1NAYA

Gpp-foldon:x-ray structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
GPPGPPGPPGPPGPPGPPGPPGPPGPPGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Collagen-like peptide
publication title Collagen Stabilization at Atomic Level. Crystal Structure of Designed (GlyProPro)(10)foldon
pubmed doi rcsb
total genus 4
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1nayA00
1PGQA 1OX3A 2W8ZA 2ZYAA 1AVYA 1PGJA 2IYPA 2IYOA 1AA0A 2W90A 1NAYA 2IZ1A 3FWNA 2JKVA 2ZYDA 2IZ0A 2PGDA 1PGPA 2ZYGA 1PGOA
chains in the Genus database with same CATH superfamily
4AYCA 3HE5B 3PTZA 4CPGA 1FC2C 3HE4A 3U1CA 5CCHD 3FGAD 1KYOE 1JY2P 2YO2A 3PP5A 3H1IE 5AW9B 2K9YA 5CCGC 1GZLA 3V2NA 4U3FD 2FFDA 2O1KA 1U57A 1UIXA 3L37A 3CC2P 5KAIH 5KAFE 1SQPJ 3RBZA 1NTKE 3CCQP 2OYIA 2K3RA 1BSHA 1LP1A 1FZCC 3P8CD 1IK7A 2WPSA 1IFPA 3OJAB 1GDTA 4QMAA 4PJ0H 5AVRB 2FYUD 4U3FE 3CWBG 4PJ0E 1E5WA 1J1EB 1S5LX 2M5AB 1NGMB 1BCCD 1G2CA 1N8RQ 1KFMA 2OYHC 1YI2P 1NAFA 1LT9A 1NU1D 3IN6A 1JY3P 2E75B 3H1HJ 1SQBD 1PIXA 3P8CE 4EDFA 3RK2D 2Y0DA 3JSVC 1L0LG 3B8EB 2VRSA 1M57D 3HD7C 1QGKB 3MHVA 3G6EP 2BEQD 1M1JB 3FXDA 1KZUB 4AUWA 1WT6A 2P1JA 1RF1A 3L75D 2KB7P 3CC4P 1NU1E 1JO5A 1N73C 2KUBA 1VQLP 1H8AA 4WY4D 2WSFJ 1KD1Q 3P32A 1PL5A 3AE3C 4N6JA 1AV1A 1KV4A 2XV5A 1DIPA 2E76D 2CK3H 1NHLA 5AW4B 1K9MQ 3G9RA 3L75E 1NKZB 2OQQA 1GW4A 3CMAP 4ZNCA 2ZAEB 3E7KA 3L74E 3BCCG 5APYA 1ZMEC 1P84D 3V4WA 3H1HG 1EDKA 2FFDC 1G1JA 2GUSA 1KN7A 1Q82Q 1X0TA 1JB0J 2B87B 2IBZI 2ZXEB 3E1RA 5TISH 4BRYB 5GTHH 1QVGO 1NTZJ 2A45G 2YNYA 1EZVI 1SP4A 2OYIC 1BGYJ 1JOCA 2ZYGA 2J59M 5TISE 5GTHE 3H32A 2KK7A 3RK3D 3S4RA 1MV8A 5CCHA 3H1LD 3L72D 2HODA 1FU1A 3E1IA 2IBZG 4RESB 5KKZB 5APUA 3CXHE 1EZVG 1VDFA 1LT9C 3H1JD 4HYTB 2NPSB 1K73Q 2JWDA 2KNCB 1NTZK 4KHXA 1DEBA 2XZRA 1SQVD 2PAJA 1ZRTD 3BATA 3L72E 1URQD 4YTPC 1JMBA 1L2PA 3H1KG 2JDIH 2P67A 1RF1C 2W6JH 2ZT9B 5DJTB 3WUUA 5B5EH 3H1JE 5E79H 3CCUP 4ZMDA 2L91A 2WMMA 1S2EA 5B5EE 5E79E 2D2CB 1NTKJ 2K88A 4Y28J 1OX3A 1FDIA 1N7SC 2JR8A 4PV1D 4EIJA 2Y0CA 1KORA 1HGZA 4DZOA 4U3FJ 3V2RA 3CCRP 5BU8B 1Z56A 1LTJC 1M1JA 3GG2A 1KILB 4NPEA 5H2FH 2AXTH 2Q6QA 2IDBA 1VF5D 1L0ND 1NTKK 2IFNA 2G3AA 5H2FE 2AXTE 1ZW0A 1ZV8A 3IF4A 1PP9D 2FXOA 3FXEA 1BE3G 1YQ3C 1LJ2A 1SQPD 3SWFA 1BCCJ 1WRGA 5AW5B 5DJUB 3GF7A 4YXDC 3GF3A 4C46A 2M3BA 1NU1J 1YTZI 2Y9YA 3JC22 1IZNB 5AVQB 5KJ7A 4LLHA 3TGUE 1LWUB 2WITA 3H6PA 3BASA 4EI2A 1L0NE 1T3UA 5CCHC 1KILE 2QJPB 5AVVB 2AEMA 2FYUK 4D6TE 3L75J 3O6QA 2R32A 1S1CX 3R4YA 5AW8B 3T97B 3PLNA 2PRRA 1NU1K 1SQQG 1JY2O 3I55P 5AVYB 4IFDK 1SQBK 1JMMA 3FWNA 1PPJD 3HTKB 3KYQA 2SPZA 3PRJA 3L4FA 2FYUG 3Q5PA 4GOFA 1FDMA 3CMEP 2PFXA 1BSNA 1HH0A 1S5LE 3RL0D 3WUTA 2E42A 3SWYA 4O9BA 1FJPA 1AJYA 4JBZA 3WUVA 4R4LA 1RQVA 3V2PA 2ITAA 1W2BO 1SQBG 1URQA 