4PD4I

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4pd4I00
1BCCJ 3L74J 4D6TJ 1L0LJ 3CXHI 1SQXJ 1PP9J 1EZVI 3L71J 3H1KJ 1SQBJ 1SQVJ 1BGYJ 1P84I 3TGUJ 3H1IJ 3BCCJ 2IBZI 1SQQJ 2FYUJ 2BCCJ 1KB9I 1SQPJ 4U3FJ 3CX5I 1NTMJ 4PD4I 5KLVJ 1KYOI 1NU1J 1L0NJ 3CWBJ 3H1LJ 1BE3J 1NTZJ 3L73J 3H1HJ 3H1JJ 3L75J 3L72J 3L70J 1NTKJ
chains in the Genus database with same CATH superfamily
1S2EA 3MD0A 2O3JA 3H1LE 1CSBA 4BWNA 1GDTA 2AXCA 1OW7A 2W27A 2WSEJ 1PP9D 4LLHA 2ZJSE 1SP4A 5KKZC 2WVRA 3CCUP 3HE5A 1SQQK 1NTKE 3P8CD 4OH8B 2KS1B 1NTKD 3MHVA 4R4MA 1SFCC 2K9JB 2O01J 2FFDC 3LW5H 5APWA 1VF5C 2FYNC 2ZFCA 4EI2A 1IFMA 1GL2D 1AJYA 1KTMA 3CXHE 1X79B 1SQBJ 4HH2A 1M90Q 1GTWA 2D2CD 3D71A 2NZ2A 2E74C 2V4HA 5GTIH 1QX8A 2IPPA 3L36A 4UB8E 2GA1A 2WSCJ 3AEGC 2IYOA 1SQQE 3G6EP 1JY2P 2HFED 3CX5D 4PD4D 1W5CE 4RKUJ 2H89C 1GW3A 3KQGA 3BATA 3L71J 4W7YA 1G2CB 1NTZG 5KTBA 2YNYA 1ZMEC 3GW6A 2M8RA 4GDOA 4L76A 4KHXA 2BASA 4NPEA 1JEKA 1S1CX 3KZIE 2YO3A 1JCCA 1D7MA 3VMYA 1U7JA 1RE4C 1L0LD 3Q1MA 1SQBD 4GOFA 1L4AB 3A5TA 4IFDK 2IYPA 1KZUB 2KZIA 5AW3B 2A06G 1SFCA 4DT0A 3VMAA 1YITP 3TSIA 2H7HA 3L74G 1FJKA 3FXDA 1FU1A 3L71D 3RGUA 1EDJA 3E1RA 3HTKA 1GW4A 1KQSO 1SQVJ 1YHQP 2FYUK 1DH3A 1KC8Q 1L0NK 4WBAA 1VPCA 1NKNA 3AE9C 3M91A 1YYCA 1S5LX 2W8ZA 2CPSA 1X8YA 4WWIA 2P58A 4XE5B 1H0TB 1IK9A 4XA4A 2A45H 2FYUE 3TGUG 1L0NE 2W83C 3GLMA 3USSA 1NH4A 1LTGC 4IOIH 5DJTB 3I5CA 2LR2A 1VQOP 1M1JB 1LNQA 1OZHA 1SQVD 5DJUB 1L4AC 2KS1A 2E42A 3SFDC 3CC4P 1QLED 1Y47A 2IZ1A 2K9JA 2J58A 1J2JB 2G3AA 2IFNA 2P67A 3VP9A 1JY3N 3CWBD 1K9MQ 2FXMA 1KFMA 3G4SP 4PV1C 3V4QA 2C0WA 3MP7B 1GK6A 5AVYB 3Q5RA 4H44D 3L70E 1BE3G 1TU3F 1FBMA 1VQ4P 2QE7H 1KV4A 1VL2A 1KORA 1G2CA 4WB4A 1IFDA 5AW0B 1KB9H 2JKVA 2ZYAA 3HE4B 2K1AA 4O9BA 1J1EB 3CCRP 1K04A 1NAFA 1KN7A 3M06A 3CCSP 2V7QH 1NTZJ 2JEEA 3VYIA 4H13B 4ZNCA 3AE7C 4GOEA 1KILE 1P84E 1HBWA 3D70A 1JNMA 3TYYA 1JY2O 2HYNA 1M1JC 2WZ7A 1L4AA 1NO4A 1SLQA 3QWOC 3RK3E 1KQGB 1VF5D 1LTJB 1LTAC 2Q9IA 2AEMA 4JQ0D 1SVFA 1M57D 1Q81Q 1AQ5A 1SQQG 3AE3C 2KI7B 5B66H 3RK2D 2FYZA 1Q2NA 3MGNA 3TNUB 1T3UA 2O1JA 1AVYA 4DZOA 3L74J 1YJWP 3A0HH 2KSEA 3K5BA 1NOHA 2OTLP 3H6PA 3E1IA 1OW8A 1NTZD 2QVAA 2ZXXA 4HKZH 1DIPA 1QGKB 4RESB 1OX3A 1FJPA 5E79H 1R8EA 1L2PA 3V4WA 5TISH 1J1EC 3A0HE 5APVA 3RL0g 2CPBA 3M0DC 4XFJA 4H13C 1FZBA 2RMZA 3H1KG 3PRJA 4U3FE 2A06E 5B5EE 1M1JA 2Q1KA 1S9KE 5E79E 1N7SD 3TGUJ 1LWUB 4H44B 3L74D 2YIUB 5APXA 2K3RA 5CCHA 4HB1A 1YTZI 1VQ7P 2POHA 4IL6E 5BVZA 4Y28J 2QJYB 3WU2E 1X9VA 5CJ4A 3M9BA 1JO5A 3V2NA 1AA0A 2FYUG 2YO2A 1L0NG 3KDPB 1RY3A 1KILB 2M5AB 2QEXP 1OW6A 2GM4A 3V2RA 5TJHA 1BE3J 3GG2A 4C7NB 2Y0CA 1Q90D 3HE4A 3TGUD 2HG5D 2XZRA 2E75B 3CXHI 5APUA 3RK3B 1A02F 2E5YA 2AXTE 2XNXA 3M0DA 5APYA 2ZVNB 2ZAEB 3MZWB 4GT1A 1BSHA 2HODB 4OVNF 1EDKA 2A45G 3M0AA 1QVGO 2C0XA 1PV3A 1L4AD 1T6AA 2NRGA 