4PD4I

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4pd4I00
3CWBJ 1SQQJ 3TGUJ 3CX5I 1L0LJ 3H1KJ 1NTKJ 3L70J 3BCCJ 1EZVI 3L74J 1NU1J 5KLVJ 4U3FJ 1KYOI 3L75J 1BE3J 3H1JJ 3L72J 1L0NJ 1BCCJ 3CXHI 2IBZI 1PP9J 3H1IJ 3L71J 4PD4I 1NTMJ 1SQVJ 1BGYJ 3H1LJ 1P84I 1SQBJ 1NTZJ 4D6TJ 1SQXJ 3L73J 2FYUJ 1KB9I 2BCCJ 3H1HJ 1SQPJ
chains in the Genus database with same CATH superfamily
2YKPA 1JUNA 1XTCC 3CWBJ 3MP7B 2JKVA 3AE1C 5APQA 2WT7A 2OYIB 2RH0A 4I6MC 3CCUP 1T2KC 1HTLC 1M7LA 1XTGB 1P84D 1JY2P 1JY3N 1GW4A 3H1LG 3HE4A 3WU2H 1L0LE 3P8CD 5AVRB 3TNUA 1RE3C 1L0LG 3H1JJ 1VQMP 4H0LC 1J1EB 1SQBK 5KLVK 2QJYC 5AW3B 1DEEG 1SLQA 1T3UA 5TJHA 1JY2N 1JY3P 1KQSO 1NTMG 1AQ5A 2WPSA 4RKUJ 1JM0A 2P7JA 1KQLA 4YTPC 1FS0E 3A2AA 3RK2B 4D6TD 2QG4A 1N7SB 4EDFA 5GTIH 2A45H 3D6ZA 2IBZD 1LNQA 3A0BE 1BCCE 3AEEC 2QM7A 2POHA 1FZCB 1X9VA 2PGDA 1KB9D 1PP9E 1WRGA 2E76C 2CPSA 2QSIA 3L72G 1CI6B 1LTGC 2WSEJ 1SQVE 3L75E 2KNCA 4OH8B 4QMAA 1DEBA 3B5NB 1HVVA 4W7ZA 1LGHB 3HE5A 3H1KJ 1JMBA 1PGOA 3Q1MA 3KZIE 4I7ZB 3L70G 1KD1Q 3RK2D 3B8EB 1N7SD 1NU1J 3CLQA 1NTZD 4N78E 3ZDMA 1SQPE 3VMZA 2C0WA 2O01H 1KZUB 2RMZA 3TF5A 3NXSA 2N9YB 1SQVK 2Y0EA 3AE6C 2YIUB 3B4SA 3RK3C 3PP5A 5CCHA 1KQGB 3FGAD 3H1HE 3AECC 3SSUA 1NHLA 3AE7C 4I2LC 1BCCD 1T3JA 3RK3D 2O3JA 2FYZA 3BCCG 3FWLA 1G1IA 2JP3A 5GTHH 2CPBA 2YO2A 2Z5IA 2N1TA 2NPSC 1R5LA 3M0AA 1JNMA 1PPJG 3CC7P 1BSHA 1IK9A 3RBZA 1NU1K 3TGUJ 4EI2A 1NH4A 1EDKA 3MD0A 1OXZA 3CL3D 5AVTB 1Y47A 3VMYA 1J2JB 5KAFH 2ZT9C 2H43A 4GDOA 1EZVD 3E1RA 2KLVA 3TGUG 1ZR2A 1KV4A 4HJGH 2W6AA 3L74E 1AQTA 4JBZA 2G8YA 3L75J 2KSEA 3RL0B 3L74G 5AVXB 2DW3A 3CI9A 3GHGC 1A02F 1FJPA 3L73E 4C7NB 3CX5H 4ZKPA 1FJKA 2IBZG 4U3FG 4WWIA 4ZKUA 2ZFCA 1W2EA 3A0HE 4WY4A 1GD2E 1Q2NA 1E79H 2Y0CA 1L4AB 2HFED 1NTKG 2QM8A 1FDOA 3N4XA 1U7MA 1VQLP 2N1TD 3CCLP 1N73C 4L75A 3LW5J 3A3YB 1GMJA 5APTA 2E43A 2YMKA 1MKMA 2NRGA 5CMZA 4KHXA 2UWJE 3A0BH 5H2FE 1BGYD 2H7HA 3AEFC 1M1KQ 2ZYDA 1IFNA 1H0TB 2WPVB 3G6EP 1KILD 1X79B 3L74D 1N7LA 3H1JD 2O1JA 2K9JB 2R44A 3GG2A 4H0LB 1ZV8A 5E79E 5KLIC 1HWTC 3P7KA 1YBKA 2V7QJ 1S1CX 1SQQG 3L73D 4HB1A 3VMAA 1SFCA 1VQOP 1Q7YQ 2M8RA 1ZN5A 2I8DA 2MJZA 1HUCA 1M90Q 1JO5A 1OFCX 1L0NJ 3U1CA 2WTYA 2E75B 1UIIA 1W2BO 4WY4D 3BATA 1YJNP 3H1KD 2ZYGA 1OWAA 1SQVJ 4PD4I 3FXDA 3LIEA 3VP8A 1PL5A 1R8EA 2RN0A 1QEXA 2JJLA 1EC5A 2HR3A 4WY4C 1PGJA 3Q5PA 3JCUE 2L91A 1DD3A 1LT9A 3KZIH 1KB9H 1KFMA 1GL2B 1FZAA 2BEQD 1QL2A 1SQBD 1G2CB 1SQPJ 2QJKB 2YXQB 3GHGA 3H1IE 4PD4E 5AW2B 3CCRP 3O6QB 2E42A 3BRTB 5BVZA 3MZWB 4L76A 1NU1G 1EDLA 1P84E 1FZFA 4N6JA 3G9RA 2E74C 4N3YB 4WB4A 3V2PA 3HD7D 1URQA 3VTPC 2Q9IA 1Q81Q 2K88A 2N1TB 1MV8A 3I5CA 1BDDA 1X8YA 3GMAA 2FFDA 3B5NC 3EFGA 2M0BA 3MIWA 1VQPP 1NTKK 2KZIA 3CXHI 3MTUE 4KJMA 4M3LA 2J5UA 5KTBA 2M5AA 2NPSB 1JMMA 3GF7A 3C1LA 1VF5B 3QH9A 1A02J 2O1KA 3HRNA 3AEAC 3T97B 