3G3ZA

The structure of nmb1585, a marr family regulator from neisseria meningitidis
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
142
structure length
142
Chain Sequence
MNQLDQLGTRINLICNVFDKWIGQQDLNYNLFAVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLLSLTETGKAYAAPLTESAQEFSDKVFATFGDKRTTRLFADLDALAEVMEKTISENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional regulator, MarR family
publication title The structure of NMB1585, a MarR-family regulator from Neisseria meningitidis
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 52
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3g3zA02
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3g3zA01
4M9XA 1TQMA 2KIUA 1RUOA 2QVOA 3ELKA 4KNYA 5HDGA 5BQTA 4PDKA 3IKTA 4KA4A 3J7AO 3KLOA 3R0AA 2YPRA 1F5TA 1W4MA 3EQLF 5DD4A 2R7DA 3NQOA 3HHGA 4HF1A 4XBFA 2H94A 2FNPA 2LSOA 3GWZA 2KKOA 4CGZA 4NQWA 1EH6A 4G6DA 3QRFF 2UXNA 1RI7A 5H6QA 1R00A 1DUXC 4IHTA 2J5PA 4LGWA 1HXDA 2M1BA 3GX4X 2OZ6A 1PP7U 3J81Z 4U0WA 3JSPA 3D0SA 2OZUA 4I02A 2HR3A 3IC7A 5HS8A 2YSRA 3V7SA 1H0MA 1IXSB 1NTMK 2Y75A 1XSDA 1TW2A 4KMFA 4G9YA 5L3DA 1U5TB 5JHUA 4XSXF 5CVUA 4MQVA 4BHBA 3REOA 1R5HA 1AOYA 1WRJA 2HFHA 3EYIA 1LNWA 1OYWA 2J5OA 5DUKA 3SHFA 4QLCU 4G6QA 2FQ3A 2VE8A 5DD8A 2GAUA 3J81K 3MZHA 1IN8A 3ERED 3Q9VA 4AIKA 1ZG1A 3TKYA 2A6HF 1IZ1A 4KN7X 3F6VA 4GYIA 2FYUK 1R23A 1LEAA 3I58A 1T2KA 3HIFA 2GWRA 4ESBA 2O3FA 3D5LA 1OYIA 5HDNA 5K5OA 4ON0A 5TJJA 3IL2A 4HDVA 1UCRA 4Q47A 4WXHA 1MJAA 2VC1A 1YFHA 2EV0A 2JSCA 3IWZA 3FMRA 2HQRA 4ASNA 2GQQA 1G3SA 2G7UA 1G3TA 1LDKB 1W7PD 2KRFA 4U7DA 2BEOA 5H6RA 2QQAA 3I59A 2J59M 1SAXA 3L09A 4EJTA 2P7VB 4JK1X 1ZRCA 2WWYA 2LKMA 3TOBA 1L0NK 2GXGA 5D5VB 1ULYA 4CZZA 4G7HF 1XSVA 1YIOA 3I4PA 4IJAA 5FLXZ 3WTSC 5AIPA 4E70A 5HS9A 2FRHA 4KUMA 2ZNZA 3BPVA 5L3CA 3KEQA 1IN6A 4ESJA 1T98A 5F64A 3FF5A 2FBHA 2BE5F 3DQVC 1QO0D 1FY7A 5DCMA 4KFCA 2NNYA 2L02A 3BPXA 1OMIA 3M7GA 1XDSA 3E5UA 2EFQA 1R22A 2OARA 5K5RA 4IVNA 1FYKA 4RB3C 4B8XA 2H09A 1QNTA 2P7CB 2DK5A 4P9UA 5FLXK 4CDGA 1L0LK 2ZO4A 1DP7P 4LK0F 3ZPLA 1SMTA 5L3BA 3HRUA 4HF0A 3QU6A 2VBZA 1MJ9A 5LBQA 1WKMA 5JFRA 4ENKA 1LB2A 3BROA 1G4DA 1TQPA 1WSUA 1C0WA 1J0RA 1T0FA 4CICA 3SZPA 3KCCA 1MDMB 4N9HA 3R0JA 1GXQA 3AAFA 1EH8A 3RPQA 1ZN2A 1SD5A 4U0VA 3EDPA 4BHPA 4UV8A 2YU3A 5ILVA 4RB2C 1SQVK 2UZKA 5HLIA 1YW8A 4OU0A 2OQGA 3FM3A 1LVAA 1K78A 1KYWA 4IF4A 4M6YA 3I71A 4EJVA 1NHAA 1R5GA 3TDUC 2FNAA 1H9GA 3T5XA 4ZZDA 5D5WB 2IA1A 3GFIA 5BOXA 5ILSA 4I0AA 2AXLA 3F6OA 4M74A 1TW3A 2QLZA 1O7FA 1Z05A 2TDXA 2CO5A 4I98B 3KP5A 3KZZA 3K1PA 2NAZA 2WC2A 3KP2A 2OQRA 4EM0B 1ZHFA 4DQ2A 1S7AA 1PP8F 4XLNF 2YR2A 5CYVA 3BJ6A 2V79A 2EK5A 2BV6A 2MD5A 4I0BA 1PUEE 2B0LA 2PJPA 4KN4X 3TOAA 5LHGA 2XAHA 4ZZLA 3L9FA 1J59A 2A07F 3FX3A 3T1BA 3GXOA 2W57A 3KP6A 4OMZA 3Q9SA 5K1YA 1KU7A 2KJBA 1ZLJA 1IF1A 4RS8A 1P4AA 2A69F 2GA1A 4BYYA 1XB4A 2V1UA 4EGZA 3FHZA 2K86A 4IFDK 4YIFA 1B4AA 1B6AA 3LAJA 4BNCA 1XMKA 2FSWA 5LGUA 1SD4A 1QZZA 2XUBA 1P6RA 1YO5C 4HBLA 4MEXF 1P4XA 4HV5A 1MZBA 2FU4A 3W6JB 4MTEA 2O01H 4MGRA 1HQCA 2K4BA 4WF2A 1FT9A 2FOKA 1QQIA 1XGMA 4A6EA 2PMHA 4S04A 1HW5A 2AS5F 5D5UB 5DDGA 2P5LC 4CHUA 3I5UA 1HSTA 2OA4A 2PLYA 1OYYA 4YFNF 5J8CA 3VFZA 2DW4A 5J6XA 3QAHA 4HLYA 2QQ9A 5F6FA 2HS5A 1S3JA 6PAXA 3FZVA 1LQ1A 1KQ9A 3EETA 1U5TC 5EEHA 5FGMA 4M9ZA 3LA3A 2MLKA 3GFLA 3P9KA 4G94A 2EWNA 2Z33A 4MNUA 1D8KA 5BS6A 3ULQB 4HV6A 3V4GA 1FOKA 1BM9A 3TO7A 3R4KA 2JTVA 3C7JA 3FMSA 3I0TA 3CUOA 1XCVA 2L54A 5CVVA 3T8TA 3E6BA 4PGGA 3TDZC 3I53A 5AIQA 5D4SA 3EUHA 5FFXA 3HSFA 4HDUA 1SFUA 4GGGA 1O3QA 1U3EM 2PG4A 2CG4A 1S8NA 4L18B 2EFWA 1WWXA 1BN5A 2R3SA 2FE3A 1GHCA 4I01A 2Y0MA 2QQBA 5JVTA 1BJAA 5EEGA 3FMQA 4AIHA 2E7XA 4ENJA 3WTUC 1E2XA 1J5YA 2K4JA 1ODDA 3KZYA 2RC4A 4Y13A 3MZYA 5FB2A 3VEPA 3RKXA 1IRGA 2QBYA 3QPHA 2CQKA 4P5OA 2HKXA 1RIOH 3K9TA 3ZP5A 1J9IA 2XGXA 3GO5A 3O2PE 1FPQA 2W25A 3FWEA 2NRAC 2F5FA 2JRTA 2IRFG 3L2CA 3F8MA 5DUIA 1IW7F 3B73A 4XSZF 1H9TA 5FD6A 1E17A 2LNBA 2Z5UA 5FFZA 1SQQK 1BBYA 3MQ0A 4RGRA 4LB5A 2ADUA 3FXQA 1ZAOA 5LEKA 3TO9A 1NTZK 2PI0A 3GLXA 1YLFA 1Z7UA 5KVRA 5E18F 1ZH5A 2O61A 4OIRF 5ICFA 2W24A 2VE9A 3CTAA 4LD5A 2XAFA 2XROA 4G7ZF 1UB9A 2R7FA 3ML6A 4RGXA 4U7BA 1T38A 3HRSA 5E8IA 5L3FA 4HLXA 4Y15A 1K7AA 4NHJA 1UHWA 4P55A 2P8TA 2H6CA 3BJOA 2XHKA 3DXJF 4KDPA 2ZBKA 5FO5A 1KQ0A 4RGUA 1EH7A 3E6CC 2EFOA 3O6BB 4HA8A 2L3DA 3LQRA 1IN5A 4KIBA 1FNNA 3E6DA 1GVJA 1ON2A 3JTHA 4ENNA 1BIBA 3RI4A 1TQIA 2IVMA 2D1HA 1FP2A 1QZYA 4IHSA 1XGNA 1CF7B 3CLQA 2IW5A 2X4HA 2ZMEB 5AONA 3HOSA 2HKOA 4MEYF 1W5TA 4I2OA 4IRIA 2XAJA 2CYYA 3LSTA 5KLVK 4GXOA 1Z6TA 3OV8A 2ZXJA 4FX0A 2STTA 4P9FA 1KU2A 4KIFA 4L5JA 1J7KA 3DF8A 1FP1D 1R1VA 1LEBA 1YS6A 1TLHB 4A0YA 4ZYGA 2EA2A 4LLGF 3WE3A 2DPDA 2IA2A 1DPRA 1K6OA 3KP4A 3GZ6A 3CDHA 1ZGAA 4TV7A 2EJRA 3JW4A 3GVAA 2EA4A 1D5VA 2M87A 2OU2A 4G8XA 1LDDA 1L0OC 4UXNA 4M72A 3HHHA 4WK8F 4Q5SF 2RQPA 4OINF 2XAQA 3RDIA 2VBYA 3G73A 1JE8A 3C3WA 1SQXK 3CO6C 3CO7C 4A2UA 3V7CA 3KP3A 4UVBA 1F1ZA 4XRFA 3N4MA 5ERIA 5CVRA 2FEZA 5HOOA 3VOEA 2ZNYA 1U5TA 1QBJA 5HVQC 5JR3A 3I64A 3F8CA 3BP8A 2EB7A 3WTWC 4M73A 2L4MA 4IRGA 3HRMA 3SQNA 3J80K 4HQMA 3TGNA 