5B66H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b66H01
5B5EH 3WU2H 5GTHH 3JCUH 2AXTH 5E79H 5B66H 3KZIH 3A0HH 4IL6H 5GTIH 5KAIH 5H2FH 5TISH 5KAFH 4UB8H 1S5LH 3A0BH 4UB6H 4PJ0H
chains in the Genus database with same CATH superfamily
3HTKB 3QWOC 4N78D 1QLED 4RO0A 5AVYB 3SFEC 4TLFA 1KFMA 4Y28J 2E5YA 3U59A 2A45H 1GW4A 3H1IJ 3RK3B 1KILD 3SWYA 5B5EE 3PH0A 1OIPA 3GHGB 1S1CX 1HGVA 2KZIA 2HFED 2FYNB 4XFJA 1T6AA 4C7NA 3G71P 2Y9ZA 2C9LY 3CD6P 1GK6A 1LTJA 3AEDC 3L74G 1L4AA 1IFMA 3USSA 1KILB 1GL2D 2RMZA 1FC2C 1LTSC 2N1TC 4U3FJ 3T97A 5CCHA 2QEXP 2D2CD 2FXOA 3B5NC 3L72J 1NTMK 1FZCC 4LLHA 3AE6C 1M1JB 1X0TA 3ABVC 2M8RA 1J1DB 1K04A 3H1KD 1GMJA 1N86A 2ZT9D 1ZLLA 2GUSA 2XDJA 2A06G 2K3RA 3A0BH 2N9YB 3BCCE 3E1RA 3M91A 2ZAEB 3MZWB 1OX3A 1SS1A 3H1HE 1JCCA 1NHLA 1URQD 1J1EC 4OVNF 3TNUB 4PV1B 1AVOA 1JB0J 1KB9I 2HODB 2W6JH 3H32B 2Y0DA 1JY2O 5CBOA 3C1LA 1PP9D 1ZOYC 2OYOA 3A0BE 1BGYE 3FGAD 2IX7C 3H6PA 3L75J 3AEGC 1KILA 1OVVA 2B9BA 1N73B 2H7HA 2M3BA 3T97B 2P1JA 4Y99C 1H88A 3EFGA 1PGOA 3GG2A 1FJPA 1IJDB 2BCCJ 3L71D 4PD4I 4W7YA 5AVSB 3VN0A 3ITKA 2KNCA 5KLVJ 2OYIC 1ZR2A 1HJBA 3P8MC 3EFFK 1EDKA 3FX0A 5M1BA 2JO1A 3TF5A 1S4XA 1L0ND 5EFWB 1OVRA 4WBAA 3CCVP 1BCCJ 2HPCA 2D2CC 4H13C 2MKVA 2IBZG 3KXDA 2BEZF 2WPQA 4H0LD 2C9NY 1T2KC 1VQ7P 2J59M 1X9VA 3JCUE 5K5GB 2E74D 1PPJG 2KP8A 3H1IG 1N73A 5APXA 1NTZE 1YTZI 3EQ2A 1DX7A 1M1JC 1PGJA 3TDKA 5AVUB 2E76D 1GL2C 5APWA 3RK2B 1OZHA 2WPRA 3HD7A 3BCCG 1IO4A 1LT9C 1BE3J 4JF7A 2OTLP 3D6YA 1FOSE 3VOPA 5KLVE 2H88C 1LTAC 2M5AA 2ZYGA 1JY2P 3H1LE 5APUA 4GIFA 5KJ7A 1GDTA 1R8EA 1K73Q 2HPCB 2Q3EA 1ZV8A 3A2AA 1L0LD 4L74A 2LKMA 1LTJC 5KLVD 2FXMA 3TGUJ 4AQRD 2NZ2A 3RL0g 2QJYB 2GA1A 3SSUA 2AEMA 3MD0A 2IDBA 5CHXA 2W8ZA 1BCCD 1YHQP 1AJYA 1QL2A 1VQLP 1RQVA 1NTKD 1OW8A 1L0NK 2ZJSE 1UIXA 3CWBD 1BCCE 4DT0A 1EC5A 2IZ1A 1QX8A 3CCRP 1PIXA 1BSHA 2WSEH 3AE2C 1RF1C 1VDFA 1JM0A 2WZ7A 3H1HG 1Q2NA 3GMAA 3L75E 4JQ0D 1IFPA 2P7JA 4KJMA 4D6TJ 1LTGC 2H43A 3L72E 3O6QA 2BCCG 1SQPE 2QJPC 2BCCE 5AW3B 4K35A 1NJIQ 1NTMG 1PP9J 1FZGA 3L74D 1OVUA 3VMAA 3FXDA 3KPEA 4LGDE 2YO2A 3CXHD 3MIWA 1Z56A 2C0XA 1JY3N 2RKLA 3LIDA 1PP9E 3TSIA 1W2BO 4AYCA 3JSVC 5BVZA 3Q1MA 2QJKC 1KILE 2J58A 3L35A 1T3UA 2OYIA 4U3FG 4I7ZB 4TT3H 5BU5A 5CCGD 1L0LJ 5AVZB 1G1JA 3F89A 4N78E 4N6JA 4BRYA 1NKNA 1A02J 2E76C 1KTMA 1JO5A 2E42A 3U1AA 1SQQK 5DJUB 2P67A 1NTKK 5KLIC 3WU2E 1NU1G 2K9YA 3CL3D 1VPCA 1BDCA 2O01N 3V2QA 3MUDA 1SQPG 2KSJA 3L72G 1L0NE 3AE3C 3NTNA 4L76A 2IYOA 3H1JG 1PGQA 1OW6A 2LR2A 1GU5A 2XNXA 3L4FA 4ZMDA 1ZRTE 3VP8A 2FBWC 1AFOA 1KYOH 2WSEJ 3EWKA 1JCDA 1NTZG 2NPSC 4NPFX 1GL2A 4IFFA 2MJZA 2KS1A 4Y99B 2H8PD 2E5TA 1GZLA 3HD7C 1N7SD 4RJTA 1LT1A 2J5UA 2JDIH 2UWJE 2KI7B 1RF1B 3TGUE 2WITA 2IBZE 3HUSA 3IFMA 