3MTUE

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
67
Chain Sequence
b'PEEHEDILNKLLDPQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tropomyosin alpha-1 chain,Microtubule-associated protein RP/
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 23
structure length 67
sequence length 70
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mtuE00
3OA7A 1NOHA 3MTUE 1NO4A 4IFFA
chains in the Genus database with same CATH superfamily
4KHXA 2YIUC 2IYPA 3O6QA 5KLVG 1IFIA 2QRXA 3QH9A 3D70A 4UB6E 1BSNA 2GA1A 1PPJE 1Y9BA 2HLOA 4JF7A 5AW7B 1SS1A 2AXCA 1IFMA 1CW5A 3MZWB 3L73E 5KLVJ 1DX7A 1M56D 4Y28J 3D6ZA 2RMZA 1EZVI 3CXHE 1VQLP 2WMMA 3L72E 2NPSB 1G1IA 2IYOA 1NVOA 3Q5SA 3L70D 2FFDC 5TISE 1JMBA 3Q1MA 3VYIA 1CI6A 1NTZK 3SFDC 3Q5RA 1YYCA 1N73C 2I1JA 1NTZD 1L4AB 2K3RA 1YQ4C 1EC5A 2PGDA 2POHA 1FZCC 5B5EH 4WY4A 5KTBA 3JCUH 3B5NC 1GW4A 2P58A 3LIEA 2KI7B 4IFDK 1NTKE 1R5LA 2W6BA 1PZQA 4C46A 3CX5I 1LWUB 1MZ9A 3WUTA 2QJPC 2WPRA 1VQKP 5AVQB 1P84I 3TDKA 3HUSB 2FBWC 1YJ9P 3CX5D 1RF0A 1JOCA 3MHVA 3NTNA 1DD3A 4C7RA 2HPCA 2ZT9C 2HR3A 2Y9YA 3HD7A 5BVZA 3RBZA 1H89A 1N86A 1VQ5P 4GIFA 3AE1C 5BU5A 1SQXG 1VQNP 1KC8Q 2LXBA 1JB0J 1L0NK 3VTPC 5KJ7C 3HE5B 1BE3E 2E5YA 4XE5B 1L0ND 2NPSA 2Z5HA 4DJGA 4H13C 1N7SC 2A06D 1SQXJ 1NGMB 2P1JA 4PV1C 2WSFH 3E7KA 1KILD 3BATA 1DEEG 3A0BE 1H8AA 4O9BA 1L4AA 5AW5B 1NOHA 4IFFA 2WT7B 1XTGB 3GF3A 4NPDA 2IPPA 1J1EB 2JJLA 2IX7C 3N7NA 3G3ZA 2Q3IA 1OVUA 3HRNA 4HKZH 1A02J 3CL3D 1LWUA 1EZVE 3CC4P 2OARA 4L74A 5APWA 1M57D 2L5GB 1DEBA 4PD4D 3HUSA 2H8PD 4BRYB 3AE3C 2OTJP 1W2BO 4IOIH 2E74C 5H2FE 1M1KQ 3SWFA 2Q7CA 2P10A 2I8DA 2B88A 1BGYG 5APTA 2QE7H 4GOFA 3B5ND 3W67A 5AVZB 1FZEA 2WVRA 2KSJA 3P32A 5AVXB 1MFTA 1SQVK 2PAJA 3Q5PA 1N7LA 1BGYJ 2ZXXA 3LW5H 1SQVD 3O8ZA 2H7HA 3HE5A 4N78E 4W7YA 4ZKUA 2D2CB 2ZAEB 2AEFA 3U59A 5CCHC 1RE4A 2YIUB 5CBOA 5B66H 3PHLA 2XU6A 2OYHB 3SFEC 4BXLA 1KV4A 2WQYC 2ZT9D 4WVZA 3RK3D 3T97B 1JY2P 1SQBE 4OGQC 1GL2C 3WU2E 5AW1B 4UB8E 1RF0C 1KFNA 3RL0g 1PL5A 2WT7A 2N1TB 5KKZB 3CCLP 1PGPA 1KB9H 3M9BA 1J1DB 2Y0DA 5KJ7D 4YXWH 4TLFA 2ZXEB 2H88C 1N7SD 2FFDB 1L2PA 1RHZB 2N9YB 5M1BA 4EI2A 1VQ7P 1BGYD 4PV1D 1OZHA 2WSFJ 1PP9G 1FJPA 5APVA 3BCCD 2RH0A 5AW3B 2E76B 4L73A 4BRYA 1NU1E 1IK7A 1ZLLA 1HGVA 2K88A 1SFCD 5C39A 2YKQA 2O01H 1OIPA 1PP9J 3MUDA 2C9NY 1GDTA 3G6EP 3N4XA 1DH3A 2K1AA 4WB4A 1KQSO 3FXDA 2FKWB 1LTJA 4W7ZA 4AYCA 1MKMA 1IZNB 1AQTA 3RBXA 2JKVA 1LTBC 2QEXP 1JCCA 2XNDH 1S9KE 2XKMA 1LWUC 2OYHA 1W2EA 1VL2A 4PJ0H 2LXCB 3T97A 1X0TA 4ZKPA 3AEFC 3HUSC 3A7OA 2N1TA 2J59M 2JWAA 4WY4D 1RQVA 3LW5J 4D6TG 1G1JA 2FXMA 2P2UA 3RL0D 2QG4A 4DOJA 4H13B 3WMM0 3VN0A 2WPQA 1KQFB 2FFDA 1KTMA 1U7JA 1FU1A 4D6TJ 1BDDA 2BCCG 1VQ4P 3KZIE 1KD1Q 1HWTC 1GK4A 2Q5UA 1G2CB 2WSCH 2BCCJ 2PFXA 4KJMA 1OX3A 1JTHB 2R3CA 1IFPA 1D7MA 5E79E 2PP6A 2YKPA 1Q86Q 1R8EA 3H1JG 3USSA 3MP7B 2J5UA 2YXQB 2Q6QA 3H1IE 3P7KA 1UIIA 3V2QA 2FYUK 3CCJP 4TT3H 1HVVA 2W90A 3H1JJ 1BDCA 2FYUD 1IJDB 2IFNA 1FZAA 1T2KC 1M7LA 3B4SA 4IL6E 5AW0B 2NPSD 2E74B 1L0LK 3L37A 3CD6P 3D71A 2W83C 3L75D 3F89A 1L0LD 3V2RA 1FDIA 3EFGA 1YQ3C 2KSEA 2QM8A 3EWKA 1JY2N 1LT9B 5AVUB 4AQRD 1KB9I 1URQC 5DJTB 4OH8B 3GHGB 3L70G 5GTIH 1J2JB 2M8RA 1U57A 3CWBE 2GUSA 5KAIH 1NTZG 4L76A 3L70J 4YPCA 2KP8A 1OW7A 4IL6X 1LT1A 2NRGA 4OGQB 1NTZJ 1T3UA 4MN4C 1GL2B 4WWIA 1M8OB 2YMKA 1BCCE 5KAFH 1PGQA 3A0HH 3AECC 1BE3D 2L91A 4H44B 1JTHA 2HODB 2OYHC 1GU4A 4JYBA 2AXTH 2KUBA 4XFJA 1USDA 3L35A 1FS0E 2R32A 2N1TC 5KKZC 1VQPP 1X79B 2IDBA 3CCSP 5CCGA 5APYA 1J1DC 3BASA 2O01N 1EDKA 1WMKA 1YTZI 3WUVA 2WSCJ 1Q82Q 2G3AA 1ZRTD 2GM4A 1LT9A 2E76C 1L0NG 1NJIQ 2Y9ZA 2A06G 2OTKE 3GHGA 4YXDC 2FY8A 2JR8A 4H0LB 1L0NJ 2YO3A 1K05A 5CCHA 1PV3A 1T2KD 3CMEP 1LNQA 4EIJA 1JMMA 3AEAC 1GL2A 2W8ZA 1S5LH 3VMAA 3ZDMA 2W27A 5APSA 4GT1A 4I7ZB 4N78D 1KQGB 1QL1A 2BCCE 