A 1M56D 1SQPD 1ZYRF 4XICA 3F6VA 5LLQA 5KJ7C 2YSRA 1P4XA 3OIQA 3ZRGA 3TGUE 3Q2YA 4A69C 3CUQA 1YS6A 2ADUA 3BG6A 3IL2A 1FBMA 1VQMP 1NAFA 2BW3B 3HHGA 3RQIA 1K05A 4S05A 4XQFA 3J81K 2ECBA 3FKIJ 1L4AD 3KP4A 2YU3A 2QJPC 5J3LA 3E97A 3CCSI 1FU1A 2WTYA 2Y0SA 4LK1F 4N0BA 4NB5A 4DYRA 2WSFH 4H44D 1YYVA 1U5TB 3QQAA 2J58A 1ZELA 4PZJA 2R7UA 3WMM0 1HUCA 1T3JA 4NC7A 2B89A 4H44C 5ICEA 3NEUA 1SQVG 1TQPA 2K27A 4XOTA 3AEEC 1CGPA 5E79H 3I59A 2UWJE 5APVA 3CC7P 5H2FC 1HBXG 2A6HF 3L75G 2V9KA 2DT6A 2ESNA 2IDBA 1YBKA 1QGPA 2X1CA 2KIKA 4GFBA 3PUBA 3RPUD 5EG0B 4IHXA 3L73J 4FISA 4A2UA 1D5VA 1KB9I 1T0FC 1BI2A 1FE6A 1JMBA 4FCYA 1GW4A 1D0XA 3VYIA 2MH2A 2W25A 1XSXA 3N97A 5F08A 4XLAA 5BS6A 4WWIA 3A01B 1YTZT 3H35A 2M9HA 4OAZA 2TDXA 4DYCA 5F04A 4CSWA 1J75A 3CCVP 3QAHA 1QX8A 4II2A 2O01J 1ERDA 2VE8A 4IQ4A 2YXQB 3H1LD 3I55P 2IZ1A 3DLLF 4BYYA 1SFEA 3QU3A 3QYBA 1L0LK 4WY4A 3OYCA 1UG2A 1SQQK 3OL3A 2E75B 2NVXJ 2N1TA 1G6NA 5TISH 1MBJA 3F0CA 2F5VA 1QGKB 5IT9K 3S9OA 3FF5A 2V26A 3ONQA 3M0AA 1JUNA 3ASNH 4UVCA 1H0TB 2QQBA 1IFJA 4Y4RA 1GXPA 3E6BA 2W4SA 3EQLF 5EGOB 2LD5A 3I3LA 3Q3SA 1PP8F 1FZBA 1OCPA 2DA3A 3ERED 2F4MB 3NAUA 1LP1A 1QEXA 4A3KJ 1SQBK 1IDYA 1Z77A 4KN4X 2K9YA 2FYUG 1ON2A 1XX5A 1K6OA 1PPJE 2MA3A 1J5YA 2VODA 1DPUA 1JI8A 5C4XJ 3TQNA 5APSA 4BE1A 1NTZD 1T56A 3LSIA 2RC4A 4KICA 3RPUA 3TNUA 2FNPA 1GK4A 3K0LA 3TOBA 1IFDA 4K3AA 4L76A 3CWBJ 2J5PA 3QWLA 1IFNA 5E1XA 3E7LA 1MZ9A 3HRNA 5LGTA 3BCCG 3DBRB 1R58A 1X3UA 3ESWB 1KILE 2FE3A 1O7FA 2JWDA 1BBYA 3L2UA 2M5AB 1Z67A 1VF5D 3L4FA 2COMA 1W1WE 3MEXA 2Q9IA 1K78B 5HVQC 5J1UA 3V7SA 1WI9A 2HQ5A 1FC2C 3TDZC 5DM6F 2K85A 2NVYJ 4KIBA 1SC7A 1L4AB 3L35A 2FFDC 2A68F 5HDKA 3WU0A 1T38A 4PV1B 5F0FA 2K1AA 2WPRA 3FZVA 3A7OA 3EDPA 4F55A 3OY9A 1XMKA 1JEKA 2WPVB 3JRHA 3MKLA 3TBIA 1HF0A 3K4BA 5C4JJ 4LG0B 4G6QA 2VJ4A 3LIDA 2CUZA 1TT0A 3I5CA 4KIGA 1KTMA 2WAQN 3I64A 5FJ8J 3GX4X 1AQTA 1SQBG 1GU5A 2EJRA 2LK2A 1SQQD 3BR5A 5J6XA 2WWWA 3IFMA 1IZ1A 4GYIA 2YKPA 4KT6A 3ZN1A 2FYZA 2WPQA 4A7PA 3CP2A 1LFBA 1FOSF 3CLOA 1W5TA 1FZEA 2P5LC 2WSFJ 1GLNA 1F9NA 1SD5A 2KRCA 2OCEA 4E7LA 4RGSA 1YJ9P 5AW0B 2YO2A 4IOIH 2NVTJ 1K04A 3ZQFA 