3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords General transcriptional corepressor TUP1
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
3HRNA 2POHA 4N3YB 5BVZA 1NKNA 3VP9A 4ZKUA 3N7NA 3U1CA 1WT6A 4N78D 3VP8A 5KTBA 3C9IA 4ZKPA 3N4XA 4O9BA 1X79B 2FXMA 2JEEA 3BASA 3U1AA 4GIFA 3U59A 5BU5A 5BU8B 1IC2A 3OJAB 4I1LA 3BATA 3P8CD
chains in the Genus database with same CATH superfamily
2IBZD 2R3CA 3B5NC 1YITP 5K5GB 2BCCD 2POHA 2W6JH 1VQ7P 1N73B 2Q9IA 4HJGH 2D2CC 4LGDE 1HGVA 5CCHC 3TNUA 1QVGO 3CD6P 2WWWA 1GL2B 1LP1A 3EQ2A 1X9VA 3B8EB 4M3LA 1LWUC 3TDKA 2E42A 1GDTA 3FXEA 2J5UA 1HJ0A 5E79H 1SQPG 1BGYE 2JP3A 1RH5B 3N4XA 1BGYG 3AE8C 1SQQK 2Y0EA 1X79B 1X8YA 3H1LG 1MKMA 5CCGD 1QX8A 1Y47A 3RK2D 3WMM0 1L0NK 1EC5A 2E75C 3GF7A 4GOEA 2P67A 4HYTB 4L74A 4U3FG 3TYYA 3OJAB 1AV1A 3CCLP 1NTZJ 1QL2A 3NFQA 5AVRB 3I56P 3GLMA 2P2UA 2LXCB 3II6A 1WMKA 1SQXJ 1JEKA 2A06G 2L5GB 2NPSB 1NTKJ 4ASVA 3G71P 1KYOE 3HUSB 3H1IE 4JYCA 3HE5A 4EDFA 3Q3DA 3VMYA 2OYHA 1N7SB 1NTZK 3PRJA 2E76B 3AE3C 5KKZC 1NTME 4TT3H 2M8RA 1KB9I 4EIJA 3V6IA 5GTIE 1USDA 1JO5A 1SQXG 4NPDA 3RK3C 1P84I 3L71D 1JTHB 1PGQA 4U3FJ 5KLIC 3L71J 5AW6B 3I55P 4KHXA 4YTPC 3E1IA 2MJZA 1W5CE 2WPQA 3V5BA 5KJ7A 5KLVJ 2RMZA 2WT7B 1J1DB 2K1AA 2QJYC 1GL2C 1AVYA 2BCCG 1VQ5P 1LT9A 4EI2A 2KXPB 3U1AA 4YXWH 5KLVG 2C9NY 2FYUD 1S9KE 1S72P 1SQPJ 3U59A 5E79E 4DCKA 2W8ZA 3H32A 3VTPC 4YXDC 1JMBA 1ZP0C 3GHGB 3HD7B 4GODA 1Y9BA 3HTKB 2IFMA 4PV1D 2HLOA 1JY2O 2GA1A 5AVVB 1L0LD 1M1JB 3VMAA 4CPGA 4RJTA 2QJKC 2YKPA 3L74E 3EFGA 4I2LC 1PFIA 3M9HA 1ZR2A 2LR2A 2OYIB 2QG4A 1P84E 1NTMK 1KILC 2B9BA 3FGAD 3W68A 1NTKE 2RN0A 3N7NA 1SQBK 1YJWP 1LTAC 3MUDC 2WPSA 2ZYGA 4H44B 1NKZB 1Q81Q 2G8YA 2V4HA 1IO4A 4D6TD 2W83C 3RBXA 1AVOA 1Y8AA 3JC22 1QEXA 4I6MC 4OWFA 1P84H 5AW2B 3CCEP 1HF9A 1FZEA 1QLED 2HYNA 3AE4C 1KC8Q 2HR3A 3S1KA 2N1TD 5AVUB 1YYCA 4PD4E 1PV3A 3R4YA 4RESB 1JOCA 5BU5A 2C0XA 3BCCD 3CXHH 1YI2P 1G1IA 1JMMA 1LGHB 1OVRA 3VN0A 1RE4C 1PGOA 3L75D 1JNMA 4H13B 3R2PA 5CBOA 1FJKA 1OFCX 3P7KA 1NU1J 2A45G 3PLNA 2YKQA 1VPCA 2IZ1A 2OGUA 4GT1A 4TLFA 5APTA 4ZKUA 2N1TB 5KLVE 4R4LA 2J58A 1SQXK 1G2CB 1L2PA 1LTTC 1BSNA 1VQOP 2QRXA 3CMAP 1NVOA 3L70J 4UB8H 1DEEG 3KDPB 1T2KC 3AEAC 5CCGA 2BASA 2JJLA 2YNYA 5APXA 3SFEC 3RK2C 3L75J 2ITAA 4AUWA 2WSFH 1FAVA 1YBKA 2OYOA 3HE4B 4C7NB 2D2CD 1BE3J 3H1IJ 2HODA 3O6QB 3JSVC 3QH9A 4PJ0E 3SWYA 3A3YB 4WY4B 3A0HH 4Y99B 1NTKG 2KB7P 4DJGA 1EZVE 3A7OA 3E7KA 3H1KE 4JQ0D 1S5LE 4U3FE 1VQ6P 2E74C 2B87B 1FZBA 3A0BH 3SFDC 5L8RJ 3VYIA 1CI6B 4U3FD 1H89A 2JKVA 2Q7CA 1VL2A 1SQPK 3CC4P 3H1LJ 1YTZI 5BVZA 3H1JJ 3SWFA 3CXHI 1BGYJ 1IFPA 5GTHH 2AEMA 1SQXE 3H1LE 1H88A 1ZRTE 2Q6QA 1L0NE 3V4WA 3CCUP 2R5BA 3CI9A 2XU6A 3B4SA 2I1KA 3M91A 3Q5RA 1VQKP 3CC2P 3AE7C 2IYPA 1YJNP 1SQXD 2FBWC 3L35A 1VQ4P 3RL0C 1FJPA 1M7LA 3M06A 1GU4A 3O8ZA 1CW5A 2K3RA 2M5AA 4QMAA 2O01H 2WSCJ 2OTJP 1ZN5A 3HUSC 4L76A 2O01J 2ZJSE 4ZMDA 3CX5H 1URQC 4LLHA 4BRYB 1BCCD 1L4AC 1MZ9A 1NTMG 2M0BA 2DW3A 2UWJE 3CL3D 2E74D 1SQQD 3V4QA 1VQ9P 1R8EA 1EZVD 1NTZE 1L4AB 2WITA 2XDJA 2Z5IA 3BRVB 1KORA 2R3SA 1ZRTD 2IDBA 4XFJA 3L73E 5B5EE 5CJ4A 1Q7YQ 1M56D 2ZYAA 2YMKA 2B88A 3AE9C 4WY4D 5AVQB 1CZQA 1OW6A 4GOFA 3CCJP 4AYCA 2A45H 3C1LA 2E75B 1K8AQ 2FYNC 3U1CA 1SFCD 2YXRB 3L4FA 1OXZA 3S4RA 2W27A 1K05A 1T3UA 1GTWA 1NJIQ 4D6TG 3V2QA 1N73A 1G1JA 1LTJA 1NYHA 5KAIH 2OYHB 1SQVJ 3AEFC 2Q1KA 5APQA 1SLQA 3Q5SA 1VDFA 4RO0A 1GL2A 1LP1B 2YKOA 2C0WA 3TGUJ 2YO3A 1EDKA 2KUBA 1GU5A 1VQ8P 3M9BA 3JCUE 1FE6A 1KV4A 1NU1E 2ZAEB 2LXBA 2KYVA 3BCCE 1IC2A 2JWDA 2W6BA 3BCCG 4I7ZB 3FX0A 3KXDA 4H44C 4WBAA 5AW1B 4BXLA 1RF1C 3RL0g 1KILD 1OW7A 2FYUG 2ZVOB 2KLUA 3V2PA 2BEZF 1N7LA 2P1JA 1VQMP 3KZIE 3GW6A 1RF1B 1DH3A 2KSEA 4DOJA 2KNCA 2FFDA 1KILE 2N9BA 1H0TB 2K9YA 2KS1A 4N6JA 3L73J 2W90A 2ZT9B 3HE5B 2I8DA 4W7YA 2ZVNB 3VP8A 2QM8A 3TF5A 2WZ7A 5AVYB 2HPCA 