3VP9A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p mutant
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
70
structure length
70
Chain Sequence
DAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYERELTHRKMKDAYEEEIKHLKLGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords General transcriptional corepressor TUP1
total genus 27
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp9A00
5KTBA 3BATA 3U1CA 3OJAB 3N7NA 3VP9A 3VP8A 3U1AA 2POHA 1WT6A 3U59A 1X79B 5BU5A 3BASA 1IC2A 1NKNA 2FXMA 4I1LA 3N4XA 4ZKPA 2JEEA 4ZKUA 4O9BA 4N78D 5BVZA 4N3YB 4GIFA 5BU8B 3P8CD 3C9IA 3HRNA
chains in the Genus database with same CATH superfamily
1S2EA 1OW7A 2OTKE 2H7HA 1M56D 2KB7P 4IL6E 1X9VA 5KAFE 3CWBJ 3GW6A 3H1ID 2YXQB 4HB1A 4IFDK 4H44C 3M9BA 5AVSB 3H1HE 3FWLA 3H1KE 3H1KG 2WT7A 5AVTB 2FYUD 4B86A 3M0DC 1VPCA 2XDJA 1FZCC 3U1AA 2O3JA 4U3FJ 1S9KE 1P84I 3L75E 1R5LA 1IC2A 2H8PD 2P7JA 2IX7C 1T8ZA 1Q81Q 1U57A 4HKZH 5CJ4A 1R8EA 2ZJSE 1SQBK 4ZKPA 1KILD 4JYCA 1EDLA 3Q5RA 1VF5B 3G71P 4EOTA 1SQQD 4D6TE 1RH5B 2W6BA 4BWNA 2IBZG 1EZVI 1LGHB 3HTKB 5C39A 4JYBA 1J1DB 1IFPA 5B66E 3CMAP 4U3FG 1FS0E 3B8EB 1IK7A 3H1KJ 3HE4A 1TU3F 2D2CD 1M57D 3L71G 4GDOA 3OJAB 3ZDMA 2QE7H 2H89C 1SQXD 1T6AA 1URQC 3AEEC 3CWBG 1W2BO 1PGJA 3HUSA 3GMAA 3H6PA 1OW8A 3VP8A 1GTWA 2R44A 4H44D 3L72G 2Q9IA 4H0LB 5K5GB 1YBKA 2WTYA 3BVHA 4D6TJ 1LTJA 1JY2P 1NU1G 3II6A 2JWDA 4WY4D 3AE6C 2GA1A 3IR9A 3FGAD 1KN7A 3RL0C 3RBXA 3W67A 3CX5D 2FBWC 2RKLA 2WSEH 5AW0B 1R5SA 1BE3E 1LWUB 2W27A 5GTIH 1NGMB 2OARA 2KLUA 5APVA 3HE5A 3CCVP 1VQ4P 2WPRA 3CX5I 3CL3D 1L4AA 1ZOYC 1AFOA 3CX5H 4L74A 1RF1A 3GHGB 4PV1B 3HD7B 1Q90D 2C9NY 3W68A 1HJBA 3KYQA 1HBWA 1N73B 3HD7C 1NAYA 1EXJA 2QVAA 4UB8H 1NU1J 2A45I 3SFEC 2V7QH 4W7YA 1H8AA 1WMKA 3AE4C 3GHGA 4NPFX 4WY4C 1AQ5A 3I56P 3IF4A 3V2PA 4OVNF 2LXCB 2D2CC 1VL2A 1BE3J 2ZFCA 4IFFA 4BXLA 3G3ZA 3RK3C 2Z4EA 2FXMA 1PPJE 5DJUB 2JR8A 5AW5B 4H0LC 3TYYA 3PJSK 1KC8Q 3H1LE 1SS1A 4DZOA 3CC4P 2QA4P 3N4XA 3B5ND 1GMJA 2XKMA 1VQNP 2BASA 2ZT9C 4N3YB 1QEXA 3AE3C 2MJZA 1LTJB 4YTPC 3RGUA 3Q1MA 3VN0A 2L5GB 2LR2A 2OYHC 1OX3A 3H1JE 5EFWB 2BEZF 1SQBE 4RESB 1VQPP 1NKZB 1LWUA 1IZNB 3MHVA 2A06E 1NTZK 1KZUB 1LTSC 1NU1E 1MZ9A 3L37A 2O01N 3LIEA 1FC2C 4I6MC 3AEDC 1NHLA 1EC5A 2YMYA 4N6JA 3Q5SA 4I7ZC 2QJKC 2JP3A 1H88A 5B5EH 1LTJC 1FZAA 1Z56A 3KZIH 2HYNA 4NPDA 2E75C 4EI2A 2Y9ZA 2Z5HA 1H0TB 2PAJA 1X22A 3KXDA 1N7SD 3RL0D 1L0NE 2ZT9D 3CLQA 1KB9H 3EWKA 2FXOA 1YJWP 3CCLP 3P7KA 3RK3B 1G1JA 2I1JA 3GLMA 2KS1A 1RE4A 1SLQA 1ZXGA 2YKPA 2A06D 3AE7C 4YXWH 1ZMEC 4L73A 3SWKA 1JEKA 2KP8A 4H0LD 2KUBA 1N7SB 3PRJA 5BU8B 5CCGA 2FFDB 3CC2P 2BEQD 4H44B 2N9YB 2WSFJ 3IAOA 1XTGB 2I8DA 5CCHC 2Y0EA 3E7KA 3L73J 2FYUG 3LW5J 1S5LE 3A3YB 3TGUG 1PL5A 2GUVA 1IFNA 1IFDA 3C1LA 4Z1MH 1KQSO 1NTMJ 2LKMA 3WUVA 4AQRD 1K8AQ 3CCEP 1CSBA 1JMMA 1KILC 1PV3A 5BU5A 1OWAA 2M8RA 2WSCH 5KLVJ 3H1HG 1KQGB 5AVZB 2OYHA 1IO4A 5CCGC 2B87A 3CC7P 2O01H 2WSCJ 1LNQA 1SQXK 2K1AA 2YKQA 1VF5D 1URQA 1CZQA 1QLED 2E76C 1OVVA 3OA7A 3JCUH 4PD4E 1MFZA 1ZR4A 2OYIA 2B9BA 1L0ND 2JWAA 3O8ZA 1X0TA 3L73E 3S4RA 1SQPK 1FZBA 5KAIH 4RJTA 3G6EP 1FZGA 1PIXA 1SQXG 1KYOH 2L91A 5KJ7C 1SP4A 3BATA 1VQ9P 3MTUE 1BGYD 5E79H 4HH2A 1L0NK 3P8MC 2QRXA 2W8ZA 4KHXA 3AECC 3TDKA 1SQPD 4AUWA 1GW4A 2FFDC 2IYPA 5H2FE 1SQBD 3OAKA 2KYVA 2QM7A 1Y47A 5KLVE 3H1JD 4A7PA 1T2KC 1DIPA 1EDIA 1OVRA 1PP9D 1VF5C 1DD3A 2CPBA 2KXPB 4K3AA 1L4AC 2P1JA 3U59A 3AE5C 3KQGA 4TLFA 1QVGO 4PD4H 2XZRA 4OWFA 2YO3A 2IYOA 1M7LA 3P8CE 3G4SP 3AE9C 2WPVB 1RF0A 2Q5UA 1LT1A 5BVZA 3L75J 2QJKB 1Q2NA 3HE5B 1KORA 2C0WA 1SQVG 2OGUA 2XNDH 2E75B 1ZRTE 1EDKA 1EZVG 2M3EA 4H13D 4MN4C 4OGQD 1URQB 4WWIA 5E79E 1LP1B 1BSHA 2AXTH 2OTJP 3HUSC 3VMYA 2FYZA 1KTMA 4WY4A 1RQVA 1SQQE 1NTKD 2Y0DA 5APSA 4D6TD 3HUSB 2OYHB 1KILE 2HLOA 3NFQA 1JTHA 2N9BA 5KLIB 2P10A 1DD4A 3L36A 2ZT9B 2MKVA 1SFCC 2A45G 3HE4B 