3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
b'DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
4N78D 3BATA 2POHA 3P8CD 3C9IA 5BU5A 4I1LA 2JEEA 1NKNA 4GIFA 3N4XA 3VP8A 3N7NA 1IC2A 1WT6A 3VP9A 1X79B 3U1CA 5KTBA 4ZKPA 3OJAB 3HRNA 5BVZA 3U59A 3U1AA 4ZKUA 4N3YB 3BASA 2FXMA 5BU8B 4O9BA
chains in the Genus database with same CATH superfamily
3RL0D 1LT9C 1NAFA 1EC5A 2OYHA 1SVFA 1USEA 1IK7A 3L73J 1LTIC 2QJYB 1GK4A 2JDIH 2XKMA 1GU4A 2AXCA 3MZWB 1SQVE 4U3FJ 4H44D 2OQQA 1GL2D 2Z5HA 4DZOA 4CPGA 1VQOP 4KT0J 2KI7B 1DIPA 2V7QJ 1HVVA 2WWWA 1XTCC 3MIWA 3RK3E 2QSIA 3WUTA 1G2CA 3H1KE 2KLVA 3M9HA 4BWNA 2JKVA 1RF1C 5AVYB 4OWFA 3HD7A 2OTJP 4ASWA 3U1AA 1SQBK 3TF5A 3AECC 3CX5E 2XZRA 3VTPC 2QJKB 1S5LE 1KYOD 1SQPE 5KTBA 3FX0A 1NGMB 2E76B 3AE3C 1VQ6P 2WPQA 2E5TA 5AW7B 2HR3A 1FZCB 2KOGA 3RL0B 2KSEA 2M3EA 1BDCA 1GW4A 1T2KC 2YMYA 1PV3A 5APVA 1SQPD 3I56P 4XA4A 3V6IA 2FYUG 2B87A 1KD1Q 5B66E 1OWAA 3A0BE 3QWOC 1NTZJ 3EWKA 2JEEA 1ZP0C 3L73D 1Z56A 1IFDA 1D7MA 1GL2B 4RJTA 3Q2YA 1AJYA 3A3YB 1L0LE 3PRJA 1N73C 4U3FD 3CCEP 4YXWH 3H1JJ 3P8CD 2POHA 3CMEP 3SWFA 2ZVOB 2FXPA 1NH4A 3BCCG 3MTUE 4HJGH 2R3CA 1UIXA 1KORA 3ITKA 2JP3A 1JMMA 3GLMA 3VMXA 2Q1KA 5CMZA 2OARA 1LTJA 5AW9B 2D2CD 2IBZE 1QEXA 2ZT9C 4GODA 1Q82Q 1L0ND 2OYOA 1SQXK 4I6MC 3AEBC 1BCCD 2I1KA 2XNXA 3GG2A 3IN6A 3L72E 2WPVB 3I5CA 1ZRTE 2VRSA 1S2EA 3H32B 1W2EA 2GM4A 3CLQA 3TGUG 1G2CB 1Q90D 4WY4A 2H88C 1OW8A 1KMIZ 2LXBA 4PJ0E 1KYOH 1FS0E 1A02J 2OYIA 1LT9B 1K9MQ 2QIWA 1M1JC 3CL3D 2W83C 2M8RA 1N7SC 1RE4A 2Y0EA 1ZRTD 2M0BA 1NTZD 4Z1MH 4N78D 5CBNA 2J5UA 2WZ7A 2YO3A 2BCCG 4GIFA 1XTGB 4QMAA 1PP9G 3T97B 2A45H 1M8OB 4LLHA 1KV4A 2FYUJ 3H1JD 5GTHE 1EDLA 3JC22 2YIUB 3GHGC 1L0NK 3HE4A 2B87B 1OW7A 1RF0A 1M1KQ 1U7JA 1ZW0A 2D2CB 1JB0J 3AEGC 4IFFA 1YJ9P 4H0LD 3RL0g 1LNQA 2A06G 5K5GB 4Y28J 4C7NB 3A0HH 1SFCA 1NTMG 3E7KA 1QGKB 3I55P 2E74C 2ZYGA 3JCUE 1M57D 3BCCJ 3M06A 2W6BA 2KNCB 1LTTC 2K37A 2N1TC 1EZVI 2N9BA 3KHUA 1FOSE 4YPCA 5KAIE 3H1ID 1URQA 3L74D 1Q86Q 1QVFO 3D70A 4XE5B 4L75A 2HPCA 1AFOA 1NTZK 3H1KG 1Q2NA 2YXRB 4JYCA 1RY3A 3V5BA 3VMAA 1VF5D 4ZKUA 2GUSA 1RQUA 1KZUB 2IPPA 1YIJP 5KJ7C 3LIDA 1AVOA 1QX8A 4K3AA 1HWTC 2G8YA 1NO4A 4U7JA 4UB6E 3W67A 1JEKA 5CCHA 3TGUJ 2SPZA 3L35A 1HGZA 2IZ0A 1GK6A 3BVHA 1IC2A 2OYIB 2FYUD 1NTKG 2LR2A 2KLUA 3E1RA 1S9KE 3FWLA 4WVZA 3CCVP 4H0LB 3P8MC 1J1DB 1RE3C 1IJDB 3S4RA 1DD3A 1EDIA 2J58A 3H1LG 4PV1C 5AVXB 3BCCE 2BCCJ 3HTKB 1M56D 1MFTA 1PP9J 1JY3O 1Y9BA 3LW5J 3Q5RA 1AVYA 2OGUA 3OJAB 2Y9ZA 2HYNA 5CCGA 1L0LG 4MN4C 3CC7P 5BU5A 1EZVD 1M7LA 1X9VA 4OVNF 3GW6A 5GTHH 1YQ4C 3C8VA 5CBOA 1VF5B 2H89C 2R32A 1PGPA 3CXHE 3A2AA 1NTMJ 5APYA 2RH0A 4HYTB 1KB9D 3BRTB 3CWBD 4GOEA 1FZCA 3H25A 2IBZG 2K1AA 5AVWB 3R4YA 3HE5B 1R5SA 3KYQA 2FYUK 1LWUC 5CCGD 1NWQA 1MFZA 3WUUA 5KAFE 5KLVG 1SLQA 5APUA 3L72G 3TGUD 3NMDA 3H1KJ 2FKWB 2GUVA 2O1JA 3U59A 1ZN5A 2KK7A 1JO5A 4O9BA 2KXPB 2OYHC 1GL2A 2YNYA 3M9QA 1YHQP 1PP9E 3N7NA 4KJMA 1CSBA 4RKUJ 2JWAA 2NPSC 2Q3EA 3CX5I 4RO0A 1GZLA 3L70G 1PIXA 2ZXEB 3H1HD 4M3LA 2BCCD 4UB6H 1JUNA 1GU5A 3CMAP 1PP9D 3AE1C 3SFEC 2R5BA 5GTIE 4YTPC 2WPSA 3MUDA 2Q3IA 2N1TB 1NTKJ 1BSNA 1ZMEC 2A45I 3B5ND 2A06E 1FZBA 2FXMA 3L75G 1NTME 2W27A 2HG5D 3KZIE 3SWYA 3H1LJ 4BRYB 3F5HA 1W5CE 5AW0B 1PGOA 2Q9IA 1JY2O 3L36A 3FWNA 1NTMD 2I1JA 1IO4A 1L0LJ 1SQVD 1NU1E 5APSA 5TISE 3H32A 4TLFA 3N4XA 1H0TB 1X8YA 1LTGC 4K35A 1LT9A 2P1JA 2Z5IA 2WITA 1VQ8P 3KDPB 2WT7B 1E5WA 1VQPP 5KKZB 1KB9H 1QLED 4JF7A 2E75D 3RK3D 2RMZA 2KYVA 3H1KD 5AW4B 3VP9A 1GDTA 1VQKP 1G1JA 2QM8A 4LC1A 2QG4A 3CCQP 1VQMP 3CX5D 1GMJA 1SQXE 2IBZI 3T97A 2IDBA 4H13C 2FFDB 5KLVJ 3L72J 1NTKE 3M0DC 1AA0A 2NRGA 3EQ2A 5DJTB 3A7OA 2DW3A 1VQ4P 3B5NB 1RF1A 3H1LE 5L8RJ 1FZEA 2AXTE 1EXJA 2JWDA 1FDOA 5E79H 1NTKD 2M5AB 3LIEA 1JNMA 3AE7C 1SQVK 1VQNP 4C7NA 2IYPA 5BVZA 4IL6X 3L70J 3H1LD 1LTJC 1BE3G 