4PD4I

Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
57
structure length
57
Chain Sequence
SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Structural analysis of atovaquone-inhibited cytochrome bc1 complex reveals the molecular basis of antimalarial drug action.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/inhibitor
total genus 21
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4pd4I00
1NTZJ 1PP9J 1P84I 1KYOI 1L0NJ 1SQBJ 3CXHI 3L74J 1L0LJ 5KLVJ 4D6TJ 3TGUJ 3L71J 2BCCJ 3L73J 1BCCJ 3H1JJ 3L75J 1EZVI 2IBZI 1BE3J 3H1KJ 2FYUJ 1SQVJ 1SQQJ 1NU1J 3H1LJ 3CWBJ 3H1HJ 1KB9I 4PD4I 3BCCJ 3L72J 1NTKJ 3L70J 1SQXJ 1NTMJ 3H1IJ 1SQPJ 4U3FJ 1BGYJ 3CX5I
chains in the Genus database with same CATH superfamily
1MV8A 5AVVB 1JMMA 3L72G 3CCSP 1NVOA 1EZVE 2KUBA 3RK2B 5GTHH 2QJYB 1N8RQ 4JF7A 4KJMA 5AVRB 1P84H 4AYCA 3HUSA 3U1CA 2J5UA 2JP3A 2Y0DA 3MUDA 1KILE 3TGUD 3CXHI 4B86A 2O3JA 2OGUA 1NYHA 3CCJP 3L75D 1IFIA 2JJLA 2ZAEB 4DCKA 5GTIH 3CMEP 5CJ0A 1NTME 2E75C 3V2NA 3L75G 2FYNC 2J58A 1FZCC 1VQ7P 3TNUB 4HB1A 4R4MA 2IBZE 1RHZB 2YKQA 3FWLA 4XA4A 3M91A 1NTKE 2A06G 4ZKPA 2YIUB 3FXEA 1URQB 1LT1A 3Q5SA 1PP9J 3L74E 3F89A 1Y8AA 3M9BA 1KN7A 3VMAA 2LKMA 1KZUB 5CCHC 1KB9H 4HJGH 5APXA 1SQQD 3M0AA 5AW1B 2I8DA 1EDIA 4H44B 3TF5A 3M06A 2HLOA 4EI2A 1RE4C 3CX5E 1EZVG 3RK3D 3AE7C 5AW0B 1P84I 2W27A 3C9IA 4D6TJ 5AVSB 4HH2A 2WSCJ 3B5ND 1SQVE 1K04A 1S9KE 3L72J 2WITA 1NTZD 1NU1K 1DEEG 1AV1A 1NTMG 3H1KD 1FZFA 1Q90D 5APSA 3EFGA 4QMAA 4NPFX 2IBZG 1PGOA 2IDBA 5KLVD 5AW9B 1VF5C 1L0LE 1RF1A 2D2CB 1NTKG 2E74C 4UB8H 2Q7CA 2HFED 1GW4A 1IK7A 3TDKA 3L74G 4YXWH 2XNDH 1KB9I 5KLVG 2BASA 4YTPC 3KXDA 1FE6A 1P84D 3FXDA 2NZ2A 2QJKC 3W68A 3CCRP 5KTBA 3CWBE 1SVFA 1AA0A 1MZ9A 5E79H 3Q5PA 3RL0D 2NPSA 1GD2E 1QLED 1SQBE 3PHLA 3WU2E 1SQVG 2P58A 5KJ7D 3HTKB 3I5CA 3L73E 5KAFH 3A3YB 3AE1C 1Z56A 1LWUA 1U7MA 5BU8B 1KORA 2XDJA 4TT3H 2CPBA 2KLVA 3MHVA 4IL6H 1L4AA 1MKMA 3V4WA 1MFZA 1PFIA 1VQMP 3FX0A 1M8OB 1GU4A 2QM8A 1JY2P 2K1AA 4I7ZC 1DD3A 1YTZT 3F5HA 3S4RA 1FDOA 1GL2B 5AW5B 1L0LG 1SQQK 4TLFA 1NTMJ 1YBKA 1KQSO 3V5BA 1OXZA 5AVZB 3HUSC 4H13C 3PRJA 1H89A 2ZT9C 3G3ZA 1NGMB 2I1KA 3MUDC 3KYQA 1NAYA 3P8CD 1NTKJ 3ABVC 3H1IE 2OYHA 2K37A 1FJPA 2RKLA 1M1JB 4A7PA 3CWBG 3L74J 3VTPC 2YMYA 1NTZK 1N7SA 4PD4H 1JEKA 1N73A 3GF7A 1SQBG 2IFNA 3JCUE 3SSUA 4EDFA 2J59M 3L73G 2FYNB 2HYNA 1JY3O 5APUA 4PV1B 1OMIA 3P7KA 1EDLA 5AVXB 2ITAA 2WPVB 1QL2A 5KLVK 2R32A 2UWJE 1PV3A 1LGHB 3H1HJ 2POHA 3OA7A 4NPEA 1Y47A 2ZYDA 3D71A 3H25A 2JKVA 4CPGA 1RF0C 2IYPA 4JYCA 4N6JA 1FZCA 3LW5H 1SQVK 4C7NA 1S3JA 5KJ7A 3D6YA 1LNQA 3KPEA 1S1CX 3H1IG 1BE3D 2JWDA 2AEMA 4L76A 1RQUA 4PD4I 1PGJA 3V2RA 3GHGB 5CCHA 1K05A 1NH4A 5B66H 2W90A 5AW6B 2CPSA 2AEFA 2ZFCA 3JSVC 3AE5C 1JM0A 1FBMA 4KHXA 3VMZA 2M3BA 2KZIA 3CWBJ 1RF1C 3BCCD 1Q7YQ 2Z5IA 2P2UA 1VF5B 3N4XA 3OJAB 1SQBJ 3PLNA 1E5WA 