1EZVI

Structure of the yeast cytochrome bc1 complex co-crystallized with an antibody fv-fragment
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 18
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2000-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ezvI00
1BCCJ 3H1IJ 3BCCJ 4D6TJ 1SQXJ 1L0NJ 1NU1J 1NTZJ 2BCCJ 3H1KJ 3L71J 2FYUJ 3H1HJ 4U3FJ 3TGUJ 1PP9J 1L0LJ 3L75J 1BGYJ 5KLVJ 1NTKJ 3CX5I 4PD4I 3CWBJ 3CXHI 3L73J 1BE3J 1SQBJ 3H1JJ 1SQPJ 1SQVJ 3L74J 1SQQJ 3L72J 2IBZI 1KYOI 3H1LJ 3L70J 1NTMJ 1P84I 1KB9I 1EZVI
chains in the Genus database with same CATH superfamily
3RK3C 2M5AB 1GDTA 1OX3A 1YQ4C 3AE6C 5M1BA 4AYCA 4I7ZC 1YJWP 2A45I 1RF1A 3L74E 4I2LC 1DEBA 3H1KJ 1VQKP 1MFTA 1MV8A 4ZKUA 4U3FJ 4KHXA 3V4QA 3VYIA 3M9BA 1X0TA 4KT0J 1LTTC 2ZYGA 1DEEG 2WSCJ 2BEQD 3V5BA 2E5TA 3CX5I 1KYOD 1JY2P 1LP1B 1PIXA 1R5SA 2B88A 3KDPB 4GIFA 5AW8B 2V7QH 3KZIE 2GUSA 1URQD 3CLQA 1EDIA 1J2JB 1SQPG 4I7ZB 1NTMD 2K9YA 1Q82Q 1SQXK 1IZNB 1BDDA 1KYOH 1SQBK 2QJPB 4JYBA 4A7PA 2M8RA 2FYNC 4H13D 1IK9A 1RQUA 4WY4D 1LTJA 3A7OA 1OVVA 1Q2NA 1BE3D 4JPZB 3RK3B 1R8EA 1SQXD 1T3JA 3L4FA 1IFIA 1SQPD 3M0DC 5CJ4A 1SQBE 4R4MA 3SFDC 1H88A 1NU1K 1KFMA 1LT1A 1YTZT 5AVYB 4GDOA 3H1IJ 1NTKE 4LGDE 4NPEA 3L70D 2YKOA 1EZVE 3FWLA 1USDA 2E76B 4UB8H 1NU1G 3RL0C 1RE3A 1NTZJ 1S5LX 2W6JH 1L0NG 3NTNA 4H0LB 2K9JA 3TSIA 1GL2B 3CD6P 3G6EP 2OYHC 2IZ0A 3GF7A 1FE6A 4ASWA 1IFNA 4IFFA 2Y9ZA 1KN7A 1FZGA 1PGJA 5KLVJ 1LNQA 2M3BA 2WZ7A 3B4SA 1VQ5P 1JTHA 2E76C 5CCGC 2Q6QA 1M1KQ 5TISE 1LT9C 3VMZA 2IDBA 2JDIH 3PH0A 1YJ9P 2FYUE 2HPCB 1QVFO 3JCUH 4WB4A 5E79E 1VQNP 2XZRA 3F5HA 3HD7A 3JCUE 3L71E 1BCCD 3RL0D 1VQ8P 3BCCE 1SQQG 4ZKPA 2YO3A 4QMAA 4U3FE 3CI9A 3P8CE 1N7SB 5AW6B 1G2CB 1UIIA 3T97A 2IZ1A 1FDMA 1FDIA 1P84I 2I1JA 2R5BA 3FXEA 2CPBA 5BVZA 2MKVA 1EC5A 2KYVA 1S5LH 5E79H 1USEA 1HJBA 1VQ9P 2GM4A 2PFXA 2JWAA 3P32A 5AVQB 1KV4A 1KZUB 1G1JA 3A0BE 3CWBD 2KLVA 2XDJA 1J1EC 2R5DA 3H1KG 3R4YA 4W7YA 4OVNF 3WU2H 2Z5IA 3AE8C 3I5CA 1T6AA 2KXPB 3TF5A 2OTLP 1N7LA 1X22A 1MFZA 2L91A 4GOEA 1SQVD 3TNUB 1DX7A 1KC8Q 3LW5J 3MIWA 1NTZK 2BCCE 3KPEA 2AXTE 1SQPJ 2YO2A 4K35A 1NYHA 1GW3A 1X8YA 4HYTB 3HD7D 1NTZE 2A06E 2K37A 2N9YB 3L72J 4OGQC 2IFMA 3CPWO 4H44C 1YTZI 3CXHD 4W80A 2B89A 4H0LD 3EWKA 3CWBE 3HUSB 5AW5B 2WSEJ 4XE5B 1NO4A 2HR3A 3H25A 1A02J 4IOIH 1SP4A 1NAYA 2CPSA 2ZVOB 5KAIE 3SFEC 3I56P 1KQFB 4ZNCA 2H43A 2NPSD 1JY3O 1E5WA 1NTMK 2H89C 2HODA 1FAVA 1BE3E 2PGDA 2XNXA 3LIEA 3Q2YA 1LT9B 2RKLA 1NKNA 2IX7C 3LIDA 3H1HG 2ZXXA 4JYCA 2P2UA 4JQ0D 3SWYA 3Q1MA 2SPZA 1Q7YQ 2H88C 3H32A 3HD7C 3U59A 3BCCD 1OW8A 1JOCA 2G3AA 3CL3D 4LLHA 1LWUB 5APSA 1N73C 3M06A 2Q3IA 2FBWC 1ZR2A 1H89A 3AE7C 3HUSA 4DZOA 1PFIA 1PP9E 2DW3A 1BSHA 1NJIQ 1RE3C 1ZMEC 1ZN5A 5EFWB 3G9RA 3CCLP 1ZV8A 1IFDA 3L74G 1RF1B 5B5EE 3S1KA 5DJTB 5L8RJ 1KD1Q 2WT7A 1PGQA 3L73E 2QEXP 1S5LE 1SFCC 1HGZA 