3H1HE 3II6A 2KLUA 1LWUC 3SSUA 1LTTC 4H44C 1SQPG 3AE2C 2YIUC 1FZCB 1BDDA 1PGPA 3L70G 3L4FA 2J59M 1S72P 3WUVA 3NTNA 1PFIA 1BE3E 3TNUA 1IK7A 2QJYC 4LC1A 2PAJA 5KAIE 1BE3D 3H1LD 1JUNA 1EDIA 1NVOA 1SQQJ 2ZVOB 1ZW0A 1PGJA 5AVWB 2LXBA 3LW5J 4OGQB 4B86A 1KYOH 1KILC 2XNDH 1OVVA 3N4XA 1N7SB 4TT3H 2E75C 1RF1B 1ZR4A 1EC5A 1USDA 2IX7C 3CX5H 4PD4H 4OWFA 4RO0A 3S1KA 2R5DA 1HF9A 3CXHD 3OAKA 3RK2C 2WSEH 1GK4A 2O1KA 3CL3D 4JF7A 1NKZB 2R5BA 1IJDB 1WT6A 2HR3A 1LWUA 5CCHD 3U1AA 1FC2C 1NJIQ 1SQQD 1FZCC 3H1KJ 2O01H 3E7KA 1LT9B 4L75A 3EFFK 1IFJA 5AW6B 2XU6A 2KIKA 2L91A 4K3AA 5GTIE 2ZT9B 3IF4A 2QM8A 3F89A 1YQ3C 1ZR2A 4UB6H 2O01N 4I1LA 4OGQC 2YKOA 1NHLA 1KILA 2M5AA 5KAFH 1U57A 2YMKA 2FXOA 2GUVA 4U3FG 2A45I 3OW2O 5AW8B 1N7SC 1K05A 1VQ6P 1Q82Q 3AECC 3V2QA 3WMM0 3H1KE 2FYUJ 3SWFA 2E43A 1XTCC 1RF1C 3OA7A 4H13D 2YXRB 3H1KD 1L0NJ 4EIJA 2QIWA 1PIXA 2HODA 4H0LB 1X22A 2N1TB 1VQ5P 4AQRD 1ZP0C 1H8AA 3AEBC 5AW2B 3PH0A 1K8AQ 1CZQA 3SFEC 2PRRA 1N73B 5APQA 3M9HA 1OFCX 5H2FH 1T8ZA 1FZCA 4ZKPA 1BDCA 1GU4A 1M1KQ 3QH9A 2DW3A 3AE8C 1CW5A 1GMJA 2ZXEB 1BCCE 3G3ZA 1LT9C 1QL1A 3KYQA 1MFZA 1LT1A 3EFGA 3G71P 1QL2A 1SQPJ 2YKQA 1DEEG 1FZAA 2WSFH 1JY3P 3L70J 3PJSK 1ZV8A 3I55P 2ZT9C 5AW4B 3H32B 1ZXGA 2FYUD 1ZRTE 4JPZB 1MV8A 1P84I 4EOTA 1NYHA 5H2FE 4EDFA 2ZYDA 2OYIB 1L0ND 4AYCA 1SQPK 3S9OA 3BASA 1FOSF 2K88A 1KB9I 3O8ZA 4D6TG 3KXDA 2HPCB 1OVRA 2PGDA 2BCCE 1R5LA 3C1LA 1N7SA 2R3SA 4GKGA 1YIJP 2P10A 1S5LH 2XV5A 3EWKA 2L5GB 1RF1A 1OXZA 2IFMA 3H1HG 4JYBA 1GZLA 2JWAA 3KHUA 4H0LC 1PPJE 2N1TC 1VQLP 2OTKE 1SQPE 3BRVB 3L75E 2KP8A 1VQ9P 2OQQA 2BEQD 3O6QB 2W6AA 3F5HA 1N73C 1M7LA 2YMYA 2M0BA 3L70D 3H25A 2OTJP 1Y8AA 2V7QJ 1LT9A 3S4RA 2Z5IA 2WMMA 4HJGH 1EZVG 1LTBC 3Q3DA 4JBZA 3H1IE 1PP9G 2KK7A 1G1IA 3A0BH 3NFQA 5AVXB 2Q5UA 1FDMA 2PP6A 1LGHB 2OYIC 2B89A 2RKLA 3H1JE 3AEEC 3V6IA 1M56D 3U59A 2E76D 4HYTB 3PP5A 1KILD 1P84D 2G8YA 3D6ZA 2WPRA 3CD6P 1KB9E 2JO1A 4DOJA 1HH0A 1HVVA 1SQXK 1N86A 4WY4B 2E75D 1BGYG 1KB9D 3V5BA 3RK3D 1AVOA 3VMXA 5CCHC 2R3CA 2KXPB 4ZMDA 3GF3A 4YTPC 2P7JA 1URQB 3L73G 3V2PA 1DD4A 4RJTA 2IZ0A 2N1TA 4U3FJ 5CBNA 4NPFX 2YKPA 4IFFA 4W7ZA 1RE3C 1FZGA 5APSA 1N73A 1XTGB 3VN0A 1EXJA 1SQXE 4ASVA 4JYCA 2AEFA 1E79H 4KJMA 3VOPA 2OGUA 4IL6X 5B66E 1K73Q 2QM7A 2I8DA 2Y0EA 4K35A 1KQLA 3PTZA 2QJKB 1NTMK 3T97B 1H0TA 1MUUA 1NU1K 1KD1Q 1OIPA 1AFOA 3H32A 2J5UA 5C39A 1L0LG 2KYVA 4N3YB 1USEA 3B8EB 3C9IA 4YXDC 2OYIA 4OGQD 2H43A 3CCVP 2OYHB 2FKWB 4PJ0H 3JC22 1VQNP 4U3FD 3C8VA 2A06D 2HPCA 4LGDE 3CCEP 1RH5B 1JCDA 3FX0A 1S9KD 1LTJC 3AE6C 4WY4C 3PLNA 5TISE 1PZQA 3N7NA 2YXQB 4EYYQ 4Y99B 1NTME 2WT7B 4D6TJ 1YBKA 4N78E 1RF0C 2KNCB 1URQC 2VRSA 1JY3O 5AVQB 2Y0DA 5AVVB 1BCCG 3CLQA 1W2EA 3HUSB 3CMEP 1RE3A 2W6JH 5GTHH 3H1HJ 3HD7B 4WVZA 3O6QA 1FZEA 3AE4C 4I7ZB 5AVZB 1EZVI 2E5TA 5KLVG 2QRXA 3P8MC 2E76B 3ABVC 1ZLLA 