1PDNC 1B9MA 4HYEA 2OD5A 2VT2A 2HWVA 4R1HA 1XCBA 1BI1A 2MH2A 2VOPA 1XSXA 4I7HA 1WQ2A 4YIIA 2WSCH 2A68F 3LA7A 2FBIA 3OOPA 4FX4A 3GF2A 3ZN0A 3RPUA 4GCVA 1OKRA 1B9NA 4EGYA 2VN2A 3WTXC 3CUQB 3VB2A 2MC3A 4WXDA 5LGNA 3E5QA 4KMUX 4L9VA 5E20A 2FXAA 1IXRC 3E6MA 1SQBK 4IRHA 3T0YA 1MGTA 3DFGA 4KICA 4HX8A 3HUGA 3GEZA 1FC3A 3IRQA 4R8HA 2XAGA 3RYRA 3JTGA 4Y17A 4KIGA 5JI6A 1Q1HA 4KYWA 4LLLA 4AWXB 2ZCWA 2IA0A 4EVIA 3QU3A 5TRDA 1Z1DA 2XASA 5BPDA 4EM2A 1KQ8A 4ZYEA 1Z9CA 3F72A 1RNLA 4S05A 2VBXA 3M1EA 3HSEA 2BBYA 4EV0A 4OIPF 3WE2A 3ZQ7A 2V1DA 4HF2A 4UUVA 2Z99A 4HX4A 4O6JA 3ABTA 1IXCA 1YW7A 4LG0B 2F5EA 4K2EA 4OMYA 5LRRA 1Y0UA 4YG2F 2PMUA 4ZYDA 4A12A 3ECHA 4Q4ZF 1R36A 2HDCA 1D8JA 3MWMA 1EV7A 4HX7A 3WTVC 1SD7A 1FLIA 2YX4A 1CGPA 3KETA 1U78A 2DLLA 3ZMSA 1YS7A 2WSEH 1BOAA 2M5WA 5L3EA 2E1NA 2QUFA 2LDUA 2GZWA 1TNTA 3M9AA 1MDMA 2IP2A 3IHUA 4OIOF 2RDPA 2BYVE 3ZMVA 3DPLC 3ZMUA 5E1ZB 3FM5A 3RTRA 3LQQA 1DDNA 4O3MA 1ZRFA 2IT0A 1O3RA 1YG2A 1ZG5A 2LF7A 2EV5A 2K27A 2MLGA 4OOIA 4HZFA 1NTKK 3QOPA 1BIAA 2K7LA 3ROUA 4A0ZA 4LLNA 3NRVA 3FXUA 3BDDA 4CXFA 3HOTA 3PQKA 4BAYA 1O7LA 1BI2A 3K0LA 2X0LA 4BH9A 2DBBA 4ETSA 4AVPA 5DV5A 4BQAA 1A04A 1IAWA 1TBXA 4DNCA 5D4RA 1HW1A 2STWA 3RYPA 5D8KB 4A0XA 2VOOA 3IWFA 4EJUA 2V9VA 2A3SA 4IXAA 2GA2A 1O57A 4WWCA 1JXSA 2DO7A 2P6SA 3SFZA 2RV8A 1Z91A 1X3UA 3K69A 3KLNA 4UVCA 2M45A 3V8LA 3DP7A 3U1DA 1R7JA 4RB0A 1LDJA 1P4WA 2PEXA 4UVAA 2FBKA 5HLGA 2UXXA 2F2EA 2Q2EA 2HGCA 3WG9A 1U8RA 2PFBA 4UV9A 1ZGJA 2QZ8A 1FX7A 4ZH4F 1HKSA 2MA3A 3MEXA 4UNOA 1QPMA 2OBPA 3DEUA 2MBFA 3GUDA 3ZMDA 4JBAA 3WTTC 1RZ4A 1J2XA 1B1BA 2CWEA 1P92A 2JZYA 2CSOA 2QYOA 4QWQA 2JT1A 2WSFH 1USSA 1T6SA 2E1CA 1AWCA 1FBUA 2FMYA 3I59B 3MAJA 5D5XB 3F21A 2PBIA 4ZYHA 2RKHA 4H0EA 2XRNA 1XGOA 1NU1K 3G3ZA 3KP7A 3M8EA 2A61A 2UWMA 2ISYA 3H3ZA 2CW0F 1V4RA 1IRFA 3BWGA 3R60A 3JAMK 4CYDA 4A6DA 2V1XA 4WX9A 1BI0A 2A5YB 4GO1A 1W7PA 1SMYF 3LFKA 2Z3YA 1FYMA 1OR7A 4RAYA 5L3GA 2K02A 5DYMA 2C6YA 5HLHA 1YTYA 5DCMB 2P6TA 3ISPA 1T39A 1IN7A 1FSEA 2ELHA 3R61A 2OAZA 5E17F 1HKQA 5J8FA 2P5KA 5D8LB 2YX7A 1S29A 2HYGD 1ZRDA 3MFKA 1ZLKA 1SQPK 2QENA 1HW2A 2FA5A 5ICCA 2DFIA 1BC7C 2DTRA 2XV4S 5HDKA 2G7HA 3ECOA 3K1NA 2ISZA 2QM3A 3IKVA 1R1UA 3R6SA 2ZJ2A 3HYIA 3F3XA 5CVIA 2NYXA 2HTSA 5D6FA 4CO8A 1Z6RA 1D3YA 4L0ZB 5BMZA 1R58A 1O3SA 4L0YB 1G3WA 3CUQC 1G3YA 2D45A 2VONA 2DQLA 4RGSA 1XN7A 1B59A 1SD6A 1S7OA 4MQ9F 1UHMA 1I27A 2PN6A 1J75A 1U6GA 4A5MA 1HBXG 1KYZA 2XKOA 1LJ9A 1SFEA 2Z9OA 4YFKF 1K78B 2F5CA 2XKPA 3DPTA 1ON1A 4PCQA 2A6EF 4IPAA 2O0YA 3IRRA 4LFUA 3WGGA 3B02A 1MJBA 3BY6A 3WTYC 3LAPA 2RN7A 3U9GA 1FBQA 1FYLA 4FT8A 4D0PA 3WU1B 5E1WA 5CLSA 1ZARA 4ESFA 3QPTA 1MKMA 5LRSA 3F8NA 4LK1F 2H6BA 1YYVA 1FZPB 3J80Z 4I09A 1JGSA 2ZKZA 5BPIA 3KE2A 2DPUA 4WXCA 1SFXA 1MD0A 1R1TA 3DV8A 3F8FA 3PFIA 4MTDA 3RKWA 3WODF 2O6GE 1F4KA 3U2RA 2XVCA 2COMA 5ILUA 3HRTA 3E5XA 2FF4A 2O03A 4A5NA 2P5VA 3RIRA 4U88A 1XMAA 2GIVA 2IJLA 5E1XA 2V6CA 1XGSA 3K1MA 5IT3A 5A2QZ 2RNJA 3ZN1A 2GXBA 2KIMA 2W84A 3LWFA 2ESNA 2KIFA 3KFWX 1RUNA 4HQEA 2M30A 4Z2YA 4N0BA 1F9NA 4BHCA 3ABUA 2BGCA 3S2WA 4YFXF 2WV0A 3WGIA 3P9IA 1KGSA 3E3VA 2CGPA 2KJCA 5CJ9A 3V8JA 3GZ5A 3L7WA 4O5VA 1REPC 2XIGA 3O3KA 4EJOA 4MHGA 1HSJA 3F23A 3C1DA 3WTZA 5A2QK 5ICGA 1BI3A 2HEOA 2LKPA 1CF7A 2W85A 2ZMEA 2JPCA 5LLQA 3DKWA 5DCFA 3HSRA 1KU9A 1I6XA 4RB1A 3C18A 1O3TA 3RJPA 2ACJA 1W5SA 2PQ8A 4GYGA 4EJWA 4LJZF 3TO6A 1ZG3A 5D6EA 2DU9A 3QP5A 2JPBA 3V8KA 1IUYA 2E7WA 3RKYA 2VODA 2HZTA 3P9CA 1I5ZA 4FHTA 4PZJA 3HTUA 3ZMTA 3GYHX 3F22A 3P7NA 3GW2A 2HQNA 4N9IA 2D1VA 2DQRA 5LHHA 3SZTA 4U0YA 3WU0A 2F5DA 2VBWA 3BOQA 3F8BA 3I54A 1I1GA 1BC8C 1QGPA 5ICEA 1U2WA 3WGHA 4M6XA 1KA8A 3GFMA 2DK8A 5CVJA 1ZREA 2VT3A 2EV6A 1P2FA 3FXRA 1YQAA 3COAC 1USTA 4L9TA 3BJAA 3T8RA 4ENMA 3HTSB 4KT5C 4HAMA 1STZA 1FWZA 2DI3A 1L3LA 3ZMZA 4M71A 4R79A 5HS7A 4G7OF 2Q8KA 4EM1A 3GFJA 1ZYRF 2Y48A 3MCZA 1TNSA 2EFPA 4L9NA 3Q5FA 3N97A 3H3UA 2L4AA 3CUQA 3TQNA 4XLPF 2QBYB 2M8EA 2HOEA 3JSOA 1DPUA 2MH9A 1UFMA 1XDUA 4HOBA 4P96A 1FSHA 1JHHA 4PGHA 3V7RA 4L9JA 4WCGA 4HW0A 1TTYA 5E8GA 5ED4A 5LEJA 2QWWA 4EQQA 1W7PB 3E97A 2WTEA 1JHFA 1WI9A 2HTJA 1YW9A 4OIQF 2VC0A 3L00A 4AIJA 2CFXA 3CLOA 2P4WA 2ZFWA 1G6NA 2DT5A 2H27A 1OPCA 5IT9Z 1IN4A 3EYYA 2ESHA 4L5IA 2EFNA 3K2ZA 2RVCA 5DEQA 2Q0OA 2IPQX 5FD5A 2LF8A 4F7ZA 1I1SA 3BZ6A 4BXUA 3VODA 1HKTA 2HYFA 4LG0A 2NNNA 2ETHA 5LGTA 4RAZA 5H20A 3QP6A 2RGVA 2O8XA 3LA2A 4JQFA 4M9SA 1K79A 5LHIA 3KEOA 4EMSA 1S6LA 3CJNA 4NB5A 3PQJA 2DAOA 5K5QA 2G9WA 2NS0A 1VTNC 3JAMZ 1KU3A 4UHTA 5IT9K 2FMLA 3SXYA 4AD9A 3M8FA 3LW5H 2L01A 1GXPA 5KK1A 3M9QA 1XD7A 4LMYA 4B09A 5F1RA 3W6KB 3NEUA 1FBSA 4Q48A 1V3FA 2D2WA 2VXZA 1ONVA 3H92A 4LB6B
chains in the Genus database with same CATH superfamily