1VQPP 4OGQB 3U1AA 1EXJA 1PPJE 2KNCA 1ZLLA 1YQ4C 3VP9A 1L4AD 2FYNC 3NXSA 1ZR2A 3RL0g 1JY3O 3L70D 3RBXA 5TJHA 1PGOA 3H25A 4WY4C 2FY8A 2ZXXA 1QX8A 1Q81Q 3L73E 4EOTA 4H0LD 3H1LJ 3L72J 5L8RJ 2E76C 2PP6A 1CSBA 4I7ZB 2XNDH 2ZJSE 2QJYC 2B88A 1EZVE 2P58A 3F89A 1TU3F 3H1JJ 1Y8AA 3L70E 1FS0E 3BRTB 2KSEA 1FAVA 4L76A 2FXMA 1HJBA 1PGPA 1FZFA 4MN4C 2E74B 1KILA 4UB8H 2C0XA 2BCCG 2KLUA 3Q3DA 1S3JA 1M1KQ 2N1TD 3AE5C 4UB8E 2WSCH 1S4XA 3B5NB 3VMZA 4XA4A 2N9BA 4WBAA 1IFDA 1OVUA 3B71A 1KYOD 2P7JA 3H1ID 5AVWB 3CC7P 2Q3EA 1GW3A 2C0WA 2XU6A 4ZKUA 1SQVK 3AE4C 1GMJA 1NTMD 3V4QA 3AE1C 3CI9A 2B9BA 1Q7YQ 2QJKB 3A7OA 2H43A 1HVVA 3KHUA 3L71D 1RF0A 4C7NB 1KYOH 1AVYA 3EQ2A 2WPQA 1Q90D 4IFMA 3TGUJ 1E79H 1CW5A 2I1KA 1L0NJ 1URQC 2KZIA 5KAFH 1T6AA 2CPBA 1PP9J 1SQVG 1NTME 2OGUA 1OWAA 3ABVC 2BEZF 1PZQA 3L71E 1JEKA 1YJWP 4D6TJ 5CBOA 2IZ1A 3AE2C 2OTKE 1AQ5A 2JKVA 2Q7CA 2N9YB 1OIPA 4PV1C 2A06D 1ZOYC 1H89A 1AFOA 3KXDA 2AXCA 1LT1A 3A0HH 3GHGB 2WWWA 2WT7A 1YJ9P 1JTHA 3NTNA 3A0HE 1OVRA 1L4AA 2OTLP 1ZR4A 3TDKA 1VQ8P 2R5BA 4JYCA 2JEEA 2QSIA 2HG5D 1SQPK 3CL3D 1U7JA 1VF5C 2E75D 1X9VA 2QA4P 1G1IA 2A06E 1BDDA 1SQQE 1FZGA 1VQOP 2E43A 1KILC 1NYHA 1LTSC 3AEFC 3CCEP 2Z4EA 3CCMP 1PGJA 3L74D 1SQXE 1PP9G 1CI6A 1SQPG 2QEXP 3EFFK 2O01H 2JP3A 2KLVA 1GU4A 3L73J 5BVZA 1EC5A 2YIUB 2O3JA 2NRGA 5APTA 1KB9I 1K04A 2N1TA 1RF0C 5KLVD 2FXPA 5KJ7D 2A45I 1OMIA 3MZWB 3L70J 2V7QH 3VMAA 4GOEA 3CCLP 1LGHB 4JYBA 4L73A 3B5NA 1ZXGA 2KZJA 3CCJP 2HPCB 1OW7A 3A2AA 5APWA 3EWKA 3CXHD 2NZ2A 1SFCB 1M7LA 5KLVE 2M3EA 4H44B 1JM0A 2WQYC 5AW2B 3CX5I 3RL0C 4LGDE 2YKPA 1PV3A 1DD4A 3P7KA 2WSCJ 4ZKPA 3HUSB 3CXHH 3GMAA 3HE5A 2FKWB 5CJ4A 4RO0A 4DCKA 1NOHA 3AEBC 2W27A 5KLIC 1L4AC 1WMKA 1YJNP 4HH2A 1N2DC 1J1DB 1HWTC 1X22A 4Y99C 2CPSA 3D70A 2P10A 4H0LC 3AEDC 3H1IJ 2R5DA 3A3YB 3S1KA 3PH0A 1YHQP 3LIDA 1VQ5P 1NTMJ 4W80A 1YYCA 3RGUA 2Y9ZA 4Z1MH 2M5AA 3L71J 2M8RA 1OW6A 3GHGA 1NTZG 1FZCB 3IR9A 2R44A 2MJZA 4YXWH 1BGYG 2G8YA 4XFJA 3TNUB 1VQMP 4TT3H 2C9LY 3QH9A 2OYHB 2N1TC 4N78E 1KQSO 5CMZA 2Z5HA 1SVFA 3NMDA 4K35A 4W7ZA 1RE3A 4W7YA 4BWNA 3MD0A 3TGUD 1L0LD 3MUDA 1Y47A 2XKMA 3HD7B 4IL6X 1KILD 3IFMA 5AW6B 3BRVB 1GK6A 3MTUE 3CWBE 3D71A 4WVZA 4D6TD 1LTTC 1N73B 1LTAC 1SQXJ 1L0LE 1VQ7P 4HJGH 2KXPB 1NTKG 4ASWA 2WVRA 1RH5B 3UIAA 3GW6A 3AE9C 3KDPB 1QVFO 2O01J 3TYYA 1RE4A 4U7JA 2GA1A 3K5BA 4U3FG 3BCCD 3CLQA 3L74J 2B87A 4BRYA 1FZAA 3TSIA 1N86A 5KTBA 1IC2A 1T3JA 1PFIA 1SFCA 1KQFB 5APVA 2V7QJ 2RH0A 2FFDB 1FBMA 2W8ZA 1OVVA 1YTZT 1KB9D 1S5LH 1AA0A 1GL2B 1M56D 1J1EC 4DJGA 2Q3IA 3GHGC 3BCCE 5KLVJ 1LP1B 1BCCG 4LC1A 3I56P 1NU1G 2E75C 2NPSA 3AE7C 3H1HE 4H13B 3L73D 2OARA 1KB9H 3C8VA 4RKUJ 2RN0A 4UB6H 2IBZD 1VQ4P 4M3LA 2A45H 1MFTA 1KB9E 1EZVD 1QL2A 1LT9B 4EYYQ 4UB6E 4I1LA 1M1JC 1RE3C 1VPCA 1JCCA 5CCGA 1M90Q 2MKVA 