3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
4ZKPA 4O9BA 5BU5A 3HRNA 3VP8A 4N78D 3U59A 3BASA 1X79B 3C9IA 4N3YB 1NKNA 4I1LA 1IC2A 3N7NA 3U1CA 3N4XA 3VP9A 3U1AA 1WT6A 5KTBA 2JEEA 3P8CD 5BU8B 2FXMA 4ZKUA 3BATA 2POHA 5BVZA 3OJAB 4GIFA
chains in the Genus database with same CATH superfamily
3HUSC 1JEKA 4IFMA 3RK2D 2IZ1A 4OGQB 1SP4A 1SQPE 3L70G 1NTKG 1ZRTE 1FDOA 4JF7A 1LTTC 4L76A 1NWQA 1Q7YQ 4XE5B 2XKMA 3L70E 4H13C 2BASA 4W7YA 2KP8A 5M1BA 3B5NC 1NTKE 3FXDA 5KAFE 3GLMA 2YXRB 1PPJG 3L74D 3H1KD 1DIPA 3TK1A 4H0LC 1G1JA 2IBZD 1KFNA 1K73Q 4PD4H 3H1JE 1VPCA 1L0LJ 5KLIC 4DZOA 3H1ID 3WU2E 1NH4A 1S2EA 1PPJE 2KLUA 1YJNP 1DX7A 4W80A 1X0TA 1R8EA 1NTMG 1PFIA 4R4MA 3PHLA 4TT3H 1EZVG 3CXHI 4IFDK 4JPZB 1SLQA 2IYPA 3BVHA 4U3FJ 1NTME 2H8PD 1N73A 2RH0A 1EZVE 2ZYGA 3BCCJ 4OGQD 1SQQJ 1FOSE 2B88A 1QL2A 2I8DA 3CCVP 3M91A 5KLVK 3H1HG 2ZYDA 4D6TJ 1R5SA 1USDA 3L75J 1PGOA 1GL2A 3H1HE 1OZHA 1BDDA 3A3YB 2FYUG 3BASA 1KQGB 3LIEA 1GK6A 2IX7C 2IYOA 3H1LJ 1IZNB 2FYUE 1PV3A 3CWBJ 2E74C 2V7QJ 5APUA 3TNUA 3S9OA 1KB9I 5GTIE 3WUTA 1J1DC 2HR3A 1RF0C 4GIFA 1ZW0A 3TGUD 2FFDA 4RO0A 1DEBA 4DT0A 3PP5A 1GW4A 1T2KC 2LKMA 2FXMA 1VQ7P 1IK9A 1QX8A 1X9VA 1AV1A 1M1JB 4I6MC 1QL1A 4WWIA 1L0LG 3CCJP 3HE5A 2N1TC 3T97A 2O1JA 1BCCJ 3Q5PA 2XU6A 3KZIE 1N7SA 5BU5A 1Y8AA 1OIPA 2YIUB 3E1RA 4U3FG 1FJKA 5AW6B 3JSVC 1NOHA 1YIJP 1EQ7A 3CX5E 3BCCG 3G71P 3H25A 1SQQG 2IFMA 1LP1B 4D6TG 3CCUP 3SFDC 5B5EE 3L75G 4BWNA 1SQQE 2LR2A 1NVOA 5CCGA 3EQ2A 3C1LA 4PD4D 3RBZA 2K1AA 4D6TE 3FXEA 3I55P 3L75E 1G2CB 3MD0A 1T6AA 1JO5A 3H1LG 1IFNA 5AVQB 1IFIA 2O01J 1KZUB 2BEZF 3AEBC 1S4XA 3IR9A 1OW6A 1P84E 2Y9YA 1WT6A 3CWBG 1EDKA 1EZVI 1IFJA 2JEEA 2IPPA 2POHA 3D71A 3H1LE 2ZT9C 4YTPC 3CCLP 5CJ4A 5KAIH 3CWBE 4ZNCA 1N73C 3HE4B 1KILC 1LJ2A 3CXHH 4WY4A 1YJ9P 2NPSA 4GOFA 2E76B 1IK7A 1FU1A 1NYHA 3GHGA 2AXTH 1NTZK 1JY3P 1LWUC 1GU5A 1GL2C 2P1JA 1LT1A 1JNMA 1ZLLA 2YKQA 1J1EC 2HYNA 1RQVA 1FDMA 2XZRA 1L0NJ 5BVZA 3OJAB 4PJ0H 4GKGA 3V2NA 5TISH 1AA0A 2YNYA 1VL2A 3L71D 1AVOA 2AXCA 3A0BH 3H1KJ 2OARA 1BCCG 2L91A 2VRSA 5BU8B 2C9NY 2KXPB 2XV5A 3II6A 1UIXA 2Q3EA 3H1IJ 1X22A 2V4HA 1BCCE 1QEXA 2SPZA 3LIDA 1NKZB 1KB9H 3Q5RA 1BSNA 5EFWB 3H32A 1JY3N 4QMAA 2QJKB 3MGNA 2E76D 1KILE 2WSFJ 2FFDC 2WQYC 1LTSC 5KKZC 1VQ6P 1HJBA 2WTYA 1UIIA 3CL3D 2W6BA 2ZXXA 3AEEC 2Q9IA 4HJGH 2K9YA 2ZVOB 2NZ2A 2KNCA 1EXIA 2KIKA 3CXHE 1GL2B 2IZ0A 3VP8A 3AE8C 3CX5I 2J5UA 3L72D 5AW4B 1SVFA 2OQQA 1JTHA 2KS1A 1IO4A 2HPCB 2YMYA 5KLVD 2OYIA 3IF4A 1LT9B 3QH9A 1YYCA 3ABVC 4I1LA 3RL0C 5APYA 3N4XA 4IFFA 1SFCA 4LC1A 5GTHH 2KLVA 1BE3E 4H44B 5AVXB 5KAFH 2K9JA 5CCGC 1P84I 1RF1B 4HKZH 3TGUJ 3WU2H 4EDFA 2O01N 1W2EA 2JWAA 2QJPC 4I7ZC 1VF5B 1RF0A 3MTUE 1L4AA 3NTNA 2ZAEB 1IFDA 1L0NE 2FYNC 3L74G 1GL2D 3AE6C 5AW3B 3H1KG 3H6PA 4UB6E 1PGPA 2IBZG 3R4YA 2YXQB 1EC5A 1H0TA 3AE4C 1ZXGA 3RBXA 2QRXA 2C0WA 1NAYA 1J2JB 3H1IG 4Y28J 1VQ8P 2R5DA 3MIWA 1NJIQ 3VMZA 3H1KE 2Q6QA 2IBZE 3R2PA 4WY4C 1JY2O 5CCHD 2NPSC 1GZLA 1U7MA 3HD7A 3SSUA 3T97B 1HBWA 2ZVNB 3H1IE 3M0AA 3HRNA 2FXPA 4NPDA 2WPQA 3GHGC 3VN0A 1N7SB 2N1TA 5K5GB 1Y9BA 2WITA 1VQNP 4GOEA 4BXLA 3CPWO 2KSEA 4H44D 2KZIA 3MP7B 4TLFA 2C9LY 5CJ0A 3QWOC 1SQVE 3IFMA 4I2LC 2HG5D 4BRYA 1SQBD 1FZCA 1S5LX 5AVRB 1ZR2A 3Q2YA 1KYOD 1VF5D 3JCUH 3AE5C 3A5TA 2I1JA 4JQ0D 5GTIH 4K3AA 3USSA 3V6IA 5GTHE 1OFCX 2RN0A 4GDOA 1FBMA 1RY3A 3Q5SA 2KOGA 2QA4P 1K8AQ 4EI2A 2WSEJ 1H88A 1N7SD 4IL6X 1GDTA 1JUNA 2IFNA 1RH5B 1K9MQ 3TYYA 1PIXA 3TGUG 3K5BA 2KSJA 4GT1A 4HB1A 4PV1B 2H88C 1KILA 3MUDA 1RE4A 3P8MC 4RJTA 3KZIH 1QGKB 3SWYA 1LTJA 3AEDC 1A02J 2YO2A 2B89A 1LWUA 3HUSB 1KD1Q 2G3AA 4C7RA 3KHUA 1LTBC 1FC2C 3CX5H 3B4SA 1ZRTD 3U59A 3L71J 2OYIC 3PLNA 1NTZD 5B5EH 2Z4EA 4H13B 1SFCC 5KJ7C 3B5NB 1Q2NA 1URQA 3D70A 4WB4A 1NGMB 3H1JD 3JCUE 3O8ZA 4H0LB 5APQA 3CC2P 3V5BA 5KLIB 3H32B 1E5WA 2HODB 2P58A 1P84H 