1EZVI

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
55
structure length
55
Chain Sequence
b'SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase/electron transport
source organism Saccharomyces cerevisiae
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
total genus 18
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ezvI00
1KYOI 2FYUJ 1KB9I 3H1KJ 1SQQJ 1BCCJ 1PP9J 3BCCJ 5KLVJ 3L72J 3H1IJ 3H1HJ 1SQXJ 3L73J 1SQPJ 1SQBJ 1SQVJ 3L71J 1NTMJ 1EZVI 4D6TJ 1BE3J 3CXHI 3CX5I 3TGUJ 2BCCJ 1NTKJ 3H1JJ 4PD4I 3L74J 2IBZI 4U3FJ 1NU1J 1P84I 1BGYJ 3L70J 3H1LJ 1L0NJ 1NTZJ 1L0LJ 3L75J 3CWBJ
chains in the Genus database with same CATH superfamily
1BSNA 2FXOA 3FWNA 1SQBE 2P58A 4L76A 1BCCJ 2Q1KA 3JCUH 3OA7A 4UB8E 3CCEP 2GA1A 2PP6A 5H2FE 1FZCC 2P2UA 2P7JA 2RKLA 4UB6H 1QVFO 1FC2C 3LIDA 3O6QA 4C7NB 1JB0J 4N78E 3CCSP 3L75E 4XA4A 2YMYA 1NJIQ 3JSVC 2C9NY 3IFMA 1OW8A 2O01J 1SQPJ 2FYNC 2RH0A 1SQVD 3M0DA 1SQQE 1FDOA 1URQB 4U3FG 3TSIA 2NPSD 1M8OB 4H0LB 1KYOE 1NU1K 1NGMB 1L0LE 2HFED 4HJGH 1NKNA 1SVFA 1IFMA 2QSIA 3V5BA 3G4SP 1BGYJ 1ZRTD 2KOGA 5AVSB 1NTZK 2Y0EA 2WTYA 1NTMK 1L0ND 2AEFA 1D7MA 5KLVK 5KAFE 5M1BA 2GUSA 1HUCA 2IZ0A 1FJKA 1PPJG 2H88C 5AVVB 3M0AA 1GU4A 2W83C 1H0TA 1SQVE 1FE6A 1SQQD 2HG5D 3FWLA 4OGQC 3HD7C 1KQFB 5KAIH 2I8DA 3CCRP 4IOIH 3M9QA 3NTNA 4C46A 2JKVA 4KT0J 2A06E 3FGAD 1J1EB 2WSCJ 4IL6E 3H1HJ 1LTSC 1IJDB 1BDDA 1EQ7A 1LTJC 2QJYC 3AEFC 2JWDA 3KXDA 3L75G 4Y28J 3S9OA 4OWFA 5APXA 5KAFH 3GLMA 1FBMA 1L0NE 2R3SA 5TJHA 1HWTC 1ZW0A 3VN0A 2QG4A 1MUUA 1KILC 3V4WA 3ITKA 1JNMA 2FYUK 1NU1D 1YJWP 1LWUA 2QIWA 1VQ6P 1SQXG 2WSEH 1KYOH 1H89A 4ZKPA 1JY3O 1SQQG 1A02J 1FDIA 2Y0DA 3TGUE 1GD2E 2E5YA 2NPSB 4H0LD 4W7ZA 1Q90D 2Y9YA 2I1KA 3D71A 1OFCX 1SQVG 2R44A 4DOJA 4GT1A 2WT7B 3EWKA 3L70E 2W90A 1LTGC 2W6AA 4H13B 5GTIE 3MIWA 1FZCA 3L70G 1JOCA 2E76C 1NU1E 2E75C 1SQXJ 1ZR2A 2RMZA 1HJ0A 1LTTC 1S1CX 2K1AA 4JQ0D 2OYIB 2QJPC 1VQ7P 2N1TA 2PFXA 3CLQA 1GZLA 4L73A 3VMZA 3TGUD 2YKOA 1NTKD 1EDIA 3I56P 2I1JA 4XFJA 2BASA 3HE4A 1RQVA 4H44C 3HE5A 3AE3C 4RJTA 5KKZC 2WSFJ 3L71G 3SFEC 1U57A 1QVGO 2A45H 3CX5D 2Y0CA 1L4AD 1JM0A 2B87A 3CXHD 4H44D 1Q7YQ 3CC2P 3CWBJ 1L4AA 1N73B 1AFOA 1LT9A 4Z1MH 4N3YB 1T2KD 3BRTB 1NYHA 3PTZA 3H1HG 3HD7A 4IFMA 1M7LA 1FZCB 2ZVNB 2JEEA 5CBNA 1JCCA 1NTKG 1U7MA 1YQ4C 1AV1A 2D2CB 2K3RA 2R5BA 3TGUG 1ZMEC 3CC4P 3H1KE 1P84D 4EOTA 1BCCG 3MUDA 3L71J 1NTMJ 3II6A 1Z56A 2B9BA 3CX5E 3MZWB 1VQNP 1OW6A 3RL0C 1SLQA 1RHZB 1AA0A 3CXHE 1SFCA 1NH4A 1DH3A 3CC7P 2E74D 1FS0E 1N7SB 4I6MC 2P67A 4LGDE 3RK3E 4OH8B 2W8ZA 1NHLA 1P84I 1RE4C 1X0TA 3V2RA 4HKZH 3S1KA 3TYYA 5AW8B 2KZIA 2O01N 4PD4H 2JJLA 4GODA 1N8RQ 5BVZA 2FXMA 2O1KA 3FX0A 3M9BA 1YJNP 1L2PA 1PV3A 3CCJP 1FZGA 3H1KD 5KJ7C 1L0NG 1M1JC 3A5TA 2Z4EA 4PV1B 3V2NA 1X79B 1BGYG 1RF0C 4DJGA 1X9VA 3M91A 5GTHH 3TNUA 1PP9J 1W2BO 3SWKA 3H6PA 3RK3D 3H32A 