1NAYA

Gpp-foldon:x-ray structure
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
GPPGPPGPPGPPGPPGPPGPPGPPGPPGSGYIPEAPRDGQAYVRKDGEWVLLSTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Collagen-like peptide
publication title Collagen Stabilization at Atomic Level. Crystal Structure of Designed (GlyProPro)(10)foldon
pubmed doi rcsb
molecule tags Structural protein
total genus 4
structure length 56
sequence length 56
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.320 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces 6-Phosphogluconate Dehydrogenase, domain 3 1nayA00
2IYPA 2W8ZA 1NAYA 1AVYA 1PGPA 2IYOA 3FWNA 1OX3A 2ZYAA 2ZYGA 1PGOA 1PGQA 2IZ1A 1PGJA 1AA0A 2IZ0A 2JKVA 2W90A 2ZYDA 2PGDA
chains in the Genus database with same CATH superfamily
1L0LK 3C9IA 3GF3A 5CJ4A 1JEKA 1OX3A 4GOFA 1M7LA 5B5EH 3LIEA 2B9BA 5KTBA 3H32B 1NJIQ 4O9BA 3D6ZA 1N7SC 4XA4A 2V7QJ 5AW5B 1BSNA 1QL2A 3Q3DA 2C0XA 4IFMA 1SQBD 3P8CD 1JB0J 2YIUB 1SQPJ 3O6QA 2V4HA 1EDJA 2HFED 2O01J 3BATA 2GM4A 4OGQD 3L75G 3L75E 1SS1A 2YKPA 3AEEC 4QMAA 2DW3A 2KLVA 1SFCA 5CBOA 3L73G 1WT6A 3VMYA 1OIPA 2Y9ZA 2FFDA 3TGUE 3CC2P 1JCDA 1PP9G 1PP9E 2NPSC 4JYBA 3D70A 1URQA 2E5YA 3D71A 1KORA 1SQXE 1YQ3C 1USEA 2GA1A 3S9OA 3G71P 3CX5E 4WY4B 1NTMG 3FX0A 3SSUA 1NTME 1T6AA 1JCCA 1UIIA 2R5BA 3FGAD 5K5GB 4K35A 3VMAA 3CCJP 2QM8A 3VN0A 4W7ZA 2YXQB 2N1TD 3B8EB 1NYHA 3B4SA 1SQVJ 3RK2C 4HKZH 3TYYA 5B66H 2LXBA 2IBZD 5KAFE 4KT0J 1X22A 4XE5B 4AUWA 3Q5PA 1SFCC 1VQOP 4D6TJ 2KXPB 2WVRA 1EDKA 2ZT9D 1NTKE 2QEXP 2KSEA 2FFDC 1HGVA 3BASA 1LWUB 3CL3D 3L72D 2I8DA 1IFIA 1URQC 2E75C 5KKZC 1E5WA 5AW1B 4U7JA 2NZ2A 3H1KJ 1R5SA 1N73B 1KQFB 3H1HD 3H1IG 3H1IE 3RGUA 2PFXA 1L0NG 4L76A 1UIXA 4PD4E 1NTZE 3G9RA 3L37A 3N4XA 1AVYA 1L0LJ 1K73Q 1NVOA 1Y8AA 1GDTA 2A45H 2J58A 4EDFA 2XKMA 3KXDA 1RE3A 1H8AA 3C8VA 1LGHB 1Q90D 3B5NA 2BCCG 4XFJA 1HUCA 1NH4A 2QJYB 3HD7D 1IJDB 1X79B 3SWFA 1NU1E 1CW5A 5CCGA 4PV1C 1YIJP 1N2DC 4C7NA 1DD4A 2Z4EA 2XV5A 3CXHE 3RL0C 1Q81Q 1LT9A 5KLVJ 2WWWA 1QVFO 1FZBA 3MIWA 1ZRTE 2OARA 4ZKPA 1H0TA 2L5GB 3Q5RA 1RH5B 3PH0A 3R4YA 2W6BA 2ZYAA 1M1JC 3H1LJ 3PP5A 3NFQA 2PP6A 3MTUE 1DX7A 2E43A 1LJ2A 1SQVG 4KJMA 1LTJA 1N7SB 3MGNA 1J1EC 5M1BA 3H1JG 1SQXK 1U7MA 3U1CA 3M9BA 3AEFC 3A3YB 1A02F 3PHLA 5AW0B 3VOPA 4Y99C 1AV1A 1KQSO 2FYNC 2H88C 4JQ0D 1VF5C 1KN7A 1ZP0C 3B5NC 2FYZA 3GMAA 3V2RA 5TISE 3VMZA 2WT7B 4DZOA 3HUSC 3H1KG 3AE3C 4N78E 2O01N 5CCGC 1PGJA 1OMIA 1R8EA 1VQNP 1KB9I 4RO0A 1LT9C 4H13D 2NPSB 1JTHB 3QH9A 3OA7A 5AVVB 1FZGA 2HG5D 1NTKK 1BCCJ 5KJ7D 3VP9A 3CCVP 1VQKP 2WSFH 1NHLA 1L0LG 3L73D 2RH0A 4DOJA 5GTHE 1NKZB 1VQ9P 1LTJC 1HF9A 2WITA 4RKUJ 1JMBA 3AEGC 1FAVA 1FJKA 2KP8A 5CBNA 4C46A 1GL2D 4OVNF 4I2LC 3O6QB 4L73A 1NTZK 3RK2B 2W27A 2FYUD 2R44A 1FS0E 2AXCA 1BSHA 1KC8Q 1S5LE 1MUUA 