3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
4N3YB 5BU5A 3BATA 2POHA 3BASA 3C9IA 1NKNA 3VP9A 3N7NA 3U1CA 4N78D 5BVZA 4GIFA 3HRNA 3U59A 5BU8B 5KTBA 3U1AA 4ZKUA 3N4XA 1X79B 4O9BA 4ZKPA 3OJAB 2FXMA 4I1LA 1WT6A 3VP8A 1IC2A 2JEEA 3P8CD
chains in the Genus database with same CATH superfamily
1FOSF 1ZLLA 3CPWO 1DEEG 1JY3N 3GF3A 1AVOA 2OYIC 2C9LY 3QWOC 1AQTA 1DEBA 1G2CA 4EOTA 2POHA 1KILE 3CC7P 3CCMP 2J58A 4Y99C 1OW8A 5CJ0A 4LLHA 3L70E 1NH4A 1Q90D 2Z4EA 1Q81Q 2W90A 3H1HG 3MTUE 2LR2A 2K9JA 2JO1A 3GHGC 5CCGA 3L74G 1U7JA 3CC4P 1HTLC 3H32A 3V2RA 3H1HJ 3W67A 3RL0D 2IX7C 5K5GB 1FZCA 2WSFH 3I5CA 5AW4B 2O01J 5CHXA 2A45I 1YTZI 1KB9I 3AEGC 2P58A 4L76A 3N7NA 3B4SA 1GU5A 3H1KE 1OWAA 3H1HD 5BU8B 1CI6A 2O01N 3CCQP 1XTGB 1LTAC 2D2CB 2IDBA 4NPFX 1W5CE 1EC5A 3EFGA 3L74D 4AUWA 1U7MA 2YIUC 2OYHA 3CXHI 1E5WA 3FGAD 3L73J 3S1KA 1NKNA 1RF0C 1VQ4P 1PZQA 4KJMA 1M56D 1RHZB 1KN7A 3U59A 1PV3A 4U3FG 5CBNA 4CPGA 4HB1A 2O3JA 1NU1J 3L74E 1R5LA 2WITA 5AVWB 2R3CA 1EDJA 1YBKA 1MUUA 1A02F 1G1JA 2RKLA 4IFDK 5AVSB 1URQA 2FYUJ 1NU1D 3BRVB 1M57D 3AE8C 2FBWC 5AW8B 2P2UA 2IBZG 1P84H 2W6BA 1K8AQ 1IC2A 1WRGA 1DD4A 1R8EA 4U3FD 1LTJC 5CBOA 3II6A 1Z56A 1KILB 1YYCA 1IFNA 1L4AC 1SQBG 1KB9D 3V2NA 3L4FA 1VPCA 1Q7YQ 1X8YA 3O8ZA 2B87B 4H44C 5CCHA 2BCCE 4DJGA 1P84E 2HYNA 1NWQA 3G4SP 1SQBJ 4U3FE 2A06G 4D6TG 1SFCA 5EFWB 2WPSA 2PP6A 1K9MQ 1ZMEC 2Q6QA 1YHQP 1SS1A 2YMYA 2YO3A 3F89A 1GDTA 1SQBD 1VQOP 3A0BE 3O6QB 1M8OB 4RO0A 4H13B 3UIAA 2H89C 1DD3A 4GOEA 2GA1A 2IBZE 2YXQB 3CMEP 4NPDA 3PHLA 2QJYB 1KZUB 2WSEH 3NTNA 2E76B 1EDLA 1N7SA 2WT7B 2CPBA 2IZ0A 3NFQA 2E75C 2P10A 3RK3C 5AVUB 4AYCA 3HTKA 1YQ3C 2N1TA 1H88A 3F5HA 2KP8A 4LGDE 1HBWA 1SQPE 4A7PA 4BXLA 5KLIB 4DT0A 3Q2YA 1OX3A 2A06E 4D6TE 4PD4I 5GTHH 1L0LG 2ZXXA 1MFTA 2M5AB 3L37A 2V4HA 1VF5C 3P8CD 1LTJA 3CWBJ 3M9BA 4EDFA 1L0LJ 2FXOA 3V2PA 3LIEA 4C7NB 1LNQA 3CWBD 1JCDA 5GTHE 2WTYA 3HD7C 4NPEA 1S5LX 3H1LJ 1HJ0A 2KYVA 1GW3A 3RK2B 4BRYA 1L0LD 2GM4A 1HWTC 3MD0A 2J5UA 3P8CE 2LKMA 4UB6H 4ZMDA 1LWUB 1FS0E 1W2BO 2FFDC 1SVFA 1SQBK 2KNCB 3RL0C 3N4XA 3H1LD 3IFMA 3Q5RA 2HG5D 3HUSC 3LIDA 2QVAA 3CMAP 3VP9A 5CCHD 2QJPB 3VMAA 1ZRTD 1JMMA 4UB6E 1PPJD 5APUA 1VQPP 4WY4B 1NTKJ 3D6ZA 2K88A 2B89A 3BCCJ 1SFCD 2IPPA 1NAYA 2J59M 3WMM0 3EQ2A 3K5BA 4KHXA 3ABVC 5KAIE 3M0DA 1NTKD 1HJBA 4WWIA 4PJ0E 3A0HH 3BCCD 1LT9C 4MN4C 5AVYB 1KV4A 2QJKC 3ITKA 1FAVA 2B87A 1LJ2A 2L5GB 1S2EA 5CMZA 3CCEP 4N78D 1M1KQ 3AE9C 2HPCA 2M8RA 1JEKA 3AE7C 4DZOA 1J1DC 3A0HE 1IJDB 3KQGA 1J1EB 1KC8Q 4YPCA 2E5YA 1L0LK 1VQMP 2QSIA 4N78E 3JCUE 5M1BA 3TK1A 1BCCE 1L0NG 3PH0A 5APTA 1S9KD 2XZRA 1FDOA 1ZR4A 1TU3F 2WT7A 1FZBA 3WUUA 4HJGH 1OVVA 2OYOA 4KT0J 1NO4A 4XE5B 4RJTA 2R44A 3VP8A 2D2CD 3KPEA 5CCGC 1S9KE 1HUCA 3T97B 1QEXA 2VRSA 1NGMB 2WSCH 3MP7B 1VQ6P 1BSHA 1EZVE 2M5AA 1AJYA 2OYIB 2HODB 1FZCC 3CL3D 2O1KA 4OWFA 2ZYAA 1N2DC 3D6YA 1RY3A 5BVZA 1LT9A 3L70G 1OMIA 2KK7A 1L0NE 2JWDA 2ZAEB 4C7NA 3E1RA 1RE4A 2GUSA 2OYHC 2KLVA 3L70J 1LWUA 3EWKA 1GZLA 1KMIZ 2WWWA 3P32A 3AE6C 1KILD 3L75G 1IFJA 2XKMA 4ASVA 3L70D 3SWFA 2W8ZA 2NPSB 3HE4A 5GTIH 4L74A 3H1KG 4O9BA 3CCUP 1URQC 3L75J 3M91A 5KKZC 2WQYC 1MZ9A 3RL0g 4GKGA 1BGYG 3CCRP 2YKOA 3H1KJ 1SP4A 1FDMA 3L75D 3C8VA 5KTBA 4I7ZB 3G71P 2I1JA 1FU1A 1GW4A 2B9BA 2QIWA 1UIXA 5KLVG 5GTIE 4H13D 4K35A 1S3JA 3VOPA 2Q9IA 3NMDA 3VMYA 1LP1A 3H1KD 5CCHC 2WSFJ 1JTHA 1OW7A 1P84I 1KYOH 3VN0A 2E76D 1R5SA 2QM8A 2P7JA 3TSIA 3L75E 1SFCC 1DX7A 3L74J 4GODA 1DH3A 1LGHB 1OIPA 1FC2C 2N9YB 3H1JG 1KFMA 4DOJA 2IBZI 4PV1C 3AE1C 1KYOE 4U7JA 1BGYE 2KSEA 5KJ7D 2XV5A 4EI2A 3AEFC 3AE5C 1L4AB 3CLQA 3H1JJ 2KXPB 4JYCA 1AVYA 1N7SC 2BCCG 2PRRA 1M1JB 3G3ZA 5KLVE 2N1TC 1T8ZA 4Y28J 1SQQE 2Q7CA 1LTTC 1EDIA 2YKQA 3H1JD 2KS1B 1LTGC 2BCCJ 1Q82Q 4U3FJ 3RK2D 3HE5A 3T97A 4W7ZA 1NYHA 2N9BA 1WT6A 1JY2O 2BCCD 1P84D 3SSUA 3G6EP 3H1JE 4IL6X 