5AW7B 2IBZG 3IFMA 4CPGA 3GHGB 2OYOA 2JP3A 2ZT9D 2QJKC 3KPEA 1YTZT 1CI6B 2BCCG 3AEDC 2K9YA 4D6TE 1WMKA 2JJLA 3G9RA 3MUDC 4D6TD 3BVHA 5KJ7D 3CCMP 2NPSD 2KUBA 1VQMP 3GMAA 2FFDB 2OYHC 1JM0A 1JOCA 2B87B 4MN4C 3JCUH 2Z4EA 1PPJG 1DEBA 1M8OB 1LTJA 4WY4A 3AEFC 3H1HD 3CWBG 3L75G 3IAOA 2LKMA 2WWWA 1ZN5A 3CMAP 1W2BO 1HWTC 4AUWA 2E74B 1IFNA 1MZ9A 1BSNA 4H0LD 1RF0A 3MIWA 2N1TD 4C7RA 1URQA 1OWAA 5L8RJ 5AVUB 1YJ9P 1BGYJ 1KFNA 1HTLC 4C46A 1HJBA 2Y9YA 1JB0J 1GD2E 1EQ7A 1NTKK 3JCUE 3HD7C 1N7LA 5CCGC 1FAVA 3RBXA 2RH0A 3VP8A 3B5NB 4I7ZC 3L73J 1ZOYC 3H1IG 4R4LA 1LP1B 1EZVE 5EFWB 3TF5A 3R2PA 2E76C 1EZVD 1PP9E 2W90A 3H1JG 1U7MA 3CXHH 3GHGC 1QVFO 1IFPA 5AVRB 5K5GB 5AW9B 3U1CA 1N8RQ 3T97A 1H88A 3RK3C 3P8CE 1PGQA 4UB8H 1FOSE 3MUDA 3SWKA 1BGYE 2OYHA 1KYOE 1BGYD 2BEZF 1KMIZ 1HGVA 1KYOD 1L0LJ 1T3JA 3L73E 1HGZA 2OARA 3Q5SA 3L73D 2WT7A 3CX5E 4PD4E 2KNCA 1SQXG 1SS1A 1L0LK 1IZNB 1SQBK 3KZIH 3TDKA 2Q7CA 1S3JA 3HUSA 2MJZA 3HD7A 2IBZI 5CCGA 2SPZA 1DD3A 2WSCH 3B5NC 2FBWC 4BRYB 3ITKA 1BCCJ 2I1JA 2GUSA 2JDIH 2NPSB 2B9BA 5M1BA 1JY2N 3GHGA 1L0LE 4C7NA 2LXCB 1SQBE 2IDBA 3B71A 5KLVJ 3FWLA 1CI6A 2KZJA 5AVSB 3D6YA 4UB6E 3PHLA 2Q3IA 1AV1A 1NGMB 1NTMG 3IN6A 3CC2P 1NU1G 2ITAA 2FFDA 5KLVK 3L71E 3TK1A 4WY4D 2BCCJ 2KLVA 5KAFE 2B87A 4PV1B 5KLIB 2UWJE 3CPWO 2WSFJ 3M9QA 1URQD 2QJPB 2WTYA 1AQTA 2XDJA 1T2KD 3Q2YA 2N9BA 1BCCD 1UIXA 3L72G 2XKMA 3HRNA 1RQUA 3CWBJ 3L75J 4I2LC 1SQVK 1GU5A 5KLVE 1N2DC 1FDOA 1VQPP 3BRTB 2P1JA 4N6JA 5KLVD 3B5NA 2IBZE 1ZRTD 5AW5B 3RL0D 1LP1A 2IBZD 4GODA 5KJ7C 4L74A 1FS0E 2NPSC 1HJ0A 3I56P 1X0TA 3RBZA 1S4XA 2BCCD 1GL2B 1RE4A 1MFTA 3H1IJ 1SQVE 2D2CB 1OVUA 5AVTB 2B88A 3H1JJ 1LTSC 1HUCA 4ZKUA 2FXPA 3BCCG 1E5WA 4A7PA 2JWDA 3CWBE 1PPJD 1SQPD 3NMDA 5AW1B 3L35A 3L75D 1VQKP 2WPVB 5KLIC 1A02J 1S5LE 2Y9ZA 1JMMA 2QJPC 3FWNA 2MKVA 1RHZB 3L37A 3FXEA 2Z5HA 3VMZA 2KB7P 3H1LG 1KQFB 3HD7D 1Q7YQ 5CCGD 1YQ4C 1P84H 4YXWH 3Q5PA 3H1ID 1NAYA 3WUUA 1JTHB 3AEAC 1SQXJ 2PFXA 3A2AA 1LJ2A 3AE5C 4BRYA 3GF7A 3H1JD 2ZYGA 5KJ7A 1NTKG 3B4SA 4YPCA 1EDLA 2NPSA 1IO4A 5BU5A 1YI2P 2WPSA 3R4YA 4KT0J 1GL2C 5CJ0A 1VDFA 3SWYA 2FY8A 3A0BE 2D2CC 1SFCD 1NTZK 1PGOA 4QMAA 1LTIC 3IR9A 5APTA 1DX7A 2WSSH 2E74D 3CCQP 4DCKA 2WPQA 5BU8B 3W68A 1SQXD 1NTMJ 2CK3H 1IFIA 1NU1J 3RL0B 1PL5A 2M3BA 1NTZE 2WITA 2WQYC 1RQVA 1WRGA 1FE6A 1YJNP 1Y9BA 2C9NY 1VQ8P 2QA4P 2RN0A 3B5ND 1Z56A 3HE5B 5B5EH 2KSJA 3UIAA 2KOGA 1SQBG 3L72J 1OMIA 3JSVC 2P2UA 4I6MC 2Q6QA 3FGAD 4IL6H 4BXLA 1GL2A 3L71G 2H88C 3VTPC 3CCJP 2C9LY 1R5SA 4M3LA 3WU2H 3NXSA 3W67A 1FDIA 1NU1E 3L74E 1NTMD 1NU1D 4N78D 1T2KC 1IC2A 2QG4A 4PJ0E 1MKMA 1J1DB 1JMBA 3ZDMA 2Q3EA 3L72E 3MTUE 5CMZA 3BCCJ 3L72D 4TLFA 2H8PD 5CBOA 3RL0C 1EXIA 2HLOA 2AXTH 5CHXA 2W6BA 5KKZB 3LIDA 5GTHE 1QEXA 1NWQA 4L73A 3P7KA 1Q86Q 1FZFA 4Z1MH 4U7JA 3EQ2A 1JTHA 3TGUE 1KYOI 1SFCB 3H1LJ 2QSIA 1SQVG 2JR8A 2N9YB 1VF5B 3LIEA 2FYNB 3OJAB 2K37A 1PP9J 4GIFA 3CC7P 3HTKB 4NPDA 2I1KA 2M3EA 2AEJA 3RK2B 3WUTA 3CX5I 4PD4I 4ASWA 3BCCE 1UIIA 4Y99C 3CI9A 1H89A 5KAIH 4W80A 1NTKJ 3BCCD 4IFMA 2R44A 2R32A 3A7OA 3HUSC 3CCLP 3A3YB 4PV1D 1G1JA 1J1DC 4DJGA 3P32A 3AE1C
