3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
1IC2A 5BU5A 3OJAB 1X79B 3U1AA 3VP8A 3HRNA 1WT6A 3P8CD 4N78D 3U59A 3BATA 5KTBA 3N4XA 3VP9A 4GIFA 5BU8B 3BASA 5BVZA 4O9BA 3N7NA 4ZKPA 4ZKUA 1NKNA 4N3YB 4I1LA 2POHA 2JEEA 3U1CA 2FXMA 3C9IA
chains in the Genus database with same CATH superfamily
2NZ2A 2E43A 1JO5A 3RK3C 1EZVD 2WQYC 3WU2E 3H1HE 1SFCD 2QJYC 4EI2A 1U7JA 1ZN5A 3C8VA 2ZJSE 3PTZA 4PV1B 1HUCA 3AE9C 3G3ZA 1BE3D 2RKLA 1JM0A 1YHQP 5AW9B 1SQPE 4WY4A 2G8YA 4H44D 1PPJE 1VQ9P 1SQBD 3HE4B 1RE3C 3PH0A 2POHA 1USEA 2VRSA 4GOEA 1LGHB 3A0HH 1XTCC 4RKUJ 2WTYA 1X79B 1YQ4C 5KLIC 3WUTA 3U59A 5CMZA 3V4QA 3G6EP 1RF1B 3L71D 1KQFB 2OYHA 1CZQA 3M0AA 1BE3J 3D70A 2I8DA 2YO3A 2L91A 4OWFA 2R5BA 1SQBJ 3L75G 1YTZT 2YKOA 2R3CA 1UIIA 2YMYA 3MTUE 2AEFA 5CCGA 1EXIA 1EQ7A 2FYZA 3A7OA 5AVXB 1HH0A 2WSFH 2YIUB 3H1IG 5APQA 5AVYB 2Q3IA 3L71J 1IFIA 3L73E 3VMXA 1BGYD 2B87A 1SLQA 4H44B 2A06D 2QG4A 3W67A 3I5CA 1T2KC 1PP9D 4WY4D 1DD3A 1R5SA 1OW7A 2ZT9D 3IAOA 3QH9A 1SQQE 2MJZA 5APTA 1J1DB 1GW4A 2IBZG 2P58A 5K5GB 4R4MA 1N7SC 1LTJC 3FWNA 4ZMDA 3TGUG 2KS1B 1M1JB 3P8CD 1S5LH 4IL6H 1KQGB 4C7RA 2FBWC 2WSCH 1YJWP 1BGYJ 1QGKB 2WPVB 4U3FE 4WVZA 3P7KA 2N1TA 2W90A 3OA7A 1PP9J 5KAFH 2WSEJ 2JWAA 4LC1A 1OVUA 3D6ZA 1XTGB 1TU3F 5AW4B 1EC5A 5CCGD 3WUUA 2FXPA 1RQUA 4UB8E 3L36A 2P2UA 1S2EA 2WWWA 5AVUB 3PLNA 1E5WA 3H1JE 3LW5H 4PV1C 4WY4B 1HTLC 1PGJA 2KZJA 1DIPA 2QA4P 1L0LE 3H1LE 2ZT9B 4HB1A 1FAVA 2YNYA 4EOTA 5APUA 1S3JA 1S72P 5KKZB 3Q2YA 1N8RQ 1EZVG 1J2JB 1IK9A 3A3YB 1NAFA 2KZIA 1N73B 2P10A 2QSIA 1RF1C 3AEFC 1FJKA 4GODA 3Q5RA 1SQBG 3L70G 3HUSA 1FOSE 4PD4E 4IOIH 2N1TD 2SPZA 2E74D 1N7LA 4Z1MH 4H0LB 2A45H 1NTMG 3SWKA 4C46A 5BVZA 4A7PA 1SQPD 2J59M 3I56P 1PPJD 1G2CB 2K88A 1NTKE 3O8ZA 3GHGB 1MKMA 3L71G 1BDDA 1L0NG 2JWDA 5GTIH 3RGUA 2YIUC 5APSA 1EZVI 1IFJA 1M1KQ 1FC2C 4W7YA 4DCKA 3VYIA 4KHXA 1W2EA 1Y8AA 2KLVA 5B66E 1VQ6P 3II6A 1FDOA 3CX5H 2D2CB 3V5BA 4TLFA 1JMBA 3L4FA 3T97A 2HODA 3L72G 2NPSC 2YKPA 1SQPJ 1Q81Q 1FOSF 1L2PA 1J1DC 3HD7B 1Q86Q 2AXTE 1M1JC 1LT9A 1OVVA 1RF0C 1FZCB 1JY3O 1SQVG 2E75B 2QVAA 1KILA 2GUVA 1X8YA 1PP9G 4N6JA 4MN4C 3L73D 3CCVP 5CCHA 1AVOA 4K35A 1BCCG 3CCSP 1VQMP 3FGAD 3Q1MA 3HE5B 2QRXA 5KLVE 3NXSA 3PHLA 2YXRB 2K37A 3A2AA 2Z4EA 2OGUA 1PIXA 1SQXK 4IL6X 3L37A 1KTMA 4U7JA 5E79E 3AEBC 4RJTA 3BCCG 2W83C 2LKMA 1DD4A 3IF4A 1ZP0C 3H6PA 3FXDA 1KYOE 3GLMA 2G3AA 2LR2A 3PP5A 3A0BH 3L73J 3K5BA 1NTZG 5DJTB 1L0NK 1W5CE 1HWTC 5KAIH 1URQA 3GG2A 5APXA 2FFDA 1GK4A 4HJGH 4U3FD 5KKZC 2FXOA 3CCQP 1HJBA 3H25A 1GU4A 2E76D 2M3EA 2RN0A 4N3YB 5L8RJ 2Y9ZA 4AYCA 2NRGA 1N73C 2ZVNB 2M5AB 1CI6A 3NMDA 2V7QH 5TJHA 3IR9A 4W7ZA 2N9YB 2HPCB 1KILD 3PRJA 1PGPA 1GL2B 2YMKA 1ZR4A 1AV1A 1VF5C 5CCHD 1GD2E 3TF5A 3H1JD 3W68A 4U3FJ 3CMAP 3H1LD 1L0LD 4H0LC 1KZUB 3AEEC 1LNQA 1ZV8A 3MP7B 3HTKB 3Q3DA 1AVYA 2WT7A 2BCCE 5CJ0A 3RK2B 4WBAA 2K9YA 3GHGC 1JTHA 2NPSA 3L74G 2M8RA 3H1HG 4EIJA 2HR3A 4L75A 5AW8B 1AQ5A 1GTWA 1LTTC 1J1EC 3FX0A 1JY2O 2WPRA 3TYYA 2QM7A 2IX7C 2D2CC 1WRGA 3H1JJ 4OGQD 5AVVB 1QL2A 2IPPA 3H1LJ 1L0LJ 1URQD 5BU5A 4QMAA 2K9JA 3S9OA 3IN6A 4PD4D 4GT1A 3N7NA 3HD7C 4OH8B 4C7NB 1VDFA 1IK7A 3RK3E 1BSHA 1L4AA 3RL0C 2R32A 2M3BA 4UB6E 3NTNA 1JCCA 1FZCC 5GTHH 1NTKD 2E75C 3RBXA 1YIJP 3ABVC 1LTAC 5KJ7A 2IZ1A 1NHLA 1FE6A 1VPCA 3TNUB 2C0WA 1NOHA 1LT1A 2KNCA 5AVZB 2ZVOB 4PJ0H 1HF9A 1SQXD 2O01N 2HLOA 2KSEA 3A0BE 1H0TB 4HKZH 1K04A 3Q5PA 3KHUA 1NTKJ 2O01J 1G1JA 3L73G 2IDBA 1M7LA 1T6AA 1UIXA 3M0DC 4B86A 2YKQA 2H8PD 1GMJA 4IFDK 4H13D 1ZRTE 1SFCB 2PGDA 1OWAA 2FYUG 2JR8A 1NU1G 3M9QA 4IFMA 3B5NA 1S1CX 4HYTB 2L5GB 1PGOA 1S4XA 3MUDC 1SQQG 3M9HA 3P32A 4RO0A 1JOCA 3VTPC 1ZOYC 2WSCJ 1USDA 5DJUB 5KLVD 3D71A 5TISH 1KC8Q 1L4AD 2QJPB 2XV5A 2OYIA 2W6AA 3NFQA 1P84E 1DX7A 1KB9E 1FDMA 1DEBA 5KJ7D 1GL2C 4DT0A 1KORA 5B5EH 1LWUA 4ZKUA 4D6TG 3L75E 3V2NA 1KYOD 