3MUDC 2KS1B 3L75G 2QVAA 4XE5B 1VQNP 2Q9IA 1SS1A 3PJSK 2IPPA 4R4MA 1IO4A 1BDCA 3W68A 3L74G 3BVHA 1LTGC 1H0TB 2IBZE 3H1KD 1FZCA 1VQKP 3II6A 3CX5H 3L36A 2C9NY 1P84I 5APSA 1DD3A 4GIFA 1KFNA 3KPEA 3TNUA 3CX5E 5KJ7C 4KT0J 1EDIA 2W83C 2V4HA 3LW5H 1FJKA 3GLMA 2WPRA 2OYHA 2I1JA 1N7SB 3TK1A 2KIKA 3VOPA 2OYOA 3H1KE 1USDA 2GUVA 4WWIA 3AE8C 3M0AA 3MIWA 3HD7A 3M0DA 4L74A 1LTBC 2POHA 1Y9BA 3VN0A 1LTJB 3R2PA 1NKNA 2JO1A 3AEEC 1BGYE 3B5ND 1S9KE 1N73A 2JJLA 1FOSF 1OW8A 1LWUA 2ZYDA 1BE3D 5AVZB 3H1LG 3L72G 2WTYA 5KKZC 3O8ZA 2RMZA 4A7PA 3H1JG 3M9QA 2NPSC 1L0LJ 3D6YA 5C39A 2HODB 3LIEA 1A02J 5CHXA 3T97A 2KSJA 1DEEG 1MZ9A 2Z5IA 4NPDA 1BE3E 5AW3B 1T2KD 2LXBA 2OTJP 4GODA 5AVUB 2LR2A 3HTKA 2ZT9C 3I5CA 2K1AA 2LKMA 1GL2A 4OWFA 1SQQD 1M8OB 2D2CC 3ITKA 5KAIE 1L0LK 3V2QA 1RY3A 1L0NK 4GT1A 3D6ZA 2WSEH 1SQXD 3VTPC 2QE7H 3RK2B 3BCCJ 4NPFX 4IOIH 4HB1A 1DH3A 2AEJA 2AEFA 3KZIH 2YXQB 1KMIZ 1Q2NA 3TGUG 1KC8Q 2KS1A 4IL6H 1L0NG 1PGQA 3M91A 3M0DC 3KZIE 2K9JB 2FYUE 4IL6E 2DW3A 2FYNB 1NJIQ 1H0TA 3OAKA 5GTIH 3B4SA 1BCCE 3OW2O 5B66H 3JCUH 4WY4B 4D6TG 5GTIE 2JWAA 4WB4A 5B66E 3M06A 3JCUE 1SQBE 5CJ0A 1W5CE 1JY2N 1LWUC 2IYPA 2J5UA 2E76B 2QJYB 2KI7B 1N7SA 3SFEC 2QJPC 3MGNA 1JNMA 2XDJA 2ZFCA 1RQUA 1W2EA 1KQLA 3VP8A 2ZVOB 1LTJA 2M0BA 4C7RA 3LW5J 1OZHA 4I2LC 4DOJA 1FE6A 3H1KJ 2BCCD 3USSA 2QG4A 2UWJE 5AVSB 1VQ9P 1UIIA 3N4XA 3O6QB 4IFFA 1PPJG 2W90A 1JY3N 3AEAC 1GL2C 5AVTB 1SFCD 3RK3B 1NO4A 1AQTA 4JF7A 4H44D 1FZEA 3HRNA 1DX7A 4C7NA 1P84H 2YKOA 3FX0A 2O01N 1MUUA 1P84E 2BCCE 3MP7B 4H13C 1NAYA 3N7NA 3L73G 2FYZA 4OGQC 2YKQA 3QWOC 2WPVB 1VL2A 4JPZB 4KJMA 2B89A 2NPSD 2PGDA 5M1BA 4AQRD 5BU5A 3CPWO 1J2JB 3L70G 3OA7A 3PHLA 1URQB 2HYNA 1HTLC 3RK3E 2L5GB 4OH8B 1BE3J 3S9OA 4N78D 3H1LE 4TLFA 5CCGD 4I7ZC 2ZT9D 2E5YA 2W6BA 2H8PD 1QL1A 4PD4I 4YPCA 1S72P 2QM8A 2D2CD 3Q1MA 4PV1B 2H89C 3P8MC 3CCSP 1NVOA 4RJTA 2IZ0A 3CWBD 2YMYA 1FDOA 1SQVE 3A0BH 5AW7B 1ZRTE 3C9IA 2IYOA 3VYIA 2E74C 1KYOI 3A0BE 1GK4A 2R3CA 3SWKA 3FWLA 1NTMK 2FBWC 1HGVA 3Q2YA 2O1JA 1EDJA 3B5NC 2WSEJ 2K9JA 1VF5B 2P2UA 1SQQJ 4I6MC 2E5TA 1HF9A 5APXA 4WY4A 3HD7D 3G71P 1QEXA 1VQ6P 3H1IG 1R5LA 3L35A 1AVOA 2ZVNB 1OFCX 2H7HA 2FYUJ 1NTMG 4BXLA 2QJKC 3V5BA 5AW0B 1IFNA 3L71G 1JCDA 1LNQA 4OVNF 1K05A 1SQBJ 2Y0EA 2WZ7A 3SSUA 1T2KC 1KTMA 1CZQA 3AEGC 1ZN5A 1GU5A 1SQQK 1HUCA 3A5TA 3KQGA 2HPCA 1FOSE 1JUNA 1RHZB 1PP9E 3V6IA 4K3AA 1IFMA 1SQPE 3HE4B 2QM7A 3H1HD 1SQXK 1GTWA 3Q5RA 1H88A 2KYVA 1R5SA 1YBKA 3HUSA 2A06G 1IFIA 2R3SA 2W6AA 3U59A 2OYIB 1D7MA 4L75A 2KOGA 5AVXB 3AE6C 1GL2D 1Q86Q 1NH4A 1SLQA 3M9HA 3RL0B 3C1LA 3VMYA 2BASA 1T8ZA 1SQXG 1K8AQ 1X79B 3RK2C 1G2CB 2K37A 2WT7B 2LXCB 4H13D 5KLIB 1OXZA 5APQA 3VMXA 1IFJA 1JTHB 2BCCJ 4OGQD 1L4AB 4GKGA 1IK9A 2YMKA 3CX5D 2YXRB 4HKZH 1N7LA 2Q1KA 2IX7C 3CD6P 4Y99B 1YIJP 