1G2CA 3CMAP 2G8YA 3L73J 1S5LH 3KZIE 3SFEC 1VDFA 1ZW0A 2N9BA 5AW8B 1J2JB 2N1TD 1WT6A 2B9BA 2KXPB 2PP6A 4EYYQ 2OTLP 4H0LC 3A0HE 4D6TE 1Q82Q 3WUUA 1UIIA 1W2EA 1PGQA 2IZ0A 2ZVOB 4PD4D 5APTA 3AE3C 3T97A 1SLQA 3H32B 1VPCA 3G9RA 3RK2D 1AQ5A 1NAFA 1DIPA 1FOSE 1OVVA 5AVQB 1ZXGA 1L4AC 3FGAD 3IAOA 2KS1B 2O01H 2ZJSE 2H89C 1PP9D 1ZMEC 1A02J 1NKZB 5CCGA 5AW4B 1OWAA 4JPZB 3RK3C 1OVRA 2R44A 1JY3N 1AVYA 2O1KA 1EXIA 2K9JB 3P8MC 2O1JA 1JTHA 1JO5A 4OVNF 3A0BE 1SQXE 3B5NC 2P1JA 1YJNP 1XTGB 3U59A 2QJPB 1Q86Q 3HUSB 3N7NA 2C0WA 2OYHC 3H1JE 1FDIA 3BASA 1KQFB 1IFMA 1URQD 2B87A 1HVVA 3L72D 4Z1MH 5KKZC 4D6TG 1SQPE 1N73C 1ZN5A 2OYIB 1PZQA 5K5GB 5L8RJ 2P10A 4NPDA 4H44D 1NO4A 1HF9A 1EZVI 3VP9A 2C9LY 4W80A 5TISE 3CX5H 1FAVA 1T2KD 3HD7A 1H0TA 1M90Q 1QGKB 3LIDA 3GF3A 1KYOE 2AXTE 1ZR2A 2R3CA 2PAJA 1SFCA 2HPCA 2Q1KA 3AEFC 3W67A 2PFXA 2QG4A 2YO2A 4ZKUA 4GIFA 1YHQP 2B88A 1IZNB 3AECC 5KAIE 1RH5B 2QVAA 2YKPA 1ZP0C 2A06D 3RL0C 1DH3A 4GDOA 1SQXG 2WT7A 1M1KQ 1L2PA 1VQLP 2IBZI 3H1LE 5KJ7C 4OWFA 2H7HA 1M56D 3O8ZA 4GOEA 2D2CD 3M9QA 3EQ2A 3H1JG 1L0NE 1OW7A 2WSEJ 4I1LA 1J1EB 4PJ0H 1SQPG 1EZVD 5DJTB 1USEA 1S72P 1J1DC 3V2PA 1FU1A 3VMXA 1Y9BA 1X8YA 2K88A 2C9NY 4K35A 4N78E 3VYIA 2FFDC 1RF0A 5APYA 3CX5I 3L36A 2Q3IA 1KILD 4WB4A 5CHXA 2KYVA 2N9YB 5M1BA 3TSIA 2GUSA 1OVUA 2KSJA 2ZVNB 1JY2O 3VOPA 3OW2O 1ZRTE 3H1HE 3TNUA 4JBZA 1NTMD 1OW8A 3WU2H 4R4LA 4WBAA 1X22A 1FZGA 1MUUA 1JCCA 5BVZA 3ZDMA 2IBZD 4M3LA 2E5TA 1OW6A 1NKNA 1NTKD 2Q3EA 4WY4A 3IN6A 4DZOA 3CC7P 2QRXA 1BDDA 2P67A 3H1LG 3L74D 2Y0EA 3D70A 4OGQB 2W6JH 3R4YA 1BCCE 1GL2D 2NPSB 1L0NG 2L5GB 1LP1A 4L73A 2H88C 1CW5A 1DX7A 4EOTA 1PL5A 1SQXJ 3CX5D 5CMZA 1LWUB 2OTJP 1GK4A 3NXSA 4Y28J 1YI2P 1RQVA 2BCCE 2W83C 3CCEP 1KILB 5CCGC 3H1JJ 2KB7P 1SQVD 1IO4A 1KB9E 1L4AB 1WRGA 2E76B 2XU6A 1S9KD 1EC5A 2H43A 2Y0CA 5AVTB 4IFFA 3NMDA 5APVA 1SQPJ 3B4SA 2JR8A 3H1HG 4Y99B 1JUNA 3JCUH 2KSEA 1LTJB 4YPCA 1H88A 3G6EP 2YMKA 1Q81Q 2Y9YA 2WQYC 5AVYB 4PV1D 3K5BA 1HTLC 2JEEA 1JB0J 2K9YA 2KK7A 1L0LD 4JQ0D 1LTTC 2LR2A 3PP5A 5AW2B 5KKZB 1N2DC 3BATA 1N7SB 4XE5B 4W7YA 4EIJA 2WPRA 1N73B 1BCCG 3AEEC 2WSFJ 2QEXP 3PH0A 2Y9ZA 1K9MQ 1G1JA 3L71E 3HD7C 1M57D 2IFMA 3B5NA 3IF4A 2FYUE 3CWBD 1KTMA 1IFNA 1SFCC 3H1LJ 5H2FE 2BCCG 4U3FE 2MKVA 3M0DA 1BGYE 5AVWB 4OH8B 1SQBD 4RO0A 2N1TC 3AE8C 1GDTA 2R3SA 1L0NJ 1NTMK 3L73D 3GMAA 3AE6C 2W8ZA 4K3AA 3TYYA 3V4QA 1X0TA 2E75B 2M3EA 1GK6A 2YO3A 5E79E 1FZCB 2YXQB 1NTKK 3IFMA 1GU5A 1HBWA 4C7NB 1EQ7A 3JC22 3RK2C 1E79H 3S1KA 5CBOA 1T3JA 1IFPA 1VF5D 2WSEH 2KZJA 3KZIH 3O6QB 3PJSK 1HGZA 4IL6E 3MGNA 2WPSA 1J1DB 1A02F 2I1JA 2QA4P 2CK3H 1W5CE 3L71G 4L75A 1BDCA 3H1ID 2NRGA 3A0HH 3CCLP 2FYUG 2Q5UA 1PIXA 2YNYA 2WSCH 1S4XA 2ZYGA 1PPJE 3P32A 3TK1A 1EDKA 3H6PA 1BCCJ 1BGYG 3BRTB 1G2CB 4LGDE 4ZNCA 3L70E 2YIUC 1URQC 1FC2C 1IK9A 1KD1Q 4WY4C 2QIWA 2BCCJ 4ZMDA 2FFDA 3G4SP 1AVOA 3HE4B 1L0LK 2A45G 5C39A 