2QSIA 3V2NA 1EZVI 3AEFC 1MZ9A 2FYNB 2Z4EA 3WUVA 1JNMA 3H1LD 1HTLC 3B5ND 3M0AA 2NPSA 1OWAA 5CMZA 5GTHH 5K5GB 3H1HJ 4C7NA 1SQPE 2QIWA 4MN4C 5APQA 3EFGA 4HKZH 5B66H 1KB9E 3H1IE 1VQPP 2OYIC 1ZRTE 4W7ZA 2FFDB 2QM7A 1W2BO 3P7KA 3A2AA 2ZXEB 4L74A 3M9QA 2LR2A 2C9LY 1SQBG 5CCGD 1LTSC 4I6MC 3R2PA 4XA4A 2WTYA 2J59M 2YKPA 2KSEA 1NU1E 2AXTH 2OTKE 1SLQA 1VDFA 2R3CA 1LP1A 1M57D 3G3ZA 4YPCA 1L0NE 3CX5E 1JB0J 2O01N 3KQGA 1WT6A 2E75D 1ZR4A 2NZ2A 2BCCD 3L74D 3B5NC 2JP3A 4L76A 4PD4H 3VP8A 1L0NK 1T2KD 1FU1A 3E7KA 3ABVC 3EQ2A 3Q5PA 1Y47A 3BCCJ 2WSFH 1AQ5A 1JTHB 3AEAC 1RY3A 5AW7B 1KQLA 2H7HA 1L2PA 4IFMA 5B66E 1H8AA 2FYUG 2Q3EA 4UB6E 1HBWA 1DD4A 1QVGO 2OYOA 2ZJSE 1KILD 5AVWB 2OGUA 4PV1B 3KZIH 2KSJA 2Y9YA 2G8YA 3MHVA 3MP7B 5GTIE 2Q9IA 1PGPA 5AW2B 3WUTA 4EDFA 2LXBA 3CXHI 3IF4A 4LC1A 1G2CA 2Y0DA 2YXQB 3FWNA 5KJ7D 3SWFA 2KZIA 2R3SA 1PL5A 2HLOA 1FZCA 3QWOC 5APVA 2KS1B 2W83C 1SQQJ 1PPJE 2YKQA 1AQTA 5APXA 1LGHB 1J1DB 1E79H 5TISH 3H1KE 5B5EH 2ZAEB 4BRYA 3E1IA 3TGUD 2N1TC 1D7MA 1QLED 3KYQA 4OGQB 4EIJA 3ITKA 4U7JA 1NGMB 3C8VA 4PV1D 5KAFH 5KLIB 2O3JA 1CZQA 3CC7P 2E43A 1N7SA 3GHGC 3BRVB 1LTIC 1CI6B 2B87B 2FYUJ 2BCCG 1P84D 1OMIA 1W5CE 3L73D 4HJGH 4OGQD 1YI2P 3M0DA 2AEFA 1KILA 3GG2A 2A06G 1FC2C 1W2EA 3PLNA 1NU1D 3EFFK 1GK6A 2BASA 1SQPK 2O1KA 3L37A 3TK1A 5KJ7A 3CWBG 3L73J 1LTAC 2D2CD 1RHZB 2J58A 1JMBA 5AVUB 1SQBJ 2ZYAA 5TJHA 1EZVD 3A3YB 1NTKD 3W67A 3L72G 3TNUA 1ZRTD 2OYHA 4GKGA 1NHLA 5AW3B 2HODB 2P7JA 4ASVA 3PHLA 3WMM0 1DD3A 1RF1C 3CX5H 2WSSH 1FZEA 3M91A 2RN0A 2WVRA 3L72D 1IC2A 3H32B 1KB9H 5CHXA 1KILB 1KYOE 1T8ZA 3CMAP 3U1CA 3GF3A 1OFCX 2POHA 1N7SD 4Y99B 2BCCJ 1L0LK 1T2KC 2ZVNB 1TU3F 1SS1A 3KXDA 1NTKK 1VPCA 2D2CB 2JWDA 3CMEP 1PP9G 3G4SP 2OTJP 3GLMA 4YTPC 1Q86Q 1L0LG 3L75G 1S4XA 4Z1MH 1NTZD 3H6PA 1VQLP 2OYHB 3BASA 2O01J 3CCMP 3L73G 2QJKB 2OARA 3HE4B 4DT0A 2WMMA 1ZXGA 2E75B 2WT7B 3D71A 3D70A 3TGUE 3HUSC 1SVFA 3B71A 1YIJP 1SQVG 4EI2A 2VRSA 4KJMA 1KYOI 4NPFX 4PJ0E 1OVRA 1EDJA 3O6QA 4I1LA 3V2RA 4EOTA 1JY2O 3AE5C 3H1IG 1KTMA 2ZYDA 1BCCJ 1OW7A 3BVHA 1FOSF 1HH0A 2AXCA 2N9BA 2V7QJ 4IL6X 1S9KD 1S9KE 5GTIH 2KB7P 1HGVA 1OW6A 3AECC 4D6TG 1FZFA 2OYIB 4Y28J 4IL6E 3VOPA 5KLVK 1PGOA 1PP9J 3L35A 3RK3E 1OZHA 3RL0g 1FJPA 1L0LJ 1WRGA 3L75J 4H13C 4EYYQ 1YJNP 1AV1A 5KLVG 2NPSB 3AEDC 5AVTB 2E74B 1KQSO 2FFDC 3O6QB 4RESB 4BXLA 1JEKA 2A06D 2B9BA 1PZQA 3II6A 1IFJA 1LTGC 1S2EA 2KIKA 4GODA 2M5AA 2PP6A 2WQYC 2YXRB 1FJKA 1N7SC 3GHGA 4OWFA 1KMIZ 2E74D 3HE5B 1KQGB 2FY8A 1QGKB 4N6JA 2WSCH 1JM0A 1U7MA 5APUA 3VMXA 1L0ND 3Q5SA 2WITA 3VN0A 2M3EA 1QEXA 2WSEH 2JEEA 2HFED 3IN6A 4CPGA 1JCDA 3B5NA 4YXWH 3RK3D 3CCEP 3L70E 3VP9A 2QM8A 4M3LA 1RE4C 4PV1C 1QX8A 1KB9D 3H1ID 2FXOA 1FS0E 2C0XA 2ZT9B 3PRJA 1NH4A 1NTME 3TYYA 1FZCB 2E5YA 2WPSA 3AEBC 1PPJG 4D6TD 3AE4C 1KORA 1BGYG 4GOFA 1HVVA 2C0WA 2W6AA 1GW4A 1QL2A 2ZT9C 3HE5A 4H44D 3PJSK 