3VP9A 1S9KD 2M3EA 1K05A 1ZP0C 2IFNA 1RE4A 2E76D 3CWBD 4DT0A 2YIUC 2B89A 4XE5B 3CCJP 3JSVC 3A0HH 4HYTB 2C9NY 5B66E 2ZT9B 3ITKA 2JR8A 3KXDA 1NTMD 5EFWB 1FAVA 1L0LJ 3H1JG 1AJYA 2Q7CA 1RF0A 2KXPB 4R4LA 3I55P 3H25A 2P1JA 3O6QA 1GDTA 1EDJA 1LTSC 2Q3EA 2A45I 3HUSA 1BE3D 1M1JB 1RQVA 2FBWC 3KHUA 3BVHA 3CCEP 1SQBG 1VL2A 1LJ2A 5KAIH 1S3JA 4DOJA 2SPZA 5CJ4A 4U3FJ 3Q5RA 1NTZE 1OW8A 3OAKA 3D71A 5AW8B 3OJAB 1PP9J 1Y8AA 1RQUA 1T8ZA 2D2CD 2XDJA 1NO4A 2WPQA 1N86A 3L37A 2R32A 1SQQE 5L8RJ 1YJ9P 1L0LK 3EWKA 3AE4C 3II6A 3MHVA 1KN7A 2O01N 5KLVD 2WSCH 3H32A 5APSA 1BE3G 2BCCJ 2YO3A 4R4MA 2FFDB 4HH2A 3CC2P 3WUVA 1HJBA 1WT6A 4I1LA 1GU5A 1L4AC 2E75D 2IYOA 2WMMA 4WBAA 2NPSD 1NKNA 3VOPA 1K04A 3C9IA 2K3RA 3H1HG 1L0NK 4TT3H 5KKZB 3CD6P 2J58A 3L70J 2P10A 1D7MA 2WPRA 1PZQA 4H44D 1ZRTE 2FYUE 5APWA 3WU2E 2P58A 4L73A 1PFIA 1L2PA 1DX7A 3F89A 1KYOI 2GM4A 1M1JA 1L4AA 2WSSH 3KYQA 5GTHE 2Z5HA 5KLIB 1N7SA 3TDKA 2IPPA 4RJTA 2WT7B 3H1IJ 1K8AQ 1GK6A 1YHQP 1H8AA 3CPWO 1IZNB 2E5YA 2XKMA 1SQPK 3LIDA 5CHXA 1RH5B 2WSEH 1WMKA 2WZ7A 4H44B 4HKZH 2CK3H 2ZVNB 4GODA 4LLHA 2E74B 5AW1B 2ZVOB 3H32B 4A7PA 3RL0D 5AW7B 2R3SA 2KS1B 3T97A 5CCGA 3IR9A 3HD7B 3C8VA 4KT0J 3FX0A 3SWKA 5CBOA 1SVFA 2LXCB 1SQQJ 2M5AB 1MZ9A 2NPSA 3CX5D 4XA4A 4WY4B 1LT9B 1YQ3C 1ZW0A 2HG5D 3L72D 1W5CE 3B71A 2IYPA 3S9OA 1ZR4A 2ZXEB 4IL6H 1BGYG 1FZCC 1GL2C 3D70A 4UB6E 1VDFA 1EZVI 2OGUA 4JPZB 3HUSC 1VF5C 5AVSB 2MKVA 2PAJA 1HJ0A 3CXHD 3H1LE 3AEBC 1OX3A 2K1AA 5KJ7C 4O9BA 1IFIA 2KSJA 4B86A 2PP6A 3KQGA 5AVZB 1PGPA 2Q5UA 2QE7H 4OGQD 2XV5A 3ABVC 3BASA 3GLMA 2LKMA 4H13C 1S72P 1HGZA 4K35A 3P8CE 1NAYA 2B87B 1EZVE 3HUSB 3USSA 1PIXA 1GL2A 1FE6A 2W6JH 2KS1A 2IDBA 1AV1A 1P84I 2WSCJ 3M9QA 2GA1A 2I1JA 2I1KA 2GUSA 2NZ2A 1LP1B 1PP9G 2IX7C 3I56P 1JY2O 2P2UA 1SQXD 1BCCG 1M56D 3L75G 4UB8E 1ZOYC 1CZQA 3L71D 5C39A 4DJGA 2OARA 3NTNA 1OW7A 2Q1KA 3S1KA 3B5NA 3PRJA 2WSFJ 1L0NE 2KNCB 4BRYB 2B88A 4BWNA 1EDIA 2Y0DA 1EXJA 2QJPB 1LTTC 3CXHE 1QGKB 5AVWB 1Q82Q 1URQC 1KYOH 2BCCD 1G2CA 1JY3O 1NJIQ 3EQ2A 1SFCB 3CMEP 2K37A 2XZRA 5KLVJ 4RESB 1H88A 1M57D 1YI2P 2K9JA 1JTHA 2K9YA 2YXRB 3S4RA 1LTIC 1MFZA 2QJPC 1EXIA 1LTBC 1M1JC 1KYOE 5APUA 1URQB 3NMDA 1Q86Q 2KUBA 2ZJSE 3BCCD 3B5ND 3CCVP 3NFQA 4PD4H 2R5DA 3CWBE 1SQVG 3HE5B 3TK1A 1JCCA 2QVAA 3OW2O 1LTAC 4W80A 5DJTB 5B5EH 1J1DC 1PPJD 1OZHA 1YQ4C 1Y9BA 2KP8A 1MUUA 3GHGB 1Q90D 3H1LJ 1UIXA 3HE4B 3WMM0 3M0DA 2Z4EA 5KKZC 1ZRTD 2FYUD 2FYUJ 2XNDH 4ASWA 5CCGD 3CMAP 1HF9A 1NTKD 3V2RA 1NTME 1VQ6P 3SFEC 2ZAEB 3P32A 1L0LD 1X0TA 2WSFH 5CJ0A 4ZMDA 5BU8B 1VQ7P 4L74A 2AEMA 1DD4A 2WVRA 1CI6A 3M9BA 1CSBA 2A06E 1DIPA 1YTZT 3H1IG 4PJ0H 1FBMA 4IL6E 4EIJA 1NTMK 2KLUA 3P8MC 5B66H 2IBZI 3CCQP 4RO0A 1GW3A 1LWUC 1SQQD 1RE3A 2IZ0A 2ZYAA 3L73G 4OWFA 5DJUB 1QL1A 4PJ0E 4YXWH 4DZOA 5CBNA 3WUUA 1FZGA 3HTKA 5CCHD 2KOGA 5KLVE 2R3CA 4C7NA 