1RHZB 4XFJA 1FZFA 2KOGA 2E74C 1SQVK 2OYOA 2Q1KA 2YKOA 2VRSA 3H1IG 5M1BA 1WT6A 5KJ7A 1S9KD 1GD2E 1QGKB 4Y99B 1ZW0A 1GZLA 2KNCA 5B5EE 2WMMA 2W83C 3H1KD 2UWJE 4GOFA 3FX0A 2K37A 1D7MA 1CW5A 1KILB 3Q2YA 4EIJA 4H13C 1U7JA 2J59M 3G9RA 1LTAC 4OGQC 3S9OA 1KMIZ 3A5TA 1VQMP 1EQ7A 4ZNCA 2FXPA 2ZXEB 2Y9YA 1Y8AA 1BCCD 2P2UA 3IFMA 5AVVB 1Q86Q 1RF1B 2NPSD 1L4AB 1BCCJ 1J2JB 3D6YA 1JOCA 2QJYC 3GF7A 2IFNA 1YTZI 3C9IA 1S3JA 1VQ8P 4HYTB 3TF5A 3NTNA 1N7LA 4LLHA 5AW1B 2KIKA 1VQ7P 4TT3H 5AW3B 1GL2A 1M1JC 3QWOC 1T3UA 3L4FA 2K88A 1OMIA 1L0NG 1QX8A 1FE6A 2B88A 1L4AD 1VDFA 3KHUA 1Y9BA 4DT0A 3ABVC 1KFNA 2Q7CA 1ZP0C 2Z5IA 2GUSA 3SFDC 4OH8B 3MD0A 3VP9A 2E76B 1FDIA 2ZYDA 5APWA 3V2QA 4EDFA 2E43A 1ZV8A 1JY2O 2PFXA 1GL2D 2WQYC 1N2DC 2A06G 5GTHE 2K9YA 1VQ6P 1JM0A 1JB0J 3V2RA 3CWBD 1E79H 1NTKJ 1FU1A 1PP9G 3L74G 4PV1D 3SWYA 1L0LK 3D71A 2V4HA 1BCCE 2KI7B 2BCCG 5CCHA 4K35A 1FOSE 1SQPE 2AXCA 4NPEA 1KYOE 3RL0g 3EFFK 2QSIA 3L75D 3PP5A 1G1IA 1BGYE 2KZJA 1LTBC 3R4YA 4PD4I 3TNUB 1KD1Q 1MKMA 2KSJA 3BCCE 3BRTB 4GODA 1NU1K 1JNMA 4Y28J 2FYUK 4YPCA 3AEAC 3I55P 1G2CB 1LTGC 1KB9D 2K9JA 3AEFC 3JCUE 2QG4A 2P67A 1M1JB 3H1LG 4C7NA 1FAVA 2QM8A 4UB6H 4PD4D 3L70G 1PPJG 3RK2C 4DJGA 5CBOA 1ZR2A 3L74J 1PP9J 3H1JJ 1NTKG 1NVOA 3KDPB 2K9JB 1SQBJ 1E5WA 1KB9I 3B5NB 4AYCA 2OTLP 1FBMA 1FDMA 1NTKE 1NO4A 1SQPJ 3SSUA 3CXHD 2E42A 1AVOA 1SQQG 4I2LC 5AVRB 2KSEA 1YIJP 1BGYJ 2IBZD 1ZRTD 2H88C 5TISE 5APUA 1LP1A 1GK6A 2K3RA 2PGDA 1YJNP 3MUDA 1SQVE 1GL2C 1JO5A 3WMM0 1L0LG 1L0NJ 1T3JA 3BCCJ 3MIWA 3A7OA 3P8CD 1OVUA 2YMKA 3HD7D 1CI6A 3L74E 2LXBA 1DEBA 3WUTA 1M1KQ 3F5HA 1FZCA 1JUNA 1KQFB 2M5AB 4WB4A 2DW3A 3V5BA 4I7ZB 3L72E 3EFGA 1IJDB 1HUCA 1NTZG 1PP9E 1RY3A 2J58A 5AW4B 5KLVD 2B89A 2WSSH 4C7RA 3CCMP 2ZYAA 3VYIA 2AXTE 2YIUC 2Y0CA 3VMZA 1J1DC 3N7NA 5B66H 1GW3A 1NTMD 3L71E 2I1KA 2RH0A 1AQTA 3JSVC 5KLVK 3RK2D 1H0TA 1PZQA 3RK3E 2CK3H 5APXA 2W6JH 2WITA 3D6ZA 1YJ9P 1IFJA 1JCCA 1NTMK 2IPPA 2IZ0A 3L73D 3R2PA 2YO2A 1YITP 2FYNB 2Q3EA 3A2AA 3GF3A 3HTKA 1Q82Q 2ZVOB 1H89A 4JF7A 3M0DA 4IL6X 4PJ0E 2KS1B 2ZVNB 2RN0A 3B5NC 4LGDE 2M3BA 3RBZA 1URQD 1FJKA 1FDOA 1MFTA 1MV8A 2R5BA 2RMZA 3AEBC 3KZIE 2IZ1A 1S1CX 5KKZC 1N73C 3L75G 4L76A 2V7QJ 1GU5A 5KKZB 3VOPA 3WUUA 1NJIQ 1LTTC 1RE4C 1JY3N 1WRGA 3JC22 3TSIA 4EYYQ 3PTZA 4RKUJ 2NRGA 2AEJA 1HGVA 2KNCB 3MUDC 4U7JA 3L70D 1PPJD 4M3LA 3CCRP 1LWUC 1EXIA 1AJYA 2HPCB 4JPZB 2WVRA 5CHXA 3A0BH 3H25A 3PHLA 2P58A 1PGQA 3H32A 4ZKUA 4N78D 4RO0A 4DOJA 5GTHH 1GDTA 1M8OB 3CPWO 1PGOA 1K73Q 2R5DA 3I5CA 5AVYB 5APTA 1M90Q 1FJPA 2B87B 4UB6E 5L8RJ 4IL6H 3HRNA 5AW7B 2G3AA 3T97A 3S1KA 2A45H 5KTBA 2R3SA 2Q3IA 1L0LD 2E76D 3B71A 1N8RQ 1VQLP 3CCSP 2H43A 1L2PA 3PLNA 4CPGA 1IK9A 1BE3D 3CXHI 1YQ3C 1J1EB 5TJHA 3CX5E 2KZIA 4W7ZA 5CCHD 2HFED 2IBZI 3AEGC 1NTZD 1LT9B 1NU1D 5AVXB 1FOSF 1N86A 2M5AA 5KLVG 1KFMA 1X79B 1NTZE 2WPQA 3O6QB 2BCCD 1K9MQ 3M9QA 5GTIE 1NOHA 1RF1C 1A02F 1VQKP 2GM4A 3CMEP 1SQBG 2NZ2A 2ITAA 3H1JG 1SFCA 2QIWA 1S4XA 4O9BA 1SQXE 3TGUJ 1UIXA 3E1IA 3H1LJ 2JDIH 1L0LE 2Q6QA 3HD7A 1S5LH 1AVYA 3TNUA 2W6AA 1LT9C 2HODB 2JKVA 1UIIA 4GIFA 1NWQA 2JO1A 3H1LD 3RK2B 3H32B 1JMBA 4XA4A 2E74B 3L35A 1J1EC 4LC1A 3LW5H 3TGUD 3SWFA 3KPEA 2OYIB 3IN6A 2CPSA 1T2KD 2IDBA 2QJYB 1VQ5P 2NPSA 2ZYGA 3NXSA 1OXZA 2BCCJ 3K5BA 5DJTB 2QJPB 1KYOI 4R4LA 3CCJP 1RF0C 1RQUA 2N1TC 1NTZJ 3LIDA 1YI2P 3M06A 3L70E 1JY3P 1RE3C 1SQXJ 3TGUE 1JTHB 1BDDA 1NAFA 2HG5D 2WPSA 5AW6B 3VMAA 3OW2O 2C9LY 2C0XA 3AE2C 1N7SA 3BCCG 4GKGA 2WT7B 1L0LJ 1W5CE 3V4WA 1DX7A 3CXHH 3M91A 1JY3O 2FYUE 1OZHA 1IFIA 2ZAEB 3EQ2A 4IOIH 2N1TB 1NYHA 1W2EA 3VMXA 3FXEA 1S5LX 3BRVB 4BRYA 5AVWB 5KAFH 1YHQP 2FY8A 1BGYG 2BCCE 2KK7A 2YIUB 1X8YA 3CCQP 1DH3A 1SQQJ 3P32A 1SQPG 4YXDC 5H2FH 1YTZT 2YNYA 4UB8E 1VQOP 2W90A 1FZEA 1JY2N 2R32A 1BCCG 2HODA 2E75D 1HWTC 3AE1C 1GU4A 3M0AA 1HGZA 3L70J 4PJ0H 2R3CA 1KV4A 4U3FD 4ZMDA 2JJLA 2YXRB 2FKWB 2FYUJ 4KJMA 1GL2B 4JBZA 