4PD4I

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4pd4I00
1EZVI 3CXHI 1SQXJ 1NTKJ 1BE3J 1SQPJ 2IBZI 4PD4I 3CX5I 3BCCJ 1NTZJ 1NTMJ 1SQBJ 1L0NJ 1KB9I 1P84I 4U3FJ 3L72J 3H1JJ 3CWBJ 1BGYJ 3TGUJ 1L0LJ 1SQQJ 1BCCJ 3L70J 3L73J 1KYOI 5KLVJ 3H1LJ 3L71J 2FYUJ 3H1IJ 3L74J 3L75J 1NU1J 2BCCJ 1PP9J 3H1KJ 4D6TJ 1SQVJ 3H1HJ
chains in the Genus database with same CATH superfamily
2XDJA 2JKVA 3FXEA 2FYZA 2B87B 3M0DC 3H1JJ 1KTMA 2O1KA 2V7QH 3USSA 2QJPC 3WU2E 1NTZE 5CCHA 2N1TA 5B66E 1KILA 1P84E 2C0WA 4PD4I 1AJYA 4WVZA 2AEMA 2CPBA 4PV1C 3KDPB 3NXSA 2J58A 3NMDA 3B5NA 4KHXA 3RK2B 3D6YA 1VL2A 1K04A 2WPRA 4ASVA 1NH4A 1DEBA 1NO4A 2B9BA 3Q5RA 3A7OA 1JCDA 1PFIA 1NTKE 2OYIC 1HWTC 1N7SA 3HUSC 2QE7H 5AVXB 2W27A 1GD2E 3CWBE 1BCCE 1LTAC 3WMM0 1D7MA 3MD0A 1KN7A 1KYOE 5K5GB 2HFED 1SQBJ 1GW3A 1YTZI 1N73B 1ZN5A 5AW5B 1A02F 4JPZB 2XZRA 1QX8A 3ITKA 3CL3D 3AEGC 2AXTE 3ZDMA 1LWUA 1RE3A 2Y0CA 1K73Q 1FZBA 3G9RA 2J5UA 2KZIA 3BCCJ 1EZVG 3LW5H 1T3JA 1PIXA 3OAKA 1PGQA 1URQC 2KXPB 1GW4A 1PP9J 1EDIA 1IFMA 1SQVG 1QGKB 1VQ5P 1NYHA 2JEEA 2M3BA 3N4XA 3A0BE 1CSBA 1JY3P 3M91A 1IO4A 2N1TB 1SFCC 3HD7C 1PZQA 1L0LD 2JJLA 2OQQA 2FYUG 2QJKC 1BGYE 4HKZH 2W6AA 3GF3A 2O1JA 1ZP0C 1L0NG 2WSSH 1MUUA 1GL2D 1R5LA 1CW5A 1NTME 4XFJA 3NFQA 3L36A 3V2PA 1BDCA 2Z5IA 1GU4A 1LTBC 1T8ZA 3V5BA 2P1JA 2WPSA 1IFNA 4U3FG 3PLNA 2WPVB 1VQPP 1RQVA 3CXHH 4PJ0E 5APYA 5CHXA 2YIUC 3TGUE 2E76C 1SQXG 2QA4P 2HPCB 4IL6X 4D6TE 5KKZB 2PRRA 2OTLP 3CX5D 1BDDA 2AXCA 1OX3A 2E5TA 2ZT9C 2Q7CA 5KJ7A 1PPJE 4LC1A 4CPGA 1Y8AA 1XTCC 1SQPD 3KQGA 1T6AA 5DJTB 1KILE 2WSEH 2A45H 3MZWB 4HH2A 3L73J 1LTGC 3L35A 3CPWO 2E5YA 3H1KJ 4RESB 3TK1A 3V2NA 1LP1A 3AEFC 4W7YA 1YI2P 2Q6QA 1W2BO 3L75E 2C9LY 4C7NA 4H13D 1OFCX 1EXIA 1AQ5A 3RBXA 1M1JA 2R5BA 3L73D 5E79H 2BCCJ 2WZ7A 4HYTB 1PL5A 1GL2B 2LXCB 3H1KD 1X0TA 3D6ZA 3CCJP 2XNDH 1JTHB 4Y99B 1LT9A 2BEZF 2PP6A 4C7RA 1LNQA 4L75A 1FZCA 1NAYA 1VQ9P 1UIIA 2KP8A 3TNUA 4EDFA 3GHGC 1SQBK 4K3AA 1LT1A 3RK2C 2H43A 1RF0A 1JY2O 4ZKPA 2BCCD 2YNYA 1FZAA 4L74A 5AW6B 1BE3D 2GUSA 2KOGA 3FGAD 2KS1A 2RH0A 1SQQG 2H88C 2N9BA 2R32A 2CPSA 5TISH 4WY4A 1L0LK 3PP5A 4RKUJ 1NTZJ 1NU1E 2LR2A 1RQUA 1ZXGA 2K3RA 3JCUH 1RY3A 3D70A 2H89C 3L74D 2IBZI 1GTWA 5AVZB 2Y9ZA 4Z1MH 3KZIE 5CCGD 2FY8A 5APTA 3SFDC 2GM4A 1BSHA 2IZ0A 4C7NB 1NTKJ 2O01J 2P58A 1LTJA 4YTPC 1Q82Q 1JNMA 3CWBJ 1EZVE 1BCCJ 4KJMA 5BVZA 4GOFA 1CI6A 4UB8H 1IFDA 1RF1A 3R4YA 4W80A 2R3CA 1GMJA 5CCHC 2N1TC 1E79H 1KILC 1LT9B 2YKQA 1IFJA 3IF4A 2IPPA 1FZCB 3BRTB 3H32A 1NTMG 1SQVE 5KAFH 3TNUB 1J1DC 1EDLA 1SQPK 3B5NC 3BASA 3B71A 2B87A 1VF5D 4IL6E 1HJBA 3MTUE 1KQFB 1H8AA 2XU6A 4C46A 5KLVE 2FYUE 3VP9A 2HR3A 3P32A 1L0NE 3L71G 1N7SC 3L70D 4MN4C 4A7PA 1N86A 1OW6A 1IFPA 5AVVB 3VYIA 3FX0A 4N3YB 1BGYJ 1G1JA 4YPCA 1VDFA 3U1CA 5KKZC 4GIFA 1GZLA 1J1EB 4U3FE 3M9BA 1K8AQ 1LWUC 1RE3C 