2AXCA 3KDPB 3V2PA 4BXLA 3CXHH 3RK2C 5KLVJ 3H32A 3H1IE 4BWNA 2O3JA 3JCUH 2WPQA 2C0XA 2Z5HA 5C39A 2Q3EA 3OJAB 3IFMA 3CCMP 2E5YA 3EFFK 4BRYA 3CC7P 3B5ND 2IBZE 3CCEP 1KILE 3QWOC 1JNMA 1X9VA 1RE3A 4GDOA 3SWFA 1VF5D 2FYUK 1NKNA 1NU1K 2Y0DA 2R44A 2BCCD 3V2QA 1GW3A 5H2FH 3A0HE 1H88A 1LTBC 2XNXA 2ZYGA 1EDIA 4JBZA 2QJKB 2OARA 2OTLP 1NO4A 1KD1Q 3O6QA 1K05A 2WSEH 2OYHB 1CW5A 4L73A 4ZNCA 1NAYA 1VQPP 3E7KA 1BE3G 2BCCJ 2MKVA 1RE4C 4NPDA 2BEQD 2LXCB 2GUSA 2ZXXA 4EDFA 4YPCA 1VQLP 3RK3D 3A5TA 3MZWB 3B8EB 2KIKA 4XE5B 1IFDA 2KOGA 1NKZB 3RL0D 4JQ0D 2UWJE 4ASWA 1HJ0A 3D6YA 2YXQB 1SFCC 2I1KA 2KXPB 3AE3C 2Y9YA 1VQKP 2I1JA 2B87B 2Q5UA 1OXZA 4PD4I 3BVHA 3VP9A 1R5LA 3BASA 2O1JA 5AW1B 3P8MC 4H44C 2QJPC 1N7SA 3PJSK 4GKGA 2DW3A 1LTJA 2QM8A 3AE4C 2FYNB 1SQXE 2ZYDA 3CWBE 3L70E 1SP4A 2KP8A 4LLHA 2QEXP 3KYQA 1S5LE 3SWYA 4IL6E 2PRRA 3CXHE 2J5UA 3MHVA 1KQSO 2BEZF 2KSJA 3H32B 1IFPA 1OW8A 2H89C 1ZRTD 2ZYAA 1BGYG 5EFWB 2C9NY 2A06G 1QVFO 3BATA 5KAFE 3RK3B 1L0NE 2JDIH 1KFMA 3KZIH 1OVRA 2N1TB 2E74B 1FZGA 4K3AA 4W80A 1FJPA 5CHXA 2OQQA 1EDKA 2B89A 3KPEA 3AEGC 1X22A 3WU2H 4AQRD 1FZFA 3ZDMA 1P84D 2Y0EA 3L72E 1KB9D 1SQBK 4YXWH 1KV4A 3L75D 1T2KD 2YO2A 3HE4A 3F5HA 5AVRB 1NTMK 1VQ8P 3G4SP 1SQVE 4LGDE 2W6JH 4WY4C 1N7SD 2ZT9C 3H1ID 1OIPA 2O1KA 1RF1A 2P1JA 1BCCE 1OFCX 1RE4A 2QJKC 3EQ2A 3AE2C 3FXEA 1LJ2A 1G1IA 2K1AA 1KYOI 1U57A 3L75J 1GK6A 3M9BA 2RH0A 2OYHC 2GM4A 2WMMA 4I6MC 2BCCG 5KTBA 3HUSB 2IBZD 1CSBA 4IFFA 2FKWB 3H1IJ 3AECC 4GOFA 3SFEC 2B9BA 1JY3N 1FZEA 1SQVK 1NTZE 1N2DC 5GTIE 5AVWB 3TDKA 5CCGC 3MGNA 4EYYQ 1YBKA 1QL1A 4PV1D 1PFIA 1MUUA 2AEMA 2PP6A 5M1BA 3RBZA 4NPEA 3CX5E 1U7MA 2N9BA 2PAJA 1FZAA 2XKMA 3N4XA 1NWQA 2PFXA 4I7ZB 3T97B 2HODB 3UIAA 2H88C 2KS1A 1M1JA 1RF0A 2FYNC 3GF3A 2QE7H 2E76B 1SQPG 2Z5IA 2XNDH 3S4RA 1T8ZA 1PPJG 1IFMA 3RL0g 2XU6A 1JEKA 4WB4A 2HG5D 3EFGA 1LT9B 5CBNA 1ZW0A 1NTZK 1PL5A 3USSA 1JUNA 2BASA 1EDJA 1KILB 2GA1A 4YTPC 1MZ9A 4L76A 1FBMA 1VQOP 3G71P 3L74E 2N1TC 1Q2NA 2OYOA 2E74C 3H1KE 3V2RA 3I55P 2E42A 1RY3A 4KJMA 3U1CA 2P67A 1KFNA 1PV3A 4UB8H 3CCJP 1FU1A 3CPWO 2WSFJ 1QVGO 3CWBD 1FDIA 3L70D 3WMM0 4O9BA 1K9MQ 3CXHD 1NTMD 5KAIE 1IFNA 2JKVA 5APWA 2NPSD 1S9KD 4OGQB 2Q1KA 4XFJA 2Q6QA 1URQB 1YQ3C 4R4LA 2K3RA 2FFDB 1L0ND 3C1LA 1JY3P 1N73A 1KN7A 4WWIA 1GDTA 3VP8A 3HRNA 1OMIA 4N78D 1SQXJ 3CWBJ 1KMIZ 3L70J 1ZXGA 1JY2N 1CI6B 1MV8A 3JC22 2WVRA 3L72D 1SQPK 1NTMJ 1A02F 1MFTA 2M0BA 3AE5C 3B71A 5AW2B 1N86A 4PD4H 2V4HA 3KQGA 1IZNB 1T3UA 3HUSC 1G2CA 2WITA 1L0NJ 3GHGA 4TT3H 4JF7A 4U3FG 1SQVD 1KQLA 1ZLLA 2O01H 2WT7B 1BDCA 1MFZA 2FYUE 1RH5B 1JTHB 1NU1E 2JP3A 2NPSB 1P84I 2J58A 4JPZB 2P7JA 3EWKA 3L72J 1BCCD 5B66H 1KB9I 1M8OB 4ZKPA 2IZ0A 2E5TA 2JEEA 1JMMA 3LW5J 1K8AQ 3GW6A 2HYNA 1FZBA 4H13B 3S1KA 3HD7A 4I7ZC 3H1JG 3M06A 2K9JB 1L0LG 3BCCD 1E79H 3H1LG 1Y9BA 1SQVJ 1FZCA 2E76C 3VMAA 2AXTH 1DEEG 1LTIC 4D6TE 3MIWA 3SFDC 1NH4A 5GTHE 1LTGC 5CJ4A 1L4AB 3CD6P 1NTZD 1LT9C 5AVQB 1BCCJ 3TGUE 4KT0J 1Q82Q 1KILC 2HFED 2R3SA 3HE5A 1H8AA 2JJLA 2Y0CA 4H0LD 1M57D 3FWLA 1SQQK 3ITKA 1SVFA 5CCHC 3CX5D 4PJ0E 2CK3H 1HGZA 2KNCB 2IBZI 3BCCJ 2H43A 5AW0B 5AW5B 5E79H 1YTZI 1RHZB 3GF7A 2FXMA 3M0DA 1QEXA 1JY2P 2IYPA 1H89A 1NTZJ 1W2BO 4M3LA 1YJNP 1LP1A 1HVVA 4HH2A 1KYOH 2D2CD 1NTKG 3LIDA 1FS0E 1M90Q 1VQ5P 1AQTA 3MUDA 4OGQC 3B4SA 4DZOA 2IFNA 3KXDA 1OW6A 1URQC 3CL3D 2FFDC 3HD7D 1Q7YQ 3B5NB 3TK1A 2M5AA 3L74D 3AEAC 3H1HD 4Y99B 1QX8A 4Y28J 1SQXG 5TISE 3CWBG 5APVA 3H1KD 4CPGA 2E75D 3OAKA 2HPCA 1VF5B 3C9IA 1EZVE 3U1AA 3Q5SA 2IYOA 1GL2A 3CCLP 3CI9A 1L0LK 1ZR2A 2OYIB 1RQVA 2WZ7A 3V4WA 1IO4A 5B5EE 2W8ZA 1HBWA 2W27A 1BE3E 1JCDA 3HTKA 1LWUB 4RESB 1SQBE 2KB7P 2ZFCA 1YI2P 3V6IA 2ITAA 3L74J 3H1HJ 4AUWA 1J1EB 3AE8C 3H1KJ 3JCUE 1NTME 3AEDC 3MD0A 1S9KE 1GU5A 1OZHA 5KLVG 1PGQA 1PZQA 3L71E 1A02J 5AVSB 4DOJA 1JB0J 2QJYB 2QIWA 3CXHI 1YITP 1NVOA 5AVTB 