1SQQK 3C8VA 1HTLC 1NKNA 3B5NA 3H1IJ 5AVQB 2J5UA 2N1TD 1SFCD 4N78E 3Q5PA 2OQQA 2WWWA 4Y99C 5CBNA 1K05A 1P84D 2AEMA 3TK1A 1SVFA 1CI6B 3UIAA 1FZCB 3MZWB 3A0BE 1KILA 5CCGD 2KLVA 4WVZA 5KLIC 1S72P 1Q7YQ 5AW9B 1GK4A 2N1TA 4BRYB 5AW8B 2SPZA 1SFCB 1P84H 3AE8C 1USDA 3ITKA 1U7MA 3U1CA 1SQVD 2E5TA 3MP7B 1EZVD 4R4MA 5KAIE 3O6QA 3H1HD 2OYIC 2WSFH 3A0HH 4HJGH 3CXHE 1NTKK 3WU2E 1QL2A 3H1IE 1IFMA 3FXDA 3Q3DA 1QVFO 3GG2A 3L72J 2QEXP 3F89A 2G8YA 1M1JA 2XV5A 2O1JA 3B4SA 4L75A 4W80A 4C7NB 2NPSB 4GT1A 5APYA 3FWNA 1BDCA 4QMAA 3V2NA 3D70A 1A02J 1RE3A 3E1RA 1KB9E 3L71J 1EDJA 1BSNA 1HJ0A 2D2CB 5KJ7D 3USSA 3RK3D 1ZLLA 2QJPC 3BCCD 4WBAA 4WY4B 1EZVE 1XTCC 3V4QA 1LTIC 2O01J 1K04A 5AVUB 3GHGC 1BE3G 1LJ2A 1KYOD 3L71D 1NTME 4KT0J 4PV1C 4GOEA 4ASWA 3A0HE 5AW2B 1OFCX 3WU2H 2ZXXA 3PH0A 1ZN5A 2E5YA 2HR3A 1JCDA 3CCUP 3CD6P 1N7SC 1DEEG 1HVVA 2O1KA 3QH9A 5APQA 1HF9A 4C46A 1AA0A 3L72D 1LT9A 3CWBE 2WZ7A 1P84E 1USEA 1MUUA 1NH4A 3M9HA 3MGNA 5TISH 1G2CA 2HPCA 1YYCA 3L74D 3NMDA 2POHA 3H1HJ 4JQ0D 2PRRA 2AEFA 3V6IA 2PP6A 3BASA 4H13B 4OGQB 1N73A 3RL0B 3VTPC 1KQLA 1QL1A 2FYNC 5CJ0A 4ASVA 1OIPA 1SQVJ 4DCKA 1AV1A 2NPSC 5CMZA 1NTMG 4I1LA 1PFIA 2E74D 2FFDA 2IBZE 2JEEA 2IFMA 4U3FE 4IFMA 3T97B 1OW6A 1HH0A 3CI9A 4D6TG 2M0BA 2WSEJ 4XE5B 3L73G 1PGPA 2XU6A 2XNXA 1YQ4C
chains in the Genus database with same CATH topology
2H7HA 2KB7P 1X9VA 3M9BA 5AVSB 2WT7A 5AVTB 4B86A 3M0DC 1VPCA 2XDJA 1FZCC 3U1AA 1S9KE 1IC2A 2H8PD 2P7JA 2IX7C 1T8ZA 5CJ4A 1SQBK 4ZKPA 1KILD 4JYCA 4EOTA 2W6BA 1LGHB 3HTKB 4JYBA 1J1DB 3B8EB 3HE4A 3OJAB 1URQC 1GTWA 3HUSA 3VP8A 3H6PA 2Q9IA 2WTYA 3BVHA 1LTJA 1JY2P 3II6A 4WY4D 3IR9A 3RL0C 2WSEH 5AW0B 1LWUB 2W27A 2OARA 5APVA 3HE5A 2WPRA 3CL3D 1L4AA 1AFOA 1RF1A 3GHGB 2C9NY 3HD7B 1HJBA 3KYQA 1HBWA 1N73B 3HD7C 2A45I 4W7YA 1H8AA 3GHGA 4WY4C 1AQ5A 3V2PA 2ZFCA 4IFFA 3G3ZA 3RK3C 2Z4EA 2FXMA 5AW5B 3TYYA 4DZOA 3N4XA 3B5ND 2XKMA 2BASA 4N3YB 2MJZA 1LTJB 3VN0A 2L5GB 2OYHC 4RESB 1NKZB 1LWUA 3L37A 1LTSC 1KZUB 1MZ9A 1NTZK 1DX7A 3LIEA 4I6MC 4N6JA 1NHLA 2YMYA 1H88A 1LTJC 1FZAA 1Z56A 2HYNA 2Z5HA 2PAJA 1N7SD 3RL0D 3CLQA 3P7KA 3RK3B 1G1JA 2I1JA 1RE4A 1SLQA 2YKPA 2KP8A 1N7SB 5BU8B 5CCGA 1XTGB 5CCHC 3A3YB 2GUVA 1IFNA 1IFDA 2LKMA 4AQRD 1CSBA 1JMMA 1KILC 5BU5A 1OWAA 2M8RA 2WSCH 5AVZB 1IO4A 5CCGC 2O01H 1SQXK 2YKQA 1URQA 1CZQA 3OA7A 1ZR4A 1MFZA 2OYIA 3O8ZA 1SQPK 1FZBA 1FZGA 5KJ7C 1SP4A 3BATA 3MTUE 4HH2A 1L0NK 3P8MC 4KHXA 4AUWA 1GW4A 2FFDC 3OAKA 2KYVA 2QM7A 1T2KC 2CPBA 3U59A 1L4AC 2P1JA 3KQGA 2XZRA 2YO3A 1M7LA 3P8CE 1RF0A 2Q5UA 5BVZA 3HE5B 2C0WA 1URQB 3HUSC 3VMYA 2FYZA 4WY4A 5APSA 2OYHB 3HUSB 2HLOA 3NFQA 1JTHA 2N9BA 3L36A 1FZFA 1SFCC 2A45G 3HE4B 2KOGA 3V2RA 1SQVK 5KJ7A 2YKOA 2OYHA 2VRSA 1GD2E 1S9KD 1WT6A 4Y99B 1GZLA 1CW5A 1KILB 4EIJA 2J59M 1LTAC 3A5TA 1EQ7A 2ZXEB 2P2UA 3IFMA 5AVVB 1RF1B 2NPSD 1L4AB 1J2JB 1JOCA 2IFNA 1YTZI 3C9IA 4HYTB 3NTNA 1N7LA 4LLHA 5AW1B 5AW3B 1GL2A 1M1JC 1T3UA 3L4FA 1L4AD 1VDFA 1KFNA 2Q7CA 2Z5IA 2GUSA 4OH8B 3MD0A 3VP9A 5APWA 3V2QA 2E43A 1ZV8A 1JY2O 1GL2D 1N2DC 1FU1A 3SWYA 1L0LK 5CCHA 1FOSE 3PP5A 3TNUB 1G1IA 1LTBC 2KSJA 3BRTB 1NU1K 1JNMA 2FYUK 1G2CB 1LTGC 2P67A 1M1JB 4C7NA 1FAVA 2QM8A 1ZR2A 3RK2C 3KDPB 4AYCA 3B5NB 1E5WA 1FBMA 1FDMA 1NO4A 4I2LC 5AVRB 5APUA 1GK6A 3MUDA 1JO5A 1GL2C 3WMM0 1T3JA 3MIWA 3A7OA 3P8CD 1DH3A 3HD7D 1CI6A 1FZCA 1JUNA 1DEBA 4WB4A 3V5BA 3EFGA 1IJDB 1HUCA 1RY3A 2J58A 5AW4B 4C7RA 3VYIA 3VMZA 1J1DC 3N7NA 1GW3A 2I1KA 5KLVK 3RK2D 5APXA 2WITA 1IFJA 1JCCA 1NTMK 2IPPA 3R2PA 2YO2A 3A2AA 3HTKA 1H89A 4JF7A 3M0DA 3B5NC 4LGDE 2M3BA 1URQD 1FJKA 1MV8A 2R5BA 1N73C 1GU5A 3VOPA 1LTTC 1RE4C 1JY3N 1WRGA 3TSIA 1HGVA 4M3LA 1LWUC 2HPCB 5CHXA 3H32A 4ZKUA 1GDTA 4N78D 4DOJA 2R5DA 3I5CA 5AVYB 5APTA 1FJPA 3HRNA 5AW7B 3T97A 2A45H 5KTBA 2Q3IA 2H43A 1IK9A 1J1EB 4W7ZA 5CCHD 2HFED 1LT9B 5AVXB 1FOSF 1N86A 1KFMA 1X79B 2WPQA 2GM4A 1RF1C 3M9QA 1NOHA 1A02F 