4A7PA 2WTYA 1H0TB 4XE5B 3L70E 2FFDC 1DEBA 3LW5H 1VQ6P 1RF0C 2KZJA 3P32A 3LIEA 3M0DC 1JMBA 1NH4A 1N7SA 1OW7A 1W5CE 2IBZD 1SQBG 4PD4E 3GHGA 3V4QA 2PFXA 1EZVI 1NKZB 1DD3A 1L4AB 1LGHB 1MZ9A 1URQC 4N3YB 3L71E 1VQMP 1A02F 3L71G 2AXTE 3F5HA 2WT7A 1Q90D 3M9QA 1FBMA 1L0LE 1SQBD 1LTIC 3N7NA 5CJ0A 3CCQP 1JNMA 1AVYA 1RE4A 2ZYAA 3L70J 1EXIA 3CPWO 1HUCA 3E7KA 1JY3O 2XU6A 2OGUA 1FZBA 2ZXXA 2PGDA 3HE4A 3OA7A 2XZRA 3HE5A 1L4AD 2W6AA 1USDA 4H0LC 3RK2D 1NYHA 2NRGA 5AVWB 1QVFO 3C9IA 3P8CE 1PFIA 2LXBA 1S5LX 3O8ZA 5H2FH 3TGUG 4EYYQ 2P2UA 3GLMA 1EZVG 1SQPK 1X8YA 1Y8AA 2KB7P 4D6TD 2QIWA 3CXHH 4GODA 3WU2H 2AXCA 3BVHA 2WPVB 1L0NG 5AW4B 1S3JA 1N2DC 3CX5E 2G3AA 3G4SP 1K9MQ 3H1HJ 4BXLA 2KOGA 3VMXA 3L73G 3N4XA 2O1KA 3CC7P 3L74J 2Q3IA 1S9KD 2QJYC 2YKPA 4I6MC 1TU3F 3PRJA 1M1KQ 3CX5D 1ZRTD 1AQTA 1OWAA 3L71J 1X79B 3SWKA 2JWAA 2XKMA 1K05A 1XTCC 1HBWA 5APVA 1PL5A 2W6BA 2WSCH 1IFNA 4U3FE 5APQA 4NPEA 2WSSH 5KAIH 2QM7A 3RK3C 1KMIZ 3RL0C 1SQQE 1QL1A 2Q7CA 1VQ9P 4HYTB 3V2RA 4GOFA 4JBZA 2FYNC 1GW3A 3AEFC 2WSFJ 1H8AA 1P84E 5B66E 1L4AC 1URQB 1KQGB 2QJPB 5KAIE 1SQQJ 1LWUB 2N1TA 1LTBC 3HTKA 1SFCA 2N1TB 2AXTH 2K37A 1JY3P 4GOEA 3H1KE 4UB8H 1IFIA 4JYBA 4IL6X 1VQKP 2IYPA 3I5CA 2ZYDA 3PJSK 2OYHC 1NOHA 1PGPA 3H1HD 4OGQB 5DJTB 2QM8A 3RBXA 4C46A 1FE6A 4CPGA 2FYUD 2QJKB 3L75G 4GKGA 3HUSC 3G6EP 3TNUA 3D6ZA 2Q9IA 1GD2E 1EDLA 3S1KA 2FFDA 3O6QB 3Q5SA 3CWBG 1EXJA 1JTHA 3P8CD 3M0DA 3L74E 2V7QJ 1SLQA 4YTPC 3L75D 4IL6H 1BGYD 2Z5IA 3Q5RA 2FYUK 2HG5D 2QRXA 3CXHE 3V5BA 2K88A 1AV1A 1SQPD 2JR8A 3GF7A 1KZUB 1CI6A 4WY4B 1SFCB 1T8ZA 1RY3A 1OXZA 1ZN5A 2CK3H 3QH9A 1R5LA 5AVTB 1IFDA 4U7JA 1QVGO 4W7ZA 1GU4A 4ASWA 4HKZH 2KIKA 1RE3C 1L0NJ 2B88A 2NPSB 2P58A 1X22A 5KAFH 2PAJA 3CCUP 1JUNA 1N7SB 3S4RA 1WRGA 3CXHI 4ZKPA 1E79H 1P84H 3A7OA 5B66H 2HODA 3G3ZA 1JTHB 3H32A 1YJNP 2YIUC 3H1JD 4H13B 2FFDB 4EDFA 3BATA 5TJHA 1FU1A 1LWUC 2WVRA 3CI9A 4RKUJ 2FKWB 2JKVA 1YI2P 3FWLA 1H89A 4ZNCA 3H1JE 4UB8E 1PPJE 1G2CA 3H1IE 1CI6B 3AEAC 3BRTB 5AW0B 1BDDA 1M1JA 1JOCA 1G2CB 1RHZB 2W90A 2WQYC 4I7ZC 4R4MA 2CPSA 1VQ5P 1L2PA 1BGYJ 3BASA 3A3YB 1LT9A 1LP1B 3B71A 1S9KE 3SFDC 4HB1A 4UB6E 2B89A 3HRNA 1NU1E 5BU8B 5GTHH 4PD4D 3W67A 1S72P 1N8RQ 2VRSA 5KJ7C 3HD7D 2M0BA 1VF5D 3V4WA 4BWNA 1ZXGA 3TGUD 3KYQA 1KORA 4D6TG 1ZP0C 3PP5A 1KYOE 3AEBC 3CCLP 2L91A 2R5BA 3RBZA 3P7KA 1KN7A 2R44A 1NTMJ 1PP9G 1SFCC 3HD7B 4LC1A 1S5LH 3D71A 1USEA 1P84D 3CCSP 2XNDH 1LJ2A 3PLNA 2A45G 4WWIA 4YXDC 1KC8Q 1AQ5A 1M8OB 2SPZA 4IFDK 1KQFB 3H1KG 3A0HE 2OYHA 3IN6A 2YXRB 1LNQA 1EDJA 4PJ0H 2KYVA 1QEXA 4M3LA 3WUVA 5CBNA 1YBKA 1VQPP 1Q86Q 1FDIA 1YITP 2JWDA 4NPDA 2FXPA 1CSBA 2FYUE 2JEEA 2QG4A 4JPZB 3L73D 4PJ0E 1YQ4C 3RL0B 1NAYA 3V6IA 1SQVG 3IR9A 4WY4A 1KB9D 2DW3A 2N9BA 3V2NA 2ZVNB 