1OX3A 3WUVA 4OVNF 3RL0B 3OW2O 4H13C 4N78E 1VQNP 2CPBA 4C7NA 1R8EA 3VMZA 3R2PA 1QLED 1NTKK 4BRYB 3VMYA 1AJYA 1X0TA 2KK7A 5BU8B 1AA0A 1WMKA 2KUBA 4UB6H 3LIEA 4YXDC 5H2FE 1AFOA 4ASVA 1L4AC 3TNUA 1GL2D 2V7QJ 3AE7C 3CC2P 5KLIB 3CC4P 2FYUD 1BGYE 5AW3B 1IJDB 1NU1D 3SSUA 2A06E 1S5LX 2W6BA 1NYHA 2FY8A 5KJ7C 1YYCA 4I1LA 4DJGA 1EDLA 1SQQD 1T3JA 2KLUA 2ZXEB 5CBOA 2C9LY 4JYBA 1D7MA 3CMEP 2A45G 1PP9E 1IC2A 2IFMA 1Q90D 2Q9IA 1WT6A 3O6QB 1H0TA 3RK2D 3R4YA 1SS1A 2R5DA 3JSVC 2AEJA 4GIFA 2KI7B 5AW6B 1LP1B 1EXJA 1YJ9P 1HGVA 2JO1A 4I2LC 3P8CE 3CLQA 2WPSA 4D6TD 2FYUJ 1NU1J 3BCCE 1SFCA 2XZRA 3L35A 3VN0A 1SQQJ 1LTSC 3BRVB 5KLVK 3TGUD 2XDJA 3M91A 1VL2A 2Q7CA 2OTJP 2OTKE 5APYA 3AE6C 1K73Q 2WSSH 3B5NC 2CPSA 2KYVA 3GMAA 4Y99C 2A45I 1NGMB 1Y47A 4L74A 3VOPA 1ZMEC 4D6TJ 2LXBA 1P84H 1Z56A 1N7SB 2H7HA 2OYIC 1LTJB 4JYCA 1KB9H 3F89A 3CCUP 3CCRP 4NPFX 1BSNA 1VQ4P 1M56D 5AW7B 2B88A 2RMZA 3TGUJ 3E1IA 3AE1C 3E1RA 1DH3A 1LWUC 1GZLA 3CX5I 2ZAEB 3H1KG 3BRTB 3KZIE 3TSIA 4XA4A 1VQ7P 3G9RA 1NJIQ
chains in the Genus database with same CATH topology
2E43A 1JO5A 3B8EB 3RK3C 1JTHB 2LKMA 3H6PA 4XE5B 1IFDA 2KOGA 1NKZB 2NPSB 1SFCD 2J58A 3RL0D 2P7JA 4ZKPA 3PP5A 1SFCC 1ZN5A 2I1KA 1L0NK 2JEEA 1JMMA 1HWTC 1HUCA 1URQA 2HYNA 3G3ZA 5APXA 2FFDA 1GK4A 2I1JA 1FZBA 2Q5UA 1OXZA 3HD7A 5AW9B 3BVHA 1HJBA 4WY4A 3VP9A 3BASA 3HE4B 2O1JA 3M06A 5AW1B 1GU4A 3P8MC 4N3YB 1RE3C 1FZCA 1N7SA 2POHA 2VRSA 4GKGA 1LTJA 2QM8A 1LGHB 1LTIC 4AYCA 1N73C 1XTCC 3MIWA 1CI6A 1NH4A 3NMDA 2WTYA 1LTGC 1X79B 5CJ4A 3IR9A 1L4AB 1SP4A 2KP8A 4LLHA 4W7ZA 3KYQA 3U59A 5CMZA 3SWYA 1LT9C 2HPCB 5AVQB 1KILD 3V4QA 1RF1B 1GL2B 1KILC 2HFED 2OYHA 1CZQA 3HE5A 3A5TA 1ZR4A 1H8AA 2JJLA 5CCHD 1GD2E 2KSJA 3H32B 3M0AA 1SQQK 2YO3A 1SVFA 5CCHC 1KZUB 2C9NY 1HGZA 3BATA 2R5BA 3RK3B 1KFMA 1ZV8A 1YTZT 3HTKB 2YKOA 2N1TB 2WT7A 2R3CA 5CJ0A 3RK2B 4WBAA 2H43A 1FZGA 5AW0B 2YMYA 4W80A 1FJPA 3GHGC 1JTHA 5AW5B 3MTUE 1YTZI 5CCGA 1EQ7A 2FXMA 2NPSA 5CHXA 3M0DA 2M8RA 4EIJA 1JY2P 2FYZA 3KPEA 3A7OA 1H89A 5AVXB 1HH0A 5AW8B 2WSFH 4M3LA 4AQRD 5AVYB 5APQA 1AQ5A 1FZFA 1HVVA 1GTWA 4HH2A 2Q3IA 1LTTC 1J1EC 1IFIA 1JY2O 3LIDA 1SQBK 2WPRA 3VMXA 3TYYA 2QM7A 1SLQA 2IX7C 1WRGA 3I5CA 5AVVB 3MUDA 1QL2A 2IPPA 1T2KD 2YO2A 1URQD 3HE4A 4DZOA 5BU5A 5AVRB 2IFNA 1T2KC 1NTMK 1URQC 3CL3D 2FFDC 3HD7D 4GT1A 3B5NB 4WY4D 3N7NA 3TK1A 3HD7C 4LGDE 4OH8B 4C7NB 2MJZA 1VDFA 4WY4C 5APTA 4Y99B 1J1DB 1L4AA 1N7SD 2R32A 3RL0C 1GW4A 5APVA 2M3BA 3NTNA 3OAKA 1JCCA 2HPCA 1FZCC 3C9IA 1N7SC 2O1KA 1LTJC 1RF1A 3U1AA 1GL2A 1M1JB 3P8CD 3CI9A 2P1JA 4C7RA 1L0LK 1LTAC 5KJ7A 1ZR2A 2WSCH 1RE4A 2OYIB 1NHLA 1VPCA 3EQ2A 2WZ7A 3V4WA 1IO4A 3TNUB 1HBWA 1G1IA 2C0WA 1GK6A 3M9BA 2W27A 1NOHA 1JCDA 3HTKA 1LWUB 5AVZB 2OYHC 2GM4A 4I6MC 3P7KA 2N1TA 3OA7A 4RESB 2KB7P 2ZFCA 5KTBA 3HUSB 4LC1A 1CSBA 2HLOA 4AUWA 1XTGB 1J1EB 4IFFA 2FKWB 5AW4B 3MD0A 1S9KE 5CCGD 1JY3N 1GU5A 1FZEA 1SQVK 1N2DC 5AVWB 1G1JA 5CCGC 1M7LA 3MGNA 3M0DC 3L36A 4B86A 1QL1A 1A02J 2P2UA 5AVSB 2YKQA 2WWWA 4DOJA 2H8PD 5AVUB 1PFIA 1MUUA 2PP6A 1E5WA 3LW5H 4IFDK 4WY4B 1HTLC 1SFCB 5AVTB 1OWAA 3RL0B 3M9QA 2N9BA 4IFMA 2PAJA 3B5NA 1FZAA 1FAVA 4HYTB 4N78E 2YNYA 2CPBA 2L5GB 4EOTA 5APUA 4C7NA 3VMZA 3R2PA 3M9HA 1NTKK 2XKMA 3N4XA 3P32A 3VMYA 1NWQA 1JOCA 3VTPC 5BU8B 2HODB 3UIAA 1M1JA 1J2JB 1RF0A 1L4AD 3LIEA 1IK9A 3A3YB 2XV5A 2OYIA 2W6AA 1NAFA 1AFOA 2Z5IA 3NFQA 1L4AC 1N73B 1T8ZA 1DX7A 3TNUA 1IFMA 1GL2D 2XU6A 4WB4A 1DEBA 1FDMA 5KJ7D 2HG5D 1RF1C 5AW3B 1GL2C 3EFGA 1IJDB 1LT9B 1NTZK 1LWUA 2W6BA 5KJ7C 4ZKUA 1FJKA 1YYCA 4I1LA 3V2NA 1JUNA 2BASA 1KILB 1T3JA 1MZ9A 2ZXEB 3HUSA 1FOSE 2C9LY 4JYBA 2A45G 3KDPB 2IFMA 1IC2A 2Q9IA 2N1TD 1WT6A 3RK2D 1FBMA 3V2PA 1N7LA 2A45H 2N1TC 2R5DA 3RK2C 4C46A 4GIFA 5BVZA 3H32A 5AW6B 2J59M 3V2RA 2E42A 2WPQA 1RY3A 1G2CB 2C0XA 3U1CA 2Z5HA 2P67A 1HGVA 3O8ZA 3GHGB 4I2LC 3P8CE 3CLQA 