1FZFA 3COAC 2LKMA 2QJYB 3CJQB 1RESA 5A2QK 2R5YA 1NTZE 2R7XA 3L36A 1LJ9A 1YRNA 3WU2E 4L73A 2MH9A 2R5ZB 1I6XA 1KYOI 3U2RA 5GPAA 3HOTA 1LWUA 3PO2J 3RIRA 4ASNA 1GDTA 3H1JD 2AQEA 2WC2A 1HSTA 4KMFA 1XTAA 4BGDA 3NWSA 3HOVJ 3F8BA 3C2GA 3QP6A 5E79E 2X0LA 1YQ3C 3DEUA 5HLHA 5J1RA 1IRGA 3ZOBA 1EDKA 4NNJA 1I3AA 2K5CA 3H1HD 3I9V2 1KQ8A 2X4HA 1PDNC 2BOLA 2WB1N 2J5OA 2FYUD 3FDYA 1NTKK 1JKRC 3FWEA 3C3WA 3U1DA 1U9NA 3OV8A 3F22A 3RL0g 2L9NA 1IXRC 2K86A 3K4MA 3L70J 3H3ZA 4LLNA 2BCCE 3D5RC 3KP3A 2B63J 2X6XA 3GF2A 1L0LE 2V6EA 3O6QB 3AECC 1NTZJ 3LSHA 4MIMA 1B4AA 4PD4I 4XRFA 3PQKA 4IL6H 3Q9SA 5F6FA 1IJWC 3RJPA 3H3VK 5KAIE 1V4RA 1MJAA 3HRUA 5DJUB 1T08B 1NTKJ 3CP8A 4S04A 2M8EA 1XS9A 3LAJA 1WRJA 2XF5A 2IAIA 4LC1A 3TP0A 4WF2A 5LEJA 3FXOA 4EGZA 1O57A 1CZQA 2QVOA 3NRVA 2M5WA 1AKHA 4YFXF 2FEZA 2XAQA 1J7KA 2LREA 4C2MJ 3RZOJ 4RB0A 1N7LA 1P7JA 3EFGA 2IA2A 2XAGA 4HDUA 5APXA 3FK7A 2RN0A 5IP7J 3GTQJ 3DU6A 3OYLA 1OYYA 1W7PB 3P7KA 1L0NK 4WB4A 3H6PA 2MBFA 5IYDJ 3H1JE 3IKTA 2V6CA 2Y0DA 4OVNF 3BCCJ 1S8NA 4D7NA 1G3TA 1JMMA 1OXZA 1H89A 3C18A 4XKWA 4OINF 1IRFA 2YO3A 1WHUA 5DM7F 3M8JA 5CJ4A 1WGXA 1XD7A 3EUAA 2BHZA 2IS6A 4Y33A 2UXXA 1VQKP 4I99C 2OV7A 4XLNF 1WSUA 2R7FA 4Y99C 5FLMJ 1R5LA 3L75E 3TP3A 1EZVD 2K3RA 2P7VB 1B8IB 3CZ6A 3DTEA 2B7EA 2OZ6A 2VJIA 4EV0A 1NOHA 3IN6A 3ZCOA 1AVOA 1VQOI 1XPXA 1EDLA 1V5EA 1J1EC 3JRDA 3NXSA 1ZRDA 3FMRA 5CVUA 1M1JC 2E7WA 1MMDA 3FM3A 1OCZH 2WZ7A 1STZA 1ZG3A 2JUGA 1K4SA 5K5GB 4GRIA 2V9PA 3BJAA 1R71A 2DFFA 4WY4D 3QH9A 2W8ZA 3LSKA 1YX3A 4CCNA 4RM3A 3L2VA 1SQVD 2N1TD 1RQVA 1DP3A 4FQGA 5FLXZ 4EM0B 4FT8A 3BG7A 3FXLA 3DBLB 3H5NA 2NNNA 1IC8A 3S17J 1Z56A 1LVKA 3MKWB 4HG2A 4IPAA 3H1KE 1IO2A 3L71E 1UZCA 2HVQA 2R7RA 1SANA 1KZUB 4YRVA 1I27A 2LFBA 2LY9A 3B02A 1LFUP 3CDHA 4LD5A 4HQMA 3P5JA 2D2WA 1MDMA 1K7AA 4XKBA 2A06D 3DPUA 4U0WA 1CSBA 2KS1B 1KYZA 3A02A 2Y30A 4DBQA 1DDNA 3KP2A 1I6HJ 2RH0A 1DP7P 3HOZJ 1Q90D 2E42A 3GTGJ 3SFDC 2O61A 1W7PA 3IAOA 3Q0UA 4E4HA 2LTPA 5F0CA 3LL7A 5D8KB 2E76B 1U5TC 2PMZA 4LK0F 1BC7C 3BRVB 2UV1A 1E79H 3C2HA 2ZXEB 1LDJA 5J4VA 1O3RA 1UB9A 3HDDA 3MIWA 1EZVI 2DA6A 1W36D 2R3CA 1MBFA 1SQPJ 3DU5A 2L54A 