3MTUE

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
67
Chain Sequence
PEEHEDILNKLLDPQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords Tropomyosin alpha-1 chain,Microtubule-associated protein RP/
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Gallus gallus
total genus 23
structure length 67
sequence length 70
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mtuE00
3OA7A 3MTUE 1NO4A 1NOHA 4IFFA
chains in the Genus database with same CATH superfamily
3S1KA 3CMAP 2R44A 4N3YB 1ZMEC 3AE5C 1HBWA 3BATA 2QJKC 2OYOA 3CXHH 1FS0E 4HKZH 1BCCJ 2E76D 2OYHA 1MFZA 1LT9C 3M0DC 3TGUG 5APXA 3FWNA 5CCGC 2FYUD 4MN4C 1L2PA 3L74D 1PP9J 1SQVG 5BU8B 2CPSA 2WT7B 1JEKA 2Q3IA 2KLUA 1EDKA 1N73A 3EFFK 3GG2A 1GL2B 1MUUA 4ZNCA 1K04A 3RK3C 5AVZB 1KN7A 1NU1K 1EDLA 3H1LE 1SQXD 4L75A 1JTHA 3H1HE 3RBXA 2KNCA 2Z5IA 2POHA 2QJYC 1LTJB 2OTLP 2OYIB 5CCHC 2YXQB 2JO1A 1J1EC 1OZHA 3HTKB 3L71D 1DX7A 1S1CX 3GF7A 1NWQA 2FXPA 3GHGC 1IO4A 3L70J 4OGQD 3D70A 1YJ9P 1LTBC 3LIEA 3W67A 3RK2D 4H13B 2LKMA 3T97B 1HVVA 1NU1E 2QM8A 3CLQA 2FFDA 1Z56A 1SFCD 2XNXA 3GW6A 5BU5A 2FXOA 2XDJA 2SPZA 2AEMA 1NAFA 1KQGB 3M9QA 1SQBG 2KIKA 2N9BA 1S72P 4WY4B 1RE4A 3B5NC 3CCMP 1NKNA 1JB0J 1VQ9P 2ZYGA 1A02J 4D6TG 1H8AA 5AVSB 3V2NA 1YBKA 2PFXA 2K37A 1XTCC 1NAYA 5AW1B 4PD4D 2IZ1A 3V2PA 3FXEA 2N1TC 4HJGH 1YTZT 1VF5D 1FAVA 1S5LH 2BEQD 4U3FE 2V4HA 3H1LJ 1NTKD 3HD7B 3H1HJ 3MZWB 1A02F 2FKWB 2YKOA 1ZRTD 3USSA 5GTHH 1JCCA 2IFMA 3KDPB 2E75D 1E5WA 2WSEH 3CCRP 1IFMA 3L72J 1KILB 1QL2A 3HUSC 3JCUE 1W2EA 2E43A 5KAIH 2MKVA 3H32B 1R8EA 1JO5A 1NU1J 1FJKA 1X0TA 4WVZA 4BRYA 3MD0A 5KKZC 3VYIA 2HODA 4GKGA 1L0LK 2P58A 1KFNA 1KQSO 1JY2O 5KAFE 3G4SP 2OYHB 1SQQD 5B66H 3MGNA 4HYTB 1PIXA 3RK3E 1LTIC 5L8RJ 5CCHD 3CXHD 1SQPD 5KJ7C 2NPSA 1JMBA 5AVWB 1GZLA 1OVRA 3RL0g 3SWYA 1L0LE 3GLMA 1NTMD 1N7SA 1NTZK 1Q90D 1W5CE 3IFMA 3H25A 1LWUA 3NMDA 3U1AA 4U3FJ 1KB9H 4ASVA 2KNCB 2RMZA 3Q5PA 2R5BA 1VDFA 1MV8A 3M91A 2AEFA 2M5AB 2IBZE 2PRRA 3WU2H 3O6QB 3Q2YA 2E74C 2KK7A 1PGPA 1SFCB 2IFNA 2LR2A 2B87A 2P7JA 2QM7A 2M3BA 1VQOP 3LIDA 1YJNP 4DOJA 2KSJA 1BE3G 1M1KQ 3G71P 3A0HH 1AFOA 4Z1MH 3CCSP 3H1IE 4H0LB 3IAOA 2QIWA 3CWBE 2N1TD 4RJTA 2E5TA 2BCCD 1DD3A 2ZXXA 2OYIC 3I56P 1QGKB 1T6AA 3IR9A 2P10A 3WUTA 3CX5D 1VF5B 3QH9A 4U7JA 3U1CA 2FYUG 1K9MQ 3L74G 1L4AC 1Y47A 3H1HG 1L0LJ 4YPCA 2YIUB 3L75E 2H88C 2O1JA 2WZ7A 2E75B 4LC1A 1AQ5A 1FDMA 1SQXG 1PPJE 1DEBA 1HWTC 1Q7YQ 3MP7B 1SVFA 1JY2P 3H6PA 3R4YA 1HH0A 3CC4P 1QLED 2GUSA 1FC2C 4ZKUA 2FYNC 1L0NK 1FZEA 1NTZJ 2ZJSE 2A06D 1G2CB 1Q82Q 4OH8B 4BRYB 5KLVE 2CK3H 3F5HA 3H1IJ 1OXZA 4JYCA 2HODB 3CWBJ 5GTHE 1AVYA 4M3LA 2IZ0A 2QJPB 1ZR2A 2WPSA 1QVFO 1HGVA 2JP3A 2YO2A 2QEXP 2Q9IA 3CPWO 1P84E 5CMZA 2NPSB 2E74D 1LTJA 3AEBC 2M8RA 4PV1D 2A45G 3CC2P 3L73D 5AVVB 3HTKA 1LWUB 3L75J 4PD4I 1RE3A 2OGUA 4NPEA 1M7LA 2A45I 2K88A 2K3RA 1URQA 1QVGO 3H1JE 5AVXB 2IYPA 2R32A 1BCCD 1HTLC 1TU3F 1KYOD 1KC8Q 2GA1A 1Q2NA 2B87B 5AW5B 3AE8C 3HE5B 2OQQA 1KB9D 1PV3A 1FZGA 4WB4A 2B9BA 4I2LC 4NPFX 1FZCA 1NYHA 1N73C 3MHVA 1PP9D 2Y0EA 5KLVJ 1LGHB 3RL0B 3V2RA 1DIPA 2H8PD 1L4AD 1W2BO 1PP9E 3JCUH 3G9RA 1FE6A 5APQA 2WSEJ 2I1JA 4BWNA 1JMMA 1AA0A 4IFFA 1LNQA 3E1IA 1GK4A 2L91A 1OMIA 3KHUA 4JYBA 3AE9C 5DJUB 2QSIA 1USEA 3HD7A 3IF4A 1IK7A 2W6AA 3L70D 3A0HE 4GIFA 2FFDC 1SQPG 1R5LA 2ZT9C 1T2KC 5KAFH 3VMAA 1FZFA 2O3JA 1KILA 5GTIH 1NTMG 1EDIA 3CXHI 1RE4C 2AXCA 1E79H 3H1JJ 3H32A 5AVQB 2BEZF 3M06A 1T3UA 2WSCJ 1ZXGA 5AW8B 5TJHA 2V7QJ 5AVTB 2YXRB 2Z5HA 3HE4A 2WITA 3PP5A 4RESB 3H1IG 3C1LA 3EQ2A 1NOHA 1H88A 5KTBA 3VMXA 1YIJP 2XZRA 1AVOA 2NZ2A 2C9NY 2K1AA 3II6A 3AEAC 2AEJA 4NPDA 5APTA 2ZYDA 3H1LD 3QWOC 1D7MA 3H1HD 2MJZA 1KQLA 2BCCG 3TDKA 3KXDA 2AXTE 4XFJA 1EDJA 1Y9BA 4PV1B 1JCDA 3W68A 4K3AA 3H1KJ 4H44B 4DJGA 2OTJP 3B4SA 2KOGA 2M0BA 3FGAD 2M5AA 3WUVA 3CX5I 1NO4A 