4M9XA 1WGXA 2E42A 1TQMA 2KIUA 3H5RA 1VQPI 1MFTA 3EWKA 1TT5B 1RUOA 1QZEA 2BW3A 3AL0B 1GL2A 1U7MA 2YKOA 5KKZC 1SFKA 1Z77A 3PM1A 3A4CA 2WSEJ 2QVOA 1KFMA 3ELKA 4KNYA 5HDGA 3BTJA 5GP9A 1TL8A 5BQTA 1NHLA 3L72G 1ZKGA 3QPSA 4PDKA 3IKTA 5E3MA 3HBLA 4PD4H 4KA4A 3J7AO 1MMSA 3KLOA 3R0AA 2K85A 2E34A 2N1TA 2YPRA 2GUSA 1F5TA 1G2CA 1W4MA 1OWAA 2M3AA 3EQLF 2RMZA 1AQ5A 3DBLB 1JKOC 2W8ZA 5JLXA 5DD4A 3N4XA 3P8MC 2R7DA 2BCCG 2Y9YA 2VL8A 2V7QH 3NQOA 1VNDA 1SVLA 3HHGA 4XKVA 1YRNA 4HF1A 3AEBC 5K7FA 1MBHA 3QYEA 4XBFA 2H94A 2FNPA 2LSOA 3GWZA 3I56I 2BY0A 4E4HA 1Y47A 2PMZA 2KKOA 4CGZA 3K5BA 4NQWA 1SP4A 1HGVA 3JC22 2VRSA 4BACA 1EH6A 4G6DA 3X2QH 3QRFF 2UXNA 3KYDB 1K83J 5TJHA 5KAFH 1RI7A 5H6QA 3RGUA 1R00A 1NVOA 4MLOA 3GCMA 1DUXC 3U1CA 4IHTA 2J5PA 4LGWA 1JOCA 1GDTA 1HXDA 2M1BA 3GX4X 3V5BA 3HUSB 3VMZA 1BJZA 3IAM2 2M5AB 3S1RJ 5E79C 2WITA 4A3JJ 2OZ6A 3O6QA 2NOJB 1PP7U 3J81Z 4PV1C 4U3FJ 4U0WA 3FK6A 3ONQA 4M3DA 1Z67A 3JSPA 3TGUD 3D0SA 4XLAA 2OZUA 3DEEA 4I02A 2KMUA 2ME6A 4YPCA 4DYRA 4DBRA 3L70G 1XG1A 1LT9B 3L2QA 2HR3A 3IC7A 5EEAA 5HS8A 5F04A 2YSRA 1KONA 2W1OA 3V7SA 3OYJA 3NAUA 2CV1A 3B6CA 1H0MA 3SEZA 1QL1A 2L7FP 1SQXJ 2UWJE 1YIJP 1VQ7P 2X9DA 1IXSB 2BHZA 3BCCJ 2K9LA 1NTMK 5E79H 2Y75A 1U57A 1XSDA 3FIWA 1TW2A 4KMFA 3QWOC 4G9YA 3JREA 5L3DA 2WB1N 2OTJP 1U5TB 5JHUA 3CC2I 5IYDJ 4XSXF 1VQKP 1I39A 1UELB 5CVUA 2KSEA 4MQVA 4BHBA 3C8VA 2MSYA 3REOA 3ABVC 1R5HA 5AVQB 2WA0A 2R7VA 1AOYA 1WRJA 2HFHA 3ZQHA 1S1CX 1NH4A 1KYOI 2IFMA 3EYIA 3USSA 1LNWA 1OYWA 1V5GA 2QF7A 3BCAA 2BVMA 2J5OA 1T6AA 5DUKA 3SHFA 4QLCU 4G6QA 2WAFA 1BOBA 3SDGA 2QG4A 5K5GB 4PJ0E 2FQ3A 3HPHA 1TWCJ 2VE8A 2WSSH 1H89A 5DD8A 2R3CA 2GAUA 1NU1D 3J81K 3MZHA 1OVUA 2R44A 2R93J 5C39A 1IN8A 3ERED 3CMEP 3Q9VA 4AIKA 1ZG1A 2NPSD 2CRGA 3CD6I 3TKYA 2A6HF 3OY9A 1Z21A 3G1LA 2ZT9D 2X1CA 2ZYDA 2ME0A 3BASA 2H1LA 1IZ1A 4KN7X 3CMMA 5GTIE 3NARA 4XL9A 3E7LA 1TWFJ 2DMNA 2QJPC 1JY2O 5AW7B 3F6VA 4GYIA 2FYUK 1IFJA 1R23A 3L71D 3CCMP 2WY7Q 4I76A 3RK2B 1IDYA 1LEAA 1FTZA 3I58A 1T2KA 1GZLA 2WMMA 3HIFA 1Y8AA 2Q5UA 2GWRA 1D0ZA 1ZN5A 3KPEA 4RKUJ 4ESBA 1NG6A 2O3FA 1KB9E 2XGEA 3D5LA 5AVUB 4XN0A 2O8KA 1FBMA 2K3PA 1OYIA 5HDNA 5K5OA 4ON0A 5TJJA 3JRDA 4AUXA 2GOXB 1AFOA 3IL2A 2HNHA 2BXYA 4FETA 1NTZD 4HDVA 3PNVA 1UCRA 2M7AA 1MIJA 2KRCA 4Q47A 4WXHA 5EYRA 3HOWJ 4Z6YA 1RETA 2ELJA 1MJAA 3BRVB 1MV8A 2VC1A 1YFHA 1SQBJ 2EV0A 3S3OA 2JSCA 3KEYA 3KYCB 3IWZA 3FMRA 2HQRA 2HYNA 2P10A 4ASNA 2GQQA 1G3SA 4DJAA 1LTIC 2ZYGA 2G7UA 1G3TA 3HUGB 1LTTC 1MNDA 1LDKB 2R7TA 3RQIA 2OC6A 1W7PD 2KRFA 4U7DA 3CCRI 4WB4A 1EDJA 3DKYA 2JJ7A 1USDA 1VQ6I 1BGYE 1G1IA 3T97A 1SQPD 4L5EA 1ZK8A 2F6CA 1PGQA 1R4NB 2BEOA 5H6RA 1LTJB 2QQAA 3I59A 1M57D 2J59M 2X1DA 2DT7B 1SAXA 3L09A 4EJTA 1OVVA 3I4NJ 2P7VB 3OR2C 3E1SA 4JK1X 1PPJE 3H6PA 2W90A 2LMDA 3RBZA 1ZRCA 2WWYA 2WSFJ 3AEAC 2LKMA 2YO3A 1IO4A 1JKRC 1FIPA 2WY8Q 3Q3SA 3TOBA 1UMQA 2GXGA 4HNUA 1L0NK 1LP1A 4WY4A 5D5VB 1ULYA 3K10A 1X2MA 4CZZA 2IAIA 2K3FA 4G7HF 1XSVA 5K7ZA 1YIOA 3MP7B 3I4PA 5H2FC 2QSHX 1JTHA 2DYSH 1BSNA 1HH0A 2L91A 3CXHE 1EZVI 2HPCB 4IJAA 3S16J 4XLFA 5FLXZ 2K9JA 2V4HA 2Y0SN 3E0JB 2Z1DA 3WTSC 4A7PA 1J09A 4CCLA 5M5YJ 1M1JC 2QM7A 2FXPA 5AIPA 2L0KA 5HS9A 4E70A 1JT0A 2FRHA 3BZKA 4KUMA 1L2PA 1ZW0A 2ZNZA 2JA6J 2E1OA 1SFCB 2IGNA 3ABMH 3BPVA 4HPQA 2E5ZA 5L3CA 2CV0A 3KEQA 3B5NC 3H1ID 4H13B 1ETKA 2Q1KA 1WJAA 2BXZA 1OQYA 1LT1A 1IN6A 2QKLB 4ESJA 1T98A 2FYUE 3V4QA 3LSMA 3FF5A 2ZC2A 3FKJA 1G8XA 5F64A 1N7SA 2FBHA 2BE5F 3DQVC 5F0CA 1NYHA 2IPPA 3M06A 1WJCA 1QO0D 3K4BA 1OW8A 1FY7A 5DCMA 4KFCA 3GBGA 4XLHA 2L02A 2MW8A 2NNYA 3BPXA 4ZJZA 1OMIA 2R7SA 2JK3A 2BASA 2WWWA 3M7GA 4II3A 1XDSA 4IL6E 3E5UA 2EFQA 1M1KQ 3OIQA 1R22A 5F27A 2OARA 5K5RA 4IVNA 1SVMA 1FYKA 4RB3C 1LJ2A 2W27A 1V55H 5CPRB 2K9MA 4B8XA 5E3NA 2H09A 4W7YA 4H44B 3H32B 3L73J 1QNTA 2P7CB 2DK5A 2CPSA 4RM3A 3WU2C 1GT0C 3OIOA 1HJ0A 4P9UA 1EZVD 3K4MA 2IBZE 1H0TB 4AC0A 1NO4A 4AYCA 3MZ8A 2R7RA 3Q3DA 1R5LA 4I6ZA 3S1MJ 3PTZA 4IOCF 2VKEA 4AM3A 5FLXK 1OW6A 4CDGA 1H8AA 4IOIH 1L0LK 2ZO4A 4JYCA 1DP7P 4LK0F 3ZPLA 3CWBD 4YXDC 3CCJP 1SMTA 4XKCA 5L3BA 3K70D 3HRUA 4HF0A 3QU6A 2M3BA 1H88C 2VBZA 3UR3C 1MJ9A 2H8WA 5LBQA 1WKMA 4I6MC 5JFRA 2R5YA 1EDIA 4ENKA 3B6AA 1URQC 2PMZN 2AEMA 1N7LA 1RF0C 1LB2A 3BROA 2VXDA 1YYCA 1G4DA 1W0TA 3L37A 1LTAC 1BGYG 1TQPA 1PIXA 3V42A 2YMYA 2CQ7A 1WSUA 3HG9A 2Q3IA 1GL2C 5KLIC 4IL6X 1C0WA 1PGOA 1J0RA 1YIJI 1T0FA 2WZ7A 2FFDB 4CICA 4PJ0H 1GVDA 1QHHD 4EOTA 3SZPA 2MFZA 3KCCA 1MDMB 1PPJG 2KS1B 4N9HA 2VQHA 3BQYA 4C2TA 1VF5D 3HE4B 3R0JA 3WUVA 1FS0E 2ZXXA 3U1KA 4LG3A 1GXQA 1BR1A 3S32A 3AAFA 3L2RA 3JCUC 1PP9E 3L74J 4MN4C 2V4JC 1EH8A 3CCQI 2X85A 4D7NA 5B66C 5DTDA 4IHXA 5GTIH 4XLEA 1VI0A 3RPQA 1ZN2A 1SD5A 4XQFA 4U0VA 3EDPA 1VQ8I 2C0XA 2ZSHB 1P84D 1Q7YQ 3LOCA 4BHPA 2IXSA 4TT3H 3VMYA 1FOSF 4UV8A 5J3LA 2YU3A 1K9MQ 5ILVA 1AJYA 4RB2C 2X51A 4C3JJ 3OAKA 1KB9H 2E76C 1N75A 1SQVK 2UZKA 2R5DA 5HLIA 3I55P 2E74C 2HDDA 1NTKJ 2I5UA 1YW8A 4OU0A 3CMEI 1LKXA 2ZXHA 1SVOA 4MFEA 2WPRA 2V9PA 3M3YJ 2OQGA 3L35A 5CCHD 2HLOA 4BKXA 3FM3A 4NPFX 3CC7P 3KPHA 2FYUG 2DFHA 3M91A 4DYQA 1LVAA 1K78A 1VQMP 1KYWA 4IF4A 1L4AA 4M6YA 3RL0g 4CCOA 2ZJPF 3I71A 4EJVA 5JHFA 2Q9IA 1NHAA 1R5GA 3CCMI 1E0EA 1A02F 2QGUA 3TDUC 2VLAA 2R92J 5TISC 2FNAA 1K4SA 5CMZA 1RE4C 1OFCX 1H9GA 1X58A 3T5XA 4ZZDA 5D5WB 3GZNB 3RKQA 3RK3E 3AE8C 3D71A 2IA1A 3GFIA 4BWNA 5BOXA 3KDPB 4FE7A 4GOEA 2PJRB 1CQTA 4ZDOA 5ILSA 1MMAA 1DGWY 1ACIA 4I0AA 2AXLA 2VJ4A 2IBZG 5EG0B 3F6OA 2CQNA 2PP6A 2DA5A 4WVZA 3SSUA 4M74A 2XGCA 3L2UA 4BJTA 1LWUA 1TW3A 1ZELA 2EQRA 3BCBA 3CCYA 2QLZA 5AW2B 3M8JA 3H9QA 3VN0A 1O7FA 3LSGA 