3LW5H 1HGVA 4ZMDA 3CCUP 2KNCA 1NAYA 2XNDH 1IFPA 3B8EB 1L0LD 2Y9YA 5CHXA 1T3JA 3AE2C 1VQ9P 3TNUB 3AE6C 3H6PA 3L75J 2QJPC 2M3BA 2KUBA 2P58A 1N8RQ 2L91A 2CK3H 2E75B 2PP6A 3RK3B 5AW6B 5DJUB 1AQTA 3PTZA 4WY4C 4AQRD 1W2BO 1P84E 1LGHB 1Y47A 1BGYE 1OVRA 4OH8B 2IFNA 2FYNC 1RE4C 1KQLA 2K3RA 3V2NA 1SQPK 3M91A 2BEZF 1HBWA 5KLVE 1SQQE 1WRGA 2BASA 2NPSB 5CJ4A 1DD4A 1KQSO 2IBZD 4AUWA 1T2KD 5KLVD 2N9YB 3L72D 3PH0A 1NKNA 3RK2C 4YXDC 3FGAD 1FC2C 3L70E 3CX5H 3HTKA 1S5LH 5H2FE 4NPDA 2MJZA 1X22A 3WU2E 5CJ0A 4W7ZA 4IL6E 1SQBG 4OGQC 2W90A 2KIKA 2C0WA 1SFCC 3L75E 1ZOYC 1KILC 3L4FA 2R44A 3IFMA 5KLIC 1OIPA 2W8ZA 1FZFA 3G71P 1A02F 1RF1B 1QL1A 1TU3F 5APWA 4JPZB 5B66H 1OFCX 3L75D 5APQA 2WTYA 3A0BH 1BE3J 4KHXA 4IFMA 2XDJA 2ZT9D 1OW6A 2V7QH 3HE5A 3IAOA 2OTKE 2O3JA 1OVVA 3BASA 2RKLA 2WSFJ 4GDOA 3GF7A 4IFDK 5CCHC 1NU1G 3L71E 1WT6A 3GHGA 2V4HA 4DCKA 1OVUA 3U1CA 3IR9A 4R4MA 1KQGB 1ZR4A 1JCCA 2ZAEB 2QJYC 3E1IA 1N7SD 3RK2D 3HUSC 4RESB 5AVRB 1KB9I 1S72P 1P84H 3CCLP 2K9YA 2H7HA 1N73B 1PPJE 1KILE 3CXHI 1FU1A 1LTSC 1LTAC 1HJBA 1LJ2A 2N1TA 1T6AA 1SQXG 1IK9A 3PHLA 4PJ0H 1JY3P 2IX7C 1S3JA 4PD4E 4BRYA 1BE3E 5M1BA 3V4QA 2ZJSE 1HF9A 1OX3A 1J2JB 5AVUB 5KJ7A 2ZT9B 2R5DA 3S1KA 1KFNA 2P7JA 4GOFA 5AVVB 5H2FH 1MUUA 1S9KD 4D6TE 2IYOA 1L4AC 1USDA 1LT1A 2E76C 3MGNA 4IL6H 1FAVA 2E74D 1H0TA 5APXA 1E79H 3B4SA 1FZCC 3BCCD 1MKMA 2O01J 3II6A 1RHZB 2WT7A 2N1TD 1VDFA 1ZV8A 1IZNB 2JJLA 3QH9A 3GF3A 1FBMA 1FJPA 1M1JB 1N7SB 3RK2B 1RQVA 2GA1A 4NPEA 2WSCJ 1N86A 1RE3A 1FE6A 4H44C 1DEEG 4W7YA 3RBXA 1YJWP 5KJ7D 5AVQB 1L0NG 2H43A 1FDMA 2W6AA 2FFDA 1BGYG 1VQ5P 2C9NY 4EOTA 3JCUH 3CXHD 1BCCG 4A7PA 4JQ0D 3G9RA 2W6JH 1H89A 1NU1J 3M0AA 1SQQG 3B5NA 1AQ5A 3CI9A 4GT1A 3NXSA 1VQLP 5KAIH 5TJHA 1OZHA 5AW8B 1WMKA 3GHGB 1FDIA 2J59M 3Q1MA 1JTHB 1K05A 2IFMA 3CCMP 1FJKA 2M5AA 1SQBE 1MZ9A 4Y99C 2ZYDA 3Q5PA 3VOPA 1JOCA 3AEDC 4PV1D 5BU8B 4LGDE 2E74B 5B5EE 2YXQB 3B71A 1SQXJ 4JBZA 1L4AD 1SS1A 1GD2E 3TNUA 1M90Q 3F89A 1JM0A 2JR8A 1JY2P 3O8ZA 2C0XA 2Q5UA 2KS1B 2WQYC 2MKVA 4WB4A 3D6ZA 1N2DC 2LXCB 2YKOA 4TT3H 3HD7C 3CC4P 4PD4H 3P7KA 4ZKPA 3BRVB 1YYCA 3HUSB 2A06D 1JY3N 2NPSA 2WSEJ 3TK1A 1KTMA 1K73Q 2E43A 2AEMA 3VN0A 2B88A 3RGUA 1K04A 2WSFH 1FZGA 3FXDA 1HH0A 1IFIA 3VMYA 3RBZA 4WWIA 3W68A 3G3ZA 1CI6A 2QRXA 3KXDA 1NU1D 3M9BA 1NHLA 2YIUC 3H1IG 1KYOE 1YITP 3L74G 1PGQA 2WSSH 3OW2O 3L71G 3EFGA 2H8PD 2D2CC 3CXHH 3CCRP 1EDKA 1L0NJ 2B9BA 4PV1B 3CD6P 1BGYJ 4N6JA 1ZR2A 4EIJA 3MD0A 1BCCJ 2FY8A 1P84I 3VP8A 2NPSD 4ASVA 1LP1B 1SQQJ 3AE4C 1AV1A 1L4AB 4NPFX 3AE9C 1PPJG 5KAFH 1JCDA 1SQXD 2XV5A 5AVSB 3TYYA 1Q81Q 3CCSP 2HFED 3L73E 1NTMK 1BSHA 2C9LY 3TSIA 5AVZB 4N3YB 1CZQA 4WBAA 4IOIH 4U3FE 2K9JB 3HD7D 3PLNA 3P8CE 2YKQA 4H44B 2Z4EA 1KN7A 1T8ZA 1J1EC 3A0HE 1L2PA 3O6QB 1NU1K 2WPRA 3Q5SA 3OA7A 1ZLLA 4I7ZC 5B5EH 1NYHA 2O01H 2OTLP 1YTZI 4D6TG 3M0DA 1LWUB 2YO2A 3CPWO 3CCJP 5GTIH 1MV8A 4C7RA 2WMMA 4C46A 2ZFCA 3FXEA 1EZVG 2HODB 2FBWC 1L0NE 2PGDA 2OYIC 2JO1A 2P67A 2FXOA 3KZIH 2WSCH 3R2PA 3PJSK 2OYHB 1JY2N 2QE7H 1BCCE 4H0LC 2IZ1A 4Y99B 3C9IA 1KC8Q 1J1DC 1GTWA 1N73A 1HJ0A 3AEAC 1YJNP 1X79B 2I8DA 2ZVNB 1UIIA 1P84D 1QL2A 3CWBG 1BGYD 5TISH 3KQGA 1NTKK 4H13D 1RH5B 3G4SP 1SQQD 3H1IJ 1CI6B 2WVRA 1JMBA 3L74J 3L71J 1PZQA 1IFJA 3V2PA 2ZYAA 1NTZE 1FZAA 1RF0C 1VF5C 3HD7B 4N78E 1QVGO 3MHVA 5APTA 4UB8E 1L0LK 1EQ7A 4EYYQ 1H8AA 1H88A 1YBKA 5AW5B 4R4LA 4JYBA 2CPBA 3L70D 2Q6QA 3H1JE 3V4WA 4W80A 3USSA 1YQ3C 3H1HG 2UWJE 3OAKA 1R8EA 1BDDA 2KZIA 3AEEC 2P10A 2E5YA 1M1JA 1FOSF 1N7SA 2AXTH 1EDJA 3SFDC 1URQC 1KQFB 1NJIQ 4WY4D 1X0TA 1U57A 1CW5A 3ZDMA 4PD4I 2QA4P 2WSEH 2YMKA 2QM7A 1U7MA 1PL5A 2YKPA 5KLVK 3TDKA 1SQQK 2O01N 1T3UA 4D6TJ 5AW1B 3WMM0 4H13B 3H1IE 3G6EP 3WUVA 1SQVG 3L74E 1KILA 4HB1A 4L73A 3P32A 3AE8C 1OXZA 1PGJA 1JTHA 2ITAA 4EI2A 1ZXGA 1EXIA 4L74A 4B86A 5AW3B 3C1LA 3AE5C 2P2UA 2KSJA 5C39A 1SP4A 