4PV1D 1VQ4P 4WBAA 1L4AC 4M3LA 3M9HA 3RK3C 1EDIA 2IBZI 3W68A 1HUCA 2OYHA 1YJWP 3L4FA 1MZ9A 4L75A 3TF5A 2V7QH 3CC4P 1M7LA 1USEA 3VMXA 4DJGA 4ZKPA 3PJSK 3F5HA 1VDFA 1FOSF 1FS0E 3O6QB 3HD7C 1NU1D 5AVTB 1SQBK 4UB8E 3ZDMA 5APXA 4H13D 2QEXP 3VOPA 2AEJA 3RGUA 1L0LE 1PP9D 3B5ND 3KDPB 5AW2B 5KLVJ 2HFED 1VQKP 2WMMA 2JWDA 4H0LD 1U57A 4NPEA 4C46A 1HGVA 2FBWC 2FYUD 1FZCC 2B87B 5AW5B 3B8EB 3P8CD 2J58A 4ASVA 4RESB 1NAFA 1L2PA 4U3FE 1HF9A 1GK4A 1IFMA 2E74B 4ZMDA 1OVVA 3ITKA 2D2CC 3BCCE 2M8RA 3RK3E 1BSHA 1MUUA 1SQXK 2WZ7A 1J1DB 2QE7H 2PRRA 2M5AB 5CBOA 3CLQA 3L71G 3HTKB 2YKPA 1MKMA 1KQFB 2IDBA 2WT7B 3L71E 3TSIA 3AE1C 2A45G 3W67A 3I56P 4JYCA 2M3BA 2RKLA 3FWNA 3RL0g 2JKVA 1SQPK 5CMZA 2QSIA 1LTAC 3KXDA 3MUDC 2W27A 2N1TB 5APTA 1CI6B 1NHLA 1RE4C 4XFJA 1LTJC 2O01H 2AEFA 2E74D 1SQBJ 4BRYB 1GMJA 1EDLA 4Y99C 1VQOP 4EIJA 1YBKA 1ZR4A 1FAVA 2WPRA 3A0HH 1X8YA 3V4WA 3L72G 1VQLP 3M06A 2P2UA 2MJZA 1EXJA 2H43A 3I5CA 1M8OB 1URQC 1T2KD 3G9RA 3L74J 1CZQA 1ZV8A 3EWKA 2MKVA 2WSSH 4C7NA 5KLVG 4ZKUA 3KYQA 2E75C 4OVNF 1DD3A 3Q3DA 1S1CX 3EFGA 2WSCJ 1SS1A 3M0DA 2ITAA 1HWTC 1YQ4C 2A06D 1IC2A 4EYYQ 5KLVE 2ZYAA 2KK7A 3CC7P 4UB6H 2N1TD 5AVYB 3BATA 1NU1K 2Q1KA 2OYHC 2ZT9B 3WMM0 1KC8Q 1N73B 1KILB 3RK2C 1LGHB 1YHQP 3GMAA 1KORA 1HVVA 2KZJA 4YXDC 2W6AA 1FJPA 1HH0A 2FYUK 1S3JA 3GG2A 1LWUB 2FXOA 3NXSA 2W90A 3AEAC 4N78D 2YO3A 4N3YB 1K05A 2WSFH 4KHXA 1PGJA 2OGUA 1J1EB 1PL5A 1S9KE 1M1JA 1S5LE 4KT0J 1YITP 5CBNA 1NTZJ 2HLOA 1MFZA 1RHZB 3LW5J 1BGYD 5AW0B 5AVSB 3L73D 2WPVB 3H1JJ 1JY3O 1M1KQ 3PH0A 1Q86Q 3U1AA 1HTLC 3A0HE 1D7MA 5APWA 3TNUB 5KJ7A 4WVZA 3S1KA 1QVGO 1SQBG 2ZT9D 2GM4A 3PRJA 2QM8A 1DH3A 1KILD 3L37A 4OGQC 3P7KA 1OWAA 1SQBE 2YMKA 1T3UA 2FFDB 2C0XA 5TJHA 1FDIA 5KKZB 4AYCA 1KYOE 2A45I 2GUSA 3AE3C 3B71A 1KTMA 1NU1J 2I1KA 2RMZA 3CXHD 3AE2C 3L74E 2K88A 3HE5B 2O3JA 3CCSP 3BRTB 1PP9J 1CSBA 2XNXA 1KN7A 1HJ0A 2LXCB 3CMAP 2Y9ZA 1T3JA 2CPBA 1OX3A 3CCQP 1OVUA 2P7JA 3AE9C 4LLHA 3HE4A 2M3EA 1BE3D 3RL0B 1OVRA 4L73A 1VQPP 5B66E 3WUVA 1M56D 1Y47A 1JMMA 1JB0J 2O1KA 1NTZG 2QJPB 4I7ZB 5AVWB 1E79H 3JC22 3NMDA 4N6JA 1L0ND 3M0DC 1KB9D 3L36A 2M0BA 3V2PA 1AQ5A 3H1JG 2FYNB 3CCRP 5E79E 1NTZE 3FGAD 4NPFX 2BCCD 1SQXD 2R3SA 4ASWA 1ZP0C 1JCDA 4JBZA 1WRGA 2Q3IA 3F89A 4WY4B 2NPSB 4UB8H 3GW6A 2LXBA 3GHGB 1IFPA 4L74A 3NFQA 3AEFC 3RL0D 2AEMA 1SQVD 2K3RA 2GA1A 3WUUA 1GU4A 3TGUE 1YTZT 4K35A 1IJDB 1DD4A 3GF3A 5DJTB 2WSEH 5CCGD 2WVRA 5AVUB 2QG4A 1SQPD 1M1JC 2DW3A 1NU1G 3IAOA 1PGQA 2Q7CA 2P67A 5AW1B 2JP3A 2YKOA 1QVFO 2Z5HA 3CI9A 4R4LA 4U7JA 3L70D 1Q81Q 1PP9G 2CK3H 2QJYC 2G8YA 2BEQD 1NTKD 1NU1E 3V2RA 5APSA 1Z56A 1U7JA 2GUVA 4C7NB 3L35A 5DJUB 3SWKA 1EDJA 1PP9E 3G6EP 2YIUC 1M90Q 1NKNA 2JR8A 1KYOI 1PPJD 1FE6A 1OW8A 2HPCA 2QIWA 5CCHA 1VQ5P 4WY4D 1TU3F 2NPSD 1LT9A 2R3CA 3P8CE 2FYZA 1ZOYC 2WPSA 2OYOA 2OTKE 2L5GB 3U1CA 2XNDH 1NTMD 1OMIA 2A45H 1EZVD 1RF1A 3VYIA 1S72P 2KUBA 4PD4E 3G4SP 2KNCB 2ZXEB 3SFEC 3G3ZA 2PP6A 2JO1A 2Y0EA 3L72J 1YQ3C 1W2BO 1LNQA 2XDJA 4DCKA 3H1HD 1VQ9P 3SWFA 1LTGC 1JTHB 2KS1B 1FZGA 1VQMP 1BGYJ 3L73J 2OYIB 2PAJA 3CCEP 3D6YA 2FKWB 2QJYB 2W83C 2E76C 1GTWA 3OAKA 2K37A 5AVZB 1SFCB 3KPEA 1L0NK 5AW9B 1FZBA 2K9JB 1YI2P 3N7NA 1XTCC 1OW7A 3Q1MA 4B86A 3AEGC 3UIAA 1RQUA 1Q82Q 1L4AB 2OTJP 5APVA 4EOTA 4GODA 3RK3B 1H0TB 1WMKA 1AFOA 1SQVK 3A7OA 4RKUJ 3VTPC 1LTIC 1KV4A 2A06G 2ZJSE 2H89C 3MHVA 3EFFK 3FX0A 1RE3A 3HD7B 2H7HA 3VP9A 1L0LD 1OXZA 2PGDA 2QJKC 2W8ZA 2A06E 3C8VA 1SFCD 1PZQA 5KJ7D 4YPCA 1DEEG 3VMYA 3E1IA 1FZFA 1MV8A 1S5LH 1NTKK 3S4RA 1N8RQ 1K04A 2WWWA 1BE3J 1GW3A 3CX5D 1FZCB 1XTGB 4U3FD 2N9YB 1N2DC 4AUWA 1L4AD 1Q90D 3BCCD 1SQQD 3RK3D 4Z1MH 3AE7C 2D2CB 1QLED 2FY8A 3CMEP 5H2FH 4D6TD 4N78E 2E5TA 3HUSA 3OA7A 3L75D 4W7ZA 1HGZA 3L72E 2Y0DA 2CPSA 1A02F 1BGYG 2NRGA 3L73G 2E43A 1NTMK 4HH2A 2KB7P 5CCHC 2QVAA 1P84D 4IL6H 3TDKA 3HD7D 2BCCJ 1KYOH 