4PD4I

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4pd4I00
3H1HJ 3H1IJ 1P84I 1SQVJ 4U3FJ 3TGUJ 3H1KJ 1L0LJ 1NU1J 1SQXJ 1KB9I 1KYOI 3L71J 5KLVJ 1BGYJ 1EZVI 2IBZI 3CXHI 3BCCJ 1BE3J 3H1JJ 1PP9J 1SQBJ 1L0NJ 3CWBJ 1BCCJ 3L74J 1SQQJ 1NTZJ 4D6TJ 3H1LJ 3L72J 2FYUJ 1NTKJ 4PD4I 1SQPJ 3CX5I 1NTMJ 3L70J 3L73J 3L75J 2BCCJ
chains in the Genus database with same CATH superfamily
3L35A 1K73Q 2FBWC 3GHGB 2Y0EA 3A0BE 3A3YB 2AEMA 2KLVA 3LW5H 3I55P 1NTZG 2IX7C 4XA4A 1KTMA 2IYPA 2RN0A 3L71G 4R4MA 5DJTB 1NTKG 1L0LJ 1ZW0A 2O1JA 1GK4A 4RESB 2JR8A 5C39A 1WT6A 1M90Q 3CC2P 2R3CA 1PL5A 3RBZA 3D70A 5KLVJ 2ZYGA 3VP9A 1BGYJ 2W27A 2A45I 1L4AD 2K9JB 4L76A 2NPSC 3V6IA 2H43A 3MD0A 4QMAA 1PP9J 1PV3A 3CI9A 3B5ND 3L71E 4KJMA 2OYIC 2XDJA 2QJKC 3A0HE 1OZHA 1KQLA 5B66H 1YJNP 2AXTH 1GU4A 1A02F 2O1KA 2ZJSE 3AEAC 2A45H 4Y99C 1M1KQ 1OWAA 1PP9D 4IL6E 2OTJP 1EDJA 1BE3G 1A02J 1BE3D 2J58A 1ZRTD 2XU6A 5KLVD 1BGYG 3TGUJ 1EZVG 3EWKA 4N3YB 1WMKA 1EQ7A 1U7MA 1L0LD 1ZLLA 1ZR2A 2IFNA 2WPQA 1KB9I 1NU1J 1R5SA 3V2PA 1X8YA 4C7NA 1JUNA 2K88A 1LT9B 1IFJA 3L74E 4WY4A 5AVSB 5AVWB 1YJ9P 2BEQD 1U57A 2GA1A 2IBZI 1L0ND 4JYCA 4L73A 1PPJG 4GIFA 3HD7B 5APYA 3TNUB 2FFDA 2VRSA 4HB1A 2JO1A 3CPWO 1YITP 3BCCE 3A2AA 5KAFE 2WT7B 3E1RA 1KILA 2W8ZA 3NTNA 4W7YA 3VMXA 4PV1B 3Q5PA 3L71D 1MUUA 2O01N 1RE3C 3FWLA 3L74G 1IFMA 1IFNA 1SQXE 3L74D 1P84H 3IAOA 1NU1K 1Y9BA 3CX5I 3RL0C 4C7NB 2H8PD 4GT1A 1FJPA 2WZ7A 1X22A 4W7ZA 3IF4A 3H6PA 4PV1D 1HVVA 1N7SA 3H1HJ 4AYCA 4NPDA 1VF5B 4TLFA 5CCHD 1RE4C 2E75B 1IFPA 3T97B 2WSCJ 1KILB 3S4RA 2R44A 3ABVC 2N9YB 2HPCA 1QVFO 1OVUA 1LWUC 2CK3H 1JOCA 1HGVA 3AE6C 3AEBC 1KV4A 4I1LA 4WY4D 1XTCC 5CCGC 1Q82Q 2H88C 2QG4A 1DD3A 1FS0E 4YPCA 1USEA 4HKZH 3WU2E 1N73B 2KXPB 1VDFA 3VYIA 1VQKP 4ASVA 4DJGA 1IFDA 4EOTA 3OW2O 1FAVA 3PTZA 5CJ0A 1S9KD 4IFDK 1MV8A 4D6TD 1YBKA 2LKMA 3L72G 3M91A 1HBWA 3ITKA 3MHVA 4WVZA 4EIJA 2HPCB 5AW6B 1HGZA 2M0BA 2N1TA 1OW8A 2WSSH 3V2QA 4DOJA 1T3UA 1BCCG 1VQ4P 5KLIB 1VQ8P 2IZ0A 2ZYAA 3IFMA 1W2BO 5TJHA 2W83C 1L0LG 2B87A 2ZT9B 5AVQB 3T97A 1VF5C 1YIJP 2WPRA 5B66E 1KILE 1IC2A 1KYOE 1QGKB 1ZXGA 3RK2C 3V4QA 4C46A 1QL1A 1CI6A 1UIIA 1HH0A 2XNDH 3PLNA 5AW7B 1YJWP 1KYOI 1NTMK 4H13D 1JTHA 4DCKA 1LTJC 1PP9G 2LXBA 4JYBA 4BRYB 2FYUK 2OTKE 1L0NE 1J1DC 2YXQB 1BDCA 3H1JD 1FZAA 1PZQA 2C9NY 4I7ZC 2SPZA 1NTME 4UB8H 1SQQK 1N7LA 1KILD 2HLOA 1X9VA 5AW8B 4YXWH 2YKOA 3G4SP 1VQ5P 3CCLP 2KNCB 2W90A 4IL6X 5KLIC 4D6TJ 1QVGO 3A0BH 3H1LD 4GDOA 1EXIA 2G8YA 3M0AA 3CCJP 1NKZB 3CWBD 1SQQG 4BRYA 3GHGC 3MUDC 1T3JA 1AVYA 3AE1C 5KJ7D 2NRGA 1VQOP 3H32A 1NO4A 1BSHA 2V4HA 3L36A 5E79H 1PGOA 2BCCD 4O9BA 3FX0A 3LIDA 3IR9A 2H7HA 3B71A 2H89C 3TSIA 4YXDC 3F5HA 1Q90D 3JSVC 1N73C 4WB4A 1SQQE 1SQXJ 1N8RQ 4HJGH 3PHLA 4I6MC 5AW0B 1L4AB 1M1JB 1OXZA 2YKQA 1LTSC 2QJYC 3A0HH 1GTWA 1EZVI 1VPCA 2Y0CA 1NHLA 3BCCJ 