3V2RA 1S4XA 3L71D 4DJGA 3VYIA 4HH2A 3D6YA 2CPSA 2KP8A 1IFMA 3CWBJ 1LTJB 1R5LA 1Q7YQ 3JSVC 2Y0DA 1J1EB 3KPEA 4I1LA 4OGQD 3SWKA 1SFCD 4I7ZB 2PFXA 5CCGC 2FYUE 1YTZT 2KS1A 4AYCA 1SQPG 1PPJD 1KILD 3EFFK 2QJPB 2ZXXA 3A5TA 2B89A 2NZ2A 3SSUA 4WY4B 2A45G 1YI2P 5KKZC 4HKZH 2O1KA 3HUSA 1OMIA 1SQBJ 1URQD 1Y8AA 2PRRA 2QJKC 3L73G 3VMZA 4PD4D 2FYNB 1BE3D 3WU2H 4UB8H 4U3FG 3BATA 3CC2P 4I2LC 1VPCA 3H1HJ 1EZVE 4XFJA 3RL0C 2FFDC 2AEJA 1PFIA 3UIAA 1VL2A 4D6TD 1DX7A 2QEXP 2AEFA 2Y0CA 1G1IA 1DH3A 2KZJA 2L5GB 5EFWB 2KB7P 3B5NC 5CCHD 2BEQD 3PP5A 1HTLC 1KB9E 2XU6A 4L76A 1GW3A 3CWBE 3HE4B 4GKGA 1GL2C 4ZNCA 1NKZB 2LKMA 1S1CX 1LP1A 1L4AA 1SQVJ 4OGQB 1K8AQ 1SFCB 3TGUE 2RN0A 3NTNA 4EDFA 1NOHA 1KILB 1VQ7P 1NVOA 5KLIB 1IFNA 3L37A 2R3SA 1KFMA 3AEFC 1LTBC 3MP7B 2E42A 3NFQA 3MUDC 3D71A 4DOJA 2E75C 3IF4A 3RK3C 1URQB 2K9JA 5E79E 3HRNA 5AVTB 2HPCB 1S5LX 3GMAA 3K5BA 3ABVC 1KYOI 3H1HE 2BCCE 3V2QA 2PAJA 1NTZG 2FYZA 4DT0A 2QVAA 3O6QA 1SQBD 3S9OA 2G3AA 3Q3DA 2K88A 1LWUA 1N7LA 1SQPJ 2E76D 2Q7CA 1DEBA 1HUCA 5AW2B 4BXLA 3H1JG 2HODA 2HLOA
chains in the Genus database with same CATH topology
1RE3C 2J58A 3P8CE 3RL0D 5AVXB 2YKQA 1FZFA 2Z4EA 1LT9C 3HTKB 1A02F 1RF1B 1QL1A 1J1EC 1T8ZA 1NAFA 2OYHA 1SVFA 1JY3O 5APWA 1NU1K 2WPRA 3OJAB 1LTIC 2HYNA 3OA7A 1ZLLA 1GK4A 5APQA 2WTYA 2XKMA 2O01H 1YTZI 1GU4A 5CCGA 3M0DA 1LWUB 2YO2A 1MV8A 4C7RA 4KHXA 4IFMA 5BU5A 2XDJA 4C46A 1M7LA 2ZFCA 2HODB 1X9VA 1GL2D 2Z5HA 4DZOA 3HE5A 2OYIC 2P67A 2WSCH 3R2PA 3BASA 2OYHB 1JY2N 2R32A 3A2AA 4Y99B 1HVVA 2WWWA 1XTCC 3C9IA 3MIWA 5APYA 1J1DC 1GTWA 1N73A 4IFDK 5CCHC 1G2CA 2KLVA 3M9HA 1WT6A 4HYTB 3GHGA 3BRTB 1IJDB 1X79B 1RF1C 3U1CA 5AVYB 3IR9A 1FZCA 3HD7A 1QL2A 3U1AA 1SQBK 5AVWB 1ZR4A 1JCCA 3E1IA 3HE5B 3KQGA 3KYQA 1N7SD 1NTKK 3HUSC 3RK2D 2FYUK 4RESB 1LWUC 5AVRB 5CCGD 2XZRA 1NWQA 3VTPC 1MFZA 1CI6B 1SLQA 5APUA 3NMDA 2H7HA 5KTBA 2FKWB 1IFJA 3V2PA 1N73B 2GUVA 2O1JA 3U59A 1ZN5A 1FU1A 1LTSC 1JO5A 2WPQA 1LTAC 1FZAA 1RF0C 5AW7B 1HJBA 1FZCB 2KOGA 4O9BA 3HD7B 4N78E 2OYHC 1GL2A 3RL0B 2N1TA 2YNYA 3M9QA 3P8MC 5APTA 1L0LK 1GW4A 1EQ7A 3N7NA 1IK9A 1T2KC 1H8AA 1H88A 1CSBA 2YMYA 5APVA 5AW5B 4JYBA 4XA4A 2CPBA 2NPSC 1JY3P 2IX7C 1GZLA 3V4WA 4W80A 2ZXEB 3V4QA 4M3LA 1OWAA 1JUNA 1GU5A 1J2JB 2JEEA 3OAKA 5AVUB 5KJ7A 2R5DA 1Z56A 2R5BA 1KFNA 2P7JA 1IFDA 5AVVB 1GL2B 2WPSA 3MUDA 2Q3IA 1M1JA 2N1TB 3A3YB 1MUUA 1FOSF 1S9KD 1N7SA 1L4AC 2A45I 3B5ND 1URQC 1N73C 1FZBA 2FXMA 3MGNA 2W27A 1FAVA 5APXA 2HG5D 3SWYA 3P8CD 2POHA 4WY4D 3SWFA 1FZCC 5AW0B 1CW5A 1NH4A 3MTUE 2WSEH 2Q9IA 2R3CA 2QM7A 3II6A 2WT7A 1JY2O 2N1TD 2YKPA 1VDFA 1ZV8A 5KLVK 1SQQK 3L36A 1T3UA 2JJLA 1FBMA 2I1JA 1IO4A 1FJPA 1M1JB 5AW1B 1JMMA 1N7SB 3WMM0 3RK2B 3VMXA 5APSA 5CMZA 3H32A 2OARA 1KILA 1N86A 3N4XA 1LTJA 5AW9B 1RE3A 1X8YA 3P32A 1OXZA 4W7YA 1JTHA 1LTGC 1LT9A 2P1JA 5KJ7D 1SQXK 5AVQB 4B86A 2Z5IA 5AW3B 2WITA 4I6MC 2H43A 1FDMA 2W6AA 2FFDA 3KDPB 2WT7B 2C9NY 1E5WA 2I1KA 2XNXA 2HLOA 4EOTA 2P2UA 2KSJA 4JF7A 1SP4A 3V2RA 3RK3D 1H89A 2KYVA 3I5CA 3M0AA 3B5NA 5AW4B 3VP9A 1GDTA 2VRSA 1AQ5A 1G1JA 3VYIA 3H32B 1W2EA 4HH2A 3CI9A 2CPSA 3CLQA 2QM8A 4GT1A 2KP8A 4LC1A 3NXSA 2GM4A 1G2CB 1IFMA 1LTJB 4WY4A 5AW8B 3GHGB 2J59M 1A02J 1JTHB 2OYIA 2IFMA 1LT9B 1FJKA 1J1EB 1M1JC 3CL3D 3KPEA 4I1LA 2M8RA 3T97A 1N7SC 2FFDB 1MZ9A 4Y99C 1SFCD 1RE4A 5CCGC 3M0DC 1YTZT 4AYCA 3EQ2A 3VOPA 1KILD 3A7OA 3B5NB 1JOCA 5BU8B 1RF1A 1FZEA 3A5TA 4LGDE 4N78D 2WZ7A 2YO3A 4WY4B 2A45G 4GIFA 1XTGB 2O1KA 3HUSA 1L4AD 3LIEA 1URQD 1JNMA 3TNUA 1GD2E 3VMZA 1SQVK 4C7NA 1JY2P 2A45H 5BVZA 3O8ZA 2C0XA 4LLHA 2Q5UA 1LTJC 3LW5H 1HGVA 3GHGC 3BATA 4WB4A 1L0NK 1N2DC 4I2LC 1VPCA 3HE4A 2YKOA 3HD7C 1RF0A 3RL0C 2FFDC 3P7KA 4ZKPA 3B8EB 3UIAA 1PFIA 1DX7A 3BRVB 1YYCA 5CHXA 4IFFA 3HUSB 1T3JA 1G1IA 1DH3A 1JY3N 2L5GB 3TNUB 3H6PA 2KB7P 2NPSA 4C7NB 3B5NC 5CCHD 2M3BA 1SFCA 3PP5A 3TK1A 2E43A 2PP6A 