5B66H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5b66H01
5GTIH 3A0HH 4UB6H 5H2FH 5TISH 3A0BH 3WU2H 1S5LH 5B5EH 5KAFH 3JCUH 3KZIH 4PJ0H 4UB8H 5E79H 5B66H 2AXTH 4IL6H 5GTHH 5KAIH
chains in the Genus database with same CATH superfamily
3D70A 3FXDA 3B5NC 2VRSA 2JWDA 4RESB 1S2EA 1LT9B 5GTIE 5APSA 2CPSA 3D71A 2LR2A 2Q3EA 2IZ0A 2FXOA 1YYCA 4IL6H 2IX7C 3A7OA 2OYHB 5AVVB 4H13B 1NTZJ 2O01H 3H1KD 5KLVG 1K73Q 1PGJA 4H44D 3ITKA 1S5LH 2OYOA 2KZJA 2QVAA 1R8EA 1JY2O 5AVXB 1VQMP 4AQRD 1Q82Q 1E79H 3VMZA 3KZIE 3P8MC 1BE3D 1L0LJ 5APVA 4DJGA 2YKQA 1NU1D 1FE6A 5AW1B 5L8RJ 1L0NG 3FWNA 1G1IA 3B5ND 3L73D 1N73B 3M9BA 3SWYA 3L75G 1URQA 1VQ5P 2DW3A 4XA4A 1JCDA 1EZVG 4JQ0D 4KHXA 5CCHC 1LNQA 1VQOP 1S1CX 1Q81Q 2K88A 2WVRA 2Z5IA 1H88A 1PP9G 1FU1A 2HR3A 3IR9A 4CPGA 3TGUG 2Q7CA 4WY4C 1JTHB 2R44A 1OW6A 1SQQE 2QJKC 1X8YA 2B87B 4GIFA 3H1HJ 1S9KD 2OTLP 2BCCG 2XNXA 2Y9ZA 3V4WA 4D6TG 1NTMG 2Q6QA 1BE3E 3MP7B 4ASVA 2ZYDA 1NU1E 2ITAA 3SWKA 2QA4P 2AXTH 3L74G 3WMM0 2HPCA 3TYYA 1PL5A 3L73E 5CCHD 4IL6X 3TDKA 2C0XA 4JYBA 3CXHD 1LTJA 3S1KA 1JY3N 2QE7H 1S5LX 1VPCA 4WY4D 3HD7C 1KD1Q 2HLOA 3RL0g 1GK6A 1NTZK 2A06D 3UIAA 2KUBA 3Q1MA 3GF3A 3AE2C 2E5TA 1VQPP 3B4SA 2GUSA 3VP9A 4LLHA 4R4MA 3A5TA 3HUSC 3CX5H 4IFMA 1JOCA 3QWOC 1UIXA 3RL0B 3M0DA 3AE6C 3L71G 1AVYA 2K9JB 2E5YA 4YXDC 3EQ2A 1DEEG 1N7LA 5KLVD 4LGDE 2WSEH 3AE9C 1GMJA 2J59M 3AEAC 2AEJA 1BCCG 3OJAB 1JO5A 4HKZH 3H1IG 2YXQB 3B71A 1T2KC 2A45H 3HD7D 2K1AA 1YI2P 1N2DC 3CXHE 1N8RQ 5TISE 4H44B 1OW7A 1SP4A 1LT9A 1RF0C 5GTHH 3H1LG 2N9YB 2WPRA 3TSIA 2OGUA 5B66E 3T97B 3LW5H 4ZNCA 2OYHA 3A0BH 1RQVA 3H1JG 2Q9IA 4U3FJ 1QX8A 3FGAD 4WVZA 2A06E 3L37A 3L75D 1SQVE 4R4LA 1JY3O 3RBXA 4DZOA 1VQKP 3ABVC 2JEEA 1EZVD 1KMIZ 1EC5A 2NRGA 5AVUB 3P8CE 3P7KA 2QRXA 1IFIA 1CI6B 4N3YB 1PP9D 3TGUD 1EDIA 4PD4E 5AVTB 3WU2E 1KYOI 2AEFA 5KLVE 1XTGB 1T2KD 1N73A 2ZT9C 3L72J 5CJ0A 1JCCA 1Q86Q 4NPDA 1AFOA 4W7ZA 3PTZA 2BCCD 3CWBE 1UIIA 2Z4EA 1N7SA 3HTKB 4D6TD 1NTMD 4H0LB 1K04A 1PGQA 1RH5B 4AYCA 5KAIH 1NGMB 4L76A 3R2PA 2YMKA 2V4HA 3L74D 2FYUD 4ZKUA 2B87A 3L75E 1BGYJ 1P84E 4RJTA 5KKZC 5EFWB 2Y0EA 1ZRTD 5DJUB 5AVWB 2Q1KA 1GZLA 3CX5I 4DOJA 4PD4I 1PP9E 2POHA 2AXCA 1EQ7A 2ZT9D 2ZXEB 3TGUE 1M1JC 2I1JA 3VMYA 3F89A 3CCVP 4M3LA 2QM8A 1X0TA 2QJKB 1FJPA 3BCCE 3I5CA 1NTKE 1FOSF 1QGKB 2WSCJ 3Q5SA 4D6TE 5C39A 5AVZB 3L71D 3FXEA 2KLVA 1NOHA 2IPPA 2KXPB 2QJPB 3M9QA 3CCLP 5CBOA 1KORA 3PJSK 1BCCD 1VF5B 1SVFA 2FYUE 1P84I 3H1ID 1Q90D 4RO0A 3CMEP 1CW5A 1HVVA 2P2UA 1RE4C 2KYVA 1NTZG 1QVGO 2W6JH 1L4AC 3E1IA 2FBWC 2AEMA 2QJYB 2K9JA 2HODB 1FJKA 3WUUA 2YKOA 4JYCA 3H1JD 2XKMA 1FOSE 4GODA 2FFDC 2P58A 4PJ0E 1BDCA 3RK3C 2IBZG 1ZR2A 1GU4A 2N9BA 3N7NA 2R32A 2E74B 1LTGC 5H2FE 1JY2N 4DT0A 1SFCB 5APYA 2BEQD 