1NAYA

Gpp-foldon:x-ray structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
GPPGPPGPPGPPGPPGPPGPPGPPGPPGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagen-like peptide
publication title Collagen Stabilization at Atomic Level. Crystal Structure of Designed (GlyProPro)(10)foldon
pubmed doi rcsb
molecule tags Structural protein
total genus 4
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1nayA00
1PGPA 1PGQA 1NAYA 2IYOA 2ZYAA 3FWNA 1PGJA 2W90A 1AVYA 1AA0A 2ZYGA 2IZ1A 2W8ZA 2ZYDA 2IZ0A 2PGDA 2JKVA 2IYPA 1PGOA 1OX3A
chains in the Genus database with same CATH superfamily
3L72G 1IFIA 1FAVA 1VF5D 1EXIA 3V5BA 2J58A 2A45H 1J1DB 4YTPC 2M3BA 5APQA 3V4QA 1SQVE 2HODB 4HKZH 2O01N 3AE3C 3L73D 4PV1D 1Y8AA 1JCDA 1X8YA 1FOSF 2I8DA 2OTLP 3LW5H 3CCRP 4GODA 2QG4A 3HD7D 2V7QH 2HPCB 3SWFA 5AW9B 4OVNF 2C0XA 2WSCJ 2KSJA 2OYHA 3RK3B 2Y9YA 2PFXA 4JBZA 3VYIA 4WVZA 2YO2A 5BU8B 1FZCC 1PGOA 3G4SP 4U3FJ 1IO4A 2A45I 1SQVD 1VL2A 2P67A 2OGUA 3CX5E 2FYUK 1KQSO 4H0LD 3H1HG 2JWAA 3G3ZA 4GOFA 5GTHH 4ZKPA 4UB8H 3CWBG 3VN0A 3N4XA 3CMEP 5B66E 1SQPG 1EDKA 4B86A 3B4SA 3L75J 1M8OB 1LTJC 3TYYA 4DJGA 5KLIC 1T6AA 3L71J 1JMMA 3BATA 3BRVB 1DX7A 3IN6A 3L71E 2QA4P 1G2CA 3SWYA 5KKZB 1LJ2A 2JKVA 2O01J 2WPQA 4N6JA 3CCJP 1RF0C 5TISH 2E75C 1SQBJ 4I7ZB 3C9IA 4OWFA 4U3FD 3CX5D 1SQBE 5CCGA 3WUTA 4HB1A 1LWUA 1YQ3C 5KLVK 1N8RQ 4Y28J 3T97A 3GHGB 1GW3A 2R5DA 2ZYAA 2KS1A 3L71D 3VMAA 1RE3A 2H88C 1KFMA 2IFMA 2OTJP 4W7YA 3OAKA 2LXCB 1T3JA 2IZ1A 1JY3O 2JWDA 1SQBD 1N7LA 2YMKA 2R5BA 2YKOA 1KN7A 1P84I 4NPEA 2B9BA 4C7RA 3TK1A 3IAOA 4WY4B 2C0WA 3D6YA 1GDTA 1BGYJ 2JR8A 2WSCH 1UIIA 1QVFO 1RHZB 1L0NJ 4JYCA 1E5WA 3L74G 3SSUA 3CC2P 2AXCA 1KC8Q 1BCCE 3ABVC 2Y0DA 1JO5A 2WZ7A 1KV4A 4O9BA 2Y0CA 3GMAA 3AE6C 4OGQB 3F89A 5CMZA 1PIXA 2K1AA 2FFDA 1N7SD 1FZCA 2W6JH 3IR9A 2CK3H 3CCEP 1GL2D 2JDIH 3LIEA 1HBWA 3AEDC 1SFCD 3A3YB 4Y99B 2QEXP 1N73B 3A5TA 1BDCA 2K3RA 3U59A 1RQUA 1URQC 2YXQB 3M0DC 1PZQA 5AVQB 3C1LA 2O01H 1BCCD 2IBZG 3CXHD 1VQLP 4ZNCA 1OW6A 1PL5A 1HUCA 1JCCA 3RL0B 3NFQA 2WSSH 5KJ7D 1YITP 1NVOA 2BEZF 3PTZA 1YJNP 2P10A 5APSA 3EFGA 1GZLA 1KFNA 5B5EH 2E43A 2ZFCA 3HE4A 3KPEA 2M8RA 2W6BA 4M3LA 2D2CB 4OH8B 2XV5A 1GK6A 2IYOA 1FDIA 2WT7B 1D7MA 3D70A 3BASA 2KLVA 3CCSP 1LTIC 3RK3E 3G6EP 5KLIB 1NTKJ 1BE3G 2YIUB 3CPWO 1NTKE 3E1IA 1L0LG 4I6MC 3BCCJ 1NOHA 1BDDA 5AW6B 2GA1A 1M1JB 3H1JE 2ZXXA 3L70E 2WTYA 5EFWB 1KILC 1DH3A 2OARA 2FXOA 1OW8A 2K9YA 2WVRA 1ZV8A 1JM0A 1SQQJ 2FBWC 4RESB 2WPSA 1SQQE 2H8PD 3RK3D 1IFJA 1NAFA 3CXHH 1GU4A 4H13B 3VMXA 5AVUB 1NTKD 5L8RJ 1Q7YQ 5CJ0A 4EYYQ 1OW7A 3I5CA 1S9KE 2QJPB 1GU5A 1M57D 2MJZA 3H1JD 3L70D 3M9QA 1Q82Q 2E5TA 2CPBA 2M5AB 1EDIA 1LGHB 1YIJP 3H1KE 3H6PA 3M0AA 3AE1C 1T3UA 2PGDA 1T2KD 3CMAP 1SQQD 1BSHA 3HE5A 1RF1A 2K9JB 3H1HJ 