3MTUE

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
67
Chain Sequence
PEEHEDILNKLLDPQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
molecule keywords Tropomyosin alpha-1 chain,Microtubule-associated protein RP/
total genus 23
structure length 67
sequence length 70
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mtuE00
3OA7A 1NOHA 1NO4A 4IFFA 3MTUE
chains in the Genus database with same CATH superfamily
1HGZA 1EDIA 1R5SA 1LTAC 2POHA 2QJKB 1BGYE 2CPSA 2WSEH 2ZVOB 3L75D 3M0AA 4PV1B 5KAFH 3CPWO 2IZ0A 1FOSE 1GL2B 1SP4A 1ZMEC 4ASWA 1SQXE 2JDIH 4OH8B 5CJ4A 1NKZB 5KJ7D 2A45I 4GDOA 1W2EA 3VMZA 2QSIA 4UB6H 3VN0A 1G1IA 3F5HA 3H1HD 2WSEJ 4L75A 4OGQB 3WU2E 1KQSO 2I8DA 1RH5B 3N4XA 2XDJA 1FOSF 2LKMA 2ZJSE 5KKZC 5AVSB 3FGAD 2E74C 1HWTC 2M8RA 3HD7D 3JSVC 2AEFA 3L73G 3CWBJ 3OAKA 1EXIA 3KZIH 3RK2B 2YO3A 4K35A 1BE3D 3WUUA 3NMDA 5M1BA 4PJ0E 1HJBA 1NAFA 1L4AC 2QM8A 1PP9E 4GT1A 2OYIA 2KP8A 3MHVA 4U3FD 1ZLLA 1NTKG 1RF1B 2KB7P 2E74B 2BCCD 1IJDB 5E79H 1VDFA 1P84E 4H44C 3USSA 2M5AA 2O01N 4D6TJ 1D7MA 3PLNA 4M3LA 1NTMK 1SFCD 1X79B 3H1KD 1KFMA 3U59A 1RF1A 2R3SA 3BCCJ 2FFDA 1SFCC 1CSBA 1KILA 1OWAA 2V7QJ 3TGUG 1YHQP 3CX5I 1SQVD 3L70G 2BEZF 2OYHA 1LT9A 1L0LG 2A06D 4H13D 2W6AA 3MTUE 3U1CA 1GZLA 3IAOA 2OYHB 4DZOA 3ABVC 1LT9B 3MZWB 3NFQA 5AVRB 1JO5A 1WMKA 2V4HA 2NPSA 2R44A 4IOIH 1N7SB 1PP9J 2I1KA 2LXCB 2KXPB 2YMKA 3CL3D 3AEGC 3H1LG 4MN4C 2QVAA 4NPDA 5APWA 1BSHA 4IFDK 3KQGA 4N6JA 3GLMA 2GUVA 2Z4EA 1SQQG 2QJYC 1FBMA 5B66H 3I56P 1SQXK 3FXEA 1NO4A 5EFWB 1YITP 1IFIA 3JCUE 2OYHC 1KORA 1UIXA 1KILC 2WPSA 3SFDC 4AUWA 1VPCA 1IFNA 1NTMD 2C0WA 5GTHH 1SVFA 4H0LD 4XFJA 3V2QA 3KHUA 2OARA 3L74D 1GK6A 1PGOA 1KYOI 2K9JA 2YKOA 3O6QA 2WT7B 2KS1A 2UWJE 2FKWB 4N78E 1VQNP 1FS0E 2KI7B 5GTHE 3CC2P 1M1JA 1YQ4C 2G3AA 3FWNA 1LTIC 1PV3A 1S5LE 2O1JA 1WT6A 2R3CA 2RH0A 2G8YA 1L0LD 1VL2A 3AE5C 4JYBA 3V5BA 1YIJP 3G6EP 1PGQA 1SQQJ 1URQB 2W27A 3AE3C 1IC2A 3RBXA 2JEEA 4PD4I 4WVZA 4D6TE 5AVUB 3CCVP 2O3JA 4NPEA 3G3ZA 1OVVA 4IL6X 3HUSB 1WRGA 3SSUA 5CCHC 1ZOYC 3RK2C 3AE6C 1ZP0C 3BVHA 5TJHA 1IFJA 2KIKA 4HB1A 4O9BA 3CMAP 1K8AQ 1T6AA 3S4RA 1T2KC 1HH0A 2A06E 2Q3EA 2W90A 1VQMP 1EZVG 1LJ2A 3Q5RA 1T2KD 1KB9E 2O1KA 4IL6E 1RE3C 3HUSC 1YJNP 1BSNA 1CZQA 2Q1KA 1NTZD 3V4QA 2YO2A 3OJAB 3VP8A 2BCCE 2OTKE 3L73D 3D6YA 5CJ0A 3PH0A 2Q9IA 1OW7A 1VF5B 5APXA 1FDIA 3AEAC 1GD2E 4BRYA 1SQVG 3HE5A 3L70D 1J1DC 3RK2D 1FZCB 2J59M 2IBZE 1SQPG 3B4SA 5H2FH 2IBZI 1AQ5A 5AVZB 1DD3A 1LWUB 4XE5B 5CMZA 1KYOE 2FYUD 1URQD 3CCJP 2ZT9D 3H1ID 1BGYJ 4WY4C 5AW1B 1H88A 1DX7A 1MUUA 2JP3A 5DJTB 2P7JA 1HF9A 3L72G 1LNQA 1PL5A 1RE4A 1JTHB 3Q5SA 3ZDMA 3T97B 2QE7H 1OW8A 3RL0g 2AEMA 2QJPB 5L8RJ 3AECC 3L72J 2H8PD 4KHXA 1JTHA 1K73Q 5B66E 2SPZA 1EZVD 1MFZA 4EDFA 2Y9YA 3V6IA 4N78D 4H13B 4R4MA 1LTTC 4ZMDA 3MUDA 2PP6A 1LT9C 1RF0C 4C7NB 3GHGC 4Y99C 1NU1K 1VQ9P 1FAVA 1RQUA 2E5TA 2M3BA 1SQXG 2FXOA 1M7LA 1P84D 3E1RA 3A7OA 3WUTA 4N3YB 1JMBA 1JY3P 3L4FA 2H7HA 4U3FE 3MP7B 3S1KA 1IO4A 2KOGA 4WWIA 3II6A 5APUA 5AW5B 1S72P 2HR3A 1FZFA 2W83C 1AVYA 1IFPA 2ZXEB 3AE9C 2OYIC 1PZQA 2FYUG 2KZJA 2HG5D 3RK3E 3IF4A 3TGUD 3AE4C 1EDKA 2E75D 1Q81Q 3R4YA 2HPCB 4HJGH 3V4WA 4RKUJ 3GF7A 4PV1D 3GHGB 4OWFA 1L4AD 3PP5A 5KLVJ 2R5BA 1BCCE 2RMZA 4HKZH 4HH2A 3CXHE 3H1JD 2XNXA 3M06A 5KTBA 3CCMP 1QEXA 2YXRB 1YQ3C 2KSJA 3RL0B 1LT1A 2C9LY 2GM4A 1NU1D 1SQVE 4EYYQ 1NTZG 1LTJB 1N7SA 2QJPC 3M0DC 3KXDA 4ASVA 4GIFA 2N1TC 2FBWC 3L75E 1TU3F 4W7YA 2OTJP 1EDJA 1U7JA 5CCHD 1LTJA 5KAIE 2IYOA 1S3JA 1J2JB 1NTKJ 1SQBD 2DW3A 2QRXA 4WY4B 2AXCA 2OQQA 3E1IA 3V2RA 3KZIE 3QH9A 2P2UA 4NPFX 4AYCA 1LWUC 4ZKUA 5K5GB 1FJPA 1L0NK 2HODB 1J1DB 3CWBD 1S5LH 2E43A 2RKLA 3L73E 4ZNCA 2ZYDA 2BEQD 3H1HG 3TK1A 3VTPC 1JY3N 2PGDA 3E7KA 3CCLP 2Q7CA 1KC8Q 3RGUA 2LR2A 1E5WA 2K1AA 2D2CD 1YYCA 1GU4A 1L4AB 1YJ9P 2WSCH 4UB6E 