1M56D 4IOIH 3L71E 2JWAA 1JMBA 1USDA 4QMAA 3T97A 5KAFH 2CPBA 3KZIH 3CI9A 1Y8AA 1RF1A 2YIUC 1BCCE 1RY3A 3CCMP 1L4AD 2FY8A 1GW3A 4I6MC 1FZFA 4JF7A 2KK7A 1SQQJ 1VDFA 5AW7B 1LGHB 2W27A 3M06A 3MHVA 3AEGC 1CI6A 3II6A 3RK3D 2M0BA 4ZKPA 2JKVA 1SQBD 4RKUJ 1U7MA 3PHLA 4WBAA 1PZQA 2WTYA 1BE3J 3WUVA 1DX7A 3EFGA 1VQ8P 3GHGB 1RE3C 1NU1J 2WZ7A 4PV1C 2P67A 3AE5C 1HTLC 1M1KQ 3L73J 3Q5RA 4MN4C 1JNMA 2M8RA 5BU5A 1WMKA 1GU5A 1KILC 1SQPK 1SQXD 2W8ZA 4TLFA 2V7QJ 2WPVB 3G71P 1KB9I 2JDIH 5AW0B 1EXJA 2ZT9B 4UB6H 2YXRB 2WSFJ 1HGVA 4L75A 1LWUC 3CC4P 2ZVOB 3RK3E 3CCEP 1SQBE 2A45G 3NTNA 3CCQP 2O01N 4LC1A 4PV1D 1T3UA 1SS1A 1KFMA 2YNYA 3RGUA 4OVNF 1ZLLA 3USSA 3FWLA 3KHUA 2V7QH 1EDLA 2NPSA 1NTZD 1KILD 1OIPA 3I56P 3IFMA 1USEA 3H1KE 2MKVA 1RHZB 2H89C 1PPJG 2OTKE 1Q7YQ 2IBZD 4NPFX 5CJ4A 1FZEA 1SQXE 1M1JB 3V2PA 1IK9A 3GMAA 1JUNA 3M9HA 4C46A 4IL6E 2OYIC 2XV5A 4WWIA 3MUDC 1VQNP 1KYOH 3MZWB 1SQVJ 1SQQK 2P7JA 4U3FG 1FAVA 1S5LE 3F5HA 1FZCB 1J1DC 1GL2B 3MIWA 1FBMA 4GOEA 2HODA 3SSUA 2CK3H 3G9RA 2FYNB 2WITA 5TISH 2KSEA 4YXWH 3D6ZA 4GKGA 2JJLA 3OA7A 5KLVJ 3V4QA 1QL1A 1NO4A 3JCUE 2BASA 5CCGA 1W2EA 1KILE 1SFCA 2E76C 3KYQA 3CWBJ 1L4AB 1K9MQ 1U57A 4GDOA 5TJHA 5KLIC 2YO3A 1HUCA 2IBZE 2WWWA 1S9KE 3GG2A 5AW6B 1OX3A 3RK3B 1MKMA 1G2CA 3KXDA 3BRTB 3EFFK 4PD4H 2C9NY 3WU2H 5K5GB 2SPZA 2M3BA 2GUVA 1L0LK 3L75J 2E75C 1FZBA 1KV4A 1HH0A 1NJIQ 2HG5D 2M3EA 2XNDH 1W2BO 4O9BA 2KS1B 4XE5B 1Y47A 2R5DA 1Y9BA 3N4XA 3CX5D 1VQ7P 2WT7B 1KN7A 1QLED 1K05A 1AQTA 1NH4A 2YIUB 3TGUJ 3GHGA 2E76D 4C7NB 3ZDMA 2KSJA 3M0DC 4EI2A 1M90Q 3H25A 4OGQC 2ZJSE 2JR8A 2AXTE 1L0ND 3BCCJ 1P84H 2RMZA 2GM4A 2K9YA 3L4FA 2JO1A 1KQLA 1NTKJ 1Q2NA 3HE4B 4D6TJ 2OTJP 3SWFA 3AE4C 3U1AA 1LJ2A 1ZMEC 5AW5B 1IJDB 1AVOA 5APUA 3B5NB 2E75D 1NYHA 1JM0A 1LT9C 3NXSA 3VOPA 1SQPG 4GOFA 3AE3C 3A0HE 2FYUJ 1S4XA 2KNCB 1SQVK 1H0TB 1FZGA 2LXBA 3BASA 2OYHC 4H13C 2J58A 3IF4A 3V6IA 3BATA 1X22A 1PPJD 1YTZI 5E79E 2Q3IA 2QG4A 1KZUB 5DJTB 1YITP 3CXHI 3GF7A 1MFTA 2L91A 3C9IA 1GW4A 4OGQD 1X79B 3SFEC 2D2CC 2O1KA 3AE8C 3EWKA 2FYZA 1OFCX 1MFZA 1LTIC 1NWQA 5B5EH 1L0NE 2YKPA 1U7JA 3HE5B 3SFDC 1Z56A 1JTHA 5AVQB 1LWUB 1N73C 1HWTC 1HJ0A 3L71J 1J2JB 3L70G 3S9OA 1N7SC 1S3JA 1EZVE 4KJMA 5GTHE 3RBZA 4H13D 1BCCJ 5CHXA 4UB8H 1NAYA 4EIJA 1KTMA 1X9VA 1GDTA 3E7KA 1FZCA 1GL2A 1BSHA 2PFXA 5H2FH 1AV1A 4WY4B 2ZYAA 5KJ7C 2D2CD 1NKNA 4K3AA 3Q3DA 1SQQG 3VP8A 2BCCE 2FXPA 3V2NA 3PH0A 1IFNA 2W6BA 1NTME 3AEFC 1FDMA 2WMMA 2FKWB 2OYIB 3CPWO 2PRRA 3W68A 3G3ZA 1RE4A 1L4AA 1KB9H 3TK1A 3L74E 2H7HA 1N7SD 1MV8A 1NTKK 1IO4A 2K37A 1IFDA 1VL2A 2UWJE 3O6QB 4Y99C 1FZAA 1JY2P 1EZVI 2WQYC 2QM7A 1ZRTE 3AECC 2WSCH 1GTWA 4JPZB 1NVOA 3H1LD 1IFJA 1JMMA 1ZR4A 2H43A 3CC2P 4HB1A 3HD7B 5KJ7D 2FYUK 3MD0A 2PAJA 3AE1C 3PP5A 