1SQXJ 5AVTB 2B87B 3CXHI 3AE7C 3CWBJ 1IFPA 2YKQA 1JTHA 1SQXE 3AE9C 1URQA 1SQPJ 1KD1Q 4W80A 2ZVNB 1S9KD 2KSEA 1SFCA 4KT0J 4PD4D 3KZIE 2HFED 4WB4A 1EZVG 4H44B 1L4AB 3EWKA 1NTZE 2N1TB 3GF7A 3H1KD 1YQ4C 5APUA 3HTKB 4D6TJ 5GTHE 1FJKA 1J1EB 4UB8E 3P8MC 4D6TE 2DW3A 1JY2O 4EDFA 1E79H 5KJ7A 2WQYC 3VTPC 1SQXD 1NU1G 3L36A 3CI9A 2CPSA 1HWTC 4RKUJ 2A06E 3MGNA 2PP6A 5CHXA 3JSVC 5CCGC 4Z1MH 2KLUA 2XZRA 2OYIC 1LWUC 3VP9A 3MUDA 4JF7A 1NTZD 1SQVK 2E76C 3WUUA 1FU1A 4IFMA 3FGAD 3D6ZA 1QL2A 1SS1A 2E74C 4WY4D 3SFDC 1AQ5A 3MTUE 5APYA 1PPJG 1P84E 1FZGA 1OVRA 2QJKB 1LTAC 3VMZA 1RE3C 4D6TD 3WMM0 2RKLA 4IFDK 3RK2B 1A02J 4OGQD 4PD4H 1KB9H 3TNUB 3B5NB 1KORA 2QJYC 2A06D 5BVZA 2MKVA 3HUSB 2LR2A 2G8YA 3TGUG 1AVOA 1Z56A 1ZR4A 2R3SA 2JJLA 2SPZA 2NPSB 3Q2YA 1MV8A 1VF5C 5DJUB 1YTZT 2B88A 1QEXA 1EXJA 2IZ0A 2FKWB 1SP4A 1G1IA 1H8AA 3AEAC 1P84D 4HYTB 1WT6A 2JEEA 2KYVA 5AW0B 4KJMA 4JYBA 1J2JB 1LP1A 3V2RA 1NTMJ 1FC2C 3RL0D 1IK9A 3KZIH 2FFDC 1NTME 3EQ2A 4PD4I 5AW4B 3HD7C 1KB9I 2ZXEB 1MFTA 3WU2H 1GW4A 4U3FE 2LKMA 2D2CD 5AVWB 1L0LK 1K73Q 2JP3A 1W5CE 4A7PA 1SQBK 1S3JA 5AW8B 1A02F 3KQGA 1FS0E 1PP9J 3AEEC 3CCLP 1VQ6P 2Z4EA 2P7JA 3AE8C 3L75E 2OYHB 1PP9E 3H1IG 4NPDA 2YKPA 4JPZB 4K35A 2O1JA 3GHGA 1NTMD 2Y0EA 4RJTA 1S5LH 2FYNC 1BE3J 4HJGH 3CL3D 1KTMA 1P84H 2FYUJ 4ZKUA 2OYIA 2POHA 2R32A 4ASVA 3M9BA 2FYUE 2PRRA 1ZN5A 1VQ4P 2N9BA 5B5EE 3TSIA 2O3JA 4H13D 5CCHA 1LT9B 3L75D 3V4WA 1PP9D 4N78E 4GDOA 1CSBA 3H32A 1OXZA 3TF5A 1VQPP 1PGQA 2KI7B 2WSEJ 3GLMA 3U1CA 1JY3P 3L73G 2ZT9B 1CI6A 3K5BA 3T97B 3L37A 3CCUP 2FXPA 2FYUD 4AYCA 1YBKA 5KLVJ 3W68A 2BCCJ 4TT3H 2C9NY 2QE7H 2BCCE 4N78D 4AQRD 3LIDA 4EOTA 2ZJSE 1BGYE 4R4MA 3M91A 1L0NE 4ZMDA 3CXHE 1YYCA 3CCQP 1R8EA 1SQVG 2IPPA 3GF3A 3OJAB 1Q2NA 2HR3A 2KP8A 4H44D 1L4AD 1N73A 2N1TD 3E1RA 3F5HA 1VQNP 1NU1K 2UWJE 3HD7A 1R5LA 2AEMA 1H0TB 1L2PA 1MZ9A 3CCMP 1RF1C 5APTA 1M56D 1K9MQ 2RH0A 3AE2C 3II6A 1N7SC 2BCCD 4C7NA 2WSFJ 1BGYD 1GL2C 3S9OA 3Q5SA 1L0ND 1USEA 2GUSA 1SFCC 2OQQA 5AW3B 2WT7A 3RL0g 1NYHA 4U3FG 5AVZB 1FZCB 2FYZA 1KZUB 4RO0A 3H1LJ 4L73A 5TJHA 1QLED 5APXA 3H1LE 4JQ0D 5GTIE 4L75A 1PGPA 1MUUA 1DD4A 5KJ7C 1X22A 1DEBA 3L71G 1VQ7P 1LTJB 3USSA 1M1JA 3FXEA 3RK2D 3R4YA 1QX8A 3BRTB 2XKMA 3B5ND 3CC4P 2HYNA 2WSEH 1Y47A 4LLHA 2NPSD 3MUDC 3L72J 1SQBG 1X79B 3BCCE 2E75B 2YXRB 3PJSK 3HE4B 1T8ZA 3H1LD 2G3AA 1J1DC 3NTNA 1CW5A 4LC1A 4IOIH 3TGUJ 2ZYGA 3KYQA 1HJ0A 3G71P 1IJDB 3M06A 3B71A 2K37A 3O6QB 2L91A 5DJTB 4IL6E 5CJ4A 1RQVA 3Q5RA 1OZHA 1HH0A 1QL1A 2M5AA 1JNMA 2OTKE 2M0BA 1U7MA 1SQXK 1VPCA 1TU3F 1VQ9P 4PD4E 3RK3C 1LTGC 1KB9E 5KAIH 3BCCD 1K04A 2RN0A 1USDA 2QIWA 3L72D 1WRGA 5CBOA 2HG5D 2Q3IA 3ZDMA 1YI2P 1NTZK 2Q9IA 2KK7A 4YPCA 3PHLA 1Q90D 2WWWA 3KXDA 1JOCA 1QGKB 3TDKA 1MFZA 3KHUA 2WSFH 2E5YA 2P1JA 1BCCG 1L4AA 3Q3DA 1N7SA 3H1HE 1XTCC 2W8ZA 1UIXA 1GD2E 2IX7C 3CWBE 1GL2A 4MN4C 1ZMEC 1SQPE 1T2KC 1RH5B 3BVHA 4R4LA 5GTIH 3AEFC 4XE5B 5KKZC 1KB9D 4K3AA 1EC5A 2XNDH 3WUVA 1X9VA 3NXSA 4GKGA 1BSNA 3QWOC 5KAFH 1NWQA 3WU2E 1OIPA 4I7ZC 4BRYA 1YTZI 2XNXA 1RF1B 1JY2P 3RGUA 3A0BE 2Q3EA 3PRJA 1JTHB 3RBXA 1URQB 3GHGC 2AEFA 3H1HD 2QM8A 4LGDE 2AXTH 2R44A 1FBMA 3EFFK 4L74A 3CWBD 3I56P 4CPGA 1ZR2A 2ZT9D 1AFOA 1SQPD 4GOEA 2IYPA 2NZ2A 3A2AA 4C46A 4U7JA 1GTWA 1NGMB 1S5LE 3S1KA 1FZAA 1PFIA 2O1KA 3V6IA 4IL6H 3B5NA 5CCHC 1KYOI 1OMIA 2Y9ZA 1HF9A 1HVVA 3CLQA 1NH4A 1KQGB 2HODA 3H25A 1NTKG 3AEGC 2NPSA 1NKNA 4YXDC 1VQMP 3S4RA 2KNCB 1GK4A 4EIJA 2Q7CA 3H1JG 2HPCA 3L70G 1FDOA 1NTMK 1MKMA 3L74J 1G1JA 1S2EA 4BWNA 3L74E 3A7OA 4OGQC 2KOGA 1KILB 1SQVJ 3UIAA 3NMDA 1S72P 1SQQG 3B8EB 2YO3A 5AW2B 2Z5HA 3OW2O 2GUVA 4Y99C 4DT0A 4PV1C 4N3YB 1LNQA 1N73C 1JY3N 3PLNA 1JUNA 1YJWP 3AECC 1EQ7A 2A45G 1VDFA 3D71A 1AJYA 3U1AA 4GT1A 2I1KA 1EDLA 4I2LC 1K8AQ 1YJ9P 3L74D 2ZYDA 3G9RA 3H1KG 3RL0C 2GM4A 3A0BH 2IBZE 1OFCX 1VQ5P 1RE4C 1GMJA 1W2EA 2OYOA 1S5LX 1LP1B 4L76A 1SQXG 2D2CC 2HLOA 4H0LC 5AW1B 5BU5A 5AVXB 2BASA 3PH0A 4TLFA 2ZVOB 5AVVB 4I1LA 4WWIA 3VMYA 2ZAEB 2E75D 2YIUC 2QM7A 3FXDA 1PGJA 1HJBA 1LT9A 1NTZG 1LTTC 1BE3E 5E79E 1FDMA 1H88A 2WITA 1M1KQ 1L0LJ 2IFNA 3CC7P 1ZRTE 2Q6QA 3P32A 2I1JA 2Q5UA 2IBZD 3KDPB 1WMKA 1M1JC 1SVFA 1L0LE 4D6TG 1ZLLA 5AVYB 2B89A 3FWNA 1Y9BA 1AA0A 2KXPB 1G2CB 3PP5A 1NKZB 3N7NA 2P58A 5AVRB 2A06G 4XA4A 5AVSB 2QVAA 3JC22 3L35A 3VOPA 1L0NK 3V2QA 4WY4A 3SWKA 4H13C 1DD3A 2Q1KA 2JO1A 2LXBA 1ZXGA 2OYIB 1BE3D 2W6AA 1LWUB 1ZRTD 2E76B 2QJPC 2E74B 1L0LD 3FX0A 2WMMA 4DOJA 3MIWA 2KS1B 2YNYA 5KLVE 1H0TA 1R5SA 3A0HE 1OVVA 1Q81Q 3H32B 1OX3A 2WPRA 3FWLA 3ITKA 3HRNA 1H89A 3P7KA 2QJYB 1VQOP 1BCCJ 5K5GB 2KIKA 1CI6B 1XTGB 4PJ0E 2QSIA 1FE6A 1VF5B 5KAIE 3CX5H 4KHXA 1U57A 3CCVP 3MD0A 2PAJA 3V2NA 4H44C 1L4AC 1FZBA 1URQD 2N1TC 1RE4A 5B66H 1YHQP 5KLVD 1EZVE 2Z5IA 1NTMG 4GIFA 3AE4C 4DCKA 3P8CE 4PV1B 1J1EC 2KB7P 1NTKK 1AQTA 2FFDB 5E79H 4HH2A 1KQFB 2FY8A 1LTJA 3HD7B 3AE5C 1S4XA 1LTBC 1KILE 1FJPA 1NU1J 3IFMA 4QMAA 2IBZI 4WBAA 1CZQA 1NU1E 3I55P 3Q5PA 2W90A 5APWA 1S1CX 2BEQD 3CX5I 3JCUE 3L75G 1PP9G 1PV3A 5KAFE 1KYOE 2C9LY 1RF0A 4C7NB 2H89C 1W2BO 1EZVD 3Q1MA 4UB6E 1NHLA 1SQQK 3V2PA 1M7LA 4H0LB 1LT1A 3P8CD 1HTLC 2QJKC 3QH9A 4YXWH 1HGZA 1N86A 4EI2A 1PPJE 1JEKA 3O6QA 2AXTE 3RK2C 5H2FE 1X0TA 2FYNB 1KILD 3L72E 3B5NC 3HUSC 2FYUG 3C8VA 1AVYA 1NU1D 3H1JJ 1JY2N 3L70J 3RBZA 3A0HH 2NPSC 3TGUE 1KYOD 1NO4A 4DZOA 2NRGA 5APVA 1ZP0C 2N9YB 1IFNA 2W83C 3OA7A 1KMIZ 1RY3A 1PPJD 2H43A 4PJ0H 2RMZA 2H7HA 1IK7A 2K9JA 1KQLA 1SQPK 2YMYA 2B87A 5C39A 3VP8A 2R3CA 1FZFA 1U7JA 3MHVA 2IDBA 3W67A 3GW6A 2WPVB 3L4FA 1AV1A 1OWAA 1N2DC 5KLVG 2V4HA 3TGUD 2BCCG 1HGVA 2J59M 3MP7B 5AW5B 1BGYG 3H1KJ 1L0NG 1JB0J 