5KLVK 2WSFH 3AECC 2WSSH 4JQ0D 3Q5SA 4H0LB 2KP8A 1RF1B 1QLED 2RKLA 1EQ7A 3CCVP 4DT0A 1R8EA 4B86A 2H88C 1HJ0A 2YIUC 3TF5A 1CI6B 1USEA 1NTZD 3G4SP 3CXHI 1U7MA 1BGYD 1EDLA 1S9KD 5KLVG 2J58A 2HR3A 1KQGB 2I8DA 5EFWB 1MKMA 1N7SD 1RE4C 1SQVJ 3WMM0 2E74D 2N1TB 1GD2E 2GM4A 5K5GB 2QIWA 2QRXA 1ZP0C 1YITP 4PD4D 4ASVA 1MFZA 1NTZE 3NFQA 1IJDB 5CBNA 1SFCC 3EFGA 3G3ZA 1XTCC 1XTGB 4H44C 1HBWA 1LTIC 2YO3A 1A02F 1FZBA 3M9BA 3WU2H 2IFMA 3CWBJ 3RK3C 3WU2E 3HUSC 4PD4H 3SFDC 4GDOA 3IAOA 3W67A 1X8YA 2ZYAA 3ZDMA 2XNXA 2HFED 3H32B 4PD4E 2Q5UA 2HLOA 1NWQA 4N3YB 3F5HA 1NTKD 1J1DC 5AW1B 1EXIA
chains in the Genus database with same CATH topology
1PGQA 1OX3A 2W8ZA 2ZYAA 1AVYA 1PGJA 2IYPA 2IYOA 1AA0A 2W90A 1NAYA 2IZ1A 3FWNA 2JKVA 2ZYDA 2IZ0A 2PGDA 1PGPA 2ZYGA 1PGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGQ A;  1OX3 A;  2W8Z A;  2ZYA A;  1AVY A;  1PGJ A;  2IYP A;  2IYO A;  1AA0 A;  2W90 A;  1NAY A;  2IZ1 A;  3FWN A;  2JKV A;  2ZYD A;  2IZ0 A;  2PGD A;  1PGP A;  2ZYG A;  1PGO A; 
#chains in the Genus database with same CATH topology
 4AYC A;  3HE5 B;  3PTZ A;  4CPG A;  1FC2 C;  3HE4 A;  3U1C A;  5CCH D;  3FGA D;  1KYO E;  1JY2 P;  2YO2 A;  3PP5 A;  3H1I E;  5AW9 B;  2K9Y A;  5CCG C;  1GZL A;  3V2N A;  4U3F D;  2FFD A;  2O1K A;  1U57 A;  1UIX A;  3L37 A;  3CC2 P;  5KAI H;  5KAF E;  1SQP J;  3RBZ A;  1NTK E;  3CCQ P;  2OYI A;  2K3R A;  1BSH A;  1LP1 A;  1FZC C;  3P8C D;  1IK7 A;  2WPS A;  1IFP A;  3OJA B;  1GDT A;  4QMA A;  4PJ0 H;  5AVR B;  2FYU D;  4U3F E;  3CWB G;  4PJ0 E;  1E5W A;  1J1E B;  1S5L X;  2M5A B;  1NGM B;  1BCC D;  1G2C A;  1N8R Q;  1KFM A;  2OYH C;  1YI2 P;  1NAF A;  1LT9 A;  1NU1 D;  3IN6 A;  1JY3 P;  2E75 B;  3H1H J;  1SQB D;  1PIX A;  3P8C E;  4EDF A;  3RK2 D;  2Y0D A;  3JSV C;  1L0L G;  3B8E B;  2VRS A;  1M57 D;  3HD7 C;  1QGK B;  3MHV A;  3G6E P;  2BEQ D;  1M1J B;  3FXD A;  1KZU B;  4AUW A;  1WT6 A;  2P1J A;  1RF1 A;  3L75 D;  2KB7 P;  3CC4 P;  1NU1 E;  1JO5 A;  1N73 C;  2KUB A;  1VQL P;  1H8A A;  4WY4 D;  2WSF J;  1KD1 Q;  3P32 A;  1PL5 A;  3AE3 C;  4N6J A;  1AV1 A;  1KV4 A;  2XV5 A;  1DIP A;  2E76 D;  2CK3 H;  1NHL A;  5AW4 B;  1K9M Q;  3G9R A;  3L75 E;  1NKZ B;  2OQQ A;  1GW4 A;  3CMA P;  4ZNC A;  2ZAE B;  3E7K A;  3L74 E;  3BCC G;  5APY A;  1ZME C;  1P84 D;  3V4W A;  3H1H G;  1EDK A;  2FFD C;  1G1J A;  2GUS A;  1KN7 A;  1Q82 Q;  1X0T A;  1JB0 J;  2B87 B;  2IBZ I;  2ZXE B;  3E1R A;  5TIS H;  4BRY B;  5GTH H;  1QVG O;  1NTZ J;  2A45 G;  2YNY A;  1EZV I;  1SP4 A;  2OYI C;  1BGY J;  1JOC A;  2ZYG A;  2J59 M;  5TIS E;  5GTH E;  3H32 A;  2KK7 A;  3RK3 D;  3S4R A;  1MV8 A;  5CCH A;  3H1L D;  3L72 D;  2HOD A;  1FU1 A;  3E1I A;  2IBZ G;  4RES B;  5KKZ B;  5APU A;  3CXH E;  1EZV G;  1VDF A;  