1GW3A 2AXTE 1KILC 1MKMA 2ZT9C 2QJKB 5KLVG 2L5GB 2JWAA 1SS1A 1SQBJ 4RKUJ 1VQPP 1GL2D 2M5AA 1Y8AA 2A06D 5APVA 3S1KA 2NPSB 2P2UA 3L74J 1S5LH 5CBOA 3A5TA 3CX5D 4IOIH 1OW7A 1GDTA 1NU1E 2YXRB 5AVTB 5KJ7C 4LC1A 1N7SC 1L0NG 5EFWB 1LT9A 1SLQA 1YQ4C 1SQBD 3CWBE 3L73J 1SQVK 1AFOA 3Q1MA 3GF7A 1Q81Q 4PJ0E 1QLED 1G1IA 3E1IA 1PIXA 2IYOA 1SP4A 3NXSA 1KC8Q 4L75A 1U7JA 1L0NK 1EZVD 5APWA 3V4WA 1IK9A 2UWJE 1CSBA 3N4XA 3W67A 1AVOA 2E5TA 1LWUB 3D71A 5CCGA 1VF5D 3H1KD 1LJ2A 3CC4P 2XV5A 1H89A 2YMYA 1SQQD 2OYOA 2R5DA 3TGUD 1KQSO 1JTHB 2P10A 3CXHH 3E7KA 2FKWB 3MGNA 2Y9YA 3EQ2A 3AE9C 1VQ7P 1L0NJ 1NTMD 3FXDA 1DEEG 4EYYQ 3CD6P 1CW5A 1JM0A 3CWBJ 1NTKE 1LTJB 2NPSA 1AA0A 1FJKA 1K04A 3L75G 1RY3A 1KYOH 3H1LJ 5AVRB 1PGJA 2RMZA 4LLHA 2JKVA 1EDKA 3RK3C 1T2KC 4IFMA 1SQPJ 4U7JA 1S1CX 2KZIA 2JEEA 2YKPA 4PV1C 4AUWA 1G2CB 1NAFA 2N1TD 2IBZG 2IFMA 1SQBE 3LIEA 3NMDA 1S72P 3CCRP 2OYIB 1OFCX 3L73E 1BGYD 5AW9B 3I56P 1YQ3C 1K05A 4UB8E 3B4SA 3L70D 2ZYDA 1FZFA 3CL3D 3M9BA 1S9KE 1N73A 5CCGD 2E76D 2OARA 3SWYA 2D2CB 2GUVA 5K5GB 5KAIH 1SFCD 1QX8A 4H0LB 3V2RA 2OTLP 1T8ZA 1L0LK 2HFED 2QIWA 3OJAB 1GL2A 2B87B 3HTKB 3P8CE 4K35A 2IPPA 2ZVNB 4N78D 1DH3A 4W80A 2C0WA 2FYUE 2PGDA 3RK3D 4ZNCA 1R8EA 2E75D 1DX7A 1N86A 2N1TB 3MUDA 1VQMP 1GU5A 1NTKJ 5KKZC 4PD4I 5H2FE 4EDFA 1JY3N 1PPJE 1RE3A 1HWTC 1JY2N 3M9HA 2Q6QA 4ZKPA 1YI2P 1N7SD 2KI7B 2O3JA 3SFDC 5CCHA 3P8CD 1OVVA 2JJLA 1GZLA 3FWNA 1NH4A 2E43A 3Q5RA 3L73D 3RK2B 4PD4H 2W6BA 3CC7P 1FZCA 1YYCA 4WY4C 3N7NA 4WWIA 4U3FD 3H1ID 2ZAEB 1IJDB 3PRJA 4BXLA 1SQBG 5AW4B 1LTBC 2E5YA 3H1HD 1AV1A 1JMBA 3ZDMA 2QRXA 1NGMB 1JNMA 4M3LA 2KYVA 3BCCD 1YTZI 3G3ZA 4GOEA 1DEBA 1T2KD 1SQBK 4K3AA 1FZEA 5TISE 2OGUA 3O6QA 3AECC 3GG2A 1YHQP 1KN7A 1H0TB 1SQXD 1SFCB 4H0LD 1FZGA 2FYZA 5KLVK 3G6EP 3H25A 2Q9IA 1BDDA 2ZVOB 1LTIC 1NTZK 1X0TA 3BATA 2WSCH 3EFGA 3M9QA 1VQ6P 1NTKK 2WPVB 1RE4A 1NWQA 4H44B 2E74B 2YMKA 2FYUG 2N1TC 1URQC 1L2PA 2KUBA 1SQPE 1KORA 4C7RA 2JP3A 3KPEA 4BWNA 3H1LE 4H13C 4GODA 3LW5J 5AW5B 2QJYB 1SQVG 1JCCA 1Z56A 3CLQA 2XNXA 4U3FE 3HE5B 3M0DC 5B5EE 2FFDB 3P32A 1FOSF 1LT1A 3CWBG 3PH0A 3NFQA 1SFCC 3H1HE 1BE3E 1JCDA 1E5WA 1QL2A 1ZRTE 3WUTA 1MFTA 2HYNA 4PJ0H 4CPGA 2HODB 3R4YA 3H1JG 3OAKA 3CCMP 1ZMEC 3CCEP 3C1LA 4D6TE 4EI2A 2FYUJ 5L8RJ 1GK6A 2KK7A 1FOSE 2O01J 2I1KA 1N2DC 2C9LY 1AQ5A 1FZBA 1NTMJ 1SQVD 4I7ZB 1HJBA 3CMEP 4UB6E 2G3AA 3SWKA 3KDPB 2XKMA 3CXHE 1DD4A 2M3BA 4OWFA 1KFMA 2P58A 1H88A 1KQGB 2MKVA 4GKGA 1RF1A 2KLUA 1KYOD 1JY2P 1HUCA 1LTTC 3H32B 1FDMA 1J1DB 1JB0J 1NAYA 3F89A 2KOGA 3HUSA 4ZKUA 1USDA 4H13B 5M1BA 1BCCD 1KZUB 2B88A 1FC2C 3HE5A 1MFZA 1URQB 3CXHD 3AE2C 2KZJA 3AE7C 2GUSA 3FXEA 2ZT9D 2CPBA 5AVXB 1J2JB 2L91A 2NZ2A 2FXOA 2HODA 1KB9H 1SQQJ 1S4XA 1ZOYC 1RQUA 2QJPB 2V7QJ 3AE3C 3KHUA 2E74D 2WSFJ 4RJTA 1NTZD 3GHGA 2WTYA 3TGUE 3HUSB 3D6YA 1OX3A 5CJ4A 2WPSA 