1K73Q 3L72E 1NU1D 3O6QA 1S4XA 4KJMA 3A0BE 1SFCA 3NFQA 2C0WA 2HLOA 3ZDMA 1URQB 2PGDA 2K9JB 4WWIA 3ABVC 5AVYB 1OW6A 2RH0A 3AECC 4UB6E 3OA7A 1GU5A 3G3ZA 4IFDK 3KQGA 1IZNB 2Q5UA 3AE1C 4I7ZB 3SSUA 5KLVG 1FZCB 1M1JA 2W27A 1N7LA 4YTPC 3BCCE 2A06G 3D71A 1N7SC 1J1DC 3BRTB 2Y0DA 1FOSE 2FY8A 1EZVE 2HR3A 5E79E 1VQNP 2ZT9D 1T2KD 1NJIQ 4U3FD 5KLIB 2HPCA 5TISE 3TK1A 1VQKP 3VMZA 1BGYE 2D2CB 3K5BA 2JKVA 1NTKK 5CJ4A 3FXDA 3AE6C 3TYYA 2H89C 3I55P 3L36A 3RL0C 4HB1A 1R5SA 2XV5A 3L73G 3AEDC 2W8ZA 1RF0A 1LP1A 2ZVNB 1P84H 1G2CA 5CCGD 1BCCG 2E76B 3HE4B 5H2FE 2XU6A 3L71J 1RF1A 4L76A 1RHZB 3AEFC 5AW4B 3L35A 3RK3D 1KYOI 1NH4A 3BCCJ 5CCHA 1SQQK 5GTIE 2P67A 1PP9G 1KB9I 2WSCH 3P7KA 1H0TA 4WBAA 2LXBA 1NKZB 3U59A 2V7QH 1L0LD 2W6JH 2ZAEB 4Y99C 4IL6E 1GTWA 2ZYAA 4XE5B 1BGYJ 2IBZD 3P8MC 1IFIA 2UWJE 3N4XA 2RKLA 1IK9A 3F89A 1YITP 4OGQB 3L70G 3RK2B 3P8CE 3OAKA 1FOSF 4C7NB 3B5ND 1BSNA 4N78E 1HJBA 1X79B 2QRXA 3HE5A 3H1ID 1S2EA 2LXCB 1NTZE 4DCKA 3S4RA 1LJ2A 3A3YB 3CWBD 1JY3O 2N1TA 3D6YA 1GL2C 3MUDA 3KZIE 3AE3C 5DJTB 2KLVA 1SQVK 5AW9B 4H44C 1VPCA 3L37A 1M1JB 2WQYC 1LTJC 2NRGA 1H89A 3V5BA 3RGUA 3WMM0 1RE3C 3M9HA 3TGUE 3L75D 4RO0A 4H13C 1KFMA 3AE4C 1YJWP 2HPCB 1SQVE 3H1LG 1PPJD 5AVRB 2QJKB 4YXDC 3HRNA 4WY4C 1SQQJ 3RBZA 3L72G 4ZKPA 1NGMB 1SS1A 4EDFA 1LT9B 2AXTH 1SQBK 3CCVP 1KTMA 1NU1G 5KLVD 1IC2A 4JPZB 1LP1B 3V4QA 2WPRA 4JQ0D 2E5YA 2JEEA 3RK3B 4JF7A 5CBNA 3GF3A 1U7MA 5KJ7D 3M0AA 2D2CC 4AYCA 3HD7C 3BCCG 2L5GB 3A0BH 4DT0A 1RF1B 2QJYB 1SQBE 3CCUP 1XTGB 4PJ0H 1P84D 2YO3A 1IFDA 2IPPA 4R4LA 1JUNA 1L0NE 1J1EB 1KILC 3D6ZA 4D6TE 2C9LY 3C8VA 1H0TB 3GHGB 1PZQA 4UB6H 2WWWA 4B86A 1EC5A 2O01J 4Y28J 3TGUJ 5APUA 3EWKA 2JDIH 1SQVJ 4U3FG 2Y0CA 1QL1A 3H1JD 1JY2N 1G1JA 1JY3P 5AW2B 5APWA 3B5NB 5EFWB 1GL2D 2K9JA 2QVAA 3KPEA 2GM4A 5E79H 2OYHC 1Q81Q 2WPQA 1IJDB 2HFED 1X8YA 5AVUB 5TISH 1UIIA 3BRVB 3N7NA 3VP8A 1UIXA 1LTTC 1FBMA 1OVVA 2N1TB 1DD4A 3Q5RA 2YMYA 3PRJA 1RY3A 1OVUA 4H13D 4OVNF 3NXSA 4LGDE 3TF5A 1HF9A 1KMIZ 1BDDA 1SQBJ 1EXIA 1K8AQ 3H1KD 3RK2C 1L0NJ 4WY4D 4D6TJ 2KI7B 3HUSB 1SFCC 1ZOYC 4I6MC 3CL3D 1AQTA 1IFNA 3H1KE 1RH5B 1L0LG 5C39A 2B88A 2ZXEB 2C0XA 5H2FH 4GOEA 2YKQA 4CPGA 4HH2A 5KKZB 4H0LC 1X9VA 3JSVC 1SP4A 4UB8E 2IBZG 2XNDH 1M1JC 3Q1MA 4RKUJ 1OW8A 4EOTA 3A7OA 1M8OB 2JJLA 2IBZI 2WSFJ 4IL6H 3SWFA 1OFCX 1NTZG 1T3JA 1VF5C 1FJPA 4OWFA 2E42A 1T8ZA 1GMJA 2GUVA 3A5TA 4YXWH 3CWBG 3R2PA 5AW0B 2YIUC 4GT1A 1BE3E 2E75C 2W90A 1KILE 2WVRA 4R4MA 2FYUK 3JC22 1ZP0C 1FU1A 1VQMP 3V4WA 1NHLA 1HJ0A 5APVA 2E74B 3KZIH 1RF0C 2RN0A 1NVOA 2HYNA 1YYCA 3L72D 1SQXK 2KYVA 2WPVB 3MTUE 5BVZA 1CW5A 3L75G 4IOIH 2FYUE 1FDIA 4O9BA 3L74E 4C7NA 2K9YA 5APSA 1PPJG 3FX0A 1HGZA 1DH3A 4PJ0E 1RF1C 2O01H 3AE7C 3SFEC 3M9BA 1FZAA 2QJPC 4ASWA 1SQXE 3VOPA 1GD2E 2Z4EA 1JM0A 3BCCD 4TT3H 4W7YA 3S9OA 4GDOA 1YHQP 1VQ6P 2NPSC 3L71E 1EZVD 5APYA 1L4AB 1U7JA 4W7ZA 2VRSA 2G3AA 3CX5H 4N6JA 3CI9A 1LWUC 3CCEP 1BE3J 1RQUA 4EYYQ 1L0NG 1BGYD 1FZBA 1QX8A 4H0LD 2R5DA 1YQ3C 1WMKA 3LW5J 1VQ8P 2Q3EA 2HG5D 5B5EE 1ZV8A 4QMAA 1OIPA 2FYNB 5CBOA 3KYQA 3E7KA 1P84I 2ZVOB 1PL5A 4XA4A 2H7HA 3MUDC 2FYUJ 1VQ5P 2I1KA 3L74J 4PD4E 1EXJA 2KSEA 1LT9A 3M0DA 3H1JG 1S9KD 1ZLLA 4DZOA 5CCGA 2KP8A 3VTPC 3WUUA 1IFPA 1LTSC 1M57D 3PH0A 1GW4A 2W6BA 1NTKE 1SQXJ 1S9KE 1VQPP 1SLQA 2KZIA 3A2AA 1ZRTE 3TNUA 4C7RA 2KXPB 2I8DA 2PAJA 3Q3DA 2YMKA 1HUCA 3P32A 3CCLP 2WSSH 1YI2P 2ITAA 2W83C 2IYOA 2WSFH 3SWKA 3GHGA 1U57A 1VL2A 1SQPK 2WTYA 1Q86Q 4AUWA 1BDCA 3H1KG 1BSHA 1NTMK 2Y9ZA 1KV4A 3G6EP 1GK6A 3P8CD 1SQQE 2J59M 2Q6QA 3SFDC 3BVHA 3B5NA 4N78D 2KS1A 1N73B 1GU4A 3FWLA 2Q7CA 3PLNA 1YTZI 1KYOH 1IFJA 4IFMA 1NTZD 3IN6A 2JWDA 4KT0J 1EQ7A 3CXHE 1SQPE 2QG4A 4JBZA 2NPSD 1JTHB 2QE7H 2FBWC 3B71A 2BASA 2QA4P 4C46A 1N7SD 1NTME 1X22A 1OX3A 1N2DC 2H43A 1FDOA 1NTKJ 1M90Q 3MIWA 3GMAA 2FXMA 4PV1C 1J2JB 2JWAA 1CI6A 1S3JA 