5APWA 4TT3H 1G1IA 1VQ7P 3L71G 2MKVA 4Z1MH 2D2CC 4TLFA 1FZAA 1IO4A 1SQPG 1T2KD 2C0WA 2Y0DA 4LC1A 4WY4D 2H43A 2A45H 2E42A 2IBZD 1GL2B 1K73Q 5KAFH 2QE7H 3CX5H 1SQPJ 1QL1A 1HH0A 3RBZA 2JR8A 3CCJP 3S9OA 2G8YA 2I1KA 1RH5B 4C7RA 4D6TJ 4K3AA 2IYPA 3CXHH 1SQPD 2M3EA 1JOCA 2NPSA 5APXA 1D7MA 3TDKA 2ZT9D 1DIPA 1W2EA 1IFPA 2A06D 3CX5E 4D6TD 5C39A 5AW1B 1Y9BA 2FYNB 1CW5A 3JSVC 3FWNA 4IOIH 2E74B 3L71E 1PGQA 2PGDA 3PRJA 3M0DC 3M0AA 2JWAA 1KILC 2RMZA 2JKVA 1K05A 3AEEC 5H2FH 4JBZA 1QGKB 2FFDB 2HR3A 1AV1A 1S4XA 3JC22 2YKPA 1FE6A 2P67A 1SQXE 3KZIH 3C1LA 2WMMA 4H0LD 2H7HA 1LTBC 2ZJSE 3AEDC 3TF5A 4IFMA 2OGUA 3MGNA 5AW3B 1VQNP 4H13C 3TNUB 1VQ8P 2K9YA 1NTZG 1PL5A 3KZIE 2FKWB 2MJZA 1HGZA 2Y0EA 2QJKB 4QMAA 2H88C 1IFDA 1M1JA 2M0BA 3D70A 1SQPK 1YITP 2C0XA 1CZQA 1ZXGA 1VL2A 1JUNA 5KLIC 2K1AA 1L2PA 3MZWB 1WMKA 2YMKA 2AEFA 2R32A 4W7YA 1KQFB 5CJ4A 1GU4A 2FXMA 3EFFK 5AW5B 5KJ7C 1NHLA 1EZVI 2OARA 1HVVA 2XNDH 1BCCG 2RH0A 1FZEA 2W27A 2KSJA 1PGOA 5B66H 1KILA 1NTZE 1X9VA 1G2CB 4OGQB 1IK9A 4PD4H 3AEAC 2NPSD 1BCCJ 3B5NB 4HYTB 1FOSE 4GT1A 1RE4C 5AVVB 3TYYA 3RK2C 2ZT9B 1OW6A 4GIFA 4GOFA 5TJHA 1SQVE 1NTMG 1LWUC 3LW5H 1BE3E 1BCCD 2QG4A 2ZXEB 1KQLA 5B66E 2R3SA 2C9NY 1N73B 1FBMA 1BSNA 1FDIA 3H25A 3H32B 1EZVG 4PD4E 2G3AA 3O6QA 3OA7A 1T6AA 1FZCB 2QJPC 1J2JB 2UWJE 1PP9G 1NTMD 4JPZB 1RQUA 4H0LB 5AVQB 2W6JH 1RF1B 4EIJA 1EZVD 1HF9A 1L0NJ 4RKUJ 2V7QH 1OVUA 2WSCJ 1AA0A 3B71A 3IR9A 3KHUA 1X0TA 2BEZF 3SWYA 1NTME 3H1IG 1PP9D 4XA4A 1L0ND 2R5BA 2GUVA 1X79B 1L4AD 1JCCA 1OFCX 5KJ7A 2I8DA 5APSA 1OXZA 1PFIA 2IYOA 5AW2B 3GLMA 3H1IJ 4ZNCA 2QEXP 2KIKA 1VDFA 5KKZB 1YTZT 4WVZA 1J1EC 1PP9E 3Q5PA 1ZN5A 1RE3C 3H1ID 4Y99B 1S5LH 1KYOI 2WPQA 2NRGA 1JY2N 2QM7A 1GMJA 4W80A 5AW9B 5APQA 5APVA 3PP5A 3NXSA 1OVRA 1MKMA 3GHGB 2KNCA 3L72E 2XNXA 5B5EH 4GDOA 2WPRA 2Q1KA 3H1IE 2SPZA 1S5LE 1NTMK 2E75D 3RK3D 3V5BA 2OTJP 2JEEA 4WY4A 1GL2D 2FXPA 3SFDC 5B5EE 1T3UA 4PV1B 1YJ9P 2YIUB 3KDPB 3FXDA 3PLNA 2FYZA 3RK3E 1L0NK 2LXCB 4N3YB 1BGYJ 1VF5D 3E7KA 3R4YA 1N7SB 1JB0J 1SQQG 3B5NA 1N7LA 3HTKB 3M9HA 2N1TB 1JMBA 5AW6B 1QLED 1LT1A 1KTMA 2AXTH 1GD2E 3Q3DA 4ZKUA 1KYOD 5KLVJ 1BGYD 2KUBA 1SQQJ 1E79H 1EDKA 2KI7B 2E74D 3HD7D 5TISH 3WU2H 3V2QA 1N73A 3RGUA 3M9QA 1CSBA 3OW2O 3QH9A 5KLVD 1Q2NA 3U1AA 1SQQD 2Z5HA 1FJPA 4L73A 1RE3A 1LTJB 1JO5A 2NPSC 3MUDA 1GTWA 2AXTE 2WZ7A 3P7KA 1JY2P 4HH2A 3CD6P 3CX5I 3L73G 5TISE 3WU2E 2WSSH 2O01H 3PJSK 4H44B 4JF7A 1ZV8A 2KZJA 4BRYB 1RF1A 4I7ZC 3BATA 1NU1G 3A3YB 1H0TB 2OTKE 1KD1Q 1NAFA 3VYIA 1RQVA 4OVNF 3H1HE 2XDJA 4R4MA 2FYUG 1JY3P 2JJLA 2Y9ZA 2KLUA 3L73D 3IF4A 2KOGA 2A45G 2NZ2A 2K3RA 3I55P 1ZP0C 2OYIA 1H8AA 2HODA 1H89A 3ZDMA 4JQ0D 1EQ7A 1UIIA 3W68A 2KB7P 4IFFA 1OZHA 2DW3A 4I1LA 1VQ5P 2E75B 3RK3B 2BASA 2ZVNB 3L73E 1QVGO 2YO2A 2FYUD 1PIXA 1KB9H 3CCLP 3AECC 3V4QA 3L71J 4YTPC 1JY3O 3A0BH 1M1JC 5AVRB 1SQXG 5KLVK 1NU1E 3CX5D 2YXRB 3GHGA 5BU5A 1SQQK 1NOHA 2ZYGA 3L71D 4OGQD 2HPCB 3B5ND 2JP3A 1VF5B 2WSEJ 1SQXJ 2FYUE 3CXHD 2JDIH 2BEQD 3VMXA 1KB9E 4ASWA 1IZNB 4EYYQ 5KAFE 2ZFCA 1T3JA 2KZIA 3C9IA 5AVTB 1SQXD 5CCGD 3M06A 2K37A 2RN0A 1VQLP 3HD7B 1NKZB 2HFED 3CXHE 4DCKA 1IFIA 2W6AA 1RF0A 3VTPC 2Z5IA 3RL0B 3USSA 4OH8B 1SQBE 5AW7B 3KYQA 3HUSB 1YIJP 1JM0A 2AXCA 1QX8A 3IN6A 1GL2C 1BDCA 1NU1K 2Y9YA 3VMZA 2WVRA 2Q3EA 3CWBG 1M7LA 2Q3IA 5H2FE 5AW0B 1AQ5A 2FYUK 2Q5UA 1M90Q 3AE3C 2R5DA 3A7OA 1QVFO 4HKZH 2QRXA 3H1LG 3BVHA 2QJYC 2PFXA 2ZYDA 3U1CA 3TGUG 1L4AA 1LT9B 2OQQA 1S1CX 2E76C 3SFEC 4YXDC 2FYNC 1Q86Q 1NTZJ 1IFMA 1URQD 2E74C 1SQVG 2Y0CA 4R4LA 1KQSO 1VQKP 1BE3G 1PPJG 3TGUJ 2L91A 4BWNA 2H8PD 2M3BA 4UB8H 5AVZB 2KS1A 1H0TA 3HRNA 1VQ9P 4C46A 1NTZD 1SQVJ 1K04A 1J1DB 1BE3J 1SQXK 1YJNP 1U57A 3TGUD 1BDDA 1NTKG 1GK4A 3CWBE 5KAIH 3L35A 1KQGB 2IFMA 3BCCG 3P8MC 4PJ0H 3HE4B 3L36A 1L0LE 1SQVD 3I56P 4I2LC 1KFNA 2FY8A 4IL6H 1BE3D 2E5TA 4UB8E 3CCSP 2WPVB 