4D6TE 1M7LA 4HJGH 3Q5PA 1SQPJ 1YTZT 5CCHC 1PZQA 4I2LC 2Z4EA 3B5NA 2XV5A 1ZR4A 1FZCA 3L70D 2WT7B 2G8YA 2IZ0A 2KLUA 1OFCX 2Y9YA 2Y0EA 2YKQA 2R5DA 4EOTA 1SQQD 2K9JB 2W83C 1M56D 1NTMD 2KSEA 1FOSF 1QGKB 1HJ0A 2Q1KA 2FYUG 1KQLA 4K3AA 2Q5UA 1MUUA 3MGNA 2H89C 4KT0J 4R4LA 4GDOA 4OGQD 5KKZB 1HWTC 1SFCD 4O9BA 1BE3G 3B8EB 5APTA 1NTME 1NO4A 5GTIE 5KLIB 3PHLA 3CC2P 5AVQB 1VF5C 1NU1K 3MP7B 2YKOA 3SWFA 1JMMA 2B87A 2R3CA 1M57D 1HVVA 2ITAA 2K1AA 2WWWA 2ZT9B 2KS1B 1W2EA 1RH5B 2HR3A 1M90Q 3H1LJ 2KK7A 1BCCG 2IBZI 2IPPA 4WY4D 1E5WA 2I8DA 1IC2A 1FZFA 2AEFA 1PPJD 3H1ID 2GM4A 3S9OA 1NTKE 2K9JA 2CPBA 3HE4B 1FDOA 1LTTC 2BCCD 3L73J 4H44B 3WUTA 4I1LA 1KD1Q 3CLQA 2ZXEB 1RF0A 1SQBJ 2NPSD 4W80A 1FDMA 1KV4A 1NTZJ 2O01H 1N7SC 3H1LG 3JCUH 5KAFE 5E79E 3RK3E 5KLVG 1ZMEC 3GHGC 1JEKA 3A5TA 5B5EH 2O01J 3BCCJ 1NWQA 2YIUB 2P10A 1FAVA 1SQBE 2WMMA 3II6A 2A06D 3L72D 3M9BA 3NMDA 4H13D 1NTKJ 2ZFCA 4WB4A 1BGYG 5AW5B 2ZVOB 1T2KD 4OH8B 4DJGA 3CC4P 2OYHB 1RE4C 1ZW0A 3RGUA 4OGQC 1VL2A 3RK2C 2E74C 2IFNA 3I55P 4HH2A 1VQNP 1L0LK 5AW6B 3HUSB 1VQ4P 1LP1A 5CJ4A 1SQXJ 1OMIA 1CW5A 1FZCB 2YO3A 4IL6E 5CMZA 1DEEG 5KKZC 4H0LB 3AE7C 3UIAA 2R32A 4BRYB 5GTIH 1BE3E 4KHXA 3R2PA 1D7MA 2OTKE 5AVXB 2O1JA 3L37A 3WUUA 3R4YA 1SP4A 2Y0CA 1LTJB 3VMYA 1VQ8P 1KB9H 1YYCA 5APSA 1VF5B 3CX5H 1T3JA 3GW6A 1FS0E 1BSNA 4WY4C 1VQOP 1S2EA 1SVFA 1RQUA 5AW2B 1WT6A 2ZT9C 1HH0A 1SQXG 1U57A 2KXPB 2FYZA 2E43A 3KHUA 3KZIE 2L5GB 2LXCB 4YPCA 3IF4A 3Q2YA 2KNCB 2POHA 1EZVD 1HGZA 1KB9E 4PD4H 3W68A 4U3FD 3RL0D 2RH0A 4L75A 2N1TD 1WMKA 1NTZD 3TK1A 2QA4P 3BRVB 1S5LE 4JYCA 3CWBE 4H44C 1K8AQ 1H0TA 3AEEC 1KFNA 1RF1A 2OYIB 1SQVK 2HYNA 2V4HA 1Q81Q 3CCJP 1EDIA 3H1KJ 3A0HH 1KYOD 1SQVJ 1YJWP 4DZOA 3NFQA 3CWBJ 1IZNB 3ZDMA 1NAFA 1AA0A 2D2CB 3OJAB 3RK3D 4L73A 5KJ7D 5CCGC 1IK7A 5C39A 4EIJA 4ASVA 1IFJA 1MFZA 2A06E 4UB6H 1XTGB 4B86A 3AECC 2FYUJ 3I56P 2YMKA 3Q3DA 4Z1MH 1IK9A 1NVOA 2PRRA 4WVZA 3LW5J 3VTPC 4DOJA 3NXSA 1SQQG 2BASA 1GL2B 5TISE 3HE5B 1Q7YQ 2M5AB 2KLVA 3GF3A 2A45I 3AE1C 3G9RA 1NGMB 3M0AA 3IAOA 1DH3A 4C7RA 3K5BA 2C0WA 4YXWH 2IFMA 2BEQD 3AE4C 1Q82Q 2JP3A 4C7NB 1U7JA 1SQXK 2YXQB 3C8VA 2E75B 3MUDC 1Y9BA 3MTUE 1SQVE 5AW9B 5TISH 2QE7H 1SQXE 2YNYA 2I1KA 5KTBA 3OW2O 1MV8A 2KUBA 3PTZA 2HLOA 3BCCD 3L73E 5H2FE 3KQGA 3TYYA 3VMZA 3CCEP 1MKMA 4PV1D 3L36A 1SQVD 3KZIH 4MN4C 2NPSA 3AE9C 2I1JA 3CCMP 1GTWA 3AE5C 3B4SA 3V2PA 1RE3A 2E75D 1EZVE 1YIJP 2OARA 1UIIA 3H1JJ 5CCHD 1PV3A 2M3EA 5AW8B 5KLVK 1HF9A 2OTJP 1N7LA 1R5SA 4OWFA 1SQBK 2AEJA 5AW7B 3WMM0 4H44D 1U7MA 4DCKA 1Y47A 3H1LD 5L8RJ 2GUVA 3M9HA 1FJKA 3H25A 1LWUA 1BE3D 1L0LG 1MFTA 2V7QH 1URQA 2W27A 1KILC 2QVAA 3MHVA 4QMAA 2FY8A 1GK4A 3E1IA 3M06A 5E79H 1DIPA 5AVRB 1YJ9P 2WSCJ 1DD4A 1LT9B 2PP6A 3D70A 3B5NB 3CMEP 2QSIA 1NU1J 3CMAP 4IFMA 1NU1D 1HTLC 1NTKG 1J2JB 4XA4A 1J1DC 3CX5I 2E74B 3OAKA 4IOIH 4EI2A 3VP9A 2YMYA 2Z5HA 1EQ7A 3FWNA 2WSFH 3VYIA 1KYOI 1JY2N 1P84I 2RN0A 3B5ND 4RESB 3L70G 3KDPB 1J1EB 2O3JA 2E76B 5APYA 5GTHE 4PV1C 1CZQA 1YQ3C 2WPSA 2E75C 5AVVB 1NTZK 2Q6QA 2R3SA 5CCGA 1N73C 1FZEA 5AW1B 3FXEA 1G1IA 2JJLA 2OQQA 4ZKUA 1SQXD 3AE8C 3U1CA 1FZAA 4GT1A 1KQSO 3JC22 4AUWA 2B87B