3VN0A 3RK3B 5AW6B 2WSFH 1HTLC 4WY4C 4AQRD 2XU6A 1GW3A 3M06A 1FZGA 3HE4B 1HH0A 1IFIA 2W6BA 4GKGA 1LGHB 3VMYA 1GL2C 1LTTC 2N1TC 2IFNA 4OH8B 1NKZB 1CI6A 2LKMA 3G3ZA 1RE4C 2N9BA 1KQLA 3V2NA 1SQPK 3M91A 1FOSE 1L4AA 3M9BA 1NHLA 1URQA 1HBWA 1WRGA 2BASA 2NPSB 4XE5B 5CJ4A 2HPCA 1AFOA 1SFCB 1NTZK 3NTNA 4JYCA 3EFGA 1RY3A 2H8PD 3V5BA 1NOHA 1KILB 4ZKUA 2GUSA 2IPPA 1KZUB 1IFNA 3L37A 5KJ7C 3LIDA 4N6JA 1ZR2A 4EIJA 1KFMA 4AUWA 1LTBC 3MD0A 2E42A 3NFQA 1T2KD 1HWTC 1NKNA 3RK2C 4DOJA 3VP8A 2NPSD 1NO4A 3RK3C 1L4AB 1URQB 3HRNA 5CCHA 5AVTB 2HPCB 3HTKA 3L35A 1JCDA 3V2QA 2PAJA 2FYZA 2MJZA 2XV5A 5AVSB 3TYYA 1HGZA 5CJ0A 4W7ZA 2HFED 1GK6A 3BVHA 1IC2A 2OYIB 1NTMK 1LWUA 1N7LA 2C0WA 1SFCC 1S9KE 2Q7CA 2C9LY 3TSIA 5AVZB 4N3YB 1CZQA 4WBAA 1DEBA 1HUCA 5AW2B 1KILC 3HD7D 3L4FA 2HODA 3IFMA 1J1DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N78 D;  3BAT A;  2POH A;  3P8C D;  3C9I A;  5BU5 A;  4I1L A;  2JEE A;  1NKN A;  4GIF A;  3N4X A;  3VP8 A;  3N7N A;  1IC2 A;  1WT6 A;  3VP9 A;  1X79 B;  3U1C A;  5KTB A;  4ZKP A;  3OJA B;  3HRN A;  5BVZ A;  3U59 A;  3U1A A;  4ZKU A;  4N3Y B;  3BAS A;  2FXM A;  5BU8 B;  4O9B A; 
#chains in the Genus database with same CATH topology
 3RL0 D;  1LT9 C;  1NAF A;  1EC5 A;  2OYH A;  1SVF A;  1USE A;  1IK7 A;  3L73 J;  1LTI C;  2QJY B;  1GK4 A;  2JDI H;  2XKM A;  1GU4 A;  2AXC A;  3MZW B;  1SQV E;  4U3F J;  4H44 D;  2OQQ A;  1GL2 D;  2Z5H A;  4DZO A;  4CPG A;  1VQO P;  4KT0 J;  2KI7 B;  1DIP A;  2V7Q J;  1HVV A;  2WWW A;  1XTC C;  3MIW A;  3RK3 E;  2QSI A;  3WUT A;  1G2C A;  3H1K E;  2KLV A;  3M9H A;  4BWN A;  2JKV A;  1RF1 C;  5AVY B;  4OWF A;  3HD7 A;  2OTJ P;  4ASW A;  3U1A A;  1SQB K;  3TF5 A;  3AEC C;  3CX5 E;  2XZR A;  3VTP C;  2QJK B;  1S5L E;  1KYO D;  1SQP E;  5KTB A;  3FX0 A;  1NGM B;  2E76 B;  3AE3 C;  1VQ6 P;  2WPQ A;  2E5T A;  5AW7 B;  2HR3 A;  1FZC B;  2KOG A;  3RL0 B;  2KSE A;  2M3E A;  1BDC A;  1GW4 A;  1T2K C;  2YMY A;  1PV3 A;  5APV A;  1SQP D;  3I56 P;  4XA4 A;  3V6I A;  2FYU G;  2B87 A;  1KD1 Q;  5B66 E;  1OWA A;  3A0B E;  3QWO C;  1NTZ J;  3EWK A;  2JEE A;  1ZP0 C;  3L73 D;  1Z56 A;  1IFD A;  1D7M A;  1GL2 B;  4RJT A;  3Q2Y A;  1AJY A;  3A3Y B;  1L0L E;  3PRJ A;  1N73 C;  4U3F D;  3CCE P;  4YXW H;  3H1J J;  3P8C D;  2POH A;  3CME P;  3SWF A;  2ZVO B;  2FXP A;  1NH4 A;  3BCC G;  3MTU E;  4HJG H;  2R3C A;  1UIX A;  1KOR A;  3ITK A;  2JP3 A;  1JMM A;  3GLM A;  3VMX A;  2Q1K A;  5CMZ A;  2OAR A;  1LTJ A;  5AW9 B;  2D2C D;  2IBZ E;  1QEX A;  2ZT9 C;  4GOD A;  1Q82 Q;  1L0N D;  2OYO A;  1SQX K;  4I6M C;  3AEB C;  1BCC D;  2I1K A;  2XNX A;  3GG2 A;  3IN6 A;  3L72 E;  2WPV B;  3I5C A;  1ZRT E;  2VRS A;  1S2E A;  3H32 B;  1W2E A;  2GM4 A;  3CLQ A;  3TGU G;  1G2C B;  1Q90 D;  4WY4 A;  2H88 C;  1OW8 A;  1KMI Z;  2LXB A;  4PJ0 E;  1KYO H;  1FS0 E;  1A02 J;  2OYI A;  1LT9 B;  1K9M Q;  2QIW A;  1M1J C;  3CL3 D;  2W83 C;  2M8R A;  1N7S C;  1RE4 A;  2Y0E A;  1ZRT D;  2M0B A;  1NTZ D;  4Z1M H;  4N78 D;  5CBN A;  2J5U A;  2WZ7 A;  2YO3 A;  2BCC G;  4GIF A;  1XTG B;  4QMA A;  1PP9 G;  3T97 B;  2A45 H;  1M8O B;  4LLH A;  1KV4 A;  2FYU J;  3H1J D;  5GTH E;  1EDL A;  3JC2 2;  2YIU B;  3GHG C;  1L0N K;  3HE4 A;  2B87 B;  1OW7 A;  1RF0 A;  1M1K Q;  1U7J A;  1ZW0 A;  2D2C B;  1JB0 J;  3AEG C;  4IFF A;  1YJ9 P;  4H0L D;  3RL0 g;  1LNQ A;  2A06 G;  5K5G B;  4Y28 J;  4C7N B;  3A0H H;  1SFC A;  1NTM G;  3E7K A;  1QGK B;  3I55 P;  2E74 C;  2ZYG A;  3JCU E;  1M57 D;  3BCC J;  3M06 A;  2W6B A;  2KNC B;  1LTT C;  2K37 A;  2N1T C;  1EZV I;  2N9B A;  3KHU A;  1FOS E;  4YPC A;  5KAI E;  3H1I D;  1URQ A;  3L74 D;  1Q86 Q;  1QVF O;  3D70 A;  4XE5 B;  4L75 A;  2HPC A;  1AFO A;  1NTZ K;  3H1K G;  1Q2N A;  2YXR B;  4JYC A;  1RY3 A;  3V5B A;  3VMA A;  1VF5 D;  4ZKU A;  