5AW3B 1AA0A 2BCCG 4OVNF 1Y9BA 2GUSA 1SQPD 3IFMA 1KYOH 1BCCD 5BVZA 3RL0D 3G4SP 2WT7A 5CHXA 2MKVA 2BCCJ 3VMAA 2XKMA 5KAFE 2YXQB 2P1JA 4RO0A 3H1KJ 4DT0A 2Y0CA 1OIPA 3BCCD 3GW6A 2ZAEB 4CPGA 2ZT9B 1GTWA 2ZVNB 3L71G 2H89C 1SQVJ 4HYTB 1L0LK 4JYCA 5GTIH 2GA1A 2QEXP 1KZUB 3U1AA 1URQA 3NXSA 4EOTA 1M1KQ 2E42A 2IFMA 1CI6B 1LP1B 1L0ND 1Q90D 2J5UA 2JR8A 3H1LD 3L75J 4W7ZA 2JJLA 5KJ7A 4K3AA 3L36A 4L76A 3AEDC 1GL2C 3QWOC 2WSSH 1VQPP 3HE4B 1USDA 1CI6A 1KB9I 1LP1A 1QLED 3P8CD 4GOEA 3IR9A 4AQRD 1JM0A 2P58A 3AE7C 3M91A 2E75C 3OA7A 5AVYB 5CBNA 5TISH 1PPJE 4WB4A 2FXMA 3CXHH 4H0LB 3G9RA 3HD7A 1NGMB 3KYQA 1S9KE 4Z1MH 1FZCA 1NTME 1EZVE 2FXPA 2K3RA 3C1LA 3CXHI 2H43A 1QGKB 2C9NY 2WSCJ 1UIIA 1XTGB 2AXTE 2YIUC 3A0BH 1OVRA 3L71J 2XNDH 2ZYGA 2FYZA 1DEBA 1NTMJ 2ZXXA 4JBZA 1M90Q 2JO1A 2KNCB 3W67A 3CCUP 1EDLA 3CMEP 5APYA 1NWQA 3HE5B 2NRGA 1VQLP 3AE2C 2YNYA 5APTA 3LW5H 1OXZA 1N86A 2E75B 2E74D 3EWKA 5AVTB 1KILD 1FZEA 4PD4D 1FZCC 2WPQA 1FDMA 3T97A 1SQQD 3L70E 3JCUH 3O8ZA 5AVVB 1SS1A 1X22A 2AEJA 1Q2NA 1VQ6P 3PRJA 3CCEP 2K88A 4PD4H 4C7NA 2OGUA 1ZR2A 1JY2O 1Q82Q 1ZN5A 2PFXA 1SQXJ 5KJ7C 2NZ2A 1VQ5P 1JNMA 1H0TA 2D2CC 1SQBK 2HFED 4GODA 3KDPB 1FJKA 1L0NE 1PGJA 2E5YA 1FDOA 5AVQB 3VYIA 1N7SD 4TT3H 5CCGA 4I1LA 3B5NA 1EC5A 2AXTH 1NTZJ 1KFNA 3AE1C 3HTKB 2N9YB 1K05A 1FZGA 4Y28J 1NAYA 3F89A 3FXDA 3B5NB 2C0XA 2HYNA 2B9BA 4UB8E 2WVRA 3V2NA 2QIWA 1OFCX 2V7QH 3OW2O 1Q7YQ 1HBWA 1NTKE 2M5AB 1N73C 4L73A 3C8VA 1Y47A 2Y0DA 2YKQA 2W8ZA 2WZ7A 5KLVG 4BXLA 1SQPK 1SQPE 3A0HE 1JCCA 3AE8C 1EQ7A 1U7MA 1L0NG 1SQVK 4JQ0D 5KKZB 2D2CB 2FYUJ 2XV5A 5AW7B 2PRRA 1GL2D 4WBAA 3VMYA 5CCGC 1KQFB 5CBOA 2WTYA 3L35A 2HPCA 2IZ1A 1VQKP 1EXJA 1QX8A 3LIEA 1YJWP 1GDTA 3A0HH 1NVOA 3CWBE 3S9OA 3WMM0 1S5LX 1LTSC 1NOHA 2NPSB 3CLQA 3MIWA 3L72E 3NTNA 1EZVI 4GKGA 5E79E 2Y0EA 2N1TB 4PV1C 3CX5D 3M9QA 2LXBA 1KTMA 2QJYB 1LTJC 1IZNB 1LTGC 3SWYA 3P32A 2R5DA 2B87A 2B88A 3C9IA 4DCKA 2JWAA 3V2PA 2FY8A 2HODA 1FC2C 3Q1MA 1S1CX 4W80A 3H32A 2B87B 3H6PA 1S4XA 2WITA 4C46A 1BDDA 1NJIQ 4U3FJ 1G2CB 4XA4A 3BCCE 1FU1A 1OZHA 3EFGA 5BU5A 1IFMA 2VRSA 1JY3O 2WSFH 4U7JA 2ZFCA 1M57D 2L5GB 1IFDA 1OW6A 1N7LA 1M1JB 1SFCB 4U3FG 4GOFA 4H0LC 4ZKPA 1VF5D 2L91A 2BASA 4IFFA 3CCRP 1K9MQ 2WMMA 1N73A 3B71A 4H44B 1PGPA 3H1KE 3SFEC 1LGHB 3L70J 3O6QB 4R4LA 3GF3A 3RK3D 3L37A 1N2DC 3H1IE 3VMXA 3W68A 3G71P 1N8RQ 3FWLA 1R5LA 2IPPA 2N1TD 1XTCC 1NU1G 1ZXGA 1ZRTD 2KUBA 1BCCG 2A45H 4JPZB 4UB8H 4Y99B 3H1IJ 1PP9D 4RJTA 2PAJA 3CX5E 1NU1J 4H13C 1GMJA 1KQLA 1T3UA 2ZT9C 3H1HJ 3M9BA 1USEA 4WY4D 5C39A 1AJYA 1ZRTE 1RQVA 3MUDC 3P8MC 1J1EC 3A0BE 1NTZK 1VQ8P 3AEEC 1G1JA 2KYVA 3TF5A 1FE6A 5AVWB 1T8ZA 4YXWH 2OTLP 1BE3J 2A45G 3L74J 2CK3H 4BRYB 4B86A 1RE4C 2O01J 5GTIE 5TISE 1YTZT 3UIAA 3L74G 1KB9H 4H44D 3TSIA 1DH3A 2QJKC 2XZRA 5KLVE 5KLVK 3A5TA 1QL1A 1QVGO 2N9BA 1K04A 5CCGD 4D6TD 1BGYG 1VF5C 2MJZA 2IDBA 1GW3A 2JKVA 2P10A 3B5ND 4L74A 2M3EA 1LTBC 1YTZI 2YMYA 1L0LE 4PJ0H 4YTPC 3I55P 1Q86Q 1JUNA 3PHLA 3D71A 1BCCJ 1P84H 4LLHA 3RK3C 2IBZD 5KLIB 1AV1A 5AVXB 4D6TG 2KLVA 2Z5HA 1H8AA 3BATA 3CC7P 1T3JA 2QM7A 2I1JA 2OYOA 3EQ2A 1HTLC 1NKNA 1NTKK 3FX0A 1AVOA 1J1EB 1JOCA 1KV4A 2E76C 1H0TB 3LW5J 3RL0C 2JWDA 1N7SC 1JY2N 1M56D 1GL2A 1SQQK 1JEKA 1DD4A 1SQQE 2R32A 3LIDA 1FZBA 2IX7C 1HJ0A 1L0NJ 1AQTA 1KB9D 1KQGB 2E76D 3D6ZA 1VQ4P 3L73J 4IFMA 3HTKA 1HVVA 2CPBA 1PP9G 3M9HA 5AW2B 1E79H 2FFDB 3Q2YA 2W6BA 1KN7A 3WU2H 5AW0B 2QA4P 1MZ9A 1RHZB 1NTKD 1ZW0A 3P7KA 2OYIB 3RBZA 1DIPA 1MKMA 1KD1Q 1HUCA 2WQYC 3N7NA 1R8EA 1IK7A 1NHLA 1M8OB 3L71D 3CC4P 5APQA 1A02J 1KYOD 2FYUE 2B89A 2WSFJ 1CW5A 1KILB 4YXDC 1X9VA 3B5NC 1L0LJ 1Y8AA 2Q5UA 2IYPA 2YKPA 4LGDE 3TYYA 3L72D 1L2PA 2RN0A 1DEEG 3PJSK 3VP9A 4EIJA 1W5CE 5KAIH 2IFNA 4QMAA 2HLOA 1W2BO 1H89A 3CD6P 3GHGA 2KLUA 1HGVA 1ZV8A 4I6MC 4TLFA 5AW4B 1GW4A 5AW6B 1JMMA 5DJUB 5APVA 