4H44C 5BU5A 2Q9IA 2LXCB 1LT9A 3SWYA 1D7MA 3WUTA 3T97B 1VQOP 5AW7B 3KDPB 2E74B 1HWTC 4U7JA 5AVUB 3A0BH 3V6IA 1NHLA 1SS1A 1KV4A 2RN0A 3L35A 2GA1A 4BRYA 3CCQP 1IFJA 3E1IA 2K3RA 1QEXA 4MN4C 4GKGA 2ZXXA 1N86A 3Q1MA 2QJKB 1LTGC 3SWKA 1SQBK 2FYZA 1NU1E 4C7RA 1HJ0A 2MJZA 1JY3P 2M8RA 2WVRA 3CL3D 1PPJG 3GLMA 1VQNP 3IR9A 1MFTA 1T3UA 3VMYA 1VQ6P 3BRVB 4BWNA 3I56P 3CLQA 3L71J 3L70G 1T6AA 5TISH 2B89A 2FYUJ 3RBZA 5B5EE 1KYOH 4I6MC 1OX3A 2AXTH 1AFOA 2PRRA 5CJ4A 2B87B 4U3FJ 3CC4P 1BGYJ 2WZ7A 5EFWB 1QL1A 2VRSA 3V2QA 2AXCA 3FWNA 4I7ZB 2WSFH 5KAIH 1VQ4P 4LC1A 3Q2YA 2KNCA 3HD7B 3TGUE 4D6TD 1FZBA 4H13B 3M0DC 2IZ1A 3L75E 1U57A 2ZT9B 1YQ4C 3H32A 1SFCB 1BE3J 2JDIH 1CSBA 3RL0g 5APWA 3AE4C 1LTBC 1NU1G 2E5YA 3HE5A 1FOSF 1CI6A 3L37A 2M0BA 1YITP 1GL2C 2WT7B 2JWAA 2M5AA 3MP7B 2O01N 4GODA 3Q5RA 1KYOI 2K9JA 2WSSH 3S9OA 1X79B 1SQQE 3G71P 3EFFK 2N1TA 3L4FA 1VL2A 4JYBA 1SQXD 3SFDC 2R5BA 3L70J 2IX7C 1M1JC 1BSNA 3RK3E 3CXHE 2HODA 3A5TA 1EXJA 2WWWA 1VQ5P 3H1JD 3A2AA 4HKZH 1VQKP 2OYIA 1IJDB 3TGUG 3ITKA 4H0LD 4UB6E 1SQPD 3MZWB 4OGQD 1NTZE 1LJ2A 1X9VA 4AUWA 2NPSD 3AEBC 2HG5D 4PV1C 3H1KE 2E42A 1AJYA 4AQRD 1KYOD 1LTSC 2OARA 4RJTA 3UIAA 5KLVE 4WY4B 2OTKE 1L4AD 2E76D 1LT9C 1NU1J 1RF1B 5KLIC 5GTHE 1NJIQ 3LW5J 4WWIA 1P84E 3CXHD 1LP1B 1SQQG 3NFQA 4L74A 3CD6P 4DOJA 1GTWA 1K73Q 1YQ3C 3B71A 1URQA 3H1LD 1CZQA 1G1IA 5AW3B 2C0XA 2SPZA 1YJWP 5GTIE 1SP4A 2WMMA 3GHGC 1L0ND 4I2LC 4H0LB 3VN0A 1YJ9P 1KQGB 2IPPA 1N7SD 1YYCA 1NTZG 1FZEA 1NOHA 1R5SA 4N78D 2Q6QA 3H1KG 4RKUJ 3AE2C 2L91A 3OAKA 3R2PA 3D6ZA 3TGUJ 2FXOA 1QVFO 3E7KA 5H2FH 3L75J 4PJ0E 1R5LA 1ZRTD 3H1HD 4DJGA 2ZXEB 1RE3A 1QX8A 1VQ9P 5TJHA 3AEAC 1SQXK 3II6A 4HYTB 1IC2A 3RK3B 1Q2NA 1ZOYC 1XTCC 2E75D 1JOCA 4WVZA 2WTYA 4N3YB 3P8CE 4IL6X 2A45H 3B5NB 3USSA 2GUVA 4IOIH 1PGPA 1RY3A 2HR3A 3M9HA 1SQPK 2QSIA 4IFDK 1BCCD 2OYHB 2LXBA 3C1LA 1UIXA 1N7LA 1SQQJ 1JNMA 2W6AA 1KILA 5CCHD 2O01J 2QM7A 1VQPP 4LLHA 2BCCD 5CBNA 2RMZA 2KI7B 1S2EA 1KB9D 1R8EA 4UB8E 3QWOC 2V7QJ 3HTKA 3SWFA 2FXPA 1FDMA 1NTZJ 4DT0A 1LTJA 4W7ZA 1LTAC 2QJPC 3KHUA 1K8AQ 1KFMA 3H1KJ 1HH0A 3RGUA 2KLUA 2OYIC 1JY2N 1T8ZA 2E43A 2A45I 3RL0B 1JMBA 1GL2A 5KLVJ 1IFDA 1L0NK 1BE3E 4GT1A 5KAFE 3CC2P 2XKMA 2QJYC 3MD0A 3I55P 2FXMA 1ZLLA 4GOFA 1JCDA 1OZHA 2E74D 4KT0J 3EWKA 3L71D 3CI9A 3VP8A 1USDA 2OYOA 3MTUE 2FYUD 3GG2A 1AQTA 1M1JA 1SQVJ 3BCCE 2XZRA 3AEGC 2DW3A 4U3FD 2FFDB 1BGYD 2QE7H 2RH0A 1HGVA 5CCGD 2FBWC 2FKWB 1LTIC 3RBXA 2Z4EA 4BXLA 1NWQA 1LT9B 4U3FG 1HJBA 2G3AA 4IFMA 5KLIB 2FY8A 2OQQA 2H8PD 1OFCX 4C46A 2ZYAA 4BRYB 1L0LJ 1J1EC 2P7JA 5B5EH 3Q3DA 3AE9C 4PD4E 3HRNA 3O6QA 2IYOA 2BEZF 1S5LX 1BE3G 2BEQD 1T2KC 1DEBA 3CCVP 2Z5HA 1VQ8P 1RE4A 3C8VA 4YXDC 3QH9A 3NTNA 3MIWA 2AEJA 3AEDC 2WPQA 3CCUP 3HD7D 1PP9E 4H13D 2JO1A 3PTZA 2ZT9D 1SFCD 3BCCG 1PPJD 3WMM0 1RE3C 1ZV8A 2KOGA 3GHGA 2YXRB 3L70D 2GM4A 1HUCA 3LIEA 1OIPA 2XV5A 2V4HA 1JTHB 3HE4A 