1LT9C 3AECC 1H89A 1BGYE 1SQXJ 3L73E 3H1LD 2R32A 4XA4A 4H44C 3B5NA 4PD4I 2Y0CA 4MN4C 3CWBD 2B9BA 3M9QA 4CPGA 1G1IA 3IN6A 3A2AA 1RF1C 3FWLA 1JY2P 2JDIH 2ZFCA 2UWJE 1SQVJ 3PTZA 2HODA 2J59M 1VF5C 2WSCH 1T8ZA 2W6JH 3OW2O 1LTJB 2PFXA 4HYTB 2R44A 2KYVA 1SQPJ 3VMAA 3V2QA 3V4QA 1JMBA 2D2CD 2P10A 4Y99B 4DOJA 3CCMP 3L70J 5KAIE 4AQRD 1NTKJ 3O6QA 1ZN5A 1N7LA 3E7KA 1N86A 1KMIZ 4JYBA 5B66H 1AVYA 1URQB 1N7SC 2Q5UA 2AXTE 1AJYA 1BDCA 3D6ZA 2E75B 4KJMA 1BCCD 1JY2N 1NO4A 1BE3G 3P32A 5CHXA 1CW5A 5H2FE 1GD2E 5AVVB 1KQLA 4A7PA 2E42A 2KI7B 2B87A 3C9IA 1JOCA 5E79H 4PJ0E 1ZMEC 1JCCA 1KFMA 5TISE 4LGDE 3LW5H 3CD6P 1NTMJ 4OH8B 2OYHB 1H8AA 4IL6E 3A0BE 2JJLA 1LP1A 1L0LK 1KQSO 4IOIH 4YXWH 3RK2B 3M9BA 1L0NG 1M57D 2OTLP 1FZAA 2M5AA 1R5LA 1RE3C 3HTKA 1G2CA 4OWFA 3H1HJ 3KQGA 5C39A 2BCCG 1KB9E 1YTZI 1SQXG 2WT7A 2Z5IA 5AW7B 1S9KD 3GF7A 5L8RJ 2QM7A 1X79B 1URQD 1SQQK 2E5YA 2BCCE 5AW8B 5KTBA 1SQXE 2FYUJ 2E75D 2N9BA 1JM0A 4O9BA 4PV1C 1SQVG 1AQTA 3MZWB 2R5BA 1CI6A 1MFTA 1W5CE 1SQPG 1FZEA 3BRVB
chains in the Genus database with same CATH topology
3HUSC 3P8CE 4IFMA 1GL2B 3RK2D 3VP8A 2FYZA 1SP4A 1SQPK 2WPSA 5CMZA 2L5GB 3U1CA 5AW4B 1LTAC 2W27A 2N1TB 4JF7A 1SVFA 1JTHA 1LTTC 5APTA 1CI6B 1NWQA 1NHLA 2A45H 4XE5B 1RE4C 1RF1A 2XKMA 3VYIA 1IO4A 2HPCB 2YMYA 2BASA 1LTJC 4W7YA 2KP8A 2O01H 3B5NC 2OYIA 1LT9B 1YYCA 2ZXEB 3G3ZA 2PP6A 4I1LA 3TK1A 3RL0C 1G1JA 5APYA 3N4XA 4IFFA 4Y99C 1KFNA 1SFCA 4LC1A 2KLVA 1VPCA 2XDJA 5AVXB 4DZOA 4EIJA 1NH4A 1ZR4A 1FAVA 3SWFA 1LTGC 5CCGC 1JTHB 2WPRA 1FZGA 1X8YA 3V4WA 1RF1B 1DX7A 4W80A 3M06A 2P2UA 2MJZA 1PFIA 2H43A 3I5CA 2OYIB 1W2EA 2PAJA 1URQC 1T2KD 4IFDK 2FKWB 1CZQA 1RF0A 1SLQA 1ZV8A 3MTUE 3BVHA 1L4AA 1GTWA 3NTNA 4C7NA 4ZKUA 3OAKA 3KYQA 5AVZB 1SFCB 3KPEA 1IFDA 2H8PD 1N73A 1L0NK 5AW9B 1GL2D 3EFGA 3H6PA 5AW3B 1FZBA 3M0DA 1FOSE 1HWTC 1QL2A 3M91A 1IC2A 2C0WA 5KLVK 3N7NA 1J2JB 1XTCC 2N1TD 2R5DA 5AVYB 3MIWA 3VMZA 4B86A 3BATA 3UIAA 3R2PA 1GL2A 1JY2O 1NU1K 4WY4C 2OYHC 3WMM0 2NPSC 5CCHD 1L4AB 1GZLA 3HD7A 5APVA 4EOTA 1HBWA 3RK3B 3M0AA 3HRNA 3A3YB 2WPQA 1N73B 3BASA 1KILB 3RK2C 3GHGC 3VN0A 1N7SB 2N1TA 1LGHB 2WITA 3LIEA 1GK6A 2IX7C 1HVVA 1AFOA 2C9LY 5CJ0A 1SQVK 2W6AA 3A7OA 1FJPA 1HH0A 3IFMA 3VTPC 2FYUK 4I2LC 1LTIC 2HG5D 1LWUB 1FZCA 3NXSA 5APUA 4N78D 5AVRB 2YO3A 1RE3A 1ZR2A 3HD7B 4N3YB 3TNUA 2WSFH 2H7HA 4KHXA 3VP9A 1J1EB 1OXZA 1S9KE 1M1JA 3A5TA 1SFCD 1J1DC 2I1JA 5KJ7D 2HLOA 1MFZA 1RF0C 3VMYA 3E1IA 4GIFA 1FZFA 1MV8A 5AW0B 1NTKK 5AVSB 2WWWA 1GW3A 2FFDA 1DEBA 1FZCB 1JY3O 1XTGB 3PP5A 1GW4A 3U1AA 2LKMA 1T2KC 1HTLC 1FBMA 3TNUB 5APWA 5KJ7A 1RY3A 2FXMA 2KOGA 1IK9A 1N2DC 1X9VA 4AUWA 2GM4A 1M1JB 1L4AD 2QM8A 4I6MC 3RK3D 1QL1A 1DH3A 1H88A 1KILD 3L37A 1N7SD 3P7KA 1OWAA 1GDTA 3HE5A 1JUNA 4N78E 1T3UA 2IFNA 3HUSA 3OA7A 4W7ZA 1HGZA 2N1TC 3TYYA 2FFDB 2C0XA 3T97A 2CPSA 2O1JA 4AYCA 1A02F 2KSJA 2A45I 2GUSA 4GT1A 2E43A 1NTMK 4HH2A 2KB7P 1KILA 5CCHC 2XU6A 5BU5A 1N7SA 3MUDA 3HD7D 1FJKA 1LT9C 1H89A 5AW6B 1NOHA 1RE4A 3P8MC 3SWYA 1EQ7A 1LTJA 2R32A 2I1KA 4XA4A 3B5NA 1A02J 2YO2A 1LWUA 3HE5B 3HUSB 3BRTB 2IFMA 3M9QA 4C7RA 1G1IA 1LTBC 3A2AA 1CSBA 1RF1C 2XNXA 3U59A 1JY2P 2ZFCA 2OYIC 1T3JA 5CCGA 2HODA 2CPBA 3EQ2A 2J59M 2WSCH 1T8ZA 2P7JA 2Z4EA 1LTJB 1SFCC 4HYTB 5KJ7C 4LLHA 3B5NB 1G2CB 2KYVA 3HE4A 1URQA 3MD0A 3V2QA 3V4QA 4WB4A 1JO5A 1IFNA 5AVQB 1IFIA 3O8ZA 1KZUB 3RL0B 5APQA 3IR9A 4Y99B 3V5BA 1WT6A 1IFJA 2JEEA 4DOJA 3H32B 2IPPA 2POHA 1E5WA 2HODB 4AQRD 1ZN5A 4WBAA 1L4AC 4M3LA 1N7LA 3M9HA 5CJ4A 3RK3C 1N86A 1JMMA 4JYBA 2O1KA 1N73C 3HE4B 1KILC 1URQB 1N7SC 2Q5UA 1HUCA 4WY4A 5AVWB 2OYHA 3NMDA 4N6JA 2NPSA 3M0DC 3L4FA 1MZ9A 3L36A 1FU1A 1JY2N 1NO4A 3P32A 3V2PA 1AQ5A 3GHGA 1M7LA 5CHXA 1CW5A 3VMXA 1NTZK 1JY3P 4ZKPA 1LWUC 1VDFA 1GD2E 5AVVB 1KQLA 1GU5A 1FOSF 2E42A 1GL2C 2P1JA 3C9IA 1JNMA 1JOCA 3HD7C 1ZLLA 1JCDA 2YKQA 5AVTB 1SQBK 