2GUS A;  1RQU A;  1KZU B;  2IPP A;  1YIJ P;  5KJ7 C;  3LID A;  1AVO A;  1QX8 A;  4K3A A;  1HWT C;  2G8Y A;  1NO4 A;  4U7J A;  4UB6 E;  3W67 A;  1JEK A;  5CCH A;  3TGU J;  2SPZ A;  3L35 A;  1HGZ A;  2IZ0 A;  1GK6 A;  3BVH A;  1IC2 A;  2OYI B;  2FYU D;  1NTK G;  2LR2 A;  2KLU A;  3E1R A;  1S9K E;  3FWL A;  4WVZ A;  3CCV P;  4H0L B;  3P8M C;  1J1D B;  1RE3 C;  1IJD B;  3S4R A;  1DD3 A;  1EDI A;  2J58 A;  3H1L G;  4PV1 C;  5AVX B;  3BCC E;  2BCC J;  3HTK B;  1M56 D;  1MFT A;  1PP9 J;  1JY3 O;  1Y9B A;  3LW5 J;  3Q5R A;  1AVY A;  2OGU A;  3OJA B;  2Y9Z A;  2HYN A;  5CCG A;  1L0L G;  4MN4 C;  3CC7 P;  5BU5 A;  1EZV D;  1M7L A;  1X9V A;  4OVN F;  3GW6 A;  5GTH H;  1YQ4 C;  3C8V A;  5CBO A;  1VF5 B;  2H89 C;  2R32 A;  1PGP A;  3CXH E;  3A2A A;  1NTM J;  5APY A;  2RH0 A;  4HYT B;  1KB9 D;  3BRT B;  3CWB D;  4GOE A;  1FZC A;  3H25 A;  2IBZ G;  2K1A A;  5AVW B;  3R4Y A;  3HE5 B;  1R5S A;  3KYQ A;  2FYU K;  1LWU C;  5CCG D;  1NWQ A;  1MFZ A;  3WUU A;  5KAF E;  5KLV G;  1SLQ A;  5APU A;  3L72 G;  3TGU D;  3NMD A;  3H1K J;  2FKW B;  2GUV A;  2O1J A;  3U59 A;  1ZN5 A;  2KK7 A;  1JO5 A;  4O9B A;  2KXP B;  2OYH C;  1GL2 A;  2YNY A;  3M9Q A;  1YHQ P;  1PP9 E;  3N7N A;  4KJM A;  1CSB A;  4RKU J;  2JWA A;  2NPS C;  2Q3E A;  3CX5 I;  4RO0 A;  1GZL A;  3L70 G;  1PIX A;  2ZXE B;  3H1H D;  4M3L A;  2BCC D;  4UB6 H;  1JUN A;  1GU5 A;  3CMA P;  1PP9 D;  3AE1 C;  3SFE C;  2R5B A;  5GTI E;  4YTP C;  2WPS A;  3MUD A;  2Q3I A;  2N1T B;  1NTK J;  1BSN A;  1ZME C;  2A45 I;  3B5N D;  2A06 E;  1FZB A;  2FXM A;  3L75 G;  1NTM E;  2W27 A;  2HG5 D;  3KZI E;  3SWY A;  3H1L J;  4BRY B;  3F5H A;  1W5C E;  5AW0 B;  1PGO A;  2Q9I A;  1JY2 O;  3L36 A;  3FWN A;  1NTM D;  2I1J A;  1IO4 A;  1L0L J;  1SQV D;  1NU1 E;  5APS A;  5TIS E;  3H32 A;  4TLF A;  3N4X A;  1H0T B;  1X8Y A;  1LTG C;  4K35 A;  1LT9 A;  2P1J A;  2Z5I A;  2WIT A;  1VQ8 P;  3KDP B;  2WT7 B;  1E5W A;  1VQP P;  5KKZ B;  1KB9 H;  1QLE D;  4JF7 A;  2E75 D;  3RK3 D;  2RMZ A;  2KYV A;  3H1K D;  5AW4 B;  3VP9 A;  1GDT A;  1VQK P;  1G1J A;  2QM8 A;  4LC1 A;  2QG4 A;  3CCQ P;  1VQM P;  3CX5 D;  1GMJ A;  1SQX E;  2IBZ I;  3T97 A;  2IDB A;  4H13 C;  2FFD B;  5KLV J;  3L72 J;  1NTK E;  3M0D C;  1AA0 A;  2NRG A;  3EQ2 A;  5DJT B;  3A7O A;  2DW3 A;  1VQ4 P;  3B5N B;  1RF1 A;  3H1L E;  5L8R J;  1FZE A;  2AXT E;  1EXJ A;  2JWD A;  1FDO A;  5E79 H;  1NTK D;  2M5A B;  3LIE A;  1JNM A;  3AE7 C;  1SQV K;  1VQN P;  4C7N A;  2IYP A;  5BVZ A;  4IL6 X;  3L70 J;  3H1L D;  1LTJ C;  1BE3 G;  3LW5 H;  1HGV A;  4ZMD A;  3CCU P;  2KNC A;  1NAY A;  2XND H;  1IFP A;  3B8E B;  1L0L D;  2Y9Y A;  5CHX A;  1T3J A;  3AE2 C;  1VQ9 P;  3TNU B;  3AE6 C;  3H6P A;  3L75 J;  2QJP C;  2M3B A;  2KUB A;  2P58 A;  1N8R Q;  2L91 A;  2CK3 H;  2E75 B;  2PP6 A;  3RK3 B;  5AW6 B;  5DJU B;  1AQT A;  3PTZ A;  4WY4 C;  4AQR D;  1W2B O;  1P84 E;  1LGH B;  1Y47 A;  1BGY E;  1OVR A;  4OH8 B;  2IFN A;  2FYN C;  1RE4 C;  1KQL A;  2K3R A;  3V2N A;  1SQP K;  3M91 A;  2BEZ F;  1HBW A;  5KLV E;  1SQQ E;  1WRG A;  2BAS A;  2NPS B;  5CJ4 A;  1DD4 A;  1KQS O;  2IBZ D;  4AUW A;  1T2K D;  5KLV D;  2N9Y B;  3L72 D;  3PH0 A;  1NKN A;  3RK2 C;  4YXD C;  3FGA D;  1FC2 C;  3L70 E;  3CX5 H;  3HTK A;  1S5L H;  5H2F E;  4NPD A;  2MJZ A;  1X22 A;  3WU2 E;  5CJ0 A;  4W7Z A;  4IL6 E;  1SQB G;  4OGQ C;  2W90 A;  2KIK A;  2C0W A;  1SFC C;  3L75 E;  1ZOY C;  1KIL C;  3L4F A;  2R44 A;  3IFM A;  5KLI C;  1OIP A;  2W8Z A;  1FZF A;  3G71 P;  1A02 F;  1RF1 B;  1QL1 A;  1TU3 F;  5APW A;  4JPZ B;  5B66 H;  1OFC X;  3L75 D;  5APQ A;  2WTY A;  3A0B H;  1BE3 J;  4KHX A;  4IFM A;  2XDJ A;  2ZT9 D;  1OW6 A;  2V7Q H;  3HE5 A;  3IAO A;  2OTK E;  2O3J A;  1OVV A;  3BAS A;  2RKL A;  2WSF J;  4GDO A;  3GF7 A;  4IFD K;  5CCH