2Q3IA 1HVVA 4OGQD 4JYCA 1USEA 1JMBA 4UB6H 4H44D 3VMYA 1SQXE 4DZOA 2M8RA 1T3UA 1LTJB 1N73A 2KLVA 1YHQP 1KB9H 1HH0A 5APUA 2C9NY 1X9VA 2QJYC 1NOHA 2IYOA 5AVWB 4PD4D 3TGUJ 1FC2C 1ZR2A 4D6TJ 5AW2B 3H1HJ 3CLQA 3H32B 1VF5B 1AVOA 2E75D 1PV3A 1ZR4A 5AW1B 2P7JA 2CK3H 5CBNA 4Y99C 5H2FE 3U59A 1NTZK 3H1LJ 1S1CX 1JB0J 1YITP 4HJGH 1XTGB 3K5BA 3H1HD 1M7LA 1FDIA 1IJDB 3AE3C 3H1JD 1USDA 3L75J 3H1LD 1AFOA 1NU1G 1KZUB 5B5EE 2W8ZA 1PGOA 4HB1A 2O01N 1KQGB 3HE5A 4OGQB 1NTKK 1L0LG 1RH5B 4N78E 4H44B 2OTJP 3RL0C 2IFNA 1JY2P 1YQ4C 1EC5A 1SQQE 3L75D 3MUDA 5KJ7C 2WSCJ 4NPDA 3I5CA 2E74B 1OZHA 1L4AD 4ZNCA 2HPCA 3S4RA 2ZVOB 1UIXA 1FDMA 3AEBC 2D2CD 2L91A 4L76A 4H0LC 5GTIE 1JMMA 3L72G 2E75B 1DD3A 1SQBD 3CXHE 1M1JC 4TT3H 3WU2H 3RK3D 3H25A 5B66H 1WRGA 1P84H 5AW0B 1Y47A 1MFZA 1JM0A 3VTPC 4ASWA 1LT9C 1IK9A 3BCCD 3PTZA 2I1KA 1VQLP 1ZRTE 5KLVG 4LGDE 2WPQA 1VQ7P 1NGMB 2IFMA 1RF0C 3LIEA 1KD1Q 1PP9D 1SQPG 2KIKA 5CBOA 5M1BA 1RE4A 1GL2A 1IZNB 1YQ3C 1U57A 1JTHA 2O01H 1FZGA 2ZFCA 4DCKA 3EFGA 5DJUB 1Q81Q 3HE5B 4WY4C 1OVUA 2QSIA 2FXPA 1IFIA 1KYOH 4I1LA 3RBZA 1CZQA 4LLHA 3L73G 2OGUA 2SPZA 3GLMA 1SQVJ 3P8CE 1L4AB 1Q2NA 2AXTH 1WMKA 2WTYA 1M90Q 2FYNB 3L71E 1N2DC 2W6JH 1Y9BA 1YJNP 2RMZA 1OWAA 1EXJA 2D2CB 2H8PD 3S9OA 1S5LH 4PV1D 3V2RA 1VQNP 1KB9D 2FYUJ 3V2QA 1U7JA 2YMYA 1SS1A 1DIPA 1BE3G 3CC2P 3RK3B 3W68A 1L0NJ 4I7ZB 3A0BH 2KLUA 2JO1A 1TU3F 2C0XA 5AW9B 1S9KE 1RF1C 1GU5A 2LXBA 1AQTA 1EZVI 3F89A 2QVAA 4WWIA 2N9YB 1FZFA 2FBWC 1FJKA 4OVNF 3IN6A 4U3FJ 5KTBA 2GUVA 1S3JA 2ZJSE 1L0ND 5L8RJ 1S4XA 2Z5HA 1FZEA 3IFMA 3AECC 2NPSA 3H1IJ 2HODA 4PD4H 3AE7C 3L74G 2WSFJ 2YXQB 1SQXJ 2K37A 2NPSD 3CX5I 3C1LA 2JWDA 3L4FA 3BATA 4NPFX 2KB7P 5TJHA 5CMZA 4PJ0H 3TYYA 2W90A 1QLED 1NJIQ 3H1ID 1ZOYC 2H7HA 1SQXD 2QJPB 2K9JB 3MGNA 1PGJA 2IBZD 4EOTA 1DH3A 3I56P 4O9BA 2POHA 4RJTA 1N8RQ 1SFCD 3M9QA 4DOJA 4H44C 4PV1B 1Q90D 3JSVC 3V4WA 4AQRD 4GDOA 2WVRA 4RO0A 4AYCA 1X22A 1HTLC 2A06D 2E74C 5APQA 3AE6C 1L0LE 1N73C 2QEXP 1YJWP 3U1AA 5CCGA 3Q2YA 3HUSB 3F5HA 1NTZD 2G8YA 3L70G 2YO3A 1KORA 3VOPA 1P84D 1N7LA 1OXZA 4H13B 4IOIH 1VQ4P 5BU8B 3AE9C 5APSA 1Q86Q 2R5DA 2NPSB 2HODB 1SQQJ 1H0TB 2WSCH 1RHZB 5AVUB 3L72E 3A3YB 1VQOP 1Z56A 2ZT9D 4UB6E 2A45G 2OYHA 1NTKD 3AE4C 5APWA 4N78D 1SQVK 3OW2O 1QEXA 3C8VA 3EQ2A 3CWBD 2MJZA 3CX5E 3G4SP 1FS0E 3HRNA 1BCCD 3G3ZA 2QRXA 2BEQD 1KYOD 3SWKA 1VQKP 1FJPA 1SFCB 2FYUK 3G71P 2KI7B 2OTKE 1EDJA 1S72P 1SQPE 3R2PA 4NPEA 5AVSB 1L0NK 2B89A 2Z4EA 3CCVP 1S5LX 4JQ0D 2PFXA 2Q1KA 1QVGO 3MUDC 3Q1MA 3CCUP 2AEJA 5GTHH 2B88A 3AE5C 4IFMA 2FYNC 1T2KD 2JWAA 4L73A 2WITA 1GDTA 3L73E 3RK2D 3VP8A 1NTMJ 1H88A 1A02J 1FE6A 1SQXK 3H1JG 3AE1C 3G6EP 3RK3C 5BU5A 1EDKA 1BGYD 2AEFA 3NTNA 3O8ZA 2ZYDA 2P67A 1MZ9A 1JY3N 3CXHI 2W83C 2BCCE 3VMXA 2ZT9B 2WT7A 1NTMD 1BE3E 4Y28J 3Q5PA 3L71J 2R44A 2M5AB 3A0HH 4U7JA 5KLIB 3FXDA 2OYHB 