5B66H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b66H01
3JCUH 5GTIH 4PJ0H 5E79H 3A0BH 3KZIH 5KAIH 5GTHH 2AXTH 4UB6H 4UB8H 3A0HH 5KAFH 3WU2H 5TISH 5B5EH 4IL6H 1S5LH 5B66H 5H2FH
chains in the Genus database with same CATH superfamily
4GKGA 2WSFH 2N1TC 1J1DC 1U7MA 1SS1A 2FYZA 4GT1A 2Y9ZA 1S5LX 2WZ7A 4H13B 1S4XA 4DT0A 1PGOA 2Z5IA 2YIUB 1EDLA 2QJYB 4Y28J 2FYUJ 2J5UA 3USSA 2P67A 3CCJP 1HF9A 1YTZT 2IZ1A 3D71A 1L0LJ 3V2NA 2HPCB 1VQLP 4B86A 1URQB 4L73A 3VMYA 2ITAA 3IAOA 4Y99C 1NTZE 3OAKA 1YIJP 2Y0EA 3GG2A 5CCGA 1VQPP 5APWA 3BCCD 3WMM0 1ZMEC 3M0AA 1EZVG 3B5ND 1VPCA 2O1JA 2L5GB 5KLIB 2FXPA 5AW3B 1H89A 3NXSA 2W6BA 3PTZA 1YHQP 4RESB 4HJGH 1M7LA 2WPQA 1LT1A 1KYOE 3HD7A 1S5LE 1P84I 3H1JE 4KHXA 1DD3A 1RF0C 3B5NB 2KS1B 4IOIH 5CBOA 1HUCA 1AJYA 2FYUK 2G3AA 3H1ID 1NTZJ 2H88C 3CCVP 1NKNA 3M06A 2LR2A 5CCHD 1S1CX 1UIIA 3P8CE 2YMYA 1RQUA 4D6TD 1G1JA 2E5YA 3HRNA 2CPSA 2K3RA 2V4HA 2KNCB 3OJAB 2JDIH 1Y47A 4L75A 3JCUH 1QL2A 2OTKE 3L4FA 1GW4A 3M0DA 2LKMA 3TYYA 1KB9E 3VMZA 3KZIE 3MIWA 3T97B 2Q3EA 3M9BA 5TISH 2E75D 3H1JJ 1J1EC 1SQBD 5K5GB 4H13C 3S1KA 2W6JH 1DX7A 2M3BA 2PP6A 2HG5D 2QJYC 2YXRB 1LT9B 1Q7YQ 3VYIA 1K9MQ 1BGYE 2ZFCA 1URQC 1NTZK 1HJ0A 1W2EA 2E75B 1Z56A 1KQSO 4M3LA 3L74E 3P7KA 3E1IA 3ZDMA 2HODA 3FGAD 1MV8A 3F5HA 1R8EA 1KTMA 5KLIC 2A45I 3HD7C 2OYOA 1Q81Q 3Q3DA 2Q1KA 1VQ5P 1JY3O 4NPDA 4RKUJ 2KLUA 5M1BA 1PPJE 4HB1A 3H1LJ 1IJDB 1AQ5A 1PL5A 1ZXGA 2OYHB 3CX5I 1GU4A 1P84H 3AE8C 2IBZI 3HE4B 2Z5HA 1SP4A 4NPEA 2AXTH 4N6JA 5AVRB 3B5NC 3VMXA 3H1HD 1SQXG 1QVGO 1FZAA 1BGYJ 1D7MA 2GUSA 2B87B 2Y0DA 3IF4A 1JCDA 4OWFA 2FYNB 1BE3D 1L0NE 4WY4D 3AEBC 2IYOA 1H0TB 1RH5B 3L74J 2HR3A 3OW2O 5AVSB 3TK1A 3H1KE 3KPEA 3CMEP 3H32B 3II6A 2BASA 4R4LA 1NGMB 1PP9D 1RQVA 2Y0CA 4BRYB 3W68A 4WY4B 1GL2D 3FXDA 2DW3A 2XKMA 1RE3C 4AYCA 1EXIA 2K9JA 5CCHC 3AE1C 4H44D 2E5TA 1FZBA 2Q7CA 1NTKG 3AECC 1G2CB 4DZOA 2H43A 1NU1E 2K9YA 1BSHA 1KILA 1GK6A 5L8RJ 1S72P 1PFIA 2WQYC 4XA4A 1SQQG 1GL2B 2R5DA 4UB6H 1CI6B 2O01N 4I2LC 4N3YB 2FKWB 3GMAA 2ZXEB 3B8EB 4H44B 1M1JA 3H1KJ 2C9NY 3FX0A 2A06E 2E75C 3WU2E 5KJ7A 2E76D 1NAFA 1SQPE 1BDDA 2QJKC 2FXMA 1OZHA 3AE2C 4A7PA 4L76A 2FXOA 2A45H 3H25A 3I56P 3H1IJ 1EZVD 2MJZA 4CPGA 4JBZA 1QEXA 1BSNA 4LGDE 2I1JA 2AEMA 1BCCG 1X22A 2E76B 3CX5H 1KQLA 1JY2P 2E74C 1GK4A 4D6TJ 3Q5PA 1ZP0C 3CCSP 4I6MC 1JTHB 2IFMA 3VOPA 3M9HA 2O01J 1UIXA 1XTGB 5KLVD 2WVRA 2QIWA 3S4RA 4IL6E 3KHUA 1YYCA 2FYNC 3V2PA 1WMKA 2H7HA 1KYOH 3PRJA 2QM8A 1SQQK 1JMBA 1N7SC 1VQKP 1MFZA 4DCKA 2BCCG 4C7RA 2YNYA 1KILC 4C7NB 3SFEC 2ZVNB 1KILE 1X9VA 4PD4D 3P8MC 3N7NA 3KDPB 5AVYB 2NPSD 1MZ9A 2M5AB 3KYQA 4WB4A 3L36A 1Y9BA 1OW8A 1GZLA 2ZYAA 3V5BA 4EDFA 1KB9H 5B5EE 1SLQA 4U3FG 3JC22 3KZIH 3EWKA 3L70E 2XNXA 1QVFO 1VF5C 1L4AD 