2NRGA 1FS0E 1KFNA 2IBZI 1HTLC 1M57D 5KLIB 4L73A 4H13C 2QJYB 4BWNA 1T8ZA 1Q90D 3BASA 3P8MC 1RF0A 4H44D 5KAFH 1W2BO 1M8OB 1SFCB 2AXTE 4GIFA 3VMXA 3FXDA 1RF0C 1R5SA 1L0LE 2FKWB 3NXSA 1KB9E 1WRGA 2RKLA 3L36A 1FZCB 3GF3A 2ZT9C 3L72E 3AE5C 3EWKA 3L72J 1NAFA 3WU2H 3I5CA 3CMEP 1KFMA 1L0LJ 1P84D 1L0NJ 1KYOI 1PGPA 1NU1D 3TK1A 2B89A 3NMDA 3PJSK 2QJKB 4OH8B 2P7JA 1J1EB 1VF5B 1JB0J 1NAYA 2O1KA 2KZIA 1S2EA 1BGYD 3HTKA 4HB1A 5H2FH 4EOTA 3IAOA 2OYIC 1JUNA 1M1JA 2R32A 1Q2NA 3UIAA 1KTMA 3VOPA 2IFNA 4AQRD 5TISE 3ABVC 1RY3A 2FYUE 1L4AD 3C9IA 1JCCA 2FXOA 2IPPA 1URQB 2WSCH 3H1KJ 2Y9YA 3HD7D 1SQBD 2ZXXA 5AVWB 2XV5A 1QVFO 1N86A 1T6AA 1FZAA 1XTCC 3BRTB 2XKMA 4IOIH 3V2RA 1LWUB 1KQLA 1SQVE 2IBZG 3MZWB 3P8CE 2JO1A 1SQQE 2E75D 2P10A 3H1HJ 1PIXA 3H1HE 3HD7C 3K5BA 1SQQG 2G3AA 4PV1C 4KT0J 2NZ2A 1LNQA 1NTZD 3B5NA 1GK6A 3M9QA 5CBNA 1N73C 3PP5A 2Z4EA 1L0ND 4Y99C 1NTMD 1EDJA 1LTBC 2K9JB 1GL2D 1EZVI 4DT0A 3AEEC 3CLQA 1KD1Q 2E74B 3TNUB 4HKZH 1YHQP 1A02J 4R4MA 1RQUA 1SQPD 1X22A 2YXQB 1AQ5A 1PGJA 1U57A 2IYOA 1K04A 2NPSD 2QJPB 3GMAA 4ASWA 2XNDH 3USSA 1J1EC 1SQBJ 1URQD 3H1KD 3OAKA 4JF7A 2M3BA 3W67A 2QSIA 2WSFJ 2VRSA 4IL6H 5AW0B 1OWAA 2FYZA 1PPJG 3AE6C 2PGDA 3L73D 2CPBA 1Q82Q 2FFDC 3RL0B 5EFWB 1LT9C 1SFCC 1N7SA 2KI7B 4JPZB 4C7NA 5AW8B 2O1JA 5DJTB 2XNXA 4WY4A 1BCCG 3CWBE 3M0DC 4OGQB 1VQPP 1BCCE 3CWBG 3RGUA 2YIUB 1A02F 3CC7P 3H1ID 1SS1A 2N1TC 1YTZT 2YMYA 1IFJA 2QIWA 5CJ0A 1FOSF 3V2NA 1JTHA 1FC2C 3L74J 1HBWA 1L0LK 1EDIA 2NPSA 1NU1K 3FWLA 4C46A 5AVZB 2AEFA 3HUSA 1HUCA 2OQQA 3L72D 3L70E 2O3JA 5TISH 4MN4C 1NWQA 1H8AA 1KB9D 1LT9B 5APYA 2Y0DA 2D2CB 4UB6E 5B66E 4ZKPA 3VMZA 3CCVP 4I7ZC 4IL6X 1NHLA 3T97B 3A5TA 3TGUD 2Y0CA 1BE3E 1ZXGA 3GHGA 5CCHD 4WVZA 1KILB 2HG5D 4C7RA 2JEEA 3L75E 4UB6H 3AEDC 1RQVA 1L0LG 2K88A 1FDMA 2M5AB 3ITKA 3H25A 1M1JC 1OMIA 1LT1A 4N78E 5CMZA 5KJ7D 3KYQA 4NPFX 1M1KQ 4PD4D 1S5LX 2JDIH 3AE2C 3BATA 2KSJA 2Y9ZA 2AXTH 4BRYA 1EXJA 3KQGA 1HVVA 3L74G 1PP9G 4N3YB 1QL1A 3B71A 3HD7A 1L4AA 3M0AA 3D6ZA 2Q3IA 1BCCJ 4OGQC 1U7JA 1KYOD 2AXCA 1PL5A 3RK3D 3CCQP 1T2KD 1SQQJ 1HWTC 2KIKA 2FYNB 4D6TE 2WMMA 3MP7B 3OW2O 1QGKB 1DX7A 1S9KD 5KKZB 3M0DA 3MGNA 1E79H 2FFDB 2LKMA 2FXPA 1VF5D 1NGMB 3LW5H 1PP9J 1GW4A 3IR9A 2FYUJ 1PP9D 3SWKA 4H0LD 1MFTA 4ZNCA 5TJHA 3A2AA 2XZRA 3L37A 4HH2A 1X0TA 1RE3A 2L91A 3RL0D 4I1LA 1G2CA 2FYUK 4XE5B 5KLVD 3WUVA 1K73Q 1FZFA 1FOSE 4H0LC 2GUSA 3JCUH 3AE1C 1KZUB 5APSA 3RBZA 4W7ZA 1EQ7A 1TU3F 2HFED 2KOGA 1FZCC 5B66H 2GUVA 3CCSP 3MD0A 1GW3A 3BVHA 1FDIA 2E76D 3KHUA 4XA4A 1WT6A 3IN6A 2HODB 3L72G 5APWA 3WU2E 1LTIC 3WUTA 1RF1A 3H1HG 5KTBA 4W80A 3G4SP 1HJBA 2N1TA 1VQNP 1UIXA 1W2EA 2JWAA 2KNCB 3KPEA 1S1CX 2H88C 5CCGC 2E5TA 2P58A 1CI6A 1ZOYC 1BE3D 2PP6A 5AVTB 1J1DC 1OW8A 1S3JA 1SQVK 2FXMA 2QM7A 2QEXP 3CWBJ 1KQFB 2CPSA 3P32A 1HH0A 3IF4A 1EZVG 2RH0A 1ZLLA 3AEBC 3G6EP 3L70D 2WSEJ 3O6QA 1U7MA 2YO2A 4K3AA 2V7QH 1T3JA 5H2FE 2V7QJ 3IFMA 3H1LD 3HRNA 2E76C 1EDLA 1YQ3C 3CX5E 3Q2YA 1NKNA 2O01N 1GK4A 4GKGA 1DEBA 3H1JD 2FY8A 2J59M 4IL6E 1IZNB 5AW7B 2ZYDA 1SQBG 5CHXA 3B5ND 5AVSB 4JBZA 2OYHC 2WT7A 3G3ZA 1IFMA 1KB9H 3L71E 3BCCJ 3S9OA 1KMIZ 1JY2P 4B86A 3D70A 1UIIA 4Z1MH 2Q5UA 3CX5D 1OIPA 1LTJC 2A06E 2KK7A 3H32B 3LIEA 1ZR4A 3Q1MA 2N9YB 1AFOA 1GD2E 1GMJA 3H1JG 1IK7A 2WPVB 3WUUA 3H1JE 2WSSH 3D71A 1FU1A 3E1RA 1OZHA 1RHZB 1NOHA 1OX3A 3MHVA 1URQA 3SSUA 1SQVG 2IBZE 3AECC 5KAIE 4Y28J 1AJYA 2OYIA 3L73G 3CCMP 1GZLA 1AQTA 1PP9E 1PPJD 1LWUA 2JR8A 3EFFK 3F5HA 1S5LH 2KLVA 2KP8A 1DIPA 4H13D 3A0HE 1IK9A 1LTJB 1R5LA 3VP9A 1JY3P 3H1KG 1BE3G 1IFNA 2QA4P 2CK3H 3B5NB 1ZMEC 1J2JB 4KJMA 4K35A 1KQSO 1MFZA 2MKVA 2PAJA 4IFFA 5B5EH 4JYBA 2WSEH 3QWOC 2ZT9D 3RK3E 4EYYQ 4OVNF 3H1HD 1LTSC 2Z5HA 3C8VA 1BDDA 5KJ7C 2WQYC 3H6PA 2H89C 3GG2A 1YQ4C 1JY3N 3GHGC 2WVRA 3MTUE 5AW4B 1IFIA 3LW5J 2GM4A 2QJPC 4IFDK 3OA7A 2QVAA 3G9RA 1EXIA 1MV8A 1L0NG 2WPRA 