2Q9IA 4IL6H 2P2UA 1FU1A 3FWNA 2IDBA 1RE4C 1GL2C 4AUWA 5AW8B 4I2LC 3V6IA 5AW3B 3WUVA 1NKZB 1K9MQ 1AVYA 3W67A 3P8CD 3H6PA 3TGUD 1KQSO 4R4MA 2A45I 2DW3A 1YBKA 1LTIC 2Y0EA 2YMKA 4D6TD 2OARA 1VQ8P 3L74E 1K05A 2Y0DA 1SQBG 3HTKA 2KYVA 2Y9YA 2FXMA 4QMAA 3MIWA 1PPJD 2UWJE 1L2PA 5APVA 5CCHD 2N1TD 2NRGA 1KILD 4ZMDA 3BCCG 3GHGB 3CMAP 3CCMP 2WSFH 1S9KD 2LKMA 2QG4A 3B5ND 2ITAA 5AW7B 1PP9G 4W7ZA 3CI9A 2YKOA 1SQQK 2VRSA 4XE5B 2K88A 1L4AA 3FWLA 4IFFA 3RGUA 2QM7A 2ZYGA 3T97B 1KFNA 2KUBA 4EYYQ 5KAIH 1DEEG 2FFDA 1M57D 1N7SD 3CCQP 2WT7B 4H13C 2E42A 4JF7A 3GF7A 3SWFA 3CCSP 3CCEP 3TSIA 4WB4A 5H2FH 3A2AA 4R4LA 2NPSC 1NU1J 2M0BA 1NHLA 2WMMA 2ZXEB 3L70E 5AVRB 4OH8B 1YYCA 1J2JB 1S5LE 3CC7P 1L0LJ 4M3LA 1FZCC 2KNCA 2WQYC 3I55P 1MKMA 1NU1D 5B5EH 1HBWA 3HTKB 2RN0A 3MP7B 4DT0A 1KILB 3QH9A 1OVRA 5C39A 1NTMK 4JYBA 4I6MC 2R3SA 4WBAA 5AVYB 4XA4A 3HE4A 2I1JA 1EQ7A 4IFDK 3RL0g 2WWWA 2Q3EA 1OIPA 1J1DB 3B5NB 2K1AA 3M0DA 3L72J 3OA7A 4KT0J 4PD4E 2K9JA 5E79E 1JUNA 1R8EA 1HUCA 3H1KG 1FBMA 2L5GB 1SP4A 1J1EC 1MFTA 1SLQA 1EZVD 5CCGC 1KV4A 1GK6A 1N7SB 5GTIH 3L37A 4GOEA 3VMAA 3Q3DA 3E1RA 2JP3A 3L72D 2FFDB 1YJ9P 1ZLLA 5KLVJ 2Q5UA 3H1IG 1X79B 2BCCG 1NWQA 1M8OB 1G2CA 3VN0A 1SQPJ 3M0AA 2M3EA 2KK7A 1SQVD 1LGHB 2NZ2A 2HLOA 2JR8A 2IBZG 1LTJC 1JCCA 3H1HE 3CCLP 2OYIA 2V4HA 1LWUB 2KSEA 3HUSA 2HYNA 5TISE 3H1JE 5KLVD 3B8EB 3RL0D 1LJ2A 1PGPA 1X8YA 2FYUD 2V7QJ 1OW8A 3H1LE 4BXLA 4TLFA 5KLIC 2OYHC 2P10A 1DD4A 5KJ7D 2KNCB 3ABVC 1Q7YQ 1DX7A 2W6BA 1VF5C 2ZXXA 1U7MA 3JCUE 2A06G 1SVFA 3N7NA 2BASA 2OYOA 2YO2A 1H0TA 2QJYB 1H89A 3IAOA 3KXDA 1OW7A 3P8MC 1NTZG 1KB9I 1JEKA 2KSJA 4H0LD 1IC2A 3HE4B 1URQA 4U3FD 3QWOC 3Q5SA 3AE8C 3AE2C 1URQD 3CC4P 1FAVA 2IX7C 1QL1A 1BE3J 1S2EA 2I8DA 5AVQB 1T2KC 5CJ0A 4YXWH 1NKNA 3OJAB 1KFMA 1SFCA 3HD7A 4UB8E 1IK7A 1FDOA 1SQBE 3M9HA 4OGQC 5EFWB 3GG2A 3CMEP 3HD7D 5AW4B 3V4QA 1AA0A 3RK3E 1NTKG 3S1KA 1JO5A 3TDKA 3VMZA 2RKLA 1VQ6P 3E1IA 1W5CE 1NU1K 3PJSK 5KAFE 4EIJA 3AEDC 3CWBG 4B86A 3BCCE 1BCCG 1KQLA 3LW5J 1G2CB 1ZMEC 3L74J 1QVFO 1W2EA 2ZAEB 4YXDC 3M06A 2OYIB 4WY4D 1JOCA 3IR9A 2QM8A 1GK4A 1PP9E 3RL0B 2XNXA 2ZVNB 3JC22 3E7KA 1YIJP 1OVVA 2HG5D 4BRYA 3GMAA 2GA1A 2XV5A 4K35A 2E75C 5APXA 5GTHE 1OMIA 2E76D 3O6QA 1HJ0A 2O3JA 1LTSC 2PAJA 5AVTB 1LP1B 4OWFA 1JY3O 3C9IA 3B4SA 4H0LB 1R5SA 1HGZA 1NVOA 2G3AA 3CCRP 2M5AA 1M1JB 1QL2A 3BVHA 1URQB 3WUUA 3KYQA 1BGYG 1G1IA 3KPEA 3AEEC 1SQQD 3EFFK 4GT1A 2IZ1A 1KB9E 2IYPA 3EWKA 2FXOA 5KLVK 1MV8A 1JY2N 3HD7B 1HF9A 2YKPA 3AEAC 1P84I 2QJKB 3L70J 3A0HE 3SFEC 3P7KA 4ZKUA 1WT6A 1KMIZ 2QIWA 2K9YA 3TF5A 3PRJA 2KS1B 3CD6P 1AV1A 3D71A 1L4AC 3CXHD 3GW6A 3TGUG 2J59M 4WY4B 4GODA 2PGDA 3KZIH 3GHGA 1FOSF 2D2CC 1M1KQ 2WSEJ 2ZYAA 2FFDC 4D6TG 3KHUA 3H1HG 4GKGA 4N6JA 2FKWB 3H1KE 4BWNA 4BRYB 5CJ4A 2E43A 3WUTA 4JBZA 1HGVA 2YIUB 1ZRTD 1KC8Q 1KYOI 1PPJG 2E76B 4I7ZC 3H1LG 3BRVB 1NAFA 3T97A 1M56D 1VQMP 4DJGA 3O6QB 3H1IE 1BSNA 3SWYA 3MHVA 3SSUA 1YTZT 2XKMA 1E5WA 3A5TA 3PH0A 2JDIH 1LTTC 2IBZE 3UIAA 3CX5H 2YXRB 3L75G 3PHLA 2E74D 4EI2A 1ZW0A 2KZJA 2MKVA 1ZV8A 1CI6B 3II6A 1VPCA 1RF1B 3LIDA 5KAIE 2A06E 3L71D 1FOSE