3GG2A 4OGQD 1GU5A 3H1KG 1NTZE 3AEBC 3BRVB 3GMAA 2KZIA 2Q3IA 2WWWA 3H1IG 1BDCA 1BE3E 2NPSC 2H88C 5KLIC 2Y9ZA 3H32B 3MD0A 1SLQA 2KSEA 2N1TA 1JB0J 2ZYAA 1JY2P 1X0TA 3CWBG 1KMIZ 3M0DA 2ITAA 3H1LJ 4JF7A 3Q3DA 4WY4A 4EI2A 2WPRA 3D70A 3H25A 3BASA 3TGUJ 1SQBG 3ITKA 3H1HE 3SWFA 1SFCA 2K9JB 2IBZG 5B5EH 2FFDC 2J58A 1RF1C 2P67A 1MFTA 1MV8A 1OX3A 1U57A 1G2CA 5BU8B 1N73B 4KT0J 5KLVD 1NH4A 1YBKA 3H1JJ 3IN6A 5APSA 3BCCG 1BGYD 2K37A 4C7RA 1L4AA 2YIUB 3AEFC 1X8YA 3HD7C 3A3YB 3L74E 3R2PA 3P8CE 2XU6A 1Z56A 2KS1B 1JCDA 3H1JG 2NPSD 2W6JH 3A2AA 3PTZA 4KJMA 1QL2A 4A7PA 1RE3A 1SQBE 3HUSA 3Q5PA 1PIXA 2A06G 3L71E 3H1LE 1AFOA 3TNUA 1KILE 4PD4E 3CCSP 4OGQC 2M0BA 3K5BA 1SQBJ 3L75G 5B5EE 1A02F 3CI9A 3HRNA 3CCQP 3TNUB 1RF0A 1URQC 5CCHA 2O01H 1OMIA 1NU1E 5H2FE 4DJGA 1ZR4A 5AW9B 1IK9A 1OVUA 3CXHD 3H1JE 1GK4A 1RY3A 1PPJG 3EFFK 1PFIA 1VQ7P 1P84I 3HE4A 2FYNB 3I5CA 1SQXD 1M1JC 1NTMG 1NYHA 2E76B 4I2LC 4I7ZB 3BRTB 5AW8B 1FZAA 4IL6H 3SWKA 2K9YA 3TGUE 1S9KD 2KNCA 1SQPJ 2Q6QA 2QG4A 1PPJD 2Z5IA 3B8EB 3HD7B 1BE3G 4BWNA 2FYUK 2WPVB 4LC1A 1YI2P 1QVFO 3VOPA 3RK3B 3MGNA 1VQOP 3JC22 1S2EA 2KK7A 3TDKA 3CX5H 4DOJA 4I7ZC 4RESB 2FYNC 1LWUA 3WUVA 4YPCA 3KPEA
chains in the Genus database with same CATH topology
1HGZA 3M9QA 1LTAC 2POHA 2WSEH 2CPSA 1FOSE 3M0AA 1GL2B 1SP4A 4OH8B 5CJ4A 1NKZB 5KJ7D 2A45I 3VMZA 1W2EA 3VN0A 1G1IA 3N4XA 2XDJA 1FOSF 2LKMA 5AVSB 1HWTC 2M8RA 3HD7D 3OAKA 3RK2B 2YO3A 3NMDA 1HJBA 1NAFA 1L4AC 2QM8A 4GT1A 2OYIA 2KP8A 1ZLLA 1RF1B 2KB7P 1IJDB 1VDFA 2Q9IA 4M3LA 1NTMK 1SFCD 1X79B 3U59A 1KFMA 1RF1A 2FFDA 1SFCC 1CSBA 1KILA 1OWAA 2OYHA 1LT9A 2W6AA 3MTUE 3U1CA 1GZLA 2OYHB 4DZOA 1LT9B 5AVRB 3NFQA 1JO5A 2NPSA 1N7SB 2I1KA 3CL3D 5APWA 4IFDK 3KQGA 4N6JA 2GUVA 2Z4EA 1FBMA 1SQXK 1NO4A 2OYHC 1IFIA 1KILC 2WPSA 4AUWA 1VPCA 1IFNA 2C0WA 1SVFA 3V2QA 2OARA 1GK6A 2WT7B 2YKOA 2FKWB 4N78E 1M1JA 1LTIC 2R3CA 2O1JA 1WT6A 4JYBA 3V5BA 1URQB 2W27A 1IC2A 2JEEA 5AVUB 3G3ZA 3HUSB 1WRGA 5CCHC 3RK2C 3BVHA 1IFJA 4O9BA 1T2KC 1HH0A 1T2KD 2O1KA 1RE3C 3HUSC 1CZQA 3V4QA 2YO2A 3OJAB 3VP8A 5CJ0A 1GD2E 5APXA 3HE5A 3RK2D 1J1DC 1FZCB 2J59M 1AQ5A 5AVZB 1LWUB 4XE5B 5CMZA 1URQD 4WY4C 5AW1B 1H88A 1DX7A 1MUUA 2P7JA 1RE4A 1JTHB 4KHXA 2H8PD 1JTHA 1MFZA 4N78D 1LTTC 3MUDA 2PP6A 1LT9C 1RF0C 4C7NB 3GHGC 4Y99C 1NU1K 1FAVA 2M3BA 1M7LA 3A7OA 4N3YB 1JY3P 3L4FA 1IO4A 2KOGA 3II6A 5APUA 5AW5B 1FZFA 2ZXEB 2OYIC 2HG5D 2HPCB 3V4WA 3GHGB 1L4AD 3PP5A 2R5BA 5KTBA 4HH2A 3M06A 2XNXA 2C9LY 2KSJA 3RL0B 2GM4A 1LTJB 1N7SA 3M0DC 4GIFA 2N1TC 4W7YA 5CCHD 1LTJA 1J2JB 4WY4B 3E1IA 3V2RA 4ZKUA 4AYCA 2P2UA 1FJPA 1LWUC 1L0NK 2HODB 1J1DB 2E43A 3TK1A 3VTPC 1JY3N 2Q7CA 1E5WA 1YYCA 1GU4A 1L4AB 2WSCH 5AW3B 2GUSA 3IFMA 5BVZA 3RL0D 2WT7A 5CHXA 2XKMA 2P1JA 1GTWA 4JYCA 4HYTB 1L0LK 1KZUB 3U1AA 1URQA 3NXSA 4EOTA 2IFMA 1CI6B 5KJ7A 4W7ZA 2JJLA 3L36A 1GL2C 3HE4B 1CI6A 3P8CD 4AQRD 3IR9A 3M91A 5AVYB 3OA7A 4WB4A 2FXMA 3HD7A 3KYQA 1S9KE 1FZCA 2C9NY 2H43A 1XTGB 2FYZA 1DEBA 5APYA 1NWQA 3HE5B 2YNYA 5APTA 3LW5H 1OXZA 1N86A 1FZCC 5AVTB 1KILD 1FZEA 2WPQA 1FDMA 3T97A 3O8ZA 5AVVB 4C7NA 1ZR2A 1JY2O 1ZN5A 5KJ7C 1JNMA 1SQBK 2HFED 3KDPB 1FJKA 5CCGA 5AVQB 3VYIA 1N7SD 4I1LA 3B5NA 3HTKB 1KFNA 1FZGA 3B5NB 2C0XA 2HYNA 3V2NA 1HBWA 1N73C 2YKQA 2WZ7A 2E42A 1SQPK 5APQA 1JCCA 1EQ7A 1SQVK 2XV5A 5AW7B 4WBAA 1GL2D 3VMYA 5CCGC 2WTYA 3L35A 2HPCA 3LIEA 1GDTA 3WMM0 1LTSC 1NOHA 2NPSB 3CLQA 3MIWA 3NTNA 4GKGA 2N1TB 1LTJC 1LTGC 3SWYA 3P32A 2R5DA 3C9IA 3V2PA 2HODA 4W80A 3H32A 3H6PA 2WITA 4C46A 4XA4A 1G2CB 1FU1A 5BU5A 1IFMA 2VRSA 1JY3O 2WSFH 2ZFCA 2L5GB 1IFDA 1SFCB 1N7LA 1M1JB 4ZKPA 2BASA 4IFFA 1N73A 2H7HA 1LGHB 3RK3D 3L37A 1N2DC 3VMXA 2IPPA 2N1TD 1XTCC 4Y99B 2A45H 2PAJA 1KQLA 1T3UA 4WY4D 3M9BA 3P8MC 1J1EC 1NTZK 1G1JA 2KYVA 5AVWB 1T8ZA 2A45G 4B86A 1RE4C 1YTZT 1DH3A 3TSIA 2XZRA 5KLVK 3A5TA 1QL1A 2N9BA 