chains in the Genus database with same CATH topology
5B5EH 3WU2H 5GTHH 3JCUH 2AXTH 5E79H 5B66H 3KZIH 3A0HH 4IL6H 5GTIH 5KAIH 5H2FH 5TISH 5KAFH 4UB8H 1S5LH 3A0BH 4UB6H 4PJ0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E H;  3WU2 H;  5GTH H;  3JCU H;  2AXT H;  5E79 H;  5B66 H;  3KZI H;  3A0H H;  4IL6 H;  5GTI H;  5KAI H;  5H2F H;  5TIS H;  5KAF H;  4UB8 H;  1S5L H;  3A0B H;  4UB6 H;  4PJ0 H; 
#chains in the Genus database with same CATH topology
 3HTK B;  3QWO C;  4N78 D;  1QLE D;  4RO0 A;  5AVY B;  3SFE C;  4TLF A;  1KFM A;  4Y28 J;  2E5Y A;  3U59 A;  2A45 H;  1GW4 A;  3H1I J;  3RK3 B;  1KIL D;  3SWY A;  5B5E E;  3PH0 A;  1OIP A;  3GHG B;  1S1C X;  1HGV A;  2KZI A;  2HFE D;  2FYN B;  4XFJ A;  1T6A A;  4C7N A;  3G71 P;  2Y9Z A;  2C9L Y;  3CD6 P;  1GK6 A;  1LTJ A;  3AED C;  3L74 G;  1L4A A;  1IFM A;  3USS A;  1KIL B;  1GL2 D;  2RMZ A;  1FC2 C;  1LTS C;  2N1T C;  4U3F J;  3T97 A;  5CCH A;  2QEX P;  2D2C D;  2FXO A;  3B5N C;  3L72 J;  1NTM K;  1FZC C;  4LLH A;  3AE6 C;  1M1J B;  1X0T A;  3ABV C;  2M8R A;  1J1D B;  1K04 A;  3H1K D;  1GMJ A;  1N86 A;  2ZT9 D;  1ZLL A;  2GUS A;  2XDJ A;  2A06 G;  2K3R A;  3A0B H;  2N9Y B;  3BCC E;  3E1R A;  3M91 A;  2ZAE B;  3MZW B;  1OX3 A;  1SS1 A;  3H1H E;  1JCC A;  1NHL A;  1URQ D;  1J1E C;  4OVN F;  3TNU B;  4PV1 B;  1AVO A;  1JB0 J;  1KB9 I;  2HOD B;  2W6J H;  3H32 B;  2Y0D A;  1JY2 O;  5CBO A;  3C1L A;  1PP9 D;  1ZOY C;  2OYO A;  3A0B E;  1BGY E;  3FGA D;  2IX7 C;  3H6P A;  3L75 J;  3AEG C;  1KIL A;  1OVV A;  2B9B A;  1N73 B;  2H7H A;  2M3B A;  3T97 B;  2P1J A;  4Y99 C;  1H88 A;  3EFG A;  1PGO A;  3GG2 A;  1FJP A;  1IJD B;  2BCC J;  3L71 D;  4PD4 I;  4W7Y A;  5AVS B;  3VN0 A;  3ITK A;  2KNC A;  5KLV J;  2OYI C;  1ZR2 A;  1HJB A;  3P8M C;  3EFF K;  1EDK A;  3FX0 A;  5M1B A;  2JO1 A;  3TF5 A;  1S4X A;  1L0N D;  5EFW B;  1OVR A;  4WBA A;  3CCV P;  1BCC J;  2HPC A;  2D2C C;  4H13 C;  2MKV A;  2IBZ G;  3KXD A;  2BEZ F;  2WPQ A;  4H0L D;  2C9N Y;  1T2K C;  1VQ7 P;  2J59 M;  1X9V A;  3JCU E;  5K5G B;  2E74 D;  1PPJ G;  2KP8 A;  3H1I G;  1N73 A;  5APX A;  1NTZ E;  1YTZ I;  3EQ2 A;  1DX7 A;  1M1J C;  1PGJ A;  3TDK A;  5AVU B;  2E76 D;  1GL2 C;  5APW A;  3RK2 B;  1OZH A;  2WPR A;  3HD7 A;  3BCC G;  1IO4 A;  1LT9 C;  1BE3 J;  4JF7 A;  2OTL P;  3D6Y A;  