3WU2H 3H1KG 2QEXP 2YO3A 4TT3H 1PP9E 1YTZT 1CI6B 3MTUE 5AVZB 3RGUA 3WUVA 3TF5A 5APQA 1FE6A 3VP8A 4OH8B 4IFFA 1EDIA 5BVZA 1VQ9P 2I1JA 5KAFH 1SQXG 1URQD 3TDKA 5TISH 4R4LA 2KSEA 5AW1B 1M8OB 3C8VA 4Y28J 3FGAD 1P84E 4WBAA 1MZ9A 2J59M 4RO0A 5GTIE 2IDBA 2CPSA 2JWDA 5H2FH 3GF3A 2M3EA 2QM7A 3M0DA 1BGYE 1PGPA 4OGQC 3RK3B 1VQLP 1FDOA 2P1JA 1LP1A 1W5CE 2R3SA 3CX5H 4OGQB 2FYNB 5AW3B 3RL0B 3RL0D 3G71P 2QVAA 1NVOA 2XZRA 4KHXA 4MN4C 1K9MQ 1IO4A 3L72D 1NU1D 2M8RA 4B86A 2E42A 1EDLA 2LR2A 2D2CD 1JMMA 2KIKA 5CBNA 1SQVE 2FXPA 4AQRD 4JBZA 2WWWA 3L75J 4L74A 5B5EH 2BCCJ 2OYHC 2PFXA 3UIAA 3AEGC 5CMZA 3RK2D 3L75E 5GTHH 2BCCG 3HD7D 3USSA 1ZR4A 4PD4D 1KMIZ 1ZP0C 3HD7A 5APXA 4H44D 1S3JA 3TNUA 4UB6H 2J5UA 1T6AA 3VMZA 3CCSP 3CCUP 1Q86Q 1SFCA 1LGHB 2DW3A 1BCCE 2Y0DA 3HE4B 1Q7YQ 2Z4EA 1P84D 3G9RA 3BVHA 1S2EA 3WMM0 3GMAA 3L75D 3H1JJ 3SWFA 3MP7B 1EXJA 3A7OA 2NPSD 3L4FA 1JY3P 1SQPD 3L37A 1RHZB 1EC5A 1GD2E 4OVNF 4Y99B 3H1IE 2E75C 2FY8A 2WVRA 2E74C 3AEDC 3U59A 4DT0A 3HE4A 3PJSK 2ITAA 3GW6A 4ZMDA 3C9IA 3U1AA 3B5NB 3PP5A 3KQGA 5CHXA 2PRRA 2Q7CA 1RQVA 1QEXA 3H1HG 3VMAA 1P84I 3CCVP 1RF1B 2YO2A 2AEFA 1KD1Q 1OVRA 3EFFK 3H1KJ 2KSJA 1KB9E 2N9BA 2QSIA 3H1IG 2C0XA 3P8MC 1NJIQ 1J1EC 1D7MA 1OMIA 1KQFB 1K8AQ 2FFDC 5APSA 3VN0A 1GL2C 1KFNA 1X79B 2AEJA 1M57D 5E79E 3HTKA 2O01H 2OYHB 5KTBA 4N6JA 2K9JA 1TU3F 4H0LC 1IK7A 1NTZJ 2RKLA 2D2CC 4OGQD 3HRNA 3S9OA 3SFEC 5BU8B 3CCQP 3B5NC 2QE7H 4NPFX 1IZNB 3KYQA 4GOFA 3I5CA 2LXCB 3Q3DA 1PGQA 5DJUB 5APTA 5CCHC 2FYNC 2W6JH 3V2NA 2Q3IA 1W2EA 2K9YA 1AJYA 3JCUE 2W6AA 3L70E 2OYHA 2B89A 2WQYC 4Z1MH 1LTGC 4H44C 2Y9ZA 1XTGB 3CX5E 4D6TG 1NU1G 2E76C 2WSEH 1FZCC 1S5LE 1RH5B 1SQPK 1URQA 2A06G 2B9BA 1KB9D 2QM8A 3HD7C 2P67A 3B8EB 3K5BA 3L71J 3GLMA 2BEZF 3QH9A 1HF9A 3M06A 3O6QB 3CXHI 3L70G 3SSUA 1LTJA 5GTHE 3KZIE 1BE3J 1H0TA 1L4AA 1M1JA 1SQPG 2YIUC 1S5LX 1EZVE 2IBZE 2KS1A 4JF7A 3BASA 1BCCJ 1L0LE 1NOHA 1UIXA 2ZXEB 5AVUB 1FBMA 2HR3A 1AQTA 2M5AB 2IZ1A 4HH2A 1RF0A 5KAIE 2OYIA 1NYHA 3Q5SA 2POHA 1Y47A 3L70J 4WY4B 2MJZA 2KNCA 2YNYA 1J1EB 5AVYB 1JY3O 3BCCG 2E76B 3Q2YA 1FZCB 3AE5C 1DIPA 1ZN5A 1G1JA 5GTIH 3U1CA 2R32A 4NPEA 2OQQA 3BRVB 1SQVJ 1M56D 1LP1B 2GM4A 1FU1A 1N7SB 2WSEJ 2FYUD 3RK3E 1Q2NA 3RL0g 3TGUG 3AE4C 3H1KE 1M7LA 2JDIH 3VOPA 1SVFA 1ZV8A 2FXMA 1FDIA 3L73G 1PPJD 4A7PA 1JEKA 4LGDE 3IN6A 4IL6H 3VMYA 3AEEC 2PAJA 2WT7A 4ASWA 2WSFH 2I8DA 2RH0A 2Z5HA 2A06E 5APUA 3QWOC 1PFIA 2V7QH 1GL2B 3KXDA 3L72J 1HTLC 2PP6A 4HYTB 1SQXK 3AEFC 3O8ZA 1OIPA 5KJ7A 2YIUB 3P7KA 3WUUA 2A45G 4JQ0D 5BU5A 1GMJA 1LT9C 4U3FG 1BSNA 1GW4A 2K1AA 3II6A 3H1JE 1LNQA 2Q1KA 1R5LA 3D6ZA 5KLVE 1RF1C 3VTPC 2QA4P 2R5BA 3JC22 3H1IJ 4U3FJ 2BASA 3TYYA 1G2CA 1JY2O 3HUSC 3BRTB 3L72E 1CZQA 3MIWA 2WMMA 3MZWB 4YTPC 1JO5A 3W68A 1OW6A 2QJPC 2HG5D 1VQNP 1WRGA 4DZOA 3AE8C 2Q3EA 1HJ0A 1LWUA 3CMAP 2Q5UA 2WITA 3JCUH 3RBXA 2BCCE 2KS1B 2IBZD 2ZFCA 1L4AC 1M1JC 1NKNA 3B5NA 3OA7A 1VL2A 4KT0J 4XE5B 2KP8A 3V5BA 1NTKD 4PD4E 4JPZB 4N78E 1E79H 2K3RA 1NTZE 3R2PA 5AW2B 3H1LG 1LTAC 2Z5IA 3KZIH 3TK1A 2P7JA 1RF0C 2K37A 2ZXXA 5KKZB 1H8AA 4XFJA 2KB7P 4I2LC 5AVVB 1NTMG 1IFIA 2AXCA