1GL2C 1GU5A 1AFOA 1Q90D 2IBZE 4N3YB 1AJYA 3MUDC 5CCGA 1GU4A 4TLFA 2LKMA 4WBAA 5AVXB 1LTJC 1PV3A 2Z5HA 3S9OA 4ZMDA 1EDKA 5KJ7C 1BSNA 3B5NB 1IO4A 2WWWA 2W8ZA 4BWNA 2KZJA 2QJYB 5GTHE 1K8AQ 4HH2A 3F89A 2Q5UA 2K9JB 2KUBA 1EXIA 2YMYA 5KTBA 3CCJP 1IFPA 2KOGA 4B86A 3LW5H 4AUWA 2KS1A 2PAJA 3VTPC 1FDOA 1M1JC 2E74C 1YITP 1NU1J 2FXMA 1M1JA 3FXDA 3L71J 3NFQA 3S4RA 3CC2P 1VQ6P 3SWKA 4BRYB 3I55P 1OXZA 1VQ7P 2YNYA 1JO5A 1M7LA 1SFCA 3L72E 1EDLA 2WPQA 5APYA 1RQVA 3CCRP 3OW2O 3GW6A 2IBZD 1SQXE 2RH0A 2WPRA 2J5UA 2P10A 3CWBJ 2P67A 3VMYA 2QA4P 3AE2C 1NWQA 2ZFCA 3L74J 3FGAD 1MKMA 3CXHE 1YBKA 3OAKA 2BEZF 1H0TA 1L4AA 3HTKA 1URQB 1NTMJ 2V4HA 3HRNA 2QJYC 3V4WA 1L0LE 3L75E 5CCHC 2E75C 4N78E 1YQ3C 2PRRA 3G71P 1JUNA 1U57A 1JCCA 2H8PD 2AEMA 3A0HE 2P1JA 4IL6H 2XU6A 3L36A 3HE4A 2JO1A 1Q81Q 1LWUC 2IFNA 1EQ7A 1JY2N 2M0BA 3TGUG 1SFCD 3A0BH 1GD2E 1SQVE 2MJZA 3MGNA 1S72P 1N73A 2IPPA 2FYUK 4R4LA 1S3JA 4OH8B 1K9MQ 4PD4I 3W68A 4RJTA 1L4AB 1GMJA 3AE1C 3GMAA 1RF0C 1PPJD 1URQA 2KI7B 3HTKB 5KKZB 1RF0A 1URQC 2R44A 1M8OB 3AEGC 1VF5C 1OIPA 4GT1A 1N2DC 1R5LA 3H1LJ 4H44B 2IYOA 2L5GB 3QH9A 4WY4A 2AEJA 4D6TE 1JY3P 1L4AD 5CBNA 1YHQP 1M90Q 1LT9A 3D6ZA 4XFJA 1OVUA 1BCCG 2FYUD 5AW9B 4U3FD 3IAOA 1SQQD 1P84H 1RH5B 2GA1A 5KLVE 3VMAA 2QJPC 5H2FE 3H1JE 3H1LE 2YIUC 1NAFA 3RK2B 2NPSC 2WPVB 1N86A 3TGUJ 2KK7A 1Y8AA 1G1IA 1ZOYC 2E42A 2ITAA 2QE7H 3USSA 5KAIH 1M56D 1IFMA 3GHGB 1LTBC 3CCSP 1BDCA 1NTKJ 2I1KA 1LJ2A 1JMMA 2OYIA 1PP9D 3KHUA 2IYPA 1L0LD 1GL2D 3L75D 1KFNA 1QL1A 2P58A 3A0HH 3OA7A 1FBMA 2QVAA 3CXHH 4L73A 4UB6H 1A02F 1VQ4P 4JF7A 4WWIA 2A45H 4N78D 5BU8B 3RBXA 5CBOA 3L70G 1WMKA 4PD4D 1NVOA 3N7NA 4DOJA 4DCKA 1SQBD 3V6IA 3MUDA 3CCVP 2N1TD 2XNDH 4C7NB 1J1DC 5DJUB 5BU5A 1NTMG 1HF9A 4HB1A 3V2QA 1T3UA 1BGYE 5CJ0A 1LTJB 1Z56A 1BGYD 1SQXJ 2GUVA 5AVRB 2IBZG 4TT3H 3TDKA 1GZLA 3AEEC 1IK7A 1L4AC 2W90A 3ZDMA 2A45G 1XTGB 1VF5D 1FZBA 3BATA 2HPCA 4YXDC 2Y0CA 1BGYJ 1NTKG 2XV5A 1CSBA 2LXCB 3HD7B 2KNCA 1EZVG 3C1LA 4Y99C 3WU2E 4C46A 2KP8A 2O01H 2QG4A 5H2FH 1CI6A 1KILC 1IJDB 1X79B 3BRTB 5APWA 1GL2A 1P84E 2W6BA 4RKUJ 3RGUA 2W27A 4O9BA 3H1JJ 5KAFE 1K04A 2R32A 4NPDA 5AW4B 2Y0EA 2E76D 3AE9C 3JC22 1CW5A 2YMKA 3RK2D 1UIXA 1X9VA 5KLIC 4RO0A 1AA0A 1RE4A 2N1TA 3H1JD 3MD0A 1HJ0A 3CC4P 3H1KD 1SQQK 3MZWB 2FFDA 3H1HD 3D6YA 1AVYA 3B8EB 5CCHD 1SQXG 2KNCB 3L71G 3T97B 4PJ0H 3Q3DA 3BCCG 1SQQE 3OJAB 4U3FG 1K73Q 1EXJA 3UIAA 2O1JA 1NOHA 1ZLLA 1K05A 3U1AA 2K88A 2JJLA 4UB8E 2NRGA 1HWTC 4PD4E 1NKZB 3CCUP 3L71D 2YIUB 4JBZA 1XTCC 4H13B 3RK2C 2QRXA 1J1EB 1M1JB 3MTUE 1FOSE 3P8MC 5AVVB 1BE3J 2N1TB 3C9IA 5AW0B 2K3RA 2RMZA 1N8RQ 1AVOA 1SFCB 3JSVC 1SQVJ 3NXSA 2Q1KA 5AW1B 3O8ZA 3SSUA 4C7RA 2CK3H 2IBZI 3L70J 3FX0A 5C39A 3V2PA 1VQMP 2HYNA 2JKVA 2B87A 3K5BA 5KKZC 1VQOP 1DH3A 4K3AA 2Q7CA 1VF5B 3PTZA 1VL2A 5CCHA 1N73B 1FZAA 4WY4C 1MUUA 2WSFJ 4D6TJ 1NTZG 1SQVK 1ZW0A 1L0NJ 3CX5D 5KLVD 1GK4A 1U7JA 3E1RA 1LWUA 4L75A 3A5TA 2OQQA 3CCQP 1H0TB 1FZCC 2HG5D 2QJKC 1S1CX 3M9HA 1YYCA 3IR9A 3AE3C 2UWJE 2K1AA 2FKWB 3RL0B 4AQRD 4WVZA 4WY4B 2D2CC 3P8CD 5APTA 1BE3G 1Y9BA 4H0LC 3WUUA 1GTWA 2C9NY 2JR8A 1BCCE 5AVZB 4DJGA 1HUCA 2ZT9D 2FXPA 3H1HE 4IFDK 3NMDA 5AVSB 2I8DA 2FYZA 3H1JG 3IFMA 3PP5A 3Q5RA 1DIPA 3H1LG 3RBZA 1KILE 1ZP0C 2XKMA 3N4XA 1JY3N 2KLUA 1KB9I