4A3FJ 3M1CA 4B43A 3BT9A 4BJ6C 3V7CA 2F5EA 3DKXA 4ZYEA 3LOCA 2H6BA 5KHDA 1BOBA 2OYHB 1SVFA 4UV9A 5ILUA 3CPWO 4RS8A 2PJRA 1NTME 3UKGA 4EJOA 2F48A 3IV5A 2R7SA 3SZGA 2WWYA 2QSHX 1OCTC 1PP9J 2ZYGA 1R4NB 1Z0XA 3SZPA 1JB0J 2IBZE 5KAFH 2Q6QA 3P9KA 4FETA 2CWEA 4A3GJ 1IFMA 3GHGB 3O6QA 1B59A 2O03A 3BDDA 4XKCA 4LB6B 1L0LJ 3CO7C 3RCOA 2KHMA 2DA5A 2ZC2A 3KETA 5CMZA 1QVGO 3ZQ7A 2OBPA 1K79A 1U8RA 3WTWC 3CO6C 1URQA 4D6TJ 1E2XA 3SQNA 2HI3A 5FO5A 2HDCA 3H0GJ 4PV1D 3CTAA 1KQ9A 3BTJA 4ITVA 1F5TA 4H13B 4AYBN 3O8HA 1GVJA 1E0EA 2BEQD 3CMYA 3J7AY 1JXSA 2P7JA 4DOJA 1S4XA 1JY2P 2MW8A 3ZGKA 3EWKA 2LNBA 1BE3G 2OF7A 1NU1J 2C6YA 3L74G 5B3SH 3G9RA 5E79C 2XSJC 3JW4A 3R2PA 4AIDA 1M1JA 2Y0SN 4BDZA 1KFNA 3UNGC 4BE2A 5KKZB 1FIPA 2RNJA 2POHA 1LT9C 2IA0A 1E5WA 1T33A 4A3EJ 4ABZA 3CMEP 1RZ4A 2NS7A 2R5YB 1KN7A 3WUVA 5AW3B 1AJYA 3P9IA 3U59A 1UMQA 2ME0A 3ZN0A 4DZJA 4IOAF 1JY2N 5HODA 3D1NI 3IWZA 4ASVA 4DT0A 2HQRA 2GLOA 5JLWA 2K37A 2ZNZA 3KIOA 2E75C 2EA2A 4N78E 1FPQA 2QRXA 5E1WA 5AW9B 3RBXA 2LXBA 1UHSA 1EDIA 4CCOA 1VF9A 2HWVA 2FRHA 3ASOH 1H8AC 1HF9A 1TWAJ 2FFDB 1RRJA 2VQHA 2M3AA 2ZMEA 5M3FJ 2KRHA 3WUTA 1FC3A 3Q3DA 5J8FA 4DJAA 1J0RA 1UELB 1LB2A 4AIJA 3K1NA 3GG2A 5EJCA 2B9SA 2L91A 1JOCA 1G2CA 2DQRA 2HTJA 5AVZB 4I98B 5CKTA 2DMUA 1RQUA 1L0OC 1LDDA 2O6GE 1V55H 4MGRA 2E5YA 3ZMDA 4HLYA 1P84H 4BE0A 3H3UA 5GTIE 1R4MB 1K78A 3S1NJ 1IRXA 3IH4A 3TGUJ 5GAHJ 2IBZI 3RK3E 3R0JA 1BL0A 2M5AA 2WSEJ 2XPWA 1TP4A 1Y6IA 2DT7B 1BIAA 2BVMA 2EFWA 1P92A 1ZGWA 1KD1Q 2MLGA 3S32A 1O3QA 3TGUD 1MMNA 2BY1A 2ITAA 2KSJA 1AFOA 2CFXA 1QHGA 3ITKA 1P9QC 3TNUB 2XAUA 2JVHA 2NYXA 3FWNA 5H2FE 4AM3A 2M45A 4BACA 3PNTA 1PUFB 4IVNA 5KJ7A 1Z7UA 1EZVE 4B1RA 3FWLA 1P2FA 1K83J 3JSPA 1BR1A 2M2EA 3K4LA 3RSNA 3CDLA 4XLFA 5DEQA 4IHWA 4IL6E 3E6DA 3GFLA 4KJZA 2K4JA 1Q7YQ 2WSSH 2N1TC 2PBIA 3VFZA 5JFRA 3LSRA 3M9BA 1TWCJ 1YIJP 5EGOA 3GWZA 1J2JB 1SQVJ 3L2QA 3JAMK 4PJLA 5E18F 2EIKH 1NK2P 2DA4A 1PUFA 1BE3D 1J1DC 4XA4A 3HBLA 1X58A 4U7JA 1Q1HA 2IVMA 1R23A 4KT5C 5KLVK 5J8CA 1Y8AA 2ZSHB 2L01A 3DBHB 1QPIA 3PH0A 5AVXB 1XGNA 2OA4A 2Q1ZB 4GCVA 4XRSA 3W6JB 4CYCB 3H1IE 4EI2A 3W2WA 4A3LJ 3F72A 3S3OA 1BIBA 