2WPSA 1KFNA 3OJAB 5APSA 3IFMA 1IFJA 1FU1A 1SFCA 4W7YA 2XZRA 3L35A 3VYIA 3WMM0 4O9BA 3VN0A 4KHXA 1W2EA 2KLVA 3II6A 1LTSC 3BRVB 5KLVK 2XDJA 3M91A 3V5BA 2Q7CA 1IFNA 5APWA 3B5ND 2NPSD 3L4FA 1S9KD 5APYA 3T97A 2HODA 3B5NC 2NPSC 2YKPA 1JNMA 2CPSA 1X9VA 1RE3A 1URQB 2KYVA 2FFDB 3SWFA 1FOSF 4Y99C 1JY3P 2FYUK 1J1DC 1NKNA 1N73A 2A45I 1NU1K 3HD7B 3V2QA 1GW3A 1GDTA 3VOPA 1M1JC 1LT9A 1RF0C 3VP8A 1Z56A 1FZCB 1N7SB 1JY3O 3HRNA 1H88A 2H7HA 4N78D 1LTBC 2OYIC 1LTJB 4JYCA 2XNXA 1JY2N 1KILA 1CI6B 1MV8A 5AW7B 2GUVA 2OARA 3E1IA 1X8YA 1NO4A 4N6JA 1SQPK 1DH3A 1A02F 5CCHA 1LWUC 1GZLA 5AW2B 1N86A 3KQGA 1T3UA 2WSEH 2OYHB 3HUSC 1CW5A 3HE5B 3BRTB 1G2CA 3NXSA 2WITA 3GHGA 3A2AA 2Z4EA 1SQXK 4JF7A 3TSIA 1RE4C 3L37A 4XA4A 1KQLA 2GUSA 1ZLLA 2O01H 2WT7B 3RK3D 1MFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IC2 A;  5BU5 A;  3OJA B;  1X79 B;  3U1A A;  3VP8 A;  3HRN A;  1WT6 A;  3P8C D;  4N78 D;  3U59 A;  3BAT A;  5KTB A;  3N4X A;  3VP9 A;  4GIF A;  5BU8 B;  3BAS A;  5BVZ A;  4O9B A;  3N7N A;  4ZKP A;  4ZKU A;  1NKN A;  4N3Y B;  4I1L A;  2POH A;  2JEE A;  3U1C A;  2FXM A;  3C9I A; 
#chains in the Genus database with same CATH topology
 2NZ2 A;  2E43 A;  1JO5 A;  3RK3 C;  1EZV D;  2WQY C;  3WU2 E;  3H1H E;  1SFC D;  2QJY C;  4EI2 A;  1U7J A;  1ZN5 A;  3C8V A;  2ZJS E;  3PTZ A;  4PV1 B;  1HUC A;  3AE9 C;  3G3Z A;  1BE3 D;  2RKL A;  1JM0 A;  1YHQ P;  5AW9 B;  1SQP E;  4WY4 A;  2G8Y A;  4H44 D;  1PPJ E;  1VQ9 P;  1SQB D;  3HE4 B;  1RE3 C;  3PH0 A;  2POH A;  1USE A;  2VRS A;  4GOE A;  1LGH B;  3A0H H;  1XTC C;  4RKU J;  2WTY A;  1X79 B;  1YQ4 C;  5KLI C;  3WUT A;  3U59 A;  5CMZ A;  3V4Q A;  3G6E P;  1RF1 B;  3L71 D;  1KQF B;  2OYH A;  1CZQ A;  3M0A A;  1BE3 J;  3D70 A;  2I8D A;  2YO3 A;  2L91 A;  4OWF A;  2R5B A;  1SQB J;  3L75 G;  1YTZ T;  2YKO A;  2R3C A;  1UII A;  2YMY A;  3MTU E;  2AEF A;  5CCG A;  1EXI A;  1EQ7 A;  2FYZ A;  3A7O A;  5AVX B;  1HH0 A;  2WSF H;  2YIU B;  3H1I G;  5APQ A;  5AVY B;  2Q3I A;  3L71 J;  1IFI A;  3L73 E;  3VMX A;  1BGY D;  2B87 A;  1SLQ A;  4H44 B;  2A06 D;  2QG4 A;  3W67 A;  3I5C A;  1T2K C;  1PP9 D;  4WY4 D;  1DD3 A;  1R5S A;  1OW7 A;  2ZT9 D;  3IAO A;  3QH9 A;  1SQQ E;  2MJZ A;  5APT A;  1J1D B;  1GW4 A;  2IBZ G;  2P58 A;  5K5G B;  4R4M A;  1N7S C;  1LTJ C;  3FWN A;  4ZMD A;  3TGU G;  2KS1 B;  1M1J B;  3P8C D;  1S5L H;  4IL6 H;  1KQG B;  4C7R A;  2FBW C;  2WSC H;  1YJW P;  1BGY J;  1QGK B;  2WPV B;  4U3F E;  4WVZ A;  3P7K A;  2N1T A;  2W90 A;  3OA7 A;  1PP9 J;  5KAF H;  2WSE J;  2JWA A;  4LC1 A;  1OVU A;  3D6Z A;  1XTG B;  1TU3 F;  5AW4 B;  1EC5 A;  5CCG D;  3WUU A;  2FXP A;  1RQU A;  4UB8 E;  3L36 A;  2P2U A;  1S2E A;  2WWW A;  5AVU B;  3PLN A;  1E5W A;  3H1J E;  3LW5 H;  4PV1 C;  4WY4 B;  1HTL C;  1PGJ A;  2KZJ A;  1DIP A;  2QA4 P;  1L0L E;  3H1L E;  2ZT9 B;  4HB1 A;  1FAV A;  2YNY A;  4EOT A;  5APU A;  1S3J A;  1S72 P;  5KKZ B;  3Q2Y A;  1N8R Q;  1EZV G;  1J2J B;  1IK9 A;  3A3Y B;  1NAF A;  2KZI A;  1N73 B;  2P10 A;  2QSI A;  1RF1 C;  3AEF C;  1FJK A;  4GOD A;  3Q5R A;  1SQB G;  3L70 G;  3HUS A;  1FOS E;  4PD4 E;  4IOI H;  2N1T D;  2SPZ A;  2E74 D;  1N7L A;  4Z1M H;  4H0L B;  2A45 H;  1NTM G;  3SWK A;  4C46 A;  5BVZ A;  4A7P A;  1SQP D;  2J59 M;  3I56 P;  1PPJ D;  1G2C B;  2K88 A;  1NTK E;  3O8Z A;  3GHG B;  1MKM A;  3L71 G;  1BDD A;  1L0N G;  2JWD A;  5GTI H;  3RGU A;  2YIU C;  5APS A;  1EZV I;  1IFJ A;  1M1K Q;  1FC2 C;  4W7Y A;  4DCK A;  3VYI A;  4KHX A;  1W2E A;  1Y8A A;  2KLV A;  5B66 E;  1VQ6 P;  3II6 A;  1FDO A;  3CX5 H;  2D2C B;  3V5B A;  4TLF A;  1JMB A;  3L4F A;  3T97 A;  2HOD A;  3L72 G;  2NPS C;  2YKP A;  1SQP J;  1Q81 Q;  1FOS F;  1L2P A;  1J1D C;  3HD7 B;  1Q86 Q;  2AXT E;  1M1J C;  1LT9 A;  1OVV A;  1RF0 C;  1FZC B;  1JY3 O;  