2O1JA 3BRTB 3V4WA 5CHXA 2AXTE 1S5LX 2NRGA 1SFCB 3CC4P 1RY3A 2HLOA 3L71G 3U59A 2W6AA 2FFDB 3BCCG 4YTPC 1A02J 2IX7C 3G3ZA 1RF0A 1NU1K 2YNYA 1URQB 1Y9BA 2E75B 5KKZB 3CX5H 2E76D 2QE7H 1PZQA 1OW7A 1PGPA 3EWKA 2WQYC 3S1KA 3CWBE 3M0DA 3RK3E 1IZNB 1VQ7P 1M56D 1JY3P 1BDCA 3L75J 2E74C 1H88A 1OXZA 2HPCA 2WPSA 3VP8A 1M1KQ 2ZVNB 3AE1C 4JBZA 3L73J 4L74A 4I7ZC 3CCMP 2ZJSE 1HBWA 3L35A 5KAFH 2AEFA 3IAOA 5BU8B 4BRYA 1PP9J 2OYOA 1GU4A 1BGYG 1BGYE 2YO2A 4UB8E 1PIXA 4HYTB 2M8RA 2RN0A 5AVXB 2G8YA 4PV1B 3M9HA 1SQQE 2Q1KA 3Q2YA 1NTMJ 2OQQA 4OGQC 2A45I 3RL0B 1RF0C 2A06D 2ZAEB 1FDOA 5AVSB 3WMM0 3EFFK 4H0LD 4DJGA 3FWNA 2B88A 1M1JB 1GD2E 4PD4H 3AE7C 3M0DC 2K9YA 1W2BO 2WPQA 2BEZF 2WSEH 3IFMA 2QG4A 1J1EB 1KD1Q 2YMYA 3R2PA 2E5TA 3GG2A 1KB9D 2KZJA 2JP3A 2LKMA 4N3YB 3NMDA 2GUSA 4Y99B 1YQ4C 2FYNB 4H44D 1VF5B 1PPJD 2P58A 1SQVD 3B5NB 2H8PD 1CSBA 3H1JD 2WTYA 3RL0g 2K3RA 3HUSB 1QL1A 3CXHH 2P10A 2POHA 3N7NA 4C7NB 2QA4P 4D6TD 2H43A 1K8AQ 3H1IJ 3JCUE 1LT9B 1L0NJ 5AVRB 1FZFA 1RF1A 5TJHA 3L4FA 1NKNA 3W67A 2Y9YA 3AEAC 1H0TB 4ASVA 5GTIE 2D2CC 3TK1A 1P84E 1DD3A 5CMZA 1BE3E 3H1KD 2PGDA 1Q82Q 3TGUG 3PTZA 3L70E 1LTJB 1USDA 3RK3C 3CMEP 1NWQA 2BCCJ 4NPFX 2YO3A 1YITP 3GHGA 3V5BA 1L4AD 2C9NY 1KQLA 1KILD 3V2QA 1SQXG 1N86A 3WUVA 4I6MC 1L0LD 1X8YA 3E1IA 1RE4C 3CPWO 5TISH 3HE5A 3ZDMA 1AQ5A 3H6PA 2XDJA 1Z56A 5E79E 3KPEA 1EDIA 2IFMA 3UIAA 1VQ6P 1W2EA 2M0BA 3PLNA 5AW6B 2I1JA 1M57D 2KB7P 2OTJP 1CZQA 5AW4B 5AVTB 2L91A 3H1JJ 3M0AA 1AFOA 1RF1C 5KLVD 1Q86Q 2PAJA 3SFEC 1SQQK 2FBWC 3E7KA 4ZNCA 3U1AA 1KTMA 2FXOA 5GTHH 1NTKG 3L71D 1LTBC 1SLQA 2W83C 3H1LD 2E74B 1U7JA 3BCCD 2Y0EA 5KJ7A 1VQ5P 1AQTA 3GHGC 2N9BA 3II6A 4I7ZB 4AQRD 3TDKA 3CX5I 3O8ZA 1M1JA 4BWNA 2CPBA 1FOSE 1S5LH 2J59M 1MFZA 3LW5H 1ZMEC 2AXTH 3A0HE 2NPSD 1NTZG 4N6JA 1KYOE 5APVA 2WPVB 4DCKA 2K1AA 1SQPE 1Y47A 3KHUA 4TLFA 3KYQA 1LP1A 2OYIA 4OGQB 1EZVG 1EZVE 1PGOA 3L74E 1YTZT 1LTGC 3ABVC 3HTKA 1L2PA 3TNUA 2R32A 1NU1G 3HUSA 3MHVA 1S9KE 4U3FE 1T3UA 1BCCD 2YXRB 4R4LA 4CPGA 4YXWH 2WSCH 1IK9A 4ZMDA 4BXLA 2JR8A 4LLHA 3B71A 1RHZB 1OW6A 2QSIA 5KAIE 2HPCB 5KJ7C 1FZCC 1Q7YQ 3L71J 1S2EA 1JY2N 4EIJA 1HGZA 1HVVA 2M3EA 1JY3O 3BCCJ 1KB9E 4BRYB 4UB8H 4NPEA 2P7JA 1URQD 2E75D 1G1JA 3MZWB 1YYCA 4UB6E 3CWBJ 2OYIC 4IFFA 1KMIZ 4W7YA 1X9VA 2QJKC 2FYUK 3AE9C 1SQBE 3P8CE 5KLIC 1T2KC 3USSA 2D2CB 4ASWA 2R5DA 2ZFCA 3V2PA 1VL2A 2KUBA 1HH0A 5CJ0A 2Q3IA 3CXHI 2Z5HA 4JF7A 5APSA 1G2CA 1T8ZA 3AECC 2C0WA 1U57A 1NAFA 5CCHA 3RK3B 3W68A 1BGYJ 1GK6A 3L75D 2JWAA 3SWKA 2E76C 3BVHA 2I1KA 4TT3H 4JPZB 1JNMA 2QM7A 4GDOA 1OFCX 4M3LA 3I56P 1SQQJ 4HB1A 3D6YA 3RL0D 1H89A 2KSJA 1IC2A 3TGUD 3JC22 1ZV8A 1PP9D 3ITKA 1KZUB 3JCUH 5AW8B 2OTKE 1GMJA 2E42A 5APQA 1XTCC 1N7LA 5AW7B 1J1DC 3AE2C 1DEEG 3CX5D 5GTIH 3WU2E 1NTMD 1P84H 3SWYA 1S72P 1SQPK 1RF1B 1PGQA 5APYA 5APUA 2XZRA 