3AE5C 4UB8E 5TISH 1RRJA 1Z05A 3BG3A 4BJ5C 2TDXA 1EXJA 2CO5A 2ID3A 5BU5A 1MW7A 2F5VA 4I98B 3C9IA 3KP5A 3L75E 2VKHA 1BDCA 1D5YA 1OCTC 2Q7CA 1YBKA 2R7OA 3KZZA 3MN2A 3K1PA 1MH3A 3CXHH 2NAZA 2Z16A 2WC2A 3KP2A 5KJ7D 4B44A 2OQRA 4EM0B 1IGNA 1ZHFA 3VSLA 4DQ2A 2KZJA 4OGQC 1FZGA 1S7AA 3CX5H 1FMWA 1PP8F 3CJQB 4XLNF 2YR2A 3O8GA 5CYVA 4QIWN 3BJ6A 2V79A 4BY1J 1YHQP 2EK5A 2BV6A 1JEKA 2MD5A 4I0BA 1E79H 1PUEE 2B0LA 1IFNA 2OGUA 2PJPA 1MBEA 4ZTJA 2GIZA 5AVYB 1WPKA 1PP9G 4KN4X 5AVRB 3G9RA 1LNQA 3RPUD 3JRFA 2AHQA 3TOAA 5LHGA 3RK2D 2XAHA 4JYBA 1T2KC 2LG4A 4ZZLA 2O01N 3L9FA 2EPFA 3OS0A 3A0BE 3CX5E 2OYHB 3ZGKA 1J59A 2A07F 4BL0B 3MVPA 3FX3A 3T1BA 2Q2EB 1YTZT 3GXOA 1T95A 4IL6H 2W57A 1VQPP 3BTCA 3KP6A 4OMZA 3Q9SA 5K1YA 1KU7A 1BDDA 2MC4A 3GHGA 2KJBA 1TP4A 1ZLJA 1IF1A 2EH3A 3OA7A 2RH0A 4EDFA 4C9YA 1YI2I 4RS8A 3HZJA 3LNQA 1P4AA 2GOMA 2YIUC 3M07A 4C3IJ 1FU1A 2A69F 2GA1A 2ICWG 1V54H 4BYYA 1XB4A 1MMGA 3S2DJ 2V1UA 4EGZA 4XRMA 4XORA 3HE5B 4X1EA 4PJJA 3FHZA 2K86A 1XTGB 5CHXA 4UB6E 3IH2A 4IFDK 3TNUA 2DMUA 2KRHA 2IS6A 4O9BA 4YIFA 1B4AA 4CPGA 1R49A 1B6AA 2WT7B 1FDMA 3LAJA 1WCMJ 2W6BA 4ANJA 4XFJA 4BNCA 1HJBA 2M3EA 3AEGC 3IF4A 2X6XA 1XMKA 2FSWA 4K35A 3AL0C 3CP8A 2KNCB 2HFED 4NPEA 4PD4E 3VTPC 1RF1B 1EDLA 1TWAJ 2OJED 4KJZA 1SD4A 1QZZA 2WAEA 2XUBA 1P6RA 5LGUA 1CI6B 1YO5C 4HBLA 2IS1A 3ZQLA 2KXPB 3RCOA 1GU5A 2ZT9B 1W36C 4MEXF 3AG4H 1WRGA 2RAEA 3CJRB 1P4XA 4D1QA 1MSFC 2KUBA 4HV5A 4WY4C 1Z7LA 5AW3B 3M0AA 1HTLC 2Y0EA 4B48A 3CCJI 3PSIA 1MZBA 5EGOB 2FU4A 3S17J 3W6JB 5IOYA 2XNXA 4MTEA 2O01H 2AO9A 4MGRA 5IP9J 1ZMEC 1HQCA 2K4BA 3HD7B 1IZNB 1KILD 2XPUA 4Y28J 3L75G 2FUG2 4WF2A 1FT9A 2FOKA 1QQIA 1TC3C 1U8BA 1XGMA 2HVQA 4W1UA 1JCDA 4J00A 4XOTA 1NU1J 4A6EA 1KD1Q 2PMHA 2ZJSE 4S04A 1V5FA 1HW5A 2AS5F 5D5UB 5DDGA 4H13D 2GBYA 1YITP 3W2WA 2P5LC 2DJNA 4JX4A 4CHUA 1SANA 3I5UA 2C9LY 2E35A 1X4OA 2OCEA 1HSTA 3FK7A 2OA4A 2JSPA 2PLYA 1OYYA 3F0CA 4YFNF 3GF7A 1DQUA 4HRIA 4IZZA 5J8CA 3VFZA 2R5BA 2OYOA 2DW4A 3W68A 2OV7A 1BW5A 5J6XA 2FYNB 2Q6QA 4U7JA 3ZCOA 3BR2A 3H1KE 3QAHA 1IDZA 4HLYA 1XMXA 2ZFCA 1GLNA 2LBFB 5E79E 2QQ9A 3K7AJ 5F6FA 2HI3A 2HS5A 4H44D 2FXOA 1S3JA 2KPMA 4KT6A 1EXIA 1OISA 1S5LH 3I55I 1HCRA 4BDYA 6PAXA 3EFFK 3ABLH 3FZVA 3AE6C 1RR7A 4BXFA 4PJNA 1LQ1A 4BE0A 2P7JA 1KQ9A 3EETA 2R32A 3CC7I 1U5TC 5EEHA 3L72D 1H8AC 5FGMA 4M9ZA 3LA3A 1VQMI 1ETOA 2MLKA 4RAGA 5AW5B 3TYYA 3GFLA 2NS8A 3P9KA 2WQYC 4G94A 1JTXA 1SQPJ 2G8YA 3P8CE 2KQRA 2BCCD 4UB8H 2EWNA 2LLKA 2AQFA 2W4SA 3MZWB 2Z33A 3QYFA 1RY3A 3RQ4A 1P7JA 3HOZJ 2B63J 2IS4A 2V1NA 2JA7J 4MNUA 4CYCB 1YOVB 1JNMA 2VI6A 1T0FC 2KB7P 1D8KA 5BS6A 3B5NA 3ULQB 5AW9B 4HV6A 3V4GA 1FOKA 3RL0B 5M5WJ 1AA7A 1RC9A 4S0HB 2ELKA 3G1OA 1BM9A 4X6AJ 3TO7A 3R4KA 1G1JA 5BU8B 2HPIA 4IQJA 2CJJA 2JTVA 3C7JA 3FMSA 2IX7C 2PGDA 2DFEA 3UNGC 2LVSA 3H5AA 3I0TA 3CUOA 4F52A 1XCVA 4Y7NJ 2H8PD 2JJLA 1FZCB 1E3HA 2MKVA 1WH7A 3DPUA 4HSTA 2L54A 5CVVA 3T8TA 5EFWB 1WJBA 3E6BA 1JCCA 3FISA 3FXMA 4F3QA 2L9RA 2BY3A 4PGGA 3TDZC 2E75D 2W48A 5J40A 5C4XJ 2WAQN 3I53A 5AIQA 5D4SA 1J1EB 3EUHA 2VQGA 3L70D 2NXNB 1X1CA 3KYQA 1DU0A 4N78E 5CCGD 5FFXA 1N73B 2OYIB 3HSFA 4HDUA 3A0BH 1SFUA 2QM8A 2R7WA 4GGGA 4A3EJ 2WBMA 1O3QA 1U3EM 2XSJC 1XTCC 4ZMDA 5FJ8J 2PG4A 2HOSA 2CG4A 2NVXJ 4JP0A 1HUCA 2BY2A 1S8NA 2HU9A 4IEJA 4AQRD 1FE6A 5J4YA 3B8EB 4L18B 1ERDA 2ZB9A 2EFWA 1SEUA 5CBOA 1WWXA 2PRRA 3LIDA 4CCMA 1BN5A 2XAUA 2F4OB 2R3SA 4AVZA 2FE3A 1LTSC 1GHCA 3GG2A 4I01A 2Y0MA 1WFXA 1H88A 2QQBA 3BQZA 5JVTA 1BJAA 5EEGA 3FMQA 1KN7A 2W6JH 3IH4A 1URQA 4BY7J 1BCCE 4AIHA 3U21A 3SFEC 2JO1A 3CCLP 4CA0A 4NC7A 5CKTA 2E7XA 1LTJC 4UB6H 2DMTA 3AE1C 4ENJA 3WTUC 4HNTA 1E2XA 1IRZA 3H1CA 1FOXA 1J5YA 4BBRJ 2K4JA 1ODDA 3KZYA 3CESA 2HOTA 1DX7A 2RC4A 4Y13A 2KFDA 1VF5B 2NPSA 3MZYA 2K5CA 4L76A 1PGPA 3CWBJ 3AFHA 3WHBA 3ZXSA 1LWUC 5FB2A 2JQ7A 2NRGA 3VEPA 1QEXA 3RKXA 1IRGA 3H1HE 4BBSJ 3NMDA 2QBYA 3QPHA 5B1AH 2CW8A 2CQKA 3K4KA 2HOAA 4P5OA 2HKXA 1X79B 1OCRH 1VL2A 2CMPA 5IY5H 1RIOH 3K9TA 3ZP5A 1J9IA 2XGXA 3MGNA 2E1MC 3GO5A 3O2PE 1FPQA 2W25A 1FOYA 5LFAA 3S1QJ 4XKWA 2P81A 3FWEA 1IK7A 4AUWA 1P9QC 1QLED 1PFIA 2HVSA 4HG2A 4J19A 2NRAC 3AE9C 2F5FA 3CP2A 2JRTA 3FXKA 2IRFG 5KHDA 1SFCC 3L2CA 5H2FE 3OYKA 3F8MA 4DOZA 5DM7F 5DUIA 1IW7F 3JRBA 3RSNA 3B73A 3S3NA 5AW6B 1EKEA 4XSZF 4W7ZA 3BR3A 3VYUB 1H9TA 2LY2A 1S9KE 2XZRA 4YIRX 5FD6A 1E17A 5J47A 2LNBA 3H1JE 2Z5UA 9ANTA 3H3VK 5FFZA 1UZCA 1SQQK 4XKBA 1GD2E 1BBYA 1JTYA 3MQ0A 4MIMA 3H36A 2R7ZJ 4R4MA 1MBFA 4RGRA 2ADUA 4LB5A 3FXQA 1ZAOA 4KITB 5LEKA 2LTPA 3TO9A 1HOMA 4ZNCA 1RE4A 1GV2A 2WPSA 2WTYA 4BJ6C 1NTZK 2PI0A 3GLXA 3V2RA 1YLFA 1Z7UA 3Q0UA 5KVRA 3GF3A 5E18F 3GHGC 1ZH5A 2O61A 4BU2A 4OIRF 1YITI 1QPIA 2HVRA 3II6A 2X6OA 3TGUE 5ICFA 3CDLA 4IQ4A 3RK3B 3AG3H 2QA4P 5EJCA 1J1DB 2W24A 2VE9A 3CTAA 4A3KJ 1KZUB 2QE7H 2M8GX 4LD5A 4XONA 2XAFA 2XROA 3O8HA 3TMOA 2JUGA 2KIKA 3CCQP 3LL7A 4G7ZF 1UB9A 2R7FA 1B8IB 3BTLA 1Y56A 3I3LA 3WU2E 3IUOA 1GW3A 3ML6A 1VQ8P 3JRIA 4RGXA 3A01B 4U7BA 1T38A 1BCCG 2XDVA 1AU7A 2CUEA 3HRSA 5E8IA 5L3FA 3PLNA 2E5YA 1YJWP 2SPZA 3LSRA 4A3GJ 4HLXA 1D1BA 3CC4P 4Y15A 1K7AA 4OAZA 4NHJA 3QYBA 1UHWA 5KTBA 1GUUA 1RQUA 2ECCA 4P55A 3HTKA 2P8TA 2ZJRF 4C2MJ 1LE8B 