chains in the Genus database with same CATH topology
1BCCJ 3L74J 4D6TJ 1L0LJ 3CXHI 1SQXJ 1PP9J 1EZVI 3L71J 3H1KJ 1SQBJ 1SQVJ 1BGYJ 1P84I 3TGUJ 3H1IJ 3BCCJ 2IBZI 1SQQJ 2FYUJ 2BCCJ 1KB9I 1SQPJ 4U3FJ 3CX5I 1NTMJ 4PD4I 5KLVJ 1KYOI 1NU1J 1L0NJ 3CWBJ 3H1LJ 1BE3J 1NTZJ 3L73J 3H1HJ 3H1JJ 3L75J 3L72J 3L70J 1NTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  3L74 J;  4D6T J;  1L0L J;  3CXH I;  1SQX J;  1PP9 J;  1EZV I;  3L71 J;  3H1K J;  1SQB J;  1SQV J;  1BGY J;  1P84 I;  3TGU J;  3H1I J;  3BCC J;  2IBZ I;  1SQQ J;  2FYU J;  2BCC J;  1KB9 I;  1SQP J;  4U3F J;  3CX5 I;  1NTM J;  4PD4 I;  5KLV J;  1KYO I;  1NU1 J;  1L0N J;  3CWB J;  3H1L J;  1BE3 J;  1NTZ J;  3L73 J;  3H1H J;  3H1J J;  3L75 J;  3L72 J;  3L70 J;  1NTK J; 
#chains in the Genus database with same CATH topology
 1S2E A;  3MD0 A;  2O3J A;  3H1L E;  1CSB A;  4BWN A;  1GDT A;  2AXC A;  1OW7 A;  2W27 A;  2WSE J;  1PP9 D;  4LLH A;  2ZJS E;  1SP4 A;  5KKZ C;  2WVR A;  3CCU P;  3HE5 A;  1SQQ K;  1NTK E;  3P8C D;  4OH8 B;  2KS1 B;  1NTK D;  3MHV A;  4R4M A;  1SFC C;  2K9J B;  2O01 J;  2FFD C;  3LW5 H;  5APW A;  1VF5 C;  2FYN C;  2ZFC A;  4EI2 A;  1IFM A;  1GL2 D;  1AJY A;  1KTM A;  3CXH E;  1X79 B;  1SQB J;  4HH2 A;  1M90 Q;  1GTW A;  2D2C D;  3D71 A;  2NZ2 A;  2E74 C;  2V4H A;  5GTI H;  1QX8 A;  2IPP A;  3L36 A;  4UB8 E;  2GA1 A;  2WSC J;  3AEG C;  2IYO A;  1SQQ E;  3G6E P;  1JY2 P;  2HFE D;  3CX5 D;  4PD4 D;  1W5C E;  4RKU J;  2H89 C;  1GW3 A;  3KQG A;  3BAT A;  3L71 J;  4W7Y A;  1G2C B;  1NTZ G;  5KTB A;  2YNY A;  1ZME C;  3GW6 A;  2M8R A;  4GDO A;  4L76 A;  4KHX A;  2BAS A;  4NPE A;  1JEK A;  1S1C X;  3KZI E;  2YO3 A;  1JCC A;  1D7M A;  3VMY A;  1U7J A;  1RE4 C;  1L0L D;  3Q1M A;  1SQB D;  4GOF A;  1L4A B;  3A5T A;  4IFD K;  2IYP A;  1KZU B;  2KZI A;  5AW3 B;  2A06 G;  1SFC A;  4DT0 A;  3VMA A;  1YIT P;  3TSI A;  2H7H A;  3L74 G;  1FJK A;  3FXD A;  1FU1 A;  3L71 D;  3RGU A;  1EDJ A;  3E1R A;  3HTK A;  1GW4 A;  1KQS O;  1SQV J;  1YHQ P;  2FYU K;  1DH3 A;  1KC8 Q;  1L0N K;  4WBA A;  1VPC A;  1NKN A;  3AE9 C;  3M91 A;  1YYC A;  1S5L X;  2W8Z A;  2CPS A;  1X8Y A;  4WWI A;  2P58 A;  4XE5 B;  1H0T B;  1IK9 A;  4XA4 A;  2A45 H;  2FYU E;  3TGU G;  1L0N E;  2W83 C;  3GLM A;  3USS A;  1NH4 A;  1LTG C;  4IOI H;  5DJT B;  3I5C A;  2LR2 A;  1VQO P;  1M1J B;  1LNQ A;  1OZH A;  1SQV D;  5DJU B;  1L4A C;  2KS1 A;  2E42 A;  3SFD C;  3CC4 P;  1QLE D;  1Y47 A;  2IZ1 A;  2K9J A;  2J58 A;  1J2J B;  2G3A A;  2IFN A;  2P67 A;  3VP9 A;  1JY3 