C;  1NU1 G;  3L71 E;  1WT6 A;  3GHG A;  2V4H A;  4DCK A;  1OVU A;  3U1C A;  3IR9 A;  4R4M A;  1KQG B;  1ZR4 A;  1JCC A;  2ZAE B;  2QJY C;  3E1I A;  1N7S D;  3RK2 D;  3HUS C;  4RES B;  5AVR B;  1KB9 I;  1S72 P;  1P84 H;  3CCL P;  2K9Y A;  2H7H A;  1N73 B;  1PPJ E;  1KIL E;  3CXH I;  1FU1 A;  1LTS C;  1LTA C;  1HJB A;  1LJ2 A;  2N1T A;  1T6A A;  1SQX G;  1IK9 A;  3PHL A;  4PJ0 H;  1JY3 P;  2IX7 C;  1S3J A;  4PD4 E;  4BRY A;  1BE3 E;  5M1B A;  3V4Q A;  2ZJS E;  1HF9 A;  1OX3 A;  1J2J B;  5AVU B;  5KJ7 A;  2ZT9 B;  2R5D A;  3S1K A;  1KFN A;  2P7J A;  4GOF A;  5AVV B;  5H2F H;  1MUU A;  1S9K D;  4D6T E;  2IYO A;  1L4A C;  1USD A;  1LT1 A;  2E76 C;  3MGN A;  4IL6 H;  1FAV A;  2E74 D;  1H0T A;  5APX A;  1E79 H;  3B4S A;  1FZC C;  3BCC D;  1MKM A;  2O01 J;  3II6 A;  1RHZ B;  2WT7 A;  2N1T D;  1VDF A;  1ZV8 A;  1IZN B;  2JJL A;  3QH9 A;  3GF3 A;  1FBM A;  1FJP A;  1M1J B;  1N7S B;  3RK2 B;  1RQV A;  2GA1 A;  4NPE A;  2WSC J;  1N86 A;  1RE3 A;  1FE6 A;  4H44 C;  1DEE G;  4W7Y A;  3RBX A;  1YJW P;  5KJ7 D;  5AVQ B;  1L0N G;  2H43 A;  1FDM A;  2W6A A;  2FFD A;  1BGY G;  1VQ5 P;  2C9N Y;  4EOT A;  3JCU H;  3CXH D;  1BCC G;  4A7P A;  4JQ0 D;  3G9R A;  2W6J H;  1H89 A;  1NU1 J;  3M0A A;  1SQQ G;  3B5N A;  1AQ5 A;  3CI9 A;  4GT1 A;  3NXS A;  1VQL P;  5KAI H;  5TJH A;  1OZH A;  5AW8 B;  1WMK A;  3GHG B;  1FDI A;  2J59 M;  3Q1M A;  1JTH B;  1K05 A;  2IFM A;  3CCM P;  1FJK A;  2M5A A;  1SQB E;  1MZ9 A;  4Y99 C;  2ZYD A;  3Q5P A;  3VOP A;  1JOC A;  3AED C;  4PV1 D;  5BU8 B;  4LGD E;  2E74 B;  5B5E E;  2YXQ B;  3B71 A;  1SQX J;  4JBZ A;  1L4A D;  1SS1 A;  1GD2 E;  3TNU A;  1M90 Q;  3F89 A;  1JM0 A;  2JR8 A;  1JY2 P;  3O8Z A;  2C0X A;  2Q5U A;  2KS1 B;  2WQY C;  2MKV A;  4WB4 A;  3D6Z A;  1N2D C;  2LXC B;  2YKO A;  4TT3 H;  3HD7 C;  3CC4 P;  4PD4 H;  3P7K A;  4ZKP A;  3BRV B;  1YYC A;  3HUS B;  2A06 D;  1JY3 N;  2NPS A;  2WSE J;  3TK1 A;  1KTM A;  1K73 Q;  2E43 A;  2AEM A;  3VN0 A;  2B88 A;  3RGU A;  1K04 A;  2WSF H;  1FZG A;  3FXD A;  1HH0 A;  1IFI A;  3VMY A;  3RBZ A;  4WWI A;  3W68 A;  3G3Z A;  1CI6 A;  2QRX A;  3KXD A;  1NU1 D;  3M9B A;  1NHL A;  2YIU C;  3H1I G;  1KYO E;  1YIT P;  3L74 G;  1PGQ A;  2WSS H;  3OW2 O;  3L71 G;  3EFG A;  2H8P D;  2D2C C;  3CXH H;  3CCR P;  1EDK A;  1L0N J;  2B9B A;  4PV1 B;  3CD6 P;  1BGY J;  4N6J A;  1ZR2 A;  4EIJ A;  3MD0 A;  1BCC J;  2FY8 A;  1P84 I;  3VP8 A;  2NPS D;  4ASV A;  1LP1 B;  1SQQ J;  3AE4 C;  1AV1 A;  1L4A B;  4NPF X;  3AE9 C;  1PPJ G;  5KAF H;  1JCD A;  1SQX D;  2XV5 A;  5AVS B;  3TYY A;  1Q81 Q;  3CCS P;  2HFE D;  3L73 E;  1NTM K;  1BSH A;  2C9L Y;  3TSI A;  5AVZ B;  4N3Y B;  1CZQ A;  4WBA A;  4IOI H;  4U3F E;  2K9J B;  3HD7 D;  3PLN A;  3P8C E;  2YKQ A;  4H44 B;  2Z4E A;  1KN7 A;  1T8Z A;  1J1E C;  3A0H E;  1L2P A;  3O6Q B;  1NU1 K;  2WPR A;  3Q5S A;  3OA7 A;  1ZLL A;  4I7Z C;  5B5E H;  1NYH A;  2O01 H;  2OTL P;  1YTZ I;  4D6T G;  3M0D A;  1LWU B;  2YO2 A;  3CPW O;  3CCJ P;  5GTI H;  1MV8 A;  4C7R A;  2WMM A;  4C46 A;  2ZFC A;  3FXE A;  1EZV G;  2HOD B;  2FBW C;  1L0N E;  2PGD A;  2OYI C;  2JO1 A;  2P67 A;  2FXO A;  3KZI H;  2WSC H;  3R2P A;  3PJS K;  2OYH B;  1JY2 N;  2QE7 H;  1BCC E;  4H0L C;  2IZ1 A;  4Y99 B;  3C9I A;  1KC8 Q;  1J1D C;  1GTW A;  1N73 A;  1HJ0 A;  3AEA C;  1YJN P;  1X79 B;  2I8D A;  2ZVN B;  1UII A;  1P84 D;  1QL2 A;  3CWB G;  1BGY D;  5TIS H;  3KQG A;  1NTK K;  4H13 D;  1RH5 B;  3G4S P;  1SQQ D;  3H1I J;  1CI6 B;  2WVR A;  1JMB A;  3L74 J;  3L71 J;  1PZQ A;  1IFJ A;  3V2P A;  2ZYA A;  1NTZ E;  1FZA A;  1RF0 C;  1VF5 C;  3HD7 B;  4N78 E;  1QVG O;  3MHV A;  5APT A;  4UB8 E;  1L0L K;  1EQ7 A;  4EYY Q;  1H8A A;  1H88 A;  1YBK A;  5AW5 B;  4R4L A;  4JYB A;  2CPB A;  3L70 D;  2Q6Q A;  3H1J E;  3V4W A;  