1SQV G;  2E75 B;  2QVA A;  1KIL A;  2GUV A;  1X8Y A;  1PP9 G;  4N6J A;  4MN4 C;  3L73 D;  3CCV P;  5CCH A;  1AVO A;  4K35 A;  1BCC G;  3CCS P;  1VQM P;  3FGA D;  3Q1M A;  3HE5 B;  2QRX A;  5KLV E;  3NXS A;  3PHL A;  2YXR B;  2K37 A;  3A2A A;  2Z4E A;  2OGU A;  1PIX A;  1SQX K;  4IL6 X;  3L37 A;  1KTM A;  4U7J A;  5E79 E;  3AEB C;  4RJT A;  3BCC G;  2W83 C;  2LKM A;  1DD4 A;  3IF4 A;  1ZP0 C;  3H6P A;  3FXD A;  1KYO E;  3GLM A;  2G3A A;  2LR2 A;  3PP5 A;  3A0B H;  3L73 J;  3K5B A;  1NTZ G;  5DJT B;  1L0N K;  1W5C E;  1HWT C;  5KAI H;  1URQ A;  3GG2 A;  5APX A;  2FFD A;  1GK4 A;  4HJG H;  4U3F D;  5KKZ C;  2FXO A;  3CCQ P;  1HJB A;  3H25 A;  1GU4 A;  2E76 D;  2M3E A;  2RN0 A;  4N3Y B;  5L8R J;  2Y9Z A;  4AYC A;  2NRG A;  1N73 C;  2ZVN B;  2M5A B;  1CI6 A;  3NMD A;  2V7Q H;  5TJH A;  3IR9 A;  4W7Z A;  2N9Y B;  2HPC B;  1KIL D;  3PRJ A;  1PGP A;  1GL2 B;  2YMK A;  1ZR4 A;  1AV1 A;  1VF5 C;  5CCH D;  1GD2 E;  3TF5 A;  3H1J D;  3W68 A;  4U3F J;  3CMA P;  3H1L D;  1L0L D;  4H0L C;  1KZU B;  3AEE C;  1LNQ A;  1ZV8 A;  3MP7 B;  3HTK B;  3Q3D A;  1AVY A;  2WT7 A;  2BCC E;  5CJ0 A;  3RK2 B;  4WBA A;  2K9Y A;  3GHG C;  1JTH A;  2NPS A;  3L74 G;  2M8R A;  3H1H G;  4EIJ A;  2HR3 A;  4L75 A;  5AW8 B;  1AQ5 A;  1GTW A;  1LTT C;  1J1E C;  3FX0 A;  1JY2 O;  2WPR A;  3TYY A;  2QM7 A;  2IX7 C;  2D2C C;  1WRG A;  3H1J J;  4OGQ D;  5AVV B;  1QL2 A;  2IPP A;  3H1L J;  1L0L J;  1URQ D;  5BU5 A;  4QMA A;  2K9J A;  3S9O A;  3IN6 A;  4PD4 D;  4GT1 A;  3N7N A;  3HD7 C;  4OH8 B;  4C7N B;  1VDF A;  1IK7 A;  3RK3 E;  1BSH A;  1L4A A;  3RL0 C;  2R32 A;  2M3B A;  4UB6 E;  3NTN A;  1JCC A;  1FZC C;  5GTH H;  1NTK D;  2E75 C;  3RBX A;  1YIJ P;  3ABV C;  1LTA C;  5KJ7 A;  2IZ1 A;  1NHL A;  1FE6 A;  1VPC A;  3TNU B;  2C0W A;  1NOH A;  1LT1 A;  2KNC A;  5AVZ B;  2ZVO B;  4PJ0 H;  1HF9 A;  1SQX D;  2O01 N;  2HLO A;  2KSE A;  3A0B E;  1H0T B;  4HKZ H;  1K04 A;  3Q5P A;  3KHU A;  1NTK J;  2O01 J;  1G1J A;  3L73 G;  2IDB A;  1M7L A;  1T6A A;  1UIX A;  3M0D C;  4B86 A;  2YKQ A;  2H8P D;  1GMJ A;  4IFD K;  4H13 D;  1ZRT E;  1SFC B;  2PGD A;  1OWA A;  2FYU G;  2JR8 A;  1NU1 G;  3M9Q A;  4IFM A;  3B5N A;  1S1C X;  4HYT B;  2L5G B;  1PGO A;  1S4X A;  3MUD C;  1SQQ G;  3M9H A;  3P32 A;  4RO0 A;  1JOC A;  3VTP C;  1ZOY C;  2WSC J;  1USD A;  5DJU B;  5KLV D;  3D71 A;  5TIS H;  1KC8 Q;  1L4A D;  2QJP B;  2XV5 A;  2OYI A;  2W6A A;  3NFQ A;  1P84 E;  1DX7 A;  1KB9 E;  1FDM A;  1DEB A;  5KJ7 D;  1GL2 C;  4DT0 A;  1KOR A;  5B5E H;  1LWU A;  4ZKU A;  4D6T G;  3L75 E;  3V2N A;  1KYO D;  2AXC A;  3KDP B;  3V2P A;  4BXL A;  3CXH H;  3RK2 C;  5KLV J;  3H32 A;  3H1I E;  4BWN A;  2O3J A;  3JCU H;  2WPQ A;  2C0X A;  2Z5H A;  5C39 A;  2Q3E A;  3OJA B;  3IFM A;  3CCM P;  2E5Y A;  3EFF K;  4BRY A;  3CC7 P;  3B5N D;  2IBZ E;  3CCE P;  1KIL E;  3QWO C;  1JNM A;  1X9V A;  1RE3 A;  4GDO A;  3SWF A;  1VF5 D;  2FYU K;  1NKN A;  1NU1 K;  2Y0D A;  2R44 A;  2BCC D;  3V2Q A;  1GW3 A;  5H2F H;  3A0H E;  1H88 A;  1LTB C;  2XNX A;  2ZYG A;  1EDI A;  4JBZ A;  2QJK B;  2OAR A;  2OTL P;  1NO4 A;  1KD1 Q;  3O6Q A;  1K05 A;  2WSE H;  2OYH B;  1CW5 A;  4L73 A;  4ZNC A;  1NAY A;  1VQP P;  3E7K A;  1BE3 G;  2BCC J;  2MKV A;  1RE4 C;  4NPD A;  2BEQ D;  2LXC B;  2GUS A;  2ZXX A;  4EDF A;  4YPC A;  1VQL P;  3RK3 D;  3A5T A;  3MZW B;  3B8E B;  2KIK A;  4XE5 B;  1IFD A;  2KOG A;  1NKZ B;  3RL0 D;  4JQ0 D;  2UWJ E;  4ASW A;  1HJ0 A;  3D6Y A;  2YXQ B;  1SFC C;  2I1K A;  2KXP B;  3AE3 C;  2Y9Y A;  1VQK P;  2I1J A;  2B87 B;  2Q5U A;  1OXZ A;  4PD4 I;  3BVH A;  3VP9 A;  1R5L A;  3BAS A;  2O1J A;  5AW1 B;  3P8M C;  4H44 C;  2QJP C;  1N7S A;  3PJS K;  4GKG A;  2DW3 A;  1LTJ A;  2QM8 A;  3AE4 C;  2FYN B;  1SQX E;  2ZYD A;  3CWB E;  3L70 E;  