2P1JA 3A7OA 2JWDA 1OZHA 5L8RJ 5EFWB 2IBZG 3F5HA 2IBZE 4LC1A 2WSFJ 1IFPA 5H2FH 1VF5D 2KZIA 5CCHC 3B5ND 1VQLP 5APTA 5APWA 1HTLC 4GT1A 2ZXEB 3GHGB 4H0LC 2H7HA 2BASA 1T3JA 1YBKA 3C1LA 2KK7A 3AEBC 5C39A 3L72E 1EDLA 3CWBG 5E79H 1NTKD 3HE5B 2AEJA 1GW3A 3T97A 2Q3EA 1FOSF 3IR9A 1DEBA 1IO4A 1OVUA 2R3SA 3H1HG 3H1HE 4W80A 1ZR2A 4H44C 1M90Q 4IFDK 3TGUJ 3CCQP 3FXDA 1W5CE 1GW4A 3V6IA 3H1ID 1L0ND 2HODA 4PD4D 3RBZA 1NTZD 1SQXJ 3AEDC 2KNCA 2N1TA 2W6JH 2WSSH 1DH3A 1SQQG 3CD6P 4WY4D 1SQBK 3EFGA 2XU6A 3CC7P 2YKOA 3MP7B 1NGMB 3Q1MA 3PJSK 2P2UA 1YJNP 4IL6X 3EQ2A 1KQGB 3AE6C 1FZCB 4GIFA 2BCCD 3A0HH 1VDFA 1FDIA 5AW3B 2ZYGA 1NU1D 1YHQP 2K88A 2RMZA 3KZIE 1KYOH 2Q6QA 4OH8B 4YPCA 3Q5SA 3CXHD 1CI6A 1L4AC 3FXEA 1PFIA 1KILC 2O01H 3IN6A 1ZRTD 2M3BA 1NTKJ 1LP1B 2OYIB 2CPSA 1ZOYC 2KS1A 1RE4A 1IFNA 2QJKB 3VTPC 1SP4A 3G6EP 2WZ7A 2Y0DA 3HTKB 1TU3F 5KLIB 3TSIA 3TNUB 4WWIA 2K9JB 2N1TC 2UWJE 5KAIH 2MJZA 2P67A 3HE4A 1NTZJ 1RQVA 3HD7A 4HJGH 2E76B 4Y28J 2WSEJ 5KLVK 1KB9H 1LT1A 2KIKA 4K3AA 1JOCA 2ZT9C 1PV3A 3A0BE 1LTIC 1BE3G 2XNXA 1QEXA 4N78D 1NO4A 3L74J 3AE4C 4PJ0E 1HWTC 3L70G 1JMMA 2WMMA 3RBXA 1KV4A 4YXDC 1S1CX 5AVZB 1MV8A 3L73E 5H2FE 3M91A 1IFDA 4UB6H 1NOHA 2YMKA 3LIDA 2ITAA 1NU1J 1AA0A 4DT0A 2FXMA 4U3FJ 1S4XA 3L36A 1FC2C 5AVWB 3WUUA 1J1DB 1XTGB 2O1KA 2M5AA 1EXJA 5AVQB 2FYUG 2FYUE 4RJTA 4EYYQ 1G2CB 2Y0CA 2PRRA 1MKMA 3MUDA 2QVAA 1N7SD 3GW6A 1LTTC 2IPPA 2B87A 1ZLLA 3KDPB 3JSVC 4AYCA 4B86A 3HD7C 1P84I 1JY2O 2QJPC 2ZVOB 4H0LB 1WRGA 1VQ8P 3CLQA 3OAKA 2Q5UA 3FWLA 4JYCA 3V2NA 2OYHA 3KQGA 1AVOA 3VMXA 4MN4C 2Q9IA 4KHXA 1SQBJ 1OVRA 2J5UA 1HJBA 2D2CD 1FZCA 3QWOC 1YJWP 1ZR4A 3H25A 1OVVA 2AEMA 5DJUB 3WU2H 4H44B 2KYVA 1R5LA 1N8RQ 3CWBD 3RK3D 1DIPA 3AE8C 2R3CA 4WB4A 4WVZA 2IYPA 1GL2A 1YTZI 1SQPG 2BEQD 1RQUA 3CCRP 3CCSP 1L0NE 3L74G 2G3AA 3MUDC 1LTSC 5AVYB 1FZAA 1EQ7A 2IZ0A 2CK3H 3AE5C 1BGYD 2ZXXA 2K9JA 4U3FG 3OJAB 3H32A 1FU1A 2A06G 2OYHC 2A06E 3RK2D 5B5EE 1JO5A 3A2AA 4H13C 1SQQD 1K05A 1VQ4P 2BCCE 1YI2P 3T97B 2JEEA 3LW5J 4C7RA 1L4AB 1KILB 1NAYA 4HH2A 1SFCD 3P32A 4GKGA 3HRNA 2LR2A 1FZEA 3TF5A 2C9LY 2B89A 4PD4I 2SPZA 2XNDH 1KYOI 2VRSA 3CCUP 3CCLP 1PL5A 3M06A 1D7MA 2HODB 2FKWB 5AW9B 1GL2C 1SVFA 1PPJG 2KNCB 2N1TB 1PPJE 3L72J 4IL6H 1EZVI 1SQVE 4GODA 3H1JE 3CMAP 4R4MA 2WSCJ 1SQBG 1IK7A 1Q2NA 2IDBA 1MZ9A 1NTMK 4D6TG 4D6TE 4ZKUA 2KOGA 3V4QA 1JY2P 3H1HJ 1MFTA 4WBAA 2ZT9B 3KZIH 4WY4A 2HYNA 1J2JB 3M9QA 1RE3C 3CI9A 4IOIH 2Z5IA 1VQPP 4GOEA 4A7PA 1HJ0A 3S4RA 1CI6B 3H1KE 1ZXGA 2E74D 4RESB 2YIUC 4PV1D 4Z1MH 3F89A 1P84D 2KLUA 2KS1B 1BE3D 1KILE 5B66E 2RKLA 3L70D 1QLED 1GK4A 1BDDA 1L0LE 2GUVA 1OWAA 4EOTA 1ZN5A 1LWUA 2K37A 1EXIA 2FY8A 1SQXD 5APXA 2HR3A 4L75A 1IFJA 4OWFA 1FJPA 2O3JA 1KFMA 3HE4B 3HD7B 2IZ1A 1S3JA 1K04A 2QJPB 3A0BH 4EI2A 1M8OB 2JKVA 3PRJA 1L0NK 4PJ0H 4LGDE 2W8ZA 4WY4C 