2HODA 2KZJA 5GTHE 1FZFA 1SQBK 4I6MC 3P8MC 3NFQA 1KORA 1SQBD 3SWKA 1KYOH 1GW3A 2IBZD 2PRRA 1SP4A 2D2CD 3TGUE 3B71A 2I1KA 4W80A 1Y47A 3G9RA 1VQ9P 4A7PA 1SQVG 1T3JA 4GOEA 3CCEP 3VP8A 3UIAA 3L36A 1GMJA 1NU1K 1ZR4A 1SQVJ 1VF5B 2N1TD 2V7QH 3H1KE 2OTLP 4UB6H 4PD4I 2P7JA 2ZYDA 1SQPE 3V5BA 1GU5A 1E79H 1SQQG 3VOPA 1NYHA 5CCGC 1KFMA 1H0TB 1EDLA 2WPVB 4U3FE 1URQB 2FXOA 3CXHH 4JQ0D 2A45H 1SQQJ 2CPSA 2E76D 1FC2C 1NTME 3HE4B 1JY3O 3NXSA 3C8VA 3OJAB 1NO4A 2Q3EA 3C9IA 2QJYC 2B9BA 1S9KD 2KYVA 1JNMA 3SWYA 4ZMDA 2QSIA 1Q7YQ 2MJZA 5AVSB 1LT9C 3BCCG 2QA4P 3GHGC 3NMDA 2HFED 5KLVE 1KN7A 1ZV8A 3CCRP 3KYQA 3BCCJ 3TF5A 3AEDC 1T8ZA 3R4YA 1GZLA 3CX5E 5AW9B 3FWLA 3CC2P 4Z1MH 1EQ7A 2YXRB 2HG5D 1LJ2A 1P84E 1VQMP 3H1HD 1DIPA 1OWAA 1HJBA 2E75B 1SQQK 3CLQA 1IK9A 2WZ7A 2Y0CA 1SQQD 2P67A 3FXEA 5AW4B 4H44C 3VMYA 1KQLA 2QIWA 3CI9A 2ZVNB 4H13D 4R4LA 2OYIB 3M0DA 5KLIB 1OFCX 2E43A 1M1JC 4C7NB 1KILE 1WT6A 3AE7C 3L71G 1H0TA 3H32B 3JC22 1GK6A 1S1CX 2YNYA 5CBNA 1URQA 2BASA 3H1LD 2FYNB 3HE4A 5DJUB 3L71J 1PPJG 1DD4A 2GUVA 5AVVB 1HH0A 3A0BH 3L74D 3W68A 1KYOI 3CCUP 2WSEH 3V2NA 1KYOD 3S9OA 2A45G 5AW8B 1FJKA 2JDIH 4H0LC 1MV8A 5CCGD 2ZFCA 3TYYA 4PD4E 3B8EB 1SQXE 2E74D 2RN0A 1IFNA 3CWBD 1IO4A 1IFDA 3KQGA 4B86A 2Z4EA 1T6AA 2KNCB 2FYUG 3II6A 4N3YB 1VDFA 1BSHA 4I7ZC 1GTWA 3L71D 1KMIZ 1PGOA 3TK1A 3E1IA 3L75G 2UWJE 3U1CA 5H2FH 2FYUJ 1L0LG 4K3AA 2JP3A 1K8AQ 3M9QA 1Q2NA 1SVFA 5CCHD 1AVYA 3L75J 4HB1A 2OYIA 1PPJD 1ZP0C 1L0LJ 4C7NA 3CXHI 1QEXA 2A45I 3EQ2A 1RY3A 3TNUB 3H32A 3L73D 1FDOA 4OGQD 3RK3E 1GL2D 3MIWA 1AA0A 3CXHD 3VMZA 1YBKA 3L72D 2QVAA 5B5EE 1VQ6P 3CMAP 4H44D 1QLED 3P8CE 2JWDA 3JCUE 2R5BA 1EXIA 1HTLC 3M06A 3WU2H 3Q3DA 1VQ8P 1LTAC 4UB8H 1VF5C 2ZVOB 1BE3G 1BGYE 1ZR2A 3OW2O 3FGAD 5TJHA 1EDIA 3SSUA 3BCCE 3RGUA 3A2AA 2KLVA 1FAVA 1BE3J 2KK7A 3KPEA 1NTKK 2O01J 1S5LE 3M0DC 2R3SA 1NTKD 2QJYB 2WWWA 2KIKA 4N6JA 2KNCA 1ZOYC 1HJ0A 3KXDA 2WSEJ 2M5AB 1FOSE 1HGZA 4RO0A 3M91A 4EDFA 1Q90D 4H0LD 2E5TA 2IZ1A 2RKLA 2V4HA 4DT0A 3GG2A 3G4SP 3CCQP 2ITAA 3RK2B 1K73Q 2Q1KA 3FX0A 4QMAA 3TNUA 1G2CA 4XA4A 1S5LX 2VRSA 4LLHA 1YIJP 2E42A 1KZUB 1X22A 4GDOA 1PP9E 1K04A 3GLMA 2E75C 1KILC 1OMIA 2HPCB 1M1JB 2C0XA 3WUUA 3HD7B 1AV1A 2R44A 2J58A 1S72P 1X9VA 4HYTB 3CPWO 2O1KA 1YHQP 3H1KD 2OYIC 1YTZT 3K5BA 3IF4A 5KLIC 1IC2A 1SQBG 1SQPK 3AE6C 1UIXA 2IBZG 1HUCA 1SQPD 3KZIH 4ASVA 1EZVD 1YI2P 4AUWA 3L4FA 1EDJA 1SQBJ 2FYNC 5AVRB 1JY3P 2M5AA 3VP9A 3AE9C 3BRVB 2W6AA 4DCKA 5AW6B 3OAKA 1NTMK 1VF5D 3AEGC 3LIDA 3MTUE 4GKGA 4U3FD 1ZMEC 2R5DA 1S4XA 2O3JA 1NTMD 2FYUE 5E79H 2B87B 1A02F 4D6TE 3L75E 5B66E 1WRGA 1NKZB 1L0LE 1XTCC 4I1LA 5KLVK 2XNXA 2H89C 1NU1G 5KLVD 2QJKB 4JYCA 2CK3H 1OVRA 2OGUA 1S2EA 1PIXA 1URQD 3G71P 1W5CE 1NAYA 4IL6H 1NU1J 1X8YA 4EOTA 1U7MA 1PFIA 2IBZI 2W6JH 1KB9E 3E1RA 4BWNA 2XDJA 1K9MQ 1RH5B 1P84D 3A5TA 3RK3C 1M1JA 2WSSH 2XV5A 1H88A 3CC7P 1JCDA 3H1JE 1YJNP 3FWNA 1RF1B 3ITKA 3PP5A 4EYYQ 1AFOA 1GD2E 3QWOC 1E5WA 3GMAA 2DW3A 4RESB 2E75D 2FXPA 2WPSA 3AE8C 1FOSF 2YO2A 2IZ0A 1NU1D 3PLNA 3V2PA 2M3BA 1SFCC 2JEEA 3H1HG 4Y99B 1FE6A 1YJWP 1FZBA 2Y0EA 2BEQD 2LR2A 2B87A 3L70E 5CJ0A 4CPGA 5CHXA 3F5HA 3H1HJ 2KLUA 3ABVC 1MUUA 3V4WA 1NTZE 1ZRTE 4PJ0E 1OVVA 3V4QA 1VPCA 5APUA 5CMZA 3AE4C 1SQXK 3R2PA 5TISH 5AVYB 1QVFO 1SQXD 1AJYA 5AW2B 3H1IG 3BVHA 1JEKA 3H1LG 1HF9A 2ZYGA 1LTJB 1Q81Q 3H1IJ 4M3LA 3L74G 4WY4C 1RF1A 3H1LJ 3RK2C 3RL0C 1USEA 1FDMA 1MFZA 3L74J 1KILB 2N9BA 1PGJA 1NH4A 3PTZA 4KT0J 3D6YA 4HH2A 3KHUA 1LTSC 1QX8A 2B89A 2XZRA 1JY3N 3CWBG 2IBZE 3KDPB 1M90Q 1NAFA 1L0NE 2LKMA 1OW6A 3M9HA 4JBZA 2A06E 3PRJA 3MGNA 4HJGH 1HBWA 3EFFK 5GTHH 3P8CD 3CWBJ 3JSVC 3HD7C 1JUNA 3H25A 1BCCG 3I5CA 3V6IA 3H1ID 2YMYA 2OYOA 1N2DC 1Y8AA 3AE2C 2K9JB 3Q2YA 1LTGC 1OW8A 5CJ4A 1QVGO 1N73B 1BCCJ 2M0BA 1RE3A 2KS1B 4ZNCA 2O1JA 2NPSC 2V7QJ 1FZCB 5GTIE 1SLQA 5APQA 3L73G 