5CCGD 2MJZA 1GW3A 3B5ND 1LTBC 1YTZI 2YMYA 1JUNA 4LLHA 3RK3C 5AVXB 2KLVA 2Z5HA 1H8AA 3BATA 1T3JA 2QM7A 2I1JA 3EQ2A 1HTLC 1NKNA 1NTKK 1J1EB 1JOCA 3RL0C 1N7SC 1JY2N 1SQQK 1GL2A 2R32A 3LIDA 1FZBA 2IX7C 4IFMA 3HTKA 1HVVA 2CPBA 3M9HA 5AW2B 2W6BA 5AW0B 1MZ9A 3P7KA 2OYIB 1HUCA 3N7NA 1NHLA 1A02J 1CW5A 1KILB 1X9VA 3B5NC 2YKPA 2Q5UA 4LGDE 3TYYA 3VP9A 4EIJA 2IFNA 1H89A 2HLOA 3GHGA 1HGVA 1ZV8A 4I6MC 5AW4B 5AW6B 1GW4A 1GU5A 1JMMA 2FFDB 5APVA 3BRVB 2Q3IA 2WWWA 2NPSC 3H32B 3MD0A 1SLQA 2N1TA 1JY2P 3M0DA 4JF7A 4WY4A 2WPRA 3BASA 3SWFA 1SFCA 2FFDC 2J58A 1RF1C 2P67A 5BU8B 1MV8A 1N73B 1G2CA 1NH4A 5APSA 4C7RA 1L4AA 3R2PA 1X8YA 3HD7C 3A3YB 3P8CE 2XU6A 1Z56A 3UIAA 1JCDA 2NPSD 3A2AA 1QL2A 1RE3A 3HUSA 1AFOA 3TNUA 1A02F 3CI9A 3HRNA 3TNUB 1RF0A 1URQC 5CCHA 2O01H 1ZR4A 5AW9B 1IK9A 1GK4A 1RY3A 1PFIA 3HE4A 4I2LC 3I5CA 5AW8B 1M1JC 3BRTB 1FZAA 1S9KD 3HD7B 2Z5IA 3B8EB 2FYUK 4LC1A 3VOPA 3RK3B 3MGNA 4DOJA 4RESB 3EFGA 1LWUA 3KPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA7 A;  1NOH A;  1NO4 A;  4IFF A;  3MTU E; 
#chains in the Genus database with same CATH topology
 1HGZ A;  1EDI A;  1R5S A;  1LTA C;  2POH A;  2QJK B;  1BGY E;  2CPS A;  2WSE H;  2ZVO B;  3L75 D;  3M0A A;  4PV1 B;  5KAF H;  3CPW O;  2IZ0 A;  1FOS E;  1GL2 B;  1SP4 A;  1ZME C;  4ASW A;  1SQX E;  2JDI H;  4OH8 B;  5CJ4 A;  1NKZ B;  5KJ7 D;  2A45 I;  4GDO A;  1W2E A;  3VMZ A;  2QSI A;  4UB6 H;  3VN0 A;  1G1I A;  3F5H A;  3H1H D;  2WSE J;  4L75 A;  4OGQ B;  3WU2 E;  1KQS O;  2I8D A;  1RH5 B;  3N4X A;  2XDJ A;  1FOS F;  2LKM A;  2ZJS E;  5KKZ C;  5AVS B;  3FGA D;  2E74 C;  1HWT C;  2M8R A;  3HD7 D;  3JSV C;  2AEF A;  3L73 G;  3CWB J;  3OAK A;  1EXI A;  3KZI H;  3RK2 B;  2YO3 A;  4K35 A;  1BE3 D;  3WUU A;  3NMD A;  5M1B A;  4PJ0 E;  1HJB A;  1NAF A;  1L4A C;  2QM8 A;  1PP9 E;  4GT1 A;  2OYI A;  2KP8 A;  3MHV A;  4U3F D;  1ZLL A;  1NTK G;  1RF1 B;  2KB7 P;  2E74 B;  2BCC D;  1IJD B;  5E79 H;  1VDF A;  1P84 E;  4H44 C;  3USS A;  2M5A A;  2O01 N;  4D6T J;  1D7M A;  3PLN A;  4M3L A;  1NTM K;  1SFC D;  1X79 B;  3H1K D;  1KFM A;  3U59 A;  1RF1 A;  2R3S A;  3BCC J;  2FFD A;  1SFC C;  1CSB A;  1KIL A;  1OWA A;  2V7Q J;  3TGU G;  1YHQ P;  3CX5 I;  1SQV D;  3L70 G;  2BEZ F;  2OYH A;  1LT9 A;  1L0L G;  2A06 D;  4H13 D;  2W6A A;  3MTU E;  3U1C A;  1GZL A;  3IAO A;  2OYH B;  4DZO A;  3ABV C;  1LT9 B;  3MZW B;  3NFQ A;  5AVR B;  1JO5 A;  1WMK A;  2V4H A;  2NPS A;  2R44 A;  4IOI H;  1N7S B;  1PP9 J;  2I1K A;  2LXC B;  2KXP B;  2YMK A;  3CL3 D;  3AEG C;  3H1L G;  4MN4 C;  2QVA A;  4NPD A;  5APW A;  1BSH A;  4IFD K;  3KQG A;  4N6J A;  3GLM A;  2GUV A;  2Z4E A;  1SQQ G;  2QJY C;  1FBM A;  5B66 H;  3I56 P;  1SQX K;  3FXE A;  1NO4 A;  5EFW B;  1YIT P;  1IFI A;  3JCU E;  2OYH C;  1KOR A;  1UIX A;  1KIL C;  2WPS A;  3SFD C;  4AUW A;  1VPC A;  1IFN A;  1NTM D;  2C0W A;  5GTH H;  1SVF A;  4H0L D;  4XFJ A;  3V2Q A;  3KHU A;  2OAR A;  3L74 D;  1GK6 A;  1PGO A;  1KYO I;  2K9J A;  2YKO A;  3O6Q A;  2WT7 B;  2KS1 A;  2UWJ E;  2FKW B;  4N78 E;  1VQN P;  1FS0 E;  2KI7 B;  5GTH E;  3CC2 P;  1M1J A;  1YQ4 C;  2G3A A;  3FWN A;  1LTI C;  1PV3 A;  1S5L E;  2O1J A;  1WT6 A;  2R3C A;  2RH0 A;  2G8Y A;  1L0L D;  1VL2 A;  3AE5 C;  4JYB A;  3V5B A;  1YIJ P;  3G6E P;  1PGQ A;  1SQQ J;  1URQ B;  2W27 A;  3AE3 C;  1IC2 A;  3RBX A;  2JEE A;  4PD4 I;  4WVZ A;  4D6T E;  5AVU B;  3CCV P;  2O3J A;  4NPE A;  3G3Z A;  1OVV A;  4IL6 X;  3HUS B;  1WRG A;  3SSU A;  5CCH C;  1ZOY C;  3RK2 C;  3AE6 C;  1ZP0 C;  3BVH A;  5TJH A;  1IFJ A;  2KIK A;  4HB1 A;  4O9B A;  3CMA P;  1K8A Q;  1T6A A;  3S4R A;  1T2K C;  1HH0 A;  2A06 E;  2Q3E A;  2W90 A;  1VQM P;  1EZV G;  1LJ2 A;  3Q5R A;  1T2K D;  1KB9 E;  2O1K A;  4IL6 E;  1RE3 C;  3HUS C;  1YJN P;  1BSN A;  