5KAIE 3KXDA 3AEFC 1FZCC 2R3SA 3TGUE 2NPSB 1NOHA 2O3JA 3R2PA 1T3JA 1SQBK 4YTPC 1OVUA 2IPPA 2FYUE 5KTBA 1NTMG 3Q5RA 2O1KA 3CXHD 3H1HJ 1BE3J 2E43A 1RF0A 1NKZB 3W67A 1ZRTE 1L4AB 2KUBA 4KT0J 3QWOC 3O6QB 1ZN5A 3L73G 3RL0C 1CZQA 3V6IA 3V4WA 1QGKB 2J59M 1PP9J 1HJBA 3K5BA 3L70J 1LP1A 2QE7H 1GD2E 1SQXD 1MUUA 2KYVA 1EZVE 5CCGD 1LJ2A 1W2BO 1S9KD 3TGUJ 4ZKPA 2D2CD 2W90A 1VQOP 1LWUA 1VQMP 3CCUP 3S9OA 2RN0A 2BEZF 3R4YA 3U1CA 1JY2N 3CX5E 4XFJA 5BU8B 1YI2P 2HPCA 1CSBA 2D2CB 2IBZE 5EFWB 1URQA 4KJMA 1NTKD 1IK7A 4H0LD 1IFMA 3A0BE 2WSEH 3CWBG 2Q3IA 2JKVA 3MTUE 3MHVA 2Q9IA 1SQQD 1IK9A 1A02F 1FZFA 1T2KC 3U59A 4WVZA 5APSA 5KLVG 1YBKA 2C9LY 2ZAEB 1TU3F 2H89C 4H0LB 2R3CA 5AVWB 2R5BA 3VN0A 4OH8B 4JF7A 1LTJB 2O01H 3TDKA 3A2AA 2WSSH 1JMMA 1A02J 1NYHA 4I1LA 5H2FE 1YITP 3B5NA 5AVQB 2KS1A 3C8VA 3WU2H 4OGQC 2AXCA 5KKZB 1FAVA 4HKZH 2WPRA 4IFDK 3O8ZA 3FWLA 1BCCD 2JWAA 1FBMA 1NO4A 3CC4P 1PZQA 3AE3C 1QX8A 1SFCD 2E42A 2M3EA 1IFNA 2KNCA 5APVA 1LWUC 2ZJSE 2JR8A 1LNQA 4EYYQ 3H1JG 3H1LE 3L71D 1RE3A 1WRGA 2OTLP 2C0XA 2RMZA 5CCHA 2YIUC 3T97A 1DH3A 3L75D 2ZYGA 3U1AA 1SFCB 1IFDA 4IL6H 2HYNA 4N78D 5AVTB 2BCCD 1VQ6P 2W83C 5KLVK 1OVVA 4K3AA 2QG4A 1USEA 4IFFA 1N86A 2HFED 4UB8H 1EZVI 1GDTA 3SWFA 1IZNB 3RBZA 1ZR4A 3MZWB 2QSIA 3PH0A 3D6ZA 1JY3P 1SQVD 1OW7A 3EFGA 4WBAA 3GLMA 2FBWC 1IC2A 1S3JA 2LXCB 3B71A 3CC2P 2G8YA 4U3FD 1HGZA 3L72D 2WPSA 3RL0g 5DJTB 3CCEP 1BDCA 1KN7A 4GOEA 3NMDA 3G71P 3BCCE 4H0LC 3GHGB 3NFQA 5B5EH 4LLHA 3C9IA 2FY8A 3G4SP 1FDIA 1RF1B 3HE4A 2ZXXA 1KFNA 1NTMD 3E1RA 5KAIH 1GTWA 1SQXJ 3HE5B 5AW7B 1SQQE 1AQTA 1LTBC 2WT7B 5AW8B 3CD6P 1H0TA 1P84D 1OMIA 1FOSE 3L73D 1K8AQ 1FU1A 3RBXA 3G6EP 1EDIA 2VRSA 1N7SA 3H1IE 1PPJG 1NJIQ 3L35A 3UIAA 3RK2D 1HH0A 4BRYA 1H88A 1MKMA 4WY4A 1Q90D 1X0TA 1VL2A 4AUWA 3BCCJ 4D6TE 1GU5A 5AW4B 1OX3A 2I8DA 1CW5A 1MFTA 5AVUB 1NTKJ 4IL6X 1L0NG 3BASA 1LT9C 3TNUB 1YQ4C 1HVVA 1BCCE 2K1AA 1G2CA 2N9YB 2IX7C 3IN6A 1M1JB 3CCQP 1L0LD 3CCRP 3H1KG 3RK2B 2V7QJ 1SQQJ 2K88A 3VP8A 1GL2A 1SQXK 2JO1A 2KK7A 3IFMA 1CI6A 2KZIA 5APTA 2QJPB 4YXDC 1Q2NA 1EXJA 1JM0A 1SQBE 1J2JB 3WUVA 5C39A 1FZCA 2KB7P 4JYBA 2ZYDA 2M0BA 2OYIB 1YJWP 3C1LA 3CWBD 3SSUA 1NU1G 2FFDB 3GF7A 4L74A 2OYHC 1VQ8P 2N1TD 3L37A 4GIFA 3BVHA 3A0BH 1BCCJ 1NTKK 5CMZA 3GHGC 2QEXP 3AE9C 3L71G 3HTKB 3KQGA 5E79E 5AW1B 1M56D 1JTHA 1RF1C 4UB8E 1USDA 2WWWA 2NZ2A 3L75G 1SQPG 5APUA 1SQBJ 1NHLA 1PGJA 3D6YA 2N1TB 1ZW0A 2WTYA 1J1DB 4U3FE 1FE6A 4WY4C 2WSCJ 3Q1MA 3H1HE 1EC5A 5H2FH 2YKQA 3A3YB 5KAFE 1ZV8A 3QH9A 1BE3E 2BCCJ 1LTTC 1AFOA 4BXLA 2KI7B 5AW2B 2KP8A 1SQVG 1JO5A 4Y99B 1NTME 1KYOD 2C0WA 2N9BA 1OVRA 1M90Q 4C7NA 3H1JD 1GL2C 3A5TA 1PP9E 3M9QA 3CMAP 1L2PA 4QMAA 1KFMA 2XU6A 3L72G 2B88A 1RY3A 4H44C 4W7YA 3FXEA 2M5AA 3RK2C 3P8CD 