chains in the Genus database with same CATH topology
1BCCJ 3H1IJ 3BCCJ 4D6TJ 1SQXJ 1L0NJ 1NU1J 1NTZJ 2BCCJ 3H1KJ 3L71J 2FYUJ 3H1HJ 4U3FJ 3TGUJ 1PP9J 1L0LJ 3L75J 1BGYJ 5KLVJ 1NTKJ 3CX5I 4PD4I 3CWBJ 3CXHI 3L73J 1BE3J 1SQBJ 3H1JJ 1SQPJ 1SQVJ 3L74J 1SQQJ 3L72J 2IBZI 1KYOI 3H1LJ 3L70J 1NTMJ 1P84I 1KB9I 1EZVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  3H1I J;  3BCC J;  4D6T J;  1SQX J;  1L0N J;  1NU1 J;  1NTZ J;  2BCC J;  3H1K J;  3L71 J;  2FYU J;  3H1H J;  4U3F J;  3TGU J;  1PP9 J;  1L0L J;  3L75 J;  1BGY J;  5KLV J;  1NTK J;  3CX5 I;  4PD4 I;  3CWB J;  3CXH I;  3L73 J;  1BE3 J;  1SQB J;  3H1J J;  1SQP J;  1SQV J;  3L74 J;  1SQQ J;  3L72 J;  2IBZ I;  1KYO I;  3H1L J;  3L70 J;  1NTM J;  1P84 I;  1KB9 I;  1EZV I; 
#chains in the Genus database with same CATH topology
 3RK3 C;  2M5A B;  1GDT A;  1OX3 A;  1YQ4 C;  3AE6 C;  5M1B A;  4AYC A;  4I7Z C;  1YJW P;  2A45 I;  1RF1 A;  3L74 E;  4I2L C;  1DEB A;  3H1K J;  1VQK P;  1MFT A;  1MV8 A;  4ZKU A;  4U3F J;  4KHX A;  3V4Q A;  3VYI A;  3M9B A;  1X0T A;  4KT0 J;  1LTT C;  2ZYG A;  1DEE G;  2WSC J;  2BEQ D;  3V5B A;  2E5T A;  3CX5 I;  1KYO D;  1JY2 P;  1LP1 B;  1PIX A;  1R5S A;  2B88 A;  3KDP B;  4GIF A;  5AW8 B;  2V7Q H;  3KZI E;  2GUS A;  1URQ D;  3CLQ A;  1EDI A;  1J2J B;  1SQP G;  4I7Z B;  1NTM D;  2K9Y A;  1Q82 Q;  1SQX K;  1IZN B;  1BDD A;  1KYO H;  1SQB K;  2QJP B;  4JYB A;  4A7P A;  2M8R A;  2FYN C;  4H13 D;  1IK9 A;  1RQU A;  4WY4 D;  1LTJ A;  3A7O A;  1OVV A;  1Q2N A;  1BE3 D;  4JPZ B;  3RK3 B;  1R8E A;  1SQX D;  1T3J A;  3L4F A;  1IFI A;  1SQP D;  3M0D C;  5CJ4 A;  1SQB E;  4R4M A;  3SFD C;  1H88 A;  1NU1 K;  1KFM A;  1LT1 A;  1YTZ T;  5AVY B;  4GDO A;  3H1I J;  1NTK E;  4LGD E;  4NPE A;  3L70 D;  2YKO A;  1EZV E;  3FWL A;  1USD A;  2E76 B;  4UB8 H;  1NU1 G;  3RL0 C;  1RE3 A;  1NTZ J;  1S5L X;  2W6J H;  1L0N G;  3NTN A;  4H0L B;  2K9J A;  3TSI A;  1GL2 B;  3CD6 P;  3G6E P;  2OYH C;  2IZ0 A;  3GF7 A;  1FE6 A;  4ASW A;  1IFN A;  4IFF A;  2Y9Z A;  1KN7 A;  1FZG A;  1PGJ A;  5KLV J;  1LNQ A;  2M3B A;  2WZ7 A;  3B4S A;  1VQ5 P;  1JTH A;  2E76 C;  5CCG C;  2Q6Q A;  1M1K Q;  5TIS E;  1LT9 C;  3VMZ A;  2IDB A;  2JDI H;  3PH0 A;  1YJ9 P;  2FYU E;  2HPC B;  1QVF O;  3JCU H;  4WB4 A;  5E79 E;  1VQN P;  2XZR A;  3F5H A;  3HD7 A;  3JCU E;  3L71 E;  1BCC D;  3RL0 D;  1VQ8 P;  3BCC E;  1SQQ G;  4ZKP A;  2YO3 A;  4QMA A;  4U3F E;  