4GODA 3TSIA 2K37A 4K35A 5KAIE 3B5NB 3VMXA 3L72G 1L4AC 2KXPB 3L73J 2WTYA 1N8RQ 4OWFA 1FBMA 4YTPC 4NPEA 1S3JA 1JO5A 3S1KA 5KAFE 3C1LA 3L72J 2C9LY 3A0HE 2QJPB 1EXJA 5L8RJ 1LP1B 3PJSK 1KILA 2C0WA 2AEMA 1OXZA 2QJKC 2AXTE 3U1AA 2ZT9B 3RK3B 2H43A 1BCCD 3HTKB 3I55P 1SQVE 1RQUA 2KOGA 1ZN5A 2WITA 2Q9IA 3IN6A 2YKOA 1NTKG 5AVWB 1LTIC 1R5SA 1PP9D 2Z5IA 2QM7A 2CPBA 1NKNA 3RK2D 1NTKJ 1N7SB 1JM0A 1ZW0A 2M3EA 3H1HE 4PV1B 1VQOP 2K9JA 2NZ2A 4LGDE 1AVOA 1RF1C 1SQQE 1N73A 4I2LC 4JPZB 3CX5H 1JY2O 3CCMP 2KS1A 3CCVP 3OA7A 1SFCB 3AEEC 2ZYAA 1CSBA 1FZCA 1LTTC 1RE4C 2IFMA 2SPZA 3MD0A 1P84H 3O6QB 2FYZA 3PH0A 3B5NA 1Z56A 2AEJA 1FZGA 3IR9A 1NHLA 3AE5C 3HD7D 1TU3F 5APXA 4DZOA 3TGUG 5EFWB 4Y99C 2K9YA 2KB7P 1NWQA 1AQ5A 3H6PA 1J1EC 3H1LE 3TGUJ 1LP1A 3BRTB 1LGHB 5BU8B 4WBAA 3L74E 4D6TD 3S4RA 3GF7A 1CI6B 1QL2A 2G8YA 2BEZF 3HTKA 4RJTA 1RE3C 3H1KG 2ZJSE 4U7JA 3AEBC 3I56P 1KYOE 4ASWA 1L4AD 2MKVA 2BCCD 3IAOA 4WY4B 3GW6A 1SQPG 4IFMA 3MUDC 2KZIA 1EZVG 3H1KJ 5KJ7A 3RL0B 4R4MA 3IFMA 1KB9D 4LC1A 1N7SA 2OQQA 1CZQA 1LTJC 3A3YB 1SQPJ 4U3FG 2HYNA 4RKUJ 1ZXGA 1NTMG 1YITP 3M0AA 4NPFX 4L75A 1IFJA 4PD4H 3H1JD 5AVTB 3TGUD 2D2CC 3L71E 2JO1A 4U3FJ 1SFCA 4OVNF 5K5GB 1NTMJ 1QGKB
chains in the Genus database with same CATH topology
4KHXA 2WPQA 2FFDA 2P67A 1FU1A 1RF1B 5AW4B 1IFIA 1HWTC 3PP5A 3VMYA 1KQLA 1AFOA 2HLOA 1GD2E 1GK4A 4JF7A 2Q5UA 5AW7B 1G2CB 2WSCH 1E5WA 1IFMA 3CI9A 4RESB 1CW5A 2WPSA 1FOSF 1DX7A 2OYIB 1JTHB 3M0DA 2E43A 2YO2A 2R3CA 1M1JC 4C7NB 1WT6A 2PP6A 2YKPA 2NPSB 3H32B 3V2PA 2M3BA 1SFCC 1G1IA 1GK6A 2JEEA 2YNYA 4Y99B 2FFDC 1URQA 1FZBA 3P7KA 3V2QA 2BASA 3VYIA 1CI6A 1NTZK 3HE4A 2FYUK 5CJ0A 1YYCA 1N73C 1HVVA 5CHXA 2I1JA 1L4AB 2GUVA 5AVVB 1IJDB 2IFNA 1FZAA 1HH0A 2POHA 1MUUA 1M7LA 1T2KC 3V4WA 1FZCC 5AW0B 2NPSD 2WSEH 3V2NA 1L0LK 3L37A 4WY4A 5KTBA 3V4QA 1VPCA 5APUA 5CMZA 3B5NC 1GW4A 3V2RA 1SQXK 3R2PA 2A45G 3EFGA 1FJKA 5AW8B 2QM8A 3LIEA 5AVYB 1MV8A 5CCGD 2ZFCA 3TYYA 1JY2N 1LT9B 5AVUB 4IFDK 4AQRD 5AW2B 1URQC 2W6BA 3B8EB 4C46A 4OH8B 3GHGB 1LWUB 3BVHA 1IFNA 1MZ9A 1IO4A 1J2JB 1IFDA 3KQGA 4B86A 2M8RA 2WPRA 2Z4EA 5AVQB 3HUSB 2GUSA 1LTJB 1RF0A 1JOCA 3II6A 4M3LA 4N3YB 1VDFA 3NTNA 4WY4C 2KP8A 1GTWA 4C7RA 1RF1A 2HPCA 3RK2C 3TK1A 3RL0C 3E1IA 3U1CA 3HD7A 1FDMA 5BVZA 1T3UA 1GL2B 1MFZA 3M9QA 1H89A 1KILB 2N9BA 1N86A 1NH4A 4GIFA 1SVFA 5CCHD 5BU5A 4HH2A 1LTSC 2OYIA 1JTHA 2HODB 1L0NK 3VTPC 2OYHC 5KJ7C 3HE5B 4C7NA 2XZRA 4XE5B 1GU4A 4JYBA 1JY3N 2A45I 3EQ2A 1RY3A 2NPSA 3TNUB 2Z5HA 3H32A 1N7SC 3L35A 3KDPB 1NAFA 1GL2D 2LKMA 2P1JA 2WSFH 3M9HA 2R32A 3MIWA 3MGNA 1KILD 3BATA 2N1TC 1HBWA 3VMZA 1X79B 3P8CD 1H8AA 5CCGA 4O9BA 5APYA 1J1DC 3HD7C 3BASA 1L4AA 5AW5B 1JUNA 3P8CE 3I5CA 1NOHA 1YTZI 2YMYA 4IFFA 2R5BA 1HTLC 1N2DC 2WT7B 1XTGB 3M06A 1LTGC 5CJ4A 1LTAC 2IPPA 1N73B 1J1EB 2JJLA 2IX7C 1ZR2A 1RE3A 3G3ZA 3N7NA 2Q3IA 2O1JA 2NPSC 1FZCB 2GM4A 1LT9A 1SLQA 5APQA 3HRNA 3A2AA 2KLVA 3TSIA 1FAVA 1A02J 3CL3D 3KPEA 3GHGA 1LWUA 1NTKK 3B5NB 3VMXA 3M0DC 2OARA 5APWA 2L5GB 2WWWA 1DEBA 1L4AC 2YO3A 3HUSA 2H8PD 4N6JA 5CCHA 2WTYA 1FBMA 1T2KD 3SWFA 1JO5A 2Q7CA 1FOSE 2C9LY 1HGZA 5APTA 4EIJA 1JMMA 3B5ND 5AVZB 3M91A 1FZEA 1GL2A 2KSJA 3P32A 5AVXB 2PAJA 1SQVK 1KILA 2C0WA 2W27A 1N7LA 5APSA 1OXZA 4GT1A 4N78D 3LW5H 3U1AA 1QL1A 3O8ZA 3RK3B 3RK2B 2HODA 2H43A 2H7HA 3HE5A 3HTKB 4N78E 4W7YA 4ZKUA 2KOGA 1ZN5A 2WITA 2Q9IA 3TNUA 3U59A 5CCHC 1G2CA 1RE4A 2YKOA 4XA4A 2VRSA 5AVWB 1LTIC 1FZFA 4LLHA 1SQBK 4I6MC 3P8MC 2E42A 2Z5IA 3NFQA 2XU6A 2OYHB 1KZUB 2QM7A 1GW3A 2CPBA 1NKNA 3RK3D 1JY2P 3RK2D 1N7SB 1GL2C 5AW1B 1SP4A 1RF0C 1KFNA 1KILC 2I1KA 2WT7A 2N1TB 4W80A 2HPCB 4LGDE 1RF1C 1M1JB 2C0XA 3M9BA 1N73A 1J1DB 4I2LC 3HD7B 1JY2O 5KJ7D 1T3JA 3OA7A 3VP8A 1SFCB 3UIAA 3L36A 2ZXEB 2J58A 1CSBA 1FZCA 1LTTC 1RE4C 2IFMA 1X9VA 4HYTB 1N7SD 2FFDB 3MD0A 2O1KA 2FYZA 1NU1K 1ZR4A 2OYIC 