2OTLP 5TISE 3U1AA 1NTKE 2W27A 1S5LX 2E75C 4DCKA 2QEXP 5CCHC 2FXMA 4LGDE 2W8ZA 4U3FE 1S5LE 3A7OA 2OYOA 4H44C 2B87A 5BU5A 5H2FH 2L5GB 1FZCA 2FYUG 1SQPD 3PTZA 5AVVB 3AE9C 1BDCA 1SQXE 1QLED 1RF1C 2IFMA 3L71E 3W68A 1EQ7A 3H1HD 3Q2YA 3U59A 2V7QH 3L4FA 3R4YA 3GW6A 1QVFO 1FDIA 1IK7A 2OYHB 3OA7A 2BCCE 2WWWA 1IFMA 1FDMA 2N1TC 1SQXK 3V4QA 3TNUB 1USDA 2JO1A 1L0ND 1LTJB 2JEEA 1X22A 3TGUE 1GTWA 2OQQA 2JWAA 2Y9ZA 3MGNA 3BCCE 1KFNA 1H89A 4GKGA 3L70D 1FZBA 2KYVA 3L74J 1LTJC 3KDPB 4OVNF 1N2DC 1PPJE 3CWBG 1OVUA 2YMYA 3L72E 5AVQB 1SQXG 2D2CB 3PHLA 1VF5D 2IBZE 4UB6H 1M8OB 1SQBE 3H1ID 3L36A 1NTKJ 3M06A 4JYBA 5APXA 2Q3IA 3N7NA 2M3BA 4AQRD 4ZNCA 1NAFA 3IAOA 2H88C 2PRRA 4JF7A 2Y9YA 4H13D 3K5BA 1KMIZ 1S2EA 2LR2A 4C46A 1SQPG 1VQ8P 1ZMEC 3JC22 3H1LD 1MFTA 1JEKA 1NOHA 1TU3F 2C0XA 4GIFA 5E79H 1KB9E 1PP9D 2H89C 1SFCC 2FYUK 3RL0g 2KK7A 4BRYA 2A06D 3L71J 1KQFB 4EYYQ 1NTMJ 1SP4A 1NYHA 2BEZF 2KI7B 4OGQC 3VMXA 3Q3DA 1K9MQ 5AVUB 4WVZA 1DH3A 1GZLA 1OW6A 3G3ZA 4AUWA 5K5GB 1GK4A 3SWYA 2HPCB 1PGQA 1L0NG 3CC4P 1R5SA 1T2KD 1AVOA 2FKWB 4OGQB 1URQD 3V2QA 1J1DB 1EZVG 2R5BA 3HD7C 1JOCA 2XNXA 3CX5I 3L35A 5AW4B 2A45G 2AXCA 2LXBA 4Y99C 5AW6B 1BSNA 1JCDA 3V4WA 2E5TA 5GTIE 3BCCJ 3RBXA 1OVRA 2KZJA 2W90A 2WQYC 3QWOC 5KAFE 1KORA 3RK3E 1RF0C 3W67A 3CCSP 2HODA 1N8RQ 2W83C 2E74D 2JWDA 1Z56A 4GOEA 3E1IA 3L72J 1ZLLA 4MN4C 2KB7P 4PV1D 5APVA 5AVYB 3TYYA 4NPFX 5TISH 1KC8Q 3AEGC 1NVOA 2FYNB 4Z1MH 3MUDC 2HYNA 1KILB 4PV1C 3V6IA 2B9BA 1GU4A 2OYIA 1E5WA 1NU1E 3FWNA 4H0LD 4BXLA 4CPGA 2HPCA 1FC2C 1S5LH 3PLNA 3WUTA 1KTMA 2OYHA 1NTZJ 3H1KG 2OTJP 1SQXJ 2JDIH 1LWUB 4IFMA 2FYNC 3H1HJ 4PV1B 1SQVD 1RF1B 2AXTE 3V5BA 1OVVA 2YKOA 1IFPA 5CCGC 3TSIA 1CW5A 2HLOA 1J1EC 2V4HA 2J59M 2OYHC 3V2NA 1YIJP 2N9BA 3AE8C 2FY8A 5AW0B 1SS1A 2KIKA 3CXHH 1BGYE 3CCMP 1VPCA 2GUVA 3KPEA 2QRXA 3MUDA 3RK2C 3AEDC 1LT9C 3Q5SA 4YXDC 1N7SC 4W7YA 3GF3A 1S9KE 3H6PA 4JQ0D 4D6TG 3M0DC 1FOSE 2QJKC 1FZEA 3IFMA 4XFJA 1HBWA 3IN6A 4IFFA 2D2CC 1SQBJ 1YYCA 2IZ1A 4GT1A 1T6AA 2W6BA 2QJYB 3L73J 1RY3A 1AA0A 4H13B 4I7ZC 1KB9I 1LTJA 4K3AA 3FXEA 1HGVA 1S4XA 3VYIA 3HD7A 5B5EE 2ZXXA 3JCUH 4YPCA 5AW5B 2XU6A 1YTZI 1NGMB 1NKZB 4Y28J 1FOSF 1IFJA 2G3AA 2Q6QA 1QX8A 3AE3C 1PV3A 3RK3B 1U57A 1L4AD 1U7JA 1P84H 5APYA 5KAIE 4ASVA 3G71P 1AFOA 1FU1A 2E76B 2WITA 4AYCA 4EOTA 4JYCA 2O01J 1HH0A 2P67A 2ZT9D 2BASA 1BE3J 2BCCG 2FXPA 2OTKE 3LW5H 1VQ9P 1LT1A 3R2PA 3UIAA 4D6TE 3SWFA 1N73A 3SFDC 3TGUD 4PD4D 1NTZK 1H0TA 1VQ5P 3PH0A 1RF1A 3BRVB 4NPDA 3L71G 1BGYJ 3A5TA 3L75D 1ZXGA 4IFDK 2YKQA 3M9HA 5M1BA 2C9LY 3L70E 1SQQK 4Y99B 1LP1A 2ITAA 3AE5C 1JTHB 3HTKB 1YITP 4GOFA 1IO4A 1KILE 2VRSA 2AEJA 4LC1A 4N78D 1OMIA 3H1JE 4UB8H 5KJ7A 5KLVG 3D6YA 3RL0C 5AW9B 1AVYA 1K73Q 2YNYA 1RE4C 2RKLA 2PFXA 2H8PD 1NU1D 1KILC 3RGUA 1RHZB 1LWUA 3F5HA 4NPEA 4U3FD 1GL2D 2A06G 1NWQA 3O8ZA 1BCCJ 3PJSK 1USEA 1NTZG 1N73B 1VQNP 3VN0A 4TLFA 1VQKP 4IL6X 4C7RA 5KJ7D 1KILA 2QA4P 4IOIH 4U7JA 2FFDC 1VQ4P 2FXOA 3AE2C 2AEFA 2AXTH 3EFFK 3M91A 1KYOD 3G4SP 1IJDB 3H1KE 1SFCD 1BE3E 1IC2A 1OIPA 3E7KA 3CX5E 2QIWA 4D6TJ 2OYIC 1JB0J 2HODB 3IF4A 1G1JA 1YJWP 1QVGO 1IFDA