1WRGA 5APXA 2Q3IA 1JCCA 1J1EC 1KFMA 4LGDE 3LW5H 2HYNA 1FDMA 2XZRA 4OH8B 4WY4B 5BVZA 2OYHB 1H8AA 3OJAB 3VOPA 2JJLA 2NPSB 1L0LK 3B5ND 3KDPB 4GKGA 3V2NA 2YNYA 5AW2B 2HFED 3RK2B 3GHGB 3M9BA 3NFQA 3RL0D 4C46A 1HGVA 1GU4A 2OARA 1FZAA 1YTZT 1FZCC 2VRSA 5AW5B 3B8EB 1RE3C 1IJDB 3P8CD 3HTKA 5BU8B 2J58A 2C9NY 1G2CA 1NAFA 2WSEH 4RESB 5CCGD 3KQGA 2XV5A 3II6A 5AVUB 1YTZI 1M1JC 1GK4A 2WT7A 1IFMA 2Z5IA 5AW7B 1S9KD 2QM7A 1X79B 3LIDA 1URQD 2P67A 5AW1B 2Q7CA 2YKOA 1NKZB 2Z5HA 3CI9A 2M8RA 1SQQK 3H32A 1JY3N 1MUUA 3MGNA 5AW8B 5KTBA 1SQXK 2WZ7A 1J1DB 2FFDC 3V2RA 5APSA 1LTSC 1Z56A 3CLQA 2N9BA 2GUVA 4C7NB 3HTKB 3L35A 2YKPA 4O9BA 1HJBA 1LT9A 2WTYA 2R5BA 1NKNA 3CL3D 1CI6A 2W6BA 2WT7B 3TSIA 2HPCA 2Q9IA 5CCHA 1FZEA 2A45G 4WY4D 4JYCA 2NPSD 2M3BA 3BRVB 2R3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZKP A;  4O9B A;  5BU5 A;  3HRN A;  3VP8 A;  4N78 D;  3U59 A;  3BAS A;  1X79 B;  3C9I A;  4N3Y B;  1NKN A;  4I1L A;  1IC2 A;  3N7N A;  3U1C A;  3N4X A;  3VP9 A;  3U1A A;  1WT6 A;  5KTB A;  2JEE A;  3P8C D;  5BU8 B;  2FXM A;  4ZKU A;  3BAT A;  2POH A;  5BVZ A;  3OJA B;  4GIF A; 
#chains in the Genus database with same CATH topology
 3HUS C;  1JEK A;  4IFM A;  3RK2 D;  2IZ1 A;  4OGQ B;  1SP4 A;  1SQP E;  3L70 G;  1NTK G;  1ZRT E;  1FDO A;  4JF7 A;  1LTT C;  4L76 A;  1NWQ A;  1Q7Y Q;  4XE5 B;  2XKM A;  3L70 E;  4H13 C;  2BAS A;  4W7Y A;  2KP8 A;  5M1B A;  3B5N C;  1NTK E;  3FXD A;  5KAF E;  3GLM A;  2YXR B;  1PPJ G;  3L74 D;  3H1K D;  1DIP A;  3TK1 A;  4H0L C;  1G1J A;  2IBZ D;  1KFN A;  1K73 Q;  4PD4 H;  3H1J E;  1VPC A;  1L0L J;  5KLI C;  4DZO A;  3H1I D;  3WU2 E;  1NH4 A;  1S2E A;  1PPJ E;  2KLU A;  1YJN P;  1DX7 A;  4W80 A;  1X0T A;  1R8E A;  1NTM G;  1PFI A;  4R4M A;  3PHL A;  4TT3 H;  1EZV G;  3CXH I;  4IFD K;  4JPZ B;  1SLQ A;  2IYP A;  3BVH A;  4U3F J;  1NTM E;  2H8P D;  1N73 A;  2RH0 A;  1EZV E;  2ZYG A;  3BCC J;  4OGQ D;  1SQQ J;  1FOS E;  2B88 A;  1QL2 A;  2I8D A;  3CCV P;  3M91 A;  5KLV K;  3H1H G;  2ZYD A;  4D6T J;  1R5S A;  1USD A;  3L75 J;  1PGO A;  1GL2 A;  3H1H E;  1OZH A;  1BDD A;  3A3Y B;  2FYU G;  3BAS A;  1KQG B;  3LIE A;  1GK6 A;  2IX7 C;  2IYO A;  3H1L J;  1IZN B;  2FYU E;  1PV3 A;  3CWB J;  2E74 C;  2V7Q J;  5APU A;  3TNU A;  3S9O A;  1KB9 I;  5GTI E;  3WUT A;  1J1D C;  2HR3 A;  1RF0 C;  4GIF A;  1ZW0 A;  3TGU D;  2FFD A;  4RO0 A;  1DEB A;  4DT0 A;  3PP5 A;  1GW4 A;  1T2K C;  2LKM A;  2FXM A;  1VQ7 P;  1IK9 A;  1QX8 A;  1X9V A;  1AV1 A;  1M1J B;  4I6M C;  1QL1 A;  4WWI A;  1L0L G;  3CCJ P;  3HE5 A;  2N1T C;  3T97 A;  2O1J A;  1BCC J;  3Q5P A;  2XU6 A;  3KZI E;  1N7S A;  5BU5 A;  1Y8A A;  1OIP A;  2YIU B;  3E1R A;  4U3F G;  1FJK A;  5AW6 B;  3JSV C;  1NOH A;  1YIJ P;  1EQ7 A;  3CX5 E;  3BCC G;  3G71 P;  3H25 A;  1SQQ G;  2IFM A;  1LP1 B;  4D6T G;  3CCU P;  3SFD C;  5B5E E;  3L75 G;  4BWN A;  1SQQ E;  2LR2 A;  1NVO A;  5CCG A;  3EQ2 A;  3C1L A;  4PD4 D;  3RBZ A;  2K1A A;  4D6T E;  3FXE A;  3I55 P;  3L75 E;  1G2C B;  3MD0 A;  1T6A A;  1JO5 A;  3H1L G;  1IFN A;  5AVQ B;  1IFI A;  2O01 J;  1KZU B;  2BEZ F;  3AEB C;  1S4X A;  3IR9 A;  1OW6 A;  1P84 E;  2Y9Y A;  1WT6 A;  3CWB G;  1EDK A;  1EZV I;  1IFJ A;  2JEE A;  2IPP A;  2POH A;  3D71 A;  3H1L E;  2ZT9 C;  4YTP C;  3CCL P;  5CJ4 A;  5KAI H;  3CWB E;  4ZNC A;  1N73 C;  3HE4 B;  1KIL C;  1LJ2 A;  3CXH H;  4WY4 A;  1YJ9 P;  2NPS A;  4GOF A;  2E76 B;  1IK7 A;  1FU1 A;  1NYH A;  3GHG A;  2AXT H;  1NTZ K;  1JY3 P;  1LWU C;  1GU5 A;  1GL2 C;  2P1J A;  1LT1 A;  1JNM A;  1ZLL A;  2YKQ A;  1J1E C;  2HYN A;  1RQV A;  1FDM A;  2XZR A;  1L0N J;  5BVZ A;  3OJA B;  4PJ0 H;  4GKG A;  3V2N A;  5TIS H;  1AA0 A;  2YNY A;  1VL2 A;  3L71 D;  1AVO A;  2AXC A;  3A0B H;  3H1K J;  2OAR A;  1BCC G;  2L91 A;  2VRS A;  5BU8 B;  