1SQXG 2ZO4A 3EQ2A 2KNCB 2JWTA 1I50J 3KZZA 4L18B 1D1BA 2A45H 2Z99A 1IUYA 1VQ6P 2IEKA 4JYKA 2FMLA 4EQQA 1FOXA 5AW4B 1L0NE 3HOYJ 3GFJA 2EIMH 1MGTA 1LDKB 2OJED 6PAXA 5LFAA 4I09A 4KYWA 3GYHX 5FKMA 5FD6A 1OIPA 3IHUA 3Q5FA 3BZ6A 3LSGA 1NU1G 1LTJC 3CCLP 4RKUJ 5BOXA 2P5KA 2WAEA 3WGHA 5EG0A 2JA2A 3V4GA 1ZW0A 1FIAA 2OCCH 5APQA 4OGQD 4HB1A 5LBQA 3CCMP 4MFEA 1GD2E 3H32B 2R3SA 2KXPB 2H09A 5H6QA 1TC3C 1ITYA 4ASWA 3N4MA 2L5QA 3JREA 1YJWP 4UNOA 2FFDA 2XPUA 1OPCA 2YNYA 1BI3A 2RKHA 4C3IJ 1FJPA 3KYDB 1FOSE 4D5FA 3VMZA 4UUTA 4IHSA 3KP6A 4B3AA 3PNYA 3FM5A 4OAYA 2DQLA 3ZMZA 2XC7A 1OJLA 2A6TA 3AE4C 2ELHA 3A3YB 5E8GA 4Z6YA 4WXCA 2ZJSE 4AQRD 3TDKA 1X9VA 1X19A 5L3FA 5LD2C 2OUMA 1H89C 1IAWA 1MFTA 1DIPA 3GW2A 2MSYA 2D2CD 2VT3A 4YFNF 2JMWA 4CCJA 2ZVNB 2BW3A 2HYJA 2H94A 2V1DA 3MGNA 3JRFA 1X1BA 3CUOA 1NTKD 1K73Q 1VQ4P 1B6AA 3WTZA 3CUQB 1IV6A 2XV5A 1ZRTE 2GOMA 1IN6A 5LHHA 1YJWI 5E3MA 3L2CA 2ZJPF 5M5YJ 2CFOA 4ZDOA 1WJFA 1LE8B 2IBZD 1F36A 2XRLA 4G7OF 2W00A 2BXZA 2DN0A 3WTUC 1USTA 3JR9A 1VQ9I 3CC2P 1JO5A 3ZQHA 1PP7U 3KHUA 2Z5HA 2PP6A 3P8CD 3B6AA 2CUEA 4O6JA 5CQGA 3R61A 3S93A 2FXAA 2YXRB 5KLVD 1HDDC 2R7WA 1H88C 1D1AA 4HSTA 4HA8A 1LEAA 2RQQA 5APWA 3K4CA 3HKZN 4LFUA 3TSIA 2BXYA 2XKPA 3LWFA 4ZKPA 3H5AA 2K9MA 2M7BA 2P10A 5EEAA 2KQRA 4JOMA 2D1HA 1HKQA 2DODA 4QWQA 3FMQA 1MZBA 5K7HA 3Q1MA 1W2EA 4M3EA 3H1JJ 2HODA 2X6YA 1SQQE 2L2OA 2WITA 3U1KA 4LMYA 1BI0A 3BY6A 2V1UA 1OWAA 4UB8H 1PGJA 2LVSA 2PFBA 5TJHA 2M4GA 2CGPA 4M3FA 3OYEA 3ZQQA 4YELA 2HR3A 4BEHA 4BXFA 4AIHA 2MD5A 3JAMZ 1MNDA 3C2BA 3HUSB 2KRFA 1HQCA 3HM5A 3M9HA 1Q1VA 3M91A 1XMXA 4A93J 4HKZH 1ETYA 2KIFA 1HCRA 3O6BB 3VSLA 1VQPI 4KISA 1HXDA 5DCFA 3HE4B 1S72P 2ZKZA 4X0GA 1W0UA 2IFMA 3HZJA 1JUSA 2KS1A 2F6CA 4D5CA 2GUSA 4EJWA 1YTZI 4K35A 3GEZA 3DF8A 4CICA 1ZN5A 3TF5A 4YIRX 3AE6C 3PNVA 1DD4A 1Z3XA 4CZCA 4B47A 4ZYDA 1BC8C 5L3CA 1UHWA 1FZGA 1GW3A 1NGMB 4RBOA 3M3YJ 2BYVE 1A35A 2HDWA 2A07F 3NARA 4ZZDA 3ABMH 3N4XA 2KP8A 3A03A 2JA8J 5CCGA 1YFHA 4AC0A 3KZIH 1K9MQ 2WA0A 2LBFA 3J7YJ 3LIEA 4EM1A 1YO5C 1WRGA 4FHTA 2FSWA 4L5EA 2CYYA 1SQBD 3GLMA 4H13D 4IHTA 3E1SA 2JTVA 1SLQA 1VQ9P 4D7MA 4XSXF 3JSOA 