1CZQ A;  2Q1K A;  1NTZ D;  3V4Q A;  2YO2 A;  3OJA B;  3VP8 A;  2BCC E;  2OTK E;  3L73 D;  3D6Y A;  5CJ0 A;  3PH0 A;  2Q9I A;  1OW7 A;  1VF5 B;  5APX A;  1FDI A;  3AEA C;  1GD2 E;  4BRY A;  1SQV G;  3HE5 A;  3L70 D;  1J1D C;  3RK2 D;  1FZC B;  2J59 M;  2IBZ E;  1SQP G;  3B4S A;  5H2F H;  2IBZ I;  1AQ5 A;  5AVZ B;  1DD3 A;  1LWU B;  4XE5 B;  5CMZ A;  1KYO E;  2FYU D;  1URQ D;  3CCJ P;  2ZT9 D;  3H1I D;  1BGY J;  4WY4 C;  5AW1 B;  1H88 A;  1DX7 A;  1MUU A;  2JP3 A;  5DJT B;  2P7J A;  1HF9 A;  3L72 G;  1LNQ A;  1PL5 A;  1RE4 A;  1JTH B;  3Q5S A;  3ZDM A;  3T97 B;  2QE7 H;  1OW8 A;  3RL0 g;  2AEM A;  2QJP B;  5L8R J;  3AEC C;  3L72 J;  2H8P D;  4KHX A;  1JTH A;  1K73 Q;  5B66 E;  2SPZ A;  1EZV D;  1MFZ A;  4EDF A;  2Y9Y A;  3V6I A;  4N78 D;  4H13 B;  4R4M A;  1LTT C;  4ZMD A;  3MUD A;  2PP6 A;  1LT9 C;  1RF0 C;  4C7N B;  3GHG C;  4Y99 C;  1NU1 K;  1VQ9 P;  1FAV A;  1RQU A;  2E5T A;  2M3B A;  1SQX G;  2FXO A;  1M7L A;  1P84 D;  3E1R A;  3A7O A;  3WUT A;  4N3Y B;  1JMB A;  1JY3 P;  3L4F A;  2H7H A;  4U3F E;  3MP7 B;  3S1K A;  1IO4 A;  2KOG A;  4WWI A;  3II6 A;  5APU A;  5AW5 B;  1S72 P;  2HR3 A;  1FZF A;  2W83 C;  1AVY A;  1IFP A;  2ZXE B;  3AE9 C;  2OYI C;  1PZQ A;  2FYU G;  2KZJ A;  2HG5 D;  3RK3 E;  3IF4 A;  3TGU D;  3AE4 C;  1EDK A;  2E75 D;  1Q81 Q;  3R4Y A;  2HPC B;  4HJG H;  3V4W A;  4RKU J;  3GF7 A;  4PV1 D;  3GHG B;  4OWF A;  1L4A D;  3PP5 A;  5KLV J;  2R5B A;  1BCC E;  2RMZ A;  4HKZ H;  4HH2 A;  3CXH E;  3H1J D;  2XNX A;  3M06 A;  5KTB A;  3CCM P;  1QEX A;  2YXR B;  1YQ3 C;  2KSJ A;  3RL0 B;  1LT1 A;  2C9L Y;  2GM4 A;  1NU1 D;  1SQV E;  4EYY Q;  1NTZ G;  1LTJ B;  1N7S A;  2QJP C;  3M0D C;  3KXD A;  4ASV A;  4GIF A;  2N1T C;  2FBW C;  3L75 E;  1TU3 F;  4W7Y A;  2OTJ P;  1EDJ A;  1U7J A;  5CCH D;  1LTJ A;  5KAI E;  2IYO A;  1S3J A;  1J2J B;  1NTK J;  1SQB D;  2DW3 A;  2QRX A;  4WY4 B;  2AXC A;  2OQQ A;  3E1I A;  3V2R A;  3KZI E;  3QH9 A;  2P2U A;  4NPF X;  4AYC A;  1LWU C;  4ZKU A;  5K5G B;  1FJP A;  1L0N K;  2HOD B;  1J1D B;  3CWB D;  1S5L H;  2E43 A;  2RKL A;  3L73 E;  4ZNC A;  2ZYD A;  2BEQ D;  3H1H G;  3TK1 A;  3VTP C;  1JY3 N;  2PGD A;  3E7K A;  3CCL P;  2Q7C A;  1KC8 Q;  3RGU A;  2LR2 A;  1E5W A;  2K1A A;  2D2C D;  1YYC A;  1GU4 A;  1L4A B;  1YJ9 P;  2WSC H;  4UB6 E;  5AW3 B;  1AA0 A;  2BCC G;  4OVN F;  1Y9B A;  2GUS A;  1SQP D;  3IFM A;  1KYO H;  1BCC D;  5BVZ A;  3RL0 D;  3G4S P;  2WT7 A;  5CHX A;  2MKV A;  2BCC J;  3VMA A;  2XKM A;  5KAF E;  2YXQ B;  2P1J A;  4RO0 A;  3H1K J;  4DT0 A;  2Y0C A;  1OIP A;  3BCC D;  3GW6 A;  2ZAE B;  4CPG A;  2ZT9 B;  1GTW A;  2ZVN B;  3L71 G;  2H89 C;  1SQV J;  4HYT B;  1L0L K;  4JYC A;  5GTI H;  2GA1 A;  2QEX P;  1KZU B;  3U1A A;  1URQ A;  3NXS A;  4EOT A;  1M1K Q;  2E42 A;  2IFM A;  1CI6 B;  1LP1 B;  1L0N D;  1Q90 D;  2J5U A;  2JR8 A;  3H1L D;  3L75 J;  4W7Z A;  2JJL A;  5KJ7 A;  4K3A A;  3L36 A;  4L76 A;  3AED C;  1GL2 C;  3QWO C;  2WSS H;  1VQP P;  3HE4 B;  1USD A;  1CI6 A;  1KB9 I;  1LP1 A;  1QLE D;  3P8C D;  4GOE A;  3IR9 A;  4AQR D;  1JM0 A;  2P58 A;  3AE7 C;  3M91 A;  2E75 C;  3OA7 A;  5AVY B;  5CBN A;  5TIS H;  1PPJ E;  4WB4 A;  2FXM A;  3CXH H;  4H0L B;  3G9R A;  3HD7 A;  1NGM B;  3KYQ A;  1S9K E;  4Z1M H;  1FZC A;  1NTM E;  1EZV E;  2FXP A;  2K3R A;  3C1L A;  3CXH I;  2H43 A;  1QGK B;  2C9N Y;  2WSC J;  1UII A;  1XTG B;  2AXT E;  2YIU C;  3A0B H;  1OVR A;  3L71 J;  2XND H;  2ZYG A;  2FYZ A;  1DEB A;  1NTM J;  2ZXX A;  4JBZ A;  1M90 Q;  2JO1 A;  2KNC B;  3W67 A;  3CCU P;  1EDL A;  3CME P;  5APY A;  1NWQ A;  3HE5 B;  2NRG A;  1VQL P;  3AE2 C;  2YNY A;  5APT A;  3LW5 H;  1OXZ A;  1N86 A;  2E75 B;  2E74 D;  3EWK A;  5AVT B;  1KIL D;  1FZE A;  4PD4 D;  1FZC C;  2WPQ A;  1FDM A;  