1YTZT 3B5NA 2N1TD 1Z56A 1IC2A 1FZGA 1SQPK 1FJPA 5APVA 3IR9A 1NHLA 3HD7D 5AW3B 1HUCA 5APXA 4DZOA 1ZLLA 1HGVA 1SFCD 4Y99C 2P7JA 2YKQA 2O01H 4AUWA 2KB7P 3L4FA 3V5BA 3MUDA 1GU5A 1NWQA 1AQ5A 3VOPA 3H6PA 5AVRB 1JY3P 3VP9A 3BRVB 2W6AA 5CCGC 2C9NY 1J1EC 3OAKA 1KFMA 5AW6B 1NTMK 3LIDA 1GDTA 3MTUE 4GKGA 3N4XA 2R5DA 1DH3A 4WB4A 2FKWB 1LTJA 3BRTB 4W7ZA 1URQB 4AYCA 2A45H 2CPSA 1LGHB 5BU8B 4WBAA 1CI6B 1A02F 1QL2A 3HE4B 1JY3O 3NXSA 3OJAB 3HTKA 1NO4A 1WRGA 1RE3C 1NKZB 3C9IA 1LTBC 1S9KD 1XTCC 4I1LA 5KLVK 2KYVA 3SWYA 1JNMA 2XNXA 1L4AD 1JCCA 2MJZA 5AVSB 1LT9C 1S9KE 4WY4B 4JYCA 2XKMA 4IFMA 1URQD 3GHGC 1LWUC 2OYHA 3NMDA 5KJ7A 2HFED 3RL0B 1W2EA 1ZV8A 3IFMA 3KYQA 1X8YA 3T97A 4LC1A 4EOTA 4ZKPA 1N7SA 1CZQA 3HUSC 1PFIA 1T8ZA 1LTJC 3A3YB 3A7OA 1GZLA 2XDJA 5AW9B 2HYNA 2N1TA 2J59M 3M0AA 1EQ7A 3A5TA 4WY4D 1M1JA 2HG5D 2XV5A 3RK3C 1H88A 1IFJA 1G1JA 2FXMA 2P2UA 5AVTB 3RL0D 4DOJA 1OWAA 1HJBA 3WMM0 1SQQK 1SFCA 1JCDA 3CLQA 1IK9A 3VN0A 2WZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA7 A;  1NOH A;  3MTU E;  1NO4 A;  4IFF A; 
#chains in the Genus database with same CATH topology
 4KHX A;  2YIU C;  2IYP A;  3O6Q A;  5KLV G;  1IFI A;  2QRX A;  3QH9 A;  3D70 A;  4UB6 E;  1BSN A;  2GA1 A;  1PPJ E;  1Y9B A;  2HLO A;  4JF7 A;  5AW7 B;  1SS1 A;  2AXC A;  1IFM A;  1CW5 A;  3MZW B;  3L73 E;  5KLV J;  1DX7 A;  1M56 D;  4Y28 J;  3D6Z A;  2RMZ A;  1EZV I;  3CXH E;  1VQL P;  2WMM A;  3L72 E;  2NPS B;  1G1I A;  2IYO A;  1NVO A;  3Q5S A;  3L70 D;  2FFD C;  5TIS E;  1JMB A;  3Q1M A;  3VYI A;  1CI6 A;  1NTZ K;  3SFD C;  3Q5R A;  1YYC A;  1N73 C;  2I1J A;  1NTZ D;  1L4A B;  2K3R A;  1YQ4 C;  1EC5 A;  2PGD A;  2POH A;  1FZC C;  5B5E H;  4WY4 A;  5KTB A;  3JCU H;  3B5N C;  1GW4 A;  2P58 A;  3LIE A;  2KI7 B;  4IFD K;  1NTK E;  1R5L A;  2W6B A;  1PZQ A;  4C46 A;  3CX5 I;  1LWU B;  1MZ9 A;  3WUT A;  2QJP C;  2WPR A;  1VQK P;  5AVQ B;  1P84 I;  3TDK A;  3HUS B;  2FBW C;  1YJ9 P;  3CX5 D;  1RF0 A;  1JOC A;  3MHV A;  3NTN A;  1DD3 A;  4C7R A;  2HPC A;  2ZT9 C;  2HR3 A;  2Y9Y A;  3HD7 A;  5BVZ A;  3RBZ A;  1H89 A;  1N86 A;  1VQ5 P;  4GIF A;  3AE1 C;  5BU5 A;  1SQX G;  1VQN P;  1KC8 Q;  2LXB A;  1JB0 J;  1L0N K;  3VTP C;  5KJ7 C;  3HE5 B;  1BE3 E;  2E5Y A;  4XE5 B;  1L0N D;  2NPS A;  2Z5H A;  4DJG A;  4H13 C;  1N7S C;  2A06 D;  1SQX J;  1NGM B;  2P1J A;  4PV1 C;  2WSF H;  3E7K A;  1KIL D;  3BAT A;  1DEE G;  3A0B E;  1H8A A;  4O9B A;  1L4A A;  5AW5 B;  1NOH A;  4IFF A;  2WT7 B;  1XTG B;  3GF3 A;  4NPD A;  2IPP A;  1J1E B;  2JJL A;  2IX7 C;  3N7N A;  3G3Z A;  2Q3I A;  1OVU A;  3HRN A;  4HKZ H;  1A02 J;  3CL3 D;  1LWU A;  1EZV E;  3CC4 P;  2OAR A;  4L74 A;  5APW A;  1M57 D;  2L5G B;  1DEB A;  4PD4 D;  3HUS A;  2H8P D;  4BRY B;  3AE3 C;  2OTJ P;  1W2B O;  4IOI H;  2E74 C;  5H2F E;  1M1K Q;  3SWF A;  2Q7C A;  2P10 A;  2I8D A;  2B88 A;  1BGY G;  5APT A;  2QE7 H;  4GOF A;  3B5N D;  3W67 A;  5AVZ B;  1FZE A;  2WVR A;  2KSJ A;  3P32 A;  5AVX B;  1MFT A;  1SQV K;  2PAJ A;  3Q5P A;  1N7L A;  1BGY J;  2ZXX A;  3LW5 H;  1SQV D;  3O8Z A;  2H7H A;  3HE5 A;  4N78 E;  4W7Y A;  4ZKU A;  2D2C B;  2ZAE B;  2AEF A;  3U59 A;  5CCH C;  1RE4 A;  2YIU B;  5CBO A;  5B66 H;  3PHL A;  2XU6 A;  2OYH B;  3SFE C;  4BXL A;  1KV4 A;  2WQY C;  2ZT9 D;  4WVZ A;  3RK3 D;  3T97 B;  1JY2 P;  1SQB E;  4OGQ C;  1GL2 C;  3WU2 E;  5AW1 B;  4UB8 E;  1RF0 C;  1KFN A;  3RL0 g;  1PL5 A;  2WT7 A;  2N1T B;  5KKZ B;  3CCL P;  1PGP A;  1KB9 H;  3M9B A;  1J1D B;  2Y0D A;  5KJ7 D;  4YXW H;  4TLF A;  2ZXE B;  2H88 C;  1N7S D;  2FFD B;  1L2P A;  1RHZ B;  2N9Y B;  5M1B A;  4EI2 A;  1VQ7 P;  1BGY D;  4PV1 D;  1OZH A;  2WSF J;  1PP9 G;  1FJP A;  5APV A;  3BCC D;  2RH0 A;  5AW3 B;  2E76 B;  4L73 A;  4BRY A;  1NU1 E;  1IK7 A;  1ZLL A;  1HGV