chains in the Genus database with same CATH topology
3CWBJ 1SQQJ 3TGUJ 3CX5I 1L0LJ 3H1KJ 1NTKJ 3L70J 3BCCJ 1EZVI 3L74J 1NU1J 5KLVJ 4U3FJ 1KYOI 3L75J 1BE3J 3H1JJ 3L72J 1L0NJ 1BCCJ 3CXHI 2IBZI 1PP9J 3H1IJ 3L71J 4PD4I 1NTMJ 1SQVJ 1BGYJ 3H1LJ 1P84I 1SQBJ 1NTZJ 4D6TJ 1SQXJ 3L73J 2FYUJ 1KB9I 2BCCJ 3H1HJ 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  1SQQ J;  3TGU J;  3CX5 I;  1L0L J;  3H1K J;  1NTK J;  3L70 J;  3BCC J;  1EZV I;  3L74 J;  1NU1 J;  5KLV J;  4U3F J;  1KYO I;  3L75 J;  1BE3 J;  3H1J J;  3L72 J;  1L0N J;  1BCC J;  3CXH I;  2IBZ I;  1PP9 J;  3H1I J;  3L71 J;  4PD4 I;  1NTM J;  1SQV J;  1BGY J;  3H1L J;  1P84 I;  1SQB J;  1NTZ J;  4D6T J;  1SQX J;  3L73 J;  2FYU J;  1KB9 I;  2BCC J;  3H1H J;  1SQP J; 
#chains in the Genus database with same CATH topology
 2YKP A;  1JUN A;  1XTC C;  3CWB J;  3MP7 B;  2JKV A;  3AE1 C;  5APQ A;  2WT7 A;  2OYI B;  2RH0 A;  4I6M C;  3CCU P;  1T2K C;  1HTL C;  1M7L A;  1XTG B;  1P84 D;  1JY2 P;  1JY3 N;  1GW4 A;  3H1L G;  3HE4 A;  3WU2 H;  1L0L E;  3P8C D;  5AVR B;  3TNU A;  1RE3 C;  1L0L G;  3H1J J;  1VQM P;  4H0L C;  1J1E B;  1SQB K;  5KLV K;  2QJY C;  5AW3 B;  1DEE G;  1SLQ A;  1T3U A;  5TJH A;  1JY2 N;  1JY3 P;  1KQS O;  1NTM G;  1AQ5 A;  2WPS A;  4RKU J;  1JM0 A;  2P7J A;  1KQL A;  4YTP C;  1FS0 E;  3A2A A;  3RK2 B;  4D6T D;  2QG4 A;  1N7S B;  4EDF A;  5GTI H;  2A45 H;  3D6Z A;  2IBZ D;  1LNQ A;  3A0B E;  1BCC E;  3AEE C;  2QM7 A;  2POH A;  1FZC B;  1X9V A;  2PGD A;  1KB9 D;  1PP9 E;  1WRG A;  2E76 C;  2CPS A;  2QSI A;  3L72 G;  1CI6 B;  1LTG C;  2WSE J;  1SQV E;  3L75 E;  2KNC A;  4OH8 B;  4QMA A;  1DEB A;  3B5N B;  1HVV A;  4W7Z A;  1LGH B;  3HE5 A;  3H1K J;  1JMB A;  1PGO A;  3Q1M A;  3KZI E;  4I7Z B;  3L70 G;  1KD1 Q;  3RK2 D;  3B8E B;  1N7S D;  1NU1 J;  3CLQ A;  1NTZ D;  4N78 E;  3ZDM A;  1SQP E;  3VMZ A;  2C0W A;  2O01 H;  1KZU B;  2RMZ A;  3TF5 A;  3NXS A;  2N9Y B;  1SQV K;  2Y0E A;  3AE6 C;  2YIU B;  3B4S A;  3RK3 C;  3PP5 A;  5CCH A;  1KQG B;  3FGA D;  3H1H E;  3AEC C;  3SSU A;  1NHL A;  3AE7 C;  4I2L C;  1BCC D;  1T3J A;  3RK3 D;  2O3J A;  2FYZ A;  3BCC G;  3FWL A;  1G1I A;  2JP3 A;  5GTH H;  2CPB A;  2YO2 A;  2Z5I A;  2N1T A;  2NPS C;  1R5L A;  3M0A A;  1JNM A;  1PPJ G;  3CC7 P;  1BSH A;  1IK9 A;  3RBZ A;  1NU1 K;  3TGU J;  4EI2 A;  1NH4 A;  1EDK A;  3MD0 A;  1OXZ A;  3CL3 D;  5AVT B;  1Y47 A;  3VMY A;  1J2J B;  5KAF H;  2ZT9 C;  2H43 A;  4GDO A;  1EZV D;  3E1R A;  2KLV A;  3TGU G;  1ZR2 A;  1KV4 A;  4HJG H;  