4IL6X 4UB8H 1PGOA 1LT1A 2FFDB 1MZ9A 5AW7B 3TGUD 2ZT9B 2IDBA 5CHXA 1SQVD 3HUSA 1N8RQ 2P1JA 5K5GB 3AEGC 2KUBA 1URQC 3AE2C 1KZUB 3RL0D 2J5UA 3C9IA 4GODA 1GDTA 2P2UA 2YNYA 2KZJA 5AW6B 2BCCE 2PP6A 4I7ZC 1LTAC 1FZCC 1KORA 3CC7P 3O8ZA 3CX5E 1YQ4C 1AV1A 1M56D 1VQLP 1Y8AA 1SQPJ 3LW5H 4AQRD 3CCJP 4LLHA 5KLVK 2J58A 1N86A 2FYZA 1NTMJ 5KJ7A 3VP9A 5KLIC 2XKMA 2ZFCA 1SQBD 3BASA 3L71G 3TNUB 2CPBA 1OW7A 1WT6A 1L0ND 4GOFA 4D6TD 5M1BA 2O1KA 4A7PA 1S5LE 3TSIA 5AW3B 1KQFB 1EZVG 4ZMDA 1DEEG 2N9YB 4L74A 2A06E 3B8EB 1JOCA 1EZVI 2M3EA 4BXLA 2WT7A 3ITKA 3PHLA 1BGYG 3CMEP 1WRGA 1GL2A 2E76C 2BCCJ 3CCQP 1CZQA 1CSBA 5KAIE 2KS1B 3V2QA 3AEEC 2YKPA 4EI2A 2OYIA 5CJ0A 1PGQA 1N7SB 1J1DB 3I5CA 3L4FA 4H44D 3EFGA 2R3CA 1S5LX 3CD6P 4K35A 3OW2O 1NTKG 3UIAA 3L73E 5B5EH 4KHXA 5B66E 3T97A 1JNMA 1L4AA 2JR8A 1GW3A 2Y9YA 3OJAB 1URQD 3E1RA 4PD4H 4EIJA 1CI6B 3PJSK 4WY4A 2A45H 1K05A 1BCCE 1LTGC 1KYOE 3PTZA 4OGQC 2IX7C 4L73A 1KB9E 3NTNA 1JY3N 3VN0A 1ZR4A 2R3SA 3VMYA 1MFTA 1PGJA 2KB7P 3WU2E 3V6IA 1ZN5A 1RQVA 4W80A 1VQ4P 1AJYA 2G8YA 1MKMA 1SQQG 3Q5SA 1G1IA 2OTKE 1VQ7P 2O01N 2D2CD 3HD7D 2DW3A 2Q1KA 3L70E 1KD1Q 2B89A 2OARA 1ZW0A 1OWAA 4TLFA 1PFIA 1BE3D 2WMMA 3L73J 4Y99B 1USDA 1QEXA 1KILD 4I1LA
chains in the Genus database with same CATH topology
2Q9IA 1GL2C 4N3YB 5CMZA 3MUDA 3KYQA 1HBWA 2NPSB 3BATA 4XA4A 1LTJA 2H7HA 2M8RA 2A45G 2KLVA 1SQVK 5AW9B 5AVVB 1VPCA 3L37A 2I1KA 1M1JB 3HTKA 1LWUB 1LT9A 1LTJC 3M0DA 1H89A 1RE3A 1S9KD 1ZLLA 3V5BA 4DZOA 1M7LA 2A45I 2KP8A 3VTPC 5CCGA 2OYHA 1MFZA 3WMM0 1LT9C 1URQA 3M0DC 5APXA 1LTSC 1RE3C 5AVXB 2R32A 1GW4A 5CCGC 2W6BA 1S9KE 3M9HA 5BU8B 1HTLC 2CPSA 2WT7B 1KFMA 1SLQA 2Q3IA 3A2AA 5AW5B 1N73A 3TNUA 4C7RA 3HE5B 2HPCB 1GL2B 2PAJA 1FZGA 4WB4A 1MUUA 4I2LC 3RK3C 5AVZB 1FZCA 5AVRB 1N73C 1NU1K 3HRNA 1HUCA 1JTHA 3P32A 4WY4C 2Z5IA 1LGHB 2POHA 3RL0B 3V2RA 1LTJB 2WSFH 3GHGA 4ZKPA 2OYIB 5CCHC 2H8PD 1L4AD 1J1EC 3HTKB 1DX7A 1LT9B 1NWQA 5APQA 3GHGC 1IO4A 1SQPK 2WTYA 1SQBK 1IC2A 1LTBC 2I1JA 1JMMA 3V4QA 3LIEA 4IFFA 4AUWA 3RK2D 1ZV8A 2LKMA 3E1IA 1NTMK 2WPRA 1GK4A 1HVVA 2QM8A 3CLQA 4JYBA 2FFDA 1Z56A 1SFCD 2JEEA 1GK6A 3P8CD 2XNXA 2J59M 5BU5A 3HD7A 2XDJA 3BVHA 3RK3B 3B5NA 4JF7A 1NAFA 2W6AA 4N78D 4GIFA 2FFDC 5KJ7D 1N73B 3M9QA 3M0AA 1GU4A 4AYCA 2Q7CA 2N9BA 1YTZI 1IFJA 3HD7C 4IFMA 4WY4B 1T2KC 1RE4A 3B5NC 2L5GB 1NKNA 1FZFA 1RF1B 1EQ7A 1A02J 1KILA 2NPSD 1XTGB 1JTHB 2YO3A 1IFDA 2IPPA 1RE4C 1H8AA 1JUNA 5AVSB 1J1EB 2BASA 1KILC 4C46A 2C9LY 1N7SD 3V2NA 3GHGB 1N2DC 3H32A 2WWWA 5AVQB 4B86A 3M06A 1T3UA 2H43A 1XTCC 5AW1B 3MIWA 5AW8B 5APUA 2FXMA 5AVTB 3V2PA 1J2JB 2N1TC 2Z5HA 1YTZT 3HE4A 1FAVA 1CI6A 2WITA 3PP5A 1QL1A 4RESB 1JY2N 1G1JA 1JY3P 5AW2B 5APWA 3EQ2A 1NOHA 2FFDB 1H88A 5KTBA 1MZ9A 5AW7B 3VMXA 3HD7B 2XZRA 3B5NB 1GL2D 1A02F 2FKWB 2C9NY 2YKOA 3KPEA 5CHXA 2GM4A 3HUSA 3II6A 2OYHC 2P1JA 1JCCA 2IFMA 3KDPB 2WPQA 1E5WA 2WSEH 1IJDB 1IFMA 1URQC 1KILB 2HFED 1QL2A 5APTA 1X8YA 5AVUB 3HUSC 1KZUB 3RL0D 1W2EA 3C9IA 3BRVB 2MJZA 2E43A 1KQLA 1GDTA 2P2UA 2YNYA 3N7NA 3VP8A 1JO5A 3H32B 1LTTC 1FBMA 5AW6B 1FJKA 2N1TB 1JCDA 2PP6A 2YMYA 1RY3A 3MD0A 1LTAC 1FZCC 3O8ZA 2KOGA 3VYIA 3NXSA 4LGDE 2HODA 1NO4A 4GKGA 1L0LK 1KFNA 1JY2O 3LW5H 4AQRD 1SFCA 2OYHB 3NFQA 2C0WA 3RK2C 4LLHA 5KLVK 2HLOA 1URQB 4WY4D 2J58A 1N86A 2FYZA 5KJ7A 3HUSB 5AVYB 3VP9A 1SFCC 3MGNA 4HYTB 4I6MC 1LTIC 3CL3D 2XKMA 3OA7A 5CCHD 1GU5A 1IFNA 3G3ZA 2ZFCA 5KJ7C 4IFDK 3BASA 2NPSA 5AVWB 1GZLA 2ZXEB 3KQGA 3TNUB 2CPBA 2C0XA 1WT6A 3SWYA 2Q5UA 2YKQA 4HH2A 1N7SA 1NTZK 1FZCB 2O1KA 1M1JA 1X9VA 3IFMA 3TSIA 2W27A 1LWUA 3NMDA 3U1AA 1N7LA 1SP4A 5AW3B 1N7SC 1J1DC 3BRTB 1M1JC 1FOSE 2R5BA 1VDFA 1MV8A 3M91A 3B8EB 4EOTA 3A7OA 1JOCA 2JJLA 3SWFA 1T2KD 1T3JA 2WT7A 1SFCB 1FJPA 2IFNA 2E42A 1T8ZA 2P7JA 2QM7A 1WRGA 2HPCA 3TK1A 2M3BA 1GL2A 3VMZA 3LIDA 4DOJA 2GUVA 2KSJA 3A5TA 1CZQA 