3CI9 A;  3P8C E;  1N7S B;  5AW6 B;  1G2C B;  1UII A;  3T97 A;  2IZ1 A;  1FDM A;  1FDI A;  1P84 I;  2I1J A;  2R5B A;  3FXE A;  2CPB A;  5BVZ A;  2MKV A;  1EC5 A;  2KYV A;  1S5L H;  5E79 H;  1USE A;  1HJB A;  1VQ9 P;  2GM4 A;  2PFX A;  2JWA A;  3P32 A;  5AVQ B;  1KV4 A;  1KZU B;  1G1J A;  3A0B E;  3CWB D;  2KLV A;  2XDJ A;  1J1E C;  2R5D A;  3H1K G;  3R4Y A;  4W7Y A;  4OVN F;  3WU2 H;  2Z5I A;  3AE8 C;  3I5C A;  1T6A A;  2KXP B;  3TF5 A;  2OTL P;  1N7L A;  1X22 A;  1MFZ A;  2L91 A;  4GOE A;  1SQV D;  3TNU B;  1DX7 A;  1KC8 Q;  3LW5 J;  3MIW A;  1NTZ K;  2BCC E;  3KPE A;  2AXT E;  1SQP J;  2YO2 A;  4K35 A;  1NYH A;  1GW3 A;  1X8Y A;  4HYT B;  3HD7 D;  1NTZ E;  2A06 E;  2K37 A;  2N9Y B;  3L72 J;  4OGQ C;  2IFM A;  3CPW O;  4H44 C;  1YTZ I;  3CXH D;  4W80 A;  2B89 A;  4H0L D;  3EWK A;  3CWB E;  3HUS B;  5AW5 B;  2WSE J;  4XE5 B;  1NO4 A;  2HR3 A;  3H25 A;  1A02 J;  4IOI H;  1SP4 A;  1NAY A;  2CPS A;  2ZVO B;  5KAI E;  3SFE C;  3I56 P;  1KQF B;  4ZNC A;  2H43 A;  2NPS D;  1JY3 O;  1E5W A;  1NTM K;  2H89 C;  2HOD A;  1FAV A;  1BE3 E;  2PGD A;  2XNX A;  3LIE A;  3Q2Y A;  1LT9 B;  2RKL A;  1NKN A;  2IX7 C;  3LID A;  3H1H G;  2ZXX A;  4JYC A;  2P2U A;  4JQ0 D;  3SWY A;  3Q1M A;  2SPZ A;  1Q7Y Q;  2H88 C;  3H32 A;  3HD7 C;  3U59 A;  3BCC D;  1OW8 A;  1JOC A;  2G3A A;  3CL3 D;  4LLH A;  1LWU B;  5APS A;  1N73 C;  3M06 A;  2Q3I A;  2FBW C;  1ZR2 A;  1H89 A;  3AE7 C;  3HUS A;  4DZO A;  1PFI A;  1PP9 E;  2DW3 A;  1BSH A;  1NJI Q;  1RE3 C;  1ZME C;  1ZN5 A;  5EFW B;  3G9R A;  3CCL P;  1ZV8 A;  1IFD A;  3L74 G;  1RF1 B;  5B5E E;  3S1K A;  5DJT B;  5L8R J;  1KD1 Q;  2WT7 A;  1PGQ A;  3L73 E;  2QEX P;  1S5L E;  1SFC C;  1HGZ A;  2QSI A;  3V2N A;  1EZV I;  3AEF C;  1MZ9 A;  2FYN B;  2Z4E A;  3WUV A;  1JNM A;  3H1L D;  1HTL C;  3B5N D;  3M0A A;  2NPS A;  1OWA A;  5CMZ A;  5GTH H;  5K5G B;  3H1H J;  4C7N A;  1SQP E;  2QIW A;  4MN4 C;  5APQ A;  3EFG A;  4HKZ H;  5B66 H;  1KB9 E;  3H1I E;  1VQP P;  2OYI C;  1ZRT E;  4W7Z A;  2FFD B;  2QM7 A;  1W2B O;  3P7K A;  3A2A A;  2ZXE B;  4L74 A;  3M9Q A;  2LR2 A;  2C9L Y;  1SQB G;  5CCG D;  1LTS C;  4I6M C;  3R2P A;  4XA4 A;  2WTY A;  2J59 M;  2YKP A;  2KSE A;  1NU1 E;  2AXT H;  2OTK E;  1SLQ A;  1VDF A;  2R3C A;  1LP1 A;  1M57 D;  3G3Z A;  4YPC A;  1L0N E;  3CX5 E;  1JB0 J;  2O01 N;  3KQG A;  1WT6 A;  2E75 D;  1ZR4 A;  2NZ2 A;  2BCC D;  3L74 D;  3B5N C;  2JP3 A;  4L76 A;  4PD4 H;  3VP8 A;  1L0N K;  1T2K D;  1FU1 A;  3E7K A;  3ABV C;  3EQ2 A;  3Q5P A;  1Y47 A;  3BCC J;  2WSF H;  1AQ5 A;  1JTH B;  3AEA C;  1RY3 A;  5AW7 B;  1KQL A;  2H7H A;  1L2P A;  4IFM A;  5B66 E;  1H8A A;  2FYU G;  2Q3E A;  4UB6 E;  1HBW A;  1DD4 A;  1QVG O;  2OYO A;  2ZJS E;  1KIL D;  5AVW B;  2OGU A;  4PV1 B;  3KZI H;  2KSJ A;  2Y9Y A;  2G8Y A;  3MHV A;  