2IFNA 3H1LE 4M3LA 3LW5J 4PD4D 1X22A 1YQ4C 1NVOA 3TGUE 1FZFA 1MFZA 3RBXA 1ZW0A 2W83C 1GL2A 1ZRTE 3MHVA 4ZKPA 4N6JA 4YXWH 4IL6E 2ZVOB 2K9JB 1SLQA 1PPJE 1LP1B 4PV1D 1YJWP 2AEMA 1PGJA 1JTHB 3JCUH 3H6PA 1NTMJ 3AEBC 1FZGA 2PAJA 1N7SD 1XTCC 2LXBA 3Q1MA 3CC2P 2AEJA 2XU6A 1NTKE 3E1IA 2B88A 3OJAB 2N1TD 3BCCE 1T2KC 2OTLP 4WY4C 3WUVA 2V7QJ 3KXDA 4WB4A 5APYA 4XFJA 1CI6B 2O1JA 3AE4C 3AE2C 1MV8A 4AQRD 3FWLA 4WBAA 1N8RQ 5DJUB 3FXEA 3CI9A 1NJIQ 3HD7A 1PP9J 2OYHB 1LTIC 1NTZK 3GMAA 3Q5SA 3L72G 1ZR2A 4OGQC 4L75A 2FFDA 3B5NC 3A2AA 3D71A 3A5TA 1YI2P 2HLOA 3OAKA 1A02J 1AFOA 3HUSA 1HGVA 3S4RA 2ITAA 2ZT9C 1GK6A 1SQVK 3GF7A 3GW6A 3L72J 2CK3H 3WUTA 4H44D 3PTZA 3V6IA 1EXJA 1FJKA 3HE5B 1N73C 1URQB 2QA4P 1Y47A 1JNMA 3GG2A 3L72D 2E43A 3FX0A 4JYBA 2IZ1A 5E79H 3MIWA 1NTKK 3MUDC 1ZOYC 3TNUA 1S72P 3BRTB 4I6MC 1N86A 1USEA 1LTSC 5DJTB 1IK7A 3G9RA 2CPSA 3IAOA 4H0LC 1USDA 1Y8AA 2P1JA 3SWKA 5L8RJ 1KORA 1RF1C 5AVXB 5E79E 3BASA 4B86A 1PGPA 3V4WA 4RESB 1SFCB 3R2PA 3B8EB 3CCVP 1EXIA 2YNYA 1QL2A
chains in the Genus database with same CATH topology
1FOSF 1ZLLA 2KOGA 2A45G 2H7HA 4DZOA 1J1DC 1JY3N 1LTBC 1IJDB 2OYIA 1H8AA 2HODA 1H89A 3KQGA 2OYIC 1J1EB 1L0LK 2C9LY 4IFMA 3MGNA 4N78E 1EQ7A 5AW3B 2KB7P 4IFFA 4I1LA 3TNUB 3TK1A 1DEBA 1G2CA 4EOTA 3RK3B 2POHA 5APTA 1S9KD 2BASA 2XZRA 1ZR4A 2J58A 2FKWB 2MJZA 4Y99C 2YO2A 1HGZA 5CJ0A 4LLHA 2WT7A 1NH4A 3V4QA 1FZBA 1JY3O 2Z4EA 1IFDA 1M1JA 1NO4A 4XE5B 1M1JC 5AVRB 3VP8A 5KLVK 1SQPK 3GHGA 3MTUE 5BU5A 1SQQK 2C0XA 1CZQA 3KPEA 3GHGC 5CCGA 1NOHA 1JUNA 5CCGC 1S9KE 1HUCA 1HTLC 3H32A 3V2RA 2VRSA 3B5ND 2HPCB 2WSCH 2R32A 4W7YA 3RL0D 5CJ4A 2IX7C 1GU4A 2FXMA 3VMXA 1FZCA 2WSFH 3I5CA 5AW5B 5AW4B 5KJ7C 5CHXA 2A45I 2OYIB 1YTZI 2HODB 1NHLA 3CL3D 2O1KA 1FZCC 1N2DC 2ZFCA 2OARA 1T3JA 1HVVA 3C9IA 3N7NA 5AVTB 1GU5A 1FZEA 2W27A 1RY3A 5CCGD 1OWAA 5BVZA 2KSJA 3M06A 5BU8B 1CI6A 1XTGB 1LTAC 3HD7B 1NKZB 1KILA 1LT9A 3EFGA 1X9VA 4AUWA 1G2CB 2HFED 1IK9A 4C7NA 2NPSD 1IFIA 3B5NB 2OYHA 2W6AA 1E5WA 1RF0A 1RE4A 4HYTB 2GUSA 3VTPC 1FOSE 2Z5IA 2OYHC 4GT1A 3RL0B 1NKNA 1RF0C 4OH8B 1RE4C 5AVVB 3TYYA 2KLVA 3RK2C 5AW7B 3KYQA 4GIFA 1LWUA 3U59A 3HUSB 1GZLA 1LWUC 3LW5H 2WWWA 3P32A 1GL2C 2ZXEB 1KQLA 1KILD 2C9NY 1N73B 1FBMA 1NU1K 1IFJA 3VMZA 2XKMA 2WITA 3H32B 5AVWB 3SWFA 2R3CA 1M7LA 1MUUA 2Q3IA 1A02F 1G1JA 5AW0B 2NPSB 3HE4A 4IFDK 3OA7A 1URQA 5AVSB 1AQ5A 1FZCB 4O9BA 1URQC 3BRVB 2FYUK 3M91A 5AW8B 2P2UA 1J2JB 2Q5UA 2W6BA 1IC2A 1WRGA 2R5DA 3A7OA 1LTJC 1MZ9A 4GKGA 3II6A 1Z56A 3BVHA 3U1CA 2YKOA 1SP4A 1KILB 1L4AA 1LT9B 1YYCA 1FDMA 5AVQB 5KTBA 1IFNA 1L4AC 3V2NA 2I1JA 1FU1A 4EIJA 1RF1B 3L4FA 1VPCA 1IFMA 1URQD 1GW4A 1X8YA 3O8ZA 3VOPA 5CCHA 2Q9IA 3NMDA 3VMYA 3IR9A 5CCHC 3SWYA 2HYNA 2H8PD 1JTHA 1NWQA 2M3BA 5AVZB 3HRNA 4C46A 3VN0A 4XA4A 1SFCA 2R5BA 2GUVA 1X79B 1J1DB 1L4AD 1JCCA 2P7JA 2QM8A 3TSIA 1SQXK 2WPSA 1SFCC 2PP6A 5KJ7A 5APSA 1OXZA 1DX7A 1PFIA 2YMYA 2YO3A 1GK4A 1DH3A 3L35A 1GDTA 2IFMA 5AW2B 3P8MC 1LGHB 3HE4B 3L36A 1VDFA 4I2LC 1KFNA 3UIAA 1YTZT 1KFMA 1J1EC 4DOJA 1ZN5A 1RE3C 2IFNA 4Y99B 4M3LA 1KZUB 2WPQA 2XV5A 5KJ7D 2WSEH 3NTNA 1L4AB 1N7SA 3CLQA 1JY2N 1FZFA 2WT7B 1MFZA 2CPBA 4JYCA 2QM7A 3NFQA 1N7SC 5AVUB 4W80A 3RK3C 3HTKA 4AYCA 1M1JB 5AW9B 5APQA 2N1TA 1H88A 5APVA 3PP5A 3NXSA 3G3ZA 1GL2A 4ZKPA 2KP8A 4LGDE 1HBWA 2N1TC 1T8ZA 3GHGB 4N6JA 2Q7CA 1SLQA 1LTTC 2XNXA 2YKQA 1JTHB 2WPRA 1LTGC 3H6PA 1FZGA 1NTMK 2PAJA 3RK2D 1N7SD 3HE5A 3RK3D 3T97A 3V5BA 1XTCC 4W7ZA 2N9BA 2XU6A 3L37A 3E1IA 3OJAB 1WT6A 2N1TD 1JY2O 2JEEA 3P8CD 4WY4A 1T2KC 1GL2D 1LTJA 3M9BA 4WY4C 4WB4A 5APYA 1CI6B 2O1JA 1MV8A 1T3UA 4AQRD 3V2PA 4WBAA 5APWA 1G1IA 3LIEA 3KDPB 3CI9A 3HD7A 2FYZA 4C7NB 2OYHB 1LTIC 1JCDA 2WTYA 3HD7C 1NTZK 1FZAA 1L0NK 4N3YB 2KYVA 1GW3A 1IO4A 3RK2B 1N7SB 1T2KD 2GM4A 1HWTC 2C0WA 3MD0A 3B5NA 1ZR2A 3P8CE 2LKMA 1N7LA 3HTKB 3M9HA 4LC1A 4WY4D 