2ZJSE 3BATA 1S72P 1K04A 1QL2A 2QM7A 1SQBJ 2Q3EA 2G3AA 3H1LG 1BCCE 1GL2B 5AW5B 1EZVI 5B66H 1BE3D 2FFDB 2POHA 3B4SA 3H1LE 1OX3A 2NZ2A 2OYHC 2KSJA 3AE7C 3GG2A 2WSFH 2IX7C 2R3CA 3A3YB 3CI9A 4WWIA 3UIAA 3GF7A 2SPZA 1XTCC 2IBZD 3FXDA 1WT6A 1M90Q 1VQKP 3S4RA 5CCHA 4O9BA 1CZQA 2J5UA 1PL5A 1VF5B 2OYHA 1L0LJ 2H43A 1HBWA 2B87B 2VRSA 1BCCD 1X22A 1YJ9P 2KSEA 3W68A 1YHQP 1N7SD 3A7OA 2E74B 1KC8Q 2ZAEB 1BGYE 3RK2D 3L36A 4PJ0H 3HE5B 3CL3D 2HR3A 4GDOA 5C39A 4C7RA 4C7NA 2YMKA 3L72J 4EYYQ 5CCGD 1SQPK 4RO0A 2IBZE 3C9IA 1SQVJ 1RE3A 2E75D 2N1TB 3GHGC 4NPEA 1T2KC 1R8EA 2FXPA 2OYHB 2ZYDA 3QWOC 1GK4A 3PH0A 1YIJP 1FZAA 2BCCD 2V7QH 2JR8A 3R2PA 3AEGC 2AXTH 2YXRB 1VQ5P 1KQGB 2HODA 2IBZI 2WPRA 3L74D 3H1HE 3LW5H 1FOSF 1JO5A 3RL0D 2V4HA 1VQMP 2CPSA 1BGYD 1IFJA 1KB9H 4H0LC 4KHXA 1L0NJ 1T3JA 3FXEA 4L75A 4R4MA 2FFDA 3CWBG 2E43A 2FYNB 3H25A 2QJKC 1N7LA 2FKWB 1J1DB 2K9JB 2MKVA 2D2CC 3AEAC 1IK7A 1HTLC 1PP9G 3H32B 1CI6A 4HH2A 1K05A 1IZNB 3GF3A 3IF4A 5KTBA 2PAJA 3PRJA 2Y9ZA 3AEEC 3Q5PA 1ZN5A 1EXJA 3H1JE 1RF0A 3MD0A 3RL0g 3L74E 3D6YA 3H1ID 2HYNA 3H1HD 4U3FE 5AVYB 2HLOA 1HGVA 2ZXXA 1XTGB 1KN7A 3VYIA 2XZRA 3V2QA 5AW6B 4UB6E 3KHUA 1GK6A 2OARA 3KZIE 3W67A 4ASVA 3I55P 3CPWO 2KNCA 1K9MQ 1JY3P 3HUSB 3SWYA 5CMZA 2WITA 1KZUB 2WPSA 3HRNA 2QEXP 2YO2A 3VMYA 1NU1J 1SQXE 1NO4A 1SQBK 5TISE 5CJ0A 5KLIB 5AVWB 3AEDC 4BXLA 2V7QJ 3TNUB 2FBWC 3Q3DA 1DEEG 1VQOP 1NTZD 3B5NB 3LIEA 1KV4A 3H1IE 1K73Q 2E76B 3L75D 1ZOYC 5APVA 3RK2C 1MZ9A 3H1IG 1KB9E 1IFPA 1UIIA 3CCUP 2YIUC 1NAYA 2C0WA 2R5DA 3TF5A 4RESB 1AVYA 4NPFX 1Q86Q 1YITP 2A06G 4WY4C 3OW2O 3M0DC 4I2LC 1T6AA 1G2CB 2L5GB 1SQXD 1LT9B 3CWBE 3V6IA 1JY2N 4XE5B 1N73A 3AE2C 1KORA 3KDPB 1YQ3C 1GW3A 4KJMA 3CXHI 3O8ZA 2J58A 2ZT9B 3C8VA 1NTZE 3CMEP 1YBKA 3L73G 1NTZG 1QL1A 1BE3G 3L4FA 1KB9D 1NTMG 2W6BA 3EQ2A 3H1JG 4GIFA 1PGPA 2L91A 5APSA 5KLVG 4B86A 2OYIC 1GMJA 3EFFK 3TDKA 3IR9A 3OAKA 1RQUA 2KK7A 2QE7H 3L71E 4WY4B 4HB1A 3BASA 2A06D 2LKMA 2YIUB 1J1EC 3L37A 5CHXA 1KB9I 1L4AB 2YO3A 4Y99C 1MFZA 1E5WA 4WY4A 5KJ7D 2QRXA 4JF7A 5AW4B 3HD7D 3P8CE 1G1IA 1NAFA 2AEJA 4H13D 1JMMA 1JY2O 1M56D 3BCCD 4YTPC 1LTAC 5APQA 4PV1C 1N73C 1N86A 1URQD 1Q2NA 2XNDH 1R5LA 2P10A 1KILD 3L73D 1KILB 2IYOA 3VTPC 2GM4A 3G9RA 1LNQA 3L71D 1NTMD 2P1JA 4D6TD 2KS1B 1LP1A 2IFNA 1HVVA 1SQXK 4AQRD 1PP9E 1PIXA 2CK3H 3RK3C 1SQQK 3L72G 2ZFCA 3D6ZA 4WVZA 1GL2C 3GW6A 3QH9A 3ZDMA 1A02F 2WQYC 3AE9C 1L0LK 2XNXA 4JBZA 3B8EB 5AVXB 3KZIH 1SQVK 3L70D 3BCCE 2ZVOB 3H1LJ 4N6JA 1MV8A 2M0BA 2OYOA 4DZOA 1VQPP 1LTBC 1OW7A 3RGUA 3Q5SA 2YKPA 3L73E 3R4YA 1VPCA 1JTHA 2OTJP 1GL2A 2E75B 4GOFA 2E76D 4H13C 3U1CA 5AVRB 4D6TE 1T8ZA 1H88A 3M06A 1HGZA 2QJKB 3USSA 3G6EP 2IPPA 2H7HA 3A0BH 1PP9D 1NTKE 4BRYB 5KLVJ 1OZHA 3E7KA 1MKMA 1NVOA 1JTHB 1S3JA 3HUSA 1SQBD 2WPQA 2FY8A 3VP8A 2C0XA 5KLIC 2WVRA 3PLNA 1VQ9P 2OQQA 2Q5UA 1CSBA 5AW2B 1M1KQ 3WUUA 4ASWA 1K8AQ 