2C9N Y;  2KXP B;  2XV5 A;  3II6 A;  1UIX A;  2Q3E A;  3H1I J;  1X22 A;  2V4H A;  1BCC E;  1QEX A;  2SPZ A;  3LID A;  1NKZ B;  1KB9 H;  3Q5R A;  1BSN A;  5EFW B;  3H32 A;  1JY3 N;  4QMA A;  2QJK B;  3MGN A;  2E76 D;  1KIL E;  2WSF J;  2FFD C;  2WQY C;  1LTS C;  5KKZ C;  1VQ6 P;  1HJB A;  2WTY A;  1UII A;  3CL3 D;  2W6B A;  2ZXX A;  3AEE C;  2Q9I A;  4HJG H;  2K9Y A;  2ZVO B;  2NZ2 A;  2KNC A;  1EXI A;  2KIK A;  3CXH E;  1GL2 B;  2IZ0 A;  3VP8 A;  3AE8 C;  3CX5 I;  2J5U A;  3L72 D;  5AW4 B;  1SVF A;  2OQQ A;  1JTH A;  2KS1 A;  1IO4 A;  2HPC B;  2YMY A;  5KLV D;  2OYI A;  3IF4 A;  1LT9 B;  3QH9 A;  1YYC A;  3ABV C;  4I1L A;  3RL0 C;  5APY A;  3N4X A;  4IFF A;  1SFC A;  4LC1 A;  5GTH H;  2KLV A;  1BE3 E;  4H44 B;  5AVX B;  5KAF H;  2K9J A;  5CCG C;  1P84 I;  1RF1 B;  4HKZ H;  3TGU J;  3WU2 H;  4EDF A;  2O01 N;  1W2E A;  2JWA A;  2QJP C;  4I7Z C;  1VF5 B;  1RF0 A;  3MTU E;  1L4A A;  3NTN A;  2ZAE B;  1IFD A;  1L0N E;  2FYN C;  3L74 G;  1GL2 D;  3AE6 C;  5AW3 B;  3H1K G;  3H6P A;  4UB6 E;  1PGP A;  2IBZ G;  3R4Y A;  2YXQ B;  1EC5 A;  1H0T A;  3AE4 C;  1ZXG A;  3RBX A;  2QRX A;  2C0W A;  1NAY A;  1J2J B;  3H1I G;  4Y28 J;  1VQ8 P;  2R5D A;  3MIW A;  1NJI Q;  3VMZ A;  3H1K E;  2Q6Q A;  2IBZ E;  3R2P A;  4WY4 C;  1JY2 O;  5CCH D;  2NPS C;  1GZL A;  1U7M A;  3HD7 A;  3SSU A;  3T97 B;  1HBW A;  2ZVN B;  3H1I E;  3M0A A;  3HRN A;  2FXP A;  4NPD A;  2WPQ A;  3GHG C;  3VN0 A;  1N7S B;  2N1T A;  5K5G B;  1Y9B A;  2WIT A;  1VQN P;  4GOE A;  4BXL A;  3CPW O;  2KSE A;  4H44 D;  2KZI A;  3MP7 B;  4TLF A;  2C9L Y;  5CJ0 A;  3QWO C;  1SQV E;  3IFM A;  4I2L C;  2HG5 D;  4BRY A;  1SQB D;  1FZC A;  1S5L X;  5AVR B;  1ZR2 A;  3Q2Y A;  1KYO D;  1VF5 D;  3JCU H;  3AE5 C;  3A5T A;  2I1J A;  4JQ0 D;  5GTI H;  4K3A A;  3USS A;  3V6I A;  5GTH E;  1OFC X;  2RN0 A;  4GDO A;  1FBM A;  1RY3 A;  3Q5S A;  2KOG A;  2QA4 P;  1K8A Q;  4EI2 A;  2WSE J;  1H88 A;  1N7S D;  4IL6 X;  1GDT A;  1JUN A;  2IFN A;  1RH5 B;  1K9M Q;  3TYY A;  1PIX A;  3TGU G;  3K5B A;  2KSJ A;  4GT1 A;  4HB1 A;  4PV1 B;  2H88 C;  1KIL A;  3MUD A;  1RE4 A;  3P8M C;  4RJT A;  3KZI H;  1QGK B;  3SWY A;  1LTJ A;  3AED C;  1A02 J;  2YO2 A;  2B89 A;  1LWU A;  3HUS B;  1KD1 Q;  2G3A A;  4C7R A;  3KHU A;  1LTB C;  1FC2 C;  3CX5 H;  3B4S A;  1ZRT D;  3U59 A;  3L71 J;  2OYI C;  3PLN A;  1NTZ D;  5B5E H;  2Z4E A;  4H13 B;  1SFC C;  5KJ7 C;  3B5N B;  1Q2N A;  1URQ A;  3D70 A;  4WB4 A;  1NGM B;  3H1J D;  3JCU E;  3O8Z A;  4H0L B;  5APQ A;  3CC2 P;  3V5B A;  5KLI B;  3H32 B;  1E5W A;  2HOD B;  2P58 A;  1P84 H;  4PV1 D;  1VQ4 P;  4WBA A;  1L4A C;  4M3L A;  3M9H A;  3RK3 C;  1EDI A;  2IBZ I;  3W68 A;  1HUC A;  2OYH A;  1YJW P;  3L4F A;  1MZ9 A;  4L75 A;  3TF5 A;  2V7Q H;  3CC4 P;  1M7L A;  1USE A;  3VMX A;  4DJG A;  4ZKP A;  3PJS K;  3F5H A;  1VDF A;  1FOS F;  1FS0 E;  3O6Q B;  3HD7 C;  1NU1 D;  5AVT B;  1SQB K;  4UB8 E;  3ZDM A;  5APX A;  4H13 D;  2QEX P;  3VOP A;  2AEJ A;  3RGU A;  1L0L E;  1PP9 D;  3B5N D;  3KDP B;  5AW2 B;  5KLV J;  2HFE D;  1VQK P;  2WMM A;  2JWD A;  4H0L D;  1U57 A;  4NPE A;  4C46 A;  1HGV A;  2FBW C;  2FYU D;  1FZC C;  2B87 B;  5AW5 B;  3B8E B;  3P8C D;  2J58 A;  4ASV A;  4RES B;  1NAF A;  1L2P A;  4U3F E;  1HF9 A;  1GK4 A;  1IFM A;  2E74 B;  4ZMD A;  1OVV A;  3ITK A;  2D2C C;  3BCC E;  2M8R A;  3RK3 E;  1BSH A;  1MUU A;  1SQX K;  2WZ7 A;  1J1D B;  2QE7 H;  2PRR A;  2M5A B;  5CBO A;  3CLQ A;  3L71 G;  3HTK B;  2YKP A;  1MKM A;  1KQF B;  2IDB A;  2WT7 B;  3L71 E;  3TSI A;  3AE1 C;  2A45 G;  3W67 A;  3I56 P;  4JYC A;  2M3B A;  2RKL A;  3FWN A;  3RL0 g;  2JKV A;  1SQP K;  5CMZ A;  2QSI A;  1LTA C;  3KXD A;  3MUD C;  2W27 A;  2N1T B;  5APT A;  1CI6 B;  1NHL A;  1RE4 C;  4XFJ A;  1LTJ C;  2O01 H;  2AEF A;  