2W6A A;  3L74 E;  1AQT A;  4JBZ A;  2G8Y A;  3L75 J;  2KSE A;  3RL0 B;  3L74 G;  5AVX B;  2DW3 A;  3CI9 A;  3GHG C;  1A02 F;  1FJP A;  3L73 E;  4C7N B;  3CX5 H;  4ZKP A;  1FJK A;  2IBZ G;  4U3F G;  4WWI A;  4ZKU A;  2ZFC A;  1W2E A;  3A0H E;  4WY4 A;  1GD2 E;  1Q2N A;  1E79 H;  2Y0C A;  1L4A B;  2HFE D;  1NTK G;  2QM8 A;  1FDO A;  3N4X A;  1U7M A;  1VQL P;  2N1T D;  3CCL P;  1N73 C;  4L75 A;  3LW5 J;  3A3Y B;  1GMJ A;  5APT A;  2E43 A;  2YMK A;  1MKM A;  2NRG A;  5CMZ A;  4KHX A;  2UWJ E;  3A0B H;  5H2F E;  1BGY D;  2H7H A;  3AEF C;  1M1K Q;  2ZYD A;  1IFN A;  1H0T B;  2WPV B;  3G6E P;  1KIL D;  1X79 B;  3L74 D;  1N7L A;  3H1J D;  2O1J A;  2K9J B;  2R44 A;  3GG2 A;  4H0L B;  1ZV8 A;  5E79 E;  5KLI C;  1HWT C;  3P7K A;  1YBK A;  2V7Q J;  1S1C X;  1SQQ G;  3L73 D;  4HB1 A;  3VMA A;  1SFC A;  1VQO P;  1Q7Y Q;  2M8R A;  1ZN5 A;  2I8D A;  2MJZ A;  1HUC A;  1M90 Q;  1JO5 A;  1OFC X;  1L0N J;  3U1C A;  2WTY A;  2E75 B;  1UII A;  1W2B O;  4WY4 D;  3BAT A;  1YJN P;  3H1K D;  2ZYG A;  1OWA A;  1SQV J;  4PD4 I;  3FXD A;  3LIE A;  3VP8 A;  1PL5 A;  1R8E A;  2RN0 A;  1QEX A;  2JJL A;  1EC5 A;  2HR3 A;  4WY4 C;  1PGJ A;  3Q5P A;  3JCU E;  2L91 A;  1DD3 A;  1LT9 A;  3KZI H;  1KB9 H;  1KFM A;  1GL2 B;  1FZA A;  2BEQ D;  1QL2 A;  1SQB D;  1G2C B;  1SQP J;  2QJK B;  2YXQ B;  3GHG A;  3H1I E;  4PD4 E;  5AW2 B;  3CCR P;  3O6Q B;  2E42 A;  3BRT B;  5BVZ A;  3MZW B;  4L76 A;  1NU1 G;  1EDL A;  1P84 E;  1FZF A;  4N6J A;  3G9R A;  2E74 C;  4N3Y B;  4WB4 A;  3V2P A;  3HD7 D;  1URQ A;  3VTP C;  2Q9I A;  1Q81 Q;  2K88 A;  2N1T B;  1MV8 A;  3I5C A;  1BDD A;  1X8Y A;  3GMA A;  2FFD A;  3B5N C;  3EFG A;  2M0B A;  3MIW A;  1VQP P;  1NTK K;  2KZI A;  3CXH I;  3MTU E;  4KJM A;  4M3L A;  2J5U A;  5KTB A;  2M5A A;  2NPS B;  1JMM A;  3GF7 A;  3C1L A;  1VF5 B;  3QH9 A;  1A02 J;  2O1K A;  3HRN A;  3AEA C;  3T97 B;  3VP9 A;  1S9K D;  2M3E A;  1K05 A;  1ZP0 C;  2IFN A;  1RE4 A;  2E76 D;  3CWB D;  4DT0 A;  2YIU C;  2B89 A;  4XE5 B;  3CCJ P;  3JSV C;  3A0H H;  4HYT B;  2C9N Y;  5B66 E;  2ZT9 B;  3ITK A;  2JR8 A;  3KXD A;  1NTM D;  5EFW B;  1FAV A;  1L0L J;  3H1J G;  1AJY A;  2Q7C A;  1RF0 A;  2KXP B;  4R4L A;  3I55 P;  3H25 A;  2P1J A;  3O6Q A;  1GDT A;  1EDJ A;  1LTS C;  2Q3E A;  2A45 I;  3HUS A;  1BE3 D;  1M1J B;  1RQV A;  2FBW C;  3KHU A;  3BVH A;  3CCE P;  1SQB G;  1VL2 A;  1LJ2 A;  5KAI H;  1S3J A;  4DOJ A;  2SPZ A;  5CJ4 A;  4U3F J;  3Q5R A;  1NTZ E;  1OW8 A;  3OAK A;  3D71 A;  5AW8 B;  3OJA B;  1PP9 J;  1Y8A A;  1RQU A;  1T8Z A;  2D2C D;  2XDJ A;  1NO4 A;  2WPQ A;  1N86 A;  3L37 A;  2R32 A;  1SQQ E;  5L8R J;  1YJ9 P;  1L0L K;  3EWK A;  3AE4 C;  3II6 A;  3MHV A;  1KN7 A;  2O01 N;  5KLV D;  2WSC H;  3H32 A;  5APS A;  1BE3 G;  2BCC J;  2YO3 A;  4R4M A;  2FFD