3L72E 4ZKUA 3WMM0 1RF1A 1URQC 3CXHH 1EDKA 3ABVC 5DJUB 3CX5H 3SSUA 1NU1G 1OMIA 3IAOA 3RBXA 4BRYA 1SP4A 2FFDC 1CI6B 2Z5HA 1ZLLA 3BCCG 5TISH 1LP1B 4QMAA 2WMMA 1KYOD 1JEKA 4GOEA 1L0LD 1HF9A 3F89A 5K5GB 2JWAA 1Q81Q 2FYUJ 4JYBA 4DCKA 1RF1C 1SS1A 3RK2B 1Q82Q 1RH5B 3O6QB 3A0HH 1ZRTE 2J59M 1Y9BA 5L8RJ 3VP9A 3M9HA 1VF5C 5APYA 4IL6X 5DJTB 1S2EA 3HD7B 3L72D 3F5HA 4OGQB 4OGQD 1EDLA 2IBZG 1W2EA 3P8MC 4R4LA 5KJ7A 5GTHE 1USEA 2B89A 4H44B 3NMDA 5E79H 1DD3A 3B5ND 2Q9IA 1PFIA 4ZNCA 2BEQD 4K35A 1JUNA 2BCCJ 1URQA 2ZT9C 1OVVA 3H1JJ 1GDTA 1EZVG 3L74J 2A45I 2QJYB 2QJPB 3AECC 5H2FH 4U3FJ 4UB8H 2JDIH 1OIPA 2K88A 4EI2A 1PGOA 1L0NK 2R32A 3AE6C 4AUWA 2FYUG 3MHVA 3U59A 1DD4A 2PRRA 2AXTE 2M8RA 1S9KE 1WMKA 2KIKA 1E79H 1G2CA 1Y8AA 3E1IA 1LWUC 2QM8A 4IL6H 1BE3E 4LC1A 5APUA 2OYIA 3B5NC 2IYPA 2WSCH 3IN6A 2Z5IA 2N9BA 3HTKB 2K37A 5EFWB 1S5LH 5CCGC 2BEZF 2DW3A 3L74G 1PZQA 2Q6QA 3CMAP 3H1IJ 1VQ4P 1ZXGA 1J1DC 3PP5A 2E42A 1N7SC 1SQPD 4PD4E 1TU3F 5BU5A 3CD6P 1EZVD 1S4XA 4WB4A 3B5NA 1X8YA 2NPSA 2XV5A 1P84H 3I5CA 4JPZB 4M3LA 3WUTA 5CCGA 1EC5A 1FAVA 3JC22 3TK1A 4PD4I 3G71P 1S9KD 3VMXA 2N9YB 5KAIE 1USDA 3PJSK 4CPGA 2H89C 4K3AA 3RK3B 3Q2YA 1LTJB 3T97B 1KQSO 1OVUA 3K5BA 3LW5J 2IFMA 2ITAA 2JO1A 5AVZB 1FJPA 1NTZJ 1FZEA 3D70A 1S5LX 3L75J 4TT3H 2KYVA 1KYOI 2NRGA 1SQPE 4PD4D 1SQQJ 1LT1A 1RE3C 1EZVE 1SQPG 5GTIH 1LTIC 1GU5A 2KUBA 1DX7A 1VQLP 1IFDA 4NPDA 1CW5A 3AE5C 1N7SA 1W5CE 4W80A 2KLUA 2ZYAA 5E79E 1OXZA 1KTMA 1KD1Q 3V4QA 2NPSC 3AE1C 4YXWH 5AVUB 1H0TB 3CCVP 1NOHA 1HJBA 1IK9A 1NTKK 1ZP0C 2G8YA 2YKQA 2Q7CA 4PV1D 4AYCA 3VMAA 3OJAB 2B88A 1LT9C 3A0HE 3N4XA 1SFCC 1YTZI 3RL0B 3BRVB 3HTKA 1P84E 3MUDC 5APTA 1OVRA 2WPVB 2M5AB 1R5SA 1ZV8A 4OVNF 2E74C 1FOSE 1JCDA 2ZYGA 3G3ZA 4WY4D 5BU8B 1GL2D 5CJ4A 1UIXA 1BDCA 1S5LE 2K9JA 2RN0A 2UWJE 1YYCA 4EIJA 1VL2A 1AQTA 3MTUE 3P32A 5APWA 1NWQA 1N2DC 1M1JA 1LJ2A 1AVOA 2WZ7A 5AW3B 3BCCJ 1M1JB 3Q5RA 3HE4B 3N7NA 1T3UA 2XDJA 3MGNA 4I1LA 4LLHA 2W27A 1SFCD 2D2CD 3U1AA 3WU2H 3KQGA 3L73J 1KFMA 3KYQA 4GKGA 2IDBA 1RE4A 2KP8A 4JYCA 2QA4P 5CBOA 2O3JA 3H1KG 4D6TJ 3NFQA 1SQBG 4MN4C 2BCCG 2N1TD 1JY2P 1KFNA 3SFDC 3TGUJ 1G1JA 1NTKJ 5KLVD 5KLVE 2QVAA 5CCHD 2CPBA 2LR2A 5B66E 2LXBA 1FDMA 2YXQB 2KB7P 2WT7A 5B5EH 4ZMDA 2KZJA 3L70J 1IO4A 3H1LD 3KPEA 5B5EE 2ZT9D 2M3EA 3AE4C 1GTWA 1PGQA 4IFFA 2OGUA 1IC2A 3CWBD 4TLFA 1LGHB 3V2PA 3RBZA 3CCQP 5AVQB 5AW9B 3NXSA 1YTZT 2WSSH 1WRGA 1AJYA 3C1LA 5AW0B 2M5AA 3WUVA 1LWUB 4IFDK 2OTLP 1DIPA 1FU1A 2KXPB 2O1JA 3JCUE 3P7KA 4HYTB 4I7ZB 1NKZB 2JP3A 1VF5D 3PHLA 2YNYA 1RF1B 1VDFA 2LXCB 1GW4A 2E5TA 2FYUE 1DEBA 1EXIA 1VQ8P 1JY3N 3AE8C 5CCHC 2PGDA 2HPCA 2O01H 3MP7B 5KKZB 1KQLA 1QLED 1IFIA 2FYZA 2GUVA 2N1TC 1J2JB 3B71A 3GHGB 5AW1B 3CCMP 3GHGA 2KLVA 4EDFA 3P8CD 3Q1MA 3L35A 2AEMA 1FZBA 2ZXEB 1Y47A 3E1RA 1OWAA 4I7ZC 1FZFA 3CCLP 3A2AA 5AW7B 2BCCE 2Q3IA 2KNCB 1KILE 2HPCB 2FYUD 3H1KJ 2XKMA 