2FFDA 2H43A 1LWUB 3B5NC 2A45H 2N1TB 3A2AA 5AW6B 2E42A 2FFDC 3A5TA 1SVFA 1GL2B 2HLOA 3OAKA 1GD2E 1SQBK 3RL0C 1A02J 1AFOA 4ZKUA 3N4XA 3HUSA 1HGVA 1GK6A 1SQVK 1QL1A 3IFMA 2HG5D 3HUSC 1HH0A 3LIDA 3HD7D 3V2QA 1N73A 2I1KA 3VP9A 1FJKA 3HE5B 4C7RA 3M9QA 5CCHD 1CSBA 1URQB 1N73C 1JMMA 1JNMA 3U1AA 1JOCA 2NPSA 2Z5HA 5APXA 1FJPA 5APUA 2E43A 4JYBA 1RE3A 4WY4B 1LTJB 1JO5A 2NPSC 3MIWA 3MUDA 1GTWA 1W2EA 1NTKK 2WZ7A 1SFCD 3P7KA 2IPPA 2J59M 3WMM0 3TNUA 3BRTB 1JY2P 4I6MC 5AW1B 1N86A 3EQ2A 4KHXA 4HH2A 1CW5A 1LTSC 3M0DA 2O01H 1HJBA 2CPSA 3M0DC 4JF7A 3M0AA 1ZV8A 1KILC 1LT9C 2P1JA 1RF1A 5AVYB 2FFDB 1RF1C 5AVXB 1FAVA 3BATA 3A3YB 3BASA 4B86A 2L5GB 5CMZA 1NAFA 4N78D 3V4WA 4RESB 2YKPA 1SFCB 3VYIA 2P67A 3R2PA 2XDJA 3B8EB 2HPCA 2M8RA 2YNYA 1JY3P 2JJLA 1QL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3Y B;  5BU5 A;  3BAT A;  2POH A;  3BAS A;  3C9I A;  1NKN A;  3VP9 A;  3N7N A;  3U1C A;  4N78 D;  5BVZ A;  4GIF A;  3HRN A;  3U59 A;  5BU8 B;  5KTB A;  3U1A A;  4ZKU A;  3N4X A;  1X79 B;  4O9B A;  4ZKP A;  3OJA B;  2FXM A;  4I1L A;  1WT6 A;  3VP8 A;  1IC2 A;  2JEE A;  3P8C D; 
#chains in the Genus database with same CATH topology
 1FOS F;  1ZLL A;  3CPW O;  1DEE G;  1JY3 N;  3GF3 A;  1AVO A;  2OYI C;  2C9L Y;  3QWO C;  1AQT A;  1DEB A;  1G2C A;  4EOT A;  2POH A;  1KIL E;  3CC7 P;  3CCM P;  2J58 A;  4Y99 C;  1OW8 A;  5CJ0 A;  4LLH A;  3L70 E;  1NH4 A;  1Q90 D;  2Z4E A;  1Q81 Q;  2W90 A;  3H1H G;  3MTU E;  2LR2 A;  2K9J A;  2JO1 A;  3GHG C;  5CCG A;  3L74 G;  1U7J A;  3CC4 P;  1HTL C;  3H32 A;  3V2R A;  3H1H J;  3W67 A;  3RL0 D;  2IX7 C;  5K5G B;  1FZC A;  2WSF H;  3I5C A;  5AW4 B;  2O01 J;  5CHX A;  2A45 I;  1YTZ I;  1KB9 I;  3AEG C;  2P58 A;  4L76 A;  3N7N A;  3B4S A;  1GU5 A;  3H1K E;  1OWA A;  3H1H D;  5BU8 B;  1CI6 A;  2O01 N;  3CCQ P;  1XTG B;  1LTA C;  2D2C B;  2IDB A;  4NPF X;  1W5C E;  1EC5 A;  3EFG A;  3L74 D;  4AUW A;  1U7M A;  2YIU C;  2OYH A;  3CXH I;  1E5W A;  3FGA D;  3L73 J;  3S1K A;  1NKN A;  1RF0 C;  1VQ4 P;  1PZQ A;  4KJM A;  1M56 D;  1RHZ B;  1KN7 A;  3U59 A;  1PV3 A;  4U3F G;  5CBN A;  4CPG A;  4HB1 A;  2O3J A;  1NU1 J;  3L74 E;  1R5L A;  2WIT A;  5AVW B;  2R3C A;  1EDJ A;  1YBK A;  1MUU A;  1A02 F;  1G1J A;  2RKL A;  4IFD K;  5AVS B;  1URQ A;  2FYU J;  1NU1 D;  3BRV B;  1M57 D;  3AE8 C;  2FBW C;  5AW8 B;  2P2U A;  2IBZ G;  1P84 H;  2W6B A;  1K8A Q;  1IC2 A;  1WRG A;  1DD4 A;  1R8E A;  4U3F D;  1LTJ C;  5CBO A;  3II6 A;  1Z56 A;  1KIL B;  1YYC A;  1IFN A;  1L4A C;  1SQB G;  1KB9 D;  3V2N A;  3L4F A;  1VPC A;  1Q7Y Q;  1X8Y A;  3O8Z A;  2B87 B;  4H44 C;  5CCH A;  2BCC E;  4DJG A;  1P84 E;  2HYN A;  1NWQ A;  3G4S P;  1SQB J;  4U3F E;  2A06 G;  4D6T G;  1SFC A;  5EFW B;  2WPS A;  2PP6 A;  1K9M Q;  1ZME C;  2Q6Q A;  1YHQ P;  1SS1 A;  2YMY A;  2YO3 A;  3F89 A;  1GDT A;  1SQB D;  1VQO P;  3A0B E;  3O6Q B;  1M8O B;  4RO0 A;  4H13 B;  3UIA A;  2H89 C;  1DD3 A;  4GOE A;  2GA1 A;  2IBZ E;  2YXQ B;  3CME P;  4NPD A;  3PHL A;  2QJY B;  1KZU B;  2WSE H;  3NTN A;  2E76 B;  1EDL A;  1N7S A;  2WT7 B;  2CPB A;  2IZ0 A;  3NFQ A;  2E75 C;  2P10 A;  3RK3 C;  5AVU B;  4AYC A;  3HTK A;  1YQ3 C;  2N1T A;  1H88 A;  3F5H A;  2KP8 A;  4LGD E;  1HBW A;  1SQP E;  4A7P A;  4BXL A;  5KLI B;  4DT0 A;  3Q2Y A;  1OX3 A;  2A06 E;  4D6T E;  4PD4 I;  5GTH H;  1L0L G;  2ZXX A;  1MFT A;  2M5A B;  3L37 A;  2V4H A;  1VF5 C;  3P8C D;  1LTJ A;  3CWB J;  3M9B A;  4EDF A;  1L0L J;  2FXO A;  3V2P A;  3LIE A;  4C7N B;  1LNQ A;  3CWB D;  1JCD A;  5GTH E;  2WTY A;  3HD7 C;  4NPE A;  1S5L X;  3H1L J;  1HJ0 A;  2KYV A;  1GW3 A;  3RK2 B;  4BRY A;  1L0L D;  2GM4 A;  1HWT C;  3MD0 A;  2J5U A;  3P8C E;  2LKM A;  4UB6 H;  4ZMD A;  1LWU B;  1FS0 E;  1W2B O;  2FFD C;  1SVF A;  1SQB K;  2KNC B;  3RL0 C;  3N4X