3MP7 B;  5GTI E;  2Q9I A;  1PGP A;  5AW2 B;  3WUT A;  4EDF A;  2LXB A;  3CXH I;  3IF4 A;  4LC1 A;  1G2C A;  2Y0D A;  2YXQ B;  3FWN A;  5KJ7 D;  3SWF A;  2KZI A;  2R3S A;  1PL5 A;  2HLO A;  1FZC A;  3QWO C;  5APV A;  2KS1 B;  2W83 C;  1SQQ J;  1PPJ E;  2YKQ A;  1AQT A;  5APX A;  1LGH B;  1J1D B;  1E79 H;  5TIS H;  3H1K E;  5B5E H;  2ZAE B;  4BRY A;  3E1I A;  3TGU D;  2N1T C;  1D7M A;  1QLE D;  3KYQ A;  4OGQ B;  4EIJ A;  3ITK A;  4U7J A;  1NGM B;  3C8V A;  4PV1 D;  5KAF H;  5KLI B;  2O3J A;  1CZQ A;  3CC7 P;  2E43 A;  1N7S A;  3GHG C;  3BRV B;  1LTI C;  1CI6 B;  2B87 B;  2FYU J;  2BCC G;  1P84 D;  1OMI A;  1W5C E;  3L73 D;  4HJG H;  4OGQ D;  1YI2 P;  3M0D A;  2AEF A;  1KIL A;  3GG2 A;  2A06 G;  1FC2 C;  1W2E A;  3PLN A;  1NU1 D;  3EFF K;  1GK6 A;  2BAS A;  1SQP K;  2O1K A;  3L37 A;  3TK1 A;  5KJ7 A;  3CWB G;  3L73 J;  1LTA C;  2D2C D;  1RHZ B;  2J58 A;  1JMB A;  5AVU B;  1SQB J;  2ZYA A;  5TJH A;  1EZV D;  3A3Y B;  1NTK D;  3W67 A;  3L72 G;  3TNU A;  1ZRT D;  2OYH A;  4GKG A;  1NHL A;  5AW3 B;  2HOD B;  2P7J A;  4ASV A;  3PHL A;  3WMM 0;  1DD3 A;  1RF1 C;  3CX5 H;  2WSS H;  1FZE A;  3M91 A;  2RN0 A;  2WVR A;  3L72 D;  1IC2 A;  3H32 B;  1KB9 H;  5CHX A;  1KIL B;  1KYO E;  1T8Z A;  3CMA P;  3U1C A;  3GF3 A;  1OFC X;  2POH A;  1N7S D;  4Y99 B;  2BCC J;  1L0L K;  1T2K C;  2ZVN B;  1TU3 F;  1SS1 A;  3KXD A;  1NTK K;  1VPC A;  2D2C B;  2JWD A;  3CME P;  1PP9 G;  3G4S P;  2OTJ P;  3GLM A;  4YTP C;  1Q86 Q;  1L0L G;  3L75 G;  1S4X A;  4Z1M H;  1NTZ D;  3H6P A;  1VQL P;  2OYH B;  3BAS A;  2O01 J;  3CCM P;  3L73 G;  2QJK B;  2OAR A;  3HE4 B;  4DT0 A;  2WMM A;  1ZXG A;  2E75 B;  2WT7 B;  3D71 A;  3D70 A;  3TGU E;  3HUS C;  1SVF A;  3B71 A;  1YIJ P;  1SQV G;  4EI2 A;  2VRS A;  4KJM A;  1KYO I;  4NPF X;  4PJ0 E;  1OVR A;  1EDJ A;  3O6Q A;  4I1L A;  3V2R A;  4EOT A;  1JY2 O;  3AE5 C;  3H1I G;  1KTM A;  2ZYD A;  1BCC J;  1OW7 A;  3BVH A;  1FOS F;  1HH0 A;  2AXC A;  2N9B A;  2V7Q J;  4IL6 X;  1S9K D;  1S9K E;  5GTI H;  2KB7 P;  1HGV A;  1OW6 A;  3AEC C;  4D6T G;  1FZF A;  2OYI B;  4Y28 J;  4IL6 E;  3VOP A;  5KLV K;  1PGO A;  1PP9 J;  3L35 A;  3RK3 E;  1OZH A;  3RL0 g;  1FJP A;  1L0L J;  1WRG A;  3L75 J;  4H13 C;  4EYY Q;  1YJN P;  1AV1 A;  5KLV G;  2NPS B;  3AED C;  5AVT B;  2E74 B;  1KQS O;  2FFD C;  3O6Q B;  4RES B;  4BXL A;  1JEK A;  2A06 D;  2B9B A;  1PZQ A;  3II6 A;  1IFJ A;  1LTG C;  1S2E A;  2KIK A;  4GOD A;  2M5A A;  2PP6 A;  2WQY C;  2YXR B;  1FJK A;  1N7S C;  3GHG A;  4OWF A;  1KMI Z;  2E74 D;  3HE5 B;  1KQG B;  2FY8 A;  1QGK B;  4N6J A;  2WSC H;  1JM0 A;  1U7M A;  5APU A;  3VMX A;  1L0N D;  3Q5S A;  2WIT A;  3VN0 A;  2M3E A;  1QEX A;  2WSE H;  2JEE A;  2HFE D;  3IN6 A;  4CPG A;  1JCD A;  3B5N A;  4YXW H;  3RK3 D;  3CCE P;  3L70 E;  3VP9 A;  2QM8 A;  4M3L