2M3EA 1NAYA 2KZJA 2N1TA 1IFDA 1IFMA 4BXLA 1ZW0A 2J5UA 4ASWA 3HTKA 2OYHC 2VRSA 3LW5J 1K05A 2FXMA 2V7QJ 4NPFX 3H1IJ 1DEEG 1Q86Q 1DIPA 3H1IE 2L5GB 3R2PA 3JCUH 3M0DA 5AW7B 1KYOH 1VQKP 4UB6H 3HE5B 1NTZJ 2AEJA 1EZVI 2XDJA 3MZWB 1N7SB 3GG2A 2ITAA 2P2UA 2XU6A 3CD6P 1NJIQ 5KTBA 1GL2B 5H2FH 1SFCB 1LT9C 1OVUA 2QRXA 5CCGD 1IC2A 1JMBA 4IL6X 2E42A 3H1LG 5M1BA 3O8ZA 3M9HA 2E76D 3E7KA 3H1ID 1VQ8P 2K88A 1FOSE 1ZOYC 2E74D 2KNCA 4BRYB 5CCHD 1EDJA 3TNUA 4W7ZA 3IF4A 3HUSA 2W27A 1SLQA 3L73J 2ZT9C 4IFFA 3SFEC 1QVGO 3L73E 2KZIA 4AUWA 5TISE 1LTSC 5CBNA 1FZEA 4XFJA 1KILA 1M90Q 4WY4C 2KUBA 3BCCG 3AEBC 1IZNB
chains in the Genus database with same CATH topology
1PGPA 1PGQA 1NAYA 2IYOA 2ZYAA 3FWNA 1PGJA 2W90A 1AVYA 1AA0A 2ZYGA 2IZ1A 2W8ZA 2ZYDA 2IZ0A 2PGDA 2JKVA 2IYPA 1PGOA 1OX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGP A;  1PGQ A;  1NAY A;  2IYO A;  2ZYA A;  3FWN A;  1PGJ A;  2W90 A;  1AVY A;  1AA0 A;  2ZYG A;  2IZ1 A;  2W8Z A;  2ZYD A;  2IZ0 A;  2PGD A;  2JKV A;  2IYP A;  1PGO A;  1OX3 A; 
#chains in the Genus database with same CATH topology
 3L72 G;  1IFI A;  1FAV A;  1VF5 D;  1EXI A;  3V5B A;  2J58 A;  2A45 H;  1J1D B;  4YTP C;  2M3B A;  5APQ A;  3V4Q A;  1SQV E;  2HOD B;  4HKZ H;  2O01 N;  3AE3 C;  3L73 D;  4PV1 D;  1Y8A A;  1JCD A;  1X8Y A;  1FOS F;  2I8D A;  2OTL P;  3LW5 H;  3CCR P;  4GOD A;  2QG4 A;  3HD7 D;  2V7Q H;  2HPC B;  3SWF A;  5AW9 B;  4OVN F;  2C0X A;  2WSC J;  2KSJ A;  2OYH A;  3RK3 B;  2Y9Y A;  2PFX A;  4JBZ A;  3VYI A;  4WVZ A;  2YO2 A;  5BU8 B;  1FZC C;  1PGO A;  3G4S P;  4U3F J;  1IO4 A;  2A45 I;  1SQV D;  1VL2 A;  2P67 A;  2OGU A;  3CX5 E;  2FYU K;  1KQS O;  4H0L D;  3H1H G;  2JWA A;  3G3Z A;  4GOF A;  5GTH H;  4ZKP A;  4UB8 H;  3CWB G;  3VN0 A;  3N4X A;  3CME P;  5B66 E;  1SQP G;  1EDK A;  4B86 A;  3B4S A;  3L75 J;  1M8O B;  1LTJ C;  3TYY A;  4DJG A;  5KLI C;  1T6A A;  3L71 J;  1JMM A;  3BAT A;  3BRV B;  1DX7 A;  3IN6 A;  3L71 E;  2QA4 P;  1G2C A;  3SWY A;  5KKZ B;  1LJ2 A;  2JKV A;  2O01 J;  2WPQ A;  4N6J A;  3CCJ P;  1RF0 C;  5TIS H;  2E75 C;  1SQB J;  4I7Z B;  3C9I A;  4OWF A;  4U3F D;  3CX5 D;  1SQB E;  5CCG A;  3WUT A;  4HB1 A;  1LWU A;  1YQ3 C;  5KLV K;  1N8R Q;  4Y28 J;  3T97 A;  3GHG B;  1GW3 A;  2R5D A;  2ZYA A;  2KS1 A;  3L71 D;  3VMA A;  1RE3 A;  2H88 C;  1KFM A;  2IFM A;  2OTJ P;  4W7Y A;  3OAK A;  2LXC B;  1T3J A;  2IZ1 A;  1JY3 O;  2JWD A;  1SQB D;  1N7L A;  2YMK A;  2R5B A;  2YKO A;  1KN7 A;  1P84 I;  4NPE A;  2B9B A;  4C7R A;  3TK1 A;  3IAO A;  4WY4 B;  2C0W A;  3D6Y A;  1GDT A;  1BGY J;  2JR8 A;  2WSC H;  1UII A;  1QVF O;  1RHZ B;  1L0N J;  4JYC A;  1E5W A;  3L74 G;  3SSU A;  3CC2 P;  2AXC A;  1KC8 Q;  1BCC E;  3ABV C;  2Y0D A;  1JO5 A;  2WZ7 A;  1KV4 A;  4O9B