3CCEP 1N73A 1WMKA 1FBMA 3WUTA 5KLVG 5KLVE 5AW2B 2OTLP 3P7KA 1JY3N 3E1RA 1GZLA 2OGUA 4I1LA 1EC5A 3MD0A 5AVUB 3L71E 1T2KD 1GTWA 1GU5A 3OW2O 3H1LG 1G1IA 3H1LE 3VYIA 5CCGD 3BCCE 3L72G 3GF7A 5BVZA 2JO1A 3I5CA 4NPDA 3K5BA 1VQMP 2MKVA 2A45G 1LNQA 1IFMA 1AJYA 2LXCB 1L4AA 1QX8A 2M5AB 1KILA 3SFDC 1OW8A 2JJLA 3I55P 1BE3J 1LWUC 3A5TA 3L70J 3NTNA 2B87B 2JDIH 1SQVK 2QIWA 2IYOA 2IBZI 1KYOD 1KFNA 2Q7CA 1N73C 1LTAC 2OYHB 1SQPD 1FDMA 3G4SP 1N7SA 2KI7B 4H13B 1FE6A 1ZW0A 4IL6E 5DJTB 2QRXA 5BU5A 1VPCA 1X0TA 2ZYDA 1EZVD 3L74D 3GLMA 2H89C 1BCCG 1BCCE 3BRVB 1JM0A 1QVGO 2FYUJ 3P8MC 1JUNA 3NXSA 2V7QH 1S9KD 4U3FD 3IF4A 2WPRA 5CCHD 2QJYC 2IFNA 2WT7A 2FXPA 1YJ9P 1GL2B 1QGKB 2YKQA 1E79H 1K9MQ 2NPSA 1JTHA 2W90A 2N9YB
chains in the Genus database with same CATH topology
2IYPA 2W8ZA 1NAYA 1AVYA 1PGPA 2IYOA 3FWNA 1OX3A 2ZYAA 2ZYGA 1PGOA 1PGQA 2IZ1A 1PGJA 1AA0A 2IZ0A 2JKVA 2W90A 2ZYDA 2PGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IYP A;  2W8Z A;  1NAY A;  1AVY A;  1PGP A;  2IYO A;  3FWN A;  1OX3 A;  2ZYA A;  2ZYG A;  1PGO A;  1PGQ A;  2IZ1 A;  1PGJ A;  1AA0 A;  2IZ0 A;  2JKV A;  2W90 A;  2ZYD A;  2PGD A; 
#chains in the Genus database with same CATH topology
 1L0L K;  3C9I A;  3GF3 A;  5CJ4 A;  1JEK A;  1OX3 A;  4GOF A;  1M7L A;  5B5E H;  3LIE A;  2B9B A;  5KTB A;  3H32 B;  1NJI Q;  4O9B A;  3D6Z A;  1N7S C;  4XA4 A;  2V7Q J;  5AW5 B;  1BSN A;  1QL2 A;  3Q3D A;  2C0X A;  4IFM A;  1SQB D;  3P8C D;  1JB0 J;  2YIU B;  1SQP J;  3O6Q A;  2V4H A;  1EDJ A;  2HFE D;  2O01 J;  3BAT A;  2GM4 A;  4OGQ D;  3L75 G;  3L75 E;  1SS1 A;  2YKP A;  3AEE C;  4QMA A;  2DW3 A;  2KLV A;  1SFC A;  5CBO A;  3L73 G;  1WT6 A;  3VMY A;  1OIP A;  2Y9Z A;  2FFD A;  3TGU E;  3CC2 P;  1JCD A;  1PP9 G;  1PP9 E;  2NPS C;  4JYB A;  3D70 A;  1URQ A;  2E5Y A;  3D71 A;  1KOR A;  1SQX E;  1YQ3 C;  1USE A;  2GA1 A;  3S9O A;  3G71 P;  3CX5 E;  4WY4 B;  1NTM G;  3FX0 A;  3SSU A;  1NTM E;  1T6A A;  1JCC A;  1UII A;  2R5B A;  3FGA D;  5K5G B;  4K35 A;  3VMA A;  3CCJ P;  2QM8 A;  3VN0 A;  4W7Z A;  2YXQ B;  2N1T D;  3B8E B;  1NYH A;  3B4S A;  1SQV J;  3RK2 C;  4HKZ H;  3TYY A;  5B66 H;  2LXB A;  2IBZ D;  5KAF E;  4KT0 J;  1X22 A;  4XE5 B;  4AUW A;  3Q5P A;  1SFC C;  1VQO P;  4D6T J;  2KXP B;  2WVR A;  1EDK A;  2ZT9 D;  1NTK E;  2QEX P;  2KSE A;  2FFD C;  1HGV A;  3BAS A;  1LWU B;  3CL3 D;  3L72 D;  2I8D A;  1IFI A;  1URQ C;  2E75 C;  5KKZ C;  1E5W A;  5AW1 B;  4U7J A;  2NZ2 A;  3H1K J;  1R5S A;  1N73 B;  1KQF B;  3H1H D;  3H1I G;  3H1I E;  3RGU A;  2PFX A;  1L0N G;  4L76 A;  1UIX A;  4PD4 E;  1NTZ E;  3G9R A;  3L37 A;  3N4X A;  1AVY A;  1L0L J;  1K73 Q;  1NVO A;  1Y8A A;  1GDT A;  2A45 H;  2J58 A;  4EDF A;  2XKM A;  3KXD A;  1RE3 A;  1H8A A;  3C8V A;  1LGH B;  1Q90 D;  3B5N