3T97 A;  1SQQ D;  3L70 E;  3JCU H;  3O8Z A;  5AVV B;  1SS1 A;  1X22 A;  2AEJ A;  1Q2N A;  1VQ6 P;  3PRJ A;  3CCE P;  2K88 A;  4PD4 H;  4C7N A;  2OGU A;  1ZR2 A;  1JY2 O;  1Q82 Q;  1ZN5 A;  2PFX A;  1SQX J;  5KJ7 C;  2NZ2 A;  1VQ5 P;  1JNM A;  1H0T A;  2D2C C;  1SQB K;  2HFE D;  4GOD A;  3KDP B;  1FJK A;  1L0N E;  1PGJ A;  2E5Y A;  1FDO A;  5AVQ B;  3VYI A;  1N7S D;  4TT3 H;  5CCG A;  4I1L A;  3B5N A;  1EC5 A;  2AXT H;  1NTZ J;  1KFN A;  3AE1 C;  3HTK B;  2N9Y B;  1K05 A;  1FZG A;  4Y28 J;  1NAY A;  3F89 A;  3FXD A;  3B5N B;  2C0X A;  2HYN A;  2B9B A;  4UB8 E;  2WVR A;  3V2N A;  2QIW A;  1OFC X;  2V7Q H;  3OW2 O;  1Q7Y Q;  1HBW A;  1NTK E;  2M5A B;  1N73 C;  4L73 A;  3C8V A;  1Y47 A;  2Y0D A;  2YKQ A;  2W8Z A;  2WZ7 A;  5KLV G;  4BXL A;  1SQP K;  1SQP E;  3A0H E;  1JCC A;  3AE8 C;  1EQ7 A;  1U7M A;  1L0N G;  1SQV K;  4JQ0 D;  5KKZ B;  2D2C B;  2FYU J;  2XV5 A;  5AW7 B;  2PRR A;  1GL2 D;  4WBA A;  3VMY A;  5CCG C;  1KQF B;  5CBO A;  2WTY A;  3L35 A;  2HPC A;  2IZ1 A;  1VQK P;  1EXJ A;  1QX8 A;  3LIE A;  1YJW P;  1GDT A;  3A0H H;  1NVO A;  3CWB E;  3S9O A;  3WMM 0;  1S5L X;  1LTS C;  1NOH A;  2NPS B;  3CLQ A;  3MIW A;  3L72 E;  3NTN A;  1EZV I;  4GKG A;  5E79 E;  2Y0E A;  2N1T B;  4PV1 C;  3CX5 D;  3M9Q A;  2LXB A;  1KTM A;  2QJY B;  1LTJ C;  1IZN B;  1LTG C;  3SWY A;  3P32 A;  2R5D A;  2B87 A;  2B88 A;  3C9I A;  4DCK A;  2JWA A;  3V2P A;  2FY8 A;  2HOD A;  1FC2 C;  3Q1M A;  1S1C X;  4W80 A;  3H32 A;  2B87 B;  3H6P A;  1S4X A;  2WIT A;  4C46 A;  1BDD A;  1NJI Q;  4U3F J;  1G2C B;  4XA4 A;  3BCC E;  1FU1 A;  1OZH A;  3EFG A;  5BU5 A;  1IFM A;  2VRS A;  1JY3 O;  2WSF H;  4U7J A;  2ZFC A;  1M57 D;  2L5G B;  1IFD A;  1OW6 A;  1N7L A;  1M1J B;  1SFC B;  4U3F G;  4GOF A;  4H0L C;  4ZKP A;  1VF5 D;  2L91 A;  2BAS A;  4IFF A;  3CCR P;  1K9M Q;  2WMM A;  1N73 A;  3B71 A;  4H44 B;  1PGP A;  3H1K E;  3SFE C;  1LGH B;  3L70 J;  3O6Q B;  4R4L A;  3GF3 A;  3RK3 D;  3L37 A;  1N2D C;  3H1I E;  3VMX A;  3W68 A;  3G71 P;  1N8R Q;  3FWL A;  1R5L A;  2IPP A;  2N1T D;  1XTC C;  1NU1 G;  1ZXG A;  1ZRT D;  2KUB A;  1BCC G;  2A45 H;  4JPZ B;  4UB8 H;  4Y99 B;  3H1I J;  1PP9 D;  4RJT A;  2PAJ A;  3CX5 E;  1NU1 J;  4H13 C;  1GMJ A;  1KQL A;  1T3U A;  2ZT9 C;  3H1H J;  3M9B A;  1USE A;  4WY4 D;  5C39 A;  1AJY A;  1ZRT E;  1RQV A;  3MUD C;  3P8M C;  1J1E C;  3A0B E;  1NTZ K;  1VQ8 P;  3AEE C;  1G1J A;  2KYV A;  3TF5 A;  1FE6 A;  5AVW B;  1T8Z A;  4YXW H;  2OTL P;  1BE3 J;  2A45 G;  3L74 J;  2CK3 H;  4BRY B;  4B86 A;  1RE4 C;  2O01 J;  5GTI E;  5TIS E;  1YTZ T;  3UIA A;  3L74 G;  1KB9 H;  4H44 D;  3TSI A;  1DH3 A;  2QJK C;  2XZR A;  5KLV E;  5KLV K;  3A5T A;  1QL1 A;  1QVG O;  2N9B A;  1K04 A;  5CCG D;  4D6T D;  1BGY G;  1VF5 C;  2MJZ A;  2IDB A;  1GW3 A;  2JKV A;  2P10 A;  3B5N D;  4L74 A;  2M3E A;  1LTB C;  1YTZ I;  2YMY A;  1L0L E;  4PJ0 H;  4YTP C;  3I55 P;  1Q86 Q;  1JUN A;  3PHL A;  3D71 A;  1BCC J;  1P84 H;  4LLH A;  3RK3 C;  2IBZ D;  5KLI B;  1AV1 A;  5AVX B;  4D6T G;  2KLV A;  2Z5H A;  1H8A A;  3BAT A;  3CC7 P;  1T3J A;  2QM7 A;  2I1J A;  2OYO A;  3EQ2 A;  1HTL C;  1NKN A;  1NTK K;  3FX0 A;  1AVO A;  1J1E B;  1JOC A;  1KV4 A;  2E76 C;  1H0T B;  3LW5 J;  3RL0 C;  2JWD A;  1N7S C;  1JY2 N;  1M56 D;  1GL2 A;  1SQQ K;  1JEK A;  1DD4 A;  1SQQ E;  2R32 A;  3LID A;  1FZB A;  2IX7 C;  1HJ0 A;  1L0N J;  1AQT A;  1KB9 D;  1KQG B;  2E76 D;  3D6Z A;  1VQ4 P;  3L73 J;  4IFM A;  3HTK A;  1HVV A;  2CPB A;  1PP9 G;  3M9H A;  5AW2 B;  1E79 H;  2FFD B;  3Q2Y A;  2W6B A;  1KN7 A;  3WU2 H;  5AW0 B;  2QA4 P;  1MZ9 A;  1RHZ B;  1NTK D;  1ZW0 A;  3P7K A;  2OYI B;  3RBZ A;  1DIP A;  1MKM A;  1KD1 Q;  1HUC A;  2WQY C;  3N7N A;  1R8E A;  1IK7 A;  1NHL A;  1M8O B;  3L71 D;  3CC4 