N;  3CWB D;  1K9M Q;  2FXM A;  1KFM A;  3G4S P;  4PV1 C;  3V4Q A;  2C0W A;  3MP7 B;  1GK6 A;  5AVY B;  3Q5R A;  4H44 D;  3L70 E;  1BE3 G;  1TU3 F;  1FBM A;  1VQ4 P;  2QE7 H;  1KV4 A;  1VL2 A;  1KOR A;  1G2C A;  4WB4 A;  1IFD A;  5AW0 B;  1KB9 H;  2JKV A;  2ZYA A;  3HE4 B;  2K1A A;  4O9B A;  1J1E B;  3CCR P;  1K04 A;  1NAF A;  1KN7 A;  3M06 A;  3CCS P;  2V7Q H;  1NTZ J;  2JEE A;  3VYI A;  4H13 B;  4ZNC A;  3AE7 C;  4GOE A;  1KIL E;  1P84 E;  1HBW A;  3D70 A;  1JNM A;  3TYY A;  1JY2 O;  2HYN A;  1M1J C;  2WZ7 A;  1L4A A;  1NO4 A;  1SLQ A;  3QWO C;  3RK3 E;  1KQG B;  1VF5 D;  1LTJ B;  1LTA C;  2Q9I A;  2AEM A;  4JQ0 D;  1SVF A;  1M57 D;  1Q81 Q;  1AQ5 A;  1SQQ G;  3AE3 C;  2KI7 B;  5B66 H;  3RK2 D;  2FYZ A;  1Q2N A;  3MGN A;  3TNU B;  1T3U A;  2O1J A;  1AVY A;  4DZO A;  3L74 J;  1YJW P;  3A0H H;  2KSE A;  3K5B A;  1NOH A;  2OTL P;  3H6P A;  3E1I A;  1OW8 A;  1NTZ D;  2QVA A;  2ZXX A;  4HKZ H;  1DIP A;  1QGK B;  4RES B;  1OX3 A;  1FJP A;  5E79 H;  1R8E A;  1L2P A;  3V4W A;  5TIS H;  1J1E C;  3A0H E;  5APV A;  3RL0 g;  2CPB A;  3M0D C;  4XFJ A;  4H13 C;  1FZB A;  2RMZ A;  3H1K G;  3PRJ A;  4U3F E;  2A06 E;  5B5E E;  1M1J A;  2Q1K A;  1S9K E;  5E79 E;  1N7S D;  3TGU J;  1LWU B;  4H44 B;  3L74 D;  2YIU B;  5APX A;  2K3R A;  5CCH A;  4HB1 A;  1YTZ I;  1VQ7 P;  2POH A;  4IL6 E;  5BVZ A;  4Y28 J;  2QJY B;  3WU2 E;  1X9V A;  5CJ4 A;  3M9B A;  1JO5 A;  3V2N A;  1AA0 A;  2FYU G;  2YO2 A;  1L0N G;  3KDP B;  1RY3 A;  1KIL B;  2M5A B;  2QEX P;  1OW6 A;  2GM4 A;  3V2R A;  5TJH A;  1BE3 J;  3GG2 A;  4C7N B;  2Y0C A;  1Q90 D;  3HE4 A;  3TGU D;  2HG5 D;  2XZR A;  2E75 B;  3CXH I;  5APU A;  3RK3 B;  1A02 F;  2E5Y A;  2AXT E;  2XNX A;  3M0D A;  5APY A;  2ZVN B;  2ZAE B;  3MZW B;  4GT1 A;  1BSH A;  2HOD B;  4OVN F;  1EDK A;  2A45 G;  3M0A A;  1QVG O;  2C0X A;  1PV3 A;  1L4A D;  1T6A A;  2NRG A;  3H1H E;  3II6 A;  2KLU A;  1LWU C;  3SSU A;  1LTT C;  4H44 C;  1SQP G;  3AE2 C;  2YIU C;  1FZC B;  1BDD A;  1PGP A;  3L70 G;  3L4F A;  2J59 M;  1S72 P;  3WUV A;  3NTN A;  1PFI A;  1BE3 E;  3TNU A;  1IK7 A;  2QJY C;  4LC1 A;  2PAJ A;  5KAI E;  1BE3 D;  3H1L D;  1JUN A;  1EDI A;  1NVO A;  1SQQ J;  2ZVO B;  1ZW0 A;  1PGJ A;  5AVW B;  2LXB A;  3LW5 J;  4OGQ B;  4B86 A;  1KYO H;  1KIL C;  2XND H;  1OVV A;  3N4X A;  1N7S B;  4TT3 H;  2E75 C;  1RF1 B;  1ZR4 A;  1EC5 A;  1USD A;  2IX7 C;  3CX5 H;  4PD4 H;  4OWF A;  4RO0 A;  3S1K A;  2R5D A;  1HF9 A;  3CXH D;  3OAK A;  3RK2 C;  2WSE H;  1GK4 A;  2O1K A;  3CL3 D;  4JF7 A;  1NKZ B;  2R5B A;  1IJD B;  1WT6 A;  2HR3 A;  1LWU A;  5CCH D;  3U1A A;  1FC2 C;  1NJI Q;  1SQQ D;  1FZC C;  3H1K J;  2O01 H;  3E7K A;  1LT9 B;  4L75 A;  3EFF K;  1IFJ A;  5AW6 B;  2XU6 A;  2KIK A;  2L91 A;  4K3A A;  5GTI E;  2ZT9 B;  3IF4 