chains in the Genus database with same CATH topology
1EZVI 3CXHI 1SQXJ 1NTKJ 1BE3J 1SQPJ 2IBZI 4PD4I 3CX5I 3BCCJ 1NTZJ 1NTMJ 1SQBJ 1L0NJ 1KB9I 1P84I 4U3FJ 3L72J 3H1JJ 3CWBJ 1BGYJ 3TGUJ 1L0LJ 1SQQJ 1BCCJ 3L70J 3L73J 1KYOI 5KLVJ 3H1LJ 3L71J 2FYUJ 3H1IJ 3L74J 3L75J 1NU1J 2BCCJ 1PP9J 3H1KJ 4D6TJ 1SQVJ 3H1HJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV I;  3CXH I;  1SQX J;  1NTK J;  1BE3 J;  1SQP J;  2IBZ I;  4PD4 I;  3CX5 I;  3BCC J;  1NTZ J;  1NTM J;  1SQB J;  1L0N J;  1KB9 I;  1P84 I;  4U3F J;  3L72 J;  3H1J J;  3CWB J;  1BGY J;  3TGU J;  1L0L J;  1SQQ J;  1BCC J;  3L70 J;  3L73 J;  1KYO I;  5KLV J;  3H1L J;  3L71 J;  2FYU J;  3H1I J;  3L74 J;  3L75 J;  1NU1 J;  2BCC J;  1PP9 J;  3H1K J;  4D6T J;  1SQV J;  3H1H J; 
#chains in the Genus database with same CATH topology
 2XDJ A;  2JKV A;  3FXE A;  2FYZ A;  2B87 B;  3M0D C;  3H1J J;  1KTM A;  2O1K A;  2V7Q H;  3USS A;  2QJP C;  3WU2 E;  1NTZ E;  5CCH A;  2N1T A;  5B66 E;  1KIL A;  1P84 E;  2C0W A;  4PD4 I;  1AJY A;  4WVZ A;  2AEM A;  2CPB A;  4PV1 C;  3KDP B;  3NXS A;  2J58 A;  3NMD A;  3B5N A;  4KHX A;  3RK2 B;  3D6Y A;  1VL2 A;  1K04 A;  2WPR A;  4ASV A;  1NH4 A;  1DEB A;  1NO4 A;  2B9B A;  3Q5R A;  3A7O A;  1JCD A;  1PFI A;  1NTK E;  2OYI C;  1HWT C;  1N7S A;  3HUS C;  2QE7 H;  5AVX B;  2W27 A;  1GD2 E;  3CWB E;  1BCC E;  1LTA C;  3WMM 0;  1D7M A;  3MD0 A;  1KN7 A;  1KYO E;  5K5G B;  2HFE D;  1SQB J;  1GW3 A;  1YTZ I;  1N73 B;  1ZN5 A;  5AW5 B;  1A02 F;  4JPZ B;  2XZR A;  1QX8 A;  3ITK A;  3CL3 D;  3AEG C;  2AXT E;  3ZDM A;  1LWU A;  1RE3 A;  2Y0C A;  1K73 Q;  1FZB A;  3G9R A;  2J5U A;  2KZI A;  3BCC J;  1EZV G;  3LW5 H;  1T3J A;  1PIX A;  3OAK A;  1PGQ A;  1URQ C;  2KXP B;  1GW4 A;  1PP9 J;  1EDI A;  1IFM A;  1SQV G;  1QGK B;  1VQ5 P;  1NYH A;  2JEE A;  2M3B A;  3N4X A;  3A0B E;  1CSB A;  1JY3 P;  3M91 A;  1IO4 A;  2N1T B;  1SFC C;  3HD7 C;  1PZQ A;  1L0L D;  2JJL A;  2OQQ A;  2FYU G;  2QJK C;  1BGY E;  4HKZ H;  2W6A A;  3GF3 A;  2O1J A;  1ZP0 C;  1L0N G;  2WSS H;  1MUU A;  1GL2 D;  1R5L A;  1CW5 A;  1NTM E;  4XFJ A;  3NFQ A;  3L36 A;  3V2P A;  1BDC A;  2Z5I A;  1GU4 A;  1LTB C;  1T8Z A;  3V5B A;  2P1J A;  2WPS A;  1IFN A;  4U3F G;  3PLN A;  2WPV B;  1VQP P;  1RQV A;  3CXH H;  4PJ0 E;  5APY A;  5CHX A;  2YIU C;  3TGU E;  2E76 C;  1SQX G;  2QA4 P;  2HPC B;  4IL6 X;  4D6T E;  5KKZ B;  2PRR A;  2OTL P;  3CX5 D;  1BDD A;  2AXC A;  1OX3 A;  2E5T A;  2ZT9 C;  2Q7C A;  5KJ7 A;  1PPJ E;  4LC1 A;  4CPG A;  1Y8A A;  1XTC C;  