1N73B 4U3FJ 4NPFX 5AW0B 2R32A 4AQRD 2QJPC 1ZLLA 5APYA 2YXQB 5B66E 3HUSB 3VTPC 2IZ0A 3CPWO 3MGNA 5GTIE 3EFFK 4ZMDA 1YQ3C 3WUTA 3H6PA 2I1KA 2K37A 4YXWH 2NPSA 1KB9D 1VQ4P 2XDJA 3AE6C 2FFDC 1NTMJ 3LIEA 2E76C 1M57D 2IFNA 4HH2A 1JCCA 1HGVA 3OA7A 3FWNA 1L4AA 5AW6B 2YKOA 3P32A 1LGHB 3O6QA 3AEAC 3L73J 1RHZB 3TF5A 3SWYA 4JQ0D 1SQVK 1W5CE 1JB0J 5TJHA 2WPVB 1BGYD 2KSEA 3AEEC 3M91A 1IFPA 3CCMP 1FS0E 1NWQA 1G1IA 3CWBE 3L74D 1VQ7P 2FYUG 1DEEG 3A0HE 1L0LG 1J1EB 3G9RA 1KZUB 1VQ9P 1E5WA 5KLVE 1VDFA 1T6AA 1EDJA 1QL1A 2V7QH 2YO3A 4MN4C 3HD7D 1DEBA 1PPJD 3E7KA 1N2DC 1NH4A 2P7JA 1NTMK 2Q5UA 1EQ7A 1R5SA 1PV3A 3BATA 4W80A 3GF3A 1LTGC 4RJTA 1GMJA 1SVFA 1L0ND 3LW5J 4PV1D 3I55P 1AVYA 2P1JA 3HD7B 3CWBJ 3V4QA 1KC8Q 2WITA 3H1KD 4JPZB 4PD4E 1N73C 4I7ZB 4IFMA 3NTNA 2NPSC 1FDOA 4LC1A 2A45G 2LXBA 4TT3H 3HUSC 2JWDA 1PGQA 5KLVJ 1NTZG 1N7LA 4Z1MH 4PV1B 1AVOA 3AEDC 1L4AC 3VMAA 1HWTC 2IBZG 1LTJA 1L0LK 3PLNA 1ZR2A 4BWNA 1NU1D 2PGDA 3N4XA 1AV1A 1KQGB 4PJ0E 4R4MA 4XE5B 3PHLA 5AW9B 1KQFB 2WSCH 2SPZA 3CXHE 3AE5C 3MD0A 5GTHH 2Z4EA 2MKVA 1KORA 2A06D 3G3ZA 1OW6A 2CK3H 5DJUB 2H8PD 3CLQA 1SQPD 4OVNF 5BU5A 2KOGA 5E79H 2POHA 1IFIA 1X8YA 5CCGC 1LT9A 1K05A 2Q6QA 3PJSK 1SFCA 1SQXE 2HODB 2GA1A 3V2RA 2D2CC 2IYPA 3IR9A 1S9KE 4GODA 2ZT9D 2RH0A 2QM7A 2P2UA 2XZRA 3A7OA 3CCLP 3ABVC 2E74D 2QJKB 1YTZI 2P10A 5KAFH 1Q86Q 2JP3A 2HLOA 3RK3D 3ITKA 3H1LG 3Q2YA 1OXZA 1K73Q 3MP7B 2UWJE 1X79B 2IDBA 2ZT9B 1JUNA 2QVAA 4ZNCA 4I7ZC 2XV5A 1BGYG 2E74B 1LTJC 1NTKE 2KXPB 2OYHA 1LTAC 2OGUA 2R44A 1N7SD 4EI2A 4DOJA 2JJLA 3RK3B 3L74G 2J58A 4GOFA 4PV1C 2YKPA 1KV4A 1JOCA 3GHGA 2B87A 5KKZC 1KILD 5AVZB 4YPCA 4PD4I 2L91A 1RE4A 5B66H 1RF1A 1JNMA 1U57A 5GTIH 4K35A 5CJ4A 3M0DC 1KYOI 3HE5A 3H32A 1N7SB 2K9JB 1IFJA 2WT7A 3LIDA 2ZVOB 3L70D 5KJ7D 4DJGA 1KILB 4W7ZA 1KMIZ 2WSFJ 3BCCG 2PAJA 5AW5B 1VF5D 1R5LA 2OTJP 1FOSF 1DIPA 5AVXB 3TGUD 1FDMA 1SFCC 2FYUD 3MUDA 2KLVA 2QRXA 2Y9YA 3CXHI 3Q5SA 3LW5H 1L0NJ 1FJKA 1ZRTD 3TNUA 2W6AA 1KB9I 1VF5B 3A0HH 2M8RA 3CC7P 3L71E 1M8OB 2B9BA 2YMKA 2GM4A 3GW6A 3TSIA 1NVOA 4U7JA 1FZCB 3RL0D 3H1IG 2KSJA 3L75E 5APXA 3CL3D 3SWKA 4N78E 3JCUE 1DD4A 3VP9A 2WSEJ 1OWAA 2BCCE 3D70A 1S2EA 3AE7C 3AE4C 5GTHE 1KD1Q 2CPBA 5CHXA 4D6TG 2JEEA 5TISE 2ZT9C 2OYIA 1NU1J 5CJ0A 1VQNP 3RL0B 2FFDA 1LTSC 3RGUA 1Q82Q 4TLFA 1QLED 4EIJA 4O9BA 1M1KQ 4HYTB 3B4SA 1SQVE 2A06G 4JYCA 1JY2O 1RE4C 3RK3C 1NTZD 1N8RQ 2P58A 4ASVA 1L0NK 2KIKA 1HTLC 2W8ZA 5AVVB 3RK3E 4ZKUA 3L71J 4PD4H 1SQBG 3CX5D 3F89A 1OFCX 1T8ZA 3HTKA 2GUVA 2NRGA 2AEJA 2IBZD 1JY3N 3L72E 5CBNA 3SFDC 1XTCC 2WMMA 3L75J 1SQPJ 1S5LH 4EOTA 1H8AA 1NAYA 1T3UA 2N1TA 1FJPA 2QA4P 3V2QA 3MUDC 1AA0A 2PRRA 1EDKA 1T2KD 2XNDH 4PJ0H 3I5CA 1NU1K 4ASWA 1SQVJ 1P84E 2KZJA 3L73E 3JSVC 5APQA 1M1JC 3CXHH 2AXTE 1FZGA 2AEFA 3PP5A 5KJ7C 2PFXA 3WUUA 3L72J 4GDOA 3CI9A 2OARA 2W27A 4C46A 4OGQD 3H1HG 2YO2A 1SQPK 1E79H 1BE3G 2B89A 1N73A 2OQQA 5BVZA 2OYIC 4RO0A 1JEKA 1K04A 4WWIA 1YJNP 3HUSA 1YJ9P 2BEQD 1L0LE 1GW3A 3EQ2A 3H1LD 1OIPA 1WT6A 1PIXA 1U7JA 4OGQB 1LTIC 1PP9G 3BRTB 1LP1B 1Y8AA 3L70G 4H13D 1ZOYC 1PGPA 3BRVB 1HBWA 4UB6E 2RKLA 1IO4A 3TGUG 1FZEA 1URQD 1FC2C 3AEGC 1LWUB