1CSBA 1NTKK 5CJ4A 1AFOA 3R2PA 5AW0B 3TYYA 3V2QA 4GT1A 2YKPA 2OYIA 2N1TD 5CJ0A 3L36A 1N7SB 2FYUK 1J1DB 3I5CA 3L4FA 3RL0C 2XV5A 3EFGA 1FU1A 2R3CA 2OYIC 3V4WA 1RF0A 1NHLA 3IR9A 3UIAA 5APVA 4KHXA 3T97A 1JNMA 1G2CA 1L4AA 1RF0C 2HYNA 1YYCA 3U1CA 5CCGD 1SQXK 1GW3A 2KYVA 3MTUE 3OJAB 1URQD 5BVZA 1L4AC 1CW5A 3HE4B 4EIJA 1CI6B 4WY4A 2A45H 4O9BA 2XU6A 1LTGC 1RF1A 2O1JA 4C7NA 5APSA 5AW4B 2WZ7A 3L35A 2IX7C 3RK3D 1HGZA 1NH4A 4LC1A 1AQ5A 5CCHA 1DH3A 1SQQK 1FDMA 1RF1C 2P67A 2O01H 3NTNA 1DEBA 2WSCH 3P7KA 1JY3N 1HWTC 3M9BA 1FZAA 4WBAA 3U59A 1NKZB 3VN0A 1ZR4A 3VMYA 3VOPA 1SVFA 1JY2P 3H6PA 1GD2E 2KB7P 1HH0A 2Z4EA 4Y99C 1ZN5A 4W80A 2GUSA 1GTWA 4ZKUA 4W7YA 1L0NK 4XE5B 1FZEA 2NPSC 5APYA 1G2CB 4OH8B 3P8MC 1IFIA 1L4AB 4W7ZA 2VRSA 3N4XA 1IK9A 4N6JA 1OXZA 3CI9A 1LWUC 1G1IA 4JYCA 2HODB 3RK2B 3P8CE 3OAKA 3HD7D 1FOSF 4C7NB 4M3LA 1FZBA 3B5ND 4N78E 1HJBA 2R5DA 1X79B 1ZR2A 2OARA 2WPSA 3HE5A 1OWAA 1HGVA 1PFIA 2YO2A 4Y99B 1KILD 2HG5D 3A3YB 4I1LA 1JY3O 2N1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA7 A;  3MTU E;  1NO4 A;  1NOH A;  4IFF A; 
#chains in the Genus database with same CATH topology
 3S1K A;  3CMA P;  2R44 A;  4N3Y B;  1ZME C;  3AE5 C;  1HBW A;  3BAT A;  2QJK C;  2OYO A;  3CXH H;  1FS0 E;  4HKZ H;  1BCC J;  2E76 D;  2OYH A;  1MFZ A;  1LT9 C;  3M0D C;  3TGU G;  5APX A;  3FWN A;  5CCG C;  2FYU D;  4MN4 C;  1L2P A;  3L74 D;  1PP9 J;  1SQV G;  5BU8 B;  2CPS A;  2WT7 B;  1JEK A;  2Q3I A;  2KLU A;  1EDK A;  1N73 A;  3EFF K;  3GG2 A;  1GL2 B;  1MUU A;  4ZNC A;  1K04 A;  3RK3 C;  5AVZ B;  1KN7 A;  1NU1 K;  1EDL A;  3H1L E;  1SQX D;  4L75 A;  1JTH A;  3H1H E;  3RBX A;  2KNC A;  2Z5I A;  2POH A;  2QJY C;  1LTJ B;  2OTL P;  2OYI B;  5CCH C;  2YXQ B;  2JO1 A;  1J1E C;  1OZH A;  3HTK B;  3L71 D;  1DX7 A;  1S1C X;  3GF7 A;  1NWQ A;  2FXP A;  3GHG C;  1IO4 A;  3L70 J;  4OGQ D;  3D70 A;  1YJ9 P;  1LTB C;  3LIE A;  3W67 A;  3RK2 D;  4H13 B;  2LKM A;  3T97 B;  1HVV A;  1NU1 E;  2QM8 A;  3CLQ A;  2FFD A;  1Z56 A;  1SFC D;  2XNX A;  3GW6 A;  5BU5 A;  2FXO A;  2XDJ A;  2SPZ A;  2AEM A;  1NAF A;  1KQG B;  3M9Q A;  1SQB G;  2KIK A;  2N9B A;  1S72 P;  4WY4 B;  1RE4 A;  3B5N C;  3CCM P;  1NKN A;  1JB0 J;  1VQ9 P;  2ZYG A;  1A02 J;  4D6T G;  1H8A A;  5AVS B;  3V2N A;  1YBK A;  2PFX A;  2K37 A;  1XTC C;  1NAY A;  5AW1 B;  4PD4 D;  2IZ1 A;  3V2P A;  3FXE A;  2N1T C;  4HJG H;  1YTZ T;  1VF5 D;  1FAV A;  1S5L H;  2BEQ D;  4U3F E;  2V4H A;  3H1L J;  1NTK D;  3HD7 B;  3H1H J;  3MZW B;  1A02 F;  2FKW B;  2YKO A;  1ZRT D;  3USS A;  5GTH H;  1JCC A;  2IFM A;  3KDP B;  2E75 D;  1E5W A;  2WSE H;  3CCR P;  1IFM A;  3L72 J;  1KIL B;  1QL2 A;  3HUS C;  3JCU E;  1W2E A;  2E43 A;  5KAI H;  2MKV A;  3H32 B;  1R8E A;  1JO5 A;  1NU1 J;  1FJK A;  1X0T A;  4WVZ A;  4BRY A;  3MD0 A;  5KKZ C;  3VYI A;  2HOD A;  4GKG A;  1L0L K;  2P58 A;  1KFN A;  1KQS O;  1JY2 O;  5KAF E;  3G4S P;  2OYH B;  1SQQ D;  5B66 H;  3MGN A;  4HYT B;  1PIX A;  3RK3 E;  1LTI C;  5L8R J;  5CCH D;  3CXH D;  1SQP D;  5KJ7 C;  2NPS A;  1JMB A;  5AVW B;  1GZL A;  1OVR A;  3RL0 g;  3SWY A;  1L0L E;  3GLM A;  1NTM D;  1N7S A;  1NTZ K;  1Q90 D;  1W5C E;  3IFM A;  3H25 A;  1LWU A;  3NMD A;  3U1A A;  4U3F J;  1KB9 H;  4ASV A;  2KNC B;  2RMZ A;  3Q5P A;  2R5B A;  1VDF A;  1MV8 A;  3M91 A;  2AEF A;  2M5A B;  2IBZ E;  2PRR A;  3WU2 H;  3O6Q B;  3Q2Y A;  2E74 C;  2KK7 A;  1PGP A;  1SFC B;  2IFN A;  2LR2 A;  2B87 A;  2P7J A;  2QM7 A;  2M3B A;  1VQO P;  3LID A;  1YJN P;  4DOJ A;  2KSJ A;  1BE3 G;  1M1K Q;  3G71 P;  3A0H H;  1AFO A;  4Z1M H;  3CCS P;  3H1I E;  4H0L B;  3IAO A;  2QIW A;  3CWB E;  2N1T D;  4RJT A;  2E5T A;  2BCC D;  1DD3 A;  2ZXX A;  2OYI C;  3I56 P;  1QGK B;  1T6A A;  3IR9 A;  2P10 A;  3WUT A;  3CX5 D;  1VF5 B;  3QH9 A;  