1LT9 C;  3H1J D;  4HYT B;  2NPS B;  1K73 Q;  2JWD A;  2KNC B;  1NTZ K;  4KHX A;  1DEB A;  2XZR A;  1SQV D;  2PAJ A;  1ZRT D;  3BAT A;  3L72 E;  1URQ D;  4YTP C;  1JMB A;  1L2P A;  3H1K G;  2JDI H;  2P67 A;  1RF1 C;  2W6J H;  2ZT9 B;  5DJT B;  3WUU A;  5B5E H;  3H1J E;  5E79 H;  3CCU P;  4ZMD A;  2L91 A;  2WMM A;  1S2E A;  5B5E E;  5E79 E;  2D2C B;  1NTK J;  2K88 A;  4Y28 J;  1OX3 A;  1FDI A;  1N7S C;  2JR8 A;  4PV1 D;  4EIJ A;  2Y0C A;  1KOR A;  1HGZ A;  4DZO A;  4U3F J;  3V2R A;  3CCR P;  5BU8 B;  1Z56 A;  1LTJ C;  1M1J A;  3GG2 A;  1KIL B;  4NPE A;  5H2F H;  2AXT H;  2Q6Q A;  2IDB A;  1VF5 D;  1L0N D;  1NTK K;  2IFN A;  2G3A A;  5H2F E;  2AXT E;  1ZW0 A;  1ZV8 A;  3IF4 A;  1PP9 D;  2FXO A;  3FXE A;  1BE3 G;  1YQ3 C;  1LJ2 A;  1SQP D;  3SWF A;  1BCC J;  1WRG A;  5AW5 B;  5DJU B;  3GF7 A;  4YXD C;  3GF3 A;  4C46 A;  2M3B A;  1NU1 J;  1YTZ I;  2Y9Y A;  3JC2 2;  1IZN B;  5AVQ B;  5KJ7 A;  4LLH A;  3TGU E;  1LWU B;  2WIT A;  3H6P A;  3BAS A;  4EI2 A;  1L0N E;  1T3U A;  5CCH C;  1KIL E;  2QJP B;  5AVV B;  2AEM A;  2FYU K;  4D6T E;  3L75 J;  3O6Q A;  2R32 A;  1S1C X;  3R4Y A;  5AW8 B;  3T97 B;  3PLN A;  2PRR A;  1NU1 K;  1SQQ G;  1JY2 O;  3I55 P;  5AVY B;  4IFD K;  1SQB K;  1JMM A;  3FWN A;  1PPJ D;  3HTK B;  3KYQ A;  2SPZ A;  3PRJ A;  3L4F A;  2FYU G;  3Q5P A;  4GOF A;  1FDM A;  3CME P;  2PFX A;  1BSN A;  1HH0 A;  1S5L E;  3RL0 D;  3WUT A;  2E42 A;  3SWY A;  4O9B A;  1FJP A;  1AJY A;  4JBZ A;  3WUV A;  4R4L A;  1RQV A;  3V2P A;  2ITA A;  1W2B O;  1SQB G;  1URQ A;  1VQP P;  4OGQ B;  3U1A A;  1EXJ A;  1PPJ E;  2KNC A;  1ZLL A;  1YQ4 C;  3VP9 A;  1L4A D;  2FYN C;  3NXS A;  1ZR2 A;  3RL0 g;  1JY3 O;  3L70 D;  3RBX A;  5TJH A;  1PGO A;  3H25 A;  4WY4 C;  2FY8 A;  2ZXX A;  1QX8 A;  1Q81 Q;  3L73 E;  4EOT A;  4H0L D;  3H1L J;  3L72 J;  5L8R J;  2E76 C;  2PP6 A;  1CSB A;  4I7Z B;  2XND H;  2ZJS E;  2QJY C;  2B88 A;  1EZV E;  2P58 A;  3F89 A;  1TU3 F;  3H1J J;  1Y8A A;  3L70 E;  1FS0 E;  3BRT B;  2KSE A;  1FAV A;  4L76 A;  2FXM A;  1HJB A;  1PGP A;  1FZF A;  4MN4 C;  2E74 B;  1KIL A;  4UB8 H;  2C0X A;  2BCC G;  2KLU A;  3Q3D A;  1S3J A;  1M1K Q;  2N1T D;  3AE5 C;  4UB8 E;  2WSC H;  1S4X A;  3B5N B;  3VMZ A;  4XA4 A;  2N9B A;  4WBA A;  1IFD A;  1OVU A;  3B71 A;  1KYO D;  2P7J A;  3H1I D;  5AVW B;  3CC7 P;  2Q3E A;  1GW3 A;  2C0W A;  2XU6 A;  4ZKU A;  1SQV K;  3AE4 C;  1GMJ A;  1NTM D;  3V4Q A;  3AE1 C;  3CI9 A;  2B9B A;  1Q7Y Q;  2QJK B;  3A7O A;  2H43 A;  1HVV A;  3KHU A;  3L71 D;  1RF0 A;  4C7N B;  1KYO H;  1AVY A;  3EQ2 A;  2WPQ A;  1Q90 D;  4IFM A;  3TGU J;  1E79 H;  1CW5 A;  2I1K A;  1L0N J;  1URQ C;  2KZI A;  5KAF H;  1T6A A;  2CPB A;  1PP9 J;  1SQV G;  1NTM E;  2OGU A;  1OWA A;  3ABV