1SFCA 4O9BA 3E1IA 3HD7A 2FFDB 3TNUA 2W6AA 1LT9C 2HODB 4GIFA 1NWQA 3RK2B 3H32B 4XA4A 3L35A 4LC1A 1J1EC 3LW5H 3SWFA 3KPEA 2OYIB 2CPSA 1T2KD 2NPSA 3NXSA 1OXZA 1RF0C 2N1TC 3LIDA 3M06A 1JY3P 1RE3C 1JTHB 1NAFA 2HG5D 5AW6B 2WPSA 2C9LY 2C0XA 1N7SA 4GKGA 2WT7B 3V4WA 3M91A 1JY3O 3EQ2A 2E42A 1IFIA 2N1TB 1W2EA 3VMXA 3BRVB 5AVWB 1X8YA 3P32A 1YTZT 2YNYA 1FZEA 1JY2N 2R32A 2HODA 1HWTC 1GU4A 3M0AA 1HGZA 2R3CA 2JJLA 2FKWB 1GL2B 1SQQK 1HTLC 1NKNA 3B5NA 5AVQB 2N1TD 1SFCD 4N78E 2WWWA 4Y99C 3TK1A 1SVFA 1CI6B 3UIAA 1FZCB 5CCGD 1KILA 2KLVA 5AW9B 1GK4A 2N1TA 5AW8B 1SFCB 3U1CA 2OYIC 2WSFH 1NTKK 1QL2A 1IFMA 1M1JA 2XV5A 2O1JA 4C7NB 4W80A 2NPSB 4GT1A 5APYA 3V2NA 1A02J 1RE3A 5KJ7D 3RK3D 1ZLLA 4WBAA 4WY4B 1XTCC 3V4QA 1LTIC 5AVUB 3GHGC 5AW2B 1ZN5A 1JCDA 1N7SC 1HVVA 2O1KA 5APQA 4C46A 1LT9A 2WZ7A 3M9HA 3MGNA 1MUUA 1NH4A 4IFDK 2HPCA 1G2CA 1YYCA 3NMDA 2POHA 2PP6A 3BASA 1N73A 3RL0B 3VTPC 1KQLA 1QL1A 5CJ0A 2NPSC 5CMZA 4I1LA 1PFIA 2FFDA 2JEEA 2IFMA 4IFMA 1HH0A 3CI9A 4XE5B 2XU6A 2XNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTB A;  3BAT A;  3U1C A;  3OJA B;  3N7N A;  3VP9 A;  3VP8 A;  3U1A A;  2POH A;  1WT6 A;  3U59 A;  1X79 B;  5BU5 A;  3BAS A;  1IC2 A;  1NKN A;  2FXM A;  4I1L A;  3N4X A;  4ZKP A;  2JEE A;  4ZKU A;  4O9B A;  4N78 D;  5BVZ A;  4N3Y B;  4GIF A;  5BU8 B;  3P8C D;  3C9I A;  3HRN A; 
#chains in the Genus database with same CATH topology
 1S2E A;  1OW7 A;  2OTK E;  2H7H A;  1M56 D;  2KB7 P;  4IL6 E;  1X9V A;  5KAF E;  3CWB J;  3GW6 A;  3H1I D;  2YXQ B;  4HB1 A;  4IFD K;  4H44 C;  3M9B A;  5AVS B;  3H1H E;  3FWL A;  3H1K E;  3H1K G;  2WT7 A;  5AVT B;  2FYU D;  4B86 A;  3M0D C;  1VPC A;  2XDJ A;  1FZC C;  3U1A A;  2O3J A;  4U3F J;  1S9K E;  1P84 I;  3L75 E;  1R5L A;  1IC2 A;  2H8P D;  2P7J A;  2IX7 C;  1T8Z A;  1Q81 Q;  1U57 A;  4HKZ H;  5CJ4 A;  1R8E A;  2ZJS E;  1SQB K;  4ZKP A;  1KIL D;  4JYC A;  1EDL A;  3Q5R A;  1VF5 B;  3G71 P;  4EOT A;  1SQQ D;  4D6T E;  1RH5 B;  2W6B A;  4BWN A;  2IBZ G;  1EZV I;  1LGH B;  3HTK B;  5C39 A;  4JYB A;  1J1D B;  1IFP A;  5B66 E;  3CMA P;  4U3F G;  1FS0 E;  3B8E B;  1IK7 A;  3H1K J;  3HE4 A;  1TU3 F;  2D2C D;  1M57 D;  3L71 G;  4GDO A;  3OJA B;  3ZDM A;  2QE7 H;  2H89 C;  1SQX D;  1T6A A;  1URQ C;  3AEE C;  3CWB G;  1W2B O;  1PGJ A;  3HUS A;  3GMA A;  3H6P A;  1OW8 A;  3VP8 A;  1GTW A;  2R44 A;  4H44 D;  3L72 G;  2Q9I A;  4H0L B;  5K5G B;  1YBK A;  2WTY A;  3BVH A;  4D6T J;  1LTJ A;  1JY2 P;  1NU1 G;  3II6 A;  2JWD A;  4WY4 D;  3AE6 C;  2GA1 A;  3IR9 A;  3FGA D;  1KN7 A;  3RL0 C;  3RBX A;  3W67 A;  3CX5 D;  2FBW C;  2RKL A;  2WSE H;  5AW0 B;  1R5S A;  1BE3 E;  1LWU B;  2W27 A;  5GTI H;  1NGM B;  2OAR A;  2KLU A;  5APV A;  3HE5 A;  3CCV P;  1VQ4 P;  2WPR A;  3CX5 I;  3CL3 D;  1L4A A;  1ZOY C;  1AFO A;  3CX5 H;  4L74 A;  1RF1 A;  3GHG B;  4PV1 B;  3HD7 B;  1Q90 D;  2C9N Y;  3W68 A;  1HJB A;  3KYQ A;  1HBW A;  1N73 B;  3HD7 C;  1NAY A;  1EXJ A;  2QVA A;  4UB8 H;  1NU1 J;  2A45 I;  3SFE C;  2V7Q H;  4W7Y A;  1H8A A;  1WMK A;  3AE4 C;  3GHG A;  4NPF X;  4WY4 C;  1AQ5 A;  3I56 P;  3IF4 A;  3V2P A;  4OVN F;  2LXC B;  2D2C C;  1VL2 A;  1BE3 J;  2ZFC A;  4IFF A;  4BXL A;  3G3Z A;  3RK3 C;  2Z4E A;  2FXM A;  1PPJ E;  5DJU B;  2JR8 A;  5AW5 B;  4H0L C;  3TYY A;  3PJS K;  1KC8 Q;  3H1L E;  1SS1 A;  4DZO A;  3CC4 P;  2QA4 P;  3N4X A;  3B5N D;  1GMJ A;  2XKM A;  1VQN P;  2BAS A;  2ZT9 C;  4N3Y B;  1QEX A;  3AE3 C;  2MJZ A;  1LTJ B;  4YTP C;  3RGU A;  3Q1M A;  3VN0 A;  2L5G B;  2LR2 A;  2OYH C;  1OX3 A;  3H1J E;  5EFW B;  2BEZ F;  1SQB E;  4RES B;  1VQP P;  1NKZ B;  1LWU A;  1IZN B;  3MHV A;  2A06 E;  1NTZ K;  1KZU B;  1LTS C;  1NU1 E;  1MZ9 A;  3L37 A;  2O01 N;  3LIE A;  1FC2 C;  4I6M C;  3AED C;  1NHL A;  1EC5 A;  2YMY A;  4N6J A;  3Q5S A;  4I7Z C;  2QJK C;  2JP3 A;  1H88 A;  5B5E