4W80 A;  3USS A;  1YQ3 C;  3H1H G;  2UWJ E;  3OAK A;  1R8E A;  1BDD A;  2KZI A;  3AEE C;  2P10 A;  2E5Y A;  1M1J A;  1FOS F;  1N7S A;  2AXT H;  1EDJ A;  3SFD C;  1URQ C;  1KQF B;  1NJI Q;  4WY4 D;  1X0T A;  1U57 A;  1CW5 A;  3ZDM A;  4PD4 I;  2QA4 P;  2WSE H;  2YMK A;  2QM7 A;  1U7M A;  1PL5 A;  2YKP A;  5KLV K;  3TDK A;  1SQQ K;  2O01 N;  1T3U A;  4D6T J;  5AW1 B;  3WMM 0;  4H13 B;  3H1I E;  3G6E P;  3WUV A;  1SQV G;  3L74 E;  1KIL A;  4HB1 A;  4L73 A;  3P32 A;  3AE8 C;  1OXZ A;  1PGJ A;  1JTH A;  2ITA A;  4EI2 A;  1ZXG A;  1EXI A;  4L74 A;  4B86 A;  5AW3 B;  3C1L A;  3AE5 C;  2P2U A;  2KSJ A;  5C39 A;  1SP4 A;  3V2R A;  1S4X A;  3L71 D;  4DJG A;  3VYI A;  4HH2 A;  3D6Y A;  2CPS A;  2KP8 A;  1IFM A;  3CWB J;  1LTJ B;  1R5L A;  1Q7Y Q;  3JSV C;  2Y0D A;  1J1E B;  3KPE A;  4I1L A;  4OGQ D;  3SWK A;  1SFC D;  4I7Z B;  2PFX A;  5CCG C;  2FYU E;  1YTZ T;  2KS1 A;  4AYC A;  1SQP G;  1PPJ D;  1KIL D;  3EFF K;  2QJP B;  2ZXX A;  3A5T A;  2B89 A;  2NZ2 A;  3SSU A;  4WY4 B;  2A45 G;  1YI2 P;  5KKZ C;  4HKZ H;  2O1K A;  3HUS A;  1OMI A;  1SQB J;  1URQ D;  1Y8A A;  2PRR A;  2QJK C;  3L73 G;  3VMZ A;  4PD4 D;  2FYN B;  1BE3 D;  3WU2 H;  4UB8 H;  4U3F G;  3BAT A;  3CC2 P;  4I2L C;  1VPC A;  3H1H J;  1EZV E;  4XFJ A;  3RL0 C;  2FFD C;  2AEJ A;  1PFI A;  3UIA A;  1VL2 A;  4D6T D;  1DX7 A;  2QEX P;  2AEF A;  2Y0C A;  1G1I A;  1DH3 A;  2KZJ A;  2L5G B;  5EFW B;  2KB7 P;  3B5N C;  5CCH D;  2BEQ D;  3PP5 A;  1HTL C;  1KB9 E;  2XU6 A;  4L76 A;  1GW3 A;  3CWB E;  3HE4 B;  4GKG A;  1GL2 C;  4ZNC A;  1NKZ B;  2LKM A;  1S1C X;  1LP1 A;  1L4A A;  1SQV J;  4OGQ B;  1K8A Q;  1SFC B;  3TGU E;  2RN0 A;  3NTN A;  4EDF A;  1NOH A;  1KIL B;  1VQ7 P;  1NVO A;  5KLI B;  1IFN A;  3L37 A;  2R3S A;  1KFM A;  3AEF C;  1LTB C;  3MP7 B;  2E42 A;  3NFQ A;  3MUD C;  3D71 A;  4DOJ A;  2E75 C;  3IF4 A;  3RK3 C;  1URQ B;  2K9J A;  5E79 E;  3HRN A;  5AVT B;  2HPC B;  1S5L X;  3GMA A;  3K5B A;  3ABV C;  1KYO I;  3H1H E;  2BCC E;  3V2Q A;  2PAJ A;  1NTZ G;  2FYZ A;  4DT0 A;  2QVA A;  3O6Q A;  1SQB D;  3S9O A;  2G3A A;  3Q3D A;  2K88 A;  1LWU A;  1N7L A;  1SQP J;  2E76 D;  2Q7C A;  1DEB A;  1HUC A;  5AW2 B;  4BXL A;  3H1J G;  2HOD A;  2HLO A; 
#chains in the Genus database with same CATH homology
 1RE3 C;  2J58 A;  3P8C E;  3RL0 D;  5AVX B;  2YKQ A;  1FZF A;  2Z4E A;  1LT9 C;  3HTK B;  1A02 F;  1RF1 B;  1QL1 A;  1J1E C;  1T8Z A;  1NAF A;  2OYH A;  1SVF A;  1JY3 O;  5APW A;  1NU1 K;  2WPR A;  3OJA B;  1LTI C;  2HYN A;  3OA7 A;  1ZLL A;  1GK4 A;  5APQ A;  2WTY A;  2XKM A;  2O01 H;  1YTZ I;  1GU4 A;  5CCG A;  3M0D A;  1LWU B;  2YO2 A;  1MV8 A;  4C7R A;  4KHX A;  4IFM A;  5BU5 A;  2XDJ A;  4C46 A;  1M7L A;  2ZFC A;  2HOD B;  1X9V A;  1GL2 D;  2Z5H A;  4DZO A;  3HE5 A;  2OYI C;  2P67 A;  2WSC H;  3R2P A;  3BAS A;  2OYH B;  1JY2 N;  2R32 A;  3A2A A;  4Y99 B;  1HVV A;  2WWW A;  1XTC C;  3C9I A;  3MIW A;  5APY A;  1J1D C;  1GTW A;  1N73 A;  4IFD K;  5CCH C;  1G2C A;  2KLV A;  3M9H A;  1WT6 A;  4HYT B;  3GHG A;  3BRT B;  1IJD B;  1X79 B;  1RF1 C;  3U1C A;  5AVY B;  3IR9 A;  1FZC A;  3HD7 A;  1QL2 A;  3U1A A;  1SQB K;  5AVW B;  1ZR4 A;  1JCC A;  3E1I A;  3HE5 B;  3KQG A;  3KYQ A;  1N7S D;  1NTK K;  3HUS C;  3RK2 D;  2FYU K;  4RES B;  1LWU C;  5AVR B;  5CCG D;  2XZR A;  1NWQ A;  3VTP C;  1MFZ A;  1CI6 B;  1SLQ A;  5APU A;  3NMD A;  2H7H A;  5KTB A;  2FKW B;  1IFJ A;  3V2P A;  1N73 B;  2GUV A;  2O1J A;  3U59 A;  1ZN5 A;  1FU1 A;  1LTS C;  1JO5 A;  2WPQ A;  1LTA C;  1FZA A;  1RF0 C;  5AW7 B;  1HJB A;  1FZC B;  2KOG A;  4O9B A;  3HD7 B;  4N78 E;  2OYH C;  1GL2 A;  3RL0 B;  2N1T A;  2YNY A;  3M9Q A;  3P8M C;  5APT A;  1L0L K;  1GW4 A;  1EQ7 A;  3N7N A;  1IK9 A;  1T2K C;  1H8A A;  1H88 A;  1CSB A;  2YMY A;  