chains in the Genus database with same CATH topology
3JCUH 5GTIH 4PJ0H 5E79H 3A0BH 3KZIH 5KAIH 5GTHH 2AXTH 4UB6H 4UB8H 3A0HH 5KAFH 3WU2H 5TISH 5B5EH 4IL6H 1S5LH 5B66H 5H2FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU H;  5GTI H;  4PJ0 H;  5E79 H;  3A0B H;  3KZI H;  5KAI H;  5GTH H;  2AXT H;  4UB6 H;  4UB8 H;  3A0H H;  5KAF H;  3WU2 H;  5TIS H;  5B5E H;  4IL6 H;  1S5L H;  5B66 H;  5H2F H; 
#chains in the Genus database with same CATH topology
 4GKG A;  2WSF H;  2N1T C;  1J1D C;  1U7M A;  1SS1 A;  2FYZ A;  4GT1 A;  2Y9Z A;  1S5L X;  2WZ7 A;  4H13 B;  1S4X A;  4DT0 A;  1PGO A;  2Z5I A;  2YIU B;  1EDL A;  2QJY B;  4Y28 J;  2FYU J;  2J5U A;  3USS A;  2P67 A;  3CCJ P;  1HF9 A;  1YTZ T;  2IZ1 A;  3D71 A;  1L0L J;  3V2N A;  2HPC B;  1VQL P;  4B86 A;  1URQ B;  4L73 A;  3VMY A;  2ITA A;  3IAO A;  4Y99 C;  1NTZ E;  3OAK A;  1YIJ P;  2Y0E A;  3GG2 A;  5CCG A;  1VQP P;  5APW A;  3BCC D;  3WMM 0;  1ZME C;  3M0A A;  1EZV G;  3B5N D;  1VPC A;  2O1J A;  2L5G B;  5KLI B;  2FXP A;  5AW3 B;  1H89 A;  3NXS A;  2W6B A;  3PTZ A;  1YHQ P;  4RES B;  4HJG H;  1M7L A;  2WPQ A;  1LT1 A;  1KYO E;  3HD7 A;  1S5L E;  1P84 I;  3H1J E;  4KHX A;  1DD3 A;  1RF0 C;  3B5N B;  2KS1 B;  4IOI H;  5CBO A;  1HUC A;  1AJY A;  2FYU K;  2G3A A;  3H1I D;  1NTZ J;  2H88 C;  3CCV P;  1NKN A;  3M06 A;  2LR2 A;  5CCH D;  1S1C X;  1UII A;  3P8C E;  2YMY A;  1RQU A;  4D6T D;  1G1J A;  2E5Y A;  3HRN A;  2CPS A;  2K3R A;  2V4H A;  2KNC B;  3OJA B;  2JDI H;  1Y47 A;  4L75 A;  3JCU H;  1QL2 A;  2OTK E;  3L4F A;  1GW4 A;  3M0D A;  2LKM A;  3TYY A;  1KB9 E;  3VMZ A;  3KZI E;  3MIW A;  3T97 B;  2Q3E A;  3M9B A;  5TIS H;  2E75 D;  3H1J J;  1J1E C;  1SQB D;  5K5G B;  4H13 C;  3S1K A;  2W6J H;  1DX7 A;  2M3B A;  2PP6 A;  2HG5 D;  2QJY C;  2YXR B;  1LT9 B;  1Q7Y Q;  3VYI A;  1K9M Q;  1BGY E;  2ZFC A;  1URQ C;  1NTZ K;  1HJ0 A;  1W2E A;  2E75 B;  1Z56 A;  1KQS O;  4M3L A;  3L74 E;  3P7K A;  3E1I A;  3ZDM A;  2HOD A;  3FGA D;  1MV8 A;  3F5H A;  1R8E A;  1KTM A;  5KLI C;  2A45 I;  3HD7 C;  2OYO A;  1Q81 Q;  3Q3D A;  2Q1K A;  1VQ5 P;  1JY3 O;  4NPD A;  4RKU J;  2KLU A;  5M1B A;  1PPJ E;  4HB1 A;  3H1L J;  1IJD B;  1AQ5 A;  1PL5 A;  1ZXG A;  2OYH B;  3CX5 I;  1GU4 A;  1P84 H;  3AE8 C;  2IBZ I;  3HE4 B;  2Z5H A;  1SP4 A;  4NPE A;  2AXT H;  