5KAIC 2H6CA 3BJOA 2XHKA 4RMNA 1NJIQ 4C7NB 2HODA 3H1HG 3DXJF 5J4VA 2XV5A 4KDPA 3S1KA 3TP3A 2I10A 1KC8Q 1U9NA 1B72A 1YJ9P 2ZBKA 5FO5A 3A03A 1KQ0A 1TWHJ 4RGUA 1EH7A 3HD7D 1WT6A 2CUZA 4XLCA 3E6CC 3JCUE 2EFOA 1HDDC 3HGYA 3O6BB 4HA8A 2L3DA 1OX3A 3LQRA 4XRSA 1IN5A 5B66E 2IEKA 4KIBA 1KB9D 2B7EA 1N25A 1FNNA 3HM5A 3MKYB 3E6DA 2M34A 3ERMA 1GVJA 1ON2A 2DOFA 3JTHA 4D7MA 4ENNA 1RHZB 3HRNA 3L71E 1BIBA 3RI4A 1QGKB 4E6KG 1TQIA 5E3OA 2IVMA 2ZJQF 1NH3A 2D2CB 3PH0A 4M3LA 2D1HA 4E7IA 1FP2A 1QZYA 4PSXA 3OL3A 3PNYA 3BRTB 3TP0A 2R7UA 1FJKA 1SQQE 4IHSA 3GTLJ 5APTA 1XX5A 3F9KA 4RJTA 1XGNA 1CF7B 2HXIA 3CLQA 1KYOE 2LY1A 4RAFA 4X0GA 2LP0A 1BA5A 3H1JG 4ABZA 2IW5A 2DA7A 2X4HA 2ZMEB 3BATA 2XDJA 5AONA 2JVGA 3Q0VA 3HOSA 1U9OA 1APLC 5M1BA 2HKOA 2VB6A 1FOSE 2HXOA 4MEYF 1FZBA 1NWQA 1NTME 1Y1VJ 2O7OA 5M3FJ 1W5TA 2GXAA 1JY3O 4I2OA 2FX0A 2K9SA 1BGYD 5APUA 4IRIA 3H1LE 2XAJA 3HOXJ 2VIXA 2YUSA 1DGRM 1YX3A 4AU7A 2CYYA 3LW5J 2W7NA 3LSTA 1GW4A 1L4AB 3HPGA 3M0DA 4D5CA 5KLVK 4GXOA 3TEDA 2IZ0A 5EZHA 3EUKL 2Y2ZA 1Z6TA 3MKWB 1DD4A 5TISE 3OV8A 1JT6A 3LIEA 1PPJD 2OPTA 2ZXJA 4FX0A 2STTA 4P9FA 4FE4A 2J58A 1KU2A 4IFMA 4BUPA 2DODA 4KIFA 3G71P 2MJZA 4L5JA 1J7KA 1D1AA 3DF8A 1FP1D 1Z3XA 1R1VA 1LEBA 1BE3E 1YS6A 4N4OB 5KKZB 5K7HA 2BVLA 1TLHB 4A0YA 3CCLI 1KILB 3SDBA 4ZYGA 1AKHB 4A3LJ 2IBZI 2YKPA 2EA2A 3CXHD 4BRYB 2IYPA 2R5ZB 4F93B 4LLGF 4A3FJ 5DM6F 4NDLA 4L74A 5IP6A 2CV2A 2BHYA 4IOAF 5APYA 2IS2A 1Q90D 3WE3A 2DPDA 2IA2A 3RL0D 1DPRA 3OYCA 3KP4A 3GZ6A 2JWTA 1K6OA 3S93A 1YI2P 4UY8I 4DYCA 3CDHA 1ZGAA 4TV7A 2EJRA 2JA5J 5H2FH 5CCHA 4YELA 3JW4A 2B89A 3GVAA 2EA4A 1ZR2A 1D5VA 3HUSA 2M87A 1WJDA 1PYVA 2OU2A 1MMNA 4LIVA 2CFOA 3OYEA 2FYUD 2M5AA 2L5GB 4G8XA 2VJIA 2V7QJ 1LDDA 1S2EA 1L0OC 4UXNA 4M72A 3HHHA 4WK8F 3W67A 4Q5SF 2RQPA 4OINF 5IYBJ 1POGA 1VZ0A 3DLLF 4GOFA 2NZ2A 3ITKA 3WMM0 2XAQA 3RDIA 2VBYA 1I3AA 3PUFA 3L1PA 3G73A 3EUHC 1LT9A 1JE8A 3C3WA 1SQXK 2XU6A 3CO6C 3CO7C 2WV1A 3HGGA 3FKIJ 1ZRTE 4A2UA 4XK4A 3V7CA 3KP3A 4UVBA 1F1ZA 1BW6A 2PAJA 4XRFA 3N4MA 2XRLA 5ERIA 4PV1B 3CCVP 5CVRA 1Y1WJ 3FDYA 2FEZA 2A06E 1P84I 5HOOA 3Q5PA 3VOEA 4W97A 1IC8A 2ZNYA 1U5TA 2IBZD 1QBJA 1X8YA 1X1BA 5HVQC 2YO2A 3ZR8X 3H5NA 3CI9A 1SQQG 2IBDA 3VPRA 2EZHA 3ZOBA 5JR3A 1IV6A 2KLVA 2L2OA 1R9TJ 2LYCA 1OZHA 4P1WA 4XE5B 1Y0NA 3I64A 1JY2N 3G6EI 3F8CA 4DZPA 2I8DA 2DFFA 3BP8A 1R4MB 2PX9A 2EB7A 4M6VA 2EBIA 3RBXA 2H89C 5J1UA 3WU2H 2B88A 1T3UA 2A45I 4DJGA 2K40A 4M73A 2L4MA 4IRGA 4U87A 3WTWC 2OYIA 1LTBC 3J7YJ 3HRMA 5KLVE 5APSA 3SQNA 1O4XA 3J80K 4HQMA 4XN3A 3TGNA 4UUSB 3OYGA 1NTMG 3M9BA 1PDNC 4GODA 5KJ7A 1B9MA 4HYEA 3CCEP 2C0WA 2OD5A 2VT2A 2HWVA 4R1HA 1L0NE 3H1LG 4QSHA 2BY1A 1IUFA 4E7KA 2QA4I 3L72J 1XCBA 4PK4A 1BI1A 4CH7A 2NPSC 3DKXA 2Q1ZB 2ZT9C 3AEEC 1UHSA 2MH2A 2VOPA 1XSXA 2ID6A 4I7HA 1WQ2A 3LSKA 4YIIA 2JUCA 1S9HA 2J5UA 2A68F 5F1JA 1SS1A 3LA7A 2KIQA 2KSJA 1D7MA 2FBIA 3LMMA 3GTKJ 2BCCJ 5AVSB 2EIJH 3OOPA 1PP9D 1HF9A 4FX4A 3GF2A 4C3HJ 3ZN0A 3RPUA 3OYMA 2KL4A 4GCVA 1OKRA 1B9NA 3HDDA 4EGYA 2VN2A 3WTXC 4HB1A 1X4PA 1BE3G 2IDBA 2E75B 4BXLA 4A3DJ 3CUQB 2DA2A 3VP9A 3VB2A 2E60A 2MC3A 4RBOA 4WXDA 5LGNA 1YJWI 3E5QA 4KMUX 4L9VA 5E20A 1IJWC 3CC4I 2DMQA 1JY3N 2FXAA 1JMBA 2CPBA 3JCUH 1IFMA 4A69C 2QJPB 3K4CA 1IXRC 3E6MA 1SQBK 4IRHA 4U3FE 5B66H 4OAYA 5HNHA 1TU3F 2M0CA 3DTIA 3T0YA 4HYTB 1BR2A 5AVWB 1MGTA 3DFGA 2DDAA 2R4GA 4Z1MH 2EZIA 4KICA 1LFUP 1VQNI 4J01A 4HX8A 5KLVJ 2Y69H 3HUGA 3GEZA 4XM3A 1FC3A 1ETWA 5EZGA 2KHMA 3I4MJ 3IRQA 1S4XA 1YJ9I 4XA4A 1IG7A 4R8HA 1SQXE 1RPWA 3U59A 2FYNC 3BCCE 1KYOH 1A6QA 1OR7C 3L70J 2XAGA 1KQGB 2K9QA 3RYRA 2RREA 1LTJA 3JTGA 4Y17A 4KIGA 3N7NA 1N7SD 5JI6A 3G1MA 1L0LE 4EEFG 4BEHB 3RK3D 5M3MJ 1Q1HA 1TT0A 4KYWA 2QJKB 4LLLA 1JB0J 3E7KA 4AWXB 2ZCWA 1R5SA 3B4SA 2IA0A 3OYFA 2DOEA 2VQCA 4EVIA 2A06G 3QU3A 1IFPA 5TRDA 1Z1DA 2XASA 1HLVA 5BPDA 2CS3A 4HJGH 4EM2A 2QKMB 3Q0WA 1KQ8A 4OWRB 4ZYEA 2XF7A 1MMDA 4PJLA 1Z9CA 3CF2A 3F72A 2L9SA 2E2HJ 4HEA2 1DP3A 1RNLA 3AE2C 1Z0XA 4S05A 1GV5A 5CJ4A 2HPCA 1M1EB 2VBXA 1LFPA 3M1EA 5CQEA 3HSEA 3L75D 3ZQIA 4EI2A 3PIPF 2BBYA 5J1RA 3R2PA 5DJUB 5KLVG 3H0GJ 2XNDH 3IH3A 1SFCA 2B9BA 4EV0A 2E43A 3PIOF 4OIPF 3WE2A 1L0NG 5FLMJ 1K61A 3ZQ7A 1Y8RB 4GFBA 2V1DA 2L7KA 3BG6A 4HF2A 4UUVA 1ZGWA 2Z99A 4HX4A 4O6JA 4E7ZA 3ABTA 3EUAA 1IXCA 3LSJA 1YW7A 1AVYA 3G71I 1M1JB 4AIDA 3GTGJ 1IFIA 4QPOA 2F5EA 4CZCA 4LG0B 2CU7A 5F0HA 4RLFA 4GDOA 2QQ8A 4PD4I 4K2EA 4OMYA 5LRRA 1Y0UA 3VSKA 1FAVA 1SQVE 3FX0A 1BSHA 2VPRA 4YG2F 1J1EC 3EQ2A 4IKFA 1SQBE 3AG1H 5AVZB 1OCOH 2QSFX 2BEZF 2E19A 2PMUA 3CX5D 2FYZA 1N73C 4I99C 3GTOJ 3A0HC 1S5LC 4ZYDA 4A12A 3H32A 3ECHA 1ZXGA 4BQOA 1X9VA 4N3YB 4Q4ZF 1R36A 1NG7A 3KX2A 2HDCA 2D2CD 1H0TA 2CQQA 3DWLE 2YU9J 4KJMA 4U3FG 5DJTB 1D8JA 3DLAA 2P58A 4E7SA 1QRYA 3LSHA 2DA4A 2R0QC 3MWMA 1EV7A 3K70C 4HX7A 3WTVC 2B87B 2IGMA 3H1JJ 2HDWA 1SD7A 3L4FA 1FJLA 2LRDA 1FLIA 4F92B 1KZHA 4YXWH 1WVRA 2YX4A 1CGPA 3KETA 2KISA 4A3BJ 3ASOH 1U78A 2DLLA 3BCCG 3ZMSA 1YS7A 3S9OA 4V19K 3AE7C 5GAGJ 3ESWB 3OW2O 2XF5A 1BOAA 1QL2A 2WSEH 1DU6A 3ZDMA 2M5WA 5L3EA 1M90Q 2E1NA 2FFDA 2QUFA 1L4AD 2LDUA 5GTHC 1F36A 2GZWA 3E1RA 4IHYA 3CCVI 1PUFB 2N9YB 4PD4D 1TNTA 3M9AA 1XPXA 2IP2A 1MDMA 