5GTIH 3V5BA 4IFDK 3HRNA 2KS1A 3PRJA 2L5GB 2RH0A 3JC22 1ZP0C 1WT6A 1L0LG 3W67A 3C1LA 2WT7A 5BU8B 1OW8A 1GK4A 4Y28J 1SQBJ 4EDFA 4K35A 2WPSA 4C7NA 5APTA 1SQPD 3G4SP 3HUSB 2KOGA 2QSIA 4I2LC 2WSSH 2HFED 5AVYB 5APXA 4N78D 2E75B 1YTZT 4OH8B 3H1IE 3TF5A 1YQ4C 3K5BA 3H1KJ 1A02F 1KFNA 1BDDA 1G1JA 2B9BA 1JEKA 3B5NA 4KT0J 3CCUP 3H1LE 1SQXJ 4L74A 3H1HG 5AW9B 5CMZA 2KNCA 1LTSC 4OGQB 1H0TA 3H1JE 2IYPA 4YTPC 3VTPC 1FC2C 4XFJA 1RF1C 1QEXA 4IFFA 3LIDA 2Y0DA 2N1TC 1DEBA 2W90A 4B86A 1VQ9P 1CZQA 1SQVG 3L70D 4I7ZC 3HTKA 1YIJP 1LTAC 3A3YB 5CBNA 3AE7C 1OXZA 3U59A 1KQGB 3M0AA 1SQPE 1W5CE 4TT3H 3NMDA 4YPCA 4BXLA 1HJBA 1IZNB 3HE5A 4N78E 1LP1B 1H89A 2Z5HA 1LWUA 1PIXA 1SQQD 1ZOYC 5AW8B 1AJYA 3L36A 1PFIA 2E42A 2W83C 1YBKA 3CWBG 4H0LC 2I8DA 2D2CB 4EYYQ 1HGZA 1VQLP 5CCHA 5KAFE 1N86A 2LKMA 2N1TD 1HBWA 1T3JA 3Q2YA 1ZW0A 2IDBA 2H88C 3H32B 3JCUH 4WY4A 2KI7B 3L35A 3I55P 2YMYA 3L70E 1KQSO 2K3RA 5KKZB 1J1EC 4N6JA 1SQBK 2WSFH 3RK2C 1MZ9A 3TNUB 3FX0A 3VMXA 1SLQA 1N7SB 2RKLA 3GW6A 1ZV8A 2OYIA 1M8OB 3MUDA 1URQC 4JBZA 3BRVB 2HYNA 2KZIA 2QEXP 4U7JA 4BRYB 2PGDA 2JP3A 1JY3P 1OWAA 2MJZA 1L0LD 4H0LD 4NPEA 1OMIA 3O6QA 1OVRA 2NPSC 2ZAEB 3E1RA 3BCCG 1RQUA 3QH9A 1NTKG 5BVZA 4Z1MH 5AW4B 1NAFA 3CXHH 1SQXK 3HD7A 2QJPC 4HH2A 1JB0J 1VF5C 4UB6E 1KYOD 2FXMA 2M5AB 1D7MA 3RK2D 1YHQP 5M1BA 5B66H 1NU1K 2FYUG 2ZVNB 1HF9A 1GD2E 1NTZE 4Y99B 1URQD 3CMAP 1FS0E 3HUSA 3H1HD 3V2QA 1NHLA 3VN0A 3L72G 2YO2A 2XDJA 2QJYC 3H6PA 1KQFB 4ASWA 2KB7P 2ZFCA 1LTJC 2NPSD 2WSEJ 2FFDB 2OARA 3A0HH 1L0NJ 2W6AA 1LTTC 1SQVD 1L0LE 2E74C 5CCGC 2IFMA 5E79H 1SFCC 3P8CD 5APWA 2C0WA 1IK7A 1LTBC 1VF5D 1BGYG 4ZMDA 1RF0A 3LW5J 3AEEC 4PD4D 3CCJP 3S4RA 1PP9J 2H8PD 1YJNP 1TU3F 1OVUA 1KYOE 1CSBA 5KTBA 1IFPA 1ZXGA 3CWBD 2ZYGA 2Q5UA 4C7RA 2R3CA 2BCCJ 3AEBC 1WRGA 3VYIA 3H1HE 2BEZF 1NTMJ 3IN6A 4I1LA 2IBZI 2IFNA 2E74D 2OQQA 1YJWP 1XTCC 3BVHA 2ZXXA 1LP1A 2J5UA 5CCGD 1RF1B 3GHGC 1SFCD 2N1TB 1P84D 3L74J 3GLMA 4PV1B 2WPQA 3MGNA 1K8AQ 4I7ZB 1M57D 2IYOA 1IC2A 3VMAA 2GA1A 2E43A 1DH3A 3V2RA 1S72P 3KPEA 1KILB 3CLQA 5AVRB 3CX5E 3JSVC 3U1CA 3H32A 3D6YA 5KLVK 3R4YA 1OVVA 3BCCD 1AQ5A 4EOTA 2P10A 4U3FD 3TNUA 1NTKD 5APQA 1L2PA 2KIKA 2B89A 3IAOA 2G3AA 1NKZB 1R5LA 2Y9YA 1R5SA 1FDOA 3MTUE 4HYTB 1SQBG 1H8AA 4BRYA 1M1JA 2P1JA 3WUTA 5KJ7A 1L0NK 4PJ0H 3A0BE 3KDPB 3H1IJ 1PGOA 1J1EB 3AEDC 3L72D 3P32A 5AW2B 3RK2B 2IZ1A 1EXIA 1PPJE 2G8YA 3H1KG 1BSNA 3CD6P 3G6EP 3H1LJ 4GT1A 1M7LA 1DIPA 1URQB 2I1KA 2KP8A 2XU6A 2M5AA 3H1JJ 1YJ9P 1SQXG 1VQ6P 3CCSP 2Y0CA 3CL3D 4BWNA 2PP6A 4L73A 4OWFA 3A2AA 4U3FE 2NPSB 1BE3G 1EDKA 1BGYD 2C9LY 2A45I 1FZCC 1GL2C 3PLNA 1NU1G 4AUWA 1J1DB 1NTMK 1T8ZA 2R5BA 1MUUA 2FYNC 1E5WA 1SQPJ 4A7PA 3L73G 1A02J 2FFDA 5KAIE 3CC7P 2XZRA 5B5EE 1PV3A 1AA0A 1KB9D 2QIWA 1OZHA 1YQ3C 1LT1A 3CCRP 2E76B 3L72E 4HJGH 1IFMA 2R3SA 2HPCB 2LXCB 3OAKA 5KLIB 2KLUA 1LTJB 4UB8E 3RL0C 5AW3B 3Q5PA 1GL2D 1VQ4P 2NZ2A 4WB4A 3LIEA 2O1JA 1ZN5A 3L70J 4W80A 4W7YA 1BGYE 1PGPA 3HE4A 3OW2O 1EDJA 3B8EB 3M91A 1FDIA 1KC8Q 4H44C 5AVSB 1DD4A 3O8ZA 2N1TA 1G2CB 1RE3A 2O3JA 2B88A 1T6AA 2RN0A 1QVFO 1QL2A 1KB9E 2O01J 3NFQA 3C8VA 1KILA 1DD3A 2A06G 3RL0D 3KQGA 4DCKA