H;  1LTJ C;  1FZA A;  1Z56 A;  3KZI H;  2HYN A;  4NPD A;  2E75 C;  4EI2 A;  2Y9Z A;  2Z5H A;  1H0T B;  2PAJ A;  1X22 A;  3KXD A;  1N7S D;  3RL0 D;  1L0N E;  2ZT9 D;  3CLQ A;  1KB9 H;  3EWK A;  2FXO A;  1YJW P;  3CCL P;  3P7K A;  3RK3 B;  1G1J A;  2I1J A;  3GLM A;  2KS1 A;  1RE4 A;  1SLQ A;  1ZXG A;  2YKP A;  2A06 D;  3AE7 C;  4YXW H;  1ZME C;  4L73 A;  3SWK A;  1JEK A;  2KP8 A;  4H0L D;  2KUB A;  1N7S B;  3PRJ A;  5BU8 B;  5CCG A;  2FFD B;  3CC2 P;  2BEQ D;  4H44 B;  2N9Y B;  2WSF J;  3IAO A;  1XTG B;  2I8D A;  5CCH C;  2Y0E A;  3E7K A;  3L73 J;  2FYU G;  3LW5 J;  1S5L E;  3A3Y B;  3TGU G;  1PL5 A;  2GUV A;  1IFN A;  1IFD A;  3C1L A;  4Z1M H;  1KQS O;  1NTM J;  2LKM A;  3WUV A;  4AQR D;  1K8A Q;  3CCE P;  1CSB A;  1JMM A;  1KIL C;  1PV3 A;  5BU5 A;  1OWA A;  2M8R A;  2WSC H;  5KLV J;  3H1H G;  1KQG B;  5AVZ B;  2OYH A;  1IO4 A;  5CCG C;  2B87 A;  3CC7 P;  2O01 H;  2WSC J;  1LNQ A;  1SQX K;  2K1A A;  2YKQ A;  1VF5 D;  1URQ A;  1CZQ A;  1QLE D;  2E76 C;  1OVV A;  3OA7 A;  3JCU H;  4PD4 E;  1MFZ A;  1ZR4 A;  2OYI A;  2B9B A;  1L0N D;  2JWA A;  3O8Z A;  1X0T A;  3L73 E;  3S4R A;  1SQP K;  1FZB A;  5KAI H;  4RJT A;  3G6E P;  1FZG A;  1PIX A;  1SQX G;  1KYO H;  2L91 A;  5KJ7 C;  1SP4 A;  3BAT A;  1VQ9 P;  3MTU E;  1BGY D;  5E79 H;  4HH2 A;  1L0N K;  3P8M C;  2QRX A;  2W8Z A;  4KHX A;  3AEC C;  3TDK A;  1SQP D;  4AUW A;  1GW4 A;  2FFD C;  2IYP A;  5H2F E;  1SQB D;  3OAK A;  2KYV A;  2QM7 A;  1Y47 A;  5KLV E;  3H1J D;  4A7P A;  1T2K C;  1DIP A;  1EDI A;  1OVR A;  1PP9 D;  1VF5 C;  1DD3 A;  2CPB A;  2KXP B;  4K3A A;  1L4A C;  2P1J A;  3U59 A;  3AE5 C;  3KQG A;  4TLF A;  1QVG O;  4PD4 H;  2XZR A;  4OWF A;  2YO3 A;  2IYO A;  1M7L A;  3P8C E;  3G4S P;  3AE9 C;  2WPV B;  1RF0 A;  2Q5U A;  1LT1 A;  5BVZ A;  3L75 J;  2QJK B;  1Q2N A;  3HE5 B;  1KOR A;  2C0W A;  1SQV G;  2OGU A;  2XND H;  2E75 B;  1ZRT E;  1EDK A;  1EZV G;  2M3E A;  4H13 D;  4MN4 C;  4OGQ D;  1URQ B;  4WWI A;  5E79 E;  1LP1 B;  1BSH A;  2AXT H;  2OTJ P;  3HUS C;  3VMY A;  2FYZ A;  1KTM A;  4WY4 A;  1RQV A;  1SQQ E;  1NTK D;  2Y0D A;  5APS A;  4D6T D;  3HUS B;  2OYH B;  1KIL E;  2HLO A;  3NFQ A;  1JTH A;  2N9B A;  5KLI B;  2P10 A;  1DD4 A;  3L36 A;  2ZT9 B;  2MKV A;  1SFC C;  2A45 G;  3HE4 B;  1RHZ B;  4XFJ A;  1FZF A;  2KOG A;  2E74 C;  1SQV K;  2OYO A;  2Q1K A;  2YKO A;  2VRS A;  3H1I G;  5M1B A;  1WT6 A;  5KJ7 A;  1S9K D;  1GD2 E;  1QGK B;  4Y99 B;  1ZW0 A;  1GZL A;  2KNC A;  5B5E E;  2WMM A;  2W83 C;  3H1K D;  2UWJ E;  4GOF A;  3FX0 A;  2K37 A;  1D7M A;  1CW5 A;  1KIL B;  3Q2Y A;  4EIJ A;  4H13 C;  1U7J A;  2J59 M;  3G9R A;  1LTA C;  4OGQ C;  3S9O A;  1KMI Z;  3A5T A;  1VQM P;  1EQ7 A;  4ZNC A;  2FXP A;  2ZXE B;  2Y9Y A;  1Y8A A;  1BCC D;  2P2U A;  3IFM A;  5AVV B;  1Q86 Q;  1RF1 B;  2NPS D;  1L4A B;  1BCC J;  1J2J B;  3D6Y A;  1JOC A;  2QJY C;  3GF7 A;  2IFN A;  1YTZ I;  3C9I A;  1S3J A;  1VQ8 P;  4HYT B;  3TF5 A;  3NTN A;  1N7L A;  4LLH A;  5AW1 B;  2KIK A;  1VQ7 P;  4TT3 H;  5AW3 B;  1GL2 A;  1M1J C;  3QWO C;  1T3U A;  3L4F A;  2K88 A;  1OMI A;  1L0N G;  1QX8 A;  1FE6 A;  2B88 A;  1L4A D;  1VDF A;  3KHU A;  1Y9B A;  4DT0 A;  3ABV C;  1KFN A;  2Q7C A;  1ZP0 C;  2Z5I A;  2GUS A;  3SFD C;  4OH8 B;  3MD0 A;  3VP9 A;  2E76 B;  1FDI A;  2ZYD A;  5APW A;  3V2Q A;  4EDF A;  2E43 A;  1ZV8 A;  1JY2 O;  2PFX A;  1GL2 D;  2WQY C;  1N2D C;  2A06 G;  5GTH E;  2K9Y A;  1VQ6 P;  1JM0 A;  1JB0 J;  3V2R A;  3CWB D;  1E79 H;  1NTK J;  1FU1 A;  1PP9 G;  3L74 G;  4PV1 D;  3SWY A;  1L0L K;  3D71 A;  2V4H A;  1BCC E;  2KI7 B;  2BCC G;  5CCH A;  4K35 A;  1FOS E;  1SQP E;  2AXC A;  4NPE A;  1KYO E;  3RL0 g;  3EFF K;  2QSI A;  3L75 D;  3PP5 A;  1G1I A;  1BGY E;  2KZJ A;  1LTB C;  3R4Y A;  4PD4 I;  3TNU B;  1KD1 Q;  1MKM A;  2KSJ A;  3BCC E;  3BRT B;  