B;  4HH2 A;  3CC2 P;  3WUV A;  1HJB A;  1WT6 A;  4I1L A;  1GU5 A;  1L4A C;  2E75 D;  2IYO A;  2WMM A;  4WBA A;  2NPS D;  1NKN A;  3VOP A;  1K04 A;  3C9I A;  2K3R A;  3H1H G;  1L0N K;  4TT3 H;  5KKZ B;  3CD6 P;  2J58 A;  3L70 J;  2P10 A;  1D7M A;  2WPR A;  1PZQ A;  4H44 D;  1ZRT E;  2FYU E;  5APW A;  3WU2 E;  2P58 A;  4L73 A;  1PFI A;  1L2P A;  1DX7 A;  3F89 A;  1KYO I;  2GM4 A;  1M1J A;  1L4A A;  2WSS H;  3KYQ A;  5GTH E;  2Z5H A;  5KLI B;  1N7S A;  3TDK A;  2IPP A;  4RJT A;  2WT7 B;  3H1I J;  1K8A Q;  1GK6 A;  1YHQ P;  1H8A A;  3CPW O;  1IZN B;  2E5Y A;  2XKM A;  1SQP K;  3LID A;  5CHX A;  1RH5 B;  2WSE H;  1WMK A;  2WZ7 A;  4H44 B;  4HKZ H;  2CK3 H;  2ZVN B;  4GOD A;  4LLH A;  2E74 B;  5AW1 B;  2ZVO B;  3H32 B;  4A7P A;  3RL0 D;  5AW7 B;  2R3S A;  2KS1 B;  3T97 A;  5CCG A;  3IR9 A;  3HD7 B;  3C8V A;  4KT0 J;  3FX0 A;  3SWK A;  5CBO A;  1SVF A;  2LXC B;  1SQQ J;  2M5A B;  1MZ9 A;  2NPS A;  3CX5 D;  4XA4 A;  4WY4 B;  1LT9 B;  1YQ3 C;  1ZW0 A;  2HG5 D;  3L72 D;  1W5C E;  3B71 A;  2IYP A;  3S9O A;  1ZR4 A;  2ZXE B;  4IL6 H;  1BGY G;  1FZC C;  1GL2 C;  3D70 A;  4UB6 E;  1VDF A;  1EZV I;  2OGU A;  4JPZ B;  3HUS C;  1VF5 C;  5AVS B;  2MKV A;  2PAJ A;  1HJ0 A;  3CXH D;  3H1L E;  3AEB C;  1OX3 A;  2K1A A;  5KJ7 C;  4O9B A;  1IFI A;  2KSJ A;  4B86 A;  2PP6 A;  3KQG A;  5AVZ B;  1PGP A;  2Q5U A;  2QE7 H;  4OGQ D;  2XV5 A;  3ABV C;  3BAS A;  3GLM A;  2LKM A;  4H13 C;  1S72 P;  1HGZ A;  4K35 A;  3P8C E;  1NAY A;  2B87 B;  1EZV E;  3HUS B;  3USS A;  1PIX A;  1GL2 A;  1FE6 A;  2W6J H;  2KS1 A;  2IDB A;  1AV1 A;  1P84 I;  2WSC J;  3M9Q A;  2GA1 A;  2I1J A;  2I1K A;  2GUS A;  2NZ2 A;  1LP1 B;  1PP9 G;  2IX7 C;  3I56 P;  1JY2 O;  2P2U A;  1SQX D;  1BCC G;  1M56 D;  3L75 G;  4UB8 E;  1ZOY C;  1CZQ A;  3L71 D;  5C39 A;  4DJG A;  2OAR A;  3NTN A;  1OW7 A;  2Q1K A;  3S1K A;  3B5N A;  3PRJ A;  2WSF J;  1L0N E;  2KNC B;  4BRY B;  2B88 A;  4BWN A;  1EDI A;  2Y0D A;  1EXJ A;  2QJP B;  1LTT C;  3CXH E;  1QGK B;  5AVW B;  1Q82 Q;  1URQ C;  1KYO H;  2BCC D;  1G2C A;  1JY3 O;  1NJI Q;  3EQ2 A;  1SFC B;  3CME P;  2K37 A;  2XZR A;  5KLV J;  4RES B;  1H88 A;  1M57 D;  1YI2 P;  2K9J A;  1JTH A;  2K9Y A;  2YXR B;  3S4R A;  1LTI C;  1MFZ A;  2QJP C;  1EXI A;  1LTB C;  1M1J C;  1KYO E;  5APU A;  1URQ B;  3NMD A;  1Q86 Q;  2KUB A;  2ZJS E;  3BCC D;  3B5N D;  3CCV P;  3NFQ A;  4PD4 H;  2R5D A;  3CWB E;  1SQV G;  3HE5 B;  3TK1 A;  1JCC A;  2QVA A;  3OW2 O;  1LTA C;  4W80 A;  5DJT B;  5B5E H;  1J1D C;  1PPJ D;  1OZH A;  1YQ4 C;  1Y9B A;  2KP8 A;  1MUU A;  3GHG B;  1Q90 D;  3H1L J;  1UIX A;  3HE4 B;  3WMM 0;  3M0D A;  2Z4E A;  5KKZ C;  1ZRT D;  2FYU D;  2FYU J;  2XND H;  4ASW A;  5CCG D;  3CMA P;  1HF9 A;  1NTK D;  3V2R A;  1NTM E;  1VQ6 P;  3SFE C;  2ZAE