1SQP D;  3KQG A;  1T6A A;  5DJT B;  1KIL E;  2WSE H;  2A45 H;  3MZW B;  4HH2 A;  3L73 J;  1LTG C;  3L35 A;  3CPW O;  2E5Y A;  3H1K J;  4RES B;  3TK1 A;  3V2N A;  1LP1 A;  3AEF C;  4W7Y A;  1YI2 P;  2Q6Q A;  1W2B O;  3L75 E;  2C9L Y;  4C7N A;  4H13 D;  1OFC X;  1EXI A;  1AQ5 A;  3RBX A;  1M1J A;  2R5B A;  3L73 D;  5E79 H;  2BCC J;  2WZ7 A;  4HYT B;  1PL5 A;  1GL2 B;  2LXC B;  3H1K D;  1X0T A;  3D6Z A;  3CCJ P;  2XND H;  1JTH B;  4Y99 B;  1LT9 A;  2BEZ F;  2PP6 A;  4C7R A;  1LNQ A;  4L75 A;  1FZC A;  1NAY A;  1VQ9 P;  1UII A;  2KP8 A;  3TNU A;  4EDF A;  3GHG C;  1SQB K;  4K3A A;  1LT1 A;  3RK2 C;  2H43 A;  1RF0 A;  1JY2 O;  4ZKP A;  2BCC D;  2YNY A;  1FZA A;  4L74 A;  5AW6 B;  1BE3 D;  2GUS A;  2KOG A;  3FGA D;  2KS1 A;  2RH0 A;  1SQQ G;  2H88 C;  2N9B A;  2R32 A;  2CPS A;  5TIS H;  4WY4 A;  1L0L K;  3PP5 A;  4RKU J;  1NTZ J;  1NU1 E;  2LR2 A;  1RQU A;  1ZXG A;  2K3R A;  3JCU H;  1RY3 A;  3D70 A;  2H89 C;  3L74 D;  2IBZ I;  1GTW A;  5AVZ B;  2Y9Z A;  4Z1M H;  3KZI E;  5CCG D;  2FY8 A;  5APT A;  3SFD C;  2GM4 A;  1BSH A;  2IZ0 A;  4C7N B;  1NTK J;  2O01 J;  2P58 A;  1LTJ A;  4YTP C;  1Q82 Q;  1JNM A;  3CWB J;  1EZV E;  1BCC J;  4KJM A;  5BVZ A;  4GOF A;  1CI6 A;  4UB8 H;  1IFD A;  1RF1 A;  3R4Y A;  4W80 A;  2R3C A;  1GMJ A;  5CCH C;  2N1T C;  1E79 H;  1KIL C;  1LT9 B;  2YKQ A;  1IFJ A;  3IF4 A;  2IPP A;  1FZC B;  3BRT B;  3H32 A;  1NTM G;  1SQV E;  5KAF H;  3TNU B;  1J1D C;  1EDL A;  1SQP K;  3B5N C;  3BAS A;  3B71 A;  2B87 A;  1VF5 D;  4IL6 E;  1HJB A;  3MTU E;  1KQF B;  1H8A A;  2XU6 A;  4C46 A;  5KLV E;  2FYU E;  3VP9 A;  2HR3 A;  3P32 A;  1L0N E;  3L71 G;  1N7S C;  3L70 D;  4MN4 C;  4A7P A;  1N86 A;  1OW6 A;  1IFP A;  5AVV B;  3VYI A;  3FX0 A;  4N3Y B;  1BGY J;  1G1J A;  4YPC A;  1VDF A;  3U1C A;  5KKZ C;  4GIF A;  1GZL A;  1J1E B;  4U3F E;  3M9B A;  1K8A Q;  1LWU C;  1RE3 C;  2Q3I A;  1HVV A;  4OGQ D;  4JYC A;  1USE A;  1JMB A;  4UB6 H;  4H44 D;  3VMY A;  1SQX E;  4DZO A;  2M8R A;  1T3U A;  1LTJ B;  1N73 A;  2KLV A;  1YHQ P;  1KB9 H;  1HH0 A;  5APU A;  2C9N Y;  1X9V A;  2QJY C;  1NOH A;  2IYO A;  5AVW B;  4PD4 D;  3TGU J;  1FC2 C;  1ZR2 A;  4D6T J;  5AW2 B;  3H1H J;  3CLQ A;  3H32 B;  1VF5 B;  1AVO A;  2E75 D;  1PV3 A;  1ZR4 A;  5AW1 B;  2P7J A;  2CK3 H;  5CBN A;  4Y99 C;  5H2F E;  3U59 A;  1NTZ K;  3H1L J;  1S1C X;  1JB0 J;  1YIT P;  4HJG H;  1XTG B;  3K5B A;  3H1H D;  1M7L A;  1FDI A;  1IJD B;  3AE3 C;  3H1J D;  1USD A;  3L75 J;  3H1L D;  1AFO A;  1NU1 G;  1KZU B;  5B5E E;  2W8Z A;  1PGO A;  4HB1 A;  2O01 N;  1KQG B;  3HE5 A;  4OGQ B;  1NTK K;  1L0L G;  1RH5 B;  4N78 E;  4H44 B;  2OTJ P;  3RL0 C;  2IFN A;  1JY2 P;  1YQ4 C;  1EC5 A;  1SQQ E;  3L75 D;  3MUD A;  5KJ7 C;  2WSC J;  4NPD A;  3I5C A;  2E74 B;  1OZH A;  1L4A