A;  2QM8 A;  3F89 A;  1YQ3 C;  1ZR2 A;  4UB6 H;  2O01 N;  4I1L A;  4OGQ C;  2YKO A;  1NHL A;  1KIL A;  2M5A A;  5KAF H;  1U57 A;  2YMK A;  2FXO A;  2GUV A;  4U3F G;  2A45 I;  3OW2 O;  5AW8 B;  1N7S C;  1K05 A;  1VQ6 P;  1Q82 Q;  3AEC C;  3V2Q A;  3WMM 0;  3H1K E;  2FYU J;  3SWF A;  2E43 A;  1XTC C;  1RF1 C;  3OA7 A;  4H13 D;  2YXR B;  3H1K D;  1L0N J;  4EIJ A;  2QIW A;  1PIX A;  2HOD A;  4H0L B;  1X22 A;  2N1T B;  1VQ5 P;  4AQR D;  1ZP0 C;  1H8A A;  3AEB C;  5AW2 B;  3PH0 A;  1K8A Q;  1CZQ A;  3SFE C;  2PRR A;  1N73 B;  5APQ A;  3M9H A;  1OFC X;  5H2F H;  1T8Z A;  1FZC A;  4ZKP A;  1BDC A;  1GU4 A;  1M1K Q;  3QH9 A;  2DW3 A;  3AE8 C;  1CW5 A;  1GMJ A;  2ZXE B;  1BCC E;  3G3Z A;  1LT9 C;  1QL1 A;  3KYQ A;  1MFZ A;  1LT1 A;  3EFG A;  3G71 P;  1QL2 A;  1SQP J;  2YKQ A;  1DEE G;  1FZA A;  2WSF H;  1JY3 P;  3L70 J;  3PJS K;  1ZV8 A;  3I55 P;  2ZT9 C;  5AW4 B;  3H32 B;  1ZXG A;  2FYU D;  1ZRT E;  4JPZ B;  1MV8 A;  1P84 I;  4EOT A;  1NYH A;  5H2F E;  4EDF A;  2ZYD A;  2OYI B;  1L0N D;  4AYC A;  1SQP K;  3S9O A;  3BAS A;  1FOS F;  2K88 A;  1KB9 I;  3O8Z A;  4D6T G;  3KXD A;  2HPC B;  1OVR A;  2PGD A;  2BCC E;  1R5L A;  3C1L A;  1N7S A;  2R3S A;  4GKG A;  1YIJ P;  2P10 A;  1S5L H;  2XV5 A;  3EWK A;  2L5G B;  1RF1 A;  1OXZ A;  2IFM A;  3H1H G;  4JYB A;  1GZL A;  2JWA A;  3KHU A;  4H0L C;  1PPJ E;  2N1T C;  1VQL P;  2OTK E;  1SQP E;  3BRV B;  3L75 E;  2KP8 A;  1VQ9 P;  2OQQ A;  2BEQ D;  3O6Q B;  2W6A A;  3F5H A;  1N73 C;  1M7L A;  2YMY A;  2M0B A;  3L70 D;  3H25 A;  2OTJ P;  1Y8A A;  2V7Q J;  1LT9 A;  3S4R A;  2Z5I A;  2WMM A;  4HJG H;  1EZV G;  1LTB C;  3Q3D A;  4JBZ A;  3H1I E;  1PP9 G;  2KK7 A;  1G1I A;  3A0B H;  3NFQ A;  5AVX B;  2Q5U A;  1FDM A;  2PP6 A;  1LGH B;  2OYI C;  2B89 A;  2RKL A;  3H1J E;  3AEE C;  3V6I A;  1M56 D;  3U59 A;  2E76 D;  4HYT B;  3PP5 A;  1KIL D;  1P84 D;  2G8Y A;  3D6Z A;  2WPR A;  3CD6 P;  1KB9 E;  2JO1 A;  4DOJ A;  1HH0 A;  1HVV A;  1SQX K;  1N86 A;  4WY4 B;  2E75 D;  1BGY G;  1KB9 D;  3V5B A;  3RK3 D;  1AVO A;  3VMX A;  5CCH C;  2R3C A;  2KXP B;  4ZMD A;  3GF3 A;  4YTP C;  2P7J A;  1URQ B;  3L73 G;  3V2P A;  1DD4 A;  4RJT A;  2IZ0 A;  2N1T A;  4U3F J;  5CBN A;  4NPF X;  2YKP A;  4IFF A;  4W7Z A;  1RE3 C;  1FZG A;  5APS A;  1N73 A;  1XTG B;  3VN0 A;  1EXJ A;  1SQX E;  4ASV A;  4JYC A;  2AEF A;  1E79 H;  4KJM A;  3VOP A;  2OGU A;  4IL6 X;  5B66 E;  1K73 Q;  2QM7 A;  2I8D A;  2Y0E A;  4K35 A;  1KQL A;  3PTZ A;  2QJK B;  1NTM K;  3T97 B;  1H0T A;  1MUU A;  1NU1 K;  1KD1 Q;  1OIP A;  1AFO A;  3H32 A;  2J5U A;  5C39 A;  1L0L G;  2KYV A;  4N3Y B;  1USE A;  3B8E B;  3C9I A;  4YXD C;  2OYI A;  4OGQ D;  2H43 A;  3CCV P;  2OYH B;  2FKW B;  4PJ0 H;  3JC2 2;  1VQN P;  4U3F D;  3C8V A;  2A06 D;  2HPC A;  4LGD E;  