chains in the Genus database with same CATH topology
5GTIH 3A0HH 4UB6H 5H2FH 5TISH 3A0BH 3WU2H 1S5LH 5B5EH 5KAFH 3JCUH 3KZIH 4PJ0H 4UB8H 5E79H 5B66H 2AXTH 4IL6H 5GTHH 5KAIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI H;  3A0H H;  4UB6 H;  5H2F H;  5TIS H;  3A0B H;  3WU2 H;  1S5L H;  5B5E H;  5KAF H;  3JCU H;  3KZI H;  4PJ0 H;  4UB8 H;  5E79 H;  5B66 H;  2AXT H;  4IL6 H;  5GTH H;  5KAI H; 
#chains in the Genus database with same CATH topology
 3D70 A;  3FXD A;  3B5N C;  2VRS A;  2JWD A;  4RES B;  1S2E A;  1LT9 B;  5GTI E;  5APS A;  2CPS A;  3D71 A;  2LR2 A;  2Q3E A;  2IZ0 A;  2FXO A;  1YYC A;  4IL6 H;  2IX7 C;  3A7O A;  2OYH B;  5AVV B;  4H13 B;  1NTZ J;  2O01 H;  3H1K D;  5KLV G;  1K73 Q;  1PGJ A;  4H44 D;  3ITK A;  1S5L H;  2OYO A;  2KZJ A;  2QVA A;  1R8E A;  1JY2 O;  5AVX B;  1VQM P;  4AQR D;  1Q82 Q;  1E79 H;  3VMZ A;  3KZI E;  3P8M C;  1BE3 D;  1L0L J;  5APV A;  4DJG A;  2YKQ A;  1NU1 D;  1FE6 A;  5AW1 B;  5L8R J;  1L0N G;  3FWN A;  1G1I A;  3B5N D;  3L73 D;  1N73 B;  3M9B A;  3SWY A;  3L75 G;  1URQ A;  1VQ5 P;  2DW3 A;  4XA4 A;  1JCD A;  1EZV G;  4JQ0 D;  4KHX A;  5CCH C;  1LNQ A;  1VQO P;  1S1C X;  1Q81 Q;  2K88 A;  2WVR A;  2Z5I A;  1H88 A;  1PP9 G;  1FU1 A;  2HR3 A;  3IR9 A;  4CPG A;  3TGU G;  2Q7C A;  4WY4 C;  1JTH B;  2R44 A;  1OW6 A;  1SQQ E;  2QJK C;  1X8Y A;  2B87 B;  4GIF A;  3H1H J;  1S9K D;  2OTL P;  2BCC G;  2XNX A;  2Y9Z A;  3V4W A;  4D6T G;  1NTM G;  2Q6Q A;  1BE3 E;  3MP7 B;  4ASV A;  2ZYD A;  1NU1 E;  2ITA A;  3SWK A;  2QA4 P;  2AXT H;  3L74 G;  3WMM 0;  2HPC A;  3TYY A;  1PL5 A;  3L73 E;  5CCH D;  4IL6 X;  3TDK A;  2C0X A;  4JYB A;  3CXH D;  1LTJ A;  3S1K A;  1JY3 N;  2QE7 H;  1S5L X;  1VPC A;  4WY4 D;  3HD7 C;  1KD1 Q;  2HLO A;  3RL0 g;  1GK6 A;  1NTZ K;  2A06 D;  3UIA A;  2KUB A;  3Q1M A;  3GF3 A;  3AE2 C;  2E5T A;  1VQP P;  3B4S A;  2GUS A;  3VP9 A;  4LLH A;  4R4M A;  3A5T A;  3HUS C;  3CX5 H;  4IFM A;  1JOC A;  3QWO C;  1UIX A;  3RL0 B;  3M0D A;  3AE6 C;  3L71 G;  1AVY A;  2K9J B;  2E5Y A;  4YXD C;  3EQ2 A;  1DEE G;  1N7L A;  5KLV D;  4LGD E;  2WSE H;  3AE9 C;  1GMJ A;  2J59 M;  3AEA C;  2AEJ A;  1BCC G;  3OJA B;  1JO5 A;  4HKZ H;  3H1I G;  2YXQ B;  3B71 A;  1T2K C;  2A45 H;  3HD7 D;  2K1A A;  1YI2 P;  1N2D C;  3CXH E;  1N8R Q;  5TIS E;  4H44 B;  