5APUA 1KQGB 1NU1G 1IFDA 1CSBA 2I1JA 1D7MA 2W6AA 3F89A 4PV1B 5CCHA 4D6TJ 2PFXA 4U7JA 2A45I 5DJUB 5C39A 2KS1B 2R5DA 2K37A 1NTKD 3NTNA 5KAFE 2IZ0A 4IFMA 2BCCE 1MUUA 4LC1A 1S4XA 1NH4A 4PD4H 1VQLP 1JM0A 4WB4A 2YIUC 2E5YA 1RE4A 5AW3B 3CCRP 1NO4A 3HE4A 1N7SC 3ZDMA 1JY2N 3LIDA 1LTGC 1SVFA 3PTZA 2H8PD 3A0BE 1XTGB 1NTMJ 3RK3B 1BDCA 2QE7H 1PZQA 1SFCA 5M1BA 1H0TA 1N7SD 2B87A 2H7HA 4WY4C 1OVVA 3KZIH 1VF5C 4WWIA 2ZXEB 4PJ0H 1FBMA 1Z56A 3PH0A 4H0LB 3CXHD 1YIJP 2C9LY 1BSHA 3L75G 5BU8B 4DZOA 1NTKK 2A06D 2Q3EA 4RKUJ 2HPCB 3T97A 1JY3O 2NPSC 1KILA 2BEQD 2R44A 3AEGC 4NPEA 3CPWO 2AEJA 3MUDA 2OARA 1SQPE 5GTHE 3TGUE 5APVA 3D6YA 3TGUG 1N2DC 1YJ9P 2BCCJ 1FZCA 1AA0A 3P8CD 1LJ2A 1M90Q 1DD4A 1PPJE 1E5WA 1ZW0A 3MIWA 5KLVK 1FZGA 3L71G 2SPZA 2WTYA 4N78D 1ZV8A 4L75A 1Q86Q 4PD4I 1FDOA 3CXHE 2M3EA 4OGQD 2OTKE 1USEA 1JCDA 2KZJA 5GTIH 1KN7A 4O9BA 5AW9B 1N8RQ 2H43A 1RE3C 3H1IG 3PHLA 4A7PA 3L74D 5AW5B 2OTLP 3CWBD 2ZFCA 1KYOH 1K9MQ 1OVUA 1SQBE 2IX7C 2K9JA 1SP4A 1IJDB 3CX5I 3FWNA 4GDOA 4YPCA 3TSIA 1HGZA 1NTZG 3L70G 4UB8E 2E43A 3RK2B 1DD3A 5AVXB 2PRRA 1SQVD 3Q5PA
chains in the Genus database with same CATH topology
2R3CA 3B5NC 2POHA 1N73B 2Q9IA 4LGDE 1HGVA 5CCHC 3TNUA 2WWWA 1GL2B 3EQ2A 4M3LA 1X9VA 3B8EB 2E42A 1LWUC 1GDTA 3N4XA 1SQQK 1X79B 1X8YA 5CCGD 3RK2D 3WMM0 1L0NK 4HYTB 2P67A 3TYYA 3OJAB 1QL2A 3NFQA 5AVRB 2FFDB 3II6A 2P2UA 2L5GB 2NPSB 3HUSB 4JYCA 2OYHA 3HE5A 3VMYA 1N7SB 1NTZK 2M8RA 4EIJA 1JO5A 3RK3C 1JTHB 5AW6B 4KHXA 3E1IA 2MJZA 3V5BA 2WPQA 5KJ7A 2WT7B 1J1DB 1GL2C 1LT9A 2C9NY 3U1AA 1S9KE 3U59A 3VTPC 3H32A 3GHGB 3HD7B 3HTKB 2IFMA 2HLOA 1JY2O 5AVVB 1M1JB 2YKPA 3EFGA 4I2LC 1PFIA 3M9HA 1ZR2A 2OYIB 1NTMK 1KILC 3N7NA 1SQBK 1LTAC 2WPSA 1NKZB 1IO4A 4I6MC 5AW2B 1FZEA 2HYNA 2N1TD 5AVUB 1YYCA 4RESB 1JOCA 5BU5A 2C0XA 1G1IA 1JMMA 1LGHB 3VN0A 1RE4C 3R2PA 1FJKA 3P7KA 2A45G 2YKQA 1VPCA 4GT1A 5APTA 4ZKUA 2N1TB 2J58A 1SQXK 1G2CB 1LTTC 3KDPB 1T2KC 5CCGA 2BASA 2JJLA 2YNYA 5APXA 3RK2C 4AUWA 2WSFH 1FAVA 3HE4B 4C7NB 1JNMA 2HODA 3SWYA 3A3YB 4WY4B 4Y99B 2KB7P 3A7OA 1FZBA 3VYIA 1CI6B 1H89A 2Q7CA 1SQPK 1YTZI 5BVZA 3SWFA 1H88A 3V4WA 2R5BA 3CI9A 2XU6A 3M91A 2I1KA 3L35A 3RL0C 1M7LA 3M06A 1GU4A 3O8ZA 1CW5A 2O01H 1ZN5A 3HUSC 1URQC 4LLHA 3CL3D 1L4AC 1MZ9A 3V4QA 2Z5IA 2WITA 1L4AB 2XDJA 3BRVB 5CJ4A 4WY4D 5AVQB 1CZQA 4AYCA 2A45H 3U1CA 1SFCD 3L4FA 1OXZA 2W27A 1T3UA 1GTWA 3V2QA 1N73A 1G1JA 1LTJA 5APQA 1SLQA 1VDFA 1GL2A 2YKOA 2C0WA 2YO3A 1GU5A 3M9BA 2KYVA 1IC2A 2W6BA 4WBAA 5AW1B 1RF1C 1KILD 3V2PA 2P1JA 1N7LA 1RF1B 1DH3A 4DOJA 2FFDA 2N9BA 4N6JA 3HE5B 4W7YA 3VP8A 2QM8A 2WZ7A 5AVYB 2HPCA 1KFNA 1HTLC 1T8ZA 3BASA 3P8MC 1RF0A 1SFCB 4GIFA 3VMXA 1RF0C 3NXSA 2FKWB 1WRGA 1FZCB 3L36A 1NAFA 3I5CA 1KFMA 3TK1A 3NMDA 4OH8B 2P7JA 3HTKA 1J1EB 2O1KA 4EOTA 2OYIC 1JUNA 1M1JA 2R32A 3UIAA 3VOPA 2IFNA 4AQRD 3C9IA 1RY3A 1L4AD 1JCCA 2IPPA 1URQB 2WSCH 3HD7D 5AVWB 2XV5A 1N86A 3BRTB 1FZAA 1XTCC 2XKMA 3V2RA 1LWUB 1KQLA 3P8CE 3HD7C 3B5NA 3M9QA 1N73C 1GK6A 3PP5A 2Z4EA 4Y99C 1LTBC 1GL2D 3CLQA 1A02J 1AQ5A 2NPSD 1J1EC 1URQD 4JF7A 3OAKA 2M3BA 2VRSA 5AW0B 1OWAA 2FYZA 2CPBA 2FFDC 3RL0B 1LT9C 1SFCC 1N7SA 4C7NA 5AW8B 2O1JA 2XNXA 4WY4A 3M0DC 1A02F 2N1TC 1YTZT 2YMYA 1IFJA 5CJ0A 1FOSF 3V2NA 1JTHA 1HBWA 1L0LK 2NPSA 1NU1K 4C46A 5AVZB 1NWQA 3HUSA 1HUCA 1H8AA 2OYHB 5APYA 1LT9B 4ZKPA 3VMZA 1NHLA 3A5TA 3GHGA 5CCHD 1KILB 2HG5D 4C7RA 2JEEA 1FDMA 1M1JC 4N78E 5CMZA 5KJ7D 3KYQA 3BATA 2KSJA 3KQGA 1HVVA 4N3YB 1QL1A 3HD7A 1L4AA 3M0AA 2Q3IA 3RK3D 1T2KD 1HWTC 1DX7A 1S9KD 3M0DA 3MGNA 2LKMA 3LW5H 1GW4A 3IR9A 3A2AA 2XZRA 3L37A 4HH2A 3RL0D 1RE3A 3TNUB 1FOSE 4I1LA 1G2CA 2FYUK 4XE5B 1FZFA 2GUSA 1KZUB 5APSA 4W7ZA 1EQ7A 2HFED 2KOGA 1FZCC 2GUVA 3MD0A 1GW3A 3BVHA 4XA4A 1WT6A 5APWA 2HODB 1LTIC 1RF1A 5KTBA 4W80A 1HJBA 2N1TA 1W2EA 3KPEA 5CCGC 1CI6A 2PP6A 5AVTB 1J1DC 1SQVK 2FXMA 2CPSA 3P32A 1HH0A 