4OGQC 1KFNA 2D2CC 1YIJP 2NPSC 1U7JA 1GW3A 2KNCB 3A7OA 3L72E 4ASWA 1M7LA 4RESB 2YKOA 1GMJA 1LWUC 1H8AA 5APQA 3CCMP 5B66E 1GZLA 1TU3F 1EDJA 1KILC 3HE5B 3U1AA 2E76C 1CI6B 3GW6A 3CXHH 3CPWO 2FYUK 2PGDA 2XNXA 3H1IJ 1ZR4A 3WUVA 1KMIZ 2M5AB 1W2BO 1H0TB 4Y99C 3B8EB 1KQLA 1FZAA 2V7QH 4ASVA 1NU1D 1PP9G 1LTJC 4UB6H 1FS0E 1S5LE 2HPCB 1BSHA 2KP8A 3BVHA 2KIKA 2R5DA 2N1TB 3E1RA 2A06E 1WMKA 2KS1A 1FJKA 4O9BA 2HODB 1KC8Q 2W6BA 1N7SC 1YTZI 3BCCJ 1QVGO 4WY4D 1DD4A 5DJUB 3KQGA 4XFJA
chains in the Genus database with same CATH topology
1NTZJ 1PP9J 1P84I 1KYOI 1L0NJ 1SQBJ 3CXHI 3L74J 1L0LJ 5KLVJ 4D6TJ 3TGUJ 3L71J 2BCCJ 3L73J 1BCCJ 3H1JJ 3L75J 1EZVI 2IBZI 1BE3J 3H1KJ 2FYUJ 1SQVJ 1SQQJ 1NU1J 3H1LJ 3CWBJ 3H1HJ 1KB9I 4PD4I 3BCCJ 3L72J 1NTKJ 3L70J 1SQXJ 1NTMJ 3H1IJ 1SQPJ 4U3FJ 1BGYJ 3CX5I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  1PP9 J;  1P84 I;  1KYO I;  1L0N J;  1SQB J;  3CXH I;  3L74 J;  1L0L J;  5KLV J;  4D6T J;  3TGU J;  3L71 J;  2BCC J;  3L73 J;  1BCC J;  3H1J J;  3L75 J;  1EZV I;  2IBZ I;  1BE3 J;  3H1K J;  2FYU J;  1SQV J;  1SQQ J;  1NU1 J;  3H1L J;  3CWB J;  3H1H J;  1KB9 I;  4PD4 I;  3BCC J;  3L72 J;  1NTK J;  3L70 J;  1SQX J;  1NTM J;  3H1I J;  1SQP J;  4U3F J;  1BGY J;  3CX5 I; 
#chains in the Genus database with same CATH topology
 1MV8 A;  5AVV B;  1JMM A;  3L72 G;  3CCS P;  1NVO A;  1EZV E;  2KUB A;  3RK2 B;  5GTH H;  2QJY B;  1N8R Q;  4JF7 A;  4KJM A;  5AVR B;  1P84 H;  4AYC A;  3HUS A;  3U1C A;  2J5U A;  2JP3 A;  2Y0D A;  3MUD A;  1KIL E;  3TGU D;  3CXH I;  4B86 A;  2O3J A;  2OGU A;  1NYH A;  3CCJ P;  3L75 D;  1IFI A;  2JJL A;  2ZAE B;  4DCK A;  5GTI H;  3CME P;  5CJ0 A;  1NTM E;  2E75 C;  3V2N A;  3L75 G;  2FYN C;  2J58 A;  1FZC C;  1VQ7 P;  3TNU B;  4HB1 A;  4R4M A;  2IBZ E;  1RHZ B;  2YKQ A;  3FWL A;  4XA4 A;  3M91 A;  1NTK E;  2A06 G;  4ZKP A;  2YIU B;  3FXE A;  1URQ B;  1LT1 A;  3Q5S A;  1PP9 J;  3L74 E;  3F89 A;  1Y8A A;  3M9B A;  1KN7 A;  3VMA A;  2LKM A;  1KZU B;  5CCH C;  1KB9 H;  4HJG H;  5APX A;  1SQQ D;  3M0A A;  5AW1 B;  2I8D A;  1EDI A;  4H44 B;  3TF5 A;  3M06 A;  2HLO A;  4EI2 A;  1RE4 C;  3CX5 E;  1EZV G;  3RK3 D;  3AE7 C;  5AW0 B;  1P84 I;  2W27 A;  3C9I A;  4D6T J;  5AVS B;  4HH2 A;  2WSC J;  3B5N D;  1SQV E;  1K04 A;  1S9K E;  3L72 J;  2WIT A;  1NTZ D;  1NU1 K;  1DEE G;  1AV1 A;  1NTM G;  3H1K D;  1FZF A;  1Q90 D;  5APS A;  3EFG A;  4QMA A;  4NPF X;  2IBZ G;  1PGO A;  2IDB A;  5KLV D;  5AW9 B;  1VF5 C;  1L0L E;  1RF1 A;  2D2C B;  1NTK G;  2E74 C;  4UB8 H;  2Q7C A;  2HFE D;  1GW4 A;  1IK7 A;  3TDK A;  3L74 G;  4YXW H;  2XND H;  1KB9 I;  5KLV G;  2BAS A;  4YTP C;  3KXD A;  1FE6 A;  1P84 D;  3FXD A;  2NZ2 A;  2QJK C;  3W68 A;  3CCR P;  5KTB A;  3CWB E;  1SVF A;  1AA0 A;  1MZ9 A;  5E79 H;  3Q5P A;  3RL0 D;  2NPS A;  1GD2 E;  1QLE D;  1SQB E;  