4N6J A;  5AVR B;  3B5N C;  3VMX A;  3H1H D;  1SQX G;  1QVG O;  1FZA A;  1BGY J;  1D7M A;  2GUS A;  2B87 B;  2Y0D A;  3IF4 A;  1JCD A;  4OWF A;  2FYN B;  1BE3 D;  1L0N E;  4WY4 D;  3AEB C;  2IYO A;  1H0T B;  1RH5 B;  3L74 J;  2HR3 A;  3OW2 O;  5AVS B;  3TK1 A;  3H1K E;  3KPE A;  3CME P;  3H32 B;  3II6 A;  2BAS A;  4R4L A;  1NGM B;  1PP9 D;  1RQV A;  2Y0C A;  4BRY B;  3W68 A;  4WY4 B;  1GL2 D;  3FXD A;  2DW3 A;  2XKM A;  1RE3 C;  4AYC A;  1EXI A;  2K9J A;  5CCH C;  3AE1 C;  4H44 D;  2E5T A;  1FZB A;  2Q7C A;  1NTK G;  3AEC C;  1G2C B;  4DZO A;  2H43 A;  1NU1 E;  2K9Y A;  1BSH A;  1KIL A;  1GK6 A;  5L8R J;  1S72 P;  1PFI A;  2WQY C;  4XA4 A;  1SQQ G;  1GL2 B;  2R5D A;  4UB6 H;  1CI6 B;  2O01 N;  4I2L C;  4N3Y B;  2FKW B;  3GMA A;  2ZXE B;  3B8E B;  4H44 B;  1M1J A;  3H1K J;  2C9N Y;  3FX0 A;  2A06 E;  2E75 C;  3WU2 E;  5KJ7 A;  2E76 D;  1NAF A;  1SQP E;  1BDD A;  2QJK C;  2FXM A;  1OZH A;  3AE2 C;  4A7P A;  4L76 A;  2FXO A;  2A45 H;  3H25 A;  3I56 P;  3H1I J;  1EZV D;  2MJZ A;  4CPG A;  4JBZ A;  1QEX A;  1BSN A;  4LGD E;  2I1J A;  2AEM A;  1BCC G;  1X22 A;  2E76 B;  3CX5 H;  1KQL A;  1JY2 P;  2E74 C;  1GK4 A;  4D6T J;  3Q5P A;  1ZP0 C;  3CCS P;  4I6M C;  1JTH B;  2IFM A;  3VOP A;  3M9H A;  2O01 J;  1UIX A;  1XTG B;  5KLV D;  2WVR A;  2QIW A;  3S4R A;  4IL6 E;  3KHU A;  1YYC A;  2FYN C;  3V2P A;  1WMK A;  2H7H A;  1KYO H;  3PRJ A;  2QM8 A;  1SQQ K;  1JMB A;  1N7S C;  1VQK P;  1MFZ A;  4DCK A;  2BCC G;  4C7R A;  2YNY A;  1KIL C;  4C7N B;  3SFE C;  2ZVN B;  1KIL E;  1X9V A;  4PD4 D;  3P8M C;  3N7N A;  3KDP B;  5AVY B;  2NPS D;  1MZ9 A;  2M5A B;  3KYQ A;  4WB4 A;  3L36 A;  1Y9B A;  1OW8 A;  1GZL A;  2ZYA A;  3V5B A;  4EDF A;  1KB9 H;  5B5E E;  1SLQ A;  4U3F G;  3JC2 2;  3KZI H;  3EWK A;  3L70 E;  2XNX A;  1QVF O;  1VF5 C;  1L4A D;  5KAI E;  3KXD A;  3AEF C;  1FZC C;  2R3S A;  3TGU E;  2NPS B;  1NOH A;  2O3J A;  3R2P A;  1T3J A;  1SQB K;  4YTP C;  1OVU A;  2IPP A;  2FYU E;  5KTB A;  1NTM G;  3Q5R A;  2O1K A;  3CXH D;  3H1H J;  1BE3 J;  2E43 A;  1RF0 A;  1NKZ B;  3W67 A;  1ZRT E;  1L4A B;  2KUB A;  4KT0 J;  3QWO C;  3O6Q B;  1ZN5 A;  3L73 G;  3RL0 C;  1CZQ A;  3V6I A;  3V4W A;  1QGK B;  2J59 M;  1PP9 J;  1HJB A;  3K5B A;  3L70 J;  1LP1 A;  2QE7 H;  1GD2 E;  1SQX D;  1MUU A;  2KYV A;  1EZV E;  5CCG D;  1LJ2 A;  1W2B O;  1S9K D;  3TGU J;  4ZKP A;  2D2C D;  2W90 A;  1VQO P;  1LWU A;  1VQM P;  3CCU P;  3S9O A;  2RN0 A;  2BEZ F;  3R4Y A;  3U1C A;  1JY2 N;  3CX5 E;  4XFJ A;  5BU8 B;  1YI2 P;  2HPC A;  1CSB A;  2D2C B;  2IBZ E;  5EFW B;  1URQ A;  4KJM A;  1NTK D;  1IK7 A;  4H0L D;  1IFM A;  3A0B E;  2WSE H;  3CWB G;  2Q3I A;  2JKV A;  3MTU E;  3MHV A;  