1OW7 A;  1SP4 A;  1LT9 A;  1RF0 C;  5GTH H;  3H1L G;  2N9Y B;  2WPR A;  3TSI A;  2OGU A;  5B66 E;  3T97 B;  3LW5 H;  4ZNC A;  2OYH A;  3A0B H;  1RQV A;  3H1J G;  2Q9I A;  4U3F J;  1QX8 A;  3FGA D;  4WVZ A;  2A06 E;  3L37 A;  3L75 D;  1SQV E;  4R4L A;  1JY3 O;  3RBX A;  4DZO A;  1VQK P;  3ABV C;  2JEE A;  1EZV D;  1KMI Z;  1EC5 A;  2NRG A;  5AVU B;  3P8C E;  3P7K A;  2QRX A;  1IFI A;  1CI6 B;  4N3Y B;  1PP9 D;  3TGU D;  1EDI A;  4PD4 E;  5AVT B;  3WU2 E;  1KYO I;  2AEF A;  5KLV E;  1XTG B;  1T2K D;  1N73 A;  2ZT9 C;  3L72 J;  5CJ0 A;  1JCC A;  1Q86 Q;  4NPD A;  1AFO A;  4W7Z A;  3PTZ A;  2BCC D;  3CWB E;  1UII A;  2Z4E A;  1N7S A;  3HTK B;  4D6T D;  1NTM D;  4H0L B;  1K04 A;  1PGQ A;  1RH5 B;  4AYC A;  5KAI H;  1NGM B;  4L76 A;  3R2P A;  2YMK A;  2V4H A;  3L74 D;  2FYU D;  4ZKU A;  2B87 A;  3L75 E;  1BGY J;  1P84 E;  4RJT A;  5KKZ C;  5EFW B;  2Y0E A;  1ZRT D;  5DJU B;  5AVW B;  2Q1K A;  1GZL A;  3CX5 I;  4DOJ A;  4PD4 I;  1PP9 E;  2POH A;  2AXC A;  1EQ7 A;  2ZT9 D;  2ZXE B;  3TGU E;  1M1J C;  2I1J A;  3VMY A;  3F89 A;  3CCV P;  4M3L A;  2QM8 A;  1X0T A;  2QJK B;  1FJP A;  3BCC E;  3I5C A;  1NTK E;  1FOS F;  1QGK B;  2WSC J;  3Q5S A;  4D6T E;  5C39 A;  5AVZ B;  3L71 D;  3FXE A;  2KLV A;  1NOH A;  2IPP A;  2KXP B;  2QJP B;  3M9Q A;  3CCL P;  5CBO A;  1KOR A;  3PJS K;  1BCC D;  1VF5 B;  1SVF A;  2FYU E;  1P84 I;  3H1I D;  1Q90 D;  4RO0 A;  3CME P;  1CW5 A;  1HVV A;  2P2U A;  1RE4 C;  2KYV A;  1NTZ G;  1QVG O;  2W6J H;  1L4A C;  3E1I A;  2FBW C;  2AEM A;  2QJY B;  2K9J A;  2HOD B;  1FJK A;  3WUU A;  2YKO A;  4JYC A;  3H1J D;  2XKM A;  1FOS E;  4GOD A;  2FFD C;  2P58 A;  4PJ0 E;  1BDC A;  3RK3 C;  2IBZ G;  1ZR2 A;  1GU4 A;  2N9B A;  3N7N A;  2R32 A;  2E74 B;  1LTG C;  5H2F E;  1JY2 N;  4DT0 A;  1SFC B;  5APY A;  2BEQ D;  1M56 D;  4IOI H;  3L71 E;  2JWA A;  1JMB A;  1USD A;  4QMA A;  3T97 A;  5KAF H;  2CPB A;  3KZI H;  3CI9 A;  1Y8A A;  1RF1 A;  2YIU C;  1BCC E;  1RY3 A;  3CCM P;  1L4A D;  2FY8 A;  1GW3 A;  4I6M C;  1FZF A;  4JF7 A;  2KK7 A;  1SQQ J;  1VDF A;  5AW7 B;  1LGH B;  2W27 A;  3M06 A;  3MHV A;  3AEG C;  1CI6 A;  3II6 A;  3RK3 D;  2M0B A;  4ZKP A;  2JKV A;  1SQB D;  4RKU J;  1U7M A;  3PHL A;  4WBA A;  1PZQ A;  2WTY A;  1BE3 J;  3WUV A;  1DX7 A;  3EFG A;  1VQ8 P;  3GHG B;  1RE3 C;  1NU1 J;  2WZ7 A;  4PV1 C;  2P67 A;  3AE5 C;  1HTL C;  1M1K Q;  3L73 J;  3Q5R A;  4MN4 C;  1JNM A;  2M8R A;  5BU5 A;  1WMK A;  1GU5 A;  1KIL C;  1SQP K;  1SQX D;  2W8Z A;  4TLF A;  2V7Q J;  2WPV B;  3G71 P;  1KB9 I;  2JDI H;  5AW0 B;  1EXJ A;  2ZT9 B;  4UB6 H;  2YXR B;  2WSF J;  1HGV A;  4L75 A;  1LWU C;  3CC4 P;  2ZVO B;  3RK3 E;  3CCE P;  1SQB E;  2A45 G;  