4OWFA 2EV6A 2BBYA 2QF7A 2DJNA 1KYWA 1W36C 1DU6A 4XONA 2V9VA 2K3FA 4M9XA 2E60A 2ETHA 4MEXF 2HU9A 2LYCA 1AOYA 4BUPA 3TOAA 5FGMA 2Q5UA 3E7KA 1ETVA 1KQ0A 2IXSA 3JCUC 3OYDA 1HGVA 2H1KA 1JY2O 2P5VA 1MBGA 1YS7A 5ILSA 5CLSA 4IRIA 4YIIA 3L72G 2UWMA 2NPSC 1MIJA 3GF3A 2A3SA 2CV2A 3BTIA 3HTSB 3IR9A 4EATA 5J47A 3PQJA 2E5ZA 4R4MA 2FXPA 1G3YA 2M1BA 3K4NA 1JJ8C 4EYYQ 3D6YA 2XVCA 3WTYC 1BM9A 2NRAC 3A2KA 1I1SA 2IJLA 3VDXA 1X1CA 4HNTA 1A36A 2VB6A 3R6SA 1ZRCA 2AEFA 2JR8A 4JQ0D 2FXMA 2QA4P 1ZQ3P 3GF7A 4F52A 5FKOA 5HNFA 3MZ8A 4L0YB 2EZKA 5H20A 4HJGH 3ZR8X 2GXGA 4CCLA 3DKWA 3HHHA 3CL3D 2DOEA 1PPJG 1T0FA 3KXDA 5KAFC 3JRBA 2BY2A 2JRMA 4L9VA 4LITA 5EEGA 3HG9A 2CV0A 2IS2A 4IFFA 1KQFB 2VONA 2VKDA 1NTKG 4L5JA 1S5LE 4AIKA 2IGOA 2ZFWA 5TJJA 1S72I 3CC4P 2R7DA 1BOAA 1X4OA 5FD5A 3X2QH 4OU0A 2Q8KA 2QJPB 4H0LB 3SWFA 4B4CA 4PUSA 1OYWA 3M9QA 3T8RA 3MAJA 5FLVA 1OQYA 1Z05A 2L7MP 3JRGA 1GL2A 2FXOA 1ENHA 5FFXA 5KLVG 1Y1VJ 3CI9A 2JPCA 3BCBA 1T2KC 2JZYA 3W67A 1NU1E 1SFKA 4X6AJ 1GUUA 4HSRA 3K1MA 1U3EM 4KUMA 3LW5H 2A06E 4JPZB 1O4XA 5B1AH 1OVVA 1YJNI 3CCQI 3GO5A 3SFEC 3M9AA 3CCMI 3RK2B 3FXKA 2O0YA 4N9IA 4AYCA 1SQQJ 1H9GA 4F91B 1G4DA 2FYNB 1NO4A 2Y0CA 2Z16A 4HDVA 2VC1A 3CCVI 1D8JA 1LGHB 4OGQB 4XLHA 1ON1A 2J59M 3AEFC 1T6AA 3V8KA 2KI7B 2DW4A 1FMVA 3GCMA 5IOZA 1V3FA 1Y8QB 3GTJJ 1PZQA 1ONVA 1IN4A 1D1CA 4UV8A 1FDMA 2AQFA 1Z9CA 2LKPA 2KZIA 2M87A 3RK3B 4E7SA 2QENA 3E5UA 3HGGA 2F5DA 3D6ZA 2VKEA 5IP9J 1ZLKA 1G1IA 4I6ZA 4LIVA 3ELKA 3ZPLA 2XSDC 1NTZG 1OZHA 4ZNCA 3USSA 2XPVA 2Q2EB 3AE8C 4N9HA 5EDNA 1JTHA 4I7ZC 3OYNA 4JBZA 3WU1B 2IS4A 3CCQP 2DLLA 3WODF 1SAXA 2ZAEB 3CXHD 4Q4ZF 2DFHA 3KFWX 2E2IJ 2OYIA 2KLUA 1ETWA 1D0ZA 1WJAA 1H88A 1PGPA 2B87A 2KFDA 3CWBD 1Q81Q 3K2AA 4RMNA 1EC5A 4E7IA 2DU9A 3P32A 3A5TA 2KLVA 3RL0D 3F89A 3WTXC 3T97B 4UVAA 2YU9J 3AG3H 1TNSA 1ZG1A 1YW9A 1LTGC 2P0WA 1W7PD 2JJLA 4RB2C 4BRYA 1OISA 2L9SA 4EJTA 5FKLA 3DEWA 3E0JB 2CPBA 3IP4B 1OW6A 2CJJA 3BPVA 3OYIA 3L73G 3AEAC 3EUHA 1U2WA 1R1VA 2GM4A 1BW6A 1L0LG 2ZXJA 3E3VA 4MQVA 4LG0A 3TW7A 2Z33A 1HW5A 3OWTA 1RE4A 1FYMA 1TU3F 1YQ4C 3EFFK 2LF8A 5DS9A 4CZZA 5ICFA 5F1RA 3RQ4A 1RETA 2KIUA 