3CCE P;  1RH5 B;  1JCD A;  3FX0 A;  1S9K D;  1LTJ C;  3AE6 C;  4WY4 C;  3PLN A;  5TIS E;  1PZQ A;  3N7N A;  2YXQ B;  4EYY Q;  4Y99 B;  1NTM E;  2WT7 B;  4D6T J;  1YBK A;  4N78 E;  1RF0 C;  2KNC B;  1URQ C;  2VRS A;  1JY3 O;  5AVQ B;  2Y0D A;  5AVV B;  1BCC G;  3CLQ A;  1W2E A;  3HUS B;  3CME P;  1RE3 A;  2W6J H;  5GTH H;  3H1H J;  3HD7 B;  4WVZ A;  3O6Q A;  1FZE A;  3AE4 C;  4I7Z B;  5AVZ B;  1EZV I;  2E5T A;  5KLV G;  2QRX A;  3P8M C;  2E76 B;  3ABV C;  1ZLL A;  5AW7 B;  2IBZ G;  3IFM A;  4CPG A;  3GHG B;  2OYO A;  2JP3 A;  2ZT9 D;  2QJK C;  3KPE A;  1YTZ T;  1CI6 B;  2BCC G;  3AED C;  2K9Y A;  4D6T E;  1WMK A;  2JJL A;  3G9R A;  3MUD C;  4D6T D;  3BVH A;  5KJ7 D;  3CCM P;  2NPS D;  2KUB A;  1VQM P;  3GMA A;  2FFD B;  2OYH C;  1JM0 A;  1JOC A;  2B87 B;  4MN4 C;  3JCU H;  2Z4E A;  1PPJ G;  1DEB A;  1M8O B;  1LTJ A;  4WY4 A;  3AEF C;  3H1H D;  3CWB G;  3L75 G;  3IAO A;  2LKM A;  2WWW A;  1ZN5 A;  3CMA P;  1W2B O;  1HWT C;  4AUW A;  2E74 B;  1IFN A;  1MZ9 A;  1BSN A;  4H0L D;  1RF0 A;  3MIW A;  2N1T D;  4C7R A;  1URQ A;  1OWA A;  5L8R J;  5AVU B;  1YJ9 P;  1BGY J;  1KFN A;  1HTL C;  4C46 A;  1HJB A;  2Y9Y A;  1JB0 J;  1GD2 E;  1EQ7 A;  1NTK K;  3JCU E;  3HD7 C;  1N7L A;  5CCG C;  1FAV A;  3RBX A;  2RH0 A;  3VP8 A;  3B5N B;  4I7Z C;  3L73 J;  1ZOY C;  3H1I G;  4R4L A;  1LP1 B;  1EZV E;  5EFW B;  3TF5 A;  3R2P A;  2E76 C;  1EZV D;  1PP9 E;  2W90 A;  3H1J G;  1U7M A;  3CXH H;  3GHG C;  1QVF O;  1IFP A;  5AVR B;  5K5G B;  5AW9 B;  3U1C A;  1N8R Q;  3T97 A;  1H88 A;  3RK3 C;  3P8C E;  1PGQ A;  4UB8 H;  1FOS E;  3MUD A;  3SWK A;  1BGY E;  2OYH A;  1KYO E;  1BGY D;  2BEZ F;  1KMI Z;  1HGV A;  1KYO D;  1L0L J;  1T3J A;  3L73 E;  1HGZ A;  2OAR A;  3Q5S A;  3L73 D;  2WT7 A;  3CX5 E;  4PD4 E;  2KNC A;  1SQX G;  1SS1 A;  1L0L K;  1IZN B;  1SQB K;  3KZI H;  3TDK A;  2Q7C A;  1S3J A;  3HUS A;  2MJZ A;  3HD7 A;  2IBZ I;  5CCG A;  2SPZ A;  1DD3 A;  2WSC H;  3B5N C;  2FBW C;  4BRY B;  3ITK A;  1BCC J;  2I1J A;  2GUS A;  2JDI H;  2NPS B;  2B9B A;  5M1B A;  1JY2 N;  3GHG A;  1L0L E;  4C7N A;  2LXC B;  1SQB E;  2IDB A;  3B71 A;  5KLV J;  3FWL A;  1CI6 A;  2KZJ A;  5AVS B;  3D6Y A;  4UB6 E;  3PHL A;  2Q3I A;  1AV1 A;  1NGM B;  1NTM G;  3IN6 A;  3CC2 P;  1NU1 G;  2ITA A;  2FFD A;  5KLV K;  3L71 E;  3TK1 A;  4WY4 D;  2BCC J;  2KLV A;  5KAF E;  2B87 A;  4PV1 B;  5KLI B;  2UWJ E;  3CPW O;  2WSF J;  3M9Q A;  1URQ D;  2QJP B;  2WTY A;  1AQT A;  2XDJ A;  1T2K D;  3Q2Y A;  2N9B A;  1BCC D;  1UIX A;  3L72 G;  2XKM A;  3HRN A;  1RQU A;  3CWB J;  3L75 J;  4I2L C;  1SQV K;  1GU5 A;  5KLV E;  1N2D C;  1FDO A;  1VQP P;  3BRT B;  2P1J A;  4N6J A;  5KLV D;  3B5N A;  2IBZ E;  1ZRT D;  5AW5 B;  3RL0 D;  1LP1 A;  2IBZ D;  4GOD A;  5KJ7 C;  4L74 A;  1FS0 E;  2NPS