A;  1RE4 C;  4PV1 C;  1QX8 A;  1KB9 D;  3H1I D;  2FXO A;  1FS0 E;  2C0X A;  2ZT9 B;  3PRJ A;  1NH4 A;  1NTM E;  3TYY A;  1FZC B;  2E5Y A;  2WPS A;  3AEB C;  1PPJ G;  4D6T D;  3AE4 C;  1KOR A;  1BGY G;  4GOF A;  1HVV A;  2C0W A;  2W6A A;  1GW4 A;  1QL2 A;  2ZT9 C;  3HE5 A;  4H44 D;  3PJS K;  1GL2 C;  1GU5 A;  1AFO A;  1Q90 D;  2IBZ E;  4N3Y B;  1AJY A;  3MUD C;  5CCG A;  1GU4 A;  4TLF A;  2LKM A;  4WBA A;  5AVX B;  1LTJ C;  1PV3 A;  2Z5H A;  3S9O A;  4ZMD A;  1EDK A;  5KJ7 C;  1BSN A;  3B5N B;  1IO4 A;  2WWW A;  2W8Z A;  4BWN A;  2KZJ A;  2QJY B;  5GTH E;  1K8A Q;  4HH2 A;  3F89 A;  2Q5U A;  2K9J B;  2KUB A;  1EXI A;  2YMY A;  5KTB A;  3CCJ P;  1IFP A;  2KOG A;  4B86 A;  3LW5 H;  4AUW A;  2KS1 A;  2PAJ A;  3VTP C;  1FDO A;  1M1J C;  2E74 C;  1YIT P;  1NU1 J;  2FXM A;  1M1J A;  3FXD A;  3L71 J;  3NFQ A;  3S4R A;  3CC2 P;  1VQ6 P;  3SWK A;  4BRY B;  3I55 P;  1OXZ A;  1VQ7 P;  2YNY A;  1JO5 A;  1M7L A;  1SFC A;  3L72 E;  1EDL A;  2WPQ A;  5APY A;  1RQV A;  3CCR P;  3OW2 O;  3GW6 A;  2IBZ D;  1SQX E;  2RH0 A;  2WPR A;  2J5U A;  2P10 A;  3CWB J;  2P67 A;  3VMY A;  2QA4 P;  3AE2 C;  1NWQ A;  2ZFC A;  3L74 J;  3FGA D;  1MKM A;  3CXH E;  1YBK A;  3OAK A;  2BEZ F;  1H0T A;  1L4A A;  3HTK A;  1URQ B;  1NTM J;  2V4H A;  3HRN A;  2QJY C;  3V4W A;  1L0L E;  3L75 E;  5CCH C;  2E75 C;  4N78 E;  1YQ3 C;  2PRR A;  3G71 P;  1JUN A;  1U57 A;  1JCC A;  2H8P D;  2AEM A;  3A0H E;  2P1J A;  4IL6 H;  2XU6 A;  3L36 A;  3HE4 A;  2JO1 A;  1Q81 Q;  1LWU C;  2IFN A;  1EQ7 A;  1JY2 N;  2M0B A;  3TGU G;  1SFC D;  3A0B H;  1GD2 E;  1SQV E;  2MJZ A;  3MGN A;  1S72 P;  1N73 A;  2IPP A;  2FYU K;  4R4L A;  1S3J A;  4OH8 B;  1K9M Q;  4PD4 I;  3W68 A;  4RJT A;  1L4A B;  1GMJ A;  3AE1 C;  3GMA A;  1RF0 C;  1PPJ D;  1URQ A;  2KI7 B;  3HTK B;  5KKZ B;  1RF0 A;  1URQ C;  2R44 A;  1M8O B;  3AEG C;  1VF5 C;  1OIP A;  4GT1 A;  1N2D C;  1R5L A;  3H1L J;  4H44 B;  2IYO A;  2L5G B;  3QH9 A;  4WY4 A;  2AEJ A;  4D6T E;  1JY3 P;  1L4A D;  5CBN A;  1YHQ P;  1M90 Q;  1LT9 A;  3D6Z A;  4XFJ A;  1OVU A;  1BCC G;  2FYU D;  5AW9 B;  4U3F D;  3IAO A;  1SQQ D;  1P84 H;  1RH5 B;  2GA1 A;  5KLV E;  3VMA A;  2QJP C;  5H2F E;  3H1J E;  3H1L E;  2YIU C;  1NAF A;  3RK2 B;  2NPS C;  2WPV B;  1N86 A;  3TGU J;  2KK7 A;  1Y8A A;  1G1I A;  1ZOY C;  2E42 A;  2ITA A;  2QE7 H;  3USS A;  5KAI H;  1M56 D;  1IFM A;  3GHG B;  1LTB C;  3CCS P;  1BDC A;  1NTK J;  2I1K A;  1LJ2 A;  1JMM A;  2OYI A;  1PP9 D;  3KHU A;  2IYP A;  1L0L D;  1GL2 D;  3L75 D;  1KFN A;  1QL1 A;  2P58 A;  3A0H H;  3OA7 A;  1FBM A;  2QVA A;  3CXH H;  4L73 A;  4UB6 H;  1A02 F;  1VQ4 P;  4JF7 A;  4WWI A;  2A45 H;  4N78 D;  5BU8 B;  3RBX A;  5CBO A;  3L70 G;  1WMK A;  4PD4 D;  1NVO A;  3N7N A;  4DOJ A;  4DCK A;  1SQB D;  3V6I A;  3MUD A;  3CCV P;  2N1T