2E74 D;  1SQB J;  4BRY B;  1GMJ A;  1EDL A;  4Y99 C;  1VQO P;  4EIJ A;  1YBK A;  1ZR4 A;  1FAV A;  2WPR A;  3A0H H;  1X8Y A;  3V4W A;  3L72 G;  1VQL P;  3M06 A;  2P2U A;  2MJZ A;  1EXJ A;  2H43 A;  3I5C A;  1M8O B;  1URQ C;  1T2K D;  3G9R A;  3L74 J;  1CZQ A;  1ZV8 A;  3EWK A;  2MKV A;  2WSS H;  4C7N A;  5KLV G;  4ZKU A;  3KYQ A;  2E75 C;  4OVN F;  1DD3 A;  3Q3D A;  1S1C X;  3EFG A;  2WSC J;  1SS1 A;  3M0D A;  2ITA A;  1HWT C;  1YQ4 C;  2A06 D;  1IC2 A;  4EYY Q;  5KLV E;  2ZYA A;  2KK7 A;  3CC7 P;  4UB6 H;  2N1T D;  5AVY B;  3BAT A;  1NU1 K;  2Q1K A;  2OYH C;  2ZT9 B;  3WMM 0;  1KC8 Q;  1N73 B;  1KIL B;  3RK2 C;  1LGH B;  1YHQ P;  3GMA A;  1KOR A;  1HVV A;  2KZJ A;  4YXD C;  2W6A A;  1FJP A;  1HH0 A;  2FYU K;  1S3J A;  3GG2 A;  1LWU B;  2FXO A;  3NXS A;  2W90 A;  3AEA C;  4N78 D;  2YO3 A;  4N3Y B;  1K05 A;  2WSF H;  4KHX A;  1PGJ A;  2OGU A;  1J1E B;  1PL5 A;  1S9K E;  1M1J A;  1S5L E;  4KT0 J;  1YIT P;  5CBN A;  1NTZ J;  2HLO A;  1MFZ A;  1RHZ B;  3LW5 J;  1BGY D;  5AW0 B;  5AVS B;  3L73 D;  2WPV B;  3H1J J;  1JY3 O;  1M1K Q;  3PH0 A;  1Q86 Q;  3U1A A;  1HTL C;  3A0H E;  1D7M A;  5APW A;  3TNU B;  5KJ7 A;  4WVZ A;  3S1K A;  1QVG O;  1SQB G;  2ZT9 D;  2GM4 A;  3PRJ A;  2QM8 A;  1DH3 A;  1KIL D;  3L37 A;  4OGQ C;  3P7K A;  1OWA A;  1SQB E;  2YMK A;  1T3U A;  2FFD B;  2C0X A;  5TJH A;  1FDI A;  5KKZ B;  4AYC A;  1KYO E;  2A45 I;  2GUS A;  3AE3 C;  3B71 A;  1KTM A;  1NU1 J;  2I1K A;  2RMZ A;  3CXH D;  3AE2 C;  3L74 E;  2K88 A;  3HE5 B;  2O3J A;  3CCS P;  3BRT B;  1PP9 J;  1CSB A;  2XNX A;  1KN7 A;  1HJ0 A;  2LXC B;  3CMA P;  2Y9Z A;  1T3J A;  2CPB A;  1OX3 A;  3CCQ P;  1OVU A;  2P7J A;  3AE9 C;  4LLH A;  3HE4 A;  2M3E A;  1BE3 D;  3RL0 B;  1OVR A;  4L73 A;  1VQP P;  5B66 E;  3WUV A;  1M56 D;  1Y47 A;  1JMM A;  1JB0 J;  2O1K A;  1NTZ G;  2QJP B;  4I7Z B;  5AVW B;  1E79 H;  3JC2 2;  3NMD A;  4N6J A;  1L0N D;  3M0D C;  1KB9 D;  3L36 A;  2M0B A;  3V2P A;  1AQ5 A;  3H1J G;  2FYN B;  3CCR P;  5E79 E;  1NTZ E;  3FGA D;  4NPF X;  2BCC D;  1SQX D;  2R3S A;  4ASW A;  1ZP0 C;  1JCD A;  4JBZ A;  1WRG A;  2Q3I A;  3F89 A;  4WY4 B;  2NPS B;  4UB8 H;  3GW6 A;  2LXB A;  3GHG B;  1IFP A;  4L74 A;  3NFQ A;  3AEF C;  3RL0 D;  2AEM A;  1SQV D;  2K3R A;  2GA1 A;  3WUU A;  1GU4 A;  3TGU E;  1YTZ T;  4K35 A;  1IJD B;  1DD4 A;  3GF3 A;  5DJT B;  2WSE H;  5CCG D;  2WVR A;  5AVU B;  2QG4 A;  1SQP D;  1M1J C;  2DW3 A;  1NU1 G;  3IAO A;  1PGQ A;  2Q7C A;  2P67 A;  5AW1 B;  2JP3 A;  2YKO A;  1QVF O;  2Z5H A;  3CI9 A;  4R4L A;  4U7J A;  3L70 D;  1Q81 Q;  1PP9 G;  2CK3 H;  2QJY C;  2G8Y A;  2BEQ D;  1NTK D;  1NU1 E;  3V2R A;  5APS A;  1Z56 A;  1U7J A;  2GUV A;  4C7N B;  3L35 A;  5DJU B;  3SWK A;  1EDJ A;  1PP9 E;  3G6E P;  2YIU C;  1M90 Q;  1NKN A;  2JR8 A;  1KYO I;  1PPJ D;  1FE6 A;  1OW8 A;  2HPC A;  2QIW A;  5CCH A;  1VQ5 P;  4WY4 D;  1TU3 F;  2NPS D;  1LT9 A;  2R3C A;  3P8C E;  2FYZ A;  1ZOY C;  2WPS A;  2OYO A;  2OTK E;  2L5G B;  3U1C A;  2XND H;  1NTM D;  1OMI A;  2A45 H;  1EZV D;  1RF1 A;  3VYI A;  1S72 P;  2KUB A;  4PD4 E;  3G4S P;  2KNC B;  2ZXE B;  3SFE C;  3G3Z A;  2PP6 A;  2JO1 A;  2Y0E A;  3L72 J;  1YQ3 C;  1W2B O;  1LNQ A;  2XDJ A;  4DCK A;  3H1H D;  1VQ9 P;  3SWF A;  1LTG C;  1JTH B;  2KS1 B;  1FZG A;  1VQM P;  1BGY J;  3L73 J;  2OYI B;  2PAJ A;  3CCE P;  3D6Y A;  2FKW B;  2QJY B;  2W83 C;  2E76 C;  1GTW A;  3OAK A;  2K37 A;  5AVZ B;  1SFC B;  3KPE A;  1L0N K;  5AW9 B;  1FZB A;  2K9J B;  1YI2 P;  3N7N A;  1XTC C;  1OW7 A;  3Q1M A;  4B86 A;  3AEG C;  3UIA A;  1RQU A;  1Q82 Q;  1L4A B;  2OTJ P;  5APV A;  4EOT A;  4GOD A;  3RK3 B;  1H0T B;  1WMK A;  1AFO A;  1SQV K;  3A7O A;  4RKU J;  3VTP C;  1LTI C;  1KV4 A;  2A06 G;  2ZJS E;  2H89 C;  3MHV A;  3EFF K;  3FX0 