1ZLLA 2YO2A 1T3JA 3IFMA 3HRNA 1NKNA 4GKGA 1GK4A 1DEBA 2J59M 5AW7B 5CHXA 5AVSB 3B5ND 2OYHC 2WT7A 3G3ZA 1IFMA 1JY2P 4B86A 2Q5UA 3LIEA 1FJPA 1LTJC 3H32B 1ZR4A 1AFOA 1GD2E 1FU1A 1NOHA 1URQA 2OYIA 1GZLA 1LWUA 2KLVA 2KP8A 1IK9A 1LTJB 3VP9A 1JY3P 1IFNA 3B5NB 1J2JB 1MFZA 2PAJA 4IFFA 4JYBA 2WSEH 1LTSC 2Z5HA 5KJ7C 3H6PA 5AW4B 3GHGC 1JY3N 2GM4A 3MTUE 1IFIA 4IFDK 3OA7A 1MV8A 2WPRA 5APUA 1IFDA 1CSBA 2I1JA 2W6AA 5CCHA 2A45I 2R5DA 3NTNA 4IFMA 1MUUA 4LC1A 1NH4A 4WB4A 1RE4A 5AW3B 1NO4A 3HE4A 1N7SC 1JY2N 3LIDA 1LTGC 1SVFA 2H8PD 1XTGB 3RK3B 1SFCA 1N7SD 2H7HA 4WY4C 2ZXEB 1FBMA 1Z56A 2C9LY 5BU8B 4DZOA 1NTKK 2HPCB 3T97A 1JY3O 2NPSC 1KILA 3MUDA 2OARA 5APVA 1N2DC 1FZCA 1E5WA 5KLVK 3MIWA 1FZGA 2WTYA 4N78D 1ZV8A 1JCDA 4O9BA 5AW9B 2H43A 1RE3C 5AW5B 2ZFCA 2IX7C 3TSIA 1SP4A 1IJDB 1HGZA 2E43A 3RK2B 5AVXB 2QM7A 3P8CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HRN A;  2POH A;  4N3Y B;  5BVZ A;  1NKN A;  3VP9 A;  4ZKU A;  3N7N A;  3U1C A;  1WT6 A;  4N78 D;  3VP8 A;  5KTB A;  3C9I A;  4ZKP A;  3N4X A;  4O9B A;  1X79 B;  2FXM A;  2JEE A;  3BAS A;  3U1A A;  4GIF A;  3U59 A;  5BU5 A;  5BU8 B;  1IC2 A;  3OJA B;  4I1L A;  3BAT A;  3P8C D; 
#chains in the Genus database with same CATH topology
 2IBZ D;  2R3C A;  3B5N C;  1YIT P;  5K5G B;  2BCC D;  2POH A;  2W6J H;  1VQ7 P;  1N73 B;  2Q9I A;  4HJG H;  2D2C C;  4LGD E;  1HGV A;  5CCH C;  3TNU A;  1QVG O;  3CD6 P;  2WWW A;  1GL2 B;  1LP1 A;  3EQ2 A;  1X9V A;  3B8E B;  4M3L A;  1LWU C;  3TDK A;  2E42 A;  1GDT A;  3FXE A;  2J5U A;  1HJ0 A;  5E79 H;  1SQP G;  1BGY E;  2JP3 A;  1RH5 B;  3N4X A;  1BGY G;  3AE8 C;  1SQQ K;  2Y0E A;  1X79 B;  1X8Y A;  3H1L G;  1MKM A;  5CCG D;  1QX8 A;  1Y47 A;  3RK2 D;  3WMM 0;  1L0N K;  1EC5 A;  2E75 C;  3GF7 A;  4GOE A;  2P67 A;  4HYT B;  4L74 A;  4U3F G;  3TYY A;  3OJA B;  1AV1 A;  3CCL P;  1NTZ J;  1QL2 A;  3NFQ A;  5AVR B;  3I56 P;  3GLM A;  2P2U A;  2LXC B;  3II6 A;  1WMK A;  1SQX J;  1JEK A;  2A06 G;  2L5G B;  2NPS B;  1NTK J;  4ASV A;  3G71 P;  1KYO E;  3HUS B;  3H1I E;  4JYC A;  3HE5 A;  4EDF A;  3Q3D A;  3VMY A;  2OYH A;  1N7S B;  1NTZ K;  3PRJ A;  2E76 B;  3AE3 C;  5KKZ C;  1NTM E;  4TT3 H;  2M8R A;  1KB9 I;  4EIJ A;  3V6I A;  5GTI E;  1USD A;  1JO5 A;  1SQX G;  4NPD A;  3RK3 C;  1P84 I;  3L71 D;  1JTH B;  1PGQ A;  4U3F J;  5KLI C;  3L71 J;  5AW6 B;  3I55 P;  4KHX A;  4YTP C;  3E1I A;  2MJZ A;  1W5C E;  2WPQ A;  3V5B A;  5KJ7 A;  5KLV J;  2RMZ A;  2WT7 B;  1J1D B;  2K1A A;  2QJY C;  1GL2 C;  1AVY A;  2BCC G;  1VQ5 P;  1LT9 A;  4EI2 A;  2KXP B;  3U1A A;  4YXW H;  5KLV G;  2C9N Y;  2FYU D;  1S9K E;  1S72 P;  1SQP J;  3U59 A;  5E79 E;  4DCK A;  2W8Z A;  3H32 A;  3VTP C;  4YXD C;  1JMB A;  1ZP0 C;  3GHG B;  3HD7 B;  4GOD A;  1Y9B A;  3HTK B;  2IFM A;  4PV1 D;  2HLO A;  1JY2 O;  2GA1 A;  5AVV B;  1L0L D;  1M1J B;  3VMA A;  4CPG A;  4RJT A;  2QJK C;  2YKP A;  3L74 E;  3EFG A;  4I2L C;  1PFI A;  3M9H A;  1ZR2 A;  2LR2 A;  2OYI B;  2QG4 A;  1P84 E;  1NTM K;  1KIL C;  2B9B A;  3FGA D;  3W68 A;  1NTK E;  2RN0 A;  3N7N A;  1SQB K;  1YJW P;  1LTA C;  3MUD C;  2WPS A;  2ZYG A;  4H44 B;  1NKZ B;  1Q81 Q;  2G8Y A;  2V4H A;  1IO4 A;  4D6T D;  2W83 C;  3RBX A;  1AVO A;  1Y8A A;  3JC2 2;  1QEX A;  4I6M C;  4OWF A;  1P84 H;  5AW2 B;  3CCE P;  1HF9 A;  1FZE A;  1QLE D;  2HYN A;  3AE4 C;  1KC8 Q;  2HR3 A;  3S1K A;  2N1T D;  5AVU B;  1YYC A;  4PD4 E;  1PV3 A;  3R4Y A;  4RES B;  1JOC A;  5BU5 A;  2C0X A;  3BCC D;  3CXH H;  1YI2 P;  1G1I A;  1JMM A;  1LGH B;  1OVR A;  3VN0 A;  1RE4 C;  1PGO A;  3L75 D;  1JNM A;  4H13 B;  3R2P A;  5CBO A;  1FJK A;  1OFC X;  3P7K A;  1NU1 J;  2A45 G;  3PLN A;  2YKQ A;  1VPC A;  2IZ1 A;  2OGU A;  4GT1 A;  4TLF A;  5APT A;  4ZKU A;  2N1T B;  5KLV E;  4R4L A;  2J58 A;  1SQX K;  1G2C B;  1L2P