A;  2BCC G;  4XFJ A;  1HUC A;  1NH4 A;  2QJY B;  3HD7 D;  1IJD B;  1X79 B;  3SWF A;  1NU1 E;  1CW5 A;  5CCG A;  4PV1 C;  1YIJ P;  1N2D C;  4C7N A;  1DD4 A;  2Z4E A;  2XV5 A;  3CXH E;  3RL0 C;  1Q81 Q;  1LT9 A;  5KLV J;  2WWW A;  1QVF O;  1FZB A;  3MIW A;  1ZRT E;  2OAR A;  4ZKP A;  1H0T A;  2L5G B;  3Q5R A;  1RH5 B;  3PH0 A;  3R4Y A;  2W6B A;  2ZYA A;  1M1J C;  3H1L J;  3PP5 A;  3NFQ A;  2PP6 A;  3MTU E;  1DX7 A;  2E43 A;  1LJ2 A;  1SQV G;  4KJM A;  1LTJ A;  1N7S B;  3MGN A;  1J1E C;  5M1B A;  3H1J G;  1SQX K;  1U7M A;  3U1C A;  3M9B A;  3AEF C;  3A3Y B;  1A02 F;  3PHL A;  5AW0 B;  3VOP A;  4Y99 C;  1AV1 A;  1KQS O;  2FYN C;  2H88 C;  4JQ0 D;  1VF5 C;  1KN7 A;  1ZP0 C;  3B5N C;  2FYZ A;  3GMA A;  3V2R A;  5TIS E;  3VMZ A;  2WT7 B;  4DZO A;  3HUS C;  3H1K G;  3AE3 C;  4N78 E;  2O01 N;  5CCG C;  1PGJ A;  1OMI A;  1R8E A;  1VQN P;  1KB9 I;  4RO0 A;  1LT9 C;  4H13 D;  2NPS B;  1JTH B;  3QH9 A;  3OA7 A;  5AVV B;  1FZG A;  2HG5 D;  1NTK K;  1BCC J;  5KJ7 D;  3VP9 A;  3CCV P;  1VQK P;  2WSF H;  1NHL A;  1L0L G;  3L73 D;  2RH0 A;  4DOJ A;  5GTH E;  1NKZ B;  1VQ9 P;  1LTJ C;  1HF9 A;  2WIT A;  4RKU J;  1JMB A;  3AEG C;  1FAV A;  1FJK A;  2KP8 A;  5CBN A;  4C46 A;  1GL2 D;  4OVN F;  4I2L C;  3O6Q B;  4L73 A;  1NTZ K;  3RK2 B;  2W27 A;  2FYU D;  2R44 A;  1FS0 E;  2AXC A;  1BSH A;  1KC8 Q;  1S5L E;  1MUU A;  2O1J A;  3BRT B;  3V4W A;  5CHX A;  2AXT E;  1S5L X;  2NRG A;  1SFC B;  3CC4 P;  1RY3 A;  2HLO A;  3L71 G;  3U59 A;  2W6A A;  2FFD B;  3BCC G;  4YTP C;  1A02 J;  2IX7 C;  3G3Z A;  1RF0 A;  1NU1 K;  2YNY A;  1URQ B;  1Y9B A;  2E75 B;  5KKZ B;  3CX5 H;  2E76 D;  2QE7 H;  1PZQ A;  1OW7 A;  1PGP A;  3EWK A;  2WQY C;  3S1K A;  3CWB E;  3M0D A;  3RK3 E;  1IZN B;  1VQ7 P;  1M56 D;  1JY3 P;  1BDC A;  3L75 J;  2E74 C;  1H88 A;  1OXZ A;  2HPC A;  2WPS A;  3VP8 A;  1M1K Q;  2ZVN B;  3AE1 C;  4JBZ A;  3L73 J;  4L74 A;  4I7Z C;  3CCM P;  2ZJS E;  1HBW A;  3L35 A;  5KAF H;  2AEF A;  3IAO A;  5BU8 B;  4BRY A;  1PP9 J;  2OYO A;  1GU4 A;  1BGY G;  1BGY E;  2YO2 A;  4UB8 E;  1PIX A;  4HYT B;  2M8R A;  2RN0 A;  5AVX B;  2G8Y A;  4PV1 B;  3M9H A;  1SQQ E;  2Q1K A;  3Q2Y A;  1NTM J;  2OQQ A;  4OGQ C;  2A45 I;  3RL0 B;  1RF0 C;  2A06 D;  2ZAE B;  1FDO A;  5AVS B;  3WMM 0;  3EFF K;  4H0L D;  4DJG A;  3FWN A;  2B88 A;  1M1J B;  1GD2 E;  4PD4 H;  3AE7 C;  3M0D C;  2K9Y A;  1W2B O;  2WPQ A;  2BEZ F;  2WSE H;  3IFM A;  2QG4 A;  1J1E B;  1KD1 Q;  2YMY A;  3R2P A;  2E5T A;  3GG2 A;  1KB9 D;  2KZJ A;  2JP3 A;  2LKM A;  4N3Y B;  3NMD A;  2GUS A;  4Y99 B;  1YQ4 C;  2FYN B;  4H44 D;  1VF5 B;  1PPJ D;  2P58 A;  1SQV D;  3B5N B;  2H8P D;  1CSB A;  3H1J D;  2WTY A;  3RL0 g;  2K3R A;  3HUS B;  1QL1 A;  3CXH H;  2P10 A;  2POH A;  3N7N A;  4C7N B;  