A;  2Y0C A;  3GMA A;  3AE6 C;  4OGQ B;  3F89 A;  5CMZ A;  1PIX A;  2K1A A;  2FFD A;  1N7S D;  1FZC A;  2W6J H;  3IR9 A;  2CK3 H;  3CCE P;  1GL2 D;  2JDI H;  3LIE A;  1HBW A;  3AED C;  1SFC D;  3A3Y B;  4Y99 B;  2QEX P;  1N73 B;  3A5T A;  1BDC A;  2K3R A;  3U59 A;  1RQU A;  1URQ C;  2YXQ B;  3M0D C;  1PZQ A;  5AVQ B;  3C1L A;  2O01 H;  1BCC D;  2IBZ G;  3CXH D;  1VQL P;  4ZNC A;  1OW6 A;  1PL5 A;  1HUC A;  1JCC A;  3RL0 B;  3NFQ A;  2WSS H;  5KJ7 D;  1YIT P;  1NVO A;  2BEZ F;  3PTZ A;  1YJN P;  2P10 A;  5APS A;  3EFG A;  1GZL A;  1KFN A;  5B5E H;  2E43 A;  2ZFC A;  3HE4 A;  3KPE A;  2M8R A;  2W6B A;  4M3L A;  2D2C B;  4OH8 B;  2XV5 A;  1GK6 A;  2IYO A;  1FDI A;  2WT7 B;  1D7M A;  3D70 A;  3BAS A;  2KLV A;  3CCS P;  1LTI C;  3RK3 E;  3G6E P;  5KLI B;  1NTK J;  1BE3 G;  2YIU B;  3CPW O;  1NTK E;  3E1I A;  1L0L G;  4I6M C;  3BCC J;  1NOH A;  1BDD A;  5AW6 B;  2GA1 A;  1M1J B;  3H1J E;  2ZXX A;  3L70 E;  2WTY A;  5EFW B;  1KIL C;  1DH3 A;  2OAR A;  2FXO A;  1OW8 A;  2K9Y A;  2WVR A;  1ZV8 A;  1JM0 A;  1SQQ J;  2FBW C;  4RES B;  2WPS A;  1SQQ E;  2H8P D;  3RK3 D;  1IFJ A;  1NAF A;  3CXH H;  1GU4 A;  4H13 B;  3VMX A;  5AVU B;  1NTK D;  5L8R J;  1Q7Y Q;  5CJ0 A;  4EYY Q;  1OW7 A;  3I5C A;  1S9K E;  2QJP B;  1GU5 A;  1M57 D;  2MJZ A;  3H1J D;  3L70 D;  3M9Q A;  1Q82 Q;  2E5T A;  2CPB A;  2M5A B;  1EDI A;  1LGH B;  1YIJ P;  3H1K E;  3H6P A;  3M0A A;  3AE1 C;  1T3U A;  2PGD A;  1T2K D;  3CMA P;  1SQQ D;  1BSH A;  3HE5 A;  1RF1 A;  2K9J B;  3H1H J;  1SQX J;  5AVT B;  2B87 B;  3CXH I;  3AE7 C;  3CWB J;  1IFP A;  2YKQ A;  1JTH A;  1SQX E;  3AE9 C;  1URQ A;  1SQP J;  1KD1 Q;  4W80 A;  2ZVN B;  1S9K D;  2KSE A;  1SFC A;  4KT0 J;  4PD4 D;  3KZI E;  2HFE D;  4WB4 A;  1EZV G;  4H44 B;  1L4A B;  3EWK A;  1NTZ E;  2N1T B;  3GF7 A;  3H1K D;  1YQ4 C;  5APU A;  3HTK B;  4D6T J;  5GTH E;  1FJK A;  1J1E B;  4UB8 E;  3P8M C;  4D6T E;  2DW3 A;  1JY2 O;  4EDF A;  1E79 H;  5KJ7 A;  2WQY C;  3VTP C;  1SQX D;  1NU1 G;  3L36 A;  3CI9 A;  2CPS A;  1HWT C;  4RKU J;  2A06 E;  3MGN A;  2PP6 A;  5CHX A;  3JSV C;  5CCG C;  4Z1M H;  2KLU A;  2XZR A;  2OYI C;  1LWU C;  3VP9 A;  3MUD A;  4JF7 A;  1NTZ D;  1SQV K;  2E76 C;  3WUU A;  1FU1 A;  4IFM A;  3FGA D;  3D6Z A;  1QL2 A;  1SS1 A;  2E74 C;  4WY4 D;  3SFD C;  1AQ5 A;  3MTU E;  5APY A;  1PPJ G;  1P84 E;  1FZG A;  1OVR A;  2QJK B;  1LTA C;  3VMZ A;  1RE3 C;  4D6T D;  3WMM 0;  2RKL A;  4IFD K;  3RK2 B;  1A02 J;  4OGQ D;  4PD4 H;  1KB9 H;  3TNU B;  3B5N B;  1KOR A;  2QJY C;  2A06 D;  5BVZ A;  2MKV A;  3HUS B;  2LR2 A;  2G8Y A;  3TGU G;  1AVO A;  1Z56 A;  1ZR4 A;  2R3S A;  2JJL A;  2SPZ A;  2NPS B;  3Q2Y A;  1MV8 A;  1VF5 C;  5DJU B;  1YTZ T;  2B88 A;  1QEX A;  1EXJ A;  2IZ0 