2Q9I A;  1SQQ D;  1IK9 A;  1A02 F;  1FZF A;  1T2K C;  3U59 A;  4WVZ A;  5APS A;  5KLV G;  1YBK A;  2C9L Y;  2ZAE B;  1TU3 F;  2H89 C;  4H0L B;  2R3C A;  5AVW B;  2R5B A;  3VN0 A;  4OH8 B;  4JF7 A;  1LTJ B;  2O01 H;  3TDK A;  3A2A A;  2WSS H;  1JMM A;  1A02 J;  1NYH A;  4I1L A;  5H2F E;  1YIT P;  3B5N A;  5AVQ B;  2KS1 A;  3C8V A;  3WU2 H;  4OGQ C;  2AXC A;  5KKZ B;  1FAV A;  4HKZ H;  2WPR A;  4IFD K;  3O8Z A;  3FWL A;  1BCC D;  2JWA A;  1FBM A;  1NO4 A;  3CC4 P;  1PZQ A;  3AE3 C;  1QX8 A;  1SFC D;  2E42 A;  2M3E A;  1IFN A;  2KNC A;  5APV A;  1LWU C;  2ZJS E;  2JR8 A;  1LNQ A;  4EYY Q;  3H1J G;  3H1L E;  3L71 D;  1RE3 A;  1WRG A;  2OTL P;  2C0X A;  2RMZ A;  5CCH A;  2YIU C;  3T97 A;  1DH3 A;  3L75 D;  2ZYG A;  3U1A A;  1SFC B;  1IFD A;  4IL6 H;  2HYN A;  4N78 D;  5AVT B;  2BCC D;  1VQ6 P;  2W83 C;  5KLV K;  1OVV A;  4K3A A;  2QG4 A;  1USE A;  4IFF A;  1N86 A;  2HFE D;  4UB8 H;  1EZV I;  1GDT A;  3SWF A;  1IZN B;  3RBZ A;  1ZR4 A;  3MZW B;  2QSI A;  3PH0 A;  3D6Z A;  1JY3 P;  1SQV D;  1OW7 A;  3EFG A;  4WBA A;  3GLM A;  2FBW C;  1IC2 A;  1S3J A;  2LXC B;  3B71 A;  3CC2 P;  2G8Y A;  4U3F D;  1HGZ A;  3L72 D;  2WPS A;  3RL0 g;  5DJT B;  3CCE P;  1BDC A;  1KN7 A;  4GOE A;  3NMD A;  3G71 P;  3BCC E;  4H0L C;  3GHG B;  3NFQ A;  5B5E H;  4LLH A;  3C9I A;  2FY8 A;  3G4S P;  1FDI A;  1RF1 B;  3HE4 A;  2ZXX A;  1KFN A;  1NTM D;  3E1R A;  5KAI H;  1GTW A;  1SQX J;  3HE5 B;  5AW7 B;  1SQQ E;  1AQT A;  1LTB C;  2WT7 B;  5AW8 B;  3CD6 P;  1H0T A;  1P84 D;  1OMI A;  1FOS E;  3L73 D;  1K8A Q;  1FU1 A;  3RBX A;  3G6E P;  1EDI A;  2VRS A;  1N7S A;  3H1I E;  1PPJ G;  1NJI Q;  3L35 A;  3UIA A;  3RK2 D;  1HH0 A;  4BRY A;  1H88 A;  1MKM A;  4WY4 A;  1Q90 D;  1X0T A;  1VL2 A;  4AUW A;  3BCC J;  4D6T E;  1GU5 A;  5AW4 B;  1OX3 A;  2I8D A;  1CW5 A;  1MFT A;  5AVU B;  1NTK J;  4IL6 X;  1L0N G;  3BAS A;  1LT9 C;  3TNU B;  1YQ4 C;  1HVV A;  1BCC E;  2K1A A;  1G2C A;  2N9Y B;  2IX7 C;  3IN6 A;  1M1J B;  3CCQ P;  1L0L D;  3CCR P;  3H1K G;  3RK2 B;  2V7Q J;  1SQQ J;  2K88 A;  3VP8 A;  1GL2 A;  1SQX K;  2JO1 A;  2KK7 A;  3IFM A;  1CI6 A;  2KZI A;  5APT A;  2QJP B;  4YXD C;  1Q2N A;  1EXJ A;  1JM0 A;  1SQB E;  1J2J B;  3WUV A;  5C39 A;  1FZC A;  2KB7 P;  4JYB A;  2ZYD A;  2M0B A;  2OYI B;  1YJW P;  3C1L A;  3CWB D;  3SSU A;  1NU1 G;  2FFD B;  3GF7 A;  4L74 A;  2OYH C;  1VQ8 P;  2N1T D;  3L37 A;  4GIF A;  3BVH A;  3A0B H;  1BCC J;  1NTK K;  5CMZ A;  3GHG C;  2QEX P;  3AE9 C;  3L71 G;  3HTK B;  3KQG A;  5E79 E;  5AW1 B;  1M56 D;  1JTH A;  1RF1 C;  4UB8 E;  1USD A;  2WWW A;  2NZ2 A;  3L75 G;  1SQP G;  5APU A;  1SQB J;  1NHL A;  1PGJ A;  3D6Y A;  2N1T B;  1ZW0 A;  2WTY A;  1J1D