A;  1LTT C;  1BSN A;  1VQO P;  2QRX A;  3CMA P;  1NVO A;  3L70 J;  4UB8 H;  1DEE G;  3KDP B;  1T2K C;  3AEA C;  5CCG A;  2BAS A;  2JJL A;  2YNY A;  5APX A;  3SFE C;  3RK2 C;  3L75 J;  2ITA A;  4AUW A;  2WSF H;  1FAV A;  1YBK A;  2OYO A;  3HE4 B;  4C7N B;  2D2C D;  1BE3 J;  3H1I J;  2HOD A;  3O6Q B;  3JSV C;  3QH9 A;  4PJ0 E;  3SWY A;  3A3Y B;  4WY4 B;  3A0H H;  4Y99 B;  1NTK G;  2KB7 P;  4DJG A;  1EZV E;  3A7O A;  3E7K A;  3H1K E;  4JQ0 D;  1S5L E;  4U3F E;  1VQ6 P;  2E74 C;  2B87 B;  1FZB A;  3A0B H;  3SFD C;  5L8R J;  3VYI A;  1CI6 B;  4U3F D;  1H89 A;  2JKV A;  2Q7C A;  1VL2 A;  1SQP K;  3CC4 P;  3H1L J;  1YTZ I;  5BVZ A;  3H1J J;  3SWF A;  3CXH I;  1BGY J;  1IFP A;  5GTH H;  2AEM A;  1SQX E;  3H1L E;  1H88 A;  1ZRT E;  2Q6Q A;  1L0N E;  3V4W A;  3CCU P;  2R5B A;  3CI9 A;  2XU6 A;  3B4S A;  2I1K A;  3M91 A;  3Q5R A;  1VQK P;  3CC2 P;  3AE7 C;  2IYP A;  1YJN P;  1SQX D;  2FBW C;  3L35 A;  1VQ4 P;  3RL0 C;  1FJP A;  1M7L A;  3M06 A;  1GU4 A;  3O8Z A;  1CW5 A;  2K3R A;  2M5A A;  4QMA A;  2O01 H;  2WSC J;  2OTJ P;  1ZN5 A;  3HUS C;  4L76 A;  2O01 J;  2ZJS E;  4ZMD A;  3CX5 H;  1URQ C;  4LLH A;  4BRY B;  1BCC D;  1L4A C;  1MZ9 A;  1NTM G;  2M0B A;  2DW3 A;  2UWJ E;  3CL3 D;  2E74 D;  1SQQ D;  3V4Q A;  1VQ9 P;  1R8E A;  1EZV D;  1NTZ E;  1L4A B;  2WIT A;  2XDJ A;  2Z5I A;  3BRV B;  1KOR A;  2R3S A;  1ZRT D;  2IDB A;  4XFJ A;  3L73 E;  5B5E E;  5CJ4 A;  1Q7Y Q;  1M56 D;  2ZYA A;  2YMK A;  2B88 A;  3AE9 C;  4WY4 D;  5AVQ B;  1CZQ A;  1OW6 A;  4GOF A;  3CCJ P;  4AYC A;  2A45 H;  3C1L A;  2E75 B;  1K8A Q;  2FYN C;  3U1C A;  1SFC D;  2YXR B;  3L4F A;  1OXZ A;  3S4R A;  2W27 A;  1K05 A;  1T3U A;  1GTW A;  1NJI Q;  4D6T G;  3V2Q A;  1N73 A;  1G1J A;  1LTJ A;  1NYH A;  5KAI H;  2OYH B;  1SQV J;  3AEF C;  2Q1K A;  5APQ A;  1SLQ A;  3Q5S A;  1VDF A;  4RO0 A;  1GL2 A;  1LP1 B;  2YKO A;  2C0W A;  3TGU J;  2YO3 A;  1EDK A;  2KUB A;  1GU5 A;  1VQ8 P;  3M9B A;  3JCU E;  1FE6 A;  1KV4 A;  1NU1 E;  2ZAE B;  2LXB A;  2KYV A;  3BCC E;  1IC2 A;  2JWD A;  2W6B A;  3BCC G;  4I7Z B;  3FX0 A;  3KXD A;  4H44 C;  4WBA A;  5AW1 B;  4BXL A;  1RF1 C;  3RL0 g;  1KIL D;  1OW7 A;  2FYU G;  2ZVO B;  2KLU A;  3V2P A;  2BEZ F;  1N7L A;  2P1J A;  1VQM P;  3KZI E;  3GW6 A;  1RF1 B;  1DH3 A;  2KSE A;  4DOJ A;  2KNC A;  2FFD A;  1KIL E;  2N9B A;  1H0T B;  2K9Y A;  2KS1 A;  4N6J A;  3L73 J;  2W90 A;  2ZT9 B;  3HE5 B;  2I8D A;  4W7Y A;  2ZVN B;  3VP8 A;  2QM8 A;  3TF5 A;  2WZ7 A;  5AVY B;  2HPC A;  2NRG A;  1FS0 E;  1KFN A;  2IBZ I;  1HTL C;  1M57 D;  5KLI B;  4L73 A;  4H13 C;  2QJY B;  4BWN A;  1T8Z A;  1Q90 D;  3BAS A;  3P8M C;  1RF0 A;  4H44 D;  5KAF H;  1W2B O;  1M8O B;  1SFC B;  2AXT E;  4GIF A;  3VMX A;  3FXD A;  1RF0 C;  1R5S A;  1L0L E;  2FKW B;  3NXS A;  1KB9 E;  1WRG A;  2RKL A;  3L36 A;  1FZC B;  3GF3 A;  2ZT9 C;  3L72 E;  3AE5 C;  3EWK A;  3L72 J;  1NAF A;  3WU2 H;  3I5C A;  3CME P;  1KFM A;  1L0L J;  1P84 D;  1L0N J;  1KYO I;  1PGP A;  1NU1 D;  3TK1 A;  2B89 A;  3NMD A;  3PJS K;  2QJK B;  4OH8 B;  2P7J A;  1J1E B;  1VF5 B;  1JB0 J;  1NAY A;  2O1K A;  2KZI A;  1S2E A;  1BGY D;  3HTK A;  4HB1 A;  5H2F H;  4EOT A;  3IAO A;  2OYI C;  1JUN A;  1M1J A;  2R32 A;  1Q2N A;  3UIA A;  1KTM A;  3VOP A;  2IFN A;  4AQR D;  5TIS E;  3ABV C;  1RY3 A;  2FYU E;  1L4A D;  3C9I A;  1JCC A;  2FXO A;  2IPP A;  1URQ B;  2WSC H;  3H1K J;  2Y9Y A;  3HD7 D;  1SQB D;  2ZXX A;  5AVW B;  2XV5 A;  1QVF O;  1N86 A;  1T6A A;  1FZA A;  1XTC C;  3BRT B;  2XKM A;  4IOI H;  3V2R A;  1LWU B;  1KQL A;  1SQV E;  2IBZ G;  3MZW B;  3P8C E;  2JO1 A;  1SQQ E;  2E75 D;  2P10 A;  3H1H J;  1PIX A;  3H1H E;  3HD7 C;  3K5B A;  1SQQ G;  2G3A A;  4PV1 C;  4KT0 J;  2NZ2 A;  1LNQ A;  1NTZ D;  3B5N A;  1GK6 A;  3M9Q A;  5CBN A;  1N73 