5APV A;  5AW5 B;  4JYB A;  4XA4 A;  2CPB A;  2NPS C;  1JY3 P;  2IX7 C;  1GZL A;  3V4W A;  4W80 A;  2ZXE B;  3V4Q A;  4M3L A;  1OWA A;  1JUN A;  1GU5 A;  1J2J B;  2JEE A;  3OAK A;  5AVU B;  5KJ7 A;  2R5D A;  1Z56 A;  2R5B A;  1KFN A;  2P7J A;  1IFD A;  5AVV B;  1GL2 B;  2WPS A;  3MUD A;  2Q3I A;  1M1J A;  2N1T B;  3A3Y B;  1MUU A;  1FOS F;  1S9K D;  1N7S A;  1L4A C;  2A45 I;  3B5N D;  1URQ C;  1N73 C;  1FZB A;  2FXM A;  3MGN A;  2W27 A;  1FAV A;  5APX A;  2HG5 D;  3SWY A;  3P8C D;  2POH A;  4WY4 D;  3SWF A;  1FZC C;  5AW0 B;  1CW5 A;  1NH4 A;  3MTU E;  2WSE H;  2Q9I A;  2R3C A;  2QM7 A;  3II6 A;  2WT7 A;  1JY2 O;  2N1T D;  2YKP A;  1VDF A;  1ZV8 A;  5KLV K;  1SQQ K;  3L36 A;  1T3U A;  2JJL A;  1FBM A;  2I1J A;  1IO4 A;  1FJP A;  1M1J B;  5AW1 B;  1JMM A;  1N7S B;  3WMM 0;  3RK2 B;  3VMX A;  5APS A;  5CMZ A;  3H32 A;  2OAR A;  1KIL A;  1N86 A;  3N4X A;  1LTJ A;  5AW9 B;  1RE3 A;  1X8Y A;  3P32 A;  1OXZ A;  4W7Y A;  1JTH A;  1LTG C;  1LT9 A;  2P1J A;  5KJ7 D;  1SQX K;  5AVQ B;  4B86 A;  2Z5I A;  5AW3 B;  2WIT A;  4I6M C;  2H43 A;  1FDM A;  2W6A A;  2FFD A;  3KDP B;  2WT7 B;  2C9N Y;  1E5W A;  2I1K A;  2XNX A;  2HLO A;  4EOT A;  2P2U A;  2KSJ A;  4JF7 A;  1SP4 A;  3V2R A;  3RK3 D;  1H89 A;  2KYV A;  3I5C A;  3M0A A;  3B5N A;  5AW4 B;  3VP9 A;  1GDT A;  2VRS A;  1AQ5 A;  1G1J A;  3VYI A;  3H32 B;  1W2E A;  4HH2 A;  3CI9 A;  2CPS A;  3CLQ A;  2QM8 A;  4GT1 A;  2KP8 A;  4LC1 A;  3NXS A;  2GM4 A;  1G2C B;  1IFM A;  1LTJ B;  4WY4 A;  5AW8 B;  3GHG B;  2J59 M;  1A02 J;  1JTH B;  2OYI A;  2IFM A;  1LT9 B;  1FJK A;  1J1E B;  1M1J C;  3CL3 D;  3KPE A;  4I1L A;  2M8R A;  3T97 A;  1N7S C;  2FFD B;  1MZ9 A;  4Y99 C;  1SFC D;  1RE4 A;  5CCG C;  3M0D C;  1YTZ T;  4AYC A;  3EQ2 A;  3VOP A;  1KIL D;  3A7O A;  3B5N B;  1JOC A;  5BU8 B;  1RF1 A;  1FZE A;  3A5T A;  4LGD E;  4N78 D;  2WZ7 A;  2YO3 A;  4WY4 B;  2A45 G;  4GIF A;  1XTG B;  2O1K A;  3HUS A;  1L4A D;  3LIE A;  1URQ D;  1JNM A;  3TNU A;  1GD2 E;  3VMZ A;  1SQV K;  4C7N A;  1JY2 P;  2A45 H;  5BVZ A;  3O8Z A;  2C0X A;  4LLH A;  2Q5U A;  1LTJ C;  3LW5 H;  1HGV A;  3GHG C;  3BAT A;  4WB4 A;  1L0N K;  1N2D C;  4I2L C;  1VPC A;  3HE4 A;  2YKO A;  3HD7 C;  1RF0 A;  3RL0 C;  2FFD C;  3P7K A;  4ZKP A;  3B8E B;  3UIA A;  1PFI A;  1DX7 A;  3BRV B;  1YYC A;  5CHX A;  4IFF A;  3HUS B;  1T3J A;  1G1I A;  1DH3 A;  1JY3 N;  2L5G B;  3TNU B;  3H6P A;  2KB7 P;  2NPS A;  4C7N B;  3B5N C;  5CCH D;  2M3B A;  1SFC A;  3PP5 A;  3TK1 A;  2E43 A;  2PP6 A;  3VN0 A;  3RK3 B;  5AW6 B;  2WSF H;  1HTL C;  4WY4 C;  4AQR D;  2XU6 A;  1GW3 A;  3M06 A;  1FZG A;  3HE4 B;  1HH0 A;  1IFI A;  2W6B A;  4GKG A;  1LGH B;  3VMY A;  1GL2 C;  1LTT C;  2N1T C;  2IFN A;  4OH8 B;  1NKZ B;  1CI6 A;  2LKM A;  3G3Z A;  1RE4 C;  2N9B A;  1KQL A;  3V2N A;  1SQP K;  3M91 A;  1FOS E;  1L4A A;  3M9B A;  1NHL A;  1URQ A;  1HBW A;  1WRG A;  2BAS A;  2NPS B;  4XE5 B;  5CJ4 A;  2HPC A;  1AFO A;  1SFC B;  1NTZ K;  3NTN A;  4JYC A;  3EFG A;  1RY3 A;  2H8P D;  3V5B A;  1NOH A;  1KIL B;  4ZKU A;  2GUS A;  2IPP A;  1KZU B;  1IFN A;  3L37 A;  5KJ7 C;  3LID A;  4N6J A;  1ZR2 A;  4EIJ A;  1KFM A;  4AUW A;  1LTB C;  3MD0 A;  2E42 A;  3NFQ A;  1T2K D;  1HWT C;  1NKN A;  3RK2 C;  4DOJ A;  3VP8 A;  2NPS D;  1NO4 A;  3RK3 C;  1L4A B;  1URQ B;  3HRN A;  5CCH A;  5AVT B;  2HPC B;  3HTK A;  3L35 A;  1JCD A;  3V2Q A;  2PAJ A;  2FYZ A;  2MJZ A;  2XV5 A;  5AVS B;  3TYY A;  1HGZ A;  5CJ0 A;  4W7Z A;  2HFE D;  1GK6 A;  3BVH A;  1IC2 A;  2OYI B;  1NTM K;  1LWU A;  1N7L A;  2C0W A;  1SFC C;  1S9K E;  2Q7C A;  2C9L Y;  3TSI A;  5AVZ B;  4N3Y B;  1CZQ A;  4WBA A;  1DEB A;  1HUC A;  5AW2 B;  1KIL C;  3HD7 D;  3L4F A;  2HOD A;  3IFM A;  1J1D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...