4GOD A;  1NU1 K;  1JNM A;  4Y28 J;  2FYU K;  4YPC A;  3AEA C;  3I55 P;  1G2C B;  1LTG C;  1KB9 D;  2K9J A;  3AEF C;  3JCU E;  2QG4 A;  2P67 A;  1M1J B;  3H1L G;  4C7N A;  1FAV A;  2QM8 A;  4UB6 H;  4PD4 D;  3L70 G;  1PPJ G;  3RK2 C;  4DJG A;  5CBO A;  1ZR2 A;  3L74 J;  1PP9 J;  3H1J J;  1NTK G;  1NVO A;  3KDP B;  2K9J B;  1SQB J;  1E5W A;  1KB9 I;  3B5N B;  4AYC A;  2OTL P;  1FBM A;  1FDM A;  1NTK E;  1NO4 A;  1SQP J;  3SSU A;  3CXH D;  2E42 A;  1AVO A;  1SQQ G;  4I2L C;  5AVR B;  2KSE A;  1YIJ P;  1BGY J;  2IBZ D;  1ZRT D;  2H88 C;  5TIS E;  5APU A;  1LP1 A;  1GK6 A;  2K3R A;  2PGD A;  1YJN P;  3MUD A;  1SQV E;  1GL2 C;  1JO5 A;  3WMM 0;  1L0L G;  1L0N J;  1T3J A;  3BCC J;  3MIW A;  3A7O A;  3P8C D;  1OVU A;  2YMK A;  3HD7 D;  1CI6 A;  3L74 E;  2LXB A;  1DEB A;  3WUT A;  1M1K Q;  3F5H A;  1FZC A;  1JUN A;  1KQF B;  2M5A B;  4WB4 A;  2DW3 A;  3V5B A;  4I7Z B;  3L72 E;  3EFG A;  1IJD B;  1HUC A;  1NTZ G;  1PP9 E;  1RY3 A;  2J58 A;  5AW4 B;  5KLV D;  2B89 A;  2WSS H;  4C7R A;  3CCM P;  2ZYA A;  3VYI A;  2AXT E;  2YIU C;  2Y0C A;  3VMZ A;  1J1D C;  3N7N A;  5B66 H;  1GW3 A;  1NTM D;  3L71 E;  2I1K A;  2RH0 A;  1AQT A;  3JSV C;  5KLV K;  3RK2 D;  1H0T A;  1PZQ A;  3RK3 E;  2CK3 H;  5APX A;  2W6J H;  2WIT A;  3D6Z A;  1YJ9 P;  1IFJ A;  1JCC A;  1NTM K;  2IPP A;  2IZ0 A;  3L73 D;  3R2P A;  2YO2 A;  1YIT P;  2FYN B;  2Q3E A;  3A2A A;  3GF3 A;  3HTK A;  1Q82 Q;  2ZVO B;  1H89 A;  4JF7 A;  3M0D A;  4IL6 X;  4PJ0 E;  2KS1 B;  2ZVN B;  2RN0 A;  3B5N C;  4LGD E;  2M3B A;  3RBZ A;  1URQ D;  1FJK A;  1FDO A;  1MFT A;  1MV8 A;  2R5B A;  2RMZ A;  3AEB C;  3KZI E;  2IZ1 A;  1S1C X;  5KKZ C;  1N73 C;  3L75 G;  4L76 A;  2V7Q J;  1GU5 A;  5KKZ B;  3VOP A;  3WUU A;  1NJI Q;  1LTT C;  1RE4 C;  1JY3 N;  1WRG A;  3JC2 2;  3TSI A;  4EYY Q;  3PTZ A;  4RKU J;  2NRG A;  2AEJ A;  1HGV A;  2KNC B;  3MUD C;  4U7J A;  3L70 D;  1PPJ D;  4M3L A;  3CCR P;  1LWU C;  1EXI A;  1AJY A;  2HPC B;  4JPZ B;  2WVR A;  5CHX A;  3A0B H;  3H25 A;  3PHL A;  2P58 A;  1PGQ A;  3H32 A;  4ZKU A;  4N78 D;  4RO0 A;  4DOJ A;  5GTH H;  1GDT A;  1M8O B;  3CPW O;  1PGO A;  1K73 Q;  2R5D A;  3I5C A;  5AVY B;  5APT A;  1M90 Q;  1FJP A;  2B87 B;  4UB6 E;  5L8R J;  4IL6 H;  3HRN A;  5AW7 B;  2G3A A;  3T97 A;  3S1K A;  2A45 H;  5KTB A;  2R3S A;  2Q3I A;  1L0L D;  2E76 D;  3B71 A;  1N8R Q;  1VQL P;  3CCS P;  2H43 A;  1L2P A;  3PLN A;  4CPG A;  1IK9 A;  1BE3 D;  3CXH I;  1YQ3 C;  1J1E B;  5TJH A;  3CX5 E;  2KZI A;  4W7Z A;  5CCH D;  2HFE D;  2IBZ I;  3AEG C;  1NTZ D;  1LT9 B;  1NU1 D;  5AVX B;  1FOS F;  1N86 A;  2M5A A;  5KLV G;  1KFM A;  1X79 B;  1NTZ E;  2WPQ A;  3O6Q B;  2BCC D;  1K9M Q;  3M9Q A;  5GTI E;  1NOH A;  1RF1 C;  1A02 F;  1VQK P;  2GM4 A;  3CME P;  1SQB G;  2NZ2 A;  2ITA A;  3H1J G;  1SFC A;  2QIW A;  1S4X A;  4O9B A;  1SQX E;  3TGU J;  1UIX A;  3E1I A;  3H1L J;  2JDI H;  1L0L E;  2Q6Q A;  3HD7 A;  1S5L H;  1AVY A;  3TNU A;  2W6A A;  1LT9 C;  2HOD B;  2JKV A;  1UII A;  4GIF A;  1NWQ A;  2JO1 A;  3H1L D;  3RK2 B;  3H32 B;  1JMB A;  4XA4 A;  2E74 B;  3L35 A;  1J1E C;  4LC1 A;  3LW5 H;  3TGU D;  3SWF A;  3KPE A;  2OYI B;  3IN6 A;  2CPS A;  1T2K D;  2IDB A;  2QJY B;  1VQ5 P;  2NPS A;  2ZYG A;  3NXS A;  1OXZ A;  2BCC J;  3K5B A;  5DJT B;  2QJP B;  1KYO I;  4R4L A;  3CCJ P;  1RF0 C;  1RQU A;  2N1T C;  1NTZ J;  3LID A;  1YI2 P;  3M06 A;  3L70 E;  1JY3 P;  1RE3 C;  1SQX J;  3TGU E;  1JTH B;  1BDD A;  1NAF A;  2HG5 D;  2WPS A;  5AW6 B;  3VMA A;  3OW2 O;  2C9L Y;  2C0X A;  3AE2 C;  1N7S A;  3BCC G;  4GKG A;  2WT7 B;  1L0L J;  1W5C E;  3V4W A;  1DX7 A;  3CXH H;  3M91 A;  1JY3 O;  2FYU E;  1OZH A;  1IFI A;  2ZAE B;  3EQ2 A;  4IOI H;  2N1T B;  1NYH A;  1W2E A;  3VMX A;  3FXE A;  1S5L X;  3BRV B;  4BRY A;  5AVW B;  5KAF H;  1YHQ P;  2FY8 A;  1BGY