4W7YA 4D6TG 4BWNA 1ZR4A 1NTME 1L4AC 2MJZA 4Y99B 1EDJA 2W6JH 2K9YA 4YPCA 4U7JA 1LTJA 3T97A 2M3BA 1RY3A 1BSHA 1IFNA 1PPJD 3AEBC 1QX8A 2A45G 3A0BE 4DT0A 2KI7B 1SFCB 2KS1A 2WWWA 1BE3J 1QEXA 1H8AA 2H8PD 3CX5I 1HH0A 1KILA 1L0LG 4L74A 3VOPA 4WBAA 4PJ0E 3SWFA 1AQ5A 1JMBA 1KMIZ 1M57D 3H1JD 2AXCA 4N78D 4RKUJ 5AVTB 3BVHA 4YXDC 1MFTA 1PGJA 4U3FD 3GMAA 3HUSC 4A7PA 2C9LY 2IZ1A 2OTKE 2HODB 3WU2E 1QGKB 3EFGA 1U7JA 1PPJE 1YI2P 2XU6A 2WSEJ
chains in the Genus database with same CATH topology
1KYOI 2FYUJ 1KB9I 3H1KJ 1SQQJ 1BCCJ 1PP9J 3BCCJ 5KLVJ 3L72J 3H1IJ 3H1HJ 1SQXJ 3L73J 1SQPJ 1SQBJ 1SQVJ 3L71J 1NTMJ 1EZVI 4D6TJ 1BE3J 3CXHI 3CX5I 3TGUJ 2BCCJ 1NTKJ 3H1JJ 4PD4I 3L74J 2IBZI 4U3FJ 1NU1J 1P84I 1BGYJ 3L70J 3H1LJ 1L0NJ 1NTZJ 1L0LJ 3L75J 3CWBJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  2FYU J;  1KB9 I;  3H1K J;  1SQQ J;  1BCC J;  1PP9 J;  3BCC J;  5KLV J;  3L72 J;  3H1I J;  3H1H J;  1SQX J;  3L73 J;  1SQP J;  1SQB J;  1SQV J;  3L71 J;  1NTM J;  1EZV I;  4D6T J;  1BE3 J;  3CXH I;  3CX5 I;  3TGU J;  2BCC J;  1NTK J;  3H1J J;  4PD4 I;  3L74 J;  2IBZ I;  4U3F J;  1NU1 J;  1P84 I;  1BGY J;  3L70 J;  3H1L J;  1L0N J;  1NTZ J;  1L0L J;  3L75 J;  3CWB J; 
#chains in the Genus database with same CATH topology
 1BSN A;  2FXO A;  3FWN A;  1SQB E;  2P58 A;  4L76 A;  1BCC J;  2Q1K A;  3JCU H;  3OA7 A;  4UB8 E;  3CCE P;  2GA1 A;  2PP6 A;  5H2F E;  1FZC C;  2P2U A;  2P7J A;  2RKL A;  4UB6 H;  1QVF O;  1FC2 C;  3LID A;  3O6Q A;  4C7N B;  1JB0 J;  4N78 E;  3CCS P;  3L75 E;  4XA4 A;  2YMY A;  1NJI Q;  3JSV C;  2C9N Y;  3IFM A;  1OW8 A;  2O01 J;  1SQP J;  2FYN C;  2RH0 A;  1SQV D;  3M0D A;  1SQQ E;  1FDO A;  1URQ B;  4U3F G;  3TSI A;  2NPS D;  1M8O B;  4H0L B;  1KYO E;  1NU1 K;  1NGM B;  1L0L E;  2HFE D;  4HJG H;  1NKN A;  1SVF A;  1IFM A;  2QSI A;  3V5B A;  3G4S P;  1BGY J;  1ZRT D;  2KOG A;  5AVS B;  1NTZ K;  2Y0E A;  2WTY A;  1NTM K;  1L0N D;  2AEF A;  1D7M A;  5KLV K;  5KAF E;  5M1B A;  2GUS A;  1HUC A;  2IZ0 A;  1FJK A;  1PPJ G;  2H88 C;  5AVV B;  3M0A A;  1GU4 A;  2W83 C;  1H0T A;  1SQV E;  1FE6 A;  1SQQ D;  2HG5 D;  3FWL A;  4OGQ C;  3HD7 C;  1KQF B;  5KAI H;  2I8D A;  3CCR P;  4IOI H;  3M9Q A;  3NTN A;  4C46 A;  2JKV A;  4KT0 J;  2A06 E;  3FGA D;  1J1E B;  2WSC J;  4IL6 E;  3H1H J;  1LTS C;  1IJD B;  1BDD A;  1EQ7 A;  1LTJ C;  2QJY C;  3AEF C;  2JWD A;  3KXD A;  3L75 G;  4Y28 J;  3S9O A;  4OWF A;  5APX A;  5KAF H;  3GLM A;  1FBM A;  1L0N E;  2R3S A;  5TJH A;  1HWT C;  1ZW0 A;  3VN0 A;  2QG4 A;  1MUU A;  1KIL C;  3V4W A;  3ITK A;  1JNM A;  2FYU K;  1NU1 D;  1YJW P;  1LWU A;  2QIW A;  1VQ6 P;  1SQX G;  2WSE H;  1KYO H;  1H89 A;  4ZKP A;  1JY3 O;  1SQQ G;  1A02 J;  1FDI A;  2Y0D A;  3TGU E;  1GD2 E;  2E5Y A;  2NPS B;  4H0L D;  4W7Z A;  1Q90 D;  2Y9Y A;  2I1K A;  3D71 A;  1OFC X;  