C;  3PP5 A;  2Z4E A;  1L0N D;  4Y99 C;  1NTM D;  1EDJ A;  1LTB C;  2K9J B;  1GL2 D;  1EZV I;  4DT0 A;  3AEE C;  3CLQ A;  1KD1 Q;  2E74 B;  3TNU B;  4HKZ H;  1YHQ P;  1A02 J;  4R4M A;  1RQU A;  1SQP D;  1X22 A;  2YXQ B;  1AQ5 A;  1PGJ A;  1U57 A;  2IYO A;  1K04 A;  2NPS D;  2QJP B;  3GMA A;  4ASW A;  2XND H;  3USS A;  1J1E C;  1SQB J;  1URQ D;  3H1K D;  3OAK A;  4JF7 A;  2M3B A;  3W67 A;  2QSI A;  2WSF J;  2VRS A;  4IL6 H;  5AW0 B;  1OWA A;  2FYZ A;  1PPJ G;  3AE6 C;  2PGD A;  3L73 D;  2CPB A;  1Q82 Q;  2FFD C;  3RL0 B;  5EFW B;  1LT9 C;  1SFC C;  1N7S A;  2KI7 B;  4JPZ B;  4C7N A;  5AW8 B;  2O1J A;  5DJT B;  2XNX A;  4WY4 A;  1BCC G;  3CWB E;  3M0D C;  4OGQ B;  1VQP P;  1BCC E;  3CWB G;  3RGU A;  2YIU B;  1A02 F;  3CC7 P;  3H1I D;  1SS1 A;  2N1T C;  1YTZ T;  2YMY A;  1IFJ A;  2QIW A;  5CJ0 A;  1FOS F;  3V2N A;  1JTH A;  1FC2 C;  3L74 J;  1HBW A;  1L0L K;  1EDI A;  2NPS A;  1NU1 K;  3FWL A;  4C46 A;  5AVZ B;  2AEF A;  3HUS A;  1HUC A;  2OQQ A;  3L72 D;  3L70 E;  2O3J A;  5TIS H;  4MN4 C;  1NWQ A;  1H8A A;  1KB9 D;  1LT9 B;  5APY A;  2Y0D A;  2D2C B;  4UB6 E;  5B66 E;  4ZKP A;  3VMZ A;  3CCV P;  4I7Z C;  4IL6 X;  1NHL A;  3T97 B;  3A5T A;  3TGU D;  2Y0C A;  1BE3 E;  1ZXG A;  3GHG A;  5CCH D;  4WVZ A;  1KIL B;  2HG5 D;  4C7R A;  2JEE A;  3L75 E;  4UB6 H;  3AED C;  1RQV A;  1L0L G;  2K88 A;  1FDM A;  2M5A B;  3ITK A;  3H25 A;  1M1J C;  1OMI A;  1LT1 A;  4N78 E;  5CMZ A;  5KJ7 D;  3KYQ A;  4NPF X;  1M1K Q;  4PD4 D;  1S5L X;  2JDI H;  3AE2 C;  3BAT A;  2KSJ A;  2Y9Z A;  2AXT H;  4BRY A;  1EXJ A;  3KQG A;  1HVV A;  3L74 G;  1PP9 G;  4N3Y B;  1QL1 A;  3B71 A;  3HD7 A;  1L4A A;  3M0A A;  3D6Z A;  2Q3I A;  1BCC J;  4OGQ C;  1U7J A;  1KYO D;  2AXC A;  1PL5 A;  3RK3 D;  3CCQ P;  1T2K D;  1SQQ J;  1HWT C;  2KIK A;  2FYN B;  4D6T E;  2WMM A;  3MP7 B;  3OW2 O;  1QGK B;  1DX7 A;  1S9K D;  5KKZ B;  3M0D A;  3MGN A;  1E79 H;  2FFD B;  2LKM A;  2FXP A;  1VF5 D;  1NGM B;  3LW5 H;  1PP9 J;  1GW4 A;  3IR9 A;  2FYU J;  1PP9 D;  3SWK A;  4H0L D;  1MFT A;  4ZNC A;  5TJH A;  3A2A A;  2XZR A;  3L37 A;  4HH2 A;  1X0T A;  1RE3 A;  2L91 A;  3RL0 D;  4I1L A;  1G2C A;  2FYU K;  4XE5 B;  5KLV D;  3WUV A;  1K73 Q;  1FZF A;  1FOS E;  4H0L C;  2GUS A;  3JCU H;  3AE1 C;  1KZU B;  5APS A;  3RBZ A;  4W7Z A;  1EQ7 A;  1TU3 F;  2HFE D;  2KOG A;  1FZC C;  5B66 H;  2GUV A;  3CCS P;  3MD0 A;  1GW3 A;  3BVH A;  1FDI A;  2E76 D;  3KHU A;  4XA4 A;  1WT6 A;  3IN6 A;  2HOD B;  3L72 G;  5APW A;  3WU2 E;  1LTI C;  3WUT A;  1RF1 A;  3H1H G;  5KTB A;  4W80 A;  3G4S P;  1HJB A;  2N1T A;  1VQN P;  1UIX A;  1W2E A;  2JWA A;  2KNC B;  3KPE A;  1S1C X;  2H88 C;  5CCG C;  2E5T A;  2P58 A;  1CI6 A;  1ZOY C;  1BE3 D;  2PP6 A;  5AVT B;  1J1D C;  1OW8 A;  1S3J A;  1SQV K;  2FXM A;  2QM7 A;  2QEX P;  3CWB J;  1KQF B;  2CPS A;  3P32 A;  1HH0 A;  3IF4 A;  1EZV G;  2RH0 A;  1ZLL A;  3AEB C;  3G6E P;  3L70 D;  2WSE J;  3O6Q A;  1U7M A;  2YO2 A;  4K3A A;  2V7Q H;  1T3J A;  5H2F E;  2V7Q J;  3IFM A;  3H1L D;  3HRN A;  2E76 C;  1EDL A;  1YQ3 C;  3CX5 E;  3Q2Y A;  1NKN A;  2O01 N;  1GK4 A;  4GKG A;  1DEB A;  3H1J D;  2FY8 A;  2J59 M;  4IL6 E;  1IZN B;  5AW7 B;  2ZYD A;  1SQB G;  5CHX A;  3B5N D;  5AVS B;  4JBZ A;  2OYH C;  2WT7 A;  3G3Z A;  1IFM A;  1KB9 H;  3L71 E;  3BCC J;  3S9O A;  1KMI Z;  1JY2 P;  4B86 A;  3D70 A;  1UII A;  4Z1M H;  2Q5U A;  3CX5 D;  1OIP A;  1LTJ C;  2A06 E;  2KK7 A;  3H32 B;  3LIE A;  1ZR4 A;  3Q1M A;  2N9Y B;  1AFO A;  1GD2 E;  1GMJ A;  3H1J G;  1IK7 A;  2WPV B;  3WUU A;  3H1J E;  2WSS H;  3D71 A;  1FU1 A;  3E1R A;  1OZH A;  1RHZ B;  1NOH A;  1OX3 A;  3MHV A;  1URQ A;  3SSU A;  1SQV G;  2IBZ E;  3AEC C;  5KAI E;  4Y28 J;  1AJY A;  2OYI A;  3L73 G;  3CCM P;  1GZL A;  1AQT A;  1PP9 E;  1PPJ D;  1LWU