2QA4 P;  4D6T D;  2H43 A;  1K8A Q;  3H1I J;  3JCU E;  1LT9 B;  1L0N J;  5AVR B;  1FZF A;  1RF1 A;  5TJH A;  3L4F A;  1NKN A;  3W67 A;  2Y9Y A;  3AEA C;  1H0T B;  4ASV A;  5GTI E;  2D2C C;  3TK1 A;  1P84 E;  1DD3 A;  5CMZ A;  1BE3 E;  3H1K D;  2PGD A;  1Q82 Q;  3TGU G;  3PTZ A;  3L70 E;  1LTJ B;  1USD A;  3RK3 C;  3CME P;  1NWQ A;  2BCC J;  4NPF X;  2YO3 A;  1YIT P;  3GHG A;  3V5B A;  1L4A D;  2C9N Y;  1KQL A;  1KIL D;  3V2Q A;  1SQX G;  1N86 A;  3WUV A;  4I6M C;  1L0L D;  1X8Y A;  3E1I A;  1RE4 C;  3CPW O;  5TIS H;  3HE5 A;  3ZDM A;  1AQ5 A;  3H6P A;  2XDJ A;  1Z56 A;  5E79 E;  3KPE A;  1EDI A;  2IFM A;  3UIA A;  1VQ6 P;  1W2E A;  2M0B A;  3PLN A;  5AW6 B;  2I1J A;  1M57 D;  2KB7 P;  2OTJ P;  1CZQ A;  5AW4 B;  5AVT B;  2L91 A;  3H1J J;  3M0A A;  1AFO A;  1RF1 C;  5KLV D;  1Q86 Q;  2PAJ A;  3SFE C;  1SQQ K;  2FBW C;  3E7K A;  4ZNC A;  3U1A A;  1KTM A;  2FXO A;  5GTH H;  1NTK G;  3L71 D;  1LTB C;  1SLQ A;  2W83 C;  3H1L D;  2E74 B;  1U7J A;  3BCC D;  2Y0E A;  5KJ7 A;  1VQ5 P;  1AQT A;  3GHG C;  2N9B A;  3II6 A;  4I7Z B;  4AQR D;  3TDK A;  3CX5 I;  3O8Z A;  1M1J A;  4BWN A;  2CPB A;  1FOS E;  1S5L H;  2J59 M;  1MFZ A;  3LW5 H;  1ZME C;  2AXT H;  3A0H E;  2NPS D;  1NTZ G;  4N6J A;  1KYO E;  5APV A;  2WPV B;  4DCK A;  2K1A A;  1SQP E;  1Y47 A;  3KHU A;  4TLF A;  3KYQ A;  1LP1 A;  2OYI A;  4OGQ B;  1EZV G;  1EZV E;  1PGO A;  3L74 E;  1YTZ T;  1LTG C;  3ABV C;  3HTK A;  1L2P A;  3TNU A;  2R32 A;  1NU1 G;  3HUS A;  3MHV A;  1S9K E;  4U3F E;  1T3U A;  1BCC D;  2YXR B;  4R4L A;  4CPG A;  4YXW H;  2WSC H;  1IK9 A;  4ZMD A;  4BXL A;  2JR8 A;  4LLH A;  3B71 A;  1RHZ B;  1OW6 A;  2QSI A;  5KAI E;  2HPC B;  5KJ7 C;  1FZC C;  1Q7Y Q;  3L71 J;  1S2E A;  1JY2 N;  4EIJ A;  1HGZ A;  1HVV A;  2M3E A;  1JY3 O;  3BCC J;  1KB9 E;  4BRY B;  4UB8 H;  4NPE A;  2P7J A;  1URQ D;  2E75 D;  1G1J A;  3MZW B;  1YYC A;  4UB6 E;  3CWB J;  2OYI C;  4IFF A;  1KMI Z;  4W7Y A;  1X9V A;  2QJK C;  2FYU K;  3AE9 C;  1SQB E;  3P8C E;  5KLI C;  1T2K C;  3USS A;  2D2C B;  4ASW A;  2R5D A;  2ZFC A;  3V2P A;  1VL2 A;  2KUB A;  1HH0 A;  5CJ0 A;  2Q3I A;  3CXH I;  2Z5H A;  4JF7 A;  5APS A;  1G2C A;  1T8Z A;  3AEC C;  2C0W A;  1U57 A;  1NAF A;  5CCH A;  3RK3 B;  3W68 A;  1BGY J;  1GK6 A;  3L75 D;  2JWA A;  3SWK A;  2E76 C;  3BVH A;  2I1K A;  4TT3 H;  4JPZ B;  1JNM A;  2QM7 A;  4GDO A;  1OFC X;  4M3L A;  3I56 P;  1SQQ J;  4HB1 A;  3D6Y A;  3RL0 D;  1H89 A;  2KSJ A;  1IC2 A;  3TGU D;  3JC2 2;  1ZV8 A;  1PP9 D;  3ITK A;  1KZU B;  3JCU H;  5AW8 B;  2OTK E;  1GMJ A;  2E42 A;  5APQ A;  1XTC C;  1N7L A;  5AW7 B;  1J1D C;  3AE2 C;  1DEE G;  3CX5 D;  5GTI H;  3WU2 E;  1NTM D;  1P84 H;  3SWY A;  1S72 P;  1SQP K;  1RF1 B;  1PGQ A;  5APY A;  5APU A;  2XZR A;  2P1J