1L0LG 3IHUA 4OIOF 2KS1A 2RDPA 3HE4A 1VF5C 2BYVE 3BG7A 5AW1B 1FDOA 4JYKA 3ZMVA 2QJYB 3VYIA 4CCNA 3D70A 1R71A 3DPLC 2VJ5A 3ZMUA 2Y30A 5E1ZB 3FM5A 3RTRA 2DJIA 2W6AA 4E7HA 4FISA 3LQQA 1DDNA 2NVTJ 2DA6A 2BW3B 4O3MA 2DDBA 3HOUJ 1ZRFA 1GL2B 1JM0A 1HVVA 4B47A 3TF5A 3W6VA 5IPAA 2IT0A 2GLOA 1O3RA 4EIJA 1YG2A 1ZG5A 2LF7A 1P7IA 1VFCA 2V7FA 2EV5A 1EQ7A 2LFBA 3CCUP 2BEQD 2K27A 2WPVB 2MLGA 3S8PA 4OOIA 3CCEI 4KISA 5CCGA 4HZFA 2N1TB 1NTKK 3QOPA 1G2CB 1GMJA 1BIAA 2K7LA 1A6IA 2WB1A 3ROUA 2WSCJ 4A0ZA 3GTQJ 4BE2A 3CDIA 3FXUA 3NRVA 4LLNA 2K3RA 1WZ2A 5CCHC 3BDDA 3VYTB 4CXFA 3HOTA 3PQKA 3HUSC 2K88A 5B1BH 2O1KA 3NTNA 1YRNB 3JRAA 3OYBA 1KQSO 2DW3A 2XKMA 3AEFC 4HKZH 3V4WA 1UG2A 1V5EA 2E5NA 4BAYA 2DMPA 1MNEA 2QRXA 4ZKUA 1O7LA 4NQWB 2QEXI 1IJDB 2IZ1A 4K3AA 2KZVA 3L73E 1JUSA 2XSDC 2NS7A 3H0DA 1BI2A 3LSIA 2H8RA 3NWTA 2JWAA 2N1TD 1FZFA 1D0XA 1X2NA 3K0LA 1SQVG 2X0LA 1LT9C 4BH9A 2DBBA 1A35A 2DTZA 4ETSA 1SQBG 3H1KD 1WHUA 4AVPA 5DV5A 3O6QB 2PJRA 4PV1D 1T8ZA 2FBWC 4BQAA 1U0JA 3WHCA 1SAUA 2M7BA 3HKZA 1A04A 1IAWA 1J1DC 2PFXA 1TBXA 2YS9A 5EG0A 1J2JB 3IR9A 2JVHA 4DNCA 5D4RA 1HW1A 4N4NB 1LPQA 2STWA 3A7OA 3OYLA 4FCYA 3RYPA 1CSBA 3BTIA 3AE3C 3H35A 4RDUA 5D8KB 1CW5A 3A1YA 3DBHB 2V9KA 3SEQA 3SWYA 3B71A 3OIPA 3TDKA 3M4OJ 1HBWA 2FD5A 1AVOA 1BGYJ 4A0XA 2OF7A 3A02A 4B3XA 4GRIA 3P8CD 2VOOA 3IWFA 1MZ9A 3SFDC 1UG0A 2DT6A 4EJUA 2AXTC 2A3SA 2V9VA 1NTMJ 4IXAA 2E5TA 1IO2A 1O57A 2GA2A 2KDOA 4WWCA 1USEA 4Y99B 5KJ7C 1JUMA 3L74E 3M1CA 1DEBA 1JXSA 1BR4A 2H7HA 2WPQA 4Y33A 1DIPA 2DO7A 2P6SA 1IFDA 3SFZA 4RLQA 2RV8A 3SFIA 2QIWA 2YXRB 1Z91A 3W2VA 2RN0A 1X3UA 5APWA 3K69A 3KLNA 3KZIC 4UVCA 2M45A 3V8LA 3DU6A 3DP7A 2K9YA 3U1DA 1AA0A 1R7JA 4RB0A 2MYSA 1LDJA 3OWTA 1ZV8A 1VQOP 3OR1C 1P4WA 2BZTA 2AXTH 2VKVA 5B5EC 1DD3A 3IFMA 2PEXA 4LLHA 3WUUA 3RK2C 4UVAA 2FBKA 3SJMA 4GKGA 3D1NI 1YX5A 5HLGA 2UXXA 1NTKE 2F2EA 1QA6A 5KAIE 4D6TE 2OYHA 3QH9A 2Y31A 3ASNH 4KHXA 1PVEA 2Q2EA 2HGCA 1MBJA 2L5QA 5FKLA 3WG9A 1U8RA 2PFBA 2L9NA 4UV9A 2XB0X 1ZGJA 2P0WA 2HQ5A 2QZ8A 3CCSP 4N78D 1NOHA 1FX7A 4ZH4F 5GPCA 1HKSA 2ZYAA 2MA3A 3UKGA 3MEXA 3FWLA 4UNOA 1OCPA 2FYUJ 2AQEA 1QPMA 2OBPA 4HNVA 3DEUA 2MBFA 5AVXB 1N86A 2JDIH 4OVNF 1DEEG 1JO5A 2RQQA 3GUDA 3ZMDA 2MGQA 3WG7H 5J1YA 4JBAA 3WTTC 2COBA 2LR2A 3HE5A 3HEFA 1RZ4A 1J2XA 3CJTB 4FQGA 3VYRB 1YJNP 3CF5F 3GMEA 1B1BA 2CWEA 1Y9BA 2Z5HA 3L73G 1P92A 4BQQA 2X1EA 3C2HA 2WT7A 2JZYA 3H1KG 2CSOA 2QYOA 4QWQA 1BCCD 4PFOA 3D5RC 1QVUA 1Y39A 1HGZA 5FKKA 1RR8C 1NKZB 3F5HA 1RF1A 2KNCA 1VQ5P 2JT1A 5DS9A 2WSFH 1RE3C 1USSA 1CI6A 1T6SA 2E1CA 5APXA 4NPDA 4NUBA 2LY9A 4RM2A 5F0FA 1AWCA 3HJEA 1FBUA 3LFUA 2LKXA 2Z5IA 3AE4C 3T97B 2FKWB 3S1NJ 4R4LA 1VQLP 3NXSA 5EGOA 2FMYA 2OTKE 3H1HD 3I59B 3JRGA 4WWIA 3MAJA 3CMAP 5D5XB 3F21A 2PBIA 4H0LB 4ZYHA 2M8RA 2RKHA 4H0EA 5BNGA 2XRNA 4IFFA 1XGOA 3HD7A 1QVTA 4BE1A 3G3ZA 1KILC 3KP7A 3M8EA 2A61A 2UWMA 1NU1K 2Y0CA 1EA3A 5JVGF 4E7LA 2ZXWH 1FZAA 1X3WB 1KORA 4DW6A 2ISYA 3FBNB 4HSRA 3H3ZA 1LP1B 1V4RA 2CW0F 1MUUA 4WY4B 3VP8A 1UIIA 1IRFA 5KAFC 3BWGA 3R60A 5FROA 1NTCA 1JKPC 1N78A 1EF4A 1L0NJ 3L74G 4H13C 4PFPA 1JKQC 3JAMK 4CYDA 1JTHB 1Z56A 2QVAA 3Q2YA 2KZIA 3MD2A 4A6DA 2KLUA 5IYCJ 3CQZJ 2V1XA 3VDXA 4WX9A 1A36A 2O01J 1PP9J 2K9JB 1BI0A 2D5VA 2XF6A 1U7JA 3C2GA 2A5YB 4Y4RA 3A2KA 1FTTA 3G6EP 4GO1A 1S9KD 1W7PA 2KOGA 1SMYF 3LFKA 3KYLA 3H1JD 2Z3YA 3B5ND 1FYMA 4XNFA 4BQNA 1WMKA 3UIAA 2L7ZA 1OR7A 4RAYA 5L3GA 1JJ8C 1ZP0C 1NTKG 4D6TG 2K02A 5DYMA 1LGHB 3CCUI 2MD0A 2LBFA 4I7ZB 1LVKA 4H44C 1N7SB 2C6YA 1MFZA 2JA8J 4IHWA 5HLHA 1IK9A 1YTYA 5DCMB 2YXQB 2MABA 2P6TA 1RH5B 3ISPA 4N6JA 3A3YB 4C46A 1T39A 1IN7A 1FSEA 1GK6A 2ELHA 4XOPA 3R61A 2OAZA 5E3LA 1W5CC 2M0MA 1HKQA 5E17F 2FY8A 5J8FA 2P5KA 3U1AA 5D8LB 2YX7A 2RNGA 1T8IA 1S29A 2HYGD 2LC2A 3MFKA 1ZRDA 1ZLKA 3S2HJ 1KB9I 1SQPK 1FDIA 1MBKA 2QENA 2FA5A 1HW2A 1D0YA 5ICCA 1W1WE 2DFIA 3AEDC 1SLQA 3RZOJ 3OJAB 1RESA 2K9NA 2DTRA 2XV4S 1BC7C 4WBAA 1Q86Q 5HDKA 3AKZA 1KFNA 2XGDA 3QWLA 2G7HA 1VF9A 3ECOA 4QPQA 1M56D 2LXBA 3K1NA 2KYVA 3FGAD 4CYCA 3AECC 2ISZA 2QM3A 3IKVA 1R1UA 3PNTA 2Y0DA 2FFDC 2LREA 3R6SA 3J7AY 2L7MP 2ZJ2A 4RESB 1FMVA 3HYIA 1L0LJ 3F3XA 3FXEA 5CVIA 5HNFA 3TW7A 4LOCA 1JMMA 2R5YB 2KT0A 5AW4B 2NYXA 1TWGJ 2HTSA 5D6FA 2H1KA 1URQD 4PJMA 2OQQA 4CO8A 1N8RQ 3AG2H 4AYBA 1Z6RA 1UAAA 1D3YA 4L0ZB 1FZCA 3CL3D 4DGWB 2JKVA 2UV1A 1NU1E 2P1JA 4EATA 2DXIA 1M7LA 4LC1A 1I50J 4E7JA 1GL2D 1OXZA 5BMZA 3K4LA 4B86A 1R58A 1D1CA 2VASA 1O3SA 4L0YB 3L75J 3OSGA 2E75C 1G3WA 3OYHA 2JWDA 3CUQC 2OTLI 1G3YA 4BS9A 2W83C 2DOAA 1N73A 2D45A 2VONA 2DQLA 2M9HA 1XN7A 4RGSA 2RKLA 4GIFA 5CCGC 4NNJA 1ETQA 4DOJA 3HKZN 5CQGA 5KAIH 1B59A 1R8EA 1SD6A 5C4JJ 3TL4X 3DCFA 4XICA 2TRTA 2KK7A 3RZDJ 3OYNA 3FWNA 3M9HA 1S7OA 4MQ9F 1MSEC 3MD0A 1UHMA 2Q3EA 4RO0A 1I27A 3CXHI 3KIOA 1HWTC 3IAS2 1VQOI 2PN6A 1SQQD 1ZR4A 2H88C 4F91B 1J75A 1U6GA 1NTZE 3S3MA 4A5MA 1NK2P 1HBXG 2KLOA 2LD5A 1HA8A 1OJLA 2E76D 4YEJA 1KYOD 1LFBA 3BZCA 2E74D 5EF6A 2R7XA 1Q2NA 3A5TA 1KYZA 2XKOA 1LJ9A 1SQVJ 1XS9A 2KDZA 5EDNA 1SFEA 2XPVA 3FXLA 4QTRA 2Z9OA 4YFKF 5FKNA 3CCSI 1NTMD 1K78B 3GLLA 2F5CA 2XKPA 3DPTA 1JGGA 3H1LD 3IN6A 1ON1A 3MMYB 3OYIA 3TGUG 2QJKC 4PCQA 4HH2A 1Z3YA 