A;  2FKW B;  1SP4 A;  1G1I A;  1H8A A;  3AEA C;  1P84 D;  4HYT B;  1WT6 A;  2JEE A;  2KYV A;  5AW0 B;  4KJM A;  4JYB A;  1J2J B;  1LP1 A;  3V2R A;  1NTM J;  1FC2 C;  3RL0 D;  1IK9 A;  3KZI H;  2FFD C;  1NTM E;  3EQ2 A;  4PD4 I;  5AW4 B;  3HD7 C;  1KB9 I;  2ZXE B;  1MFT A;  3WU2 H;  1GW4 A;  4U3F E;  2LKM A;  2D2C D;  5AVW B;  1L0L K;  1K73 Q;  2JP3 A;  1W5C E;  4A7P A;  1SQB K;  1S3J A;  5AW8 B;  1A02 F;  3KQG A;  1FS0 E;  1PP9 J;  3AEE C;  3CCL P;  1VQ6 P;  2Z4E A;  2P7J A;  3AE8 C;  3L75 E;  2OYH B;  1PP9 E;  3H1I G;  4NPD A;  2YKP A;  4JPZ B;  4K35 A;  2O1J A;  3GHG A;  1NTM D;  2Y0E A;  4RJT A;  1S5L H;  2FYN C;  1BE3 J;  4HJG H;  3CL3 D;  1KTM A;  1P84 H;  2FYU J;  4ZKU A;  2OYI A;  2POH A;  2R32 A;  4ASV A;  3M9B A;  2FYU E;  2PRR A;  1ZN5 A;  1VQ4 P;  2N9B A;  5B5E E;  3TSI A;  2O3J A;  4H13 D;  5CCH A;  1LT9 B;  3L75 D;  3V4W A;  1PP9 D;  4N78 E;  4GDO A;  1CSB A;  3H32 A;  1OXZ A;  3TF5 A;  1VQP P;  1PGQ A;  2KI7 B;  2WSE J;  3GLM A;  3U1C A;  1JY3 P;  3L73 G;  2ZT9 B;  1CI6 A;  3K5B A;  3T97 B;  3L37 A;  3CCU P;  2FXP A;  2FYU D;  4AYC A;  1YBK A;  5KLV J;  3W68 A;  2BCC J;  4TT3 H;  2C9N Y;  2QE7 H;  2BCC E;  4N78 D;  4AQR D;  3LID A;  4EOT A;  2ZJS E;  1BGY E;  4R4M A;  3M91 A;  1L0N E;  4ZMD A;  3CXH E;  1YYC A;  3CCQ P;  1R8E A;  1SQV G;  2IPP A;  3GF3 A;  3OJA B;  1Q2N A;  2HR3 A;  2KP8 A;  4H44 D;  1L4A D;  1N73 A;  2N1T D;  3E1R A;  3F5H A;  1VQN P;  1NU1 K;  2UWJ E;  3HD7 A;  1R5L A;  2AEM A;  1H0T B;  1L2P A;  1MZ9 A;  3CCM P;  1RF1 C;  5APT A;  1M56 D;  1K9M Q;  2RH0 A;  3AE2 C;  3II6 A;  1N7S C;  2BCC D;  4C7N A;  2WSF J;  1BGY D;  1GL2 C;  3S9O A;  3Q5S A;  1L0N D;  1USE A;  2GUS A;  1SFC C;  2OQQ A;  5AW3 B;  2WT7 A;  3RL0 g;  1NYH A;  4U3F G;  5AVZ B;  1FZC B;  2FYZ A;  1KZU B;  4RO0 A;  3H1L J;  4L73 A;  5TJH A;  1QLE D;  5APX A;  3H1L E;  4JQ0 D;  5GTI E;  4L75 A;  1PGP A;  1MUU A;  1DD4 A;  5KJ7 C;  1X22 A;  1DEB A;  3L71 G;  1VQ7 P;  1LTJ B;  3USS A;  1M1J A;  3FXE A;  3RK2 D;  3R4Y A;  1QX8 A;  3BRT B;  2XKM A;  3B5N D;  3CC4 P;  2HYN A;  2WSE H;  1Y47 A;  4LLH A;  2NPS D;  3MUD C;  3L72 J;  1SQB G;  1X79 B;  3BCC E;  2E75 B;  2YXR B;  3PJS K;  3HE4 B;  1T8Z A;  3H1L D;  2G3A A;  1J1D C;  3NTN A;  1CW5 A;  4LC1 A;  4IOI H;  3TGU J;  2ZYG A;  3KYQ A;  1HJ0 A;  3G71 P;  1IJD B;  3M06 A;  3B71 A;  2K37 A;  3O6Q B;  2L91 A;  5DJT B;  4IL6 E;  5CJ4 A;  1RQV A;  3Q5R A;  1OZH A;  1HH0 A;  1QL1 A;  2M5A A;  1JNM A;  2OTK E;  2M0B A;  1U7M A;  1SQX K;  1VPC A;  1TU3 F;  1VQ9 P;  4PD4 E;  3RK3 C;  1LTG C;  1KB9 E;  5KAI H;  3BCC D;  1K04 A;  2RN0 A;  1USD A;  2QIW A;  3L72 D;  1WRG A;  5CBO A;  2HG5 D;  2Q3I A;  3ZDM A;  1YI2 P;  1NTZ K;  2Q9I A;  2KK7 A;  4YPC