1SQV G;  2R44 A;  4DOJ A;  4GT1 A;  2WT7 B;  3EWK A;  3L70 E;  2W90 A;  1LTG C;  2W6A A;  4H13 B;  5GTI E;  3MIW A;  1FZC A;  3L70 G;  1JOC A;  2E76 C;  1NU1 E;  2E75 C;  1SQX J;  1ZR2 A;  2RMZ A;  1HJ0 A;  1LTT C;  1S1C X;  2K1A A;  4JQ0 D;  2OYI B;  2QJP C;  1VQ7 P;  2N1T A;  2PFX A;  3CLQ A;  1GZL A;  4L73 A;  3VMZ A;  3TGU D;  2YKO A;  1NTK D;  1EDI A;  3I56 P;  2I1J A;  4XFJ A;  2BAS A;  3HE4 A;  1RQV A;  4H44 C;  3HE5 A;  3AE3 C;  4RJT A;  5KKZ C;  2WSF J;  3L71 G;  3SFE C;  1U57 A;  1QVG O;  2A45 H;  3CX5 D;  2Y0C A;  1L4A D;  1JM0 A;  2B87 A;  3CXH D;  4H44 D;  1Q7Y Q;  3CC2 P;  3CWB J;  1L4A A;  1N73 B;  1AFO A;  1LT9 A;  4Z1M H;  4N3Y B;  1T2K D;  3BRT B;  1NYH A;  3PTZ A;  3H1H G;  3HD7 A;  4IFM A;  1M7L A;  1FZC B;  2ZVN B;  2JEE A;  5CBN A;  1JCC A;  1NTK G;  1U7M A;  1YQ4 C;  1AV1 A;  2D2C B;  2K3R A;  2R5B A;  3TGU G;  1ZME C;  3CC4 P;  3H1K E;  1P84 D;  4EOT A;  1BCC G;  3MUD A;  3L71 J;  1NTM J;  3II6 A;  1Z56 A;  2B9B A;  3CX5 E;  3MZW B;  1VQN P;  1OW6 A;  3RL0 C;  1SLQ A;  1RHZ B;  1AA0 A;  3CXH E;  1SFC A;  1NH4 A;  1DH3 A;  3CC7 P;  2E74 D;  1FS0 E;  1N7S B;  4I6M C;  2P67 A;  4LGD E;  3RK3 E;  4OH8 B;  2W8Z A;  1NHL A;  1P84 I;  1RE4 C;  1X0T A;  3V2R A;  4HKZ H;  3S1K A;  3TYY A;  5AW8 B;  2KZI A;  2O01 N;  4PD4 H;  2JJL A;  4GOD A;  1N8R Q;  5BVZ A;  2FXM A;  2O1K A;  3FX0 A;  3M9B A;  1YJN P;  1L2P A;  1PV3 A;  3CCJ P;  1FZG A;  3H1K D;  5KJ7 C;  1L0N G;  1M1J C;  3A5T A;  2Z4E A;  4PV1 B;  3V2N A;  1X79 B;  1BGY G;  1RF0 C;  4DJG A;  1X9V A;  3M91 A;  5GTH H;  3TNU A;  1PP9 J;  1W2B O;  3SWK A;  3H6P A;  3RK3 D;  3H32 A;  2ZJS E;  3BAT A;  1S72 P;  1K04 A;  1QL2 A;  2QM7 A;  1SQB J;  2Q3E A;  2G3A A;  3H1L G;  1BCC E;  1GL2 B;  5AW5 B;  1EZV I;  5B66 H;  1BE3 D;  2FFD B;  2POH A;  3B4S A;  3H1L E;  1OX3 A;  2NZ2 A;  2OYH C;  2KSJ A;  3AE7 C;  3GG2 A;  2WSF H;  2IX7 C;  2R3C A;  3A3Y B;  3CI9 A;  4WWI A;  3UIA A;  3GF7 A;  2SPZ A;  1XTC C;  2IBZ D;  3FXD A;  1WT6 A;  1M90 Q;  1VQK P;  3S4R A;  5CCH A;  4O9B A;  1CZQ A;  2J5U A;  1PL5 A;  1VF5 B;  2OYH A;  1L0L J;  2H43 A;  1HBW A;  2B87 B;  2VRS A;  1BCC D;  1X22 A;  1YJ9 P;  2KSE A;  3W68 A;  1YHQ P;  1N7S D;  3A7O A;  2E74 B;  1KC8 Q;  2ZAE B;  1BGY E;  3RK2 D;  3L36 A;  4PJ0 H;  3HE5 B;  3CL3 D;  2HR3 A;  4GDO A;  5C39 A;  4C7R A;  4C7N A;  2YMK A;  3L72 J;  4EYY Q;  5CCG D;  1SQP K;  4RO0 A;  2IBZ E;  3C9I A;  1SQV J;  1RE3 A;  2E75 D;  2N1T B;  3GHG C;  4NPE A;  1T2K C;  1R8E A;  2FXP A;  2OYH B;  2ZYD A;  3QWO C;  1GK4 A;  3PH0 A;  1YIJ P;  1FZA A;  2BCC D;  2V7Q H;  2JR8 A;  3R2P A;  3AEG C;  2AXT H;  2YXR B;  1VQ5 P;  1KQG B;  2HOD A;  2IBZ I;  2WPR A;  3L74 D;  3H1H E;  3LW5 H;  1FOS F;  1JO5 A;  3RL0 D;  2V4H A;  1VQM P;  2CPS A;  1BGY D;  1IFJ A;  1KB9 H;  4H0L C;  