chains in the Genus database with same CATH topology
3H1HJ 3H1IJ 1P84I 1SQVJ 4U3FJ 3TGUJ 3H1KJ 1L0LJ 1NU1J 1SQXJ 1KB9I 1KYOI 3L71J 5KLVJ 1BGYJ 1EZVI 2IBZI 3CXHI 3BCCJ 1BE3J 3H1JJ 1PP9J 1SQBJ 1L0NJ 3CWBJ 1BCCJ 3L74J 1SQQJ 1NTZJ 4D6TJ 3H1LJ 3L72J 2FYUJ 1NTKJ 4PD4I 1SQPJ 3CX5I 1NTMJ 3L70J 3L73J 3L75J 2BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H J;  3H1I J;  1P84 I;  1SQV J;  4U3F J;  3TGU J;  3H1K J;  1L0L J;  1NU1 J;  1SQX J;  1KB9 I;  1KYO I;  3L71 J;  5KLV J;  1BGY J;  1EZV I;  2IBZ I;  3CXH I;  3BCC J;  1BE3 J;  3H1J J;  1PP9 J;  1SQB J;  1L0N J;  3CWB J;  1BCC J;  3L74 J;  1SQQ J;  1NTZ J;  4D6T J;  3H1L J;  3L72 J;  2FYU J;  1NTK J;  4PD4 I;  1SQP J;  3CX5 I;  1NTM J;  3L70 J;  3L73 J;  3L75 J;  2BCC J; 
#chains in the Genus database with same CATH topology
 3L35 A;  1K73 Q;  2FBW C;  3GHG B;  2Y0E A;  3A0B E;  3A3Y B;  2AEM A;  2KLV A;  3LW5 H;  3I55 P;  1NTZ G;  2IX7 C;  4XA4 A;  1KTM A;  2IYP A;  2RN0 A;  3L71 G;  4R4M A;  5DJT B;  1NTK G;  1L0L J;  1ZW0 A;  2O1J A;  1GK4 A;  4RES B;  2JR8 A;  5C39 A;  1WT6 A;  1M90 Q;  3CC2 P;  2R3C A;  1PL5 A;  3RBZ A;  3D70 A;  5KLV J;  2ZYG A;  3VP9 A;  1BGY J;  2W27 A;  2A45 I;  1L4A D;  2K9J B;  4L76 A;  2NPS C;  3V6I A;  2H43 A;  3MD0 A;  4QMA A;  1PP9 J;  1PV3 A;  3CI9 A;  3B5N D;  3L71 E;  4KJM A;  2OYI C;  2XDJ A;  2QJK C;  3A0H E;  1OZH A;  1KQL A;  5B66 H;  1YJN P;  2AXT H;  1GU4 A;  1A02 F;  2O1K A;  2ZJS E;  3AEA C;  2A45 H;  4Y99 C;  1M1K Q;  1OWA A;  1PP9 D;  4IL6 E;  2OTJ P;  1EDJ A;  1BE3 G;  1A02 J;  1BE3 D;  2J58 A;  1ZRT D;  2XU6 A;  5KLV D;  1BGY G;  3TGU J;  1EZV G;  3EWK A;  4N3Y B;  1WMK A;  1EQ7 A;  1U7M A;  1L0L D;  1ZLL A;  1ZR2 A;  2IFN A;  2WPQ A;  1KB9 I;  1NU1 J;  1R5S A;  3V2P A;  1X8Y A;  4C7N A;  1JUN A;  2K88 A;  1LT9 B;  1IFJ A;  3L74 E;  4WY4 A;  5AVS B;  5AVW B;  1YJ9 P;  2BEQ D;  1U57 A;  2GA1 A;  2IBZ I;  1L0N D;  4JYC A;  4L73 A;  1PPJ G;  4GIF A;  3HD7 B;  5APY A;  3TNU B;  2FFD A;  2VRS A;  4HB1 A;  2JO1 A;  3CPW O;  1YIT P;  3BCC E;  3A2A A;  5KAF E;  2WT7 B;  3E1R A;  1KIL A;  2W8Z A;  3NTN A;  4W7Y A;  3VMX A;  4PV1 B;  3Q5P A;  3L71 D;  1MUU A;  2O01 N;  1RE3 C;  3FWL A;  3L74 G;  1IFM A;  1IFN A;  1SQX E;  3L74 D;  1P84 H;  3IAO A;  1NU1 K;  1Y9B A;  3CX5 I;  3RL0 C;  4C7N B;  2H8P D;  4GT1 A;  1FJP A;  2WZ7 A;  1X22 A;  4W7Z A;  3IF4 A;  3H6P A;  4PV1 D;  1HVV A;  1N7S A;  3H1H J;  4AYC A;  4NPD A;  1VF5 B;  4TLF A;  5CCH D;  1RE4 C;  2E75 B;  1IFP A;  3T97 B;  2WSC J;  