5FB2A 2E75D 3LSPA 1Y8RB 1YITP 4F92B 1Y9BA 1BI1A 1EH7A 5C39A 5BNGA 2I1JA 4HV6A 3RYRA 5HDNA 1NH4A 2DTZA 3G6EP 1ZK8A 2NOJB 1NAYA 1ZR4A 3QPSA 1ZARA 3MCZA 3L70E 5BPIA 2WSCH 1HSJA 2ZYAA 1LPQA 3CESA 3RL0B 2JWAA 1BGYD 2RREA 5ERIA 3OW2O 5L3DA 1VQOP 2JP3A 3VOPA 3L2RA 4ZYGA 5L3GA 2X85A 3O8ZA 2JDIH 3B5NC 1XGOA 1JKQC 4XE5B 3H1JG 1Z6RA 2VXZA 2GQQA 1KB9E 4JYBA 1HW1A 2G7HA 1CF7A 3HRTA 2YMYA 5GADJ 1LP1B 1N2DC 3ZMTA 5D5VB 3KYQA 1FZCB 4PGHA 3FIWA 1PGOA 3E5XA 4CXFA 2VC0A 4M71A 3FXEA 3L72J 2NPSD 2VKVA 2HPCA 4MQ9F 3ZMSA 1H0TA 1AWCA 5DD8A 3ABUA 1R1UA 1SFCC 2AXTC 2EH3A 1FBSA 2VRSA 3M8EA 1A02J 1KILC 1FTTA 4WK8F 3MUDC 2XF7A 3REOA 3PHLA 1Z91A 5ILVA 5DCMB 3WTTC 1TT5B 4M6VA 2F4IA 2EIJH 1BE3J 3GMAA 3GUDA 4HX8A 1LT1A 4N6JA 4FE7A 4BHBA 5KAFE 3RK2C 3J7ZI 2EZLA 3LQQA 5HLGA 1FJLA 3A01A 2B9BA 1ETKA 1XSDA 1KQSO 4WXHA 2X1DA 2EK5A 3S15J 3PM1A 2EINH 3VP8A 3CJTB 4RAZA 4W1UA 1OVRA 2QJKB 4Y7NJ 1USEA 4GXOA 3DP7A 4HNUA 2KUBA 2CUJA 3JTGA 5HDGA 1BW5A 1JT0A 3CXHI 1OCCH 2W24A 3VN0A 4FX0A 1YHQI 3QODA 4BQQA 3Q9VA 3D0SA 1T6SA 4LLGF 3S1MJ 3FXQA 3HOSA 1TW3A 3I59B 1BR2A 1LEBA 3GLXA 2QUFA 4M3GA 1PVEA 4PJ0C 4QIWN 1ZRFA 2W90A 2GIZA 3ABTA 3MD2A 1MKMA 4BU2A 1HWTC 2W85A 3EUHC 5JHUA 3CMAP 3I56P 5IP6A 3HPGA 2ECCA 3E6MA 2DFIA 3M06A 3J80K 5AW7B 1KGSA 3GW6A 1JUPA 1RH5B 3HTKA 2E74D 2V1NA 1NG7A 3BJ6A 3TEDA 5DUIA 1LTJB 1IXCA 1IFIA 4U3FE 1M1EB 2PMUA 3TK1A 5ED4A 1FSEA 5GTHH 1FOWA 1REPC 1FY7A 2G3AA 3CCUP 3PSFA 4C2TA 3H1KJ 3FXDA 4O9BA 1LUJB 1X3WB 3SFIA 2VE9A 3L71J 3R4YA 1W2BO 1VFCA 1W0TA 2P58A 1KZHA 4OIQF 1ETOA 5E17F 1BSNA 3C8VA 3HSEA 4U88A 5JHFA 4OIRF 5M5WJ 3SZTA 2G9WA 1SQXJ 2FX0A 5BPDA 2Q3EA 5AVQB 1T2KA 2LG4A 2RVCA 1S5LC 4M3BA 3W3CA 4RB3C 3A0HC 4A3JJ 2O9LA 4RB1A 4Z2YA 4A12A 4XIDA 3VWBA 3IH2A 4K2EA 4ZYAA 1ULYA 1HTLC 1BDCA 4U0YA 4YXDC 5CCHC 3L7WA 1K61A 3H9GA 4A0YA 2JRTA 3HYIA 2B87B 1SFCB 3A0HE 1TWGJ 4P5OA 3KCCA 3NQOA 2XB5A 5CVJA 1BGYJ 1EH8A 1PPJD 2FBHA 3V8LA 1XC5A 2VLAA 2OYHA 2OYIB 2JSCA 3H25A 4BXUA 2YX7A 2IGKA 5B1BH 1L0LD 2HOAA 1MV8A 1ZOYC 1ZN2A 4BBSJ 4UUSB 3DPTA 2LXCB 2HQNA 3V8JA 1VZ0A 2XDJA 4IL6X 3A0BE 3QYFA 3V6IA 1FP1D 3OOPA 1XGMA 1R6RA 2MJZA 2XAJA 4XLCA 