3DU5A 2ZFUA 1I6HJ 1SQPE 4EYYQ 2M2EA 2A6EF 2KZGA 4IPAA 1W0UA 2O0YA 3IRRA 1OVRA 3NFQA 4LFUA 3WGGA 1BL0A 3B02A 1MJBA 3BY6A 3WTYC 3TK1A 3H9JA 3LAPA 2RN7A 2IGKA 3U9GA 1FBQA 4NBQA 1PL5A 3ABKH 4PUSA 1YJNI 3PJSK 1FYLA 2X6WA 4FT8A 4D0PA 2XB5A 3WU1B 2N9BA 3S4RA 4G12A 1BE3D 1CZQA 5E1WA 2E36A 5CLSA 1K8AQ 1MBGA 1ZARA 3CPWO 1LWUB 1FIAA 2BOLA 3BR6A 3QPTA 4ESFA 1VQ5I 3Q5SA 1JUPA 2M4KA 1MKMA 3BR0A 5LRSA 3F8NA 4LK1F 2LK2A 2QCOA 1OCZH 2H6BA 3FHNA 3L2VA 1YYVA 2FQ4A 2MG4A 1FZPB 3J80Z 1S72P 3D6YA 2E1MB 4I09A 4RA2A 2XC7A 1VQ9I 1VPCA 4JX6A 1E3OC 1VQLI 3G4SP 3JSVC 3DBRB 1RQVA 1JGSA 1N2DC 3CMAI 5FLVA 2ZKZA 3H1IE 3O8ZA 1WH5A 5BPIA 3KE2A 4OGQD 2DPUA 1NU1G 4WXCA 3ZRGA 2W82A 2HG5D 1SFXA 1MD0A 4F55A 4Y52J 2AXCA 2OYHC 4DBQA 1WI3A 1R1TA 3DV8A 3KQGA 3ZQGA 3BVHA 4CCJA 3F8FA 1W2EA 2FXMA 1K73Q 1TZLA 3PFIA 2YKQA 4MTDA 2ZAEB 3MUDC 3RKWA 3WODF 2O3JA 3M0DC 2O6GE 1F4KA 2JN6A 3U2RA 2XVCA 2COMA 5ILUA 3HRTA 3L71G 2QSIA 1ZRTD 3E5XA 2LH9A 2FF4A 3SZGA 2O03A 3K4JA 4A5NA 2P5VA 3RIRA 5FRMA 1T56A 2X6YA 3K4NA 2R7QA 1T2KD 1SVFA 1QVGO 4U88A 2WADA 2A06D 2JEEA 1XMAA 2GIVA 2IJLA 3FBIB 1YQ3C 1S5LE 1B8IA 5IP7J 5E1XA 3A0HE 2V6CA 1XGSA 1X22A 3W2AA 3IAOA 2V6EA 4DCKA 1EZVE 3GHGB 2VJJA 1NTZG 3OOUA 3K1MA 2UUZA 1R5ID 3GTJJ 2K37A 1Y8QB 4IHVA 2KI7B 5IT3A 5A2QZ 3A01A 2RNJA 3EFGA 3ZN1A 2GXBA 1WJFA 3ZQQA 3S15J 3H1KJ 2KIMA 3Q1MA 2W84A 1AHDP 3LWFA 2JR8A 2N8GA 2ESNA 3CWBE 2KIFA 4ITVA 3KFWX 1RUNA 3OS2A 1XC5A 3PP5A 1RF1C 1ZOYC 4PJ0C 5KLVD 1S7EA 3LSPA 2EZKA 3JRHA 4HQEA 2M30A 2HYJA 4Z2YA 1PZQA 2LOOA 3J7ZI 4C2UA 2V26A 1L0ND 3BG5A 4B4CA 1PV3A 2VKDA 1LE8A 4IO9F 1SQPG 2POHA 4N0BA 1F9NA 3TNUB 4C7NA 2QJYC 2IGOA 4BHCA 3ABUA 2BGCA 3QQAA 3S2WA 5HODA 3VMXA 5GTIC 5GTHE 2NVQJ 4H0LD 1M8OB 3GMAA 2QEXP 1AV1A 2Z4EA 1EJ9A 2HZDA 4YFXF 2E2JJ 4BDZA 1VQ7I 2WV0A 3WGIA 2CUJA 1A31A 3S14J 2YNYA 4KT0J 1Q1VA 3P9IA 1PJRA 4FASD 1KGSA 2W00A 3E1IA 1S5LX 3E3VA 2CGPA 3HD7C 1VQNP 2ZXEB 4ZTFA 3Q5RA 1NK3P 1XTAA 2KJCA 5CJ9A 1W36D 3V8JA 3PL8A 1T3JA 2OTJI 5AW8B 4WY4D 1OCCH 1RKWA 3GZ5A 3L7WA 1VQKI 1OIPA 2N1TC 4OH8B 4O5VA 2AEJA 5BVZA 1REPC 1ETYA 2G3AA 4W80A 2XIGA 3O3KA 3PSFA 5FKMA 4EJOA 2LR8A 4MHGA 1P84E 1HSJA 3K2AA 3F23A 3C1DA 1ETVA 4YRVA 4U3FD 4C30A 3WTZA 5A2QK 5ICGA 1ITYA 1FC2C 1ZLLA 1BI3A 1EDKA 2VQLA 2HEOA 1E5WA 3MKLA 4B1RA 2LKPA 1GTWA 1CF7A 1ORKA 2W85A 1T08B 3H1IG 4ZDPA 2ZMEA 1YQ4C 1PGJA 2JPCA 3KXDA 4D6TJ 4BGDA 1SQXD 5LLQA 3DKWA 3BCCD 5DCFA 3HC7A 4LIUA 3IP4B 1UJ8A 3HSRA 4G6TB 1VQ4P 3TBIA 1RE3A 2WSCH 1NAFA 3VMAA 2FJ1A 3OS1A 2X48A 1Q81Q 1KU9A 1I6XA 4RB1A 4A3MJ 3C18A 4AYBN 1L0LD 2O5RA 3TW6A 1Y6IA 2DYRH 1O3TA 4XRSG 3KHUA 3RJPA 4ZDLA 1ETXA 3CX5I 1X0TA 3BLYA 2ACJA 3HOVJ 2VUMJ 1W5SA 2PQ8A 2WAQA 1EZVG 4GYGA 4EJWA 5IOZA 1BCCJ 4LJZF 1KTMA 4BXXJ 1KILA 3SWFA 2IYOA 3TO6A 1AKHA 1ZG3A 4Y99C 4BRYA 5D6EA 2R5ZA 2DU9A 1K04A 3CWBG 3QP5A 2JPBA 3PHLA 2OUMA 3GW6A 3V8KA 1IUYA 3RL0C 2E7WA 2CH0A 2LKSA 1KV4A 3RKYA 3PRJA 2VODA 3N05A 3IV5A 2WVRA 3QODA 2HZTA 3P9CA 2O9LA 1I5ZA 2EIKH 4FHTA 4PZJA 2AXTE 1X3ZB 3BG9A 5HLTA 3H1HJ 3HTUA 2M0BA 1FZCC 3ZMTA 2LXCB 3MHVA 2B9SA 1Q82Q 3PUBA 5TGTA 5AW0B 3GYHX 3F22A 3P7NA 5FKOA 3MIWA 1H89C 3D5SC 2K1AA 4XMYA 3SYTA 3P7KA 2NVUB 4CCKA 3GW2A 4D5FA 2HQNA 1RKTA 4N9IA 2D1VA 2DQRA 5LHHA 3B5NB 5APVA 3BT9A 4XIDA 2H43A 1YTZI 3SZTA 3KZIE 4D9JA 3WU0A 4U0YA 4QMAA 4IL6C 2F5DA 2FOWA 2VBWA 1SQVD 3BOQA 3F8BA 2OYIC 2VPLA 1UIXA 3I54A 1I1GA 4A3CJ 1SQBD 1BC8C 3MTUE 5B5EE 2CK3H 1QGPA 5ICEA 1U2WA 2L9VA 1W2BO 3WGHA 4M6XA 2P2UA 3V2PA 1JI8A 1S72I 1KA8A 2A6TA 3GFMA 4XR6A 3HL2A 3G4SI 4JBZA 1X1DA 4OWFA 3SWKA 2DK8A 5CVJA 2GUVA 1ZREA 1DH3A 2VT3A 2EV6A 1P2FA 3FXRA 1K4TA 3V6IA 1YQAA 3COAC 1USTA 3PJRA 4V2GA 4L9TA 3A0HH 3C1LA 3BJAA 3T8RA 4ENMA 3HTSB 3G2BA 4KT5C 1SQXG 3F89A 4HAMA 2AEFA 2ZVOB 1STZA 2I1JA 1FWZA 4H4KC 2A45G 2DI3A 1GK4A 1FEXA 2YMKA 1L3LA 3ZMZA 1QU3A 1ZQ3P 4UUSA 3I9V2 4M71A 3K6GA 3BR1A 3BR5A 2ZXIA 5F08A 3TGUJ 2EZLA 4R79A 4A93J 5HS7A 4G7OF 4ZYAA 3PFYA 2Q8KA 1OW7A 4EM1A 4I2LC 3GFJA 1ZYRF 4V2FA 5B3SH 3A2AA 5AVTB 4NC8A 2Y48A 1URQB 2A05A 3R4YA 3MCZA 1T33A 1MNMC 2QSGX 2ITAA 3I56P 1TNSA 2E2IJ 4ASVA 2E71A 2NOGA 2EFPA 5JLWA 4L9NA 2OCCH 3DEWA 4H0LC 4ZKPA 5KLIB 4FTHA 3OYAA 3GTPJ 1KQFB 3Q5FA 1MH4A 2ECBA 3N97A 1LTGC 1LUJB 4JPZB 1AQTA 5GTHH 3H3UA 2L4AA 3VOPA 3HB9A 3CUQA 2HPMA 2O1JA 3TQNA 1NGMB 2NPSB 5C3EJ 2JMWA 1VDFA 3L36A 4M3GA 2IFNA 3VYSB 1FJPA 4XLPF 3P5JA 3L2WA 3QOEA 4GT1A 2QBYB 4C7RA 2M8EA 2HOEA 2DN0A 3EPZA 1ENHA 3TSIA 4DT0A 1F43A 3OL4A 2CUFA 3JSOA 2A5WA 3CMYA 3W3CA 5KNLA 1KILE 1DPUA 2DA1A 2MH9A 1UFMA 1XDUA 1P84H 4HOBA 4M3FA 4P96A 4DZJA 1FSHA 1JUNA 1JHHA 4PGHA 3V7RA 4TLFA 5KAFE 4M3EA 2ZVNB 4L9JA 1HC8A 3NWSA 1SFCD 3KZIH 2E76B 4WCGA 2E74B 3JR9A 3FXOA 5AVVB 5L8RJ 1N77A 3L73D 3WUTA 5CBNA 4JQ0D 1JY2P 1HDPA 1KMIZ 2EIMH 4I7ZC 2A45H 4HW0A 4JF7A 3CC2P 1TTYA 5E8GA 5ED4A 1N7SC 2CQXA 4DIQA 5LEJA 1A5JA 4B3AA 1QX8A 3L71J 2G0EA 4BEHA 3RK3C 3MKZA 2QWWA 4EQQA 3QPLA 1WJ5A 3GTMJ 1W7PB 1X19A 4L75A 4IX7A 1SQQJ 3E97A 3P32A 4A3IJ 2WTEA 1QVFO 1JHFA 5GPAA 1WI9A 1SFOJ 4MO7A 1QHGA 2HTJA 3ZQCA 5C44J 4II2A 1NTZJ 1YW9A 4UB8C 4OIQF 2VC0A 4LITA 3H25A 4L73A 1R6RA 3L00A 4AIJA 2C9NY 2CFXA 2XPWA 3L72E 1W5CE 4LGDE 3CLOA 2P4WA 