4U7J A;  3U1C A;  2FYU G;  1K9M Q;  3L74 G;  1L4A C;  1Y47 A;  3H1H G;  1L0L J;  4YPC A;  2YIU B;  3L75 E;  2H88 C;  2O1J A;  2WZ7 A;  2E75 B;  4LC1 A;  1AQ5 A;  1FDM A;  1SQX G;  1PPJ E;  1DEB A;  1HWT C;  1Q7Y Q;  3MP7 B;  1SVF A;  1JY2 P;  3H6P A;  3R4Y A;  1HH0 A;  3CC4 P;  1QLE D;  2GUS A;  1FC2 C;  4ZKU A;  2FYN C;  1L0N K;  1FZE A;  1NTZ J;  2ZJS E;  2A06 D;  1G2C B;  1Q82 Q;  4OH8 B;  4BRY B;  5KLV E;  2CK3 H;  3F5H A;  3H1I J;  1OXZ A;  4JYC A;  2HOD B;  3CWB J;  5GTH E;  1AVY A;  4M3L A;  2IZ0 A;  2QJP B;  1ZR2 A;  2WPS A;  1QVF O;  1HGV A;  2JP3 A;  2YO2 A;  2QEX P;  2Q9I A;  3CPW O;  1P84 E;  5CMZ A;  2NPS B;  2E74 D;  1LTJ A;  3AEB C;  2M8R A;  4PV1 D;  2A45 G;  3CC2 P;  3L73 D;  5AVV B;  3HTK A;  1LWU B;  3L75 J;  4PD4 I;  1RE3 A;  2OGU A;  4NPE A;  1M7L A;  2A45 I;  2K88 A;  2K3R A;  1URQ A;  1QVG O;  3H1J E;  5AVX B;  2IYP A;  2R32 A;  1BCC D;  1HTL C;  1TU3 F;  1KYO D;  1KC8 Q;  2GA1 A;  1Q2N A;  2B87 B;  5AW5 B;  3AE8 C;  3HE5 B;  2OQQ A;  1KB9 D;  1PV3 A;  1FZG A;  4WB4 A;  2B9B A;  4I2L C;  4NPF X;  1FZC A;  1NYH A;  1N73 C;  3MHV A;  1PP9 D;  2Y0E A;  5KLV J;  1LGH B;  3RL0 B;  3V2R A;  1DIP A;  2H8P D;  1L4A D;  1W2B O;  1PP9 E;  3JCU H;  3G9R A;  1FE6 A;  5APQ A;  2WSE J;  2I1J A;  4BWN A;  1JMM A;  1AA0 A;  4IFF A;  1LNQ A;  3E1I A;  1GK4 A;  2L91 A;  1OMI A;  3KHU A;  4JYB A;  3AE9 C;  5DJU B;  2QSI A;  1USE A;  3HD7 A;  3IF4 A;  1IK7 A;  2W6A A;  3L70 D;  3A0H E;  4GIF A;  2FFD C;  1SQP G;  1R5L A;  2ZT9 C;  1T2K C;  5KAF H;  3VMA A;  1FZF A;  2O3J A;  1KIL A;  5GTI H;  1NTM G;  1EDI A;  3CXH I;  1RE4 C;  2AXC A;  1E79 H;  3H1J J;  3H32 A;  5AVQ B;  2BEZ F;  3M06 A;  1T3U A;  2WSC J;  1ZXG A;  5AW8 B;  5TJH A;  2V7Q J;  5AVT B;  2YXR B;  2Z5H A;  3HE4 A;  2WIT A;  3PP5 A;  4RES B;  3H1I G;  3C1L A;  3EQ2 A;  1NOH A;  1H88 A;  5KTB A;  3VMX A;  1YIJ P;  2XZR A;  1AVO A;  2NZ2 A;  2C9N Y;  2K1A A;  3II6 A;  3AEA C;  2AEJ A;  4NPD A;  5APT A;  2ZYD A;  3H1L D;  3QWO C;  1D7M A;  3H1H D;  2MJZ A;  1KQL A;  2BCC G;  3TDK A;  3KXD A;  2AXT E;  4XFJ A;  1EDJ A;  1Y9B A;  4PV1 B;  1JCD A;  3W68 A;  4K3A A;  3H1K J;  4H44 B;  4DJG A;  2OTJ P;  3B4S A;  2KOG A;  2M0B A;  3FGA D;  2M5A A;  3WUV A;  3CX5 I;  1NO4 A;  1K73 Q;  3L72 E;  1NU1 D;  3O6Q A;  1S4X A;  4KJM A;  3A0B E;  1SFC A;  3NFQ A;  2C0W A;  2HLO A;  3ZDM A;  1URQ B;  2PGD A;  2K9J B;  4WWI A;  3ABV C;  5AVY B;  1OW6 A;  2RH0 A;  3AEC C;  4UB6 E;  3OA7 A;  1GU5 A;  3G3Z A;  4IFD K;  3KQG A;  1IZN B;  2Q5U A;  3AE1 C;  4I7Z B;  3SSU A;  5KLV G;  1FZC B;  1M1J A;  2W27 A;  1N7L A;  4YTP C;  3BCC E;  2A06 G;  3D71 A;  1N7S C;  1J1D C;  3BRT B;  2Y0D A;  1FOS E;  2FY8 A;  1EZV E;  2HR3 A;  5E79 E;  1VQN P;  2ZT9 D;  1T2K D;  1NJI Q;  4U3F D;  5KLI B;  2HPC A;  5TIS E;  3TK1 A;  1VQK P;  3VMZ A;  1BGY E;  2D2C B;  3K5B A;  2JKV A;  1NTK K;  5CJ4 A;  3FXD A;  3AE6 C;  3TYY A;  2H89 C;  3I55 P;  3L36 A;  3RL0 C;  4HB1 A;  1R5S A;  2XV5 A;  3L73 G;  3AED C;  2W8Z A;  1RF0 A;  1LP1 A;  2ZVN B;  1P84 H;  1G2C A;  5CCG D;  1BCC G;  2E76 B;  3HE4 B;  5H2F E;  2XU6 A;  3L71 J;  1RF1 A;  4L76 A;  1RHZ B;  3AEF C;  5AW4 B;  3L35 A;  3RK3 D;  1KYO I;  1NH4 A;  3BCC J;  5CCH A;  1SQQ K;  5GTI E;  2P67 A;  1PP9 G;  1KB9 I;  2WSC H;  3P7K A;  1H0T A;  4WBA A;  2LXB A;  1NKZ B;  3U59 A;  2V7Q H;  1L0L D;  2W6J H;  2ZAE B;  4Y99 C;  4IL6 E;  1GTW A;  2ZYA A;  4XE5 B;  1BGY J;  2IBZ D;  3P8M C;  1IFI A;  2UWJ E;  3N4X A;  2RKL A;  1IK9 A;  3F89 A;  1YIT P;  4OGQ B;  3L70 G;  3RK2 B;  3P8C E;  3OAK A;  1FOS F;  4C7N B;  3B5N D;  1BSN A;  4N78 E;  1HJB A;  1X79 B;  2QRX A;  3HE5 A;  3H1I D;  1S2E A;  2LXC B;  1NTZ E;  4DCK A;  3S4R A;  1LJ2 A;  3A3Y B;  3CWB D;  1JY3 O;  2N1T A;  