A;  3H1L D;  3IFM A;  3Q5R A;  2HG5 D;  3HUS C;  3LID A;  2QVA A;  3CMA P;  3VP9 A;  5CCH D;  2QJP B;  3VMA A;  1ZRT D;  1JMM A;  4UB6 E;  1PPJ D;  5APU A;  1VQP P;  4WY4 B;  1NTK J;  3D6Z A;  2K88 A;  2B89 A;  3BCC J;  1SFC D;  2IPP A;  1NAY A;  2J59 M;  3WMM 0;  3EQ2 A;  3K5B A;  4KHX A;  3ABV C;  5KAI E;  3M0D A;  1NTK D;  1HJB A;  4WWI A;  4PJ0 E;  3A0H H;  3BCC D;  1LT9 C;  4MN4 C;  5AVY B;  1KV4 A;  2QJK C;  3ITK A;  1FAV A;  2B87 A;  1LJ2 A;  2L5G B;  1S2E A;  5CMZ A;  3CCE P;  4N78 D;  1M1K Q;  3AE9 C;  2HPC A;  2M8R A;  1JEK A;  3AE7 C;  4DZO A;  1J1D C;  3A0H E;  1IJD B;  3KQG A;  1J1E B;  1KC8 Q;  4YPC A;  2E5Y A;  1L0L K;  1VQM P;  2QSI A;  4N78 E;  3JCU E;  5M1B A;  3TK1 A;  1BCC E;  1L0N G;  3PH0 A;  5APT A;  1S9K D;  2XZR A;  1FDO A;  1ZR4 A;  1TU3 F;  2WT7 A;  1FZB A;  3WUU A;  4HJG H;  1OVV A;  2OYO A;  4KT0 J;  1NO4 A;  4XE5 B;  4RJT A;  2R44 A;  3VP8 A;  2D2C D;  3KPE A;  5CCG C;  1S9K E;  1HUC A;  3T97 B;  1QEX A;  2VRS A;  1NGM B;  2WSC H;  3MP7 B;  1VQ6 P;  1BSH A;  1EZV E;  2M5A A;  1AJY A;  2OYI B;  2HOD B;  1FZC C;  3CL3 D;  2O1K A;  4OWF A;  2ZYA A;  1N2D C;  3D6Y A;  1RY3 A;  5BVZ A;  1LT9 A;  3L70 G;  1OMI A;  2KK7 A;  1L0N E;  2JWD A;  2ZAE B;  4C7N A;  3E1R A;  1RE4 A;  2GUS A;  2OYH C;  2KLV A;  3L70 J;  1LWU A;  3EWK A;  1GZL A;  1KMI Z;  2WWW A;  3P32 A;  3AE6 C;  1KIL D;  3L75 G;  1IFJ A;  2XKM A;  4ASV A;  3L70 D;  3SWF A;  2W8Z A;  2NPS B;  3HE4 A;  5GTI H;  4L74 A;  3H1K G;  4O9B A;  3CCU P;  1URQ C;  3L75 J;  3M91 A;  5KKZ C;  2WQY C;  1MZ9 A;  3RL0 g;  4GKG A;  1BGY G;  3CCR P;  2YKO A;  3H1K J;  1SP4 A;  1FDM A;  3L75 D;  3C8V A;  5KTB A;  4I7Z B;  3G71 P;  2I1J A;  1FU1 A;  1GW4 A;  2B9B A;  2QIW A;  1UIX A;  5KLV G;  5GTI E;  4H13 D;  4K35 A;  1S3J A;  3VOP A;  2Q9I A;  3NMD A;  3VMY A;  1LP1 A;  3H1K D;  5CCH C;  2WSF J;  1JTH A;  1OW7 A;  1P84 I;  1KYO H;  3VN0 A;  2E76 D;  1R5S A;  2QM8 A;  2P7J A;  3TSI A;  3L75 E;  1SFC C;  1DX7 A;  3L74 J;  4GOD A;  1DH3 A;  1LGH B;  1OIP A;  1FC2 C;  2N9Y B;  3H1J G;  1KFM A;  4DOJ A;  2IBZ I;  4PV1 C;  3AE1 C;  1KYO E;  4U7J A;  1BGY E;  2KSE A;  5KJ7 D;  2XV5 A;  4EI2 A;  3AEF C;  3AE5 C;  1L4A B;  3CLQ A;  3H1J J;  2KXP B;  4JYC A;  1AVY A;  1N7S C;  2BCC G;  2PRR A;  1M1J B;  3G3Z A;  5KLV E;  2N1T C;  1T8Z A;  4Y28 J;  1SQQ E;  2Q7C A;  1LTT C;  1EDI A;  2YKQ A;  3H1J D;  2KS1 B;  1LTG C;  2BCC J;  1Q82 Q;  4U3F J;  3RK2 D;  3HE5 A;  3T97 A;  4W7Z A;  1NYH A;  2N9B A;  1WT6 A;  1JY2 O;  2BCC D;  1P84 D;  3SSU A;  3G6E P;  3H1J E;  4IL6 X;  5APW A;  4TT3 H;  1G1I A;  1VQ7 P;  3L71 G;  2MKV A;  4Z1M H;  2D2C C;  4TLF A;  1FZA A;  1IO4 A;  1SQP G;  1T2K D;  2C0W A;  2Y0D A;  4LC1 A;  4WY4 D;  2H43 A;  2A45 H;  2E42 A;  2IBZ D;  1GL2 B;  1K73 Q;  5KAF H;  2QE7 H;  3CX5 H;  1SQP J;  1QL1 A;  1HH0 A;  3RBZ A;  2JR8 A;  3CCJ P;  3S9O A;  2G8Y A;  2I1K A;  1RH5 B;  4C7R A;  4D6T J;  4K3A A;  2IYP A;  3CXH H;  1SQP D;  2M3E A;  1JOC A;  2NPS A;  5APX A;  1D7M A;  3TDK A;  2ZT9 D;  1DIP A;  1W2E A;  1IFP A;  2A06 D;  3CX5 E;  4D6T D;  5C39 A;  5AW1 B;  1Y9B A;  2FYN B;  1CW5 A;  3JSV C;  3FWN A;  4IOI H;  2E74 B;  3L71 E;  1PGQ A;  2PGD A;  3PRJ A;  3M0D C;  3M0A A;  2JWA A;  1KIL C;  2RMZ A;  2JKV A;  1K05 A;  3AEE C;  5H2F H;  4JBZ A;  1QGK B;  2FFD B;  2HR3 A;  1AV1 A;  1S4X A;  3JC2 2;  2YKP A;  1FE6 A;  2P67 A;  1SQX E;  3KZI H;  3C1L A;  2WMM A;  4H0L D;  2H7H A;  1LTB C;  2ZJS E;  3AED C;  3TF5 A;  4IFM A;  2OGU A;  3MGN A;  5AW3 B;  1VQN P;  4H13 C;  3TNU B;  1VQ8 P;  2K9Y A;  1NTZ G;  1PL5 A;  3KZI E;  2FKW B;  2MJZ A;  1HGZ A;  2Y0E A;  2QJK B;  4QMA A;  2H88 C;  1IFD A;  1M1J A;  2M0B A;  3D70 A;  1SQP K;  1YIT P;  2C0X A;  1CZQ A;  1ZXG A;  1VL2 A;  