C;  2BEZ F;  1PZQ A;  3L71 E;  1JEK A;  1YJW P;  4D6T J;  5CBO A;  2IZ1 A;  3AE2 C;  2OTK E;  1AQ5 A;  2JKV A;  2Q7C A;  2N9Y B;  1OIP A;  4PV1 C;  2A06 D;  1ZOY C;  1H89 A;  1AFO A;  3KXD A;  2AXC A;  1LT1 A;  3A0H H;  3GHG B;  2WWW A;  2WT7 A;  1YJ9 P;  1JTH A;  3NTN A;  3A0H E;  1OVR A;  1L4A A;  2OTL P;  1ZR4 A;  3TDK A;  1VQ8 P;  2R5B A;  4JYC A;  2JEE A;  2QSI A;  2HG5 D;  1SQP K;  3CL3 D;  1U7J A;  1VF5 C;  2E75 D;  1X9V A;  2QA4 P;  1G1I A;  2A06 E;  1BDD A;  1SQQ E;  1FZG A;  1VQO P;  2E43 A;  1KIL C;  1NYH A;  1LTS C;  3AEF C;  3CCE P;  2Z4E A;  3CCM P;  1PGJ A;  3L74 D;  1SQX E;  1PP9 G;  1CI6 A;  1SQP G;  2QEX P;  3EFF K;  2O01 H;  2JP3 A;  2KLV A;  1GU4 A;  3L73 J;  5BVZ A;  1EC5 A;  2YIU B;  2O3J A;  2NRG A;  5APT A;  1KB9 I;  1K04 A;  2N1T A;  1RF0 C;  5KLV D;  2FXP A;  5KJ7 D;  2A45 I;  1OMI A;  3MZW B;  3L70 J;  2V7Q H;  3VMA A;  4GOE A;  3CCL P;  1LGH B;  4JYB A;  4L73 A;  3B5N A;  1ZXG A;  2KZJ A;  3CCJ P;  2HPC B;  1OW7 A;  3A2A A;  5APW A;  3EWK A;  3CXH D;  2NZ2 A;  1SFC B;  1M7L A;  5KLV E;  2M3E A;  4H44 B;  1JM0 A;  2WQY C;  5AW2 B;  3CX5 I;  3RL0 C;  4LGD E;  2YKP A;  1PV3 A;  1DD4 A;  3P7K A;  2WSC J;  4ZKP A;  3HUS B;  3CXH H;  3GMA A;  3HE5 A;  2FKW B;  5CJ4 A;  4RO0 A;  4DCK A;  1NOH A;  3AEB C;  2W27 A;  5KLI C;  1L4A C;  1WMK A;  1YJN P;  4HH2 A;  1N2D C;  1J1D B;  1HWT C;  1X22 A;  4Y99 C;  2CPS A;  3D70 A;  2P10 A;  4H0L C;  3AED C;  3H1I J;  2R5D A;  3A3Y B;  3S1K A;  3PH0 A;  1YHQ P;  3LID A;  1VQ5 P;  1NTM J;  4W80 A;  1YYC A;  3RGU A;  2Y9Z A;  4Z1M H;  2M5A A;  3L71 J;  2M8R A;  1OW6 A;  3GHG A;  1NTZ G;  1FZC B;  3IR9 A;  2R44 A;  2MJZ A;  4YXW H;  1BGY G;  2G8Y A;  4XFJ A;  3TNU B;  1VQM P;  4TT3 H;  2C9L Y;  3QH9 A;  2OYH B;  2N1T C;  4N78 E;  1KQS O;  5CMZ A;  2Z5H A;  1SVF A;  3NMD A;  4K35 A;  4W7Z A;  1RE3 A;  4W7Y A;  4BWN A;  3MD0 A;  3TGU D;  1L0L D;  3MUD A;  1Y47 A;  2XKM A;  3HD7 B;  4IL6 X;  1KIL D;  3IFM A;  5AW6 B;  3BRV B;  1GK6 A;  3MTU E;  3CWB E;  3D71 A;  4WVZ A;  4D6T D;  1LTT C;  1N73 B;  1LTA C;  1SQX J;  1L0L E;  1VQ7 P;  4HJG H;  2KXP B;  1NTK G;  4ASW A;  2WVR A;  1RH5 B;  3UIA A;  3GW6 A;  3AE9 C;  3KDP B;  1QVF O;  2O01 J;  3TYY A;  1RE4 A;  4U7J A;  2GA1 A;  3K5B A;  4U3F G;  3BCC D;  3CLQ A;  3L74 J;  2B87 A;  4BRY A;  1FZA A;  3TSI A;  1N86 A;  5KTB A;  1IC2 A;  1T3J A;  1PFI A;  1SFC A;  1KQF B;  5APV A;  2V7Q J;  2RH0 A;  2FFD B;  1FBM A;  2W8Z A;  1OVV A;  1YTZ T;  1KB9 D;  1S5L H;  1AA0 A;  1GL2 B;  1M56 D;  1J1E C;  4DJG A;  2Q3I A;  3GHG C;  3BCC E;  5KLV J;  1LP1 B;  1BCC G;  4LC1 A;  3I56 P;  1NU1 G;  2E75 C;  2NPS A;  3AE7 C;  3H1H E;  4H13 B;  3L73 D;  2OAR A;  1KB9 H;  3C8V A;  4RKU J;  2RN0 A;  4UB6 