1FOS E;  3VOP A;  5KLV E;  2H88 C;  1LTA C;  2M5A A;  2ZYG A;  1JY2 P;  3H1L E;  5APU A;  4GIF A;  5KJ7 A;  1GDT A;  1R8E A;  1K73 Q;  2HPC B;  2Q3E A;  1ZV8 A;  3A2A A;  1L0L D;  4L74 A;  2LKM A;  1LTJ C;  5KLV D;  2FXM A;  3TGU J;  4AQR D;  2NZ2 A;  3RL0 g;  2QJY B;  2GA1 A;  3SSU A;  2AEM A;  3MD0 A;  2IDB A;  5CHX A;  2W8Z A;  1BCC D;  1YHQ P;  1AJY A;  1QL2 A;  1VQL P;  1RQV A;  1NTK D;  1OW8 A;  1L0N K;  2ZJS E;  1UIX A;  3CWB D;  1BCC E;  4DT0 A;  1EC5 A;  2IZ1 A;  1QX8 A;  3CCR P;  1PIX A;  1BSH A;  2WSE H;  3AE2 C;  1RF1 C;  1VDF A;  1JM0 A;  2WZ7 A;  3H1H G;  1Q2N A;  3GMA A;  3L75 E;  4JQ0 D;  1IFP A;  2P7J A;  4KJM A;  4D6T J;  1LTG C;  2H43 A;  3L72 E;  3O6Q A;  2BCC G;  1SQP E;  2QJP C;  2BCC E;  5AW3 B;  4K35 A;  1NJI Q;  1NTM G;  1PP9 J;  1FZG A;  3L74 D;  1OVU A;  3VMA A;  3FXD A;  3KPE A;  4LGD E;  2YO2 A;  3CXH D;  3MIW A;  1Z56 A;  2C0X A;  1JY3 N;  2RKL A;  3LID A;  1PP9 E;  3TSI A;  1W2B O;  4AYC A;  3JSV C;  5BVZ A;  3Q1M A;  2QJK C;  1KIL E;  2J58 A;  3L35 A;  1T3U A;  2OYI A;  4U3F G;  4I7Z B;  4TT3 H;  5BU5 A;  5CCG D;  1L0L J;  5AVZ B;  1G1J A;  3F89 A;  4N78 E;  4N6J A;  4BRY A;  1NKN A;  1A02 J;  2E76 C;  1KTM A;  1JO5 A;  2E42 A;  3U1A A;  1SQQ K;  5DJU B;  2P67 A;  1NTK K;  5KLI C;  3WU2 E;  1NU1 G;  2K9Y A;  3CL3 D;  1VPC A;  1BDC A;  2O01 N;  3V2Q A;  3MUD A;  1SQP G;  2KSJ A;  3L72 G;  1L0N E;  3AE3 C;  3NTN A;  4L76 A;  2IYO A;  3H1J G;  1PGQ A;  1OW6 A;  2LR2 A;  1GU5 A;  2XNX A;  3L4F A;  4ZMD A;  1ZRT E;  3VP8 A;  2FBW C;  1AFO A;  1KYO H;  2WSE J;  3EWK A;  1JCD A;  1NTZ G;  2NPS C;  4NPF X;  1GL2 A;  4IFF A;  2MJZ A;  2KS1 A;  4Y99 B;  2H8P D;  2E5T A;  1GZL A;  3HD7 C;  1N7S D;  4RJT A;  1LT1 A;  2J5U A;  2JDI H;  2UWJ E;  2KI7 B;  1RF1 B;  3TGU E;  2WIT A;  2IBZ E;  3HUS A;  3IFM A;  4A7P A;  2WTY A;  1H0T B;  4XE5 B;  3L70 E;  2FFD C;  1DEB A;  3LW5 H;  1VQ6 P;  1RF0 C;  2KZJ A;  3P32 A;  3LIE A;  3M0D C;  1JMB A;  1NH4 A;  1N7S A;  1OW7 A;  1W5C E;  2IBZ D;  1SQB G;  4PD4 E;  3GHG A;  3V4Q A;  2PFX A;  1EZV I;  1NKZ B;  1DD3 A;  1L4A B;  1LGH B;  1MZ9 A;  1URQ C;  4N3Y B;  3L71 E;  1VQM P;  1A02 F;  3L71 G;  2AXT E;  3F5H A;  2WT7 A;  1Q90 D;  3M9Q A;  1FBM A;  1L0L E;  1SQB D;  1LTI C;  3N7N A;  5CJ0 A;  3CCQ P;  1JNM A;  1AVY A;  1RE4 A;  2ZYA A;  3L70 J;  1EXI A;  3CPW O;  1HUC A;  3E7K A;  1JY3 O;  2XU6 A;  2OGU A;  1FZB A;  2ZXX A;  2PGD A;  3HE4 A;  3OA7 A;  2XZR A;  3HE5 A;  1L4A D;  2W6A A;  1USD A;  4H0L C;  3RK2 D;  1NYH A;  2NRG A;  5AVW B;  1QVF O;  3C9I A;  3P8C E;  1PFI A;  2LXB A;  1S5L X;  3O8Z A;  5H2F H;  3TGU G;  4EYY Q;  2P2U A;  3GLM A;  1EZV G;  1SQP K;  1X8Y A;  1Y8A A;  