2OTLP 3CD6P 4M3BA 3JRCA 2ZFWA 1G6NA 2DT5A 1G59A 2H27A 3PO3J 4YTPC 1NKNA 3H1LJ 1OPCA 3DTKA 5LD2C 1VQ4I 3PO2J 3V2NA 2I1KA 2Z2SB 2Y9ZA 1IC2A 1K05A 5IT9Z 2BCCE 1IN4A 3FXDA 3L74D 3EYYA 2ESHA 4L5IA 4MFDA 2EFNA 3HXLA 3K2ZA 2RVCA 5DEQA 4I1LA 1JY3P 3CZ6A 2Q0OA 2IPQX 5GAHJ 5FD5A 2LF8A 4B43A 4F7ZA 1I1SA 1K6YA 3BZ6A 4BXUA 3H9GA 1M1JA 1FZEA 5APQA 3VODA 1HKTA 4OGQB 2HYFA 3D6ZA 2GM4A 1A02J 1BE3J 4LG0A 4GDFA 4CUGA 3C2BA 2HQAA 2NNNA 2ETHA 1SC7A 5LGTA 5M5XJ 3ZQFA 1KQLA 2M4GA 3HTKB 4D6TD 1NTKD 3MUDA 2EILH 3A0BC 1E3PA 2ZSIB 2CW7A 3QP6A 2F4MB 2RGVA 4JX5A 4RAZA 5H20A 2O8XA 3LA2A 4JQFA 4M9SA 1K79A 1HF0A 5LHIA 1X1PA 1IV8A 2HODB 5CJ0A 4CSWA 3KEOA 2DA3A 3OSFA 2D2CC 5FRNA 1B72B 4EMSA 5B5EH 3CCRP 4DZOA 1S6LA 3CJNA 4NB5A 3OYDA 3V2QA 2JA2A 2JRMA 3PQJA 2DAOA 3DTEA 3L70E 2DCEA 1VQ6P 3VWBA 5K5QA 2G9WA 4JOMA 2NS0A 4Y3OA 3FXJA 1FOWA 1VTNC 2B87A 3H1IJ 1OLTA 4NC6A 3JAMZ 4UUTA 2Y0SA 2ZMEC 1ZTRA 1I3QJ 3BC8A 1KU3A 1X1AA 2NVYJ 4UHTA 2JP3A 5IT9K 1EC5A 1NAYA 2EINH 1WJEA 2FMLA 3OMYA 3SXYA 4AD9A 2P67A 2F48A 4PSWA 3M8FA 4UB6C 2KP8A 3I5CA 3LW5H 1YHQI 2L01A 1GXPA 3GLMA 5KK1A 2YIUB 3M9QA 3HOYJ 1XD7A 1IRXA 2KP6A 5GADJ 4LMYA 4B09A 5F1RA 1JJ6C 1L4AC 5KCMA 3W6KB 3NEUA 4ZC3A 1FBSA 4Q48A 1PUFA 1V3FA 4ASWA 2TCTA 2D2WA 2VXZA 5GAEJ 1ONVA 2F4IA 1GU4A 1VQ9P 3H92A 1RF0A 1YE9A 4LB6B 1G2HA
chains in the Genus database with same CATH topology
4M9XA 2E42A 1TQMA 2KIUA 1RUOA 1GL2A 2YKOA 2QVOA 1KFMA 3ELKA 4KNYA 5HDGA 5BQTA 1NHLA 4PDKA 3IKTA 4KA4A 3J7AO 3KLOA 3R0AA 2N1TA 2YPRA 2GUSA 1F5TA 1G2CA 1W4MA 1OWAA 3EQLF 1AQ5A 3N4XA 5DD4A 3P8MC 2R7DA 3NQOA 3HHGA 4HF1A 4XBFA 2H94A 2FNPA 2LSOA 3GWZA 2KKOA 4CGZA 4NQWA 1SP4A 1HGVA 2VRSA 1EH6A 4G6DA 3QRFF 2UXNA 1RI7A 5H6QA 1R00A 3U1CA 1DUXC 4IHTA 2J5PA 4LGWA 1JOCA 3VMZA 1HXDA 2M1BA 3GX4X 3V5BA 3HUSB 1GDTA 2WITA 2OZ6A 1PP7U 3J81Z 4U0WA 3JSPA 3D0SA 2OZUA 4I02A 1LT9B 2HR3A 3IC7A 5HS8A 2YSRA 3V7SA 1QL1A 1H0MA 1IXSB 1NTMK 2Y75A 1XSDA 1TW2A 4KMFA 4G9YA 5L3DA 1U5TB 5JHUA 4XSXF 5CVUA 4MQVA 4BHBA 3REOA 1R5HA 5AVQB 1AOYA 1WRJA 2HFHA 1NH4A 2IFMA 3EYIA 1LNWA 1OYWA 2J5OA 5DUKA 3SHFA 4QLCU 4G6QA 2FQ3A 2VE8A 1H89A 5DD8A 2R3CA 2GAUA 3J81K 3MZHA 1IN8A 3ERED 3Q9VA 4AIKA 1ZG1A 2NPSD 3TKYA 2A6HF 3BASA 1IZ1A 4KN7X 1JY2O 5AW7B 3F6VA 4GYIA 2FYUK 1IFJA 1R23A 3RK2B 1LEAA 1GZLA 2Z5IA 3I58A 1T2KA 3HIFA 2Q5UA 2GWRA 1ZN5A 3KPEA 4ESBA 2O3FA 3D5LA 5AVUB 1FBMA 1OYIA 5HDNA 5K5OA 4ON0A 5TJJA 1AFOA 3IL2A 4HDVA 1UCRA 4Q47A 4WXHA 1MJAA 3BRVB 1MV8A 2VC1A 1YFHA 2EV0A 2JSCA 3IWZA 3FMRA 2HQRA 2HYNA 4ASNA 2GQQA 1G3SA 1LTIC 2G7UA 1G3TA 1LTTC 1LDKB 1W7PD 2KRFA 4U7DA 4WB4A 1G1IA 3T97A 2BEOA 5H6RA 1LTJB 2QQAA 3I59A 2J59M 1SAXA 3L09A 4EJTA 2P7VB 4JK1X 3H6PA 1ZRCA 2WWYA 2LKMA 2YO3A 1IO4A 3TOBA 1L0NK 2GXGA 4WY4A 5D5VB 1ULYA 4CZZA 4G7HF 1XSVA 1YIOA 3I4PA 1JTHA 1HH0A 2HPCB 4IJAA 5FLXZ 3WTSC 1M1JC 2QM7A 5AIPA 4E70A 5HS9A 2FRHA 4KUMA 2ZNZA 1SFCB 3BPVA 5L3CA 3B5NC 3KEQA 3V4QA 1IN6A 4ESJA 1T98A 5F64A 3FF5A 1N7SA 2FBHA 2BE5F 3DQVC 2IPPA 3M06A 1QO0D 1FY7A 5DCMA 4KFCA 2NNYA 2L02A 3BPXA 1OMIA 2BASA 2WWWA 3M7GA 1XDSA 3E5UA 2EFQA 1R22A 2OARA 5K5RA 4IVNA 1FYKA 2W27A 4RB3C 4B8XA 2H09A 4W7YA 3H32B 1QNTA 2P7CB 2DK5A 2CPSA 4P9UA 1NO4A 4AYCA 5FLXK 1H8AA 4CDGA 1L0LK 2ZO4A 4JYCA 1DP7P 4LK0F 3ZPLA 1SMTA 5L3BA 3HRUA 4HF0A 3QU6A 2M3BA 2VBZA 1MJ9A 5LBQA 1WKMA 4I6MC 5JFRA 4ENKA 1URQC 1N7LA 1RF0C 1LB2A 3BROA 1YYCA 1G4DA 3L37A 1LTAC 1TQPA 2YMYA 1WSUA 2Q3IA 1GL2C 1C0WA 2WZ7A 1J0RA 1T0FA 2FFDB 4CICA 4EOTA 3SZPA 3KCCA 1MDMB 4N9HA 3HE4B 3R0JA 1GXQA 3AAFA 1EH8A 3RPQA 1ZN2A 1SD5A 4U0VA 3EDPA 2C0XA 4BHPA 3VMYA 1FOSF 4UV8A 2YU3A 5ILVA 4RB2C 3OAKA 1SQVK 2UZKA 2R5DA 5HLIA 1YW8A 4OU0A 2WPRA 3L35A 2OQGA 5CCHD 2HLOA 3FM3A 3M91A 1LVAA 1K78A 1KYWA 4IF4A 1L4AA 4M6YA 3I71A 4EJVA 2Q9IA 1NHAA 1R5GA 1A02F 3TDUC 2FNAA 5CMZA 1RE4C 1H9GA 3T5XA 4ZZDA 5D5WB 2IA1A 3GFIA 5BOXA 3KDPB 5ILSA 4I0AA 2AXLA 2PP6A 3F6OA 4M74A 1LWUA 1TW3A 3VN0A 5AW2B 2QLZA 1O7FA 1Z05A 2TDXA 2CO5A 5BU5A 4I98B 3C9IA 3KP5A 2Q7CA 3KZZA 3K1PA 2NAZA 2WC2A 3KP2A 5KJ7D 2OQRA 4EM0B 1FZGA 1ZHFA 4DQ2A 1S7AA 1PP8F 4XLNF 2YR2A 5CYVA 3BJ6A 2V79A 2EK5A 2BV6A 2MD5A 4I0BA 1PUEE 2B0LA 1IFNA 2PJPA 4KN4X 5AVRB 3TOAA 5LHGA 3RK2D 2XAHA 4JYBA 1T2KC 4ZZLA 3L9FA 2OYHB 1J59A 2A07F 3FX3A 3T1BA 1YTZT 3GXOA 2W57A 3KP6A 4OMZA 3Q9SA 5K1YA 1KU7A 3GHGA 2KJBA 1ZLJA 1IF1A 3OA7A 4RS8A 1P4AA 1FU1A 2A69F 2GA1A 4BYYA 1XB4A 2V1UA 4EGZA 3HE5B 3FHZA 1XTGB 2K86A 5CHXA 4IFDK 3TNUA 4O9BA 4YIFA 1B4AA 2WT7B 1B6AA 1FDMA 3LAJA 2W6BA 4BNCA 1HJBA 1XMKA 2FSWA 3VTPC 1RF1B 2HFED 5LGUA 1CI6B 1SD4A 1QZZA 2XUBA 1P6RA 1YO5C 4HBLA 1GU5A 4MEXF 1WRGA 1P4XA 4HV5A 4WY4C 5AW3B 3M0AA 1HTLC 1MZBA 2FU4A 3W6JB 2XNXA 4MTEA 2O01H 4MGRA 1HQCA 2K4BA 3HD7B 1KILD 4WF2A 1FT9A 2FOKA 1QQIA 1XGMA 1JCDA 4A6EA 2PMHA 4S04A 1HW5A 2AS5F 5D5UB 5DDGA 2P5LC 4CHUA 3I5UA 2C9LY 1HSTA 2OA4A 2PLYA 1OYYA 4YFNF 5J8CA 3VFZA 2R5BA 2DW4A 5J6XA 3QAHA 4HLYA 2ZFCA 2QQ9A 5F6FA 2HS5A 1S3JA 6PAXA 3FZVA 1LQ1A 2P7JA 1KQ9A 3EETA 2R32A 1U5TC 5EEHA 5FGMA 4M9ZA 3LA3A 2MLKA 5AW5B 3TYYA 3GFLA 3P9KA 4G94A 3P8CE 2EWNA 2Z33A 1RY3A 1JNMA 4MNUA 2KB7P 1D8KA 5BS6A 3B5NA 3ULQB 5AW9B 4HV6A 3V4GA 1FOKA 3RL0B 1G1JA 1BM9A 5BU8B