3NTN A;  3CCQ P;  2O01 N;  4LC1 A;  4PV1 D;  1T3U A;  1SS1 A;  1KFM A;  2YNY A;  3RGU A;  4OVN F;  1ZLL A;  3USS A;  3FWL A;  3KHU A;  2V7Q H;  1EDL A;  2NPS A;  1NTZ D;  1KIL D;  1OIP A;  3I56 P;  3IFM A;  1USE A;  3H1K E;  2MKV A;  1RHZ B;  2H89 C;  1PPJ G;  2OTK E;  1Q7Y Q;  2IBZ D;  4NPF X;  5CJ4 A;  1FZE A;  1SQX E;  1M1J B;  3V2P A;  1IK9 A;  3GMA A;  1JUN A;  3M9H A;  4C46 A;  4IL6 E;  2OYI C;  2XV5 A;  4WWI A;  3MUD C;  1VQN P;  1KYO H;  3MZW B;  1SQV J;  1SQQ K;  2P7J A;  4U3F G;  1FAV A;  1S5L E;  3F5H A;  1FZC B;  1J1D C;  1GL2 B;  3MIW A;  1FBM A;  4GOE A;  2HOD A;  3SSU A;  2CK3 H;  3G9R A;  2FYN B;  2WIT A;  5TIS H;  2KSE A;  4YXW H;  3D6Z A;  4GKG A;  2JJL A;  3OA7 A;  5KLV J;  3V4Q A;  1QL1 A;  1NO4 A;  3JCU E;  2BAS A;  5CCG A;  1W2E A;  1KIL E;  1SFC A;  2E76 C;  3KYQ A;  3CWB J;  1L4A B;  1K9M Q;  1U57 A;  4GDO A;  5TJH A;  5KLI C;  2YO3 A;  1HUC A;  2IBZ E;  2WWW A;  1S9K E;  3GG2 A;  5AW6 B;  1OX3 A;  3RK3 B;  1MKM A;  1G2C A;  3KXD A;  3BRT B;  3EFF K;  4PD4 H;  2C9N Y;  3WU2 H;  5K5G B;  2SPZ A;  2M3B A;  2GUV A;  1L0L K;  3L75 J;  2E75 C;  1FZB A;  1KV4 A;  1HH0 A;  1NJI Q;  2HG5 D;  2M3E A;  2XND H;  1W2B O;  4O9B A;  2KS1 B;  4XE5 B;  1Y47 A;  2R5D A;  1Y9B A;  3N4X A;  3CX5 D;  1VQ7 P;  2WT7 B;  1KN7 A;  1QLE D;  1K05 A;  1AQT A;  1NH4 A;  2YIU B;  3TGU J;  3GHG A;  2E76 D;  4C7N B;  3ZDM A;  2KSJ A;  3M0D C;  4EI2 A;  1M90 Q;  3H25 A;  4OGQ C;  2ZJS E;  2JR8 A;  2AXT E;  1L0N D;  3BCC J;  1P84 H;  2RMZ A;  2GM4 A;  2K9Y A;  3L4F A;  2JO1 A;  1KQL A;  1NTK J;  1Q2N A;  3HE4 B;  4D6T J;  2OTJ P;  3SWF A;  3AE4 C;  3U1A A;  1LJ2 A;  1ZME C;  5AW5 B;  1IJD B;  1AVO A;  5APU A;  3B5N B;  2E75 D;  1NYH A;  1JM0 A;  1LT9 C;  3NXS A;  3VOP A;  1SQP G;  4GOF A;  3AE3 C;  3A0H E;  2FYU J;  1S4X A;  2KNC B;  1SQV K;  1H0T B;  1FZG A;  2LXB A;  3BAS A;  2OYH C;  4H13 C;  2J58 A;  3IF4 A;  3V6I A;  3BAT A;  1X22 A;  1PPJ D;  1YTZ I;  5E79 E;  2Q3I A;  2QG4 A;  1KZU B;  5DJT B;  1YIT P;  3CXH I;  3GF7 A;  1MFT A;  2L91 A;  3C9I A;  1GW4 A;  4OGQ D;  1X79 B;  3SFE C;  2D2C C;  2O1K A;  3AE8 C;  3EWK A;  2FYZ A;  1OFC X;  1MFZ A;  1LTI C;  1NWQ A;  5B5E H;  1L0N E;  2YKP A;  1U7J A;  3HE5 B;  3SFD C;  1Z56 A;  1JTH A;  5AVQ B;  1LWU B;  1N73 C;  1HWT C;  1HJ0 A;  3L71 J;  1J2J B;  3L70 G;  3S9O A;  1N7S C;  1S3J A;  1EZV E;  4KJM A;  5GTH E;  3RBZ A;  4H13 D;  1BCC J;  5CHX A;  4UB8 H;  1NAY A;  4EIJ A;  1KTM A;  1X9V A;  1GDT A;  3E7K A;  1FZC A;  1GL2 A;  1BSH A;  2PFX A;  5H2F H;  1AV1 A;  4WY4 B;  2ZYA A;  5KJ7 C;  2D2C D;  1NKN A;  4K3A A;  3Q3D A;  1SQQ G;  3VP8 A;  2BCC E;  2FXP A;  3V2N A;  3PH0 A;  1IFN A;  2W6B A;  1NTM