2KB7 P;  4D6T D;  2QIW A;  3CXH H;  4GOD A;  3WU2 H;  2AXC A;  3BVH A;  2WPV B;  1L0N G;  5AW4 B;  1S3J A;  1N2D C;  3CX5 E;  2G3A A;  3G4S P;  1K9M Q;  3H1H J;  4BXL A;  2KOG A;  3VMX A;  3L73 G;  3N4X A;  2O1K A;  3CC7 P;  3L74 J;  2Q3I A;  1S9K D;  2QJY C;  2YKP A;  4I6M C;  1TU3 F;  3PRJ A;  1M1K Q;  3CX5 D;  1ZRT D;  1AQT A;  1OWA A;  3L71 J;  1X79 B;  3SWK A;  2JWA A;  2XKM A;  1K05 A;  1XTC C;  1HBW A;  5APV A;  1PL5 A;  2W6B A;  2WSC H;  1IFN A;  4U3F E;  5APQ A;  4NPE A;  2WSS H;  5KAI H;  2QM7 A;  3RK3 C;  1KMI Z;  3RL0 C;  1SQQ E;  1QL1 A;  2Q7C A;  1VQ9 P;  4HYT B;  3V2R A;  4GOF A;  4JBZ A;  2FYN C;  1GW3 A;  3AEF C;  2WSF J;  1H8A A;  1P84 E;  5B66 E;  1L4A C;  1URQ B;  1KQG B;  2QJP B;  5KAI E;  1SQQ J;  1LWU B;  2N1T A;  1LTB C;  3HTK A;  1SFC A;  2N1T B;  2AXT H;  2K37 A;  1JY3 P;  4GOE A;  3H1K E;  4UB8 H;  1IFI A;  4JYB A;  4IL6 X;  1VQK P;  2IYP A;  3I5C A;  2ZYD A;  3PJS K;  2OYH C;  1NOH A;  1PGP A;  3H1H D;  4OGQ B;  5DJT B;  2QM8 A;  3RBX A;  4C46 A;  1FE6 A;  4CPG A;  2FYU D;  2QJK B;  3L75 G;  4GKG A;  3HUS C;  3G6E P;  3TNU A;  3D6Z A;  2Q9I A;  1GD2 E;  1EDL A;  3S1K A;  2FFD A;  3O6Q B;  3Q5S A;  3CWB G;  1EXJ A;  1JTH A;  3P8C D;  3M0D A;  3L74 E;  2V7Q J;  1SLQ A;  4YTP C;  3L75 D;  4IL6 H;  1BGY D;  2Z5I A;  3Q5R A;  2FYU K;  2HG5 D;  2QRX A;  3CXH E;  3V5B A;  2K88 A;  1AV1 A;  1SQP D;  2JR8 A;  3GF7 A;  1KZU B;  1CI6 A;  4WY4 B;  1SFC B;  1T8Z A;  1RY3 A;  1OXZ A;  1ZN5 A;  2CK3 H;  3QH9 A;  1R5L A;  5AVT B;  1IFD A;  4U7J A;  1QVG O;  4W7Z A;  1GU4 A;  4ASW A;  4HKZ H;  2KIK A;  1RE3 C;  1L0N J;  2B88 A;  2NPS B;  2P58 A;  1X22 A;  5KAF H;  2PAJ A;  3CCU P;  1JUN A;  1N7S B;  3S4R A;  1WRG A;  3CXH I;  4ZKP A;  1E79 H;  1P84 H;  3A7O A;  5B66 H;  2HOD A;  3G3Z A;  1JTH B;  3H32 A;  1YJN P;  2YIU C;  3H1J D;  4H13 B;  2FFD B;  4EDF A;  3BAT A;  5TJH A;  1FU1 A;  1LWU C;  2WVR A;  3CI9 A;  4RKU J;  2FKW B;  2JKV A;  1YI2 P;  3FWL A;  1H89 A;  4ZNC A;  3H1J E;  4UB8 E;  1PPJ E;  1G2C A;  3H1I E;  1CI6 B;  3AEA C;  3BRT B;  5AW0 B;  1BDD A;  1M1J A;  1JOC A;  1G2C B;  1RHZ B;  2W90 A;  2WQY C;  4I7Z C;  4R4M A;  2CPS A;  1VQ5 P;  1L2P A;  1BGY J;  3BAS A;  3A3Y B;  1LT9 A;  1LP1 B;  3B71 A;  1S9K E;  3SFD C;  4HB1 A;  4UB6 E;  2B89 A;  3HRN A;  1NU1 E;  5BU8 B;  5GTH H;  4PD4 D;  3W67 A;  1S72 P;  1N8R Q;  2VRS A;  5KJ7 C;  3HD7 D;  2M0B A;  1VF5 D;  3V4W A;  4BWN A;  1ZXG A;  3TGU D;  3KYQ A;  1KOR A;  4D6T G;  1ZP0 C;  3PP5 A;  1KYO E;  3AEB C;  3CCL P;  2L91 A;  2R5B A;  3RBZ A;  3P7K A;  1KN7 A;  2R44 A;  1NTM J;  1PP9 G;  1SFC C;  3HD7 B;  4LC1 A;  1S5L H;  3D71 A;  1USE A;  1P84 D;  3CCS P;  2XND H;  1LJ2 