A;  3A7O A;  2JWD A;  1OZH A;  5L8R J;  5EFW B;  2IBZ G;  3F5H A;  2IBZ E;  4LC1 A;  2WSF J;  1IFP A;  5H2F H;  1VF5 D;  2KZI A;  5CCH C;  3B5N D;  1VQL P;  5APT A;  5APW A;  1HTL C;  4GT1 A;  2ZXE B;  3GHG B;  4H0L C;  2H7H A;  2BAS A;  1T3J A;  1YBK A;  3C1L A;  2KK7 A;  3AEB C;  5C39 A;  3L72 E;  1EDL A;  3CWB G;  5E79 H;  1NTK D;  3HE5 B;  2AEJ A;  1GW3 A;  3T97 A;  2Q3E A;  1FOS F;  3IR9 A;  1DEB A;  1IO4 A;  1OVU A;  2R3S A;  3H1H G;  3H1H E;  4W80 A;  1ZR2 A;  4H44 C;  1M90 Q;  4IFD K;  3TGU J;  3CCQ P;  3FXD A;  1W5C E;  1GW4 A;  3V6I A;  3H1I D;  1L0N D;  2HOD A;  4PD4 D;  3RBZ A;  1NTZ D;  1SQX J;  3AED C;  2KNC A;  2N1T A;  2W6J H;  2WSS H;  1DH3 A;  1SQQ G;  3CD6 P;  4WY4 D;  1SQB K;  3EFG A;  2XU6 A;  3CC7 P;  2YKO A;  3MP7 B;  1NGM B;  3Q1M A;  3PJS K;  2P2U A;  1YJN P;  4IL6 X;  3EQ2 A;  1KQG B;  3AE6 C;  1FZC B;  4GIF A;  2BCC D;  3A0H H;  1VDF A;  1FDI A;  5AW3 B;  2ZYG A;  1NU1 D;  1YHQ P;  2K88 A;  2RMZ A;  3KZI E;  1KYO H;  2Q6Q A;  4OH8 B;  4YPC A;  3Q5S A;  3CXH D;  1CI6 A;  1L4A C;  3FXE A;  1PFI A;  1KIL C;  2O01 H;  3IN6 A;  1ZRT D;  2M3B A;  1NTK J;  1LP1 B;  2OYI B;  2CPS A;  1ZOY C;  2KS1 A;  1RE4 A;  1IFN A;  2QJK B;  3VTP C;  1SP4 A;  3G6E P;  2WZ7 A;  2Y0D A;  3HTK B;  1TU3 F;  5KLI B;  3TSI A;  3TNU B;  4WWI A;  2K9J B;  2N1T C;  2UWJ E;  5KAI H;  2MJZ A;  2P67 A;  3HE4 A;  1NTZ J;  1RQV A;  3HD7 A;  4HJG H;  2E76 B;  4Y28 J;  2WSE J;  5KLV K;  1KB9 H;  1LT1 A;  2KIK A;  4K3A A;  1JOC A;  2ZT9 C;  1PV3 A;  3A0B E;  1LTI C;  1BE3 G;  2XNX A;  1QEX A;  4N78 D;  1NO4 A;  3L74 J;  3AE4 C;  4PJ0 E;  1HWT C;  3L70 G;  1JMM A;  2WMM A;  3RBX A;  1KV4 A;  4YXD C;  1S1C X;  5AVZ B;  1MV8 A;  3L73 E;  5H2F E;  3M91 A;  1IFD A;  4UB6 H;  1NOH A;  2YMK A;  3LID A;  2ITA A;  1NU1 J;  1AA0 A;  4DT0 A;  2FXM A;  4U3F J;  1S4X A;  3L36 A;  1FC2 C;  5AVW B;  3WUU A;  1J1D B;  1XTG B;  2O1K A;  2M5A A;  1EXJ A;  5AVQ B;  2FYU G;  2FYU E;  4RJT A;  4EYY Q;  1G2C B;  2Y0C A;  2PRR A;  1MKM A;  3MUD A;  2QVA A;  1N7S D;  3GW6 A;  1LTT C;  2IPP A;  2B87 A;  1ZLL A;  3KDP B;  3JSV C;  4AYC A;  4B86 A;  3HD7 C;  1P84 I;  1JY2 O;  2QJP C;  2ZVO B;  4H0L B;  1WRG A;  1VQ8 P;  3CLQ A;  3OAK A;  2Q5U A;  3FWL A;  4JYC A;  3V2N A;  2OYH A;  3KQG A;  1AVO A;  3VMX A;  4MN4 C;  2Q9I A;  4KHX A;  1SQB J;  1OVR A;  2J5U A;  1HJB A;  2D2C D;  1FZC A;  3QWO C;  1YJW P;  1ZR4 A;  3H25 A;  1OVV A;  2AEM A;  5DJU B;  3WU2 H;  4H44 B;  2KYV A;  1R5L A;  1N8R Q;  3CWB D;  3RK3 D;  1DIP A;  3AE8 C;  2R3C A;  4WB4 A;  4WVZ A;  2IYP A;  1GL2 A;  1YTZ I;  1SQP G;  2BEQ D;  1RQU A;  3CCR P;  3CCS P;  1L0N E;  3L74 G;  2G3A A;  3MUD C;  1LTS C;  5AVY B;  1FZA A;  1EQ7 A;  2IZ0 A;  2CK3 H;  3AE5 C;  1BGY D;  2ZXX A;  