C;  1HJ0 A;  3I56 P;  1X0T A;  3RBZ A;  1S4X A;  2BCC D;  1GL2 B;  1RE4 A;  1MFT A;  3H1I J;  1SQV E;  2D2C B;  1OVU A;  5AVT B;  2B88 A;  3H1J J;  1LTS C;  1HUC A;  4ZKU A;  2FXP A;  3BCC G;  1E5W A;  4A7P A;  2JWD A;  3CWB E;  1PPJ D;  1SQP D;  3NMD A;  5AW1 B;  3L35 A;  3L75 D;  1VQK P;  2WPV B;  5KLI C;  1A02 J;  1S5L E;  2Y9Z A;  1JMM A;  2QJP C;  3FWN A;  2MKV A;  1RHZ B;  3L37 A;  3FXE A;  2Z5H A;  3VMZ A;  2KB7 P;  3H1L G;  1KQF B;  3HD7 D;  1Q7Y Q;  5CCG D;  1YQ4 C;  1P84 H;  4YXW H;  3Q5P A;  3H1I D;  1NAY A;  3WUU A;  1JTH B;  3AEA C;  1SQX J;  2PFX A;  3A2A A;  1LJ2 A;  3AE5 C;  4BRY A;  3GF7 A;  3H1J D;  2ZYG A;  5KJ7 A;  1NTK G;  3B4S A;  4YPC A;  1EDL A;  2NPS A;  1IO4 A;  5BU5 A;  1YI2 P;  2WPS A;  3R4Y A;  4KT0 J;  1GL2 C;  5CJ0 A;  1VDF A;  3SWY A;  2FY8 A;  3A0B E;  2D2C C;  1SFC D;  1NTZ K;  1PGO A;  4QMA A;  1LTI C;  3IR9 A;  5APT A;  1DX7 A;  2WSS H;  2E74 D;  3CCQ P;  4DCK A;  2WPQ A;  5BU8 B;  3W68 A;  1SQX D;  1NTM J;  2CK3 H;  1IFI A;  1NU1 J;  3RL0 B;  1PL5 A;  2M3B A;  1NTZ E;  2WIT A;  2WQY C;  1RQV A;  1WRG A;  1FE6 A;  1YJN P;  1Y9B A;  2C9N Y;  1VQ8 P;  2QA4 P;  2RN0 A;  3B5N D;  1Z56 A;  3HE5 B;  5B5E H;  2KSJ A;  3UIA A;  2KOG A;  1SQB G;  3L72 J;  1OMI A;  3JSV C;  2P2U A;  4I6M C;  2Q6Q A;  3FGA D;  4IL6 H;  4BXL A;  1GL2 A;  3L71 G;  2H88 C;  3VTP C;  3CCJ P;  2C9L Y;  1R5S A;  4M3L A;  3WU2 H;  3NXS A;  3W67 A;  1FDI A;  1NU1 E;  3L74 E;  1NTM D;  1NU1 D;  4N78 D;  1T2K C;  1IC2 A;  2QG4 A;  4PJ0 E;  1MKM A;  1J1D B;  1JMB A;  3ZDM A;  2Q3E A;  3L72 E;  3MTU E;  5CMZ A;  3BCC J;  3L72 D;  4TLF A;  2H8P D;  5CBO A;  3RL0 C;  1EXI A;  2HLO A;  2AXT H;  5CHX A;  2W6B A;  5KKZ B;  3LID A;  5GTH E;  1QEX A;  1NWQ A;  4L73 A;  3P7K A;  1Q86 Q;  1FZF A;  4Z1M H;  4U7J A;  3EQ2 A;  1JTH A;  3TGU E;  1KYO I;  1SFC B;  3H1L J;  2QSI A;  1SQV G;  2JR8 A;  2N9Y B;  1VF5 B;  3LIE A;  2FYN B;  3OJA B;  2K37 A;  1PP9 J;  4GIF A;  3CC7 P;  3HTK B;  4NPD A;  2I1K A;  2M3E A;  2AEJ A;  3RK2 B;  3WUT A;  3CX5 I;  4PD4 I;  4ASW A;  3BCC E;  1UII A;  4Y99 C;  3CI9 A;  1H89 A;  5KAI H;  4W80 A;  1NTK J;  3BCC D;  4IFM A;  2R44 A;  2R32 A;  3A7O A;  3HUS C;  3CCL P;  3A3Y B;  4PV1 D;  1G1J A;  1J1D C;  4DJG A;  3P32 A;  3AE1 C; 
#chains in the Genus database with same CATH homology
 1BCC J;  3L74 J;  4D6T J;  1L0L J;  3CXH I;  1SQX J;  1PP9 J;  1EZV I;  3L71 J;  3H1K J;  1SQB J;  1SQV J;  1BGY J;  1P84 I;  3TGU J;  3H1I J;  3BCC J;  2IBZ I;  1SQQ J;  2FYU J;  2BCC J;  1KB9 I;  1SQP J;  4U3F J;  3CX5 I;  1NTM J;  4PD4 I;  5KLV J;  1KYO I;  1NU1 J;  1L0N J;  3CWB J;  3H1L J;  1BE3 J;  1NTZ J;  3L73 J;  3H1H J;  3H1J J;  3L75 J;  3L72 J;  3L70 J;  1NTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...