A;  3PLN A;  2A45 G;  4WWI A;  4YXD C;  1KC8 Q;  1AQ5 A;  1M8O B;  2SPZ A;  4IFD K;  1KQF B;  3H1K G;  3A0H E;  2OYH A;  3IN6 A;  2YXR B;  1LNQ A;  1EDJ A;  4PJ0 H;  2KYV A;  1QEX A;  4M3L A;  3WUV A;  5CBN A;  1YBK A;  1VQP P;  1Q86 Q;  1FDI A;  1YIT P;  2JWD A;  4NPD A;  2FXP A;  1CSB A;  2FYU E;  2JEE A;  2QG4 A;  4JPZ B;  3L73 D;  4PJ0 E;  1YQ4 C;  3RL0 B;  1NAY A;  3V6I A;  1SQV G;  3IR9 A;  4WY4 A;  1KB9 D;  2DW3 A;  2N9B A;  3V2N A;  2ZVN B;  4D6T E;  1M7L A;  4HJG H;  3Q5P A;  1SQP J;  1YTZ T;  5CCH C;  1PZQ A;  4I2L C;  2Z4E A;  3B5N A;  2XV5 A;  1ZR4 A;  1FZC A;  3L70 D;  2WT7 B;  2G8Y A;  2IZ0 A;  2KLU A;  1OFC X;  2Y9Y A;  2Y0E A;  2YKQ A;  2R5D A;  4EOT A;  1SQQ D;  2K9J B;  2W83 C;  1M56 D;  1NTM D;  2KSE A;  1FOS F;  1QGK B;  1HJ0 A;  2Q1K A;  2FYU G;  1KQL A;  4K3A A;  2Q5U A;  1MUU A;  3MGN A;  2H89 C;  4KT0 J;  4R4L A;  4GDO A;  4OGQ D;  5KKZ B;  1HWT C;  1SFC D;  4O9B A;  1BE3 G;  3B8E B;  5APT A;  1NTM E;  1NO4 A;  5GTI E;  5KLI B;  3PHL A;  3CC2 P;  5AVQ B;  1VF5 C;  1NU1 K;  3MP7 B;  2YKO A;  3SWF A;  1JMM A;  2B87 A;  2R3C A;  1M57 D;  1HVV A;  2ITA A;  2K1A A;  2WWW A;  2ZT9 B;  2KS1 B;  1W2E A;  1RH5 B;  2HR3 A;  1M90 Q;  3H1L J;  2KK7 A;  1BCC G;  2IBZ I;  2IPP A;  4WY4 D;  1E5W A;  2I8D A;  1IC2 A;  1FZF A;  2AEF A;  1PPJ D;  3H1I D;  2GM4 A;  3S9O A;  1NTK E;  2K9J A;  2CPB A;  3HE4 B;  1FDO A;  1LTT C;  2BCC D;  3L73 J;  4H44 B;  3WUT A;  4I1L A;  1KD1 Q;  3CLQ A;  2ZXE B;  1RF0 A;  1SQB J;  2NPS D;  4W80 A;  1FDM A;  1KV4 A;  1NTZ J;  2O01 H;  1N7S C;  3H1L G;  3JCU H;  5KAF E;  5E79 E;  3RK3 E;  5KLV G;  1ZME C;  3GHG C;  1JEK A;  3A5T A;  5B5E H;  2O01 J;  3BCC J;  1NWQ A;  2YIU B;  2P10 A;  1FAV A;  1SQB E;  2WMM A;  3II6 A;  2A06 D;  3L72 D;  3M9B A;  3NMD A;  4H13 D;  1NTK J;  2ZFC A;  4WB4 A;  1BGY G;  5AW5 B;  2ZVO B;  1T2K D;  4OH8 B;  4DJG A;  3CC4 P;  2OYH B;  1RE4 C;  1ZW0 A;  3RGU A;  4OGQ C;  1VL2 A;  3RK2 C;  2E74 C;  2IFN A;  3I55 P;  4HH2 A;  1VQN P;  1L0L K;  5AW6 B;  3HUS B;  1VQ4 P;  1LP1 A;  5CJ4 A;  1SQX J;  1OMI A;  1CW5 A;  1FZC B;  2YO3 A;  4IL6 E;  5CMZ A;  1DEE G;  5KKZ C;  4H0L B;  3AE7 C;  3UIA A;  2R32 A;  4BRY B;  5GTI H;  1BE3 E;  4KHX A;  3R2P A;  1D7M A;  2OTK E;  5AVX B;  2O1J A;  3L37 A;  3WUU A;  3R4Y A;  1SP4 A;  2Y0C A;  1LTJ B;  3VMY A;  1VQ8 P;  1KB9 H;  1YYC A;  5APS A;  1VF5 B;  3CX5 H;  1T3J A;  3GW6 A;  1FS0 E;  1BSN A;  4WY4 C;  1VQO P;  1S2E A;  1SVF A;  1RQU A;  5AW2 B;  1WT6 A;  2ZT9 C;  1HH0 A;  1SQX G;  1U57 A;  2KXP B;  2FYZ A;  2E43 A;  3KHU A;  3KZI E;  2L5G B;  2LXC B;  4YPC A;  3IF4 A;  3Q2Y A;  2KNC B;  2POH A;  1EZV D;  1HGZ A;  1KB9 E;  4PD4 H;  3W68 