E;  3AEF C;  1FDM A;  2WMM A;  2FKW B;  2OYI B;  3CPW O;  2PRR A;  3W68 A;  3G3Z A;  1RE4 A;  1L4A A;  1KB9 H;  3TK1 A;  3L74 E;  2H7H A;  1N7S D;  1MV8 A;  1NTK K;  1IO4 A;  2K37 A;  1IFD A;  1VL2 A;  2UWJ E;  3O6Q B;  4Y99 C;  1FZA A;  1JY2 P;  1EZV I;  2WQY C;  2QM7 A;  1ZRT E;  3AEC C;  2WSC H;  1GTW A;  4JPZ B;  1NVO A;  3H1L D;  1IFJ A;  1JMM A;  1ZR4 A;  2H43 A;  3CC2 P;  4HB1 A;  3HD7 B;  5KJ7 D;  2FYU K;  3MD0 A;  2PAJ A;  3AE1 C;  3PP5 A;  5GTI H;  3V5B A;  4IFD K;  3HRN A;  2KS1 A;  3PRJ A;  2L5G B;  2RH0 A;  3JC2 2;  1ZP0 C;  1WT6 A;  1L0L G;  3W67 A;  3C1L A;  2WT7 A;  5BU8 B;  1OW8 A;  1GK4 A;  4Y28 J;  1SQB J;  4EDF A;  4K35 A;  2WPS A;  4C7N A;  5APT A;  1SQP D;  3G4S P;  3HUS B;  2KOG A;  2QSI A;  4I2L C;  2WSS H;  2HFE D;  5AVY B;  5APX A;  4N78 D;  2E75 B;  1YTZ T;  4OH8 B;  3H1I E;  3TF5 A;  1YQ4 C;  3K5B A;  3H1K J;  1A02 F;  1KFN A;  1BDD A;  1G1J A;  2B9B A;  1JEK A;  3B5N A;  4KT0 J;  3CCU P;  3H1L E;  1SQX J;  4L74 A;  3H1H G;  5AW9 B;  5CMZ A;  2KNC A;  1LTS C;  4OGQ B;  1H0T A;  3H1J E;  2IYP A;  4YTP C;  3VTP C;  1FC2 C;  4XFJ A;  1RF1 C;  1QEX A;  4IFF A;  3LID A;  2Y0D A;  2N1T C;  1DEB A;  2W90 A;  4B86 A;  1VQ9 P;  1CZQ A;  1SQV G;  3L70 D;  4I7Z C;  3HTK A;  1YIJ P;  1LTA C;  3A3Y B;  5CBN A;  3AE7 C;  1OXZ A;  3U59 A;  1KQG B;  3M0A A;  1SQP E;  1W5C E;  4TT3 H;  3NMD A;  4YPC A;  4BXL A;  1HJB A;  1IZN B;  3HE5 A;  4N78 E;  1LP1 B;  1H89 A;  2Z5H A;  1LWU A;  1PIX A;  1SQQ D;  1ZOY C;  5AW8 B;  1AJY A;  3L36 A;  1PFI A;  2E42 A;  2W83 C;  1YBK A;  3CWB G;  4H0L C;  2I8D A;  2D2C B;  4EYY Q;  1HGZ A;  1VQL P;  5CCH A;  5KAF E;  1N86 A;  2LKM A;  2N1T D;  1HBW A;  1T3J A;  3Q2Y A;  1ZW0 A;  2IDB A;  2H88 C;  3H32 B;  3JCU H;  4WY4 A;  2KI7 B;  3L35 A;  3I55 P;  2YMY A;  3L70 E;  1KQS O;  2K3R A;  5KKZ B;  1J1E C;  4N6J A;  1SQB K;  2WSF H;  3RK2 C;  1MZ9 A;  3TNU B;  3FX0 A;  3VMX A;  1SLQ A;  1N7S B;  2RKL A;  3GW6 A;  1ZV8 A;  2OYI A;  1M8O B;  3MUD A;  1URQ C;  4JBZ A;  3BRV B;  2HYN A;  2KZI A;  2QEX P;  4U7J A;  4BRY B;  2PGD A;  2JP3 A;  1JY3 P;  1OWA A;  2MJZ A;  1L0L D;  4H0L D;  4NPE A;  1OMI A;  3O6Q A;  1OVR A;  2NPS C;  2ZAE B;  3E1R A;  3BCC G;  1RQU A;  3QH9 A;  1NTK G;  5BVZ A;  4Z1M H;  5AW4 B;  1NAF A;  3CXH H;  1SQX K;  3HD7 A;  2QJP C;  4HH2 A;  1JB0 J;  1VF5 C;  4UB6 E;  1KYO D;  2FXM A;  2M5A B;  1D7M A;  3RK2 D;  1YHQ P;  5M1B A;  5B66 H;  1NU1 K;  2FYU G;  2ZVN B;  1HF9 A;  1GD2 E;  1NTZ E;  4Y99 B;  1URQ D;  3CMA P;  1FS0 E;  3HUS A;  3H1H D;  3V2Q A;  1NHL A;  3VN0 A;  3L72 G;  2YO2 A;  2XDJ A;  2QJY C;  3H6P A;  1KQF B;  4ASW A;  2KB7 P;  2ZFC A;  1LTJ C;  2NPS D;  2WSE J;  2FFD