B;  3P32 A;  1L0L D;  1X0T A;  2WSF H;  5CJ0 A;  4ZMD A;  5BU8 B;  1VQ7 P;  4L74 A;  2AEM A;  1DD4 A;  2WVR A;  1CI6 A;  3M9B A;  1CSB A;  2A06 E;  1DIP A;  1YTZ T;  3H1I G;  4PJ0 H;  1FBM A;  4IL6 E;  4EIJ A;  1NTM K;  2KLU A;  3P8M C;  5B66 H;  2IBZ I;  3CCQ P;  4RO0 A;  1GW3 A;  1LWU C;  1SQQ D;  1RE3 A;  2IZ0 A;  2ZYA A;  3L73 G;  4OWF A;  5DJU B;  1QL1 A;  4PJ0 E;  4YXW H;  4DZO A;  5CBN A;  3WUU A;  1FZG A;  3HTK A;  5CCH D;  2KOG A;  5KLV E;  2R3C A;  4C7N A;  2OTL P;  5TIS E;  3U1A A;  1NTK E;  2W27 A;  1S5L X;  2E75 C;  4DCK A;  2QEX P;  5CCH C;  2FXM A;  4LGD E;  2W8Z A;  4U3F E;  1S5L E;  3A7O A;  2OYO A;  4H44 C;  2B87 A;  5BU5 A;  5H2F H;  2L5G B;  1FZC A;  2FYU G;  1SQP D;  3PTZ A;  5AVV B;  3AE9 C;  1BDC A;  1SQX E;  1QLE D;  1RF1 C;  2IFM A;  3L71 E;  3W68 A;  1EQ7 A;  3H1H D;  3Q2Y A;  3U59 A;  2V7Q H;  3L4F A;  3R4Y A;  3GW6 A;  1QVF O;  1FDI A;  1IK7 A;  2OYH B;  3OA7 A;  2BCC E;  2WWW A;  1IFM A;  1FDM A;  2N1T C;  1SQX K;  3V4Q A;  3TNU B;  1USD A;  2JO1 A;  1L0N D;  1LTJ B;  2JEE A;  1X22 A;  3TGU E;  1GTW A;  2OQQ A;  2JWA A;  2Y9Z A;  3MGN A;  3BCC E;  1KFN A;  1H89 A;  4GKG A;  3L70 D;  1FZB A;  2KYV A;  3L74 J;  1LTJ C;  3KDP B;  4OVN F;  1N2D C;  1PPJ E;  3CWB G;  1OVU A;  2YMY A;  3L72 E;  5AVQ B;  1SQX G;  2D2C B;  3PHL A;  1VF5 D;  2IBZ E;  4UB6 H;  1M8O B;  1SQB E;  3H1I D;  3L36 A;  1NTK J;  3M06 A;  4JYB A;  5APX A;  2Q3I A;  3N7N A;  2M3B A;  4AQR D;  4ZNC A;  1NAF A;  3IAO A;  2H88 C;  2PRR A;  4JF7 A;  2Y9Y A;  4H13 D;  3K5B A;  1KMI Z;  1S2E A;  2LR2 A;  4C46 A;  1SQP G;  1VQ8 P;  1ZME C;  3JC2 2;  3H1L D;  1MFT A;  1JEK A;  1NOH A;  1TU3 F;  2C0X A;  4GIF A;  5E79 H;  1KB9 E;  1PP9 D;  2H89 C;  1SFC C;  2FYU K;  3RL0 g;  2KK7 A;  4BRY A;  2A06 D;  3L71 J;  1KQF B;  4EYY Q;  1NTM J;  1SP4 A;  1NYH A;  2BEZ F;  2KI7 B;  4OGQ C;  3VMX A;  3Q3D A;  1K9M Q;  5AVU B;  4WVZ A;  1DH3 A;  1GZL A;  1OW6 A;  3G3Z A;  4AUW A;  5K5G B;  1GK4 A;  3SWY A;  2HPC B;  1PGQ A;  1L0N G;  3CC4 P;  1R5S A;  1T2K D;  1AVO A;  2FKW B;  4OGQ B;  1URQ D;  3V2Q A;  1J1D B;  1EZV G;  2R5B A;  3HD7 C;  1JOC A;  2XNX A;  3CX5 I;  3L35 A;  5AW4 B;  2A45 G;  2AXC A;  2LXB A;  4Y99 C;  5AW6 B;  1BSN A;  1JCD A;  3V4W A;  2E5T A;  5GTI E;  3BCC J;  3RBX A;  1OVR A;  2KZJ A;  2W90 A;  2WQY C;  3QWO C;  5KAF E;  1KOR A;  3RK3 E;  1RF0 C;  3W67 A;  3CCS P;  2HOD A;  1N8R Q;  2W83 C;  2E74 D;  2JWD A;  1Z56 A;  4GOE A;  3E1I A;  3L72 J;  1ZLL A;  4MN4 C;  2KB7 P;  4PV1 D;  5APV A;  5AVY B;  3TYY A;  4NPF X;  5TIS H;  1KC8 Q;  3AEG C;  1NVO A;  2FYN B;  4Z1M H;  3MUD C;  2HYN A;  1KIL B;  4PV1 C;  3V6I A;  2B9B A;  1GU4 A;  2OYI A;  1E5W A;  1NU1 E;  3FWN A;  4H0L D;  4BXL A;  4CPG A;  2HPC A;  1FC2 C;  1S5L H;  3PLN A;  