3D6Y A;  1GL2 C;  3MUD A;  3KZI E;  3AE3 C;  5DJT B;  2KLV A;  1SQV K;  5AW9 B;  4H44 C;  1VPC A;  3L37 A;  1M1J B;  2WQY C;  1LTJ C;  2NRG A;  1H89 A;  3V5B A;  3RGU A;  3WMM 0;  1RE3 C;  3M9H A;  3TGU E;  3L75 D;  4RO0 A;  4H13 C;  1KFM A;  3AE4 C;  1YJW P;  2HPC B;  1SQV E;  3H1L G;  1PPJ D;  5AVR B;  2QJK B;  4YXD C;  3HRN A;  4WY4 C;  1SQQ J;  3RBZ A;  3L72 G;  4ZKP A;  1NGM B;  1SS1 A;  4EDF A;  1LT9 B;  2AXT H;  1SQB K;  3CCV P;  1KTM A;  1NU1 G;  5KLV D;  1IC2 A;  4JPZ B;  1LP1 B;  3V4Q A;  2WPR A;  4JQ0 D;  2E5Y A;  2JEE A;  3RK3 B;  4JF7 A;  5CBN A;  3GF3 A;  1U7M A;  5KJ7 D;  3M0A A;  2D2C C;  4AYC A;  3HD7 C;  3BCC G;  2L5G B;  3A0B H;  4DT0 A;  1RF1 B;  2QJY B;  1SQB E;  3CCU P;  1XTG B;  4PJ0 H;  1P84 D;  2YO3 A;  1IFD A;  2IPP A;  4R4L A;  1JUN A;  1L0N E;  1J1E B;  1KIL C;  3D6Z A;  4D6T E;  2C9L Y;  3C8V A;  1H0T B;  3GHG B;  1PZQ A;  4UB6 H;  2WWW A;  4B86 A;  1EC5 A;  2O01 J;  4Y28 J;  3TGU J;  5APU A;  3EWK A;  2JDI H;  1SQV J;  4U3F G;  2Y0C A;  1QL1 A;  3H1J D;  1JY2 N;  1G1J A;  1JY3 P;  5AW2 B;  5APW A;  3B5N B;  5EFW B;  1GL2 D;  2K9J A;  2QVA A;  3KPE A;  2GM4 A;  5E79 H;  2OYH C;  1Q81 Q;  2WPQ A;  1IJD B;  2HFE D;  1X8Y A;  5AVU B;  5TIS H;  1UII A;  3BRV B;  3N7N A;  3VP8 A;  1UIX A;  1LTT C;  1FBM A;  1OVV A;  2N1T B;  1DD4 A;  3Q5R A;  2YMY A;  3PRJ A;  1RY3 A;  1OVU A;  4H13 D;  4OVN F;  3NXS A;  4LGD E;  3TF5 A;  1HF9 A;  1KMI Z;  1BDD A;  1SQB J;  1EXI A;  1K8A Q;  3H1K D;  3RK2 C;  1L0N J;  4WY4 D;  4D6T J;  2KI7 B;  3HUS B;  1SFC C;  1ZOY C;  4I6M C;  3CL3 D;  1AQT A;  1IFN A;  3H1K E;  1RH5 B;  1L0L G;  5C39 A;  2B88 A;  2ZXE B;  2C0X A;  5H2F H;  4GOE A;  2YKQ A;  4CPG A;  4HH2 A;  5KKZ B;  4H0L C;  1X9V A;  3JSV C;  1SP4 A;  4UB8 E;  2IBZ G;  2XND H;  1M1J C;  3Q1M A;  4RKU J;  1OW8 A;  4EOT A;  3A7O A;  1M8O B;  2JJL A;  2IBZ I;  2WSF J;  4IL6 H;  3SWF A;  1OFC X;  1NTZ G;  1T3J A;  1VF5 C;  1FJP A;  4OWF A;  2E42 A;  1T8Z A;  1GMJ A;  2GUV A;  3A5T A;  4YXW H;  3CWB G;  3R2P A;  5AW0 B;  2YIU C;  4GT1 A;  1BE3 E;  2E75 C;  2W90 A;  1KIL E;  2WVR A;  4R4M A;  2FYU K;  3JC2 2;  1ZP0 C;  1FU1 A;  1VQM P;  3V4W A;  1NHL A;  1HJ0 A;  5APV A;  2E74 B;  3KZI H;  1RF0 C;  2RN0 A;  1NVO A;  2HYN A;  1YYC A;  3L72 D;  1SQX K;  2KYV A;  2WPV B;  3MTU E;  5BVZ A;  1CW5 A;  3L75 G;  4IOI H;  2FYU E;  1FDI A;  4O9B A;  3L74 E;  4C7N A;  2K9Y A;  5APS A;  1PPJ G;  3FX0 A;  1HGZ A;  1DH3 A;  4PJ0 E;  1RF1 C;  2O01 H;  3AE7 C;  3SFE C;  3M9B A;  1FZA A;  2QJP C;  4ASW A;  1SQX E;  3VOP A;  1GD2 E;  2Z4E A;  1JM0 A;  3BCC D;  4TT3 H;  4W7Y A;  3S9O A;  4GDO A;  1YHQ P;  1VQ6 P;  2NPS C;  3L71 E;  1EZV D;  5APY A;  1L4A B;  1U7J A;  4W7Z A;  2VRS A;  2G3A A;  3CX5 H;  4N6J A;  3CI9 A;  1LWU C;  3CCE P;  1BE3 J;  1RQU A;  4EYY Q;  1L0N G;  1BGY D;  1FZB A;  1QX8 A;  4H0L D;  2R5D A;  1YQ3 C;  1WMK A;  3LW5 J;  1VQ8 P;  2Q3E A;  2HG5 D;  5B5E E;  1ZV8 A;  4QMA A;  1OIP A;  2FYN B;  5CBO A;  3KYQ A;  3E7K A;  1P84 I;  2ZVO B;  1PL5 A;  4XA4 A;  2H7H A;  3MUD C;  2FYU J;  1VQ5 P;  2I1K A;  3L74 J;  4PD4 E;  1EXJ A;  2KSE A;  1LT9 A;  3M0D A;  3H1J G;  1S9K D;  1ZLL A;  4DZO A;  5CCG A;  2KP8 A;  3VTP C;  3WUU A;  1IFP A;  1LTS C;  1M57 D;  3PH0 A;  1GW4 A;  2W6B A;  1NTK E;  1SQX J;  1S9K E;  1VQP P;  1SLQ A;  2KZI A;  3A2A A;  1ZRT E;  3TNU A;  4C7R A;  2KXP B;  2I8D A;  2PAJ A;  3Q3D A;  2YMK A;  1HUC A;  3P32 A;  3CCL P;  2WSS H;  1YI2 P;  2ITA A;  2W83 C;  2IYO A;  2WSF H;  3SWK A;  3GHG A;  1U57 A;  1VL2 A;  1SQP K;  2WTY A;  1Q86 Q;  4AUW A;  1BDC A;  3H1K G;  1BSH A;  1NTM K;  2Y9Z A;  1KV4 A;  3G6E P;  1GK6 A;  3P8C D;  1SQQ E;  2J59 M;  2Q6Q A;  3SFD C;  3BVH A;  3B5N A;  4N78 D;  2KS1 A;  1N73 B;  1GU4 A;  