A;  3PHL A;  1Q90 D;  2WWW A;  3KXD A;  1JOC A;  1QGK B;  3TDK A;  1MFZ A;  3KHU A;  2WSF H;  2E5Y A;  2P1J A;  1BCC G;  1L4A A;  3Q3D A;  1N7S A;  3H1H E;  1XTC C;  2W8Z A;  1UIX A;  1GD2 E;  2IX7 C;  3CWB E;  1GL2 A;  4MN4 C;  1ZME C;  1SQP E;  1T2K C;  1RH5 B;  3BVH A;  4R4L A;  5GTI H;  3AEF C;  4XE5 B;  5KKZ C;  1KB9 D;  4K3A A;  1EC5 A;  2XND H;  3WUV A;  1X9V A;  3NXS A;  4GKG A;  1BSN A;  3QWO C;  5KAF H;  1NWQ A;  3WU2 E;  1OIP A;  4I7Z C;  4BRY A;  1YTZ I;  2XNX A;  1RF1 B;  1JY2 P;  3RGU A;  3A0B E;  2Q3E A;  3PRJ A;  1JTH B;  3RBX A;  1URQ B;  3GHG C;  2AEF A;  3H1H D;  2QM8 A;  4LGD E;  2AXT H;  2R44 A;  1FBM A;  3EFF K;  4L74 A;  3CWB D;  3I56 P;  4CPG A;  1ZR2 A;  2ZT9 D;  1AFO A;  1SQP D;  4GOE A;  2IYP A;  2NZ2 A;  3A2A A;  4C46 A;  4U7J A;  1GTW A;  1NGM B;  1S5L E;  3S1K A;  1FZA A;  1PFI A;  2O1K A;  3V6I A;  4IL6 H;  3B5N A;  5CCH C;  1KYO I;  1OMI A;  2Y9Z A;  1HF9 A;  1HVV A;  3CLQ A;  1NH4 A;  1KQG B;  2HOD A;  3H25 A;  1NTK G;  3AEG C;  2NPS A;  1NKN A;  4YXD C;  1VQM P;  3S4R A;  2KNC B;  1GK4 A;  4EIJ A;  2Q7C A;  3H1J G;  2HPC A;  3L70 G;  1FDO A;  1NTM K;  1MKM A;  3L74 J;  1G1J A;  1S2E A;  4BWN A;  3L74 E;  3A7O A;  4OGQ C;  2KOG A;  1KIL B;  1SQV J;  3UIA A;  3NMD A;  1S72 P;  1SQQ G;  3B8E B;  2YO3 A;  5AW2 B;  2Z5H A;  3OW2 O;  2GUV A;  4Y99 C;  4DT0 A;  4PV1 C;  4N3Y B;  1LNQ A;  1N73 C;  1JY3 N;  3PLN A;  1JUN A;  1YJW P;  3AEC C;  1EQ7 A;  2A45 G;  1VDF A;  3D71 A;  1AJY A;  3U1A A;  4GT1 A;  2I1K A;  1EDL A;  4I2L C;  1K8A Q;  1YJ9 P;  3L74 D;  2ZYD A;  3G9R A;  3H1K G;  3RL0 C;  2GM4 A;  3A0B H;  2IBZ E;  1OFC X;  1VQ5 P;  1RE4 C;  1GMJ A;  1W2E A;  2OYO A;  1S5L X;  1LP1 B;  4L76 A;  1SQX G;  2D2C C;  2HLO A;  4H0L C;  5AW1 B;  5BU5 A;  5AVX B;  2BAS A;  3PH0 A;  4TLF A;  2ZVO B;  5AVV B;  4I1L A;  4WWI A;  3VMY A;  2ZAE B;  2E75 D;  2YIU C;  2QM7 A;  3FXD A;  1PGJ A;  1HJB A;  1LT9 A;  1NTZ G;  1LTT C;  1BE3 E;  5E79 E;  1FDM A;  1H88 A;  2WIT A;  1M1K Q;  1L0L J;  2IFN A;  3CC7 P;  1ZRT E;  2Q6Q A;  3P32 A;  2I1J A;  2Q5U A;  2IBZ D;  3KDP B;  1WMK A;  1M1J C;  1SVF A;  1L0L E;  4D6T G;  1ZLL A;  5AVY B;  2B89 A;  3FWN A;  1Y9B A;  1AA0 A;  2KXP B;  1G2C B;  3PP5 A;  1NKZ B;  3N7N A;  2P58 A;  5AVR B;  2A06 G;  4XA4 A;  5AVS B;  2QVA A;  3JC2 2;  3L35 A;  3VOP A;  1L0N K;  3V2Q A;  4WY4 A;  3SWK A;  4H13 C;  1DD3 A;  2Q1K A;  2JO1 A;  2LXB A;  1ZXG A;  2OYI B;  1BE3 D;  2W6A A;  1LWU B;  1ZRT D;  2E76 B;  2QJP C;  2E74 B;  1L0L D;  3FX0 A;  2WMM A;  4DOJ A;  3MIW A;  2KS1 B;  2YNY A;  5KLV E;  1H0T A;  1R5S A;  3A0H E;  1OVV A;  1Q81 Q;  3H32 B;  1OX3 A;  2WPR A;  3FWL A;  3ITK A;  3HRN A;  1H89 A;  3P7K A;  2QJY B;  1VQO P;  1BCC J;  5K5G