D;  2XND H;  4C7N B;  1J1D C;  5DJU B;  5BU5 A;  1NTM G;  1HF9 A;  4HB1 A;  3V2Q A;  1T3U A;  1BGY E;  5CJ0 A;  1LTJ B;  1Z56 A;  1BGY D;  1SQX J;  2GUV A;  5AVR B;  2IBZ G;  4TT3 H;  3TDK A;  1GZL A;  3AEE C;  1IK7 A;  1L4A C;  2W90 A;  3ZDM A;  2A45 G;  1XTG B;  1VF5 D;  1FZB A;  3BAT A;  2HPC A;  4YXD C;  2Y0C A;  1BGY J;  1NTK G;  2XV5 A;  1CSB A;  2LXC B;  3HD7 B;  2KNC A;  1EZV G;  3C1L A;  4Y99 C;  3WU2 E;  4C46 A;  2KP8 A;  2O01 H;  2QG4 A;  5H2F H;  1CI6 A;  1KIL C;  1IJD B;  1X79 B;  3BRT B;  5APW A;  1GL2 A;  1P84 E;  2W6B A;  4RKU J;  3RGU A;  2W27 A;  4O9B A;  3H1J J;  5KAF E;  1K04 A;  2R32 A;  4NPD A;  5AW4 B;  2Y0E A;  2E76 D;  3AE9 C;  3JC2 2;  1CW5 A;  2YMK A;  3RK2 D;  1UIX A;  1X9V A;  5KLI C;  4RO0 A;  1AA0 A;  1RE4 A;  2N1T A;  3H1J D;  3MD0 A;  1HJ0 A;  3CC4 P;  3H1K D;  1SQQ K;  3MZW B;  2FFD A;  3H1H D;  3D6Y A;  1AVY A;  3B8E B;  5CCH D;  1SQX G;  2KNC B;  3L71 G;  3T97 B;  4PJ0 H;  3Q3D A;  3BCC G;  1SQQ E;  3OJA B;  4U3F G;  1K73 Q;  1EXJ A;  3UIA A;  2O1J A;  1NOH A;  1ZLL A;  1K05 A;  3U1A A;  2K88 A;  2JJL A;  4UB8 E;  2NRG A;  1HWT C;  4PD4 E;  1NKZ B;  3CCU P;  3L71 D;  2YIU B;  4JBZ A;  1XTC C;  4H13 B;  3RK2 C;  2QRX A;  1J1E B;  1M1J B;  3MTU E;  1FOS E;  3P8M C;  5AVV B;  1BE3 J;  2N1T B;  3C9I A;  5AW0 B;  2K3R A;  2RMZ A;  1N8R Q;  1AVO A;  1SFC B;  3JSV C;  1SQV J;  3NXS A;  2Q1K A;  5AW1 B;  3O8Z A;  3SSU A;  4C7R A;  2CK3 H;  2IBZ I;  3L70 J;  3FX0 A;  5C39 A;  3V2P A;  1VQM P;  2HYN A;  2JKV A;  2B87 A;  3K5B A;  5KKZ C;  1VQO P;  1DH3 A;  4K3A A;  2Q7C A;  1VF5 B;  3PTZ A;  1VL2 A;  5CCH A;  1N73 B;  1FZA A;  4WY4 C;  1MUU A;  2WSF J;  4D6T J;  1NTZ G;  1SQV K;  1ZW0 A;  1L0N J;  3CX5 D;  5KLV D;  1GK4 A;  1U7J A;  3E1R A;  1LWU A;  4L75 A;  3A5T A;  2OQQ A;  3CCQ P;  1H0T B;  1FZC C;  2HG5 D;  2QJK C;  1S1C X;  3M9H A;  1YYC A;  3IR9 A;  3AE3 C;  2UWJ E;  2K1A A;  2FKW B;  3RL0 B;  4AQR D;  4WVZ A;  4WY4 B;  2D2C C;  3P8C D;  5APT A;  1BE3 G;  1Y9B A;  4H0L C;  3WUU A;  1GTW A;  2C9N Y;  2JR8 A;  1BCC E;  5AVZ B;  4DJG A;  1HUC A;  2ZT9 D;  2FXP A;  3H1H E;  4IFD K;  3NMD A;  5AVS B;  2I8D A;  2FYZ A;  3H1J G;  3IFM A;  3PP5 A;  3Q5R A;  1DIP A;  3H1L G;  3RBZ A;  1KIL E;  1ZP0 C;  2XKM A;  3N4X A;  1JY3 N;  2KLU A;  1KB9 I; 
#chains in the Genus database with same CATH homology
 1BCC J;  3H1I J;  3BCC J;  4D6T J;  1SQX J;  1L0N J;  1NU1 J;  1NTZ J;  2BCC J;  3H1K J;  3L71 J;  2FYU J;  3H1H J;  4U3F J;  3TGU J;  1PP9 J;  1L0L J;  3L75 J;  1BGY J;  5KLV J;  1NTK J;  3CX5 I;  4PD4 I;  3CWB J;  3CXH I;  3L73 J;  1BE3 J;  1SQB J;  3H1J J;  1SQP J;  1SQV J;  3L74 J;  1SQQ J;  3L72 J;  2IBZ I;  1KYO I;  3H1L J;  3L70 J;  1NTM J;  1P84 I;  1KB9 I;  1EZV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...