1SP4 A;  2KP8 A;  4LLH A;  2QEX P;  3KYQ A;  1S5L E;  3SWY A;  4IL6 E;  2PRR A;  3CXH E;  2J5U A;  3MHV A;  1KQS O;  2BEZ F;  2KSJ A;  3H32 B;  1IFP A;  1OW8 A;  2H89 C;  1ZRT D;  2ZYA A;  1BGY G;  5EFW B;  2C9N Y;  2A06 G;  1QVF O;  3BAT A;  5KAF E;  3RK3 B;  1L0N E;  2JDI H;  1KFM A;  3KZI H;  1OVR A;  2N1T B;  2E74 B;  1FZG A;  4K3A A;  4W80 A;  1FJP A;  5CHX A;  2OQQ A;  1EDK A;  2B89 A;  3KPE A;  3AEG C;  1X22 A;  3WU2 H;  4AQR D;  1FZF A;  3ZDM A;  1P84 D;  2Y0E A;  3L72 E;  1KB9 D;  1SQB K;  4YXW H;  1KV4 A;  3L75 D;  1T2K D;  2YO2 A;  3HE4 A;  3F5H A;  5AVR B;  1NTM K;  1VQ8 P;  3G4S P;  1SQV E;  4LGD E;  2W6J H;  4WY4 C;  1N7S D;  2ZT9 C;  3H1I D;  1OIP A;  2O1K A;  1RF1 A;  2P1J A;  1BCC E;  1OFC X;  1RE4 A;  2QJK C;  3EQ2 A;  3AE2 C;  3FXE A;  1LJ2 A;  1G1I A;  2K1A A;  1KYO I;  1U57 A;  3L75 J;  1GK6 A;  3M9B A;  2RH0 A;  2OYH C;  2GM4 A;  2WMM A;  4I6M C;  2BCC G;  5KTB A;  3HUS B;  2IBZ D;  1CSB A;  4IFF A;  2FKW B;  3H1I J;  3AEC C;  4GOF A;  3SFE C;  2B9B A;  1JY3 N;  1FZE A;  1SQV K;  1NTZ E;  1N2D C;  5GTI E;  5AVW B;  3TDK A;  5CCG C;  3MGN A;  4EYY Q;  1YBK A;  1QL1 A;  4PV1 D;  1PFI A;  1MUU A;  2AEM A;  2PP6 A;  5M1B A;  3RBZ A;  4NPE A;  3CX5 E;  1U7M A;  2N9B A;  2PAJ A;  1FZA A;  2XKM A;  3N4X A;  1NWQ A;  2PFX A;  4I7Z B;  3T97 B;  2HOD B;  3UIA A;  2H88 C;  2KS1 A;  1M1J A;  1RF0 A;  2FYN C;  3GF3 A;  2QE7 H;  2E76 B;  1SQP G;  2Z5I A;  2XND H;  3S4R A;  1T8Z A;  1PPJ G;  1IFM A;  3RL0 g;  2XU6 A;  1JEK A;  4WB4 A;  2HG5 D;  3EFG A;  1LT9 B;  5CBN A;  1ZW0 A;  1NTZ K;  1PL5 A;  3USS A;  1JUN A;  2BAS A;  1EDJ A;  1KIL B;  2GA1 A;  4YTP C;  1MZ9 A;  4L76 A;  1FBM A;  1VQO P;  3G71 P;  3L74 E;  2N1T C;  1Q2N A;  2OYO A;  2E74 C;  3H1K E;  3V2R A;  3I55 P;  2E42 A;  1RY3 A;  4KJM A;  3U1C A;  2P67 A;  1KFN A;  1PV3 A;  4UB8 H;  3CCJ P;  1FU1 A;  3CPW O;  2WSF J;  1QVG O;  3CWB D;  1FDI A;  3L70 D;  3WMM 0;  4O9B A;  1K9M Q;  3CXH D;  1NTM D;  5KAI E;  1IFN A;  2JKV A;  5APW A;  2NPS D;  1S9K D;  4OGQ B;  2Q1K A;  4XFJ A;  2Q6Q A;  1URQ B;  1YQ3 C;  4R4L A;  2K3R A;  2FFD B;  1L0N D;  3C1L A;  1JY3 P;  1N73 A;  1KN7 A;  4WWI A;  1GDT A;  3VP8 A;  3HRN A;  1OMI A;  4N78 D;  1SQX J;  3CWB J;  1KMI Z;  3L70 J;  1ZXG A;  1JY2 N;  1CI6 B;  1MV8 A;  3JC2 2;  2WVR A;  3L72 D;  1SQP K;  1NTM J;  1A02 F;  1MFT A;  2M0B A;  3AE5 C;  3B71 A;  5AW2 B;  1N86 A;  4PD4 H;  2V4H A;  3KQG A;  1IZN B;  1T3U A;  3HUS C;  1G2C A;  2WIT A;  1L0N J;  3GHG A;  4TT3 H;  4JF7 A;  4U3F G;  1SQV D;  1KQL A;  1ZLL A;  2O01 H;  2WT7 B;  1BDC A;  1MFZ A;  2FYU E;  1RH5 B;  1JTH B;  1NU1 E;  2JP3 A;  2NPS B;  1P84 I;  2J58 A;  4JPZ B;  2P7J A;  3EWK A;  3L72 J;  1BCC D;  5B66 H;  1KB9 I;  1M8O B;  4ZKP A;  2IZ0 A;  2E5T A;  2JEE A;  1JMM A;  3LW5 J;  1K8A Q;  3GW6 A;  2HYN A;  1FZB A;  4H13 B;  3S1K A;  3HD7 A;  4I7Z C;  3H1J G;  3M06 A;  2K9J B;  1L0L G;  3BCC D;  1E79 H;  3H1L G;  1Y9B A;  1SQV J;  1FZC A;  2E76 C;  3VMA A;  2AXT H;  1DEE G;  1LTI C;  4D6T E;  3MIW A;  3SFD C;  1NH4 A;  5GTH E;  1LTG C;  5CJ4 A;  1L4A B;  3CD6 P;  1NTZ D;  1LT9 C;  5AVQ B;  1BCC J;  3TGU E;  4KT0 J;  1Q82 Q;  1KIL C;  2HFE D;  2R3S A;  3HE5 A;  1H8A A;  2JJL A;  2Y0C A;  4H0L D;  1M57 D;  3FWL A;  1SQQ K;  3ITK A;  1SVF A;  5CCH C;  3CX5 D;  4PJ0 E;  2CK3 H;  1HGZ A;  2KNC B;  2IBZ I;  3BCC J;  2H43 A;  5AW0 B;  5AW5 B;  5E79 H;  1YTZ I;  1RHZ B;  3GF7 A;  2FXM A;  3M0D A;  1QEX A;  1JY2 P;  2IYP A;  1H89 A;  1NTZ J;  1W2B O;  4M3L A;  1YJN P;  1LP1 A;  1HVV A;  4HH2 A;  1KYO H;  2D2C D;  1NTK G;  3LID A;  1FS0 E;  1M90 Q;  1VQ5 P;  1AQT A;  3MUD A;  4OGQ C;  3B4S A;  4DZO A;  2IFN A;  3KXD A;  1OW6 A;  1URQ C;  3CL3 D;  2FFD C;  3HD7 D;  1Q7Y Q;  3B5N B;  3TK1 