A;  1RE3 A;  3HD7 B;  2H7H A;  3VP9 A;  1L0L D;  1OXZ A;  2PGD A;  2QJK C;  2W8Z A;  2A06 E;  3C8V A;  1SFC D;  1PZQ A;  5KJ7 D;  4YPC A;  1DEE G;  3VMY A;  3E1I A;  1FZF A;  1MV8 A;  1S5L H;  1NTK K;  3S4R A;  1N8R Q;  1K04 A;  2WWW A;  1BE3 J;  1GW3 A;  3CX5 D;  1FZC B;  1XTG B;  4U3F D;  2N9Y B;  1N2D C;  4AUW A;  1L4A D;  1Q90 D;  3BCC D;  1SQQ D;  3RK3 D;  4Z1M H;  3AE7 C;  2D2C B;  1QLE D;  2FY8 A;  3CME P;  5H2F H;  4D6T D;  4N78 E;  2E5T A;  3HUS A;  3OA7 A;  3L75 D;  4W7Z A;  1HGZ A;  3L72 E;  2Y0D A;  2CPS A;  1A02 F;  1BGY G;  2NRG A;  3L73 G;  2E43 A;  1NTM K;  4HH2 A;  2KB7 P;  5CCH C;  2QVA A;  1P84 D;  4IL6 H;  3TDK A;  3HD7 D;  2BCC J;  1KYO H;  1LT9 C;  3AEC C;  1H89 A;  1BGY E;  1SQX J;  3L73 E;  3H1L D;  2R32 A;  4XA4 A;  4H44 C;  3B5N A;  4PD4 I;  2Y0C A;  4MN4 C;  3CWB D;  2B9B A;  3M9Q A;  4CPG A;  1G1I A;  3IN6 A;  3A2A A;  1RF1 C;  3FWL A;  1JY2 P;  2JDI H;  2ZFC A;  2UWJ E;  1SQV J;  3PTZ A;  2HOD A;  2J59 M;  1VF5 C;  2WSC H;  1T8Z A;  2W6J H;  3OW2 O;  1LTJ B;  2PFX A;  4HYT B;  2R44 A;  2KYV A;  1SQP J;  3VMA A;  3V2Q A;  3V4Q A;  1JMB A;  2D2C D;  2P10 A;  4Y99 B;  4DOJ A;  3CCM P;  3L70 J;  5KAI E;  4AQR D;  1NTK J;  3O6Q A;  1ZN5 A;  1N7L A;  3E7K A;  1N86 A;  1KMI Z;  4JYB A;  5B66 H;  1AVY A;  1URQ B;  1N7S C;  2Q5U A;  2AXT E;  1AJY A;  1BDC A;  3D6Z A;  2E75 B;  4KJM A;  1BCC D;  1JY2 N;  1NO4 A;  1BE3 G;  3P32 A;  5CHX A;  1CW5 A;  5H2F E;  1GD2 E;  5AVV B;  1KQL A;  4A7P A;  2E42 A;  2KI7 B;  2B87 A;  3C9I A;  1JOC A;  5E79 H;  4PJ0 E;  1ZME C;  1JCC A;  1KFM A;  5TIS E;  4LGD E;  3LW5 H;  3CD6 P;  1NTM J;  4OH8 B;  2OYH B;  1H8A A;  4IL6 E;  3A0B E;  2JJL A;  1LP1 A;  1L0L K;  1KQS O;  4IOI H;  4YXW H;  3RK2 B;  3M9B A;  1L0N G;  1M57 D;  2OTL P;  1FZA A;  2M5A A;  1R5L A;  1RE3 C;  3HTK A;  1G2C A;  4OWF A;  3H1H J;  3KQG A;  5C39 A;  2BCC G;  1KB9 E;  1YTZ I;  1SQX G;  2WT7 A;  2Z5I A;  5AW7 B;  1S9K D;  3GF7 A;  5L8R J;  2QM7 A;  1X79 B;  1URQ D;  1SQQ K;  2E5Y A;  2BCC E;  5AW8 B;  5KTB A;  1SQX E;  2FYU J;  2E75 D;  2N9B A;  1JM0 A;  4O9B A;  4PV1 C;  1SQV G;  1AQT A;  3MZW B;  2R5B A;  1CI6 A;  1MFT A;  1W5C E;  1SQP G;  1FZE A;  3BRV B; 
#chains in the Genus database with same CATH homology
 3HUS C;  3P8C E;  4IFM A;  1GL2 B;  3RK2 D;  3VP8 A;  2FYZ A;  1SP4 A;  1SQP K;  2WPS A;  5CMZ A;  2L5G B;  3U1C A;  5AW4 B;  1LTA C;  2W27 A;  2N1T B;  4JF7 A;  1SVF A;  1JTH A;  1LTT C;  5APT A;  1CI6 B;  1NWQ A;  1NHL A;  2A45 H;  4XE5 B;  1RE4 C;  1RF1 A;  2XKM A;  3VYI A;  1IO4 A;  2HPC B;  2YMY A;  2BAS A;  1LTJ C;  4W7Y A;  2KP8 A;  2O01 H;  3B5N C;  2OYI A;  1LT9 B;  1YYC A;  2ZXE B;  3G3Z A;  2PP6 A;  4I1L A;  3TK1 A;  3RL0 C;  1G1J A;  5APY A;  3N4X A;  4IFF A;  4Y99 C;  1KFN A;  1SFC A;  4LC1 A;  2KLV A;  1VPC A;  2XDJ A;  5AVX B;  4DZO A;  4EIJ A;  1NH4 A;  1ZR4 A;  1FAV A;  3SWF A;  1LTG C;  5CCG C;  1JTH B;  2WPR A;  1FZG A;  1X8Y A;  3V4W A;  1RF1 B;  1DX7 A;  4W80 A;  3M06 A;  2P2U A;  2MJZ A;  1PFI A;  2H43 A;  3I5C A;  2OYI B;  1W2E A;  2PAJ A;  1URQ C;  1T2K D;  4IFD K;  2FKW B;  1CZQ A;  1RF0 A;  1SLQ A;  1ZV8 A;  3MTU E;  3BVH A;  1L4A A;  1GTW A;  3NTN A;  4C7N A;  4ZKU A;  3OAK A;  3KYQ A;  5AVZ B;  1SFC B;  3KPE A;  1IFD A;  2H8P D;  1N73 A;  1L0N K;  5AW9 B;  1GL2 D;  3EFG A;  3H6P A;  5AW3 B;  1FZB A;  3M0D A;  1FOS E;  1HWT C;  1QL2 A;  3M91 A;  1IC2 A;  2C0W A;  5KLV K;  3N7N A;  1J2J B;  1XTC C;  2N1T D;  2R5D A;  5AVY B;  3MIW A;  3VMZ A;  4B86 A;  3BAT A;  3UIA A;  3R2P A;  1GL2 A;  1JY2 O;  1NU1 K;  4WY4 C;  2OYH C;  3WMM 0;  2NPS C;  5CCH D;  1L4A B;  1GZL A;  3HD7 A;  5APV A;  4EOT A;  1HBW A;  3RK3 B;  3M0A A;  3HRN A;  3A3Y B;  2WPQ A;  1N73 B;  3BAS A;  1KIL B;  3RK2 C;  