1JUN A;  5KLI C;  2K1A A;  1L2P A;  3MZW B;  1WMK A;  2YMK A;  2AEF A;  2R32 A;  4W7Y A;  1KQF B;  5CJ4 A;  1GU4 A;  2FXM A;  3EFF K;  5AW5 B;  5KJ7 C;  1NHL A;  1EZV I;  2OAR A;  1HVV A;  2XND H;  1BCC G;  2RH0 A;  1FZE A;  2W27 A;  2KSJ A;  1PGO A;  5B66 H;  1KIL A;  1NTZ E;  1X9V A;  1G2C B;  4OGQ B;  1IK9 A;  4PD4 H;  3AEA C;  2NPS D;  1BCC J;  3B5N B;  4HYT B;  1FOS E;  4GT1 A;  1RE4 C;  5AVV B;  3TYY A;  3RK2 C;  2ZT9 B;  1OW6 A;  4GIF A;  4GOF A;  5TJH A;  1SQV E;  1NTM G;  1LWU C;  3LW5 H;  1BE3 E;  1BCC D;  2QG4 A;  2ZXE B;  1KQL A;  5B66 E;  2R3S A;  2C9N Y;  1N73 B;  1FBM A;  1BSN A;  1FDI A;  3H25 A;  3H32 B;  1EZV G;  4PD4 E;  2G3A A;  3O6Q A;  3OA7 A;  1T6A A;  1FZC B;  2QJP C;  1J2J B;  2UWJ E;  1PP9 G;  1NTM D;  4JPZ B;  1RQU A;  4H0L B;  5AVQ B;  2W6J H;  1RF1 B;  4EIJ A;  1EZV D;  1HF9 A;  1L0N J;  4RKU J;  2V7Q H;  1OVU A;  2WSC J;  1AA0 A;  3B71 A;  3IR9 A;  3KHU A;  1X0T A;  2BEZ F;  3SWY A;  1NTM E;  3H1I G;  1PP9 D;  4XA4 A;  1L0N D;  2R5B A;  2GUV A;  1X79 B;  1L4A D;  1JCC A;  1OFC X;  5KJ7 A;  2I8D A;  5APS A;  1OXZ A;  1PFI A;  2IYO A;  5AW2 B;  3GLM A;  3H1I J;  4ZNC A;  2QEX P;  2KIK A;  1VDF A;  5KKZ B;  1YTZ T;  4WVZ A;  1J1E C;  1PP9 E;  3Q5P A;  1ZN5 A;  1RE3 C;  3H1I D;  4Y99 B;  1S5L H;  1KYO I;  2WPQ A;  2NRG A;  1JY2 N;  2QM7 A;  1GMJ A;  4W80 A;  5AW9 B;  5APQ A;  5APV A;  3PP5 A;  3NXS A;  1OVR A;  1MKM A;  3GHG B;  2KNC A;  3L72 E;  2XNX A;  5B5E H;  4GDO A;  2WPR A;  2Q1K A;  3H1I E;  2SPZ A;  1S5L E;  1NTM K;  2E75 D;  3RK3 D;  3V5B A;  2OTJ P;  2JEE A;  4WY4 A;  1GL2 D;  2FXP A;  3SFD C;  5B5E E;  1T3U A;  4PV1 B;  1YJ9 P;  2YIU B;  3KDP B;  3FXD A;  3PLN A;  2FYZ A;  3RK3 E;  1L0N K;  2LXC B;  4N3Y B;  1BGY J;  1VF5 D;  3E7K A;  3R4Y A;  1N7S B;  1JB0 J;  1SQQ G;  3B5N A;  1N7L A;  3HTK B;  3M9H A;  2N1T B;  1JMB A;  5AW6 B;  1QLE D;  1LT1 A;  1KTM A;  2AXT H;  1GD2 E;  3Q3D A;  4ZKU A;  1KYO D;  5KLV J;  1BGY D;  2KUB A;  1SQQ J;  1E79 H;  1EDK A;  2KI7 B;  2E74 D;  3HD7 D;  5TIS H;  3WU2 H;  3V2Q A;  1N73 A;  3RGU A;  3M9Q A;  1CSB A;  3OW2 O;  3QH9 A;  5KLV D;  1Q2N A;  3U1A A;  1SQQ D;  2Z5H A;  1FJP A;  4L73 A;  1RE3 A;  1LTJ B;  1JO5 A;  2NPS C;  3MUD A;  1GTW A;  2AXT E;  2WZ7 A;  3P7K A;  1JY2 P;  4HH2 A;  3CD6 P;  3CX5 I;  3L73 G;  5TIS E;  3WU2 E;  2WSS H;  2O01 H;  3PJS K;  4H44 B;  4JF7 A;  1ZV8 A;  2KZJ A;  4BRY B;  1RF1 A;  4I7Z C;  3BAT A;  1NU1 G;  3A3Y B;  1H0T B;  2OTK E;  1KD1 Q;  1NAF A;  3VYI A;  1RQV A;  4OVN F;  3H1H E;  2XDJ A;  4R4M A;  2FYU G;  1JY3 P;  2JJL A;  2Y9Z A;  2KLU A;  3L73 D;  3IF4 A;  2KOG A;  2A45 G;  2NZ2 A;  2K3R A;  3I55 P;  1ZP0 C;  2OYI A;  1H8A A;  2HOD A;  1H89 A;  3ZDM A;  4JQ0 D;  1EQ7 A;  1UII A;  3W68 A;  2KB7 P;  4IFF A;  1OZH A;  2DW3 A;  4I1L A;  1VQ5 P;  2E75 B;  3RK3 B;  2BAS A;  2ZVN B;  3L73 E;  1QVG O;  2YO2 A;  2FYU D;  1PIX A;  1KB9 H;  3CCL P;  3AEC C;  3V4Q A;  3L71 J;  4YTP C;  1JY3 O;  3A0B H;  1M1J C;  5AVR B;  1SQX G;  5KLV K;  1NU1 E;  3CX5 D;  2YXR B;  3GHG A;  5BU5 A;  1SQQ K;  1NOH A;  2ZYG A;  3L71 D;  4OGQ D;  2HPC B;  3B5N D;  2JP3 A;  1VF5 B;  2WSE J;  1SQX J;  2FYU E;  3CXH D;  2JDI H;  2BEQ D;  3VMX A;  1KB9 E;  4ASW A;  1IZN B;  4EYY Q;  5KAF E;  2ZFC A;  1T3J A;  2KZI A;  3C9I A;  5AVT B;  1SQX D;  5CCG D;  3M06 A;  2K37 A;  2RN0 A;  1VQL P;  3HD7 B;  1NKZ B;  2HFE D;  3CXH E;  4DCK A;  1IFI A;  2W6A A;  1RF0 A;  3VTP C;  2Z5I A;  3RL0 B;  3USS A;  4OH8 B;  1SQB E;  5AW7 B;  3KYQ A;  3HUS B;  1YIJ P;  1JM0 A;  2AXC A;  1QX8 A;  3IN6 A;  1GL2 C;  1BDC A;  1NU1 K;  2Y9Y A;  3VMZ A;  2WVR A;  2Q3E A;  3CWB G;  1M7L A;  2Q3I A;  5H2F E;  5AW0 B;  1AQ5 A;  2FYU K;  2Q5U A;  1M90 Q;  3AE3 C;  2R5D A;  3A7O A;  1QVF O;  4HKZ H;  2QRX A;  3H1L G;  3BVH A;  2QJY C;  2PFX A;  2ZYD A;  3U1C A;  3TGU G;  1L4A A;  1LT9 B;  2OQQ A;  1S1C X;  2E76 C;  3SFE C;  4YXD C;  2FYN C;  1Q86 Q;  1NTZ J;  1IFM A;  1URQ D;  2E74 C;  1SQV G;  2Y0C A;  4R4L A;  1KQS O;  1VQK P;  1BE3 G;  1PPJ G;  3TGU J;  2L91 A;  4BWN A;  2H8P D;  2M3B A;  4UB8 H;  5AVZ B;  2KS1 A;  1H0T A;  3HRN A;  1VQ9 P;  4C46 A;  1NTZ D;  1SQV J;  1K04 A;  1J1D B;  1BE3 J;  1SQX K;  1YJN P;  1U57 A;  3TGU D;  1BDD A;  1NTK G;  1GK4 A;  3CWB E;  5KAI H;  3L35 A;  1KQG B;  2IFM A;  3BCC G;  3P8M C;  4PJ0 H;  3HE4 B;  3L36 A;  1L0L E;  1SQV D;  3I56 P;  4I2L C;  1KFN A;  2FY8 A;  4IL6 H;  1BE3 D;  2E5T A;  4UB8 E;  3CCS P;  2WPV B;  2IFN A;  3H1L E;  4M3L A;  3LW5 J;  4PD4 D;  1X22 A;  1YQ4 C;  1NVO A;  3TGU E;  1FZF A;  1MFZ A;  3RBX A;  1ZW0 A;  2W83 C;  1GL2 A;  1ZRT E;  3MHV A;  4ZKP A;  4N6J A;  4YXW H;  4IL6 E;  2ZVO B;  2K9J B;  1SLQ A;  1PPJ E;  1LP1 B;  4PV1 D;  1YJW P;  2AEM A;  1PGJ A;  1JTH B;  3JCU H;  3H6P A;  1NTM J;  3AEB C;  1FZG A;  2PAJ A;  1N7S D;  1XTC C;  2LXB A;  3Q1M A;  3CC2 P;  2AEJ A;  2XU6 A;  1NTK E;  3E1I A;  2B88 A;  3OJA B;  2N1T D;  3BCC E;  1T2K C;  2OTL P;  4WY4 C;  3WUV A;  2V7Q J;  3KXD A;  4WB4 A;  5APY A;  4XFJ A;  1CI6 B;  2O1J A;  3AE4 C;  3AE2 C;  1MV8 A;  4AQR D;  3FWL A;  4WBA A;  1N8R Q;  5DJU B;  3FXE A;  3CI9 A;  1NJI Q;  3HD7 A;  1PP9 J;  2OYH B;  1LTI C;  1NTZ K;  3GMA A;  3Q5S A;  3L72 G;  1ZR2 A;  4OGQ C;  4L75 A;  2FFD A;  3B5N C;  3A2A A;  3D71 A;  3A5T A;  1YI2 P;  2HLO A;  3OAK A;  1A02 J;  1AFO A;  3HUS A;  1HGV A;  3S4R A;  2ITA A;  2ZT9 C;  1GK6 A;  1SQV K;  3GF7 A;  3GW6 A;  3L72 J;  2CK3 H;  3WUT A;  4H44 D;  3PTZ A;  3V6I A;  1EXJ A;  1FJK A;  3HE5 B;  1N73 C;  1URQ B;  2QA4 P;  1Y47 A;  1JNM A;  3GG2 A;  3L72 D;  2E43 A;  3FX0 A;  4JYB A;  2IZ1 A;  5E79 H;  3MIW A;  1NTK K;  3MUD C;  1ZOY C;  3TNU A;  1S72 P;  3BRT B;  4I6M C;  1N86 A;  1USE A;  1LTS C;  5DJT B;  1IK7 A;  3G9R A;  2CPS A;  3IAO A;  4H0L C;  1USD A;  1Y8A A;  2P1J A;  3SWK A;  5L8R J;  1KOR A;  1RF1 C;  5AVX B;  5E79 E;  3BAS A;  4B86 A;  1PGP A;  3V4W A;  4RES B;  1SFC B;  3R2P A;  3B8E B;  3CCV P;  1EXI A;  2YNY A;  1QL2 A; 
#chains in the Genus database with same CATH homology
 1FOS F;  1ZLL A;  2KOG A;  2A45 G;  2H7H A;  4DZO A;  1J1D C;  1JY3 N;  1LTB C;  1IJD B;  2OYI A;  1H8A A;  2HOD A;  1H89 A;  3KQG A;  2OYI C;  1J1E B;  1L0L K;  2C9L Y;  4IFM A;  3MGN A;  4N78 E;  1EQ7 A;  5AW3 B;  2KB7 P;  4IFF A;  4I1L A;  3TNU B;  3TK1 A;  1DEB A;  1G2C A;  4EOT A;  3RK3 B;  2POH A;  5APT A;  1S9K D;  2BAS A;  2XZR A;  1ZR4 A;  2J58 A;  2FKW B;  2MJZ A;  4Y99 C;  2YO2 A;  1HGZ A;  5CJ0 A;  4LLH A;  2WT7 A;  1NH4 A;  3V4Q A;  1FZB A;  1JY3 O;  2Z4E A;  1IFD A;  1M1J A;  1NO4 A;  4XE5 B;  1M1J C;  5AVR B;  3VP8 A;  5KLV K;  1SQP K;  3GHG A;  3MTU E;  5BU5 A;  1SQQ K;  2C0X A;  1CZQ A;  3KPE A;  3GHG C;  5CCG A;  1NOH A;  1JUN A;  5CCG C;  1S9K E;  1HUC A;  1HTL C;  3H32 A;  3V2R A;  2VRS A;  3B5N D;  2HPC B;  2WSC H;  2R32 A;  4W7Y A;  3RL0 D;  5CJ4 A;  2IX7 C;  1GU4 A;  2FXM A;  3VMX A;  1FZC A;  2WSF H;  3I5C A;  5AW5 B;  5AW4 B;  5KJ7 C;  5CHX A;  2A45 I;  2OYI B;  1YTZ I;  2HOD B;  1NHL A;  3CL3 D;  2O1K A;  1FZC C;  1N2D C;  2ZFC A;  2OAR A;  1T3J A;  1HVV A;  3C9I A;  3N7N A;  5AVT B;  1GU5 A;  1FZE A;  2W27 A;  1RY3 A;  5CCG D;  1OWA A;  5BVZ A;  2KSJ A;  3M06 A;  5BU8 B;  1CI6 A;  1XTG B;  1LTA C;  3HD7 B;  1NKZ B;  1KIL A;  1LT9 A;  3EFG A;  1X9V A;  4AUW A;  1G2C B;  2HFE D;  1IK9 A;  4C7N A;  2NPS D;  1IFI A;  3B5N B;  2OYH A;  2W6A A;  1E5W A;  1RF0 A;  1RE4 A;  4HYT B;  2GUS A;  3VTP C;  1FOS E;  2Z5I A;  2OYH C;  4GT1 A;  3RL0 B;  1NKN A;  1RF0 C;  4OH8 B;  1RE4 C;  5AVV B;  