3PHL A;  3WU2 E;  1SQV G;  2P58 A;  5KJ7 D;  3HTK B;  3I5C A;  3L73 E;  5KAF H;  3A3Y B;  3AE1 C;  1Z56 A;  1LWU A;  1U7M A;  5BU8 B;  1KOR A;  2XDJ A;  4TT3 H;  2CPB A;  2KLV A;  3MHV A;  4IL6 H;  1L4A A;  1MKM A;  3V4W A;  1MFZ A;  1PFI A;  1VQM P;  3FX0 A;  1M8O B;  1GU4 A;  2QM8 A;  1JY2 P;  2K1A A;  4I7Z C;  1DD3 A;  1YTZ T;  3F5H A;  3S4R A;  1FDO A;  1GL2 B;  5AW5 B;  1L0L G;  1SQQ K;  4TLF A;  1NTM J;  1YBK A;  1KQS O;  3V5B A;  1OXZ A;  5AVZ B;  3HUS C;  4H13 C;  3PRJ A;  1H89 A;  2ZT9 C;  3G3Z A;  1NGM B;  2I1K A;  3MUD C;  3KYQ A;  1NAY A;  3P8C D;  1NTK J;  3ABV C;  3H1I E;  2OYH A;  2K37 A;  1FJP A;  2RKL A;  1M1J B;  4A7P A;  3CWB G;  3L74 J;  3VTP C;  2YMY A;  1NTZ K;  1N7S A;  4PD4 H;  1JEK A;  1N73 A;  3GF7 A;  1SQB G;  2IFN A;  3JCU E;  3SSU A;  4EDF A;  2J59 M;  3L73 G;  2FYN B;  2HYN A;  1JY3 O;  5APU A;  4PV1 B;  1OMI A;  3P7K A;  1EDL A;  5AVX B;  2ITA A;  2WPV B;  1QL2 A;  5KLV K;  2R32 A;  2UWJ E;  1PV3 A;  1LGH B;  3H1H J;  2POH A;  3OA7 A;  4NPE A;  1Y47 A;  2ZYD A;  3D71 A;  3H25 A;  2JKV A;  4CPG A;  1RF0 C;  2IYP A;  4JYC A;  4N6J A;  1FZC A;  3LW5 H;  1SQV K;  4C7N A;  1S3J A;  5KJ7 A;  3D6Y A;  1LNQ A;  3KPE A;  1S1C X;  3H1I G;  1BE3 D;  2JWD A;  2AEM A;  4L76 A;  1RQU A;  4PD4 I;  1PGJ A;  3V2R A;  3GHG B;  5CCH A;  1K05 A;  1NH4 A;  5B66 H;  2W90 A;  5AW6 B;  2CPS A;  2AEF A;  2ZFC A;  3JSV C;  3AE5 C;  1JM0 A;  1FBM A;  4KHX A;  3VMZ A;  2M3B A;  2KZI A;  3CWB J;  1RF1 C;  3BCC D;  1Q7Y Q;  2Z5I A;  2P2U A;  1VF5 B;  3N4X A;  3OJA B;  1SQB J;  3PLN A;  1E5W A;  1G2C A;  3CMA P;  2G8Y A;  3L73 J;  1S5L H;  3KZI E;  3SFE C;  1VDF A;  1ZW0 A;  2N9B A;  5AW8 B;  1J2J B;  2N1T D;  1WT6 A;  2B9B A;  2KXP B;  2PP6 A;  4EYY Q;  2OTL P;  4H0L C;  3A0H E;  4D6T E;  1Q82 Q;  3WUU A;  1UII A;  1W2E A;  1PGQ A;  2IZ0 A;  2ZVO B;  4PD4 D;  5APT A;  3AE3 C;  3T97 A;  1SLQ A;  3H32 B;  1VPC A;  3G9R A;  3RK2 D;  1AQ5 A;  1NAF A;  1DIP A;  1FOS E;  1OVV A;  5AVQ B;  1ZXG A;  1L4A C;  3FGA D;  3IAO A;  2KS1 B;  2O01 H;  2ZJS E;  2H89 C;  1PP9 D;  1ZME C;  1A02 J;  1NKZ B;  5CCG A;  5AW4 B;  1OWA A;  4JPZ B;  3RK3 C;  1OVR A;  2R44 A;  1JY3 N;  1AVY A;  2O1K A;  1EXI A;  2K9J B;  3P8M C;  2O1J A;  1JTH A;  1JO5 A;  4OVN F;  3A0B E;  1SQX E;  3B5N C;  2P1J A;  1YJN P;  1XTG B;  3U59 A;  2QJP B;  1Q86 Q;  3HUS B;  3N7N A;  2C0W A;  2OYH C;  3H1J E;  1FDI A;  3BAS A;  1KQF B;  1IFM A;  1URQ D;  2B87 A;  1HVV A;  3L72 D;  4Z1M H;  5KKZ C;  4D6T G;  1SQP E;  1N73 C;  1ZN5 A;  2OYI B;  1PZQ A;  5K5G B;  5L8R J;  2P10 A;  4NPD A;  4H44 D;  1NO4 A;  1HF9 A;  1EZV I;  3VP9 A;  2C9L Y;  4W80 A;  5TIS E;  3CX5 H;  1FAV A;  1T2K D;  3HD7 A;  1H0T A;  1M90 Q;  1QGK B;  3LID A;  3GF3 A;  1KYO E;  2AXT E;  1ZR2 A;  2R3C A;  2PAJ A;  1SFC A;  2HPC A;  2Q1K A;  