A;  2JR8 A;  3EFF K;  3F5H A;  1S5L H;  2KLV A;  2KP8 A;  1DIP A;  4H13 D;  3A0H E;  1IK9 A;  1LTJ B;  1R5L A;  3VP9 A;  1JY3 P;  3H1K G;  1BE3 G;  1IFN A;  2QA4 P;  2CK3 H;  3B5N B;  1ZME C;  1J2J B;  4KJM A;  4K35 A;  1KQS O;  1MFZ A;  2MKV A;  2PAJ A;  4IFF A;  5B5E H;  4JYB A;  2WSE H;  3QWO C;  2ZT9 D;  3RK3 E;  4EYY Q;  4OVN F;  3H1H D;  1LTS C;  2Z5H A;  3C8V A;  1BDD A;  5KJ7 C;  2WQY C;  3H6P A;  2H89 C;  3GG2 A;  1YQ4 C;  1JY3 N;  3GHG C;  2WVR A;  3MTU E;  5AW4 B;  1IFI A;  3LW5 J;  2GM4 A;  2QJP C;  4IFD K;  3OA7 A;  2QVA A;  3G9R A;  1EXI A;  1MV8 A;  1L0N G;  2WPR A;  5APU A;  1KQG B;  1NU1 G;  1IFD A;  1CSB A;  2I1J A;  1D7M A;  2W6A A;  3F89 A;  4PV1 B;  5CCH A;  4D6T J;  2PFX A;  4U7J A;  2A45 I;  5DJU B;  5C39 A;  2KS1 B;  2R5D A;  2K37 A;  1NTK D;  3NTN A;  5KAF E;  2IZ0 A;  4IFM A;  2BCC E;  1MUU A;  4LC1 A;  1S4X A;  1NH4 A;  4PD4 H;  1VQL P;  1JM0 A;  4WB4 A;  2YIU C;  2E5Y A;  1RE4 A;  5AW3 B;  3CCR P;  1NO4 A;  3HE4 A;  1N7S C;  3ZDM A;  1JY2 N;  3LID A;  1LTG C;  1SVF A;  3PTZ A;  2H8P D;  3A0B E;  1XTG B;  1NTM J;  3RK3 B;  1BDC A;  2QE7 H;  1PZQ A;  1SFC A;  5M1B A;  1H0T A;  1N7S D;  2B87 A;  2H7H A;  4WY4 C;  1OVV A;  3KZI H;  1VF5 C;  4WWI A;  2ZXE B;  4PJ0 H;  1FBM A;  1Z56 A;  3PH0 A;  4H0L B;  3CXH D;  1YIJ P;  2C9L Y;  1BSH A;  3L75 G;  5BU8 B;  4DZO A;  1NTK K;  2A06 D;  2Q3E A;  4RKU J;  2HPC B;  3T97 A;  1JY3 O;  2NPS C;  1KIL A;  2BEQ D;  2R44 A;  3AEG C;  4NPE A;  3CPW O;  2AEJ A;  3MUD A;  2OAR A;  1SQP E;  5GTH E;  3TGU E;  5APV A;  3D6Y A;  3TGU G;  1N2D C;  1YJ9 P;  2BCC J;  1FZC A;  1AA0 A;  3P8C D;  1LJ2 A;  1M90 Q;  1DD4 A;  1PPJ E;  1E5W A;  1ZW0 A;  3MIW A;  5KLV K;  1FZG A;  3L71 G;  2SPZ A;  2WTY A;  4N78 D;  1ZV8 A;  4L75 A;  1Q86 Q;  4PD4 I;  1FDO A;  3CXH E;  2M3E A;  4OGQ D;  2OTK E;  1USE A;  1JCD A;  2KZJ A;  5GTI H;  1KN7 A;  4O9B A;  5AW9 B;  1N8R Q;  2H43 A;  1RE3 C;  3H1I G;  3PHL A;  4A7P A;  3L74 D;  5AW5 B;  2OTL P;  3CWB D;  2ZFC A;  1KYO H;  1K9M Q;  1OVU A;  1SQB E;  2IX7 C;  2K9J A;  1SP4 A;  1IJD B;  3CX5 I;  3FWN A;  4GDO A;  4YPC A;  3TSI A;  1HGZ A;  1NTZ G;  3L70 G;  4UB8 E;  2E43 A;  3RK2 B;  1DD3 A;  5AVX B;  2PRR A;  1SQV D;  3Q5P A; 
#chains in the Genus database with same CATH homology
 2R3C A;  3B5N C;  2POH A;  1N73 B;  2Q9I A;  4LGD E;  1HGV A;  5CCH C;  3TNU A;  2WWW A;  1GL2 B;  3EQ2 A;  4M3L A;  1X9V A;  3B8E B;  2E42 A;  1LWU C;  1GDT A;  3N4X A;  1SQQ K;  1X79 B;  1X8Y A;  5CCG D;  3RK2 D;  3WMM 0;  1L0N K;  4HYT B;  2P67 A;  3TYY A;  3OJA B;  1QL2 A;  3NFQ A;  5AVR B;  2FFD B;  3II6 A;  2P2U A;  2L5G B;  2NPS B;  3HUS B;  4JYC A;  2OYH A;  3HE5 A;  3VMY A;  1N7S B;  1NTZ K;  2M8R A;  4EIJ A;  1JO5 A;  3RK3 C;  1JTH B;  5AW6 B;  4KHX A;  3E1I A;  2MJZ A;  3V5B A;  2WPQ A;  5KJ7 A;  2WT7 B;  1J1D B;  1GL2 C;  1LT9 A;  2C9N Y;  3U1A A;  1S9K E;  3U59 A;  3VTP C;  3H32 A;  3GHG B;  3HD7 B;  3HTK B;  2IFM A;  2HLO A;  1JY2 O;  5AVV B;  1M1J B;  2YKP A;  3EFG A;  4I2L C;  1PFI A;  3M9H A;  1ZR2 A;  2OYI B;  1NTM K;  1KIL C;  3N7N A;  1SQB K;  1LTA C;  2WPS A;  1NKZ B;  1IO4 A;  4I6M C;  5AW2 B;  1FZE A;  2HYN A;  2N1T D;  5AVU B;  1YYC A;  4RES B;  1JOC A;  5BU5 A;  2C0X A;  1G1I A;  1JMM A;  1LGH B;  3VN0 A;  1RE4 C;  3R2P A;  1FJK A;  3P7K A;  2A45 G;  2YKQ A;  1VPC A;  4GT1 A;  5APT A;  4ZKU A;  2N1T B;  2J58 A;  1SQX K;  1G2C B;  1LTT C;  3KDP B;  1T2K C;  5CCG A;  2BAS A;  2JJL A;  2YNY A;  5APX A;  3RK2 C;  4AUW A;  2WSF H;  1FAV A;  3HE4 B;  4C7N B;  1JNM A;  2HOD A;  3SWY A;  3A3Y B;  4WY4 B;  4Y99 B;  2KB7 P;  3A7O A;  1FZB A;  3VYI A;  1CI6 B;  1H89 A;  2Q7C A;  1SQP K;  1YTZ I;  5BVZ A;  3SWF A;  1H88 A;  3V4W A;  2R5B A;  3CI9 A;  2XU6 A;  3M91 A;  2I1K A;  3L35 