G;  2BCC E;  2KK7 A;  2YIU B;  1X8Y A;  3CCQ P;  1DH3 A;  1SQQ J;  3P32 A;  1SQP G;  4YXD C;  5H2F H;  1YTZ T;  2YNY A;  4UB8 E;  1VQO P;  2W90 A;  1FZE A;  1JY2 N;  2R32 A;  1BCC G;  2HOD A;  2E75 D;  1HWT C;  3AE1 C;  1GU4 A;  3M0A A;  1HGZ A;  3L70 J;  4PJ0 H;  2R3C A;  1KV4 A;  4U3F D;  4ZMD A;  2JJL A;  2YXR B;  2FKW B;  2FYU J;  4KJM A;  1GL2 B;  4JBZ A;  1SQQ K;  3C8V A;  1HTL C;  1NKN A;  3B5N A;  3H1I J;  5AVQ B;  2J5U A;  2N1T D;  1SFC D;  4N78 E;  3Q5P A;  2OQQ A;  2WWW A;  4Y99 C;  5CBN A;  1K05 A;  1P84 D;  2AEM A;  3TK1 A;  1SVF A;  1CI6 B;  3UIA A;  1FZC B;  3MZW B;  3A0B E;  1KIL A;  5CCG D;  2KLV A;  4WVZ A;  5KLI C;  1S72 P;  1Q7Y Q;  5AW9 B;  1GK4 A;  2N1T A;  4BRY B;  5AW8 B;  2SPZ A;  1SFC B;  1P84 H;  3AE8 C;  1USD A;  3ITK A;  1U7M A;  3U1C A;  1SQV D;  2E5T A;  3MP7 B;  1EZV D;  4R4M A;  5KAI E;  3O6Q A;  3H1H D;  2OYI C;  2WSF H;  3A0H H;  4HJG H;  3CXH E;  1NTK K;  3WU2 E;  1QL2 A;  3H1I E;  1IFM A;  3FXD A;  3Q3D A;  1QVF O;  3GG2 A;  3L72 J;  2QEX P;  3F89 A;  2G8Y A;  1M1J A;  2XV5 A;  2O1J A;  3B4S A;  4L75 A;  4W80 A;  4C7N B;  2NPS B;  4GT1 A;  5APY A;  3FWN A;  1BDC A;  4QMA A;  3V2N A;  3D70 A;  1A02 J;  1RE3 A;  3E1R A;  1KB9 E;  3L71 J;  1EDJ A;  1BSN A;  1HJ0 A;  2D2C B;  5KJ7 D;  3USS A;  3RK3 D;  1ZLL A;  2QJP C;  3BCC D;  4WBA A;  4WY4 B;  1EZV E;  1XTC C;  3V4Q A;  1LTI C;  2O01 J;  1K04 A;  5AVU B;  3GHG C;  1BE3 G;  1LJ2 A;  1KYO D;  3L71 D;  1NTM E;  4KT0 J;  4PV1 C;  4GOE A;  4ASW A;  3A0H E;  5AW2 B;  1OFC X;  3WU2 H;  2ZXX A;  3PH0 A;  1ZN5 A;  2E5Y A;  2HR3 A;  1JCD A;  3CCU P;  3CD6 P;  1N7S C;  1DEE G;  1HVV A;  2O1K A;  3QH9 A;  5APQ A;  1HF9 A;  4C46 A;  1AA0 A;  3L72 D;  1LT9 A;  3CWB E;  2WZ7 A;  1P84 E;  1USE A;  1MUU A;  1NH4 A;  3M9H A;  3MGN A;  5TIS H;  1G2C A;  2HPC A;  1YYC A;  3L74 D;  3NMD A;  2POH A;  3H1H J;  4JQ0 D;  2PRR A;  2AEF A;  3V6I A;  2PP6 A;  3BAS A;  4H13 B;  4OGQ B;  1N73 A;  3RL0 B;  3VTP C;  1KQL A;  1QL1 A;  2FYN C;  5CJ0 A;  4ASV A;  1OIP A;  1SQV J;  4DCK A;  1AV1 A;  2NPS C;  5CMZ A;  1NTM G;  4I1L A;  1PFI A;  2E74 D;  2FFD A;  2IBZ E;  2JEE A;  2IFM A;  4U3F E;  4IFM A;  3T97 B;  1OW6 A;  1HH0 A;  3CI9 A;  4D6T G;  2M0B A;  2WSE J;  4XE5 B;  3L73 G;  1PGP A;  2XU6 A;  2XNX A;  1YQ4 C; 
#chains in the Genus database with same CATH homology
 2H7H A;  2KB7 P;  1X9V A;  3M9B A;  5AVS B;  2WT7 A;  5AVT B;  4B86 A;  3M0D C;  1VPC A;  2XDJ A;  1FZC C;  3U1A A;  1S9K E;  1IC2 A;  2H8P D;  2P7J A;  2IX7 C;  1T8Z A;  5CJ4 A;  1SQB K;  4ZKP A;  1KIL D;  4JYC A;  4EOT A;  2W6B A;  1LGH B;  3HTK B;  4JYB A;  1J1D B;  3B8E B;  3HE4 A;  3OJA B;  1URQ C;  1GTW A;  3HUS A;  3VP8 A;  3H6P A;  2Q9I A;  2WTY A;  3BVH A;  1LTJ A;  1JY2 P;  3II6 A;  4WY4 D;  3IR9 A;  3RL0 C;  2WSE H;  5AW0 B;  1LWU B;  2W27 A;  2OAR A;  5APV A;  3HE5 A;  2WPR A;  3CL3 D;  1L4A A;  1AFO A;  1RF1 A;  3GHG B;  2C9N Y;  3HD7 B;  1HJB A;  3KYQ A;  1HBW A;  1N73 B;  3HD7 C;  2A45 I;  4W7Y A;  1H8A A;  3GHG A;  4WY4 C;  1AQ5 A;  3V2P A;  2ZFC A;  4IFF A;  3G3Z A;  3RK3 C;  2Z4E A;  2FXM A;  5AW5 B;  3TYY A;  4DZO A;  3N4X A;  3B5N D;  2XKM A;  2BAS A;  4N3Y B;  2MJZ A;  1LTJ B;  3VN0 A;  2L5G B;  2OYH C;  4RES B;  1NKZ B;  1LWU A;  3L37 A;  1LTS C;  1KZU B;  1MZ9 A;  1NTZ K;  1DX7 A;  3LIE A;  4I6M C;  4N6J A;  1NHL A;  2YMY A;  1H88 A;  1LTJ C;  1FZA A;  1Z56 A;  2HYN A;  2Z5H A;  2PAJ A;  1N7S D;  3RL0 D;  3CLQ A;  3P7K A;  3RK3 B;  1G1J A;  2I1J A;  1RE4 A;  1SLQ A;  2YKP A;  2KP8 A;  1N7S B;  5BU8 B;  5CCG A;  1XTG B;  5CCH C;  3A3Y B;  2GUV A;  1IFN A;  1IFD A;  2LKM A;  4AQR D;  1CSB A;  1JMM A;  1KIL C;  5BU5 A;  1OWA A;  2M8R A;  2WSC H;  5AVZ B;  1IO4 A;  5CCG C;  2O01 H;  1SQX K;  2YKQ A;  1URQ A;  1CZQ A;  3OA7 A;  1ZR4 A;  1MFZ A;  