B;  4U3F E;  1FE6 A;  4WY4 C;  2WSC J;  3Q1M A;  3H1H E;  1EC5 A;  5H2F H;  2YKQ A;  3A3Y B;  5KAF E;  1ZV8 A;  3QH9 A;  1BE3 E;  2BCC J;  1LTT C;  1AFO A;  4BXL A;  2KI7 B;  5AW2 B;  2KP8 A;  1SQV G;  1JO5 A;  4Y99 B;  1NTM E;  1KYO D;  2C0W A;  2N9B A;  1OVR A;  1M90 Q;  4C7N A;  3H1J D;  1GL2 C;  3A5T A;  1PP9 E;  3M9Q A;  3CMA P;  1L2P A;  4QMA A;  1KFM A;  2XU6 A;  3L72 G;  2B88 A;  1RY3 A;  4H44 C;  4W7Y A;  3FXE A;  2M5A A;  3RK2 C;  3P8C D;  1N73 B;  4U3F J;  4NPF X;  5AW0 B;  2R32 A;  4AQR D;  2QJP C;  1ZLL A;  5APY A;  2YXQ B;  5B66 E;  3HUS B;  3VTP C;  2IZ0 A;  3CPW O;  3MGN A;  5GTI E;  3EFF K;  4ZMD A;  1YQ3 C;  3WUT A;  3H6P A;  2I1K A;  2K37 A;  4YXW H;  2NPS A;  1KB9 D;  1VQ4 P;  2XDJ A;  3AE6 C;  2FFD C;  1NTM J;  3LIE A;  2E76 C;  1M57 D;  2IFN A;  4HH2 A;  1JCC A;  1HGV A;  3OA7 A;  3FWN A;  1L4A A;  5AW6 B;  2YKO A;  3P32 A;  1LGH B;  3O6Q A;  3AEA C;  3L73 J;  1RHZ B;  3TF5 A;  3SWY A;  4JQ0 D;  1SQV K;  1W5C E;  1JB0 J;  5TJH A;  2WPV B;  1BGY D;  2KSE A;  3AEE C;  3M91 A;  1IFP A;  3CCM P;  1FS0 E;  1NWQ A;  1G1I A;  3CWB E;  3L74 D;  1VQ7 P;  2FYU G;  1DEE G;  3A0H E;  1L0L G;  1J1E B;  3G9R A;  1KZU B;  1VQ9 P;  1E5W A;  5KLV E;  1VDF A;  1T6A A;  1EDJ A;  1QL1 A;  2V7Q H;  2YO3 A;  4MN4 C;  3HD7 D;  1DEB A;  1PPJ D;  3E7K A;  1N2D C;  1NH4 A;  2P7J A;  1NTM K;  2Q5U A;  1EQ7 A;  1R5S A;  1PV3 A;  3BAT A;  4W80 A;  3GF3 A;  1LTG C;  4RJT A;  1GMJ A;  1SVF A;  1L0N D;  3LW5 J;  4PV1 D;  3I55 P;  1AVY A;  2P1J A;  3HD7 B;  3CWB J;  3V4Q A;  1KC8 Q;  2WIT A;  3H1K D;  4JPZ B;  4PD4 E;  1N73 C;  4I7Z B;  4IFM A;  3NTN A;  2NPS C;  1FDO A;  4LC1 A;  2A45 G;  2LXB A;  4TT3 H;  3HUS C;  2JWD A;  1PGQ A;  5KLV J;  1NTZ G;  1N7L A;  4Z1M H;  4PV1 B;  1AVO A;  3AED C;  1L4A C;  3VMA A;  1HWT C;  2IBZ G;  1LTJ A;  1L0L K;  3PLN A;  1ZR2 A;  4BWN A;  1NU1 D;  2PGD A;  3N4X A;  1AV1 A;  1KQG B;  4PJ0 E;  4R4M A;  4XE5 B;  3PHL A;  5AW9 B;  1KQF B;  2WSC H;  2SPZ A;  3CXH E;  3AE5 C;  3MD0 A;  5GTH H;  2Z4E A;  2MKV A;  1KOR A;  2A06 D;  3G3Z A;  1OW6 A;  2CK3 H;  5DJU B;  2H8P D;  3CLQ A;  1SQP D;  4OVN F;  5BU5 A;  2KOG A;  5E79 H;  2POH A;  1IFI A;  1X8Y A;  5CCG C;  1LT9 A;  1K05 A;  2Q6Q A;  3PJS K;  1SFC A;  1SQX E;  2HOD B;  2GA1 A;  3V2R A;  2D2C C;  2IYP A;  3IR9 A;  1S9K E;  4GOD A;  2ZT9 D;  2RH0 A;  2QM7 A;  2P2U A;  2XZR A;  3A7O A;  3CCL P;  3ABV C;  2E74 D;  2QJK B;  1YTZ I;  2P10 A;  5KAF H;  1Q86 Q;  2JP3 A;  2HLO A;  3RK3 D;  3ITK A;  3H1L G;  3Q2Y A;  1OXZ A;  1K73 Q;  3MP7 B;  2UWJ E;  1X79 B;  2IDB A;  2ZT9 B;  1JUN A;  2QVA A;  4ZNC A;  4I7Z C;  2XV5 A;  1BGY G;  2E74 B;  1LTJ C;  1NTK E;  2KXP B;  2OYH