P;  5APQ A;  1A02 J;  1KYO D;  2FYU E;  2B89 A;  2WSF J;  1CW5 A;  1KIL B;  4YXD C;  1X9V A;  3B5N C;  1L0L J;  1Y8A A;  2Q5U A;  2IYP A;  2YKP A;  4LGD E;  3TYY A;  3L72 D;  1L2P A;  2RN0 A;  1DEE G;  3PJS K;  3VP9 A;  4EIJ A;  1W5C E;  5KAI H;  2IFN A;  4QMA A;  2HLO A;  1W2B O;  1H89 A;  3CD6 P;  3GHG A;  2KLU A;  1HGV A;  1ZV8 A;  4I6M C;  4TLF A;  5AW4 B;  1GW4 A;  5AW6 B;  1JMM A;  5DJU B;  5APV A;  3GG2 A;  4OGQ D;  1GU5 A;  3H1K G;  1NTZ E;  3AEB C;  3BRV B;  3GMA A;  2KZI A;  2Q3I A;  2WWW A;  3H1I G;  1BDC A;  1BE3 E;  2NPS C;  2H88 C;  5KLI C;  2Y9Z A;  3H32 B;  3MD0 A;  1SLQ A;  2KSE A;  2N1T A;  1JB0 J;  2ZYA A;  1JY2 P;  1X0T A;  3CWB G;  1KMI Z;  3M0D A;  2ITA A;  3H1L J;  4JF7 A;  3Q3D A;  4WY4 A;  4EI2 A;  2WPR A;  3D70 A;  3H25 A;  3BAS A;  3TGU J;  1SQB G;  3ITK A;  3H1H E;  3SWF A;  1SFC A;  2K9J B;  2IBZ G;  5B5E H;  2FFD C;  2J58 A;  1RF1 C;  2P67 A;  1MFT A;  1MV8 A;  1OX3 A;  1U57 A;  1G2C A;  5BU8 B;  1N73 B;  4KT0 J;  5KLV D;  1NH4 A;  1YBK A;  3H1J J;  3IN6 A;  5APS A;  3BCC G;  1BGY D;  2K37 A;  4C7R A;  1L4A A;  2YIU B;  3AEF C;  1X8Y A;  3HD7 C;  3A3Y B;  3L74 E;  3R2P A;  3P8C E;  2XU6 A;  1Z56 A;  2KS1 B;  1JCD A;  3H1J G;  2NPS D;  2W6J H;  3A2A A;  3PTZ A;  4KJM A;  1QL2 A;  4A7P A;  1RE3 A;  1SQB E;  3HUS A;  3Q5P A;  1PIX A;  2A06 G;  3L71 E;  3H1L E;  1AFO A;  3TNU A;  1KIL E;  4PD4 E;  3CCS P;  4OGQ C;  2M0B A;  3K5B A;  1SQB J;  3L75 G;  5B5E E;  1A02 F;  3CI9 A;  3HRN A;  3CCQ P;  3TNU B;  1RF0 A;  1URQ C;  5CCH A;  2O01 H;  1OMI A;  1NU1 E;  5H2F E;  4DJG A;  1ZR4 A;  5AW9 B;  1IK9 A;  1OVU A;  3CXH D;  3H1J E;  1GK4 A;  1RY3 A;  1PPJ G;  3EFF K;  1PFI A;  1VQ7 P;  1P84 I;  3HE4 A;  2FYN B;  3I5C A;  1SQX D;  1M1J C;  1NTM G;  1NYH A;  2E76 B;  4I2L C;  4I7Z B;  3BRT B;  5AW8 B;  1FZA A;  4IL6 H;  3SWK A;  2K9Y A;  3TGU E;  1S9K D;  2KNC A;  1SQP J;  2Q6Q A;  2QG4 A;  1PPJ D;  2Z5I A;  3B8E B;  3HD7 B;  1BE3 G;  4BWN A;  2FYU K;  2WPV B;  4LC1 A;  1YI2 P;  1QVF O;  3VOP A;  3RK3 B;  3MGN A;  1VQO P;  3JC2 2;  1S2E A;  2KK7 A;  3TDK A;  3CX5 H;  4DOJ A;  4I7Z C;  4RES B;  2FYN C;  1LWU A;  3WUV A;  4YPC A;  3KPE A; 
#chains in the Genus database with same CATH homology
 1HGZ A;  3M9Q A;  1LTA C;  2POH A;  2WSE H;  2CPS A;  1FOS E;  3M0A A;  1GL2 B;  1SP4 A;  4OH8 B;  5CJ4 A;  1NKZ B;  5KJ7 D;  2A45 I;  3VMZ A;  1W2E A;  3VN0 A;  1G1I A;  3N4X A;  2XDJ A;  1FOS F;  2LKM A;  5AVS B;  1HWT C;  2M8R A;  3HD7 D;  3OAK A;  3RK2 B;  2YO3 A;  3NMD A;  1HJB A;  1NAF A;  1L4A C;  2QM8 A;  4GT1 A;  2OYI A;  2KP8 A;  1ZLL A;  1RF1 B;  2KB7 P;  1IJD B;  1VDF A;  2Q9I A;  4M3L A;  1NTM K;  1SFC D;  1X79 B;  3U59 A;  1KFM A;  1RF1 A;  2FFD A;  1SFC C;  1CSB A;  1KIL A;  1OWA A;  2OYH A;  1LT9 A;  2W6A A;  3MTU E;  3U1C A;  1GZL A;  2OYH B;  4DZO A;  1LT9 B;  5AVR B;  3NFQ A;  1JO5 A;  2NPS A;  1N7S B;  2I1K A;  3CL3 D;  5APW A;  4IFD K;  3KQG A;  4N6J A;  2GUV A;  2Z4E A;  1FBM A;  1SQX K;  1NO4 A;  2OYH C;  1IFI A;  1KIL C;  2WPS A;  4AUW A;  1VPC A;  1IFN A;  2C0W A;  1SVF A;  3V2Q A;  2OAR A;  1GK6 A;  2WT7 B;  2YKO A;  2FKW B;  4N78 E;  1M1J A;  1LTI C;  2R3C A;  2O1J A;  1WT6 A;  4JYB A;  3V5B A;  1URQ B;  2W27 A;  1IC2 A;  2JEE A;  5AVU B;  3G3Z A;  3HUS B;  1WRG A;  5CCH C;  3RK2 C;  3BVH A;  1IFJ A;  4O9B A;  1T2K C;  1HH0 A;  1T2K D;  2O1K A;  1RE3 C;  3HUS C;  1CZQ A;  3V4Q A;  2YO2 A;  3OJA B;  3VP8 A;  5CJ0 A;  1GD2 E;  5APX A;  3HE5 A;  3RK2 D;  1J1D C;  1FZC B;  2J59 M;  1AQ5 A;  5AVZ B;  1LWU B;  4XE5 B;  5CMZ A;  1URQ D;  4WY4 C;  5AW1 B;  1H88 A;  1DX7 A;  1MUU A;  2P7J A;  1RE4 A;  1JTH B;  4KHX A;  2H8P D;  1JTH A;  1MFZ A;  4N78 D;  1LTT C;  3MUD A;  2PP6 A;  1LT9 C;  1RF0 C;  4C7N