3WUT A;  1KTM A;  2OYH A;  1NTZ J;  3H1K G;  2OTJ P;  1SQX J;  2JDI H;  1LWU B;  4IFM A;  2FYN C;  3H1H J;  4PV1 B;  1SQV D;  1RF1 B;  2AXT E;  3V5B A;  1OVV A;  2YKO A;  1IFP A;  5CCG C;  3TSI A;  1CW5 A;  2HLO A;  1J1E C;  2V4H A;  2J59 M;  2OYH C;  3V2N A;  1YIJ P;  2N9B A;  3AE8 C;  2FY8 A;  5AW0 B;  1SS1 A;  2KIK A;  3CXH H;  1BGY E;  3CCM P;  1VPC A;  2GUV A;  3KPE A;  2QRX A;  3MUD A;  3RK2 C;  3AED C;  1LT9 C;  3Q5S A;  4YXD C;  1N7S C;  4W7Y A;  3GF3 A;  1S9K E;  3H6P A;  4JQ0 D;  4D6T G;  3M0D C;  1FOS E;  2QJK C;  1FZE A;  3IFM A;  4XFJ A;  1HBW A;  3IN6 A;  4IFF A;  2D2C C;  1SQB J;  1YYC A;  2IZ1 A;  4GT1 A;  1T6A A;  2W6B A;  2QJY B;  3L73 J;  1RY3 A;  1AA0 A;  4H13 B;  4I7Z C;  1KB9 I;  1LTJ A;  4K3A A;  3FXE A;  1HGV A;  1S4X A;  3VYI A;  3HD7 A;  5B5E E;  2ZXX A;  3JCU H;  4YPC A;  5AW5 B;  2XU6 A;  1YTZ I;  1NGM B;  1NKZ B;  4Y28 J;  1FOS F;  1IFJ A;  2G3A A;  2Q6Q A;  1QX8 A;  3AE3 C;  1PV3 A;  3RK3 B;  1U57 A;  1L4A D;  1U7J A;  1P84 H;  5APY A;  5KAI E;  4ASV A;  3G71 P;  1AFO A;  1FU1 A;  2E76 B;  2WIT A;  4AYC A;  4EOT A;  4JYC A;  2O01 J;  1HH0 A;  2P67 A;  2ZT9 D;  2BAS A;  1BE3 J;  2BCC G;  2FXP A;  2OTK E;  3LW5 H;  1VQ9 P;  1LT1 A;  3R2P A;  3UIA A;  4D6T E;  3SWF A;  1N73 A;  3SFD C;  3TGU D;  4PD4 D;  1NTZ K;  1H0T A;  1VQ5 P;  3PH0 A;  1RF1 A;  3BRV B;  4NPD A;  3L71 G;  1BGY J;  3A5T A;  3L75 D;  1ZXG A;  4IFD K;  2YKQ A;  3M9H A;  5M1B A;  2C9L Y;  3L70 E;  1SQQ K;  4Y99 B;  1LP1 A;  2ITA A;  3AE5 C;  1JTH B;  3HTK B;  1YIT P;  4GOF A;  1IO4 A;  1KIL E;  2VRS A;  2AEJ A;  4LC1 A;  4N78 D;  1OMI A;  3H1J E;  4UB8 H;  5KJ7 A;  5KLV G;  3D6Y A;  3RL0 C;  5AW9 B;  1AVY A;  1K73 Q;  2YNY A;  1RE4 C;  2RKL A;  2PFX A;  2H8P D;  1NU1 D;  1KIL C;  3RGU A;  1RHZ B;  1LWU A;  3F5H A;  4NPE A;  4U3F D;  1GL2 D;  2A06 G;  1NWQ A;  3O8Z A;  1BCC J;  3PJS K;  1USE A;  1NTZ G;  1N73 B;  1VQN P;  3VN0 A;  4TLF A;  1VQK P;  4IL6 X;  4C7R A;  5KJ7 D;  1KIL A;  2QA4 P;  4IOI H;  4U7J A;  2FFD C;  1VQ4 P;  2FXO A;  3AE2 C;  2AEF A;  2AXT H;  3EFF K;  3M91 A;  1KYO D;  3G4S P;  1IJD B;  3H1K E;  1SFC D;  1BE3 E;  1IC2 A;  1OIP A;  3E7K A;  3CX5 E;  2QIW A;  4D6T J;  2OYI C;  1JB0 J;  2HOD B;  3IF4 A;  1G1J A;  1YJW P;  1QVG O;  1IFD A; 
#chains in the Genus database with same CATH homology
 3CWB J;  1SQQ J;  3TGU J;  3CX5 I;  1L0L J;  3H1K J;  1NTK J;  3L70 J;  3BCC J;  1EZV I;  3L74 J;  1NU1 J;  5KLV J;  4U3F J;  1KYO I;  3L75 J;  1BE3 J;  3H1J J;  3L72 J;  1L0N J;  1BCC J;  3CXH I;  2IBZ I;  1PP9 J;  3H1I J;  3L71 J;  4PD4 I;  1NTM J;  1SQV J;  1BGY J;  3H1L J;  1P84 I;  1SQB J;  1NTZ J;  4D6T J;  1SQX J;  3L73 J;  2FYU J;  1KB9 I;  2BCC J;  3H1H J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...