3TYY A;  2KLV A;  3RK2 C;  5AW7 B;  3KYQ A;  4GIF A;  1LWU A;  3U59 A;  3HUS B;  1GZL A;  1LWU C;  3LW5 H;  2WWW A;  3P32 A;  1GL2 C;  2ZXE B;  1KQL A;  1KIL D;  2C9N Y;  1N73 B;  1FBM A;  1NU1 K;  1IFJ A;  3VMZ A;  2XKM A;  2WIT A;  3H32 B;  5AVW B;  3SWF A;  2R3C A;  1M7L A;  1MUU A;  2Q3I A;  1A02 F;  1G1J A;  5AW0 B;  2NPS B;  3HE4 A;  4IFD K;  3OA7 A;  1URQ A;  5AVS B;  1AQ5 A;  1FZC B;  4O9B A;  1URQ C;  3BRV B;  2FYU K;  3M91 A;  5AW8 B;  2P2U A;  1J2J B;  2Q5U A;  2W6B A;  1IC2 A;  1WRG A;  2R5D A;  3A7O A;  1LTJ C;  1MZ9 A;  4GKG A;  3II6 A;  1Z56 A;  3BVH A;  3U1C A;  2YKO A;  1SP4 A;  1KIL B;  1L4A A;  1LT9 B;  1YYC A;  1FDM A;  5AVQ B;  5KTB A;  1IFN A;  1L4A C;  3V2N A;  2I1J A;  1FU1 A;  4EIJ A;  1RF1 B;  3L4F A;  1VPC A;  1IFM A;  1URQ D;  1GW4 A;  1X8Y A;  3O8Z A;  3VOP A;  5CCH A;  2Q9I A;  3NMD A;  3VMY A;  3IR9 A;  5CCH C;  3SWY A;  2HYN A;  2H8P D;  1JTH A;  1NWQ A;  2M3B A;  5AVZ B;  3HRN A;  4C46 A;  3VN0 A;  4XA4 A;  1SFC A;  2R5B A;  2GUV A;  1X79 B;  1J1D B;  1L4A D;  1JCC A;  2P7J A;  2QM8 A;  3TSI A;  1SQX K;  2WPS A;  1SFC C;  2PP6 A;  5KJ7 A;  5APS A;  1OXZ A;  1DX7 A;  1PFI A;  2YMY A;  2YO3 A;  1GK4 A;  1DH3 A;  3L35 A;  1GDT A;  2IFM A;  5AW2 B;  3P8M C;  1LGH B;  3HE4 B;  3L36 A;  1VDF A;  4I2L C;  1KFN A;  3UIA A;  1YTZ T;  1KFM A;  1J1E C;  4DOJ A;  1ZN5 A;  1RE3 C;  2IFN A;  4Y99 B;  4M3L A;  1KZU B;  2WPQ A;  2XV5 A;  5KJ7 D;  2WSE H;  3NTN A;  1L4A B;  1N7S A;  3CLQ A;  1JY2 N;  1FZF A;  2WT7 B;  1MFZ A;  2CPB A;  4JYC A;  2QM7 A;  3NFQ A;  1N7S C;  5AVU B;  4W80 A;  3RK3 C;  3HTK A;  4AYC A;  1M1J B;  5AW9 B;  5APQ A;  2N1T A;  1H88 A;  5APV A;  3PP5 A;  3NXS A;  3G3Z A;  1GL2 A;  4ZKP A;  2KP8 A;  4LGD E;  1HBW A;  2N1T C;  1T8Z A;  3GHG B;  4N6J A;  2Q7C A;  1SLQ A;  1LTT C;  2XNX A;  2YKQ A;  1JTH B;  2WPR A;  1LTG C;  3H6P A;  1FZG A;  1NTM K;  2PAJ A;  3RK2 D;  1N7S D;  3HE5 A;  3RK3 D;  3T97 A;  3V5B A;  1XTC C;  4W7Z A;  2N9B A;  2XU6 A;  3L37 A;  3E1I A;  3OJA B;  1WT6 A;  2N1T D;  1JY2 O;  2JEE A;  3P8C D;  4WY4 A;  1T2K C;  1GL2 D;  1LTJ A;  3M9B A;  4WY4 C;  4WB4 A;  5APY A;  1CI6 B;  2O1J A;  1MV8 A;  1T3U A;  4AQR D;  3V2P A;  4WBA A;  5APW A;  1G1I A;  3LIE A;  3KDP B;  3CI9 A;  3HD7 A;  2FYZ A;  4C7N B;  2OYH B;  1LTI C;  1JCD A;  2WTY A;  3HD7 C;  1NTZ K;  1FZA A;  1L0N K;  4N3Y B;  2KYV A;  1GW3 A;  1IO4 A;  3RK2 B;  1N7S B;  1T2K D;  2GM4 A;  1HWT C;  2C0W A;  3MD0 A;  3B5N A;  1ZR2 A;  3P8C E;  2LKM A;  1N7L A;  3HTK B;  3M9H A;  4LC1 A;  4WY4 D;  2FFD A;  2H43 A;  1LWU B;  3B5N C;  2A45 H;  2N1T B;  3A2A A;  5AW6 B;  2E42 A;  2FFD C;  3A5T A;  1SVF A;  1GL2 B;  2HLO A;  3OAK A;  1GD2 E;  1SQB K;  3RL0 C;  1A02 J;  1AFO A;  4ZKU A;  3N4X A;  3HUS A;  1HGV A;  1GK6 A;  1SQV K;  1QL1 A;  3IFM A;  2HG5 D;  3HUS C;  1HH0 A;  3LID A;  3HD7 D;  3V2Q A;  1N73 A;  2I1K A;  3VP9 A;  1FJK A;  3HE5 B;  4C7R A;  3M9Q A;  5CCH D;  1CSB A;  1URQ B;  1N73 C;  1JMM A;  1JNM A;  3U1A A;  1JOC A;  2NPS A;  2Z5H A;  5APX A;  1FJP A;  5APU A;  2E43 A;  4JYB A;  1RE3 A;  4WY4 B;  1LTJ B;  1JO5 A;  2NPS C;  3MIW A;  3MUD A;  1GTW A;  1W2E A;  1NTK K;  2WZ7 A;  1SFC D;  3P7K A;  2IPP A;  2J59 M;  3WMM 0;  3TNU A;  3BRT B;  1JY2 P;  4I6M C;  5AW1 B;  1N86 A;  3EQ2 A;  4KHX A;  4HH2 A;  1CW5 A;  1LTS C;  3M0D A;  2O01 H;  1HJB A;  2CPS A;  3M0D C;  4JF7 A;  3M0A A;  1ZV8 A;  1KIL C;  1LT9 C;  2P1J A;  1RF1 A;  5AVY B;  2FFD B;  1RF1 C;  5AVX B;  1FAV A;  3BAT A;  3A3Y B;  3BAS A;  4B86 A;  2L5G B;  5CMZ A;  1NAF A;  4N78 D;  3V4W A;  4RES B;  2YKP A;  1SFC B;  3VYI A;  2P67 A;  3R2P A;  2XDJ A;  3B8E B;  2HPC A;  2M8R A;  2YNY A;  1JY3 P;  2JJL A;  1QL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...