D;  4ZNC A;  2HPC A;  3S4R A;  2ZVO B;  1UIX A;  1FDM A;  3AEB C;  2D2C D;  2L91 A;  4L76 A;  4H0L C;  5GTI E;  1JMM A;  3L72 G;  2E75 B;  1DD3 A;  1SQB D;  3CXH E;  1M1J C;  4TT3 H;  3WU2 H;  3RK3 D;  3H25 A;  5B66 H;  1WRG A;  1P84 H;  5AW0 B;  1Y47 A;  1MFZ A;  1JM0 A;  3VTP C;  4ASW A;  1LT9 C;  1IK9 A;  3BCC D;  3PTZ A;  2I1K A;  1VQL P;  1ZRT E;  5KLV G;  4LGD E;  2WPQ A;  1VQ7 P;  1NGM B;  2IFM A;  1RF0 C;  3LIE A;  1KD1 Q;  1PP9 D;  1SQP G;  2KIK A;  5CBO A;  5M1B A;  1RE4 A;  1GL2 A;  1IZN B;  1YQ3 C;  1U57 A;  1JTH A;  2O01 H;  1FZG A;  2ZFC A;  4DCK A;  3EFG A;  5DJU B;  1Q81 Q;  3HE5 B;  4WY4 C;  1OVU A;  2QSI A;  2FXP A;  1IFI A;  1KYO H;  4I1L A;  3RBZ A;  1CZQ A;  4LLH A;  3L73 G;  2OGU A;  2SPZ A;  3GLM A;  1SQV J;  3P8C E;  1L4A B;  1Q2N A;  2AXT H;  1WMK A;  2WTY A;  1M90 Q;  2FYN B;  3L71 E;  1N2D C;  2W6J H;  1Y9B A;  1YJN P;  2RMZ A;  1OWA A;  1EXJ A;  2D2C B;  2H8P D;  3S9O A;  1S5L H;  4PV1 D;  3V2R A;  1VQN P;  1KB9 D;  2FYU J;  3V2Q A;  1U7J A;  2YMY A;  1SS1 A;  1DIP A;  1BE3 G;  3CC2 P;  3RK3 B;  3W68 A;  1L0N J;  4I7Z B;  3A0B H;  2KLU A;  2JO1 A;  1TU3 F;  2C0X A;  5AW9 B;  1S9K E;  1RF1 C;  1GU5 A;  2LXB A;  1AQT A;  1EZV I;  3F89 A;  2QVA A;  4WWI A;  2N9Y B;  1FZF A;  2FBW C;  1FJK A;  4OVN F;  3IN6 A;  4U3F J;  5KTB A;  2GUV A;  1S3J A;  2ZJS E;  1L0N D;  5L8R J;  1S4X A;  2Z5H A;  1FZE A;  3IFM A;  3AEC C;  2NPS A;  3H1I J;  2HOD A;  4PD4 H;  3AE7 C;  3L74 G;  2WSF J;  2YXQ B;  1SQX J;  2K37 A;  2NPS D;  3CX5 I;  3C1L A;  2JWD A;  3L4F A;  3BAT A;  4NPF X;  2KB7 P;  5TJH A;  5CMZ A;  4PJ0 H;  3TYY A;  2W90 A;  1QLE D;  1NJI Q;  3H1I D;  1ZOY C;  2H7H A;  1SQX D;  2QJP B;  2K9J B;  3MGN A;  1PGJ A;  2IBZ D;  4EOT A;  1DH3 A;  3I56 P;  4O9B A;  2POH A;  4RJT A;  1N8R Q;  1SFC D;  3M9Q A;  4DOJ A;  4H44 C;  4PV1 B;  1Q90 D;  3JSV C;  3V4W A;  4AQR D;  4GDO A;  2WVR A;  4RO0 A;  4AYC A;  1X22 A;  1HTL C;  2A06 D;  2E74 C;  5APQ A;  3AE6 C;  1L0L E;  1N73 C;  2QEX P;  1YJW P;  3U1A A;  5CCG A;  3Q2Y A;  3HUS B;  3F5H A;  1NTZ D;  2G8Y A;  3L70 G;  2YO3 A;  1KOR A;  3VOP A;  1P84 D;  1N7L A;  1OXZ A;  4H13 B;  4IOI H;  1VQ4 P;  5BU8 B;  3AE9 C;  5APS A;  1Q86 Q;  2R5D A;  2NPS B;  2HOD B;  1SQQ J;  1H0T B;  2WSC H;  1RHZ B;  5AVU B;  3L72 E;  3A3Y B;  1VQO P;  1Z56 A;  2ZT9 D;  4UB6 E;  2A45 G;  2OYH A;  1NTK D;  3AE4 C;  5APW A;  4N78 D;  1SQV K;  3OW2 O;  1QEX A;  3C8V A;  3EQ2 A;  3CWB D;  2MJZ A;  3CX5 E;  3G4S P;  1FS0 E;  3HRN A;  1BCC D;  3G3Z A;  2QRX A;  2BEQ D;  1KYO D;  3SWK A;  1VQK P;  1FJP A;  1SFC B;  2FYU K;  3G71 P;  2KI7 B;  2OTK E;  1EDJ A;  1S72 P;  1SQP E;  3R2P A;  4NPE A;  5AVS B;  1L0N K;  2B89 A;  2Z4E A;  3CCV P;  1S5L X;  4JQ0 D;  2PFX A;  2Q1K A;  1QVG O;  3MUD C;  