H;  2IBZ D;  1VQ4 P;  4M3L A;  2A45 H;  1MFT A;  1KB9 E;  1EZV D;  1QL2 A;  1LT9 B;  4EYY Q;  4UB6 E;  4I1L A;  1M1J C;  1RE3 C;  1VPC A;  1JCC A;  5CCG A;  1M90 Q;  2MKV A;  3MUD C;  2KS1 B;  3L75 G;  2QVA A;  4XE5 B;  1VQN P;  2Q9I A;  1SS1 A;  3PJS K;  2IPP A;  4R4M A;  1IO4 A;  1BDC A;  3W68 A;  3L74 G;  3BVH A;  1LTG C;  1H0T B;  2IBZ E;  3H1K D;  1FZC A;  1VQK P;  3II6 A;  3CX5 H;  3L36 A;  2C9N Y;  1P84 I;  5APS A;  1DD3 A;  4GIF A;  1KFN A;  3KPE A;  3TNU A;  3CX5 E;  5KJ7 C;  4KT0 J;  1EDI A;  2W83 C;  2V4H A;  3LW5 H;  1FJK A;  3GLM A;  2WPR A;  2OYH A;  2I1J A;  1N7S B;  3TK1 A;  2KIK A;  3VOP A;  2OYO A;  3H1K E;  1USD A;  2GUV A;  4WWI A;  3AE8 C;  3M0A A;  3MIW A;  3HD7 A;  3M0D A;  4L74 A;  1LTB C;  2POH A;  1Y9B A;  3VN0 A;  1LTJ B;  3R2P A;  1NKN A;  2JO1 A;  3AEE C;  1BGY E;  3B5N D;  1S9K E;  1N73 A;  2JJL A;  1FOS F;  1OW8 A;  1LWU A;  2ZYD A;  1BE3 D;  5AVZ B;  3H1L G;  3L72 G;  2WTY A;  5KKZ C;  3O8Z A;  2RMZ A;  4A7P A;  3H1J G;  3M9Q A;  2NPS C;  1L0L J;  3D6Y A;  5C39 A;  2HOD B;  3LIE A;  1A02 J;  5CHX A;  3T97 A;  2KSJ A;  1DEE G;  1MZ9 A;  2Z5I A;  4NPD A;  1BE3 E;  5AW3 B;  1T2K D;  2LXB A;  2OTJ P;  4GOD A;  5AVU B;  2LR2 A;  3HTK A;  2ZT9 C;  3I5C A;  2K1A A;  2LKM A;  1GL2 A;  4OWF A;  1SQQ D;  1M8O B;  2D2C C;  3ITK A;  5KAI E;  1L0L K;  3V2Q A;  1RY3 A;  1L0N K;  4GT1 A;  3D6Z A;  2WSE H;  1SQX D;  3VTP C;  2QE7 H;  3RK2 B;  3BCC J;  4NPF X;  4IOI H;  4HB1 A;  1DH3 A;  2AEJ A;  2AEF A;  3KZI H;  2YXQ B;  1KMI Z;  1Q2N A;  3TGU G;  1KC8 Q;  2KS1 A;  4IL6 H;  1L0N G;  1PGQ A;  3M91 A;  3M0D C;  3KZI E;  2K9J B;  2FYU E;  4IL6 E;  2DW3 A;  2FYN B;  1NJI Q;  1H0T A;  3OAK A;  5GTI H;  3B4S A;  1BCC E;  3OW2 O;  5B66 H;  3JCU H;  4WY4 B;  4D6T G;  5GTI E;  2JWA A;  4WB4 A;  5B66 E;  3M06 A;  3JCU E;  1SQB E;  5CJ0 A;  1W5C E;  1JY2 N;  1LWU C;  2IYP A;  2J5U A;  2E76 B;  2QJY B;  2KI7 B;  1N7S A;  3SFE C;  2QJP C;  3MGN A;  1JNM A;  2XDJ A;  2ZFC A;  1RQU A;  1W2E A;  1KQL A;  3VP8 A;  2ZVO B;  1LTJ A;  2M0B A;  4C7R A;  3LW5 J;  1OZH A;  4I2L C;  4DOJ A;  1FE6 A;  3H1K J;  2BCC D;  3USS A;  2QG4 A;  2UWJ E;  5AVS B;  1VQ9 P;  1UII A;  3N4X A;  3O6Q B;  4IFF A;  1PPJ G;  2W90 A;  1JY3 N;  3AEA C;  1GL2 C;  5AVT B;  1SFC D;  3RK3 B;  1NO4 A;  1AQT A;  4JF7 A;  4H44 D;  1FZE A;  3HRN A;  1DX7 A;  4C7N A;  1P84 H;  2YKO A;  3FX0 A;  2O01 N;  1MUU A;  1P84 E;  2BCC E;  3MP7 B;  4H13 C;  1NAY A;  3N7N A;  3L73 G;  2FYZ A;  4OGQ C;  2YKQ A;  3QWO C;  2WPV B;  1VL2 A;  4JPZ B;  4KJM A;  2B89 A;  2NPS D;  2PGD A;  5M1B A;  4AQR D;  5BU5 A;  3CPW O;  1J2J B;  3L70 G;  3OA7 A;  3PHL A;  1URQ B;  2HYN A;  1HTL C;  3RK3 E;  2L5G B;  4OH8 B;  1BE3 J;  3S9O A;  