A;  3RL0 C;  1M7L A;  3M06 A;  1GU4 A;  3O8Z A;  1CW5 A;  2O01 H;  1ZN5 A;  3HUS C;  1URQ C;  4LLH A;  3CL3 D;  1L4A C;  1MZ9 A;  3V4Q A;  2Z5I A;  2WIT A;  1L4A B;  2XDJ A;  3BRV B;  5CJ4 A;  4WY4 D;  5AVQ B;  1CZQ A;  4AYC A;  2A45 H;  3U1C A;  1SFC D;  3L4F A;  1OXZ A;  2W27 A;  1T3U A;  1GTW A;  3V2Q A;  1N73 A;  1G1J A;  1LTJ A;  5APQ A;  1SLQ A;  1VDF A;  1GL2 A;  2YKO A;  2C0W A;  2YO3 A;  1GU5 A;  3M9B A;  2KYV A;  1IC2 A;  2W6B A;  4WBA A;  5AW1 B;  1RF1 C;  1KIL D;  3V2P A;  2P1J A;  1N7L A;  1RF1 B;  1DH3 A;  4DOJ A;  2FFD A;  2N9B A;  4N6J A;  3HE5 B;  4W7Y A;  3VP8 A;  2QM8 A;  2WZ7 A;  5AVY B;  2HPC A;  1KFN A;  1HTL C;  1T8Z A;  3BAS A;  3P8M C;  1RF0 A;  1SFC B;  4GIF A;  3VMX A;  1RF0 C;  3NXS A;  2FKW B;  1WRG A;  1FZC B;  3L36 A;  1NAF A;  3I5C A;  1KFM A;  3TK1 A;  3NMD A;  4OH8 B;  2P7J A;  3HTK A;  1J1E B;  2O1K A;  4EOT A;  2OYI C;  1JUN A;  1M1J A;  2R32 A;  3UIA A;  3VOP A;  2IFN A;  4AQR D;  3C9I A;  1RY3 A;  1L4A D;  1JCC A;  2IPP A;  1URQ B;  2WSC H;  3HD7 D;  5AVW B;  2XV5 A;  1N86 A;  3BRT B;  1FZA A;  1XTC C;  2XKM A;  3V2R A;  1LWU B;  1KQL A;  3P8C E;  3HD7 C;  3B5N A;  3M9Q A;  1N73 C;  1GK6 A;  3PP5 A;  2Z4E A;  4Y99 C;  1LTB C;  1GL2 D;  3CLQ A;  1A02 J;  1AQ5 A;  2NPS D;  1J1E C;  1URQ D;  4JF7 A;  3OAK A;  2M3B A;  2VRS A;  5AW0 B;  1OWA A;  2FYZ A;  2CPB A;  2FFD C;  3RL0 B;  1LT9 C;  1SFC C;  1N7S A;  4C7N A;  5AW8 B;  2O1J A;  2XNX A;  4WY4 A;  3M0D C;  1A02 F;  2N1T C;  1YTZ T;  2YMY A;  1IFJ A;  5CJ0 A;  1FOS F;  3V2N A;  1JTH A;  1HBW A;  1L0L K;  2NPS A;  1NU1 K;  4C46 A;  5AVZ B;  1NWQ A;  3HUS A;  1HUC A;  1H8A A;  2OYH B;  5APY A;  1LT9 B;  4ZKP A;  3VMZ A;  1NHL A;  3A5T A;  3GHG A;  5CCH D;  1KIL B;  2HG5 D;  4C7R A;  2JEE A;  1FDM A;  1M1J C;  4N78 E;  5CMZ A;  5KJ7 D;  3KYQ A;  3BAT A;  2KSJ A;  3KQG A;  1HVV A;  4N3Y B;  1QL1 A;  3HD7 A;  1L4A A;  3M0A A;  2Q3I A;  3RK3 D;  1T2K D;  1HWT C;  1DX7 A;  1S9K D;  3M0D A;  3MGN A;  2LKM A;  3LW5 H;  1GW4 A;  3IR9 A;  3A2A A;  2XZR A;  3L37 A;  4HH2 A;  3RL0 D;  1RE3 A;  3TNU B;  1FOS E;  4I1L A;  1G2C A;  2FYU K;  4XE5 B;  1FZF A;  2GUS A;  1KZU B;  5APS A;  4W7Z A;  1EQ7 A;  2HFE D;  2KOG A;  1FZC C;  2GUV A;  3MD0 A;  1GW3 A;  3BVH A;  4XA4 A;  1WT6 A;  5APW A;  2HOD B;  1LTI C;  1RF1 A;  5KTB A;  4W80 A;  1HJB A;  2N1T A;  1W2E A;  3KPE A;  5CCG C;  1CI6 A;  2PP6 A;  5AVT B;  1J1D C;  1SQV K;  2FXM A;  2CPS A;  3P32 A;  1HH0 A;  1ZLL A;  2YO2 A;  1T3J A;  3IFM A;  3HRN A;  1NKN A;  4GKG A;  1GK4 A;  1DEB A;  2J59 M;  5AW7 B;  5CHX A;  5AVS B;  3B5N D;  2OYH C;  2WT7 A;  3G3Z A;  1IFM A;  1JY2 P;  4B86 A;  2Q5U A;  3LIE A;  1FJP A;  1LTJ C;  3H32 B;  1ZR4 A;  1AFO A;  1GD2 E;  1FU1 A;  1NOH A;  1URQ A;  2OYI A;  1GZL A;  1LWU A;  2KLV A;  2KP8 A;  1IK9 A;  1LTJ B;  3VP9 A;  1JY3 P;  1IFN A;  3B5N B;  1J2J B;  1MFZ A;  2PAJ A;  4IFF A;  4JYB A;  2WSE H;  1LTS C;  2Z5H A;  5KJ7 C;  3H6P A;  5AW4 B;  3GHG C;  1JY3 N;  2GM4 A;  3MTU E;  1IFI A;  4IFD K;  3OA7 A;  1MV8 A;  2WPR A;  5APU A;  1IFD A;  1CSB A;  2I1J A;  2W6A A;  5CCH A;  2A45 I;  2R5D A;  3NTN A;  4IFM A;  1MUU A;  4LC1 A;  1NH4 A;  4WB4 A;  1RE4 A;  5AW3 B;  1NO4 A;  3HE4 A;  1N7S C;  1JY2 N;  3LID A;  1LTG C;  1SVF A;  2H8P D;  1XTG B;  3RK3 B;  1SFC A;  1N7S D;  2H7H A;  4WY4 C;  2ZXE B;  1FBM A;  1Z56 A;  2C9L Y;  5BU8 B;  4DZO A;  1NTK K;  2HPC B;  3T97 A;  1JY3 O;  2NPS C;  1KIL A;  3MUD A;  2OAR A;  5APV A;  1N2D C;  1FZC A;  1E5W A;  5KLV K;  3MIW A;  1FZG A;  2WTY A;  4N78 D;  1ZV8 A;  1JCD A;  4O9B A;  5AW9 B;  2H43 A;  1RE3 C;  5AW5 B;  2ZFC A;  2IX7 C;  3TSI A;  1SP4 A;  1IJD B;  1HGZ A;  2E43 A;  3RK2 B;  5AVX B;  2QM7 A;  3P8C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...