3Q1M A;  3CCU P;  2AEJ A;  5GTH H;  2B88 A;  3AE5 C;  4IFM A;  2FYN C;  1T2K D;  2JWA A;  4L73 A;  2WIT A;  1GDT A;  3L73 E;  3RK2 D;  3VP8 A;  1NTM J;  1H88 A;  1A02 J;  1FE6 A;  1SQX K;  3H1J G;  3AE1 C;  3G6E P;  3RK3 C;  5BU5 A;  1EDK A;  1BGY D;  2AEF A;  3NTN A;  3O8Z A;  2ZYD A;  2P67 A;  1MZ9 A;  1JY3 N;  3CXH I;  2W83 C;  2BCC E;  3VMX A;  2ZT9 B;  2WT7 A;  1NTM D;  1BE3 E;  4Y28 J;  3Q5P A;  3L71 J;  2R44 A;  2M5A B;  3A0H H;  4U7J A;  5KLI B;  3FXD A;  2OYH B;  2Q9I A;  4IL6 H;  2P2U A;  1FU1 A;  3FWN A;  2IDB A;  1RE4 C;  1GL2 C;  4AUW A;  5AW8 B;  4I2L C;  3V6I A;  5AW3 B;  3WUV A;  1NKZ B;  1K9M Q;  1AVY A;  3W67 A;  3P8C D;  3H6P A;  3TGU D;  1KQS O;  4R4M A;  2A45 I;  2DW3 A;  1YBK A;  1LTI C;  2Y0E A;  2YMK A;  4D6T D;  2OAR A;  1VQ8 P;  3L74 E;  1K05 A;  2Y0D A;  1SQB G;  3HTK A;  2KYV A;  2Y9Y A;  2FXM A;  4QMA A;  3MIW A;  1PPJ D;  2UWJ E;  1L2P A;  5APV A;  5CCH D;  2N1T D;  2NRG A;  1KIL D;  4ZMD A;  3BCC G;  3GHG B;  3CMA P;  3CCM P;  2WSF H;  1S9K D;  2LKM A;  2QG4 A;  3B5N D;  2ITA A;  5AW7 B;  1PP9 G;  4W7Z A;  3CI9 A;  2YKO A;  1SQQ K;  2VRS A;  4XE5 B;  2K88 A;  1L4A A;  3FWL A;  4IFF A;  3RGU A;  2QM7 A;  2ZYG A;  3T97 B;  1KFN A;  2KUB A;  4EYY Q;  5KAI H;  1DEE G;  2FFD A;  1M57 D;  1N7S D;  3CCQ P;  2WT7 B;  4H13 C;  2E42 A;  4JF7 A;  3GF7 A;  3SWF A;  3CCS P;  3CCE P;  3TSI A;  4WB4 A;  5H2F H;  3A2A A;  4R4L A;  2NPS C;  1NU1 J;  2M0B A;  1NHL A;  2WMM A;  2ZXE B;  3L70 E;  5AVR B;  4OH8 B;  1YYC A;  1J2J B;  1S5L E;  3CC7 P;  1L0L J;  4M3L A;  1FZC C;  2KNC A;  2WQY C;  3I55 P;  1MKM A;  1NU1 D;  5B5E H;  1HBW A;  3HTK B;  2RN0 A;  3MP7 B;  4DT0 A;  1KIL B;  3QH9 A;  1OVR A;  5C39 A;  1NTM K;  4JYB A;  4I6M C;  2R3S A;  4WBA A;  5AVY B;  4XA4 A;  3HE4 A;  2I1J A;  1EQ7 A;  4IFD K;  3RL0 g;  2WWW A;  2Q3E A;  1OIP A;  1J1D B;  3B5N B;  2K1A A;  3M0D A;  3L72 J;  3OA7 A;  4KT0 J;  4PD4 E;  2K9J A;  5E79 E;  1JUN A;  1R8E A;  1HUC A;  3H1K G;  1FBM A;  2L5G B;  1SP4 A;  1J1E C;  1MFT A;  1SLQ A;  1EZV D;  5CCG C;  1KV4 A;  1GK6 A;  1N7S B;  5GTI H;  3L37 A;  4GOE A;  3VMA A;  3Q3D A;  3E1R A;  2JP3 A;  3L72 D;  2FFD B;  1YJ9 P;  1ZLL A;  5KLV J;  2Q5U A;  3H1I G;  1X79 B;  2BCC G;  1NWQ A;  1M8O B;  1G2C A;  3VN0 A;  1SQP J;  3M0A A;  2M3E A;  2KK7 A;  1SQV D;  1LGH B;  2NZ2 A;  2HLO A;  2JR8 A;  2IBZ G;  1LTJ C;  1JCC A;  3H1H E;  3CCL P;  2OYI A;  2V4H A;  1LWU B;  2KSE A;  3HUS A;  2HYN A;  5TIS E;  3H1J E;  5KLV D;  3B8E B;  3RL0 D;  1LJ2 A;  1PGP A;  1X8Y A;  2FYU D;  2V7Q J;  1OW8 A;  3H1L E;  4BXL A;  4TLF A;  5KLI C;  2OYH C;  2P10 A;  1DD4 A;  5KJ7 D;  2KNC B;  3ABV C;  1Q7Y Q;  1DX7 A;  2W6B A;  1VF5 C;  2ZXX A;  1U7M A;  3JCU E;  2A06 G;  1SVF A;  3N7N A;  2BAS A;  2OYO A;  2YO2 