1KIL B;  3S4R A;  2R44 A;  3ABV C;  2N9Y B;  2HPC A;  1QVF O;  1OVU A;  1LWU C;  2CK3 H;  1JOC A;  1HGV A;  3AE6 C;  3AEB C;  1KV4 A;  4I1L A;  4WY4 D;  1XTC C;  5CCG C;  1Q82 Q;  2H88 C;  2QG4 A;  1DD3 A;  1FS0 E;  4YPC A;  1USE A;  4HKZ H;  3WU2 E;  1N73 B;  2KXP B;  1VDF A;  3VYI A;  1VQK P;  4ASV A;  4DJG A;  1IFD A;  4EOT A;  3OW2 O;  1FAV A;  3PTZ A;  5CJ0 A;  1S9K D;  4IFD K;  1MV8 A;  4D6T D;  1YBK A;  2LKM A;  3L72 G;  3M91 A;  1HBW A;  3ITK A;  3MHV A;  4WVZ A;  4EIJ A;  2HPC B;  5AW6 B;  1HGZ A;  2M0B A;  2N1T A;  1OW8 A;  2WSS H;  3V2Q A;  4DOJ A;  1T3U A;  1BCC G;  1VQ4 P;  5KLI B;  1VQ8 P;  2IZ0 A;  2ZYA A;  3IFM A;  1W2B O;  5TJH A;  2W83 C;  1L0L G;  2B87 A;  2ZT9 B;  5AVQ B;  3T97 A;  1VF5 C;  1YIJ P;  2WPR A;  5B66 E;  1KIL E;  1IC2 A;  1KYO E;  1QGK B;  1ZXG A;  3RK2 C;  3V4Q A;  4C46 A;  1QL1 A;  1CI6 A;  1UII A;  1HH0 A;  2XND H;  3PLN A;  5AW7 B;  1YJW P;  1KYO I;  1NTM K;  4H13 D;  1JTH A;  4DCK A;  1LTJ C;  1PP9 G;  2LXB A;  4JYB A;  4BRY B;  2FYU K;  2OTK E;  1L0N E;  1J1D C;  2YXQ B;  1BDC A;  3H1J D;  1FZA A;  1PZQ A;  2C9N Y;  4I7Z C;  2SPZ A;  1NTM E;  4UB8 H;  1SQQ K;  1N7L A;  1KIL D;  2HLO A;  1X9V A;  5AW8 B;  4YXW H;  2YKO A;  3G4S P;  1VQ5 P;  3CCL P;  2KNC B;  2W90 A;  4IL6 X;  5KLI C;  4D6T J;  1QVG O;  3A0B H;  3H1L D;  4GDO A;  1EXI A;  2G8Y A;  3M0A A;  3CCJ P;  1NKZ B;  3CWB D;  1SQQ G;  4BRY A;  3GHG C;  3MUD C;  1T3J A;  1AVY A;  3AE1 C;  5KJ7 D;  2NRG A;  1VQO P;  3H32 A;  1NO4 A;  1BSH A;  2V4H A;  3L36 A;  5E79 H;  1PGO A;  2BCC D;  4O9B A;  3FX0 A;  3LID A;  3IR9 A;  2H7H A;  3B71 A;  2H89 C;  3TSI A;  4YXD C;  3F5H A;  1Q90 D;  3JSV C;  1N73 C;  4WB4 A;  1SQQ E;  1SQX J;  1N8R Q;  4HJG H;  3PHL A;  4I6M C;  5AW0 B;  1L4A B;  1M1J B;  1OXZ A;  2YKQ A;  1LTS C;  2QJY C;  3A0H H;  1GTW A;  1EZV I;  1VPC A;  2Y0C A;  1NHL A;  3BCC J;  1GW3 A;  2AXT E;  1KIL C;  1MKM A;  2ZT9 C;  2QJK B;  5KLV G;  2L5G B;  2JWA A;  1SS1 A;  1SQB J;  4RKU J;  1VQP P;  1GL2 D;  2M5A A;  1Y8A A;  2A06 D;  5APV A;  3S1K A;  2NPS B;  2P2U A;  3L74 J;  1S5L H;  5CBO A;  3A5T A;  3CX5 D;  4IOI H;  1OW7 A;  1GDT A;  1NU1 E;  2YXR B;  5AVT B;  5KJ7 C;  4LC1 A;  1N7S C;  1L0N G;  5EFW B;  1LT9 A;  1SLQ A;  1YQ4 C;  1SQB D;  3CWB E;  3L73 J;  1SQV K;  1AFO A;  3Q1M A;  3GF7 A;  1Q81 Q;  4PJ0 E;  1QLE D;  1G1I A;  3E1I A;  1PIX A;  2IYO A;  1SP4 A;  3NXS A;  1KC8 Q;  4L75 A;  1U7J A;  1L0N K;  1EZV D;  5APW A;  3V4W A;  1IK9 A;  2UWJ E;  1CSB A;  3N4X A;  3W67 A;  1AVO A;  2E5T A;  1LWU B;  3D71 A;  5CCG A;  1VF5 D;  3H1K D;  1LJ2 A;  3CC4 P;  2XV5 A;  1H89 A;  2YMY A;  1SQQ D;  2OYO A;  2R5D A;  3TGU D;  1KQS O;  1JTH B;  2P10 A;  3CXH H;  3E7K A;  2FKW B;  3MGN A;  2Y9Y A;  3EQ2 A;  3AE9 C;  1VQ7 P;  1L0N