A;  2M5A A;  3L74 D;  3AEA C;  3H1H D;  4Y99 B;  1QX8 A;  4Y28 J;  1SQX G;  5TIS E;  3CWB G;  5APV A;  3H1K D;  4CPG A;  2E75 D;  3OAK A;  2HPC A;  1VF5 B;  3C9I A;  1EZV E;  3U1A A;  3Q5S A;  2IYO A;  1GL2 A;  3CCL P;  3CI9 A;  1L0L K;  1ZR2 A;  2OYI B;  1RQV A;  2WZ7 A;  3V4W A;  1IO4 A;  5B5E E;  2W8Z A;  1HBW A;  2W27 A;  1BE3 E;  1JCD A;  3HTK A;  1LWU B;  4RES B;  1SQB E;  2KB7 P;  2ZFC A;  1YI2 P;  3V6I A;  2ITA A;  3L74 J;  3H1H J;  4AUW A;  1J1E B;  3AE8 C;  3H1K J;  3JCU E;  1NTM E;  3AED C;  3MD0 A;  1S9K E;  1GU5 A;  1OZH A;  5KLV G;  1PGQ A;  1PZQ A;  3L71 E;  1A02 J;  5AVS B;  4DOJ A;  1JB0 J;  2QJY B;  2QIW A;  3CXH I;  1YIT P;  1NVO A;  5AVT B;  1OX3 A;  3WUV A;  4OVN F;  3RL0 B;  3OW2 O;  4H13 C;  4N78 E;  1VQN P;  2CPB A;  4C7N A;  1R8E A;  3VMZ A;  3R2P A;  1QLE D;  1NTK K;  4BRY B;  3VMY A;  1AJY A;  1X0T A;  2KK7 A;  5BU8 B;  1AA0 A;  1WMK A;  2KUB A;  4UB6 H;  3LIE A;  4YXD C;  5H2F E;  1AFO A;  4ASV A;  1L4A C;  3TNU A;  1GL2 D;  2V7Q J;  3AE7 C;  3CC2 P;  5KLI B;  3CC4 P;  2FYU D;  1BGY E;  5AW3 B;  1IJD B;  1NU1 D;  3SSU A;  2A06 E;  1S5L X;  2W6B A;  1NYH A;  2FY8 A;  5KJ7 C;  1YYC A;  4I1L A;  4DJG A;  1EDL A;  1SQQ D;  1T3J A;  2KLU A;  2ZXE B;  5CBO A;  2C9L Y;  4JYB A;  1D7M A;  3CME P;  2A45 G;  1PP9 E;  1IC2 A;  2IFM A;  1Q90 D;  2Q9I A;  1WT6 A;  3O6Q B;  1H0T A;  3RK2 D;  3R4Y A;  1SS1 A;  2R5D A;  3JSV C;  2AEJ A;  4GIF A;  2KI7 B;  5AW6 B;  1LP1 B;  1EXJ A;  1YJ9 P;  1HGV A;  2JO1 A;  4I2L C;  3P8C E;  3CLQ A;  2WPS A;  4D6T D;  2FYU J;  1NU1 J;  3BCC E;  1SFC A;  2XZR A;  3L35 A;  3VN0 A;  1SQQ J;  1LTS C;  3BRV B;  5KLV K;  3TGU D;  2XDJ A;  3M91 A;  1VL2 A;  2Q7C A;  2OTJ P;  2OTK E;  5APY A;  3AE6 C;  1K73 Q;  2WSS H;  3B5N C;  2CPS A;  2KYV A;  3GMA A;  4Y99 C;  2A45 I;  1NGM B;  1Y47 A;  4L74 A;  3VOP A;  1ZME C;  4D6T J;  2LXB A;  1P84 H;  1Z56 A;  1N7S B;  2H7H A;  2OYI C;  1LTJ B;  4JYC A;  1KB9 H;  3F89 A;  3CCU P;  3CCR P;  4NPF X;  1BSN A;  1VQ4 P;  1M56 D;  5AW7 B;  2B88 A;  2RMZ A;  3TGU J;  3E1I A;  3AE1 C;  3E1R A;  1DH3 A;  1LWU C;  1GZL A;  3CX5 I;  2ZAE B;  3H1K G;  3BRT B;  3KZI E;  3TSI A;  4XA4 A;  1VQ7 P;  3G9R A;  1NJI Q; 
#chains in the Genus database with same CATH homology
 2E43 A;  1JO5 A;  3B8E B;  3RK3 C;  1JTH B;  2LKM A;  3H6P A;  4XE5 B;  1IFD A;  2KOG A;  1NKZ B;  2NPS B;  1SFC D;  2J58 A;  3RL0 D;  2P7J A;  4ZKP A;  3PP5 A;  1SFC C;  1ZN5 A;  2I1K A;  1L0N K;  2JEE A;  1JMM A;  1HWT C;  1HUC A;  1URQ A;  2HYN A;  3G3Z A;  5APX A;  2FFD A;  1GK4 A;  2I1J A;  1FZB A;  2Q5U A;  1OXZ A;  3HD7 A;  5AW9 B;  3BVH A;  1HJB A;  4WY4 A;  3VP9 A;  3BAS A;  3HE4 B;  2O1J A;  3M06 A;  5AW1 B;  1GU4 A;  3P8M C;  4N3Y B;  1RE3 C;  1FZC A;  1N7S A;  2POH A;  2VRS A;  4GKG A;  1LTJ A;  2QM8 A;  1LGH B;  1LTI C;  4AYC A;  1N73 C;  1XTC C;  3MIW A;  1CI6 A;  1NH4 A;  3NMD A;  2WTY A;  1LTG C;  1X79 B;  5CJ4 A;  3IR9 A;  1L4A B;  1SP4 A;  2KP8 A;  4LLH A;  4W7Z A;  3KYQ A;  3U59 A;  5CMZ A;  3SWY A;  1LT9 C;  2HPC B;  5AVQ B;  1KIL D;  3V4Q A;  1RF1 B;  1GL2 B;  1KIL C;  2HFE D;  2OYH A;  1CZQ A;  3HE5 A;  3A5T A;  1ZR4 A;  1H8A A;  2JJL A;  5CCH D;  1GD2 E;  2KSJ A;  3H32 B;  3M0A A;  1SQQ K;  2YO3 A;  1SVF A;  5CCH C;  1KZU B;  2C9N Y;  1HGZ A;  3BAT A;  2R5B A;  3RK3 B;  1KFM A;  1ZV8 A;  1YTZ T;  3HTK B;  2YKO A;  2N1T B;  2WT7 A;  2R3C A;  5CJ0 A;  3RK2 B;  4WBA A;  2H43 A;  1FZG A;  5AW0 B;  2YMY A;  4W80 A;  1FJP A;  3GHG C;  1JTH A;  5AW5 B;  3MTU E;  1YTZ I;  5CCG A;  1EQ7 A;  2FXM A;  2NPS A;  5CHX A;  3M0D A;  2M8R A;  4EIJ A;  1JY2 P;  2FYZ A;  3KPE A;  3A7O A;  1H89 A;  5AVX B;  1HH0 A;  5AW8 B;  2WSF H;  4M3L A;  4AQR D;  5AVY B;  5APQ A;  1AQ5 A;  1FZF A;  1HVV A;  1GTW A;  