A;  2K88 A;  1SFC D;  5C39 A;  2YKQ A;  2O01 H;  1OIP A;  1PP9 J;  3MUD A;  2C9N Y;  1GDT A;  3G6E P;  3N4X A;  1DH3 A;  2K1A A;  4WB4 A;  1KQS O;  3FXD A;  2FKW B;  1LTJ A;  4W7Z A;  4AYC A;  1MKM A;  1IZN B;  1AQT A;  3RBX A;  2JKV A;  1LTB C;  2QEX P;  1JCC A;  2XND H;  1S9K E;  2XKM A;  1LWU C;  2OYH A;  1W2E A;  1VL2 A;  4PJ0 H;  2LXC B;  3T97 A;  1X0T A;  4ZKP A;  3AEF C;  3HUS C;  3A7O A;  2N1T A;  2J59 M;  2JWA A;  4WY4 D;  1RQV A;  3LW5 J;  4D6T G;  1G1J A;  2FXM A;  2P2U A;  3RL0 D;  2QG4 A;  4DOJ A;  4H13 B;  3WMM 0;  3VN0 A;  2WPQ A;  1KQF B;  2FFD A;  1KTM A;  1U7J A;  1FU1 A;  4D6T J;  1BDD A;  2BCC G;  1VQ4 P;  3KZI E;  1KD1 Q;  1HWT C;  1GK4 A;  2Q5U A;  1G2C B;  2WSC H;  2BCC J;  2PFX A;  4KJM A;  1OX3 A;  1JTH B;  2R3C A;  1IFP A;  1D7M A;  5E79 E;  2PP6 A;  2YKP A;  1Q86 Q;  1R8E A;  3H1J G;  3USS A;  3MP7 B;  2J5U A;  2YXQ B;  2Q6Q A;  3H1I E;  3P7K A;  1UII A;  3V2Q A;  2FYU K;  3CCJ P;  4TT3 H;  1HVV A;  2W90 A;  3H1J J;  1BDC A;  2FYU D;  1IJD B;  2IFN A;  1FZA A;  1T2K C;  1M7L A;  3B4S A;  4IL6 E;  5AW0 B;  2NPS D;  2E74 B;  1L0L K;  3L37 A;  3CD6 P;  3D71 A;  2W83 C;  3L75 D;  3F89 A;  1L0L D;  3V2R A;  1FDI A;  3EFG A;  1YQ3 C;  2KSE A;  2QM8 A;  3EWK A;  1JY2 N;  1LT9 B;  5AVU B;  4AQR D;  1KB9 I;  1URQ C;  5DJT B;  4OH8 B;  3GHG B;  3L70 G;  5GTI H;  1J2J B;  2M8R A;  1U57 A;  3CWB E;  2GUS A;  5KAI H;  1NTZ G;  4L76 A;  3L70 J;  4YPC A;  2KP8 A;  1OW7 A;  4IL6 X;  1LT1 A;  2NRG A;  4OGQ B;  1NTZ J;  1T3U A;  4MN4 C;  1GL2 B;  4WWI A;  1M8O B;  2YMK A;  1BCC E;  5KAF H;  1PGQ A;  3A0H H;  3AEC C;  1BE3 D;  2L91 A;  4H44 B;  1JTH A;  2HOD B;  2OYH C;  1GU4 A;  4JYB A;  2AXT H;  2KUB A;  4XFJ A;  1USD A;  3L35 A;  1FS0 E;  2R32 A;  2N1T C;  5KKZ C;  1VQP P;  1X79 B;  2IDB A;  3CCS P;  5CCG A;  5APY A;  1J1D C;  3BAS A;  2O01 N;  1EDK A;  1WMK A;  1YTZ I;  3WUV A;  2WSC J;  1Q82 Q;  2G3A A;  1ZRT D;  2GM4 A;  1LT9 A;  2E76 C;  1L0N G;  1NJI Q;  2Y9Z A;  2A06 G;  2OTK E;  3GHG A;  4YXD C;  2FY8 A;  2JR8 A;  4H0L B;  1L0N J;  2YO3 A;  1K05 A;  5CCH A;  1PV3 A;  1T2K D;  3CME P;  1LNQ A;  4EIJ A;  1JMM A;  3AEA C;  1GL2 A;  2W8Z A;  1S5L H;  3VMA A;  3ZDM A;  2W27 A;  5APS A;  4GT1 A;  4I7Z B;  4N78 D;  1KQG B;  1QL1 A;  2BCC E;  2HOD A;  2KZJ A;  5GTH E;  1FZF A;  1SQB K;  4I6M C;  3P8M C;  3NFQ A;  1KOR A;  1SQB D;  3SWK A;  1KYO H;  1GW3 A;  2IBZ D;  2PRR A;  1SP4 A;  2D2C D;  3TGU E;  3B71 A;  2I1K A;  4W80 A;  1Y47 A;  3G9R A;  1VQ9 P;  4A7P A;  1SQV G;  1T3J A;  4GOE A;  3CCE P;  3VP8 A;  3UIA A;  3L36 A;  1GMJ A;  1NU1 K;  1ZR4 A;  1SQV J;  1VF5 B;  2N1T D;  2V7Q H;  3H1K E;  2OTL P;  4UB6 H;  4PD4 I;  2P7J A;  2ZYD A;  1SQP E;  3V5B A;  1GU5 A;  1E79 H;  1SQQ G;  3VOP A;  1NYH A;  5CCG C;  1KFM A;  1H0T B;  1EDL A;  2WPV B;  4U3F E;  1URQ B;  2FXO A;  3CXH H;  4JQ0 D;  2A45 H;  1SQQ J;  2CPS A;  2E76 D;  1FC2 C;  1NTM E;  3HE4 B;  1JY3 O;  3NXS A;  3C8V A;  3OJA B;  1NO4 A;  2Q3E A;  3C9I A;  2QJY C;  2B9B A;  1S9K D;  2KYV A;  1JNM A;  3SWY A;  4ZMD A;  2QSI A;  1Q7Y Q;  2MJZ A;  5AVS B;  1LT9 C;  3BCC G;  2QA4 P;  3GHG C;  3NMD A;  2HFE D;  5KLV E;  1KN7 A;  1ZV8 A;  3CCR P;  3KYQ A;  3BCC J;  3TF5 A;  3AED C;  1T8Z A;  3R4Y A;  1GZL A;  3CX5 E;  5AW9 B;  3FWL A;  3CC2 P;  4Z1M H;  1EQ7 A;  2YXR B;  2HG5 D;  1LJ2 A;  1P84 E;  1VQM P;  3H1H D;  1DIP A;  1OWA A;  1HJB A;  2E75 B;  1SQQ K;  3CLQ A;  1IK9 A;  2WZ7 A;  2Y0C A;  1SQQ D;  2P67 A;  3FXE A;  5AW4 B;  4H44 C;  3VMY A;  1KQL A;  2QIW A;  3CI9 A;  2ZVN B;  4H13 D;  4R4L A;  2OYI B;  3M0D A;  5KLI B;  1OFC X;  2E43 A;  1M1J C;  4C7N B;  1KIL E;  1WT6 A;  3AE7 C;  3L71 G;  1H0T A;  3H32 B;  3JC2 2;  1GK6 A;  1S1C X;  2YNY A;  5CBN A;  1URQ A;  