J;  1NTM D;  3FXD A;  1DEE G;  4EYY Q;  3CD6 P;  1CW5 A;  1JM0 A;  3CWB J;  1NTK E;  1LTJ B;  2NPS A;  1AA0 A;  1FJK A;  1K04 A;  3L75 G;  1RY3 A;  1KYO H;  3H1L J;  5AVR B;  1PGJ A;  2RMZ A;  4LLH A;  2JKV A;  1EDK A;  3RK3 C;  1T2K C;  4IFM A;  1SQP J;  4U7J A;  1S1C X;  2KZI A;  2JEE A;  2YKP A;  4PV1 C;  4AUW A;  1G2C B;  1NAF A;  2N1T D;  2IBZ G;  2IFM A;  1SQB E;  3LIE A;  3NMD A;  1S72 P;  3CCR P;  2OYI B;  1OFC X;  3L73 E;  1BGY D;  5AW9 B;  3I56 P;  1YQ3 C;  1K05 A;  4UB8 E;  3B4S A;  3L70 D;  2ZYD A;  1FZF A;  3CL3 D;  3M9B A;  1S9K E;  1N73 A;  5CCG D;  2E76 D;  2OAR A;  3SWY A;  2D2C B;  2GUV A;  5K5G B;  5KAI H;  1SFC D;  1QX8 A;  4H0L B;  3V2R A;  2OTL P;  1T8Z A;  1L0L K;  2HFE D;  2QIW A;  3OJA B;  1GL2 A;  2B87 B;  3HTK B;  3P8C E;  4K35 A;  2IPP A;  2ZVN B;  4N78 D;  1DH3 A;  4W80 A;  2C0W A;  2FYU E;  2PGD A;  3RK3 D;  4ZNC A;  1R8E A;  2E75 D;  1DX7 A;  1N86 A;  2N1T B;  3MUD A;  1VQM P;  1GU5 A;  1NTK J;  5KKZ C;  4PD4 I;  5H2F E;  4EDF A;  1JY3 N;  1PPJ E;  1RE3 A;  1HWT C;  1JY2 N;  3M9H A;  2Q6Q A;  4ZKP A;  1YI2 P;  1N7S D;  2KI7 B;  2O3J A;  3SFD C;  5CCH A;  3P8C D;  1OVV A;  2JJL A;  1GZL A;  3FWN A;  1NH4 A;  2E43 A;  3Q5R A;  3L73 D;  3RK2 B;  4PD4 H;  2W6B A;  3CC7 P;  1FZC A;  1YYC A;  4WY4 C;  3N7N A;  4WWI A;  4U3F D;  3H1I D;  2ZAE B;  1IJD B;  3PRJ A;  4BXL A;  1SQB G;  5AW4 B;  1LTB C;  2E5Y A;  3H1H D;  1AV1 A;  1JMB A;  3ZDM A;  2QRX A;  1NGM B;  1JNM A;  4M3L A;  2KYV A;  3BCC D;  1YTZ I;  3G3Z A;  4GOE A;  1DEB A;  1T2K D;  1SQB K;  4K3A A;  1FZE A;  5TIS E;  2OGU A;  3O6Q A;  3AEC C;  3GG2 A;  1YHQ P;  1KN7 A;  1H0T B;  1SQX D;  1SFC B;  4H0L D;  1FZG A;  2FYZ A;  5KLV K;  3G6E P;  3H25 A;  2Q9I A;  1BDD A;  2ZVO B;  1LTI C;  1NTZ K;  1X0T A;  3BAT A;  2WSC H;  3EFG A;  3M9Q A;  1VQ6 P;  1NTK K;  2WPV B;  1RE4 A;  1NWQ A;  4H44 B;  2E74 B;  2YMK A;  2FYU G;  2N1T C;  1URQ C;  1L2P A;  2KUB A;  1SQP E;  1KOR A;  4C7R A;  2JP3 A;  3KPE A;  4BWN A;  3H1L E;  4H13 C;  4GOD A;  3LW5 J;  5AW5 B;  2QJY B;  1SQV G;  1JCC A;  1Z56 A;  3CLQ A;  2XNX A;  4U3F E;  3HE5 B;  3M0D C;  5B5E E;  2FFD B;  3P32 A;  1FOS F;  1LT1 A;  3CWB G;  3PH0 A;  3NFQ A;  1SFC C;  3H1H E;  1BE3 E;  1JCD A;  1E5W A;  1QL2 A;  1ZRT E;  3WUT A;  1MFT A;  2HYN A;  4PJ0 H;  4CPG A;  2HOD B;  3R4Y A;  3H1J G;  3OAK A;  3CCM P;  1ZME C;  3CCE P;  3C1L A;  4D6T E;  4EI2 A;  2FYU J;  5L8R J;  1GK6 A;  2KK7 A;  1FOS E;  2O01 J;  2I1K A;  1N2D C;  2C9L Y;  1AQ5 A;  1FZB A;  1NTM J;  1SQV D;  4I7Z B;  1HJB A;  3CME P;  4UB6 E;  2G3A A;  3SWK A;  3KDP B;  2XKM A;  3CXH E;  1DD4 A;  2M3B A;  4OWF A;  1KFM A;  2P58 A;  1H88 A;  1KQG B;  2MKV A;  4GKG A;  1RF1 A;  2KLU A;  1KYO D;  1JY2 P;  1HUC A;  1LTT C;  3H32 B;  1FDM A;  