A;  1H0T A;  2QJY B;  1H89 A;  3IAO A;  3KXD A;  1OW7 A;  3P8M C;  1NTZ G;  1KB9 I;  1JEK A;  2KSJ A;  4H0L D;  1IC2 A;  3HE4 B;  1URQ A;  4U3F D;  3QWO C;  3Q5S A;  3AE8 C;  3AE2 C;  1URQ D;  3CC4 P;  1FAV A;  2IX7 C;  1QL1 A;  1BE3 J;  1S2E A;  2I8D A;  5AVQ B;  1T2K C;  5CJ0 A;  4YXW H;  1NKN A;  3OJA B;  1KFM A;  1SFC A;  3HD7 A;  4UB8 E;  1IK7 A;  1FDO A;  1SQB E;  3M9H A;  4OGQ C;  5EFW B;  3GG2 A;  3CME P;  3HD7 D;  5AW4 B;  3V4Q A;  1AA0 A;  3RK3 E;  1NTK G;  3S1K A;  1JO5 A;  3TDK A;  3VMZ A;  2RKL A;  1VQ6 P;  3E1I A;  1W5C E;  1NU1 K;  3PJS K;  5KAF E;  4EIJ A;  3AED C;  3CWB G;  4B86 A;  3BCC E;  1BCC G;  1KQL A;  3LW5 J;  1G2C B;  1ZME C;  3L74 J;  1QVF O;  1W2E A;  2ZAE B;  4YXD C;  3M06 A;  2OYI B;  4WY4 D;  1JOC A;  3IR9 A;  2QM8 A;  1GK4 A;  1PP9 E;  3RL0 B;  2XNX A;  2ZVN B;  3JC2 2;  3E7K A;  1YIJ P;  1OVV A;  2HG5 D;  4BRY A;  3GMA A;  2GA1 A;  2XV5 A;  4K35 A;  2E75 C;  5APX A;  5GTH E;  1OMI A;  2E76 D;  3O6Q A;  1HJ0 A;  2O3J A;  1LTS C;  2PAJ A;  5AVT B;  1LP1 B;  4OWF A;  1JY3 O;  3C9I A;  3B4S A;  4H0L B;  1R5S A;  1HGZ A;  1NVO A;  2G3A A;  3CCR P;  2M5A A;  1M1J B;  1QL2 A;  3BVH A;  1URQ B;  3WUU A;  3KYQ A;  1BGY G;  1G1I A;  3KPE A;  3AEE C;  1SQQ D;  3EFF K;  4GT1 A;  2IZ1 A;  1KB9 E;  2IYP A;  3EWK A;  2FXO A;  5KLV K;  1MV8 A;  1JY2 N;  3HD7 B;  1HF9 A;  2YKP A;  3AEA C;  1P84 I;  2QJK B;  3L70 J;  3A0H E;  3SFE C;  3P7K A;  4ZKU A;  1WT6 A;  1KMI Z;  2QIW A;  2K9Y A;  3TF5 A;  3PRJ A;  2KS1 B;  3CD6 P;  1AV1 A;  3D71 A;  1L4A C;  3CXH D;  3GW6 A;  3TGU G;  2J59 M;  4WY4 B;  4GOD A;  2PGD A;  3KZI H;  3GHG A;  1FOS F;  2D2C C;  1M1K Q;  2WSE J;  2ZYA A;  2FFD C;  4D6T G;  3KHU A;  3H1H G;  4GKG A;  4N6J A;  2FKW B;  3H1K E;  4BWN A;  4BRY B;  5CJ4 A;  2E43 A;  3WUT A;  4JBZ A;  1HGV A;  2YIU B;  1ZRT D;  1KC8 Q;  1KYO I;  1PPJ G;  2E76 B;  4I7Z C;  3H1L G;  3BRV B;  1NAF A;  3T97 A;  1M56 D;  1VQM P;  4DJG A;  3O6Q B;  3H1I E;  1BSN A;  3SWY A;  3MHV A;  3SSU A;  1YTZ T;  2XKM A;  1E5W A;  3A5T A;  3PH0 A;  2JDI H;  1LTT C;  2IBZ E;  3UIA A;  3CX5 H;  2YXR B;  3L75 G;  3PHL A;  2E74 D;  4EI2 A;  1ZW0 A;  2KZJ A;  2MKV A;  1ZV8 A;  1CI6 B;  3II6 A;  1VPC A;  1RF1 B;  3LID A;  5KAI E;  2A06 E;  3L71 D;  1FOS E; 
#chains in the Genus database with same CATH homology
 1EZV I;  3CXH I;  1SQX J;  1NTK J;  1BE3 J;  1SQP J;  2IBZ I;  4PD4 I;  3CX5 I;  3BCC J;  1NTZ J;  1NTM J;  1SQB J;  1L0N J;  1KB9 I;  1P84 I;  4U3F J;  3L72 J;  3H1J J;  3CWB J;  1BGY J;  3TGU J;  1L0L J;  1SQQ J;  1BCC J;  3L70 J;  3L73 J;  1KYO I;  5KLV J;  3H1L J;  3L71 J;  2FYU J;  3H1I J;  3L74 J;  3L75 J;  1NU1 J;  2BCC J;  1PP9 J;  3H1K J;  4D6T J;  1SQV J;  3H1H J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...