4N78 D;  3H1L E;  4TLF A;  5CCG D;  4I7Z C;  2ZT9 D;  2E5Y A;  2W6B A;  2H8P D;  1QL1 A;  4PD4 I;  4YPC A;  1S72 P;  2QM8 A;  2D2C D;  3Q1M A;  4PV1 B;  2H89 C;  3P8M C;  3CCS P;  1NVO A;  4RJT A;  2IZ0 A;  3CWB D;  2YMY A;  1FDO A;  1SQV E;  3A0B H;  5AW7 B;  1ZRT E;  3C9I A;  2IYO A;  3VYI A;  2E74 C;  1KYO I;  3A0B E;  1GK4 A;  2R3C A;  3SWK A;  3FWL A;  1NTM K;  2FBW C;  1HGV A;  3Q2Y A;  2O1J A;  1EDJ A;  3B5N C;  2WSE J;  2K9J A;  1VF5 B;  2P2U A;  1SQQ J;  4I6M C;  2E5T A;  1HF9 A;  5APX A;  4WY4 A;  3HD7 D;  3G71 P;  1QEX A;  1VQ6 P;  3H1I G;  1R5L A;  3L35 A;  1AVO A;  2ZVN B;  1OFC X;  2H7H A;  2FYU J;  1NTM G;  4BXL A;  2QJK C;  3V5B A;  5AW0 B;  1IFN A;  3L71 G;  1JCD A;  1LNQ A;  4OVN F;  1K05 A;  1SQB J;  2Y0E A;  2WZ7 A;  3SSU A;  1T2K C;  1KTM A;  1CZQ A;  3AEG C;  1ZN5 A;  1GU5 A;  1SQQ K;  1HUC A;  3A5T A;  3KQG A;  2HPC A;  1FOS E;  1JUN A;  1RHZ B;  1PP9 E;  3V6I A;  4K3A A;  1IFM A;  1SQP E;  3HE4 B;  2QM7 A;  3H1H D;  1SQX K;  1GTW A;  3Q5R A;  1H88 A;  2KYV A;  1R5S A;  1YBK A;  3HUS A;  2A06 G;  1IFI A;  2R3S A;  2W6A A;  3U59 A;  2OYI B;  1D7M A;  4L75 A;  2KOG A;  5AVX B;  3AE6 C;  1GL2 D;  1Q86 Q;  1NH4 A;  1SLQ A;  3M9H A;  3RL0 B;  3C1L A;  3VMY A;  2BAS A;  1T8Z A;  1SQX G;  1K8A Q;  1X79 B;  3RK2 C;  1G2C B;  2K37 A;  2WT7 B;  2LXC B;  4H13 D;  5KLI B;  1OXZ A;  5APQ A;  3VMX A;  1IFJ A;  1JTH B;  2BCC J;  4OGQ D;  1L4A B;  4GKG A;  1IK9 A;  2YMK A;  3CX5 D;  2YXR B;  4HKZ H;  1N7L A;  2Q1K A;  2IX7 C;  3CD6 P;  4Y99 B;  1YIJ P;  5KLV K;  2WSF H;  3AEC C;  2WSS H;  4JQ0 D;  3Q5S A;  4H0L B;  2KP8 A;  1RF1 B;  1QLE D;  2RKL A;  1EQ7 A;  3CCV P;  4DT0 A;  1R8E A;  4B86 A;  2H88 C;  1HJ0 A;  2YIU C;  3TF5 A;  1CI6 B;  1USE A;  1NTZ D;  3G4S P;  3CXH I;  1U7M A;  1BGY D;  1EDL A;  1S9K D;  5KLV G;  2J58 A;  2HR3 A;  1KQG B;  2I8D A;  5EFW B;  1MKM A;  1N7S D;  1RE4 C;  1SQV J;  3WMM 0;  2E74 D;  2N1T B;  1GD2 E;  2GM4 A;  5K5G B;  2QIW A;  2QRX A;  1ZP0 C;  1YIT P;  4PD4 D;  4ASV A;  1MFZ A;  1NTZ E;  3NFQ A;  1IJD B;  5CBN A;  1SFC C;  3EFG A;  3G3Z A;  1XTC C;  1XTG B;  4H44 C;  1HBW A;  1LTI C;  2YO3 A;  1A02 F;  1FZB A;  3M9B A;  3WU2 H;  2IFM A;  3CWB J;  3RK3 C;  3WU2 E;  3HUS C;  4PD4 H;  3SFD C;  4GDO A;  3IAO A;  3W67 A;  1X8Y A;  2ZYA A;  3ZDM A;  2XNX A;  2HFE D;  3H32 B;  4PD4 E;  2Q5U A;  2HLO A;  1NWQ A;  4N3Y B;  3F5H A;  1NTK D;  1J1D C;  5AW1 B;  1EXI A; 
#chains in the Genus database with same CATH homology
 1PGQ A;  1OX3 A;  2W8Z A;  2ZYA A;  1AVY A;  1PGJ A;  2IYP A;  2IYO A;  1AA0 A;  2W90 A;  1NAY A;  2IZ1 A;  3FWN A;  2JKV A;  2ZYD A;  2IZ0 A;  2PGD A;  1PGP A;  2ZYG A;  1PGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...