B;  2OAR A;  3A0H H;  1L0N J;  2W6A A;  1LTT C;  1SQV D;  1L0L E;  2E74 C;  5CCG C;  2IFM A;  5E79 H;  1SFC C;  3P8C D;  5APW A;  2C0W A;  1IK7 A;  1LTB C;  1VF5 D;  1BGY G;  4ZMD A;  1RF0 A;  3LW5 J;  3AEE C;  4PD4 D;  3CCJ P;  3S4R A;  1PP9 J;  2H8P D;  1YJN P;  1TU3 F;  1OVU A;  1KYO E;  1CSB A;  5KTB A;  1IFP A;  1ZXG A;  3CWB D;  2ZYG A;  2Q5U A;  4C7R A;  2R3C A;  2BCC J;  3AEB C;  1WRG A;  3VYI A;  3H1H E;  2BEZ F;  1NTM J;  3IN6 A;  4I1L A;  2IBZ I;  2IFN A;  2E74 D;  2OQQ A;  1YJW P;  1XTC C;  3BVH A;  2ZXX A;  1LP1 A;  2J5U A;  5CCG D;  1RF1 B;  3GHG C;  1SFC D;  2N1T B;  1P84 D;  3L74 J;  3GLM A;  4PV1 B;  2WPQ A;  3MGN A;  1K8A Q;  4I7Z B;  1M57 D;  2IYO A;  1IC2 A;  3VMA A;  2GA1 A;  2E43 A;  1DH3 A;  3V2R A;  1S72 P;  3KPE A;  1KIL B;  3CLQ A;  5AVR B;  3CX5 E;  3JSV C;  3U1C A;  3H32 A;  3D6Y A;  5KLV K;  3R4Y A;  1OVV A;  3BCC D;  1AQ5 A;  4EOT A;  2P10 A;  4U3F D;  3TNU A;  1NTK D;  5APQ A;  1L2P A;  2KIK A;  2B89 A;  3IAO A;  2G3A A;  1NKZ B;  1R5L A;  2Y9Y A;  1R5S A;  1FDO A;  3MTU E;  4HYT B;  1SQB G;  1H8A A;  4BRY A;  1M1J A;  2P1J A;  3WUT A;  5KJ7 A;  1L0N K;  4PJ0 H;  3A0B E;  3KDP B;  3H1I J;  1PGO A;  1J1E B;  3AED C;  3L72 D;  3P32 A;  5AW2 B;  3RK2 B;  2IZ1 A;  1EXI A;  1PPJ E;  2G8Y A;  3H1K G;  1BSN A;  3CD6 P;  3G6E P;  3H1L J;  4GT1 A;  1M7L A;  1DIP A;  1URQ B;  2I1K A;  2KP8 A;  2XU6 A;  2M5A A;  3H1J J;  1YJ9 P;  1SQX G;  1VQ6 P;  3CCS P;  2Y0C A;  3CL3 D;  4BWN A;  2PP6 A;  4L73 A;  4OWF A;  3A2A A;  4U3F E;  2NPS B;  1BE3 G;  1EDK A;  1BGY D;  2C9L Y;  2A45 I;  1FZC C;  1GL2 C;  3PLN A;  1NU1 G;  4AUW A;  1J1D B;  1NTM K;  1T8Z A;  2R5B A;  1MUU A;  2FYN C;  1E5W A;  1SQP J;  4A7P A;  3L73 G;  1A02 J;  2FFD A;  5KAI E;  3CC7 P;  2XZR A;  5B5E E;  1PV3 A;  1AA0 A;  1KB9 D;  2QIW A;  1OZH A;  1YQ3 C;  1LT1 A;  3CCR P;  2E76 B;  3L72 E;  4HJG H;  1IFM A;  2R3S A;  2HPC B;  2LXC B;  3OAK A;  5KLI B;  2KLU A;  1LTJ B;  4UB8 E;  3RL0 C;  5AW3 B;  3Q5P A;  1GL2 D;  1VQ4 P;  2NZ2 A;  4WB4 A;  3LIE A;  2O1J A;  1ZN5 A;  3L70 J;  4W80 A;  4W7Y A;  1BGY E;  1PGP A;  3HE4 A;  3OW2 O;  1EDJ A;  3B8E B;  3M91 A;  1FDI A;  1KC8 Q;  4H44 C;  5AVS B;  1DD4 A;  3O8Z A;  2N1T A;  1G2C B;  1RE3 A;  2O3J A;  2B88 A;  1T6A A;  2RN0 A;  1QVF O;  1QL2 A;  1KB9 E;  2O01 J;  3NFQ A;  3C8V A;  1KIL A;  1DD3 A;  2A06 G;  3RL0 D;  3KQG A;  4DCK A; 
#chains in the Genus database with same CATH homology
 5GTI H;  3A0H H;  4UB6 H;  5H2F H;  5TIS H;  3A0B H;  3WU2 H;  1S5L H;  5B5E H;  5KAF H;  3JCU H;  3KZI H;  4PJ0 H;  4UB8 H;  5E79 H;  5B66 H;  2AXT H;  4IL6 H;  5GTH H;  5KAI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...