3FWL A;  2Q7C A;  3PLN A;  1YTZ I;  1KYO H;  1IFJ A;  4IFM A;  1NTZ D;  3IN6 A;  2JWD A;  4KT0 J;  1EQ7 A;  3CXH E;  1SQP E;  2QG4 A;  4JBZ A;  2NPS D;  1JTH B;  2QE7 H;  2FBW C;  3B71 A;  2BAS A;  2QA4 P;  4C46 A;  1N7S D;  1NTM E;  1X22 A;  1OX3 A;  1N2D C;  2H43 A;  1FDO A;  1NTK J;  1M90 Q;  3MIW A;  3GMA A;  2FXM A;  4PV1 C;  1J2J B;  2JWA A;  1CI6 A;  1S3J A;  4IL6 X;  4UB8 H;  1PGO A;  1LT1 A;  2FFD B;  1MZ9 A;  5AW7 B;  3TGU D;  2ZT9 B;  2IDB A;  5CHX A;  1SQV D;  3HUS A;  1N8R Q;  2P1J A;  5K5G B;  3AEG C;  2KUB A;  1URQ C;  3AE2 C;  1KZU B;  3RL0 D;  2J5U A;  3C9I A;  4GOD A;  1GDT A;  2P2U A;  2YNY A;  2KZJ A;  5AW6 B;  2BCC E;  2PP6 A;  4I7Z C;  1LTA C;  1FZC C;  1KOR A;  3CC7 P;  3O8Z A;  3CX5 E;  1YQ4 C;  1AV1 A;  1M56 D;  1VQL P;  1Y8A A;  1SQP J;  3LW5 H;  4AQR D;  3CCJ P;  4LLH A;  5KLV K;  2J58 A;  1N86 A;  2FYZ A;  1NTM J;  5KJ7 A;  3VP9 A;  5KLI C;  2XKM A;  2ZFC A;  1SQB D;  3BAS A;  3L71 G;  3TNU B;  2CPB A;  1OW7 A;  1WT6 A;  1L0N D;  4GOF A;  4D6T D;  5M1B A;  2O1K A;  4A7P A;  1S5L E;  3TSI A;  5AW3 B;  1KQF B;  1EZV G;  4ZMD A;  1DEE G;  2N9Y B;  4L74 A;  2A06 E;  3B8E B;  1JOC A;  1EZV I;  2M3E A;  4BXL A;  2WT7 A;  3ITK A;  3PHL A;  1BGY G;  3CME P;  1WRG A;  1GL2 A;  2E76 C;  2BCC J;  3CCQ P;  1CZQ A;  1CSB A;  5KAI E;  2KS1 B;  3V2Q A;  3AEE C;  2YKP A;  4EI2 A;  2OYI A;  5CJ0 A;  1PGQ A;  1N7S B;  1J1D B;  3I5C A;  3L4F A;  4H44 D;  3EFG A;  2R3C A;  1S5L X;  3CD6 P;  4K35 A;  3OW2 O;  1NTK G;  3UIA A;  3L73 E;  5B5E H;  4KHX A;  5B66 E;  3T97 A;  1JNM A;  1L4A A;  2JR8 A;  1GW3 A;  2Y9Y A;  3OJA B;  1URQ D;  3E1R A;  4PD4 H;  4EIJ A;  1CI6 B;  3PJS K;  4WY4 A;  2A45 H;  1K05 A;  1BCC E;  1LTG C;  1KYO E;  3PTZ A;  4OGQ C;  2IX7 C;  4L73 A;  1KB9 E;  3NTN A;  1JY3 N;  3VN0 A;  1ZR4 A;  2R3S A;  3VMY A;  1MFT A;  1PGJ A;  2KB7 P;  3WU2 E;  3V6I A;  1ZN5 A;  1RQV A;  4W80 A;  1VQ4 P;  1AJY A;  2G8Y A;  1MKM A;  1SQQ G;  3Q5S A;  1G1I A;  2OTK E;  1VQ7 P;  2O01 N;  2D2C D;  3HD7 D;  2DW3 A;  2Q1K A;  3L70 E;  1KD1 Q;  2B89 A;  2OAR A;  1ZW0 A;  1OWA A;  4TLF A;  1PFI A;  1BE3 D;  2WMM A;  3L73 J;  4Y99 B;  1USD A;  1QEX A;  1KIL D;  4I1L A; 
#chains in the Genus database with same CATH homology
 2Q9I A;  1GL2 C;  4N3Y B;  5CMZ A;  3MUD A;  3KYQ A;  1HBW A;  2NPS B;  3BAT A;  4XA4 A;  1LTJ A;  2H7H A;  2M8R A;  2A45 G;  2KLV A;  1SQV K;  5AW9 B;  5AVV B;  1VPC A;  3L37 A;  2I1K A;  1M1J B;  3HTK A;  1LWU B;  1LT9 A;  1LTJ C;  3M0D A;  1H89 A;  1RE3 A;  1S9K D;  1ZLL A;  3V5B A;  4DZO A;  1M7L A;  2A45 I;  2KP8 A;  3VTP C;  5CCG A;  2OYH A;  1MFZ A;  3WMM 0;  1LT9 C;  1URQ A;  3M0D C;  5APX A;  1LTS C;  1RE3 C;  5AVX B;  2R32 A;  1GW4 A;  5CCG C;  2W6B A;  1S9K E;  3M9H A;  5BU8 B;  1HTL C;  2CPS A;  2WT7 B;  1KFM A;  1SLQ A;  2Q3I A;  3A2A A;  5AW5 B;  1N73 A;  3TNU A;  4C7R A;  3HE5 B;  2HPC B;  1GL2 B;  2PAJ A;  1FZG A;  4WB4 A;  1MUU A;  4I2L C;  3RK3 C;  5AVZ B;  1FZC A;  5AVR B;  1N73 C;  1NU1 K;  3HRN A;  1HUC A;  1JTH A;  3P32 A;  4WY4 C;  2Z5I A;  1LGH B;  2POH A;  3RL0 B;  3V2R A;  1LTJ B;  2WSF H;  3GHG A;  4ZKP A;  2OYI B;  5CCH C;  2H8P D;  1L4A D;  1J1E C;  3HTK B;  1DX7 A;  1LT9 B;  1NWQ A;  5APQ A;  3GHG C;  1IO4 A;  1SQP K;  2WTY A;  1SQB K;  1IC2 A;  1LTB C;  2I1J A;  1JMM A;  3V4Q A;  3LIE A;  4IFF A;  4AUW A;  3RK2 D;  1ZV8 A;  2LKM A;  3E1I A;  1NTM K;  2WPR A;  1GK4 A;  1HVV A;  2QM8 A;  3CLQ A;  4JYB A;  2FFD A;  1Z56 A;  1SFC D;  2JEE A;  1GK6 A;  3P8C D;  2XNX A;  2J59 M;  5BU5 A;  3HD7 A;  2XDJ A;  3BVH A;  3RK3 B;  3B5N A;  4JF7 A;  1NAF A;  2W6A A;  4N78 D;  4GIF A;  2FFD C;  5KJ7 D;  1N73 B;  3M9Q A;  3M0A A;  1GU4 A;  4AYC A;  2Q7C A;  2N9B A;  1YTZ I;  1IFJ A;  3HD7 C;  4IFM