4KHX A;  1L0N J;  1T3J A;  3FXE A;  4L75 A;  4R4M A;  2FFD A;  3CWB G;  2E43 A;  2FYN B;  3H25 A;  2QJK C;  1N7L A;  2FKW B;  1J1D B;  2K9J B;  2MKV A;  2D2C C;  3AEA C;  1IK7 A;  1HTL C;  1PP9 G;  3H32 B;  1CI6 A;  4HH2 A;  1K05 A;  1IZN B;  3GF3 A;  3IF4 A;  5KTB A;  2PAJ A;  3PRJ A;  2Y9Z A;  3AEE C;  3Q5P A;  1ZN5 A;  1EXJ A;  3H1J E;  1RF0 A;  3MD0 A;  3RL0 g;  3L74 E;  3D6Y A;  3H1I D;  2HYN A;  3H1H D;  4U3F E;  5AVY B;  2HLO A;  1HGV A;  2ZXX A;  1XTG B;  1KN7 A;  3VYI A;  2XZR A;  3V2Q A;  5AW6 B;  4UB6 E;  3KHU A;  1GK6 A;  2OAR A;  3KZI E;  3W67 A;  4ASV A;  3I55 P;  3CPW O;  2KNC A;  1K9M Q;  1JY3 P;  3HUS B;  3SWY A;  5CMZ A;  2WIT A;  1KZU B;  2WPS A;  3HRN A;  2QEX P;  2YO2 A;  3VMY A;  1NU1 J;  1SQX E;  1NO4 A;  1SQB K;  5TIS E;  5CJ0 A;  5KLI B;  5AVW B;  3AED C;  4BXL A;  2V7Q J;  3TNU B;  2FBW C;  3Q3D A;  1DEE G;  1VQO P;  1NTZ D;  3B5N B;  3LIE A;  1KV4 A;  3H1I E;  1K73 Q;  2E76 B;  3L75 D;  1ZOY C;  5APV A;  3RK2 C;  1MZ9 A;  3H1I G;  1KB9 E;  1IFP A;  1UII A;  3CCU P;  2YIU C;  1NAY A;  2C0W A;  2R5D A;  3TF5 A;  4RES B;  1AVY A;  4NPF X;  1Q86 Q;  1YIT P;  2A06 G;  4WY4 C;  3OW2 O;  3M0D C;  4I2L C;  1T6A A;  1G2C B;  2L5G B;  1SQX D;  1LT9 B;  3CWB E;  3V6I A;  1JY2 N;  4XE5 B;  1N73 A;  3AE2 C;  1KOR A;  3KDP B;  1YQ3 C;  1GW3 A;  4KJM A;  3CXH I;  3O8Z A;  2J58 A;  2ZT9 B;  3C8V A;  1NTZ E;  3CME P;  1YBK A;  3L73 G;  1NTZ G;  1QL1 A;  1BE3 G;  3L4F A;  1KB9 D;  1NTM G;  2W6B A;  3EQ2 A;  3H1J G;  4GIF A;  1PGP A;  2L91 A;  5APS A;  5KLV G;  4B86 A;  2OYI C;  1GMJ A;  3EFF K;  3TDK A;  3IR9 A;  3OAK A;  1RQU A;  2KK7 A;  2QE7 H;  3L71 E;  4WY4 B;  4HB1 A;  3BAS A;  2A06 D;  2LKM A;  2YIU B;  1J1E C;  3L37 A;  5CHX A;  1KB9 I;  1L4A B;  2YO3 A;  4Y99 C;  1MFZ A;  1E5W A;  4WY4 A;  5KJ7 D;  2QRX A;  4JF7 A;  5AW4 B;  3HD7 D;  3P8C E;  1G1I A;  1NAF A;  2AEJ A;  4H13 D;  1JMM A;  1JY2 O;  1M56 D;  3BCC D;  4YTP C;  1LTA C;  5APQ A;  4PV1 C;  1N73 C;  1N86 A;  1URQ D;  1Q2N A;  2XND H;  1R5L A;  2P10 A;  1KIL D;  3L73 D;  1KIL B;  2IYO A;  3VTP C;  2GM4 A;  3G9R A;  1LNQ A;  3L71 D;  1NTM D;  2P1J A;  4D6T D;  2KS1 B;  1LP1 A;  2IFN A;  1HVV A;  1SQX K;  4AQR D;  1PP9 E;  1PIX A;  2CK3 H;  3RK3 C;  1SQQ K;  3L72 G;  2ZFC A;  3D6Z A;  4WVZ A;  1GL2 C;  3GW6 A;  3QH9 A;  3ZDM A;  1A02 F;  2WQY C;  3AE9 C;  1L0L K;  2XNX A;  4JBZ A;  3B8E B;  5AVX B;  3KZI H;  1SQV K;  3L70 D;  3BCC E;  2ZVO B;  3H1L J;  4N6J A;  1MV8 A;  2M0B A;  2OYO A;  4DZO A;  1VQP P;  1LTB C;  1OW7 A;  3RGU A;  3Q5S A;  2YKP A;  3L73 E;  3R4Y A;  1VPC A;  1JTH A;  2OTJ P;  1GL2 A;  2E75 B;  4GOF A;  2E76 D;  4H13 C;  3U1C A;  5AVR B;  4D6T E;  1T8Z A;  1H88 A;  3M06 A;  1HGZ A;  2QJK B;  3USS A;  3G6E P;  2IPP A;  2H7H A;  3A0B H;  1PP9 D;  1NTK E;  4BRY B;  5KLV