1J1D B;  1JB0 J;  1NAY A;  3F89 A;  2KOG A;  3HUS A;  4ZKU A;  1USD A;  4H13 B;  5M1B A;  1BCC D;  1KZU B;  2B88 A;  1FC2 C;  3HE5 A;  1MFZ A;  1URQ B;  3CXH D;  3AE2 C;  2KZJ A;  3AE7 C;  2GUS A;  3FXE A;  2ZT9 D;  2CPB A;  5AVX B;  1J2J B;  2L91 A;  2NZ2 A;  2FXO A;  2HOD A;  1KB9 H;  1SQQ J;  1S4X A;  1ZOY C;  1RQU A;  2QJP B;  2V7Q J;  3AE3 C;  3KHU A;  2E74 D;  2WSF J;  4RJT A;  1NTZ D;  3GHG A;  2WTY A;  3TGU E;  3HUS B;  3D6Y A;  1OX3 A;  5CJ4 A;  2WPS A;  3WU2 H;  3H1K G;  2QEX P;  2YO3 A;  4TT3 H;  1PP9 E;  1YTZ T;  1CI6 B;  3MTU E;  5AVZ B;  3RGU A;  3WUV A;  3TF5 A;  5APQ A;  1FE6 A;  3VP8 A;  4OH8 B;  4IFF A;  1EDI A;  5BVZ A;  1VQ9 P;  2I1J A;  5KAF H;  1SQX G;  1URQ D;  3TDK A;  5TIS H;  4R4L A;  2KSE A;  5AW1 B;  1M8O B;  3C8V A;  4Y28 J;  3FGA D;  1P84 E;  4WBA A;  1MZ9 A;  2J59 M;  4RO0 A;  5GTI E;  2IDB A;  2CPS A;  2JWD A;  5H2F H;  3GF3 A;  2M3E A;  2QM7 A;  3M0D A;  1BGY E;  1PGP A;  4OGQ C;  3RK3 B;  1VQL P;  1FDO A;  2P1J A;  1LP1 A;  1W5C E;  2R3S A;  3CX5 H;  4OGQ B;  2FYN B;  5AW3 B;  3RL0 B;  3RL0 D;  3G71 P;  2QVA A;  1NVO A;  2XZR A;  4KHX A;  4MN4 C;  1K9M Q;  1IO4 A;  3L72 D;  1NU1 D;  2M8R A;  4B86 A;  2E42 A;  1EDL A;  2LR2 A;  2D2C D;  1JMM A;  2KIK A;  5CBN A;  1SQV E;  2FXP A;  4AQR D;  4JBZ A;  2WWW A;  3L75 J;  4L74 A;  5B5E H;  2BCC J;  2OYH C;  2PFX A;  3UIA A;  3AEG C;  5CMZ A;  3RK2 D;  3L75 E;  5GTH H;  2BCC G;  3HD7 D;  3USS A;  1ZR4 A;  4PD4 D;  1KMI Z;  1ZP0 C;  3HD7 A;  5APX A;  4H44 D;  1S3J A;  3TNU A;  4UB6 H;  2J5U A;  1T6A A;  3VMZ A;  3CCS P;  3CCU P;  1Q86 Q;  1SFC A;  1LGH B;  2DW3 A;  1BCC E;  2Y0D A;  3HE4 B;  1Q7Y Q;  2Z4E A;  1P84 D;  3G9R A;  3BVH A;  1S2E A;  3WMM 0;  3GMA A;  3L75 D;  3H1J J;  3SWF A;  3MP7 B;  1EXJ A;  3A7O A;  2NPS D;  3L4F A;  1JY3 P;  1SQP D;  3L37 A;  1RHZ B;  1EC5 A;  1GD2 E;  4OVN F;  4Y99 B;  3H1I E;  2E75 C;  2FY8 A;  2WVR A;  2E74 C;  3AED C;  3U59 A;  4DT0 A;  3HE4 A;  3PJS K;  2ITA A;  3GW6 A;  4ZMD A;  3C9I A;  3U1A A;  3B5N B;  3PP5 A;  3KQG A;  5CHX A;  2PRR A;  2Q7C A;  1RQV A;  1QEX A;  3H1H G;  3VMA A;  1P84 I;  3CCV P;  1RF1 B;  2YO2 A;  2AEF A;  1KD1 Q;  1OVR A;  3EFF K;  3H1K J;  2KSJ A;  1KB9 E;  2N9B A;  2QSI A;  3H1I G;  2C0X A;  3P8M C;  1NJI Q;  1J1E C;  1D7M A;  1OMI A;  1KQF B;  1K8A Q;  2FFD C;  5APS A;  3VN0 A;  1GL2 C;  1KFN A;  1X79 B;  2AEJ A;  1M57 D;  5E79 E;  3HTK A;  2O01 H;  2OYH B;  5KTB A;  4N6J A;  2K9J A;  1TU3 F;  4H0L C;  1IK7 A;  1NTZ J;  2RKL A;  2D2C C;  4OGQ D;  3HRN A;  3S9O A;  3SFE C;  5BU8 B;  3CCQ P;  3B5N C;  2QE7 H;  4NPF X;  1IZN B;  3KYQ A;  4GOF A;  3I5C A;  2LXC B;  3Q3D A;  1PGQ A;  5DJU B;  5APT A;  5CCH C;  2FYN C;  2W6J H;  3V2N A;  2Q3I A;  1W2E A;  2K9Y A;  1AJY A;  3JCU E;  