3AEF C;  3W67 A;  2PFX A;  2QG4 A;  2YO2 A;  4ZKU A;  4GIF A;  1YHQ P;  2B88 A;  1IZN B;  3AEC C;  5KAI E;  1RH5 B;  2QVA A;  2YKP A;  1ZP0 C;  2A06 D;  3RL0 C;  1DH3 A;  4GDO A;  1SQX G;  2WT7 A;  1M1K Q;  1L2P A;  1VQL P;  2IBZ I;  3H1L E;  5KJ7 C;  4OWF A;  2H7H A;  1M56 D;  3O8Z A;  4GOE A;  2D2C D;  3M9Q A;  3EQ2 A;  3H1J G;  1L0N E;  1OW7 A;  2WSE J;  4I1L A;  1J1E B;  4PJ0 H;  1SQP G;  1EZV D;  5DJT B;  1USE A;  1S72 P;  1J1D C;  3V2P A;  1FU1 A;  3VMX A;  1Y9B A;  1X8Y A;  2K88 A;  2C9N Y;  4K35 A;  4N78 E;  3VYI A;  2FFD C;  1RF0 A;  5APY A;  3CX5 I;  3L36 A;  2Q3I A;  1KIL D;  4WB4 A;  5CHX A;  2KYV A;  2N9Y B;  5M1B A;  3TSI A;  2GUS A;  1OVU A;  2KSJ A;  2ZVN B;  1JY2 O;  3VOP A;  3OW2 O;  1ZRT E;  3H1H E;  3TNU A;  4JBZ A;  1NTM D;  1OW8 A;  3WU2 H;  4R4L A;  4WBA A;  1X22 A;  1FZG A;  1MUU A;  1JCC A;  5BVZ A;  3ZDM A;  2IBZ D;  4M3L A;  2E5T A;  1OW6 A;  1NKN A;  1NTK D;  2Q3E A;  4WY4 A;  3IN6 A;  4DZO A;  3CC7 P;  2QRX A;  1BDD A;  2P67 A;  3H1L G;  3L74 D;  2Y0E A;  3D70 A;  4OGQ B;  2W6J H;  3R4Y A;  1BCC E;  1GL2 D;  2NPS B;  1L0N G;  2L5G B;  1LP1 A;  4L73 A;  2H88 C;  1CW5 A;  1DX7 A;  4EOT A;  1PL5 A;  1SQX J;  3CX5 D;  5CMZ A;  1LWU B;  2OTJ P;  1GK4 A;  3NXS A;  4Y28 J;  1YI2 P;  1RQV A;  2BCC E;  2W83 C;  3CCE P;  1KIL B;  5CCG C;  3H1J J;  2KB7 P;  1SQV D;  1IO4 A;  1KB9 E;  1L4A B;  1WRG A;  2E76 B;  2XU6 A;  1S9K D;  1EC5 A;  2H43 A;  2Y0C A;  5AVT B;  4IFF A;  3NMD A;  5APV A;  1SQP J;  3B4S A;  2JR8 A;  3H1H G;  4Y99 B;  1JUN A;  3JCU H;  2KSE A;  1LTJ B;  4YPC A;  1H88 A;  3G6E P;  2YMK A;  1Q81 Q;  2Y9Y A;  2WQY C;  5AVY B;  4PV1 D;  3K5B A;  1HTL C;  2JEE A;  1JB0 J;  2K9Y A;  2KK7 A;  1L0L D;  4JQ0 D;  1LTT C;  2LR2 A;  3PP5 A;  5AW2 B;  5KKZ B;  1N2D C;  3BAT A;  1N7S B;  4XE5 B;  4W7Y A;  4EIJ A;  2WPR A;  1N73 B;  1BCC G;  3AEE C;  2WSF J;  2QEX P;  3PH0 A;  2Y9Z A;  1K9M Q;  1G1J A;  3L71 E;  3HD7 C;  1M57 D;  2IFM A;  3B5N A;  3IF4 A;  2FYU E;  3CWB D;  1KTM A;  1IFN A;  1SFC C;  3H1L J;  5H2F E;  2BCC G;  4U3F E;  2MKV A;  3M0D A;  1BGY E;  5AVW B;  4OH8 B;  1SQB D;  4RO0 A;  2N1T C;  3AE8 C;  1GDT A;  2R3S A;  1L0N J;  1NTM K;  3L73 D;  3GMA A;  3AE6 C;  2W8Z A;  4K3A A;  3TYY A;  3V4Q A;  1X0T A;  2E75 B;  2M3E A;  1GK6 A;  2YO3 A;  5E79 E;  1FZC B;  2YXQ B;  1NTK K;  3IFM A;  1GU5 A;  1HBW A;  4C7N B;  1EQ7 A;  3JC2 2;  3RK2 C;  1E79 H;  3S1K A;  5CBO A;  1T3J A;  1IFP A;  1VF5 D;  2WSE H;  2KZJ A;  3KZI H;  3O6Q B;  3PJS K;  1HGZ A;  4IL6 E;  3MGN A;  2WPS A;  1J1D B;  1A02 F;  2I1J A;  2QA4 P;  2CK3 H;  1W5C E;  3L71 G;  4L75 A;  1BDC A;  3H1I D;  2NRG A;  3A0H H;  3CCL P;  2FYU G;  2Q5U A;  1PIX A;  2YNY A;  2WSC H;  1S4X A;  2ZYG A;  1PPJ E;  3P32 A;  3TK1 A;  1EDK A;  3H6P A;  1BCC J;  1BGY G;  3BRT B;  1G2C B;  4LGD