J;  1OZH A;  3E7K A;  1MKM A;  1NVO A;  1JTH B;  1S3J A;  3HUS A;  1SQB D;  2WPQ A;  2FY8 A;  3VP8 A;  2C0X A;  5KLI C;  2WVR A;  3PLN A;  1VQ9 P;  2OQQ A;  2Q5U A;  1CSB A;  5AW2 B;  1M1K Q;  3WUU A;  4ASW A;  1K8A Q;  3L72 E;  4ZKU A;  3WMM 0;  1RF1 A;  1URQ C;  3CXH H;  1EDK A;  3ABV C;  5DJU B;  3CX5 H;  3SSU A;  1NU1 G;  1OMI A;  3IAO A;  3RBX A;  4BRY A;  1SP4 A;  2FFD C;  1CI6 B;  2Z5H A;  1ZLL A;  3BCC G;  5TIS H;  1LP1 B;  4QMA A;  2WMM A;  1KYO D;  1JEK A;  4GOE A;  1L0L D;  1HF9 A;  3F89 A;  5K5G B;  2JWA A;  1Q81 Q;  2FYU J;  4JYB A;  4DCK A;  1RF1 C;  1SS1 A;  3RK2 B;  1Q82 Q;  1RH5 B;  3O6Q B;  3A0H H;  1ZRT E;  2J59 M;  1Y9B A;  5L8R J;  3VP9 A;  3M9H A;  1VF5 C;  5APY A;  4IL6 X;  5DJT B;  1S2E A;  3HD7 B;  3L72 D;  3F5H A;  4OGQ B;  4OGQ D;  1EDL A;  2IBZ G;  1W2E A;  3P8M C;  4R4L A;  5KJ7 A;  5GTH E;  1USE A;  2B89 A;  4H44 B;  3NMD A;  5E79 H;  1DD3 A;  3B5N D;  2Q9I A;  1PFI A;  4ZNC A;  2BEQ D;  4K35 A;  1JUN A;  2BCC J;  1URQ A;  2ZT9 C;  1OVV A;  3H1J J;  1GDT A;  1EZV G;  3L74 J;  2A45 I;  2QJY B;  2QJP B;  3AEC C;  5H2F H;  4U3F J;  4UB8 H;  2JDI H;  1OIP A;  2K88 A;  4EI2 A;  1PGO A;  1L0N K;  2R32 A;  3AE6 C;  4AUW A;  2FYU G;  3MHV A;  3U59 A;  1DD4 A;  2PRR A;  2AXT E;  2M8R A;  1S9K E;  1WMK A;  2KIK A;  1E79 H;  1G2C A;  1Y8A A;  3E1I A;  1LWU C;  2QM8 A;  4IL6 H;  1BE3 E;  4LC1 A;  5APU A;  2OYI A;  3B5N C;  2IYP A;  2WSC H;  3IN6 A;  2Z5I A;  2N9B A;  3HTK B;  2K37 A;  5EFW B;  1S5L H;  5CCG C;  2BEZ F;  2DW3 A;  3L74 G;  1PZQ A;  2Q6Q A;  3CMA P;  3H1I J;  1VQ4 P;  1ZXG A;  1J1D C;  3PP5 A;  2E42 A;  1N7S C;  1SQP D;  4PD4 E;  1TU3 F;  5BU5 A;  3CD6 P;  1EZV D;  1S4X A;  4WB4 A;  3B5N A;  1X8Y A;  2NPS A;  2XV5 A;  1P84 H;  3I5C A;  4JPZ B;  4M3L A;  3WUT A;  5CCG A;  1EC5 A;  1FAV A;  3JC2 2;  3TK1 A;  4PD4 I;  3G71 P;  1S9K D;  3VMX A;  2N9Y B;  5KAI E;  1USD A;  3PJS K;  4CPG A;  2H89 C;  4K3A A;  3RK3 B;  3Q2Y A;  1LTJ B;  3T97 B;  1KQS O;  1OVU A;  3K5B A;  3LW5 J;  2IFM A;  2ITA A;  2JO1 A;  5AVZ B;  1FJP A;  1NTZ J;  1FZE A;  3D70 A;  1S5L X;  3L75 J;  4TT3 H;  2KYV A;  1KYO I;  2NRG A;  1SQP E;  4PD4 D;  1SQQ J;  1LT1 A;  1RE3 C;  1EZV E;  1SQP G;  5GTI H;  1LTI C;  1GU5 A;  2KUB A;  1DX7 A;  1VQL P;  1IFD A;  4NPD A;  1CW5 A;  3AE5 C;  1N7S A;  1W5C E;  4W80 A;  2KLU A;  2ZYA A;  5E79 E;  1OXZ A;  1KTM A;  1KD1 Q;  3V4Q A;  2NPS C;  3AE1 C;  4YXW H;  5AVU B;  1H0T B;  3CCV P;  1NOH A;  1HJB A;  1IK9 A;  1NTK K;  1ZP0 C;  2G8Y A;  2YKQ A;  2Q7C A;  4PV1 D;  4AYC A;  3VMA A;  3OJA B;  2B88 A;  1LT9 C;  3A0H E;  3N4X A;  1SFC C;  1YTZ I;  3RL0 B;  3BRV B;  3HTK A;  1P84 E;  3MUD C;  5APT A;  1OVR A;  2WPV B;  2M5A B;  1R5S A;  1ZV8 A;  4OVN F;  2E74 C;  1FOS E;  1JCD A;  2ZYG A;  3G3Z A;  4WY4 D;  5BU8 B;  1GL2 