3BWGA 1KFMA 4KMUX 2FY8A 1SEUA 3W68A 3WU2C 5LGNA 3QOEA 3OS0A 2HPMA 2ID3A 1AU7A 3NFQA 3W2AA 3DFGA 3L37A 2HOTA 2WVRA 2H43A 2V7QJ 1YTYA 1VQMI 3FKJA 4XOPA 2YUSA 3HRSA 5D5UB 4ZMDA 5J40A 3ABKH 3GBGA 3G2BA 4U7DA 4KDPA 3CXHE 3H1KD 4D6TD 1N73C 3EUKL 2OYIC 2BHYA 2K9NA 3PUFA 3L74D 2HGCA 4PDKA 1FSHA 2ID6A 2XASA 1PV3A 3RKXA 3WTSC 1VQ6I 1IGNA 1FDIA 3OSFA 2NZ2A 4P96A 3AG1H 5ICGA 4LIUA 2VOOA 5E3OA 1PP9D 4A5NA 3DKYA 5IPAA 5LRSA 5AIPA 1S1CX 2Q0OA 1U78A 1LNWA 1SFOJ
chains in the Genus database with same CATH topology
2STTA 2XIGA 2JT1A 2EFOA 5DYMA 4NHJA 2Y48A 1URQD 1S9KD 2XRNA 4KHXA 2L02A 3ZP5A 1SD6A 3R4KA 1UFMA 5AONA 1QL2A 3W6KB 4R79A 5BVZA 2UXNA 2GA1A 1HW2A 3I53A 1TQMA 3RK3D 3L09A 3OA7A 1EH6A 3ECOA 5BU8B 1BN5A 2ESHA 3EETA 2KB7P 3ZMUA 3LA7A 1KILD 4C7NB 2H7HA 3J80Z 3RI4A 4I0BA 3O2PE 1JNMA 2EFPA 2BGCA 1ZLJA 2MLKA 3C7JA 2DI3A 3WGIA 2GZWA 4A0XA 1H8AA 4NQWA 3TDUC 3ULQB 2H8PD 2NPSA 1GXQA 4GO1A 1LTAC 3P8MC 1IXSB 5AVTB 2P67A 2P2UA 3VOEA 1OKRA 4I2OA 5CJ0A 2GA2A 1ZAOA 1S6LA 3BASA 4HV5A 1FYKA 2HEOA 3TYYA 4M9SA 1KU3A 1DPRA 1QO0D 2GUVA 1GK6A 4JQFA 4EJVA 4WX9A 2XHKA 2HKXA 3IC7A 2P7CB 1G3WA 2RV8A 3HE4A 5AIQA 4QLCU 2HOEA 2PJPA 2O1KA 4HW0A 5AVWB 3F23A 2EFNA 4GIFA 1L4AC 3HUSA 2A6EF 2HLOA 5L3BA 4A6EA 1B9MA 1FBQA 3KDPB 2ACJA 5BQTA 2F5FA 4JF7A 3VMYA 2C9LY 1QBJA 1TTYA 4CYDA 1O3SA 2L4MA 2Y0MA 1D8KA 4BH9A 2QBYA 1XSVA 2WTEA 2YKQA 4W7ZA 3KP7A 5APYA 2RQPA 5BMZA 3EYYA 2O8XA 3V4QA 2P8TA 4AUWA 2F5CA 4G7HF 2IPQX 2OAZA 1E17A 3MZYA 1IN7A 4WWCA 3U1AA 4C7RA 5CCHA 1O3TA 1LQ1A 1TLHB 2FOKA 1SFCA 4LB5A 3F8FA 1IK9A 3B5ND 3B5NB 3HE5B 1S7AA 4GKGA 4L0ZB 3MUDA 1RF1B 3F8CA 2XAFA 3IKVA 4DNCA 2XV4S 5DD4A 1HJBA 5LHIA 2P6SA 2ISYA 1FT9A 5CVIA 2HYNA 4N3YB 3EYIA 2DBBA 5CYVA 2GAUA 1YW7A 1N73A 1Z1DA 1XMAA 4JYCA 4OIPF 1R00A 2VN2A 5H6RA 4HYEA 1F1ZA 1CI6A 1FWZA 2QM8A 1YQAA 2KIMA 3GZ5A 4BHPA 1ZGJA 3RK2D 1C0WA 2EB7A 3D5LA 1W5SA 4L9TA 4IRGA 3H32A 2P1JA 2XKOA 4GYGA 3QOPA 5K5OA 2KOGA 2XU6A 4EOTA 1S3JA 2XUBA 1SQXK 3FX3A 5CVVA 1SP4A 4HLXA 1R1TA 4UHTA 1HGZA 1X79B 5AW2B 1J9IA 1SQPK 2D45A 2ZNYA 3TO6A 4PCQA 3LFKA 3DPLC 4L5IA 1JHHA 4OMZA 4HZFA 5F64A 1QNTA 3GVAA 4ON0A 4AVPA 