E;  4ZNC A;  3L70 E;  2YIU C;  1URQ C;  1FC2 C;  1IK9 A;  1KD1 Q;  4WY4 C;  2QIW A;  2BCC J;  4ZMD A;  2FFD A;  3G4S P;  1AVO A;  3HE4 B;  1L0L K;  2A45 G;  5C39 A;  4H44 C;  5BU5 A;  2Q9I A;  2LXC B;  1LT9 A;  3SWY A;  1D7M A;  3WUT A;  3T97 B;  1VQO P;  5AW7 B;  3KDP B;  2E74 B;  1HWT C;  4U7J A;  5AVU B;  3A0B H;  3V6I A;  1NHL A;  1SS1 A;  1KV4 A;  2RN0 A;  3L35 A;  2GA1 A;  4BRY A;  3CCQ P;  1IFJ A;  3E1I A;  2K3R A;  1QEX A;  4MN4 C;  4GKG A;  2ZXX A;  1N86 A;  3Q1M A;  2QJK B;  1LTG C;  3SWK A;  1SQB K;  2FYZ A;  1NU1 E;  4C7R A;  1HJ0 A;  2MJZ A;  1JY3 P;  2M8R A;  2WVR A;  3CL3 D;  1PPJ G;  3GLM A;  1VQN P;  3IR9 A;  1MFT A;  1T3U A;  3VMY A;  1VQ6 P;  3BRV B;  4BWN A;  3I56 P;  3CLQ A;  3L71 J;  3L70 G;  1T6A A;  5TIS H;  2B89 A;  2FYU J;  3RBZ A;  5B5E E;  1KYO H;  4I6M C;  1OX3 A;  2AXT H;  1AFO A;  2PRR A;  5CJ4 A;  2B87 B;  4U3F J;  3CC4 P;  1BGY J;  2WZ7 A;  5EFW B;  1QL1 A;  2VRS A;  3V2Q A;  2AXC A;  3FWN A;  4I7Z B;  2WSF H;  5KAI H;  1VQ4 P;  4LC1 A;  3Q2Y A;  2KNC A;  3HD7 B;  3TGU E;  4D6T D;  1FZB A;  4H13 B;  3M0D C;  2IZ1 A;  3L75 E;  1U57 A;  2ZT9 B;  1YQ4 C;  3H32 A;  1SFC B;  1BE3 J;  2JDI H;  1CSB A;  3RL0 g;  5APW A;  3AE4 C;  1LTB C;  1NU1 G;  2E5Y A;  3HE5 A;  1FOS F;  1CI6 A;  3L37 A;  2M0B A;  1YIT P;  1GL2 C;  2WT7 B;  2JWA A;  2M5A A;  3MP7 B;  2O01 N;  4GOD A;  3Q5R A;  1KYO I;  2K9J A;  2WSS H;  3S9O A;  1X79 B;  1SQQ E;  3G71 P;  3EFF K;  2N1T A;  3L4F A;  1VL2 A;  4JYB A;  1SQX D;  3SFD C;  2R5B A;  3L70 J;  2IX7 C;  1M1J C;  1BSN A;  3RK3 E;  3CXH E;  2HOD A;  3A5T A;  1EXJ A;  2WWW A;  1VQ5 P;  3H1J D;  3A2A A;  4HKZ H;  1VQK P;  2OYI A;  1IJD B;  3TGU G;  3ITK A;  4H0L D;  4UB6 E;  1SQP D;  3MZW B;  4OGQ D;  1NTZ E;  1LJ2 A;  1X9V A;  4AUW A;  2NPS D;  3AEB C;  2HG5 D;  4PV1 C;  3H1K E;  2E42 A;  1AJY A;  4AQR D;  1KYO D;  1LTS C;  2OAR A;  4RJT A;  3UIA A;  5KLV E;  4WY4 B;  2OTK E;  1L4A D;  2E76 D;  1LT9 C;  1NU1 J;  1RF1 B;  5KLI C;  5GTH E;  1NJI Q;  3LW5 J;  4WWI A;  1P84 E;  3CXH D;  1LP1 B;  1SQQ G;  3NFQ A;  4L74 A;  3CD6 P;  4DOJ A;  1GTW A;  1K73 Q;  1YQ3 C;  3B71 A;  1URQ A;  3H1L D;  1CZQ A;  1G1I A;  5AW3 B;  2C0X A;  2SPZ A;  1YJW P;  5GTI E;  1SP4 A;  2WMM A;  3GHG C;  1L0N D;  4I2L C;  4H0L B;  3VN0 A;  1YJ9 P;  1KQG B;  2IPP A;  1N7S D;  1YYC A;  1NTZ G;  1FZE A;  1NOH A;  1R5S A;  4N78 D;  2Q6Q A;  3H1K G;  4RKU J;  3AE2 C;  2L91 A;  3OAK A;  3R2P A;  3D6Z A;  3TGU J;  2FXO A;  1QVF O;  3E7K A;  5H2F H;  3L75 J;  4PJ0 E;  1R5L A;  1ZRT D;  3H1H D;  4DJG A;  2ZXE B;  1RE3 A;  1QX8 A;  1VQ9 P;  5TJH A;  3AEA C;  1SQX K;  3II6 A;  4HYT B;  1IC2 A;  3RK3 B;  1Q2N A;  1ZOY C;  1XTC C;  2E75 D;  1JOC A;  4WVZ A;  2WTY A;  4N3Y B;  3P8C E;  4IL6 X;  2A45 H;  3B5N B;  3USS A;  2GUV A;  4IOI H;  1PGP A;  1RY3 