2BAS A;  3H1L D;  2FYN B;  3HE4 A;  5DJU B;  3L71 J;  1PPJ G;  1DD4 A;  2GUV A;  5AVV B;  1HH0 A;  3A0B H;  3L74 D;  3W68 A;  1KYO I;  3CCU P;  2WSE H;  3V2N A;  1KYO D;  3S9O A;  2A45 G;  5AW8 B;  1FJK A;  2JDI H;  4H0L C;  1MV8 A;  5CCG D;  2ZFC A;  3TYY A;  4PD4 E;  3B8E B;  1SQX E;  2E74 D;  2RN0 A;  1IFN A;  3CWB D;  1IO4 A;  1IFD A;  3KQG A;  4B86 A;  2Z4E A;  1T6A A;  2KNC B;  2FYU G;  3II6 A;  4N3Y B;  1VDF A;  1BSH A;  4I7Z C;  1GTW A;  3L71 D;  1KMI Z;  1PGO A;  3TK1 A;  3E1I A;  3L75 G;  2UWJ E;  3U1C A;  5H2F H;  2FYU J;  1L0L G;  4K3A A;  2JP3 A;  1K8A Q;  3M9Q A;  1Q2N A;  1SVF A;  5CCH D;  1AVY A;  3L75 J;  4HB1 A;  2OYI A;  1PPJ D;  1ZP0 C;  1L0L J;  4C7N A;  3CXH I;  1QEX A;  2A45 I;  3EQ2 A;  1RY3 A;  3TNU B;  3H32 A;  3L73 D;  1FDO A;  4OGQ D;  3RK3 E;  1GL2 D;  3MIW A;  1AA0 A;  3CXH D;  3VMZ A;  1YBK A;  3L72 D;  2QVA A;  5B5E E;  1VQ6 P;  3CMA P;  4H44 D;  1QLE D;  3P8C E;  2JWD A;  3JCU E;  2R5B A;  1EXI A;  1HTL C;  3M06 A;  3WU2 H;  3Q3D A;  1VQ8 P;  1LTA C;  4UB8 H;  1VF5 C;  2ZVO B;  1BE3 G;  1BGY E;  1ZR2 A;  3OW2 O;  3FGA D;  5TJH A;  1EDI A;  3SSU A;  3BCC E;  3RGU A;  3A2A A;  2KLV A;  1FAV A;  1BE3 J;  2KK7 A;  3KPE A;  1NTK K;  2O01 J;  1S5L E;  3M0D C;  2R3S A;  1NTK D;  2QJY B;  2WWW A;  2KIK A;  4N6J A;  2KNC A;  1ZOY C;  1HJ0 A;  3KXD A;  2WSE J;  2M5A B;  1FOS E;  1HGZ A;  4RO0 A;  3M91 A;  4EDF A;  1Q90 D;  4H0L D;  2E5T A;  2IZ1 A;  2RKL A;  2V4H A;  4DT0 A;  3GG2 A;  3G4S P;  3CCQ P;  2ITA A;  3RK2 B;  1K73 Q;  2Q1K A;  3FX0 A;  4QMA A;  3TNU A;  1G2C A;  4XA4 A;  1S5L X;  2VRS A;  4LLH A;  1YIJ P;  2E42 A;  1KZU B;  1X22 A;  4GDO A;  1PP9 E;  1K04 A;  3GLM A;  2E75 C;  1KIL C;  1OMI A;  2HPC B;  1M1J B;  2C0X A;  3WUU A;  3HD7 B;  1AV1 A;  2R44 A;  2J58 A;  1S72 P;  1X9V A;  4HYT B;  3CPW O;  2O1K A;  1YHQ P;  3H1K D;  2OYI C;  1YTZ T;  3K5B A;  3IF4 A;  5KLI C;  1IC2 A;  1SQB G;  1SQP K;  3AE6 C;  1UIX A;  2IBZ G;  1HUC A;  1SQP D;  3KZI H;  4ASV A;  1EZV D;  1YI2 P;  4AUW A;  3L4F A;  1EDJ A;  1SQB J;  2FYN C;  5AVR B;  1JY3 P;  2M5A A;  3VP9 A;  3AE9 C;  3BRV B;  2W6A A;  4DCK A;  5AW6 B;  3OAK A;  1NTM K;  1VF5 D;  3AEG C;  3LID A;  3MTU E;  4GKG A;  4U3F D;  1ZME C;  2R5D A;  1S4X A;  2O3J A;  1NTM D;  2FYU E;  5E79 H;  2B87 B;  1A02 F;  4D6T E;  3L75 E;  5B66 E;  1WRG A;  1NKZ B;  1L0L E;  1XTC C;  4I1L A;  5KLV K;  2XNX A;  2H89 C;  1NU1 G;  5KLV D;  2QJK B;  4JYC A;  2CK3 H;  1OVR A;  2OGU A;  1S2E A;  1PIX A;  1URQ D;  3G71 P;  1W5C E;  1NAY A;  4IL6 H;  1NU1 J;  1X8Y A;  4EOT A;  1U7M A;  1PFI A;  2IBZ I;  2W6J H;  1KB9 E;  3E1R A;  4BWN A;  2XDJ A;  1K9M Q;  1RH5 B;  1P84 D;  3A5T A;  3RK3 C;  1M1J A;  2WSS H;  2XV5 A;  1H88 A;  3CC7 P;  1JCD A;  3H1J E;  1YJN P;  3FWN A;  1RF1 B;  3ITK A;  3PP5 A;  4EYY Q;  1AFO A;  1GD2 E;  3QWO C;  1E5W A;  3GMA A;  2DW3 A;  4RES B;  2E75 D;  2FXP A;  2WPS A;  3AE8 C;  1FOS F;  2YO2 A;  2IZ0 A;  1NU1 D;  3PLN A;  3V2P A;  2M3B A;  1SFC C;  2JEE A;  3H1H G;  4Y99 B;  1FE6 A;  1YJW P;  1FZB A;  2Y0E A;  2BEQ D;  2LR2 A;  2B87 A;  3L70 E;  5CJ0 A;  4CPG A;  5CHX A;  3F5H A;  3H1H J;  2KLU A;  3ABV C;  1MUU A;  3V4W A;  1NTZ E;  1ZRT E;  4PJ0 E;  1OVV A;  3V4Q A;  1VPC A;  5APU A;  5CMZ A;  3AE4 C;  1SQX K;  3R2P A;  5TIS H;  5AVY B;  1QVF O;  1SQX D;  1AJY A;  5AW2 B;  3H1I G;  3BVH A;  1JEK A;  3H1L G;  1HF9 A;  2ZYG A;  1LTJ B;  1Q81 Q;  3H1I J;  4M3L A;  3L74 G;  4WY4 C;  1RF1 A;  3H1L J;  3RK2 C;  3RL0 C;  1USE A;  1FDM A;  1MFZ A;  3L74 J;  1KIL B;  2N9B A;  1PGJ A;  1NH4 A;  3PTZ A;  4KT0 J;  3D6Y A;  4HH2 A;  3KHU A;  1LTS C;  1QX8 A;  2B89 A;  2XZR A;  1JY3 N;  3CWB G;  2IBZ E;  3KDP B;  1M90 Q;  1NAF A;  1L0N E;  2LKM A;  1OW6 A;  3M9H