A;  4WY4 B;  1T2K C;  1RE4 A;  3B5N C;  2L5G B;  1NKN A;  1FZF A;  1RF1 B;  1EQ7 A;  1A02 J;  1KIL A;  2NPS D;  1XTG B;  1JTH B;  2YO3 A;  1IFD A;  2IPP A;  1RE4 C;  1H8A A;  1JUN A;  5AVS B;  1J1E B;  2BAS A;  1KIL C;  4C46 A;  2C9L Y;  1N7S D;  3V2N A;  3GHG B;  1N2D C;  3H32 A;  2WWW A;  5AVQ B;  4B86 A;  3M06 A;  1T3U A;  2H43 A;  1XTC C;  5AW1 B;  3MIW A;  5AW8 B;  5APU A;  2FXM A;  5AVT B;  3V2P A;  1J2J B;  2N1T C;  2Z5H A;  1YTZ T;  3HE4 A;  1FAV A;  1CI6 A;  2WIT A;  3PP5 A;  1QL1 A;  4RES B;  1JY2 N;  1G1J A;  1JY3 P;  5AW2 B;  5APW A;  3EQ2 A;  1NOH A;  2FFD B;  1H88 A;  5KTB A;  1MZ9 A;  5AW7 B;  3VMX A;  3HD7 B;  2XZR A;  3B5N B;  1GL2 D;  1A02 F;  2FKW B;  2C9N Y;  2YKO A;  3KPE A;  5CHX A;  2GM4 A;  3HUS A;  3II6 A;  2OYH C;  2P1J A;  1JCC A;  2IFM A;  3KDP B;  2WPQ A;  1E5W A;  2WSE H;  1IJD B;  1IFM A;  1URQ C;  1KIL B;  2HFE D;  1QL2 A;  5APT A;  1X8Y A;  5AVU B;  3HUS C;  1KZU B;  3RL0 D;  1W2E A;  3C9I A;  3BRV B;  2MJZ A;  2E43 A;  1KQL A;  1GDT A;  2P2U A;  2YNY A;  3N7N A;  3VP8 A;  1JO5 A;  3H32 B;  1LTT C;  1FBM A;  5AW6 B;  1FJK A;  2N1T B;  1JCD A;  2PP6 A;  2YMY A;  1RY3 A;  3MD0 A;  1LTA C;  1FZC C;  3O8Z A;  2KOG A;  3VYI A;  3NXS A;  4LGD E;  2HOD A;  1NO4 A;  4GKG A;  1L0L K;  1KFN A;  1JY2 O;  3LW5 H;  4AQR D;  1SFC A;  2OYH B;  3NFQ A;  2C0W A;  3RK2 C;  4LLH A;  5KLV K;  2HLO A;  1URQ B;  4WY4 D;  2J58 A;  1N86 A;  2FYZ A;  5KJ7 A;  3HUS B;  5AVY B;  3VP9 A;  1SFC C;  3MGN A;  4HYT B;  4I6M C;  1LTI C;  3CL3 D;  2XKM A;  3OA7 A;  5CCH D;  1GU5 A;  1IFN A;  3G3Z A;  2ZFC A;  5KJ7 C;  4IFD K;  3BAS A;  2NPS A;  5AVW B;  1GZL A;  2ZXE B;  3KQG A;  3TNU B;  2CPB A;  2C0X A;  1WT6 A;  3SWY A;  2Q5U A;  2YKQ A;  4HH2 A;  1N7S A;  1NTZ K;  1FZC B;  2O1K A;  1M1J A;  1X9V A;  3IFM A;  3TSI A;  2W27 A;  1LWU A;  3NMD A;  3U1A A;  1N7L A;  1SP4 A;  5AW3 B;  1N7S C;  1J1D C;  3BRT B;  1M1J C;  1FOS E;  2R5B A;  1VDF A;  1MV8 A;  3M91 A;  3B8E B;  4EOT A;  3A7O A;  1JOC A;  2JJL A;  3SWF A;  1T2K D;  1T3J A;  2WT7 A;  1SFC B;  1FJP A;  2IFN A;  2E42 A;  1T8Z A;  2P7J A;  2QM7 A;  1WRG A;  2HPC A;  3TK1 A;  2M3B A;  1GL2 A;  3VMZ A;  3LID A;  4DOJ A;  2GUV A;  2KSJ A;  3A5T A;  1CZQ A;  1CSB A;  1NTK K;  5CJ4 A;  1AFO A;  3R2P A;  5AW0 B;  3TYY A;  3V2Q A;  4GT1 A;  2YKP A;  2OYI A;  2N1T D;  5CJ0 A;  3L36 A;  1N7S B;  2FYU K;  1J1D B;  3I5C A;  3L4F A;  3RL0 C;  2XV5 A;  3EFG A;  1FU1 A;  2R3C A;  2OYI C;  3V4W A;  1RF0 A;  1NHL A;  3IR9 A;  3UIA A;  5APV A;  4KHX A;  3T97 A;  1JNM A;  1G2C A;  1L4A A;  1RF0 C;  2HYN A;  1YYC A;  3U1C A;  5CCG D;  1SQX K;  1GW3 A;  2KYV A;  3MTU E;  3OJA B;  1URQ D;  5BVZ A;  1L4A C;  1CW5 A;  3HE4 B;  4EIJ A;  1CI6 B;  4WY4 A;  2A45 H;  4O9B A;  2XU6 A;  1LTG C;  1RF1 A;  2O1J A;  4C7N A;  5APS A;  5AW4 B;  2WZ7 A;  3L35 A;  2IX7 C;  3RK3 D;  1HGZ A;  1NH4 A;  4LC1 A;  1AQ5 A;  5CCH A;  1DH3 A;  1SQQ K;  1FDM A;  1RF1 C;  2P67 A;  2O01 H;  3NTN A;  1DEB A;  2WSC H;  3P7K A;  1JY3 N;  1HWT C;  3M9B A;  1FZA A;  4WBA A;  3U59 A;  1NKZ B;  3VN0 A;  1ZR4 A;  3VMY A;  3VOP A;  1SVF A;  1JY2 P;  3H6P A;  1GD2 E;  2KB7 P;  1HH0 A;  2Z4E A;  4Y99 C;  1ZN5 A;  4W80 A;  2GUS A;  1GTW A;  4ZKU A;  4W7Y A;  1L0N K;  4XE5 B;  1FZE A;  2NPS C;  5APY A;  1G2C B;  4OH8 B;  3P8M C;  1IFI A;  1L4A B;  4W7Z A;  2VRS A;  3N4X A;  1IK9 A;  4N6J A;  1OXZ A;  3CI9 A;  1LWU C;  1G1I A;  4JYC A;  2HOD B;  3RK2 B;  3P8C E;  3OAK A;  3HD7 D;  1FOS F;  4C7N B;  4M3L A;  1FZB A;  3B5N D;  4N78 E;  1HJB A;  2R5D A;  1X79 B;  1ZR2 A;  2OAR A;  2WPS A;  3HE5 A;  1OWA A;  1HGV A;  1PFI A;  2YO2 A;  4Y99 B;  1KIL D;  2HG5 D;  3A3Y B;  4I1L A;  1JY3 O;  2N1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...