2OYI A;  3O8Z A;  1SQP K;  1FZB A;  1FZG A;  5KJ7 C;  1SP4 A;  3BAT A;  3MTU E;  4HH2 A;  1L0N K;  3P8M C;  4KHX A;  4AUW A;  1GW4 A;  2FFD C;  3OAK A;  2KYV A;  2QM7 A;  1T2K C;  2CPB A;  3U59 A;  1L4A C;  2P1J A;  3KQG A;  2XZR A;  2YO3 A;  1M7L A;  3P8C E;  1RF0 A;  2Q5U A;  5BVZ A;  3HE5 B;  2C0W A;  1URQ B;  3HUS C;  3VMY A;  2FYZ A;  4WY4 A;  5APS A;  2OYH B;  3HUS B;  2HLO A;  3NFQ A;  1JTH A;  2N9B A;  3L36 A;  1FZF A;  1SFC C;  2A45 G;  3HE4 B;  2KOG A;  3V2R A;  1SQV K;  5KJ7 A;  2YKO A;  2OYH A;  2VRS A;  1GD2 E;  1S9K D;  1WT6 A;  4Y99 B;  1GZL A;  1CW5 A;  1KIL B;  4EIJ A;  2J59 M;  1LTA C;  3A5T A;  1EQ7 A;  2ZXE B;  2P2U A;  3IFM A;  5AVV B;  1RF1 B;  2NPS D;  1L4A B;  1J2J B;  1JOC A;  2IFN A;  1YTZ I;  3C9I A;  4HYT B;  3NTN A;  1N7L A;  4LLH A;  5AW1 B;  5AW3 B;  1GL2 A;  1M1J C;  1T3U A;  3L4F A;  1L4A D;  1VDF A;  1KFN A;  2Q7C A;  2Z5I A;  2GUS A;  4OH8 B;  3MD0 A;  3VP9 A;  5APW A;  3V2Q A;  2E43 A;  1ZV8 A;  1JY2 O;  1GL2 D;  1N2D C;  1FU1 A;  3SWY A;  1L0L K;  5CCH A;  1FOS E;  3PP5 A;  3TNU B;  1G1I A;  1LTB C;  2KSJ A;  3BRT B;  1NU1 K;  1JNM A;  2FYU K;  1G2C B;  1LTG C;  2P67 A;  1M1J B;  4C7N A;  1FAV A;  2QM8 A;  1ZR2 A;  3RK2 C;  3KDP B;  4AYC A;  3B5N B;  1E5W A;  1FBM A;  1FDM A;  1NO4 A;  4I2L C;  5AVR B;  5APU A;  1GK6 A;  3MUD A;  1JO5 A;  1GL2 C;  3WMM 0;  1T3J A;  3MIW A;  3A7O A;  3P8C D;  1DH3 A;  3HD7 D;  1CI6 A;  1FZC A;  1JUN A;  1DEB A;  4WB4 A;  3V5B A;  3EFG A;  1IJD B;  1HUC A;  1RY3 A;  2J58 A;  5AW4 B;  4C7R A;  3VYI A;  3VMZ A;  1J1D C;  3N7N A;  1GW3 A;  2I1K A;  5KLV K;  3RK2 D;  5APX A;  2WIT A;  1IFJ A;  1JCC A;  1NTM K;  2IPP A;  3R2P A;  2YO2 A;  3A2A A;  3HTK A;  1H89 A;  4JF7 A;  3M0D A;  3B5N C;  4LGD E;  2M3B A;  1URQ D;  1FJK A;  1MV8 A;  2R5B A;  1N73 C;  1GU5 A;  3VOP A;  1LTT C;  1RE4 C;  1JY3 N;  1WRG A;  3TSI A;  1HGV A;  4M3L A;  1LWU C;  2HPC B;  5CHX A;  3H32 A;  4ZKU A;  1GDT A;  4N78 D;  4DOJ A;  2R5D A;  3I5C A;  5AVY B;  5APT A;  1FJP A;  3HRN A;  5AW7 B;  3T97 A;  2A45 H;  5KTB A;  2Q3I A;  2H43 A;  1IK9 A;  1J1E B;  4W7Z A;  5CCH D;  2HFE D;  1LT9 B;  5AVX B;  1FOS F;  1N86 A;  1KFM A;  1X79 B;  2WPQ A;  2GM4 A;  1RF1 C;  3M9Q A;  1NOH A;  1A02 F;  1SFC A;  4O9B A;  3E1I A;  3HD7 A;  2FFD B;  3TNU A;  2W6A A;  1LT9 C;  2HOD B;  4GIF A;  1NWQ A;  3RK2 B;  3H32 B;  4XA4 A;  3L35 A;  4LC1 A;  1J1E C;  3LW5 H;  3SWF A;  3KPE A;  2OYI B;  2CPS A;  1T2K D;  2NPS A;  3NXS A;  1OXZ A;  1RF0 C;  2N1T C;  3LID A;  3M06 A;  1JY3 P;  1RE3 C;  1JTH B;  1NAF A;  2HG5 D;  5AW6 B;  2WPS A;  2C9L Y;  2C0X A;  1N7S A;  4GKG A;  2WT7 B;  3V4W A;  3M91 A;  1JY3 O;  3EQ2 A;  2E42 A;  1IFI A;  2N1T B;  1W2E A;  3VMX A;  3BRV B;  5AVW B;  1X8Y A;  3P32 A;  1YTZ T;  2YNY A;  1FZE A;  1JY2 N;  2R32 A;  2HOD A;  1HWT C;  1GU4 A;  3M0A A;  1HGZ A;  2R3C A;  2JJL A;  2FKW B;  1GL2 B;  1SQQ K;  1HTL C;  1NKN A;  3B5N A;  5AVQ B;  2N1T D;  1SFC D;  4N78 E;  2WWW A;  4Y99 C;  3TK1 A;  1SVF A;  1CI6 B;  3UIA A;  1FZC B;  5CCG D;  1KIL A;  2KLV A;  5AW9 B;  1GK4 A;  2N1T A;  5AW8 B;  1SFC B;  3U1C A;  2OYI C;  2WSF H;  1NTK K;  1QL2 A;  1IFM A;  1M1J A;  2XV5 A;  2O1J A;  4C7N B;  4W80 A;  2NPS B;  4GT1 A;  5APY A;  3V2N A;  1A02 J;  1RE3 A;  5KJ7 D;  3RK3 D;  1ZLL A;  4WBA A;  4WY4 B;  1XTC C;  3V4Q A;  1LTI C;  5AVU B;  3GHG C;  5AW2 B;  1ZN5 A;  1JCD A;  1N7S C;  1HVV A;  2O1K A;  5APQ A;  4C46 A;  1LT9 A;  2WZ7 A;  3M9H A;  3MGN A;  1MUU A;  1NH4 A;  4IFD K;  2HPC A;  1G2C A;  1YYC A;  3NMD A;  2POH A;  2PP6 A;  3BAS A;  1N73 A;  3RL0 B;  3VTP C;  1KQL A;  1QL1 A;  5CJ0 A;  2NPS C;  5CMZ A;  4I1L A;  1PFI A;  2FFD A;  2JEE A;  2IFM A;  4IFM A;  1HH0 A;  3CI9 A;  4XE5 B;  2XU6 A;  2XNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...