4HH2 A;  2Q3I A;  1LTT C;  1J1E C;  1IFI A;  1JY2 O;  3LID A;  1SQB K;  2WPR A;  3VMX A;  3TYY A;  2QM7 A;  1SLQ A;  2IX7 C;  1WRG A;  3I5C A;  5AVV B;  3MUD A;  1QL2 A;  2IPP A;  1T2K D;  2YO2 A;  1URQ D;  3HE4 A;  4DZO A;  5BU5 A;  5AVR B;  2IFN A;  1T2K C;  1NTM K;  1URQ C;  3CL3 D;  2FFD C;  3HD7 D;  4GT1 A;  3B5N B;  4WY4 D;  3N7N A;  3TK1 A;  3HD7 C;  4LGD E;  4OH8 B;  4C7N B;  2MJZ A;  1VDF A;  4WY4 C;  5APT A;  4Y99 B;  1J1D B;  1L4A A;  1N7S D;  2R32 A;  3RL0 C;  1GW4 A;  5APV A;  2M3B A;  3NTN A;  3OAK A;  1JCC A;  2HPC A;  1FZC C;  3C9I A;  1N7S C;  2O1K A;  1LTJ C;  1RF1 A;  3U1A A;  1GL2 A;  1M1J B;  3P8C D;  3CI9 A;  2P1J A;  4C7R A;  1L0L K;  1LTA C;  5KJ7 A;  1ZR2 A;  2WSC H;  1RE4 A;  2OYI B;  1NHL A;  1VPC A;  3EQ2 A;  2WZ7 A;  3V4W A;  1IO4 A;  3TNU B;  1HBW A;  1G1I A;  2C0W A;  1GK6 A;  3M9B A;  2W27 A;  1NOH A;  1JCD A;  3HTK A;  1LWU B;  5AVZ B;  2OYH C;  2GM4 A;  4I6M C;  3P7K A;  2N1T A;  3OA7 A;  4RES B;  2KB7 P;  2ZFC A;  5KTB A;  3HUS B;  4LC1 A;  1CSB A;  2HLO A;  4AUW A;  1XTG B;  1J1E B;  4IFF A;  2FKW B;  5AW4 B;  3MD0 A;  1S9K E;  5CCG D;  1JY3 N;  1GU5 A;  1FZE A;  1SQV K;  1N2D C;  5AVW B;  1G1J A;  5CCG C;  1M7L A;  3MGN A;  3M0D C;  3L36 A;  4B86 A;  1QL1 A;  1A02 J;  2P2U A;  5AVS B;  2YKQ A;  2WWW A;  4DOJ A;  2H8P D;  5AVU B;  1PFI A;  1MUU A;  2PP6 A;  1E5W A;  3LW5 H;  4IFD K;  4WY4 B;  1HTL C;  1SFC B;  5AVT B;  1OWA A;  3RL0 B;  3M9Q A;  2N9B A;  4IFM A;  2PAJ A;  3B5N A;  1FZA A;  1FAV A;  4HYT B;  4N78 E;  2YNY A;  2CPB A;  2L5G B;  4EOT A;  5APU A;  4C7N A;  3VMZ A;  3R2P A;  3M9H A;  1NTK K;  2XKM A;  3N4X A;  3P32 A;  3VMY A;  1NWQ A;  1JOC A;  3VTP C;  5BU8 B;  2HOD B;  3UIA A;  1M1J A;  1J2J B;  1RF0 A;  1L4A D;  3LIE A;  1IK9 A;  3A3Y B;  2XV5 A;  2OYI A;  2W6A A;  1NAF A;  1AFO A;  2Z5I A;  3NFQ A;  1L4A C;  1N73 B;  1T8Z A;  1DX7 A;  3TNU A;  1IFM A;  1GL2 D;  2XU6 A;  4WB4 A;  1DEB A;  1FDM A;  5KJ7 D;  2HG5 D;  1RF1 C;  5AW3 B;  1GL2 C;  3EFG A;  1IJD B;  1LT9 B;  1NTZ K;  1LWU A;  2W6B A;  5KJ7 C;  4ZKU A;  1FJK A;  1YYC A;  4I1L A;  3V2N A;  1JUN A;  2BAS A;  1KIL B;  1T3J A;  1MZ9 A;  2ZXE B;  3HUS A;  1FOS E;  2C9L Y;  4JYB A;  2A45 G;  3KDP B;  2IFM A;  1IC2 A;  2Q9I A;  2N1T D;  1WT6 A;  3RK2 D;  1FBM A;  3V2P A;  1N7L A;  2A45 H;  2N1T C;  2R5D A;  3RK2 C;  4C46 A;  4GIF A;  5BVZ A;  3H32 A;  5AW6 B;  2J59 M;  3V2R A;  2E42 A;  2WPQ A;  1RY3 A;  1G2C B;  2C0X A;  3U1C A;  2Z5H A;  2P67 A;  1HGV A;  3O8Z A;  3GHG B;  4I2L C;  3P8C E;  3CLQ A;  2WPS A;  1KFN A;  3OJA B;  5APS A;  3IFM A;  1IFJ A;  1FU1 A;  1SFC A;  4W7Y A;  2XZR A;  3L35 A;  3VYI A;  3WMM 0;  4O9B A;  3VN0 A;  4KHX A;  1W2E A;  2KLV A;  3II6 A;  1LTS C;  3BRV B;  5KLV K;  2XDJ A;  3M91 A;  3V5B A;  2Q7C A;  1IFN A;  5APW A;  3B5N D;  2NPS D;  3L4F A;  1S9K D;  5APY A;  3T97 A;  2HOD A;  3B5N C;  2NPS C;  2YKP A;  1JNM A;  2CPS A;  1X9V A;  1RE3 A;  1URQ B;  2KYV A;  2FFD B;  3SWF A;  1FOS F;  4Y99 C;  1JY3 P;  2FYU K;  1J1D C;  1NKN A;  1N73 A;  2A45 I;  1NU1 K;  3HD7 B;  3V2Q A;  1GW3 A;  1GDT A;  3VOP A;  1M1J C;  1LT9 A;  1RF0 C;  3VP8 A;  1Z56 A;  1FZC B;  1N7S B;  1JY3 O;  3HRN A;  1H88 A;  2H7H A;  4N78 D;  1LTB C;  2OYI C;  1LTJ B;  4JYC A;  2XNX A;  1JY2 N;  1KIL A;  1CI6 B;  1MV8 A;  5AW7 B;  2GUV A;  2OAR A;  3E1I A;  1X8Y A;  1NO4 A;  4N6J A;  1SQP K;  1DH3 A;  1A02 F;  5CCH A;  1LWU C;  1GZL A;  5AW2 B;  1N86 A;  3KQG A;  1T3U A;  2WSE H;  2OYH B;  3HUS C;  1CW5 A;  3HE5 B;  3BRT B;  1G2C A;  3NXS A;  2WIT A;  3GHG A;  3A2A A;  2Z4E A;  1SQX K;  4JF7 A;  3TSI A;  1RE4 C;  3L37 A;  4XA4 A;  1KQL A;  2GUS A;  1ZLL A;  2O01 H;  2WT7 B;  3RK3 D;  1MFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...