1P4WA 2HPCB 1FZCA 1KILA 3H92A 1KA8A 1CF7B 3T8TA 2KYVA 3OJAB 1XN7A 2CW0F 4EM2A 3V2PA 3MTUE 5CCHD 1KU9A 4CHUA 1RF0C 5APUA 1SD7A 3B8EB 2I1KA 1SFXA 2HTSA 2OQRA 5HLIA 2EA4A 4ETSA 4OMYA 2C9NY 5BU5A 4ESJA 3RL0C 4M6YA 3TO9A 1G2CB 2XROA 1S29A 1R5HA 1JE8A 5JR3A 5D5WB 2HFHA 5ICCA 2NAZA 1IN8A 5HS8A 2Z3YA 3NMDA 5HOOA 2ZMEB 4MTDA 2ZBKA 4LJZF 1JY3P 3ISPA 2IP2A 1SFUA 1GZLA 1AQ5A 2E1NA 3T97A 3E5QA 2K02A 4O3MA 4ZYHA 3N7NA 4EMSA 1LWUC 2QQ9A 2VOPA 1Z6TA 2PN6A 1NTZK 1OMIA 3HUGA 1FLIA 1N7SB 4BHCA 3GZ6A 2BV6A 2FBKA 2ZCWA 2Q2EA 3R0AA 1M1JB 3RPQA 1I1GA 3RTRA 1BJAA 4A0ZA 4YIFA 3C1DA 2IW5A 2DT5A 4B8XA 1ODDA 2PQ8A 3BROA 4XLPF 1G3SA 2A5YB 1SMYF 2IPPA 3P8CE 1LTBC 4TV7A 2BASA 3VP9A 2XAHA 4H0EA 4IF4A 1FJKA 2YPRA 3GHGA 5CVRA 1SFCD 3RYPA 2R5BA 2M3BA 1TNTA 2CG4A 1QPMA 2R32A 2STWA 3T0YA 2MC3A 1B9NA 1HKSA 2WPRA 2OYHA 2VBZA 1TBXA 1YG2A 1GL2B 1RF0A 1ZLLA 1QQIA 4WXDA 2HZTA 2OQGA 4AWXB 1M7LA 3OAKA 2ZFCA 1FP2A 1R5GA 3V2NA 1MJ9A 1MD0A 4E70A 3VMXA 3BJOA 4JK1X 1RF1C 5D5XB 1RE3A 4LGDE 4MNUA 2G7UA 2QM3A 1N7SD 2NS0A 4M74A 5AW6B 1LTTC 4C46A 1LVAA 5D4RA 3VEPA 2KJBA 2D1VA 5HS9A 4KNYA 4I6MC 3M1EA 4F7ZA 4HAMA 5K1YA 3RK3C 3MZHA 3IWFA 5AW5B 4RGRA 3II6A 5AVVB 3F8MA 3C9IA 2O1JA 1JHFA 2DK5A 4ENKA 3M0DA 4CDGA 1EQ7A 3G3ZA 2FYUK 1Y0UA 2DO7A 2F2EA 1NHAA 3BP8A 4M72A 1S7OA 4HOBA 2HYGD 3PP5A 2VBWA 4P9UA 2L4AA 5TRDA 3BATA 3K1PA 4DQ2A 3MWMA 3RKYA 4Q47A 1P4AA 5CJ9A 2HFED 1JY3N 4G94A 2R5DA 4P9FA 1R22A 3WGGA 3BOQA 5IT3A 2FKWB 5AW1B 3IRRA 1T3UA 4UVBA 5KTBA 4DZOA 3QPTA 3V5BA 2BEOA 1W4MA 1NU1K 2WSEH 3KLOA 1RY3A 1RE3C 2NPSB 1OYIA 3P7NA 4HX7A 4BNCA 4M6XA 1IJDB 4OOIA 4FX4A 1JGSA 1PFIA 1KU7A 4I01A 2PEXA 1F4KA 1URQC 3MFKA 2E43A 1N86A 4KIFA 3KLNA 3HSFA 4JBAA 3V4WA 1T8ZA 2NNYA 2Z5UA 5DDGA 2H6CA 1XTCC 3NTNA 2Z5IA 1YYCA 2N9BA 4C7NA 4I7HA 3LAPA 1VPCA 1FNNA 2FQ3A 1L3LA 2DPUA 4IJAA 2L5GB 3QPHA 1RUOA 3ZMVA 4L9NA 2K4BA 3BVHA 3VB2A 4R1HA 1WT6A 4IXAA 2EV0A 4KA4A 3CUQC 1FYLA 3ML6A 4N78D 1RNLA 2UZKA 5AVSB 4G8XA 3GHGC 3L9FA 3V7RA 4GT1A 2ZJ2A 1IC2A 5JI6A 3FHZA 1QL1A 3BPXA 3S2WA 1G1JA 4CO8A 3WTVC 2WV0A 4RGXA 2EFQA 3UIAA 3ROUA 2ISZA 1WWXA 4I2LC 5LHGA 1NHLA 1FAVA 4YFKF 1B1BA 1H9TA