A;  1LTA C;  2OGU A;  2R44 A;  1N7S D;  4EI2 A;  4DOJ A;  2JJL A;  3RK3 B;  3L74 G;  2J58 A;  4GOF A;  4PV1 C;  2YKP A;  1KV4 A;  1JOC A;  3GHG A;  2B87 A;  5KKZ C;  1KIL D;  5AVZ B;  4YPC A;  4PD4 I;  2L91 A;  1RE4 A;  5B66 H;  1RF1 A;  1JNM A;  1U57 A;  5GTI H;  4K35 A;  5CJ4 A;  3M0D C;  1KYO I;  3HE5 A;  3H32 A;  1N7S B;  2K9J B;  1IFJ A;  2WT7 A;  3LID A;  2ZVO B;  3L70 D;  5KJ7 D;  4DJG A;  1KIL B;  4W7Z A;  1KMI Z;  2WSF J;  3BCC G;  2PAJ A;  5AW5 B;  1VF5 D;  1R5L A;  2OTJ P;  1FOS F;  1DIP A;  5AVX B;  3TGU D;  1FDM A;  1SFC C;  2FYU D;  3MUD A;  2KLV A;  2QRX A;  2Y9Y A;  3CXH I;  3Q5S A;  3LW5 H;  1L0N J;  1FJK A;  1ZRT D;  3TNU A;  2W6A A;  1KB9 I;  1VF5 B;  3A0H H;  2M8R A;  3CC7 P;  3L71 E;  1M8O B;  2B9B A;  2YMK A;  2GM4 A;  3GW6 A;  3TSI A;  1NVO A;  4U7J A;  1FZC B;  3RL0 D;  3H1I G;  2KSJ A;  3L75 E;  5APX A;  3CL3 D;  3SWK A;  4N78 E;  3JCU E;  1DD4 A;  3VP9 A;  2WSE J;  1OWA A;  2BCC E;  3D70 A;  1S2E A;  3AE7 C;  3AE4 C;  5GTH E;  1KD1 Q;  2CPB A;  5CHX A;  4D6T G;  2JEE A;  5TIS E;  2ZT9 C;  2OYI A;  1NU1 J;  5CJ0 A;  1VQN P;  3RL0 B;  2FFD A;  1LTS C;  3RGU A;  1Q82 Q;  4TLF A;  1QLE D;  4EIJ A;  4O9B A;  1M1K Q;  4HYT B;  3B4S A;  1SQV E;  2A06 G;  4JYC A;  1JY2 O;  1RE4 C;  3RK3 C;  1NTZ D;  1N8R Q;  2P58 A;  4ASV A;  1L0N K;  2KIK A;  1HTL C;  2W8Z A;  5AVV B;  3RK3 E;  4ZKU A;  3L71 J;  4PD4 H;  1SQB G;  3CX5 D;  3F89 A;  1OFC X;  1T8Z A;  3HTK A;  2GUV A;  2NRG A;  2AEJ A;  2IBZ D;  1JY3 N;  3L72 E;  5CBN A;  3SFD C;  1XTC C;  2WMM A;  3L75 J;  1SQP J;  1S5L H;  4EOT A;  1H8A A;  1NAY A;  1T3U A;  2N1T A;  1FJP A;  2QA4 P;  3V2Q A;  3MUD C;  1AA0 A;  2PRR A;  1EDK A;  1T2K D;  2XND H;  4PJ0 H;  3I5C A;  1NU1 K;  4ASW A;  1SQV J;  1P84 E;  2KZJ A;  3L73 E;  3JSV C;  5APQ A;  1M1J C;  3CXH H;  2AXT E;  1FZG A;  2AEF A;  3PP5 A;  5KJ7 C;  2PFX A;  3WUU A;  3L72 J;  4GDO A;  3CI9 A;  2OAR A;  2W27 A;  4C46 A;  4OGQ D;  3H1H G;  2YO2 A;  1SQP K;  1E79 H;  1BE3 G;  2B89 A;  1N73 A;  2OQQ A;  5BVZ A;  2OYI C;  4RO0 A;  1JEK A;  1K04 A;  4WWI A;  1YJN P;  3HUS A;  1YJ9 P;  2BEQ D;  1L0L E;  1GW3 A;  3EQ2 A;  3H1L D;  1OIP A;  1WT6 A;  1PIX A;  1U7J A;  4OGQ B;  1LTI C;  1PP9 G;  3BRT B;  1LP1 B;  1Y8A A;  3L70 G;  4H13 D;  1ZOY C;  1PGP A;  3BRV B;  1HBW A;  4UB6 E;  2RKL A;  1IO4 A;  3TGU G;  1FZE A;  1URQ D;  1FC2 C;  3AEG C;  1LWU B; 
#chains in the Genus database with same CATH homology
 3JCU H;  5GTI H;  4PJ0 H;  5E79 H;  3A0B H;  3KZI H;  5KAI H;  5GTH H;  2AXT H;  4UB6 H;  4UB8 H;  3A0H H;  5KAF H;  3WU2 H;  5TIS H;  5B5E H;  4IL6 H;  1S5L H;  5B66 H;  5H2F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...