D;  5CJ4 A;  1UIX A;  1BDC A;  1S5L E;  2K9J A;  2RN0 A;  2UWJ E;  1YYC A;  4EIJ A;  1VL2 A;  1AQT A;  3MTU E;  3P32 A;  5APW A;  1NWQ A;  1N2D C;  1M1J A;  1LJ2 A;  1AVO A;  2WZ7 A;  5AW3 B;  3BCC J;  1M1J B;  3Q5R A;  3HE4 B;  3N7N A;  1T3U A;  2XDJ A;  3MGN A;  4I1L A;  4LLH A;  2W27 A;  1SFC D;  2D2C D;  3U1A A;  3WU2 H;  3KQG A;  3L73 J;  1KFM A;  3KYQ A;  4GKG A;  2IDB A;  1RE4 A;  2KP8 A;  4JYC A;  2QA4 P;  5CBO A;  2O3J A;  3H1K G;  4D6T J;  3NFQ A;  1SQB G;  4MN4 C;  2BCC G;  2N1T D;  1JY2 P;  1KFN A;  3SFD C;  3TGU J;  1G1J A;  1NTK J;  5KLV D;  5KLV E;  2QVA A;  5CCH D;  2CPB A;  2LR2 A;  5B66 E;  2LXB A;  1FDM A;  2YXQ B;  2KB7 P;  2WT7 A;  5B5E H;  4ZMD A;  2KZJ A;  3L70 J;  1IO4 A;  3H1L D;  3KPE A;  5B5E E;  2ZT9 D;  2M3E A;  3AE4 C;  1GTW A;  1PGQ A;  4IFF A;  2OGU A;  1IC2 A;  3CWB D;  4TLF A;  1LGH B;  3V2P A;  3RBZ A;  3CCQ P;  5AVQ B;  5AW9 B;  3NXS A;  1YTZ T;  2WSS H;  1WRG A;  1AJY A;  3C1L A;  5AW0 B;  2M5A A;  3WUV A;  1LWU B;  4IFD K;  2OTL P;  1DIP A;  1FU1 A;  2KXP B;  2O1J A;  3JCU E;  3P7K A;  4HYT B;  4I7Z B;  1NKZ B;  2JP3 A;  1VF5 D;  3PHL A;  2YNY A;  1RF1 B;  1VDF A;  2LXC B;  1GW4 A;  2E5T A;  2FYU E;  1DEB A;  1EXI A;  1VQ8 P;  1JY3 N;  3AE8 C;  5CCH C;  2PGD A;  2HPC A;  2O01 H;  3MP7 B;  5KKZ B;  1KQL A;  1QLE D;  1IFI A;  2FYZ A;  2GUV A;  2N1T C;  1J2J B;  3B71 A;  3GHG B;  5AW1 B;  3CCM P;  3GHG A;  2KLV A;  4EDF A;  3P8C D;  3Q1M A;  3L35 A;  2AEM A;  1FZB A;  2ZXE B;  1Y47 A;  3E1R A;  1OWA A;  4I7Z C;  1FZF A;  3CCL P;  3A2A A;  5AW7 B;  2BCC E;  2Q3I A;  2KNC B;  1KIL E;  2HPC B;  2FYU D;  3H1K J;  2XKM A;  4W7Y A;  4D6T G;  4BWN A;  1ZR4 A;  1NTM E;  1L4A C;  2MJZ A;  4Y99 B;  1EDJ A;  2W6J H;  2K9Y A;  4YPC A;  4U7J A;  1LTJ A;  3T97 A;  2M3B A;  1RY3 A;  1BSH A;  1IFN A;  1PPJ D;  3AEB C;  1QX8 A;  2A45 G;  3A0B E;  4DT0 A;  2KI7 B;  1SFC B;  2KS1 A;  2WWW A;  1BE3 J;  1QEX A;  1H8A A;  2H8P D;  3CX5 I;  1HH0 A;  1KIL A;  1L0L G;  4L74 A;  3VOP A;  4WBA A;  4PJ0 E;  3SWF A;  1AQ5 A;  1JMB A;  1KMI Z;  1M57 D;  3H1J D;  2AXC A;  4N78 D;  4RKU J;  5AVT B;  3BVH A;  4YXD C;  1MFT A;  1PGJ A;  4U3F D;  3GMA A;  3HUS C;  4A7P A;  2C9L Y;  2IZ1 A;  2OTK E;  2HOD B;  3WU2 E;  1QGK B;  3EFG A;  1U7J A;  1PPJ E;  1YI2 P;  2XU6 A;  2WSE J; 
#chains in the Genus database with same CATH homology
 1KYO I;  2FYU J;  1KB9 I;  3H1K J;  1SQQ J;  1BCC J;  1PP9 J;  3BCC J;  5KLV J;  3L72 J;  3H1I J;  3H1H J;  1SQX J;  3L73 J;  1SQP J;  1SQB J;  1SQV J;  3L71 J;  1NTM J;  1EZV I;  4D6T J;  1BE3 J;  3CXH I;  3CX5 I;  3TGU J;  2BCC J;  1NTK J;  3H1J J;  4PD4 I;  3L74 J;  2IBZ I;  4U3F J;  1NU1 J;  1P84 I;  1BGY J;  3L70 J;  3H1L J;  1L0N J;  1NTZ J;  1L0L J;  3L75 J;  3CWB J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...