A;  2HR3 A;  3M9H A;  1SQP K;  2QSI A;  4IFD K;  1BCC D;  2OYH B;  2LXB A;  3C1L A;  1UIX A;  1N7L A;  1SQQ J;  1JNM A;  2W6A A;  1KIL A;  5CCH D;  2O01 J;  2QM7 A;  1VQP P;  4LLH A;  2BCC D;  5CBN A;  2RMZ A;  2KI7 B;  1S2E A;  1KB9 D;  1R8E A;  4UB8 E;  3QWO C;  2V7Q J;  3HTK A;  3SWF A;  2FXP A;  1FDM A;  1NTZ J;  4DT0 A;  1LTJ A;  4W7Z A;  1LTA C;  2QJP C;  3KHU A;  1K8A Q;  1KFM A;  3H1K J;  1HH0 A;  3RGU A;  2KLU A;  2OYI C;  1JY2 N;  1T8Z A;  2E43 A;  2A45 I;  3RL0 B;  1JMB A;  1GL2 A;  5KLV J;  1IFD A;  1L0N K;  1BE3 E;  4GT1 A;  5KAF E;  3CC2 P;  2XKM A;  2QJY C;  3MD0 A;  3I55 P;  2FXM A;  1ZLL A;  4GOF A;  1JCD A;  1OZH A;  2E74 D;  4KT0 J;  3EWK A;  3L71 D;  3CI9 A;  3VP8 A;  1USD A;  2OYO A;  3MTU E;  2FYU D;  3GG2 A;  1AQT A;  1M1J A;  1SQV J;  3BCC E;  2XZR A;  3AEG C;  2DW3 A;  4U3F D;  2FFD B;  1BGY D;  2QE7 H;  2RH0 A;  1HGV A;  5CCG D;  2FBW C;  2FKW B;  1LTI C;  3RBX A;  2Z4E A;  4BXL A;  1NWQ A;  1LT9 B;  4U3F G;  1HJB A;  2G3A A;  4IFM A;  5KLI B;  2FY8 A;  2OQQ A;  2H8P D;  1OFC X;  4C46 A;  2ZYA A;  4BRY B;  1L0L J;  1J1E C;  2P7J A;  5B5E H;  3Q3D A;  3AE9 C;  4PD4 E;  3HRN A;  3O6Q A;  2IYO A;  2BEZ F;  1S5L X;  1BE3 G;  2BEQ D;  1T2K C;  1DEB A;  3CCV P;  2Z5H A;  1VQ8 P;  1RE4 A;  3C8V A;  4YXD C;  3QH9 A;  3NTN A;  3MIW A;  2AEJ A;  3AED C;  2WPQ A;  3CCU P;  3HD7 D;  1PP9 E;  4H13 D;  2JO1 A;  3PTZ A;  2ZT9 D;  1SFC D;  3BCC G;  1PPJ D;  3WMM 0;  1RE3 C;  1ZV8 A;  2KOG A;  3GHG A;  2YXR B;  3L70 D;  2GM4 A;  1HUC A;  3LIE A;  1OIP A;  2XV5 A;  2V4H A;  1JTH B;  3HE4 A;  4OGQ C;  1KFN A;  2D2C C;  1YIJ P;  2NPS C;  1U7J A;  1GW3 A;  2KNC B;  3A7O A;  3L72 E;  4ASW A;  1M7L A;  4RES B;  2YKO A;  1GMJ A;  1LWU C;  1H8A A;  5APQ A;  3CCM P;  5B66 E;  1GZL A;  1TU3 F;  1EDJ A;  1KIL C;  3HE5 B;  3U1A A;  2E76 C;  1CI6 B;  3GW6 A;  3CXH H;  3CPW O;  2FYU K;  2PGD A;  2XNX A;  3H1I J;  1ZR4 A;  3WUV A;  1KMI Z;  2M5A B;  1W2B O;  1H0T B;  4Y99 C;  3B8E B;  1KQL A;  1FZA A;  2V7Q H;  4ASV A;  1NU1 D;  1PP9 G;  1LTJ C;  4UB6 H;  1FS0 E;  1S5L E;  2HPC B;  1BSH A;  2KP8 A;  3BVH A;  2KIK A;  2R5D A;  2N1T B;  3E1R A;  2A06 E;  1WMK A;  2KS1 A;  1FJK A;  4O9B A;  2HOD B;  1KC8 Q;  2W6B A;  1N7S C;  1YTZ I;  3BCC J;  1QVG O;  4WY4 D;  1DD4 A;  5DJU B;  3KQG A;  4XFJ A; 
#chains in the Genus database with same CATH homology
 1NTZ J;  1PP9 J;  1P84 I;  1KYO I;  1L0N J;  1SQB J;  3CXH I;  3L74 J;  1L0L J;  5KLV J;  4D6T J;  3TGU J;  3L71 J;  2BCC J;  3L73 J;  1BCC J;  3H1J J;  3L75 J;  1EZV I;  2IBZ I;  1BE3 J;  3H1K J;  2FYU J;  1SQV J;  1SQQ J;  1NU1 J;  3H1L J;  3CWB J;  3H1H J;  1KB9 I;  4PD4 I;  3BCC J;  3L72 J;  1NTK J;  3L70 J;  1SQX J;  1NTM J;  3H1I J;  1SQP J;  4U3F J;  1BGY J;  3CX5 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...