3GHG C;  3VN0 A;  1N7S B;  2N1T A;  1LGH B;  2WIT A;  3LIE A;  1GK6 A;  2IX7 C;  1HVV A;  1AFO A;  2C9L Y;  5CJ0 A;  1SQV K;  2W6A A;  3A7O A;  1FJP A;  1HH0 A;  3IFM A;  3VTP C;  2FYU K;  4I2L C;  1LTI C;  2HG5 D;  1LWU B;  1FZC A;  3NXS A;  5APU A;  4N78 D;  5AVR B;  2YO3 A;  1RE3 A;  1ZR2 A;  3HD7 B;  4N3Y B;  3TNU A;  2WSF H;  2H7H A;  4KHX A;  3VP9 A;  1J1E B;  1OXZ A;  1S9K E;  1M1J A;  3A5T A;  1SFC D;  1J1D C;  2I1J A;  5KJ7 D;  2HLO A;  1MFZ A;  1RF0 C;  3VMY A;  3E1I A;  4GIF A;  1FZF A;  1MV8 A;  5AW0 B;  1NTK K;  5AVS B;  2WWW A;  1GW3 A;  2FFD A;  1DEB A;  1FZC B;  1JY3 O;  1XTG B;  3PP5 A;  1GW4 A;  3U1A A;  2LKM A;  1T2K C;  1HTL C;  1FBM A;  3TNU B;  5APW A;  5KJ7 A;  1RY3 A;  2FXM A;  2KOG A;  1IK9 A;  1N2D C;  1X9V A;  4AUW A;  2GM4 A;  1M1J B;  1L4A D;  2QM8 A;  4I6M C;  3RK3 D;  1QL1 A;  1DH3 A;  1H88 A;  1KIL D;  3L37 A;  1N7S D;  3P7K A;  1OWA A;  1GDT A;  3HE5 A;  1JUN A;  4N78 E;  1T3U A;  2IFN A;  3HUS A;  3OA7 A;  4W7Z A;  1HGZ A;  2N1T C;  3TYY A;  2FFD B;  2C0X A;  3T97 A;  2CPS A;  2O1J A;  4AYC A;  1A02 F;  2KSJ A;  2A45 I;  2GUS A;  4GT1 A;  2E43 A;  1NTM K;  4HH2 A;  2KB7 P;  1KIL A;  5CCH C;  2XU6 A;  5BU5 A;  1N7S A;  3MUD A;  3HD7 D;  1FJK A;  1LT9 C;  1H89 A;  5AW6 B;  1NOH A;  1RE4 A;  3P8M C;  3SWY A;  1EQ7 A;  1LTJ A;  2R32 A;  2I1K A;  4XA4 A;  3B5N A;  1A02 J;  2YO2 A;  1LWU A;  3HE5 B;  3HUS B;  3BRT B;  2IFM A;  3M9Q A;  4C7R A;  1G1I A;  1LTB C;  3A2A A;  1CSB A;  1RF1 C;  2XNX A;  3U59 A;  1JY2 P;  2ZFC A;  2OYI C;  1T3J A;  5CCG A;  2HOD A;  2CPB A;  3EQ2 A;  2J59 M;  2WSC H;  1T8Z A;  2P7J A;  2Z4E A;  1LTJ B;  1SFC C;  4HYT B;  5KJ7 C;  4LLH A;  3B5N B;  1G2C B;  2KYV A;  3HE4 A;  1URQ A;  3MD0 A;  3V2Q A;  3V4Q A;  4WB4 A;  1JO5 A;  1IFN A;  5AVQ B;  1IFI A;  3O8Z A;  1KZU B;  3RL0 B;  5APQ A;  3IR9 A;  4Y99 B;  3V5B A;  1WT6 A;  1IFJ A;  2JEE A;  4DOJ A;  3H32 B;  2IPP A;  2POH A;  1E5W A;  2HOD B;  4AQR D;  1ZN5 A;  4WBA A;  1L4A C;  4M3L A;  1N7L A;  3M9H A;  5CJ4 A;  3RK3 C;  1N86 A;  1JMM A;  4JYB A;  2O1K A;  1N73 C;  3HE4 B;  1KIL C;  1URQ B;  1N7S C;  2Q5U A;  1HUC A;  4WY4 A;  5AVW B;  2OYH A;  3NMD A;  4N6J A;  2NPS A;  3M0D C;  3L4F A;  1MZ9 A;  3L36 A;  1FU1 A;  1JY2 N;  1NO4 A;  3P32 A;  3V2P A;  1AQ5 A;  3GHG A;  1M7L A;  5CHX A;  1CW5 A;  3VMX A;  1NTZ K;  1JY3 P;  4ZKP A;  1LWU C;  1VDF A;  1GD2 E;  5AVV B;  1KQL A;  1GU5 A;  1FOS F;  2E42 A;  1GL2 C;  2P1J A;  3C9I A;  1JNM A;  1JOC A;  3HD7 C;  1ZLL A;  1JCD A;  2YKQ A;  5AVT B;  1SQB K;  1WRG A;  5APX A;  2Q3I A;  1JCC A;  1J1E C;  1KFM A;  4LGD E;  3LW5 H;  2HYN A;  1FDM A;  2XZR A;  4OH8 B;  4WY4 B;  5BVZ A;  2OYH B;  1H8A A;  3OJA B;  3VOP A;  2JJL A;  2NPS B;  1L0L K;  3B5N D;  3KDP B;  4GKG A;  3V2N A;  2YNY A;  5AW2 B;  2HFE D;  3RK2 B;  3GHG B;  3M9B A;  3NFQ A;  3RL0 D;  4C46 A;  1HGV A;  1GU4 A;  2OAR A;  1FZA A;  1YTZ T;  1FZC C;  2VRS A;  5AW5 B;  3B8E B;  1RE3 C;  1IJD B;  3P8C D;  3HTK A;  5BU8 B;  2J58 A;  2C9N Y;  1G2C A;  1NAF A;  2WSE H;  4RES B;  5CCG D;  3KQG A;  2XV5 A;  3II6 A;  5AVU B;  1YTZ I;  1M1J C;  1GK4 A;  2WT7 A;  1IFM A;  2Z5I A;  5AW7 B;  1S9K D;  2QM7 A;  1X79 B;  3LID A;  1URQ D;  2P67 A;  5AW1 B;  2Q7C A;  2YKO A;  1NKZ B;  2Z5H A;  3CI9 A;  2M8R A;  1SQQ K;  3H32 A;  1JY3 N;  1MUU A;  3MGN A;  5AW8 B;  5KTB A;  1SQX K;  2WZ7 A;  1J1D B;  2FFD C;  3V2R A;  5APS A;  1LTS C;  1Z56 A;  3CLQ A;  2N9B A;  2GUV A;  4C7N B;  3HTK B;  3L35 A;  2YKP A;  4O9B A;  1HJB A;  1LT9 A;  2WTY A;  2R5B A;  1NKN A;  3CL3 D;  1CI6 A;  2W6B A;  2WT7 B;  3TSI A;  2HPC A;  2Q9I A;  5CCH A;  1FZE A;  2A45 G;  4WY4 D;  4JYC A;  2NPS D;  2M3B A;  3BRV B;  2R3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...