B;  3GHG C;  4Y99 C;  1NU1 K;  1FAV A;  2M3B A;  1M7L A;  3A7O A;  4N3Y B;  1JY3 P;  3L4F A;  1IO4 A;  2KOG A;  3II6 A;  5APU A;  5AW5 B;  1FZF A;  2ZXE B;  2OYI C;  2HG5 D;  2HPC B;  3V4W A;  3GHG B;  1L4A D;  3PP5 A;  2R5B A;  5KTB A;  4HH2 A;  3M06 A;  2XNX A;  2C9L Y;  2KSJ A;  3RL0 B;  2GM4 A;  1LTJ B;  1N7S A;  3M0D C;  4GIF A;  2N1T C;  4W7Y A;  5CCH D;  1LTJ A;  1J2J B;  4WY4 B;  3E1I A;  3V2R A;  4ZKU A;  4AYC A;  2P2U A;  1FJP A;  1LWU C;  1L0N K;  2HOD B;  1J1D B;  2E43 A;  3TK1 A;  3VTP C;  1JY3 N;  2Q7C A;  1E5W A;  1YYC A;  1GU4 A;  1L4A B;  2WSC H;  5AW3 B;  2GUS A;  3IFM A;  5BVZ A;  3RL0 D;  2WT7 A;  5CHX A;  2XKM A;  2P1J A;  1GTW A;  4JYC A;  4HYT B;  1L0L K;  1KZU B;  3U1A A;  1URQ A;  3NXS A;  4EOT A;  2IFM A;  1CI6 B;  5KJ7 A;  4W7Z A;  2JJL A;  3L36 A;  1GL2 C;  3HE4 B;  1CI6 A;  3P8C D;  4AQR D;  3IR9 A;  3M91 A;  5AVY B;  3OA7 A;  4WB4 A;  2FXM A;  3HD7 A;  3KYQ A;  1S9K E;  1FZC A;  2C9N Y;  2H43 A;  1XTG B;  2FYZ A;  1DEB A;  5APY A;  1NWQ A;  3HE5 B;  2YNY A;  5APT A;  3LW5 H;  1OXZ A;  1N86 A;  1FZC C;  5AVT B;  1KIL D;  1FZE A;  2WPQ A;  1FDM A;  3T97 A;  3O8Z A;  5AVV B;  4C7N A;  1ZR2 A;  1JY2 O;  1ZN5 A;  5KJ7 C;  1JNM A;  1SQB K;  2HFE D;  3KDP B;  1FJK A;  5CCG A;  5AVQ B;  3VYI A;  1N7S D;  4I1L A;  3B5N A;  3HTK B;  1KFN A;  1FZG A;  3B5N B;  2C0X A;  2HYN A;  3V2N A;  1HBW A;  1N73 C;  2YKQ A;  2WZ7 A;  2E42 A;  1SQP K;  5APQ A;  1JCC A;  1EQ7 A;  1SQV K;  2XV5 A;  5AW7 B;  4WBA A;  1GL2 D;  3VMY A;  5CCG C;  2WTY A;  3L35 A;  2HPC A;  3LIE A;  1GDT A;  3WMM 0;  1LTS C;  1NOH A;  2NPS B;  3CLQ A;  3MIW A;  3NTN A;  4GKG A;  2N1T B;  1LTJ C;  1LTG C;  3SWY A;  3P32 A;  2R5D A;  3C9I A;  3V2P A;  2HOD A;  4W80 A;  3H32 A;  3H6P A;  2WIT A;  4C46 A;  4XA4 A;  1G2C B;  1FU1 A;  5BU5 A;  1IFM A;  2VRS A;  1JY3 O;  2WSF H;  2ZFC A;  2L5G B;  1IFD A;  1SFC B;  1N7L A;  1M1J B;  4ZKP A;  2BAS A;  4IFF A;  1N73 A;  2H7H A;  1LGH B;  3RK3 D;  3L37 A;  1N2D C;  3VMX A;  2IPP A;  2N1T D;  1XTC C;  4Y99 B;  2A45 H;  2PAJ A;  1KQL A;  1T3U A;  4WY4 D;  3M9B A;  3P8M C;  1J1E C;  1NTZ K;  1G1J A;  2KYV A;  5AVW B;  1T8Z A;  2A45 G;  4B86 A;  1RE4 C;  1YTZ T;  1DH3 A;  3TSI A;  2XZR A;  5KLV K;  3A5T A;  1QL1 A;  2N9B A;  5CCG D;  2MJZ A;  1GW3 A;  3B5N D;  1LTB C;  1YTZ I;  2YMY A;  1JUN A;  4LLH A;  3RK3 C;  5AVX B;  2KLV A;  2Z5H A;  1H8A A;  3BAT A;  1T3J A;  2QM7 A;  2I1J A;  3EQ2 A;  1HTL C;  1NKN A;  1NTK K;  1J1E B;  1JOC A;  3RL0 C;  1N7S C;  1JY2 N;  1SQQ K;  1GL2 A;  2R32 A;  3LID A;  1FZB A;  2IX7 C;  4IFM A;  3HTK A;  1HVV A;  2CPB A;  3M9H A;  5AW2 B;  2W6B A;  5AW0 B;  1MZ9 A;  3P7K A;  2OYI B;  1HUC A;  3N7N A;  1NHL A;  1A02 J;  1CW5 A;  1KIL B;  1X9V A;  3B5N C;  2YKP A;  2Q5U A;  4LGD E;  3TYY A;  3VP9 A;  4EIJ A;  2IFN A;  1H89 A;  2HLO A;  3GHG A;  1HGV A;  1ZV8 A;  4I6M C;  5AW4 B;  5AW6 B;  1GW4 A;  1GU5 A;  1JMM A;  2FFD B;  5APV A;  3BRV B;  2Q3I A;  2WWW A;  2NPS C;  3H32 B;  3MD0 A;  1SLQ A;  2N1T A;  1JY2 P;  3M0D A;  4JF7 A;  4WY4 A;  2WPR A;  3BAS A;  3SWF A;  1SFC A;  2FFD C;  2J58 A;  1RF1 C;  2P67 A;  5BU8 B;  1MV8 A;  1N73 B;  1G2C A;  1NH4 A;  5APS A;  4C7R A;  1L4A A;  3R2P A;  1X8Y A;  3HD7 C;  3A3Y B;  3P8C E;  2XU6 A;  1Z56 A;  3UIA A;  1JCD A;  2NPS D;  3A2A A;  1QL2 A;  1RE3 A;  3HUS A;  1AFO A;  3TNU A;  1A02 F;  3CI9 A;  3HRN A;  3TNU B;  1RF0 A;  1URQ C;  5CCH A;  2O01 H;  1ZR4 A;  5AW9 B;  1IK9 A;  1GK4 A;  1RY3 A;  1PFI A;  3HE4 A;  4I2L C;  3I5C A;  5AW8 B;  1M1J C;  3BRT B;  1FZA A;  1S9K D;  3HD7 B;  2Z5I A;  3B8E B;  2FYU K;  4LC1 A;  3VOP A;  3RK3 B;  3MGN A;  4DOJ A;  4RES B;  3EFG A;  1LWU A;  3KPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...