A;  4JBZ A;  2A06 E;  3PRJ A;  3MGN A;  4HJG H;  1HBW A;  3EFF K;  5GTH H;  3P8C D;  3CWB J;  3JSV C;  3HD7 C;  1JUN A;  3H25 A;  1BCC G;  3I5C A;  3V6I A;  3H1I D;  2YMY A;  2OYO A;  1N2D C;  1Y8A A;  3AE2 C;  2K9J B;  3Q2Y A;  1LTG C;  1OW8 A;  5CJ4 A;  1QVG O;  1N73 B;  1BCC J;  2M0B A;  1RE3 A;  2KS1 B;  4ZNC A;  2O1J A;  2NPS C;  2V7Q J;  1FZC B;  5GTI E;  1SLQ A;  5APQ A;  3L73 G;  4GOD A;  3TSI A;  2K37 A;  4K35 A;  5KAI E;  3B5N B;  3VMX A;  3L72 G;  1L4A C;  2KXP B;  3L73 J;  2WTY A;  1N8R Q;  4OWF A;  1FBM A;  4YTP C;  4NPE A;  1S3J A;  1JO5 A;  3S1K A;  5KAF E;  3C1L A;  3L72 J;  2C9L Y;  3A0H E;  2QJP B;  1EXJ A;  5L8R J;  1LP1 B;  3PJS K;  1KIL A;  2C0W A;  2AEM A;  1OXZ A;  2QJK C;  2AXT E;  3U1A A;  2ZT9 B;  3RK3 B;  2H43 A;  1BCC D;  3HTK B;  3I55 P;  1SQV E;  1RQU A;  2KOG A;  1ZN5 A;  2WIT A;  2Q9I A;  3IN6 A;  2YKO A;  1NTK G;  5AVW B;  1LTI C;  1R5S A;  1PP9 D;  2Z5I A;  2QM7 A;  2CPB A;  1NKN A;  3RK2 D;  1NTK J;  1N7S B;  1JM0 A;  1ZW0 A;  2M3E A;  3H1H E;  4PV1 B;  1VQO P;  2K9J A;  2NZ2 A;  4LGD E;  1AVO A;  1RF1 C;  1SQQ E;  1N73 A;  4I2L C;  4JPZ B;  3CX5 H;  1JY2 O;  3CCM P;  2KS1 A;  3CCV P;  3OA7 A;  1SFC B;  3AEE C;  2ZYA A;  1CSB A;  1FZC A;  1LTT C;  1RE4 C;  2IFM A;  2SPZ A;  3MD0 A;  1P84 H;  3O6Q B;  2FYZ A;  3PH0 A;  3B5N A;  1Z56 A;  2AEJ A;  1FZG A;  3IR9 A;  1NHL A;  3AE5 C;  3HD7 D;  1TU3 F;  5APX A;  4DZO A;  3TGU G;  5EFW B;  4Y99 C;  2K9Y A;  2KB7 P;  1NWQ A;  1AQ5 A;  3H6P A;  1J1E C;  3H1L E;  3TGU J;  1LP1 A;  3BRT B;  1LGH B;  5BU8 B;  4WBA A;  3L74 E;  4D6T D;  3S4R A;  3GF7 A;  1CI6 B;  1QL2 A;  2G8Y A;  2BEZ F;  3HTK A;  4RJT A;  1RE3 C;  3H1K G;  2ZJS E;  4U7J A;  3AEB C;  3I56 P;  1KYO E;  4ASW A;  1L4A D;  2MKV A;  2BCC D;  3IAO A;  4WY4 B;  3GW6 A;  1SQP G;  4IFM A;  3MUD C;  2KZI A;  1EZV G;  3H1K J;  5KJ7 A;  3RL0 B;  4R4M A;  3IFM A;  1KB9 D;  4LC1 A;  1N7S A;  2OQQ A;  1CZQ A;  1LTJ C;  3A3Y B;  1SQP J;  4U3F G;  2HYN A;  4RKU J;  1ZXG A;  1NTM G;  1YIT P;  3M0A A;  4NPF X;  4L75 A;  1IFJ A;  4PD4 H;  3H1J D;  5AVT B;  3TGU D;  2D2C C;  3L71 E;  2JO1 A;  4U3F J;  1SFC A;  4OVN F;  5K5G B;  1NTM J;  1QGK B; 
#chains in the Genus database with same CATH homology
 4KHX A;  2WPQ A;  2FFD A;  2P67 A;  1FU1 A;  1RF1 B;  5AW4 B;  1IFI A;  1HWT C;  3PP5 A;  3VMY A;  1KQL A;  1AFO A;  2HLO A;  1GD2 E;  1GK4 A;  4JF7 A;  2Q5U A;  5AW7 B;  1G2C B;  2WSC H;  1E5W A;  1IFM A;  3CI9 A;  4RES B;  1CW5 A;  2WPS A;  1FOS F;  1DX7 A;  2OYI B;  1JTH B;  3M0D A;  2E43 A;  2YO2 A;  2R3C A;  1M1J C;  4C7N B;  1WT6 A;  2PP6 A;  2YKP A;  2NPS B;  3H32 B;  3V2P A;  2M3B A;  1SFC C;  1G1I A;  1GK6 A;  2JEE A;  2YNY A;  4Y99 B;  2FFD C;  1URQ A;  1FZB A;  3P7K A;  3V2Q A;  2BAS A;  3VYI A;  1CI6 A;  1NTZ K;  3HE4 A;  2FYU K;  5CJ0 A;  1YYC A;  1N73 C;  1HVV A;  5CHX A;  2I1J A;  1L4A B;  2GUV A;  5AVV B;  1IJD B;  2IFN A;  1FZA A;  1HH0 A;  2POH A;  1MUU A;  1M7L A;  1T2K C;  3V4W A;  1FZC C;  5AW0 B;  2NPS D;  2WSE H;  3V2N A;  1L0L K;  3L37 A;  4WY4 A;  5KTB A;  3V4Q A;  1VPC A;  5APU A;  5CMZ A;  3B5N C;  1GW4 A;  3V2R A;  1SQX K;  3R2P A;  2A45 G;  3EFG A;  1FJK A;  5AW8 B;  2QM8 A;  3LIE A;  5AVY B;  1MV8 A;  5CCG D;  2ZFC A;  3TYY A;  1JY2 N;  1LT9 B;  5AVU B;  4IFD K;  4AQR D;  5AW2 B;  1URQ C;  2W6B A;  3B8E B;  4C46 A;  4OH8 B;  3GHG B;  1LWU B;  3BVH A;  1IFN A;  1MZ9 A;  1IO4 A;  1J2J B;  1IFD A;  3KQG A;  4B86 A;  2M8R A;  2WPR A;  2Z4E A;  5AVQ B;  3HUS B;  2GUS A;  1LTJ B;  1RF0 A;  1JOC A;  3II6 A;  4M3L A;  4N3Y B;  1VDF A;  3NTN A;  4WY4 C;  2KP8 A;  1GTW A;  4C7R A;  1RF1 A;  2HPC A;  3RK2 C;  3TK1 A;  3RL0 C;  3E1I A;  3U1C A;  3HD7 A;  1FDM A;  5BVZ A;  1T3U A;  1GL2 B;  1MFZ A;  