2K9J A;  4U3F G;  3OJA B;  3H32 A;  1FU1 A;  2A06 G;  2OYH C;  2A06 E;  3RK2 D;  5B5E E;  1JO5 A;  3A2A A;  4H13 C;  1SQQ D;  1K05 A;  1VQ4 P;  2BCC E;  1YI2 P;  3T97 B;  2JEE A;  3LW5 J;  4C7R A;  1L4A B;  1KIL B;  1NAY A;  4HH2 A;  1SFC D;  3P32 A;  4GKG A;  3HRN A;  2LR2 A;  1FZE A;  3TF5 A;  2C9L Y;  2B89 A;  4PD4 I;  2SPZ A;  2XND H;  1KYO I;  2VRS A;  3CCU P;  3CCL P;  1PL5 A;  3M06 A;  1D7M A;  2HOD B;  2FKW B;  5AW9 B;  1GL2 C;  1SVF A;  1PPJ G;  2KNC B;  2N1T B;  1PPJ E;  3L72 J;  4IL6 H;  1EZV I;  1SQV E;  4GOD A;  3H1J E;  3CMA P;  4R4M A;  2WSC J;  1SQB G;  1IK7 A;  1Q2N A;  2IDB A;  1MZ9 A;  1NTM K;  4D6T G;  4D6T E;  4ZKU A;  2KOG A;  3V4Q A;  1JY2 P;  3H1H J;  1MFT A;  4WBA A;  2ZT9 B;  3KZI H;  4WY4 A;  2HYN A;  1J2J B;  3M9Q A;  1RE3 C;  3CI9 A;  4IOI H;  2Z5I A;  1VQP P;  4GOE A;  4A7P A;  1HJ0 A;  3S4R A;  1CI6 B;  3H1K E;  1ZXG A;  2E74 D;  4RES B;  2YIU C;  4PV1 D;  4Z1M H;  3F89 A;  1P84 D;  2KLU A;  2KS1 B;  1BE3 D;  1KIL E;  5B66 E;  2RKL A;  3L70 D;  1QLE D;  1GK4 A;  1BDD A;  1L0L E;  2GUV A;  1OWA A;  4EOT A;  1ZN5 A;  1LWU A;  2K37 A;  1EXI A;  2FY8 A;  1SQX D;  5APX A;  2HR3 A;  4L75 A;  1IFJ A;  4OWF A;  1FJP A;  2O3J A;  1KFM A;  3HE4 B;  3HD7 B;  2IZ1 A;  1S3J A;  1K04 A;  2QJP B;  3A0B H;  4EI2 A;  1M8O B;  2JKV A;  3PRJ A;  1L0N K;  4PJ0 H;  4LGD E;  2W8Z A;  4WY4 C;  3CCE P;  1N73 A;  1WMK A;  1FBM A;  3WUT A;  5KLV G;  5KLV E;  5AW2 B;  2OTL P;  3P7K A;  1JY3 N;  3E1R A;  1GZL A;  2OGU A;  4I1L A;  1EC5 A;  3MD0 A;  5AVU B;  3L71 E;  1T2K D;  1GTW A;  1GU5 A;  3OW2 O;  3H1L G;  1G1I A;  3H1L E;  3VYI A;  5CCG D;  3BCC E;  3L72 G;  3GF7 A;  5BVZ A;  2JO1 A;  3I5C A;  4NPD A;  3K5B A;  1VQM P;  2MKV A;  2A45 G;  1LNQ A;  1IFM A;  1AJY A;  2LXC B;  1L4A A;  1QX8 A;  2M5A B;  1KIL A;  3SFD C;  1OW8 A;  2JJL A;  3I55 P;  1BE3 J;  1LWU C;  3A5T A;  3L70 J;  3NTN A;  2B87 B;  2JDI H;  1SQV K;  2QIW A;  2IYO A;  2IBZ I;  1KYO D;  1KFN A;  2Q7C A;  1N73 C;  1LTA C;  2OYH B;  1SQP D;  1FDM A;  3G4S P;  1N7S A;  2KI7 B;  4H13 B;  1FE6 A;  1ZW0 A;  4IL6 E;  5DJT B;  2QRX A;  5BU5 A;  1VPC A;  1X0T A;  2ZYD A;  1EZV D;  3L74 D;  3GLM A;  2H89 C;  1BCC G;  1BCC E;  3BRV B;  1JM0 A;  1QVG O;  2FYU J;  3P8M C;  1JUN A;  3NXS A;  2V7Q H;  1S9K D;  4U3F D;  3IF4 A;  2WPR A;  5CCH D;  2QJY C;  2IFN A;  2WT7 A;  2FXP A;  1YJ9 P;  1GL2 B;  1QGK B;  2YKQ A;  1E79 H;  1K9M Q;  2NPS A;  1JTH A;  2W90 A;  2N9Y B; 
#chains in the Genus database with same CATH homology
 2IYP A;  2W8Z A;  1NAY A;  1AVY A;  1PGP A;  2IYO A;  3FWN A;  1OX3 A;  2ZYA A;  2ZYG A;  1PGO A;  1PGQ A;  2IZ1 A;  1PGJ A;  1AA0 A;  2IZ0 A;  2JKV A;  2W90 A;  2ZYD A;  2PGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...