A;  4U3F D;  3RL0 D;  2RH0 A;  4L75 A;  2N1T D;  1WMK A;  1NTZ D;  3TK1 A;  2QA4 P;  3BRV B;  1S5L E;  4JYC A;  3CWB E;  4H44 C;  1K8A Q;  1H0T A;  3AEE C;  1KFN A;  1RF1 A;  2OYI B;  1SQV K;  2HYN A;  2V4H A;  1Q81 Q;  3CCJ P;  1EDI A;  3H1K J;  3A0H H;  1KYO D;  1SQV J;  1YJW P;  4DZO A;  3NFQ A;  3CWB J;  1IZN B;  3ZDM A;  1NAF A;  1AA0 A;  2D2C B;  3OJA B;  3RK3 D;  4L73 A;  5KJ7 D;  5CCG C;  1IK7 A;  5C39 A;  4EIJ A;  4ASV A;  1IFJ A;  1MFZ A;  2A06 E;  4UB6 H;  1XTG B;  4B86 A;  3AEC C;  2FYU J;  3I56 P;  2YMK A;  3Q3D A;  4Z1M H;  1IK9 A;  1NVO A;  2PRR A;  4WVZ A;  3LW5 J;  3VTP C;  4DOJ A;  3NXS A;  1SQQ G;  2BAS A;  1GL2 B;  5TIS E;  3HE5 B;  1Q7Y Q;  2M5A B;  2KLV A;  3GF3 A;  2A45 I;  3AE1 C;  3G9R A;  1NGM B;  3M0A A;  3IAO A;  1DH3 A;  4C7R A;  3K5B A;  2C0W A;  4YXW H;  2IFM A;  2BEQ D;  3AE4 C;  1Q82 Q;  2JP3 A;  4C7N B;  1U7J A;  1SQX K;  2YXQ B;  3C8V A;  2E75 B;  3MUD C;  1Y9B A;  3MTU E;  1SQV E;  5AW9 B;  5TIS H;  2QE7 H;  1SQX E;  2YNY A;  2I1K A;  5KTB A;  3OW2 O;  1MV8 A;  2KUB A;  3PTZ A;  2HLO A;  3BCC D;  3L73 E;  5H2F E;  3KQG A;  3TYY A;  3VMZ A;  3CCE P;  1MKM A;  4PV1 D;  3L36 A;  1SQV D;  3KZI H;  4MN4 C;  2NPS A;  3AE9 C;  2I1J A;  3CCM P;  1GTW A;  3AE5 C;  3B4S A;  3V2P A;  1RE3 A;  2E75 D;  1EZV E;  1YIJ P;  2OAR A;  1UII A;  3H1J J;  5CCH D;  1PV3 A;  2M3E A;  5AW8 B;  5KLV K;  1HF9 A;  2OTJ P;  1N7L A;  1R5S A;  4OWF A;  1SQB K;  2AEJ A;  5AW7 B;  3WMM 0;  4H44 D;  1U7M A;  4DCK A;  1Y47 A;  3H1L D;  5L8R J;  2GUV A;  3M9H A;  1FJK A;  3H25 A;  1LWU A;  1BE3 D;  1L0L G;  1MFT A;  2V7Q H;  1URQ A;  2W27 A;  1KIL C;  2QVA A;  3MHV A;  4QMA A;  2FY8 A;  1GK4 A;  3E1I A;  3M06 A;  5E79 H;  1DIP A;  5AVR B;  1YJ9 P;  2WSC J;  1DD4 A;  1LT9 B;  2PP6 A;  3D70 A;  3B5N B;  3CME P;  2QSI A;  1NU1 J;  3CMA P;  4IFM A;  1NU1 D;  1HTL C;  1NTK G;  1J2J B;  4XA4 A;  1J1D C;  3CX5 I;  2E74 B;  3OAK A;  4IOI H;  4EI2 A;  3VP9 A;  2YMY A;  2Z5H A;  1EQ7 A;  3FWN A;  2WSF H;  3VYI A;  1KYO I;  1JY2 N;  1P84 I;  2RN0 A;  3B5N D;  4RES B;  3L70 G;  3KDP B;  1J1E B;  2O3J A;  2E76 B;  5APY A;  5GTH E;  4PV1 C;  1CZQ A;  1YQ3 C;  2WPS A;  2E75 C;  5AVV B;  1NTZ K;  2Q6Q A;  2R3S A;  5CCG A;  1N73 C;  1FZE A;  5AW1 B;  3FXE A;  1G1I A;  2JJL A;  2OQQ A;  4ZKU A;  1SQX D;  3AE8 C;  3U1C A;  1FZA A;  4GT1 A;  1KQS O;  3JC2 2;  4AUW A;  2B87 B; 
#chains in the Genus database with same CATH homology
 5B5E H;  3WU2 H;  5GTH H;  3JCU H;  2AXT H;  5E79 H;  5B66 H;  3KZI H;  3A0H H;  4IL6 H;  5GTI H;  5KAI H;  5H2F H;  5TIS H;  5KAF H;  4UB8 H;  1S5L H;  3A0B H;  4UB6 H;  4PJ0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...