2W6A A;  3L70 E;  2OYH A;  2B89 A;  2WQY C;  4Z1M H;  1LTG C;  4H44 C;  2Y9Z A;  1XTG B;  3CX5 E;  4D6T G;  1NU1 G;  2E76 C;  2WSE H;  1FZC C;  1S5L E;  1RH5 B;  1SQP K;  1URQ A;  2A06 G;  2B9B A;  1KB9 D;  2QM8 A;  3HD7 C;  2P67 A;  3B8E B;  3K5B A;  3L71 J;  3GLM A;  2BEZ F;  3QH9 A;  1HF9 A;  3M06 A;  3O6Q B;  3CXH I;  3L70 G;  3SSU A;  1LTJ A;  5GTH E;  3KZI E;  1BE3 J;  1H0T A;  1L4A A;  1M1J A;  1SQP G;  2YIU C;  1S5L X;  1EZV E;  2IBZ E;  2KS1 A;  4JF7 A;  3BAS A;  1BCC J;  1L0L E;  1NOH A;  1UIX A;  2ZXE B;  5AVU B;  1FBM A;  2HR3 A;  1AQT A;  2M5A B;  2IZ1 A;  4HH2 A;  1RF0 A;  5KAI E;  2OYI A;  1NYH A;  3Q5S A;  2POH A;  1Y47 A;  3L70 J;  4WY4 B;  2MJZ A;  2KNC A;  2YNY A;  1J1E B;  5AVY B;  1JY3 O;  3BCC G;  2E76 B;  3Q2Y A;  1FZC B;  3AE5 C;  1DIP A;  1ZN5 A;  1G1J A;  5GTI H;  3U1C A;  2R32 A;  4NPE A;  2OQQ A;  3BRV B;  1SQV J;  1M56 D;  1LP1 B;  2GM4 A;  1FU1 A;  1N7S B;  2WSE J;  2FYU D;  3RK3 E;  1Q2N A;  3RL0 g;  3TGU G;  3AE4 C;  3H1K E;  1M7L A;  2JDI H;  3VOP A;  1SVF A;  1ZV8 A;  2FXM A;  1FDI A;  3L73 G;  1PPJ D;  4A7P A;  1JEK A;  4LGD E;  3IN6 A;  4IL6 H;  3VMY A;  3AEE C;  2PAJ A;  2WT7 A;  4ASW A;  2WSF H;  2I8D A;  2RH0 A;  2Z5H A;  2A06 E;  5APU A;  3QWO C;  1PFI A;  2V7Q H;  1GL2 B;  3KXD A;  3L72 J;  1HTL C;  2PP6 A;  4HYT B;  1SQX K;  3AEF C;  3O8Z A;  1OIP A;  5KJ7 A;  2YIU B;  3P7K A;  3WUU A;  2A45 G;  4JQ0 D;  5BU5 A;  1GMJ A;  1LT9 C;  4U3F G;  1BSN A;  1GW4 A;  2K1A A;  3II6 A;  3H1J E;  1LNQ A;  2Q1K A;  1R5L A;  3D6Z A;  5KLV E;  1RF1 C;  3VTP C;  2QA4 P;  2R5B A;  3JC2 2;  3H1I J;  4U3F J;  2BAS A;  3TYY A;  1G2C A;  1JY2 O;  3HUS C;  3BRT B;  3L72 E;  1CZQ A;  3MIW A;  2WMM A;  3MZW B;  4YTP C;  1JO5 A;  3W68 A;  1OW6 A;  2QJP C;  2HG5 D;  1VQN P;  1WRG A;  4DZO A;  3AE8 C;  2Q3E A;  1HJ0 A;  1LWU A;  3CMA P;  2Q5U A;  2WIT A;  3JCU H;  3RBX A;  2BCC E;  2KS1 B;  2IBZ D;  2ZFC A;  1L4A C;  1M1J C;  1NKN A;  3B5N A;  3OA7 A;  1VL2 A;  4KT0 J;  4XE5 B;  2KP8 A;  3V5B A;  1NTK D;  4PD4 E;  4JPZ B;  4N78 E;  1E79 H;  2K3R A;  1NTZ E;  3R2P A;  5AW2 B;  3H1L G;  1LTA C;  2Z5I A;  3KZI H;  3TK1 A;  2P7J A;  1RF0 C;  2K37 A;  2ZXX A;  5KKZ B;  1H8A A;  4XFJ A;  2KB7 P;  4I2L C;  5AVV B;  1NTM G;  1IFI A;  2AXC A; 
#chains in the Genus database with same CATH homology
 3H1H J;  3H1I J;  1P84 I;  1SQV J;  4U3F J;  3TGU J;  3H1K J;  1L0L J;  1NU1 J;  1SQX J;  1KB9 I;  1KYO I;  3L71 J;  5KLV J;  1BGY J;  1EZV I;  2IBZ I;  3CXH I;  3BCC J;  1BE3 J;  3H1J J;  1PP9 J;  1SQB J;  1L0N J;  3CWB J;  1BCC J;  3L74 J;  1SQQ J;  1NTZ J;  4D6T J;  3H1L J;  3L72 J;  2FYU J;  1NTK J;  4PD4 I;  1SQP J;  3CX5 I;  1NTM J;  3L70 J;  3L73 J;  3L75 J;  2BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...