3M9Q A;  1H89 A;  1KIL B;  2N9B A;  1N86 A;  1NH4 A;  4GIF A;  1SVF A;  5CCH D;  5BU5 A;  4HH2 A;  1LTS C;  2OYI A;  1JTH A;  2HOD B;  1L0N K;  3VTP C;  2OYH C;  5KJ7 C;  3HE5 B;  4C7N A;  2XZR A;  4XE5 B;  1GU4 A;  4JYB A;  1JY3 N;  2A45 I;  3EQ2 A;  1RY3 A;  2NPS A;  3TNU B;  2Z5H A;  3H32 A;  1N7S C;  3L35 A;  3KDP B;  1NAF A;  1GL2 D;  2LKM A;  2P1J A;  2WSF H;  3M9H A;  2R32 A;  3MIW A;  3MGN A;  1KIL D;  3BAT A;  2N1T C;  1HBW A;  3VMZ A;  1X79 B;  3P8C D;  1H8A A;  5CCG A;  4O9B A;  5APY A;  1J1D C;  3HD7 C;  3BAS A;  1L4A A;  5AW5 B;  1JUN A;  3P8C E;  3I5C A;  1NOH A;  1YTZ I;  2YMY A;  4IFF A;  2R5B A;  1HTL C;  1N2D C;  2WT7 B;  1XTG B;  3M06 A;  1LTG C;  5CJ4 A;  1LTA C;  2IPP A;  1N73 B;  1J1E B;  2JJL A;  2IX7 C;  1ZR2 A;  1RE3 A;  3G3Z A;  3N7N A;  2Q3I A;  2O1J A;  2NPS C;  1FZC B;  2GM4 A;  1LT9 A;  1SLQ A;  5APQ A;  3HRN A;  3A2A A;  2KLV A;  3TSI A;  1FAV A;  1A02 J;  3CL3 D;  3KPE A;  3GHG A;  1LWU A;  1NTK K;  3B5N B;  3VMX A;  3M0D C;  2OAR A;  5APW A;  2L5G B;  2WWW A;  1DEB A;  1L4A C;  2YO3 A;  3HUS A;  2H8P D;  4N6J A;  5CCH A;  2WTY A;  1FBM A;  1T2K D;  3SWF A;  1JO5 A;  2Q7C A;  1FOS E;  2C9L Y;  1HGZ A;  5APT A;  4EIJ A;  1JMM A;  3B5N D;  5AVZ B;  3M91 A;  1FZE A;  1GL2 A;  2KSJ A;  3P32 A;  5AVX B;  2PAJ A;  1SQV K;  1KIL A;  2C0W A;  2W27 A;  1N7L A;  5APS A;  1OXZ A;  4GT1 A;  4N78 D;  3LW5 H;  3U1A A;  1QL1 A;  3O8Z A;  3RK3 B;  3RK2 B;  2HOD A;  2H43 A;  2H7H A;  3HE5 A;  3HTK B;  4N78 E;  4W7Y A;  4ZKU A;  2KOG A;  1ZN5 A;  2WIT A;  2Q9I A;  3TNU A;  3U59 A;  5CCH C;  1G2C A;  1RE4 A;  2YKO A;  4XA4 A;  2VRS A;  5AVW B;  1LTI C;  1FZF A;  4LLH A;  1SQB K;  4I6M C;  3P8M C;  2E42 A;  2Z5I A;  3NFQ A;  2XU6 A;  2OYH B;  1KZU B;  2QM7 A;  1GW3 A;  2CPB A;  1NKN A;  3RK3 D;  1JY2 P;  3RK2 D;  1N7S B;  1GL2 C;  5AW1 B;  1SP4 A;  1RF0 C;  1KFN A;  1KIL C;  2I1K A;  2WT7 A;  2N1T B;  4W80 A;  2HPC B;  4LGD E;  1RF1 C;  1M1J B;  2C0X A;  3M9B A;  1N73 A;  1J1D B;  4I2L C;  3HD7 B;  1JY2 O;  5KJ7 D;  1T3J A;  3OA7 A;  3VP8 A;  1SFC B;  3UIA A;  3L36 A;  2ZXE B;  2J58 A;  1CSB A;  1FZC A;  1LTT C;  1RE4 C;  2IFM A;  1X9V A;  4HYT B;  1N7S D;  2FFD B;  3MD0 A;  2O1K A;  2FYZ A;  1NU1 K;  1ZR4 A;  2OYI C;  1YTZ T;  3B5N A;  2N1T D;  1Z56 A;  1IC2 A;  1FZG A;  1SQP K;  1FJP A;  5APV A;  3IR9 A;  1NHL A;  3HD7 D;  5AW3 B;  1HUC A;  5APX A;  4DZO A;  1ZLL A;  1HGV A;  1SFC D;  4Y99 C;  2P7J A;  2YKQ A;  2O01 H;  4AUW A;  2KB7 P;  3L4F A;  3V5B A;  3MUD A;  1GU5 A;  1NWQ A;  1AQ5 A;  3VOP A;  3H6P A;  5AVR B;  1JY3 P;  3VP9 A;  3BRV B;  2W6A A;  5CCG C;  2C9N Y;  1J1E C;  3OAK A;  1KFM A;  5AW6 B;  1NTM K;  3LID A;  1GDT A;  3MTU E;  4GKG A;  3N4X A;  2R5D A;  1DH3 A;  4WB4 A;  2FKW B;  1LTJ A;  3BRT B;  4W7Z A;  1URQ B;  4AYC A;  2A45 H;  2CPS A;  1LGH B;  5BU8 B;  4WBA A;  1CI6 B;  1A02 F;  1QL2 A;  3HE4 B;  1JY3 O;  3NXS A;  3OJA B;  3HTK A;  1NO4 A;  1WRG A;  1RE3 C;  1NKZ B;  3C9I A;  1LTB C;  1S9K D;  1XTC C;  4I1L A;  5KLV K;  2KYV A;  3SWY A;  1JNM A;  2XNX A;  1L4A D;  1JCC A;  2MJZ A;  5AVS B;  1LT9 C;  1S9K E;  4WY4 B;  4JYC A;  2XKM A;  4IFM A;  1URQ D;  3GHG C;  1LWU C;  2OYH A;  3NMD A;  5KJ7 A;  2HFE D;  3RL0 B;  1W2E A;  1ZV8 A;  3IFM A;  3KYQ A;  1X8Y A;  3T97 A;  4LC1 A;  4EOT A;  4ZKP A;  1N7S A;  1CZQ A;  3HUS C;  1PFI A;  1T8Z A;  1LTJ C;  3A3Y B;  3A7O A;  1GZL A;  2XDJ A;  5AW9 B;  2HYN A;  2N1T A;  2J59 M;  3M0A A;  1EQ7 A;  3A5T A;  4WY4 D;  1M1J A;  2HG5 D;  2XV5 A;  3RK3 C;  1H88 A;  1IFJ A;  1G1J A;  2FXM A;  2P2U A;  5AVT B;  3RL0 D;  4DOJ A;  1OWA A;  1HJB A;  3WMM 0;  1SQQ K;  1SFC A;  1JCD A;  3CLQ A;  1IK9 A;  3VN0 A;  2WZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...