B;  2KIK A;  1CI6 B;  1XTG B;  4PJ0 E;  2QSI A;  1FE6 A;  1VF5 B;  5KAI E;  3CX5 H;  4KHX A;  1U57 A;  3CCV P;  3MD0 A;  2PAJ A;  3V2N A;  4H44 C;  1L4A C;  1FZB A;  1URQ D;  2N1T C;  1RE4 A;  5B66 H;  1YHQ P;  5KLV D;  1EZV E;  2Z5I A;  1NTM G;  4GIF A;  3AE4 C;  4DCK A;  3P8C E;  4PV1 B;  1J1E C;  2KB7 P;  1NTK K;  1AQT A;  2FFD B;  5E79 H;  4HH2 A;  1KQF B;  2FY8 A;  1LTJ A;  3HD7 B;  3AE5 C;  1S4X A;  1LTB C;  1KIL E;  1FJP A;  1NU1 J;  3IFM A;  4QMA A;  2IBZ I;  4WBA A;  1CZQ A;  1NU1 E;  3I55 P;  3Q5P A;  2W90 A;  5APW A;  1S1C X;  2BEQ D;  3CX5 I;  3JCU E;  3L75 G;  1PP9 G;  1PV3 A;  5KAF E;  1KYO E;  2C9L Y;  1RF0 A;  4C7N B;  2H89 C;  1W2B O;  1EZV D;  3Q1M A;  4UB6 E;  1NHL A;  1SQQ K;  3V2P A;  1M7L A;  4H0L B;  1LT1 A;  3P8C D;  1HTL C;  2QJK C;  3QH9 A;  4YXW H;  1HGZ A;  1N86 A;  4EI2 A;  1PPJ E;  1JEK A;  3O6Q A;  2AXT E;  3RK2 C;  5H2F E;  1X0T A;  2FYN B;  1KIL D;  3L72 E;  3B5N C;  3HUS C;  2FYU G;  3C8V A;  1AVY A;  1NU1 D;  3H1J J;  1JY2 N;  3L70 J;  3RBZ A;  3A0H H;  2NPS C;  3TGU E;  1KYO D;  1NO4 A;  4DZO A;  2NRG A;  5APV A;  1ZP0 C;  2N9Y B;  1IFN A;  2W83 C;  3OA7 A;  1KMI Z;  1RY3 A;  1PPJ D;  2H43 A;  4PJ0 H;  2RMZ A;  2H7H A;  1IK7 A;  2K9J A;  1KQL A;  1SQP K;  2YMY A;  2B87 A;  5C39 A;  3VP8 A;  2R3C A;  1FZF A;  1U7J A;  3MHV A;  2IDB A;  3W67 A;  3GW6 A;  2WPV B;  3L4F A;  1AV1 A;  1OWA A;  1N2D C;  5KLV G;  2V4H A;  3TGU D;  2BCC G;  1HGV A;  2J59 M;  3MP7 B;  5AW5 B;  1BGY G;  3H1K J;  1L0N G;  1JB0 J;  2M3E A;  1NAY A;  2KZJ A;  2N1T A;  1IFD A;  1IFM A;  4BXL A;  1ZW0 A;  2J5U A;  4ASW A;  3HTK A;  2OYH C;  2VRS A;  3LW5 J;  1K05 A;  2FXM A;  2V7Q J;  4NPF X;  3H1I J;  1DEE G;  1Q86 Q;  1DIP A;  3H1I E;  2L5G B;  3R2P A;  3JCU H;  3M0D A;  5AW7 B;  1KYO H;  1VQK P;  4UB6 H;  3HE5 B;  1NTZ J;  2AEJ A;  1EZV I;  2XDJ A;  3MZW B;  1N7S B;  3GG2 A;  2ITA A;  2P2U A;  2XU6 A;  3CD6 P;  1NJI Q;  5KTB A;  1GL2 B;  5H2F H;  1SFC B;  1LT9 C;  1OVU A;  2QRX A;  5CCG D;  1IC2 A;  1JMB A;  4IL6 X;  2E42 A;  3H1L G;  5M1B A;  3O8Z A;  3M9H A;  2E76 D;  3E7K A;  3H1I D;  1VQ8 P;  2K88 A;  1FOS E;  1ZOY C;  2E74 D;  2KNC A;  4BRY B;  5CCH D;  1EDJ A;  3TNU A;  4W7Z A;  3IF4 A;  3HUS A;  2W27 A;  1SLQ A;  3L73 J;  2ZT9 C;  4IFF A;  3SFE C;  1QVG O;  3L73 E;  2KZI A;  4AUW A;  5TIS E;  1LTS C;  5CBN A;  1FZE A;  4XFJ A;  1KIL A;  1M90 Q;  4WY4 C;  2KUB A;  3BCC G;  3AEB C;  1IZN B; 
#chains in the Genus database with same CATH homology
 1PGP A;  1PGQ A;  1NAY A;  2IYO A;  2ZYA A;  3FWN A;  1PGJ A;  2W90 A;  1AVY A;  1AA0 A;  2ZYG A;  2IZ1 A;  2W8Z A;  2ZYD A;  2IZ0 A;  2PGD A;  2JKV A;  2IYP A;  1PGO A;  1OX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...