3MTUE

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
67
Chain Sequence
PEEHEDILNKLLDPQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tropomyosin alpha-1 chain,Microtubule-associated protein RP/
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 23
structure length 67
sequence length 70
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mtuE00
4IFFA 1NO4A 1NOHA 3MTUE 3OA7A
chains in the Genus database with same CATH superfamily
4JYCA 2Y0EA 3N4XA 5B66H 2RN0A 3VP9A 1SQVE 4H44C 2ZFCA 1A02J 2R44A 2OTLP 2FYUG 2H88C 1W2BO 3G9RA 2KXPB 2NRGA 2FYUD 3V6IA 2PP6A 1L2PA 5AW3B 3AEAC 1OVUA 2KZJA 3OJAB 1S5LX 5M1BA 3VMXA 2O1KA 1X9VA 1KILD 2Q9IA 3TDKA 1L0NE 1WMKA 3BRTB 3TGUJ 1R8EA 5AVZB 3TSIA 1LTTC 5AW0B 2XNDH 1BGYJ 4IOIH 3RL0D 1VQLP 1S5LE 1JMBA 1NTZJ 5B66E 2B89A 2ITAA 4IFMA 3H1HG 1ZP0C 3M9BA 2QRXA 3VP8A 5AW5B 3NMDA 1KZUB 2DW3A 3LIEA 1AA0A 2WPQA 2HODA 1K05A 1VL2A 3H1JJ 1CI6A 1SFCA 1BCCJ 3M91A 2FXMA 1SS1A 3CCLP 3CCSP 1KQFB 1KYOH 4N3YB 1NAFA 4IL6X 1LTIC 2WSEH 3MZWB 3GF3A 1W5CE 1FDMA 3AE3C 2E43A 1SQBD 4JYBA 3CPWO 2BEQD 2ZYAA 1RF1C 3OAKA 4W7YA 1VF5B 5AVSB 2FFDA 1KQSO 2I1JA 2KNCA 1BE3G 4GT1A 1PIXA 2A45H 2IFMA 1N7SA 1BE3E 2QA4P 4KHXA 3T97A 3CD6P 4NPFX 1T3JA 4L75A 1G2CA 2MJZA 1EXJA 1MFTA 2Y9YA 1KYOE 1NJIQ 3Q5SA 1L4AC 2WT7B 3VMAA 1M56D 1JTHB 3HRNA 1NTZE 1JOCA 1FZBA 2Q6QA 1H8AA 5KJ7C 3B5NB 1OW7A 1FS0E 2Q3EA 4C7RA 1S4XA 2A45G 4D6TD 2AEJA 1FOSE 4JBZA 2W83C 4H0LD 3RK2D 5CJ0A 1E5WA 2WSCH 3L73G 3H1LG 3A0HH 3AE1C 1YITP 3CCEP 1BDDA 4IFFA 3L73D 5APSA 3H1LD 3H1JE 1ZW0A 5CMZA 1VQ6P 2QJYB 4N6JA 1OX3A 1YJWP 5CBOA 1GD2E 5C39A 1HF9A 1FBMA 2QIWA 1M1JA 5KAIH 1KYOI 4PD4D 4Y28J 1YJNP 2C0WA 2AEFA 1SQPJ 5CCGA 5EFWB 3MD0A 1M90Q 1JB0J 1EQ7A 2B87B 5KLVK 1K9MQ 2OYIA 3G6EP 4A7PA 1SQQG 1RF0C 1RQVA 3RK3E 4PV1C 1TU3F 1ZN5A 2KSJA 3KDPB 2ZT9D 1GL2C 3M06A 3C8VA 3A0HE 4AUWA 3RGUA 1FZFA 2E76B 1IFDA 1VDFA 2YMKA 2O01N 1DEBA 1LJ2A 1IK9A 2W6AA 3CWBG 2YO2A 1QGKB 3OA7A 1H89A 1QVFO 3CCQP 2R32A 3P8MC 5KAIE 3CWBD 1J1EC 1SQXK 3HE4B 1X79B 1GU5A 2ZYDA 2NPSC 2E5YA 1NO4A 3L71J 2FKWB 1GK4A 5KLVJ 2E74C 3CMAP 2YKPA 1P84D 1NYHA 2KB7P 2QM7A 3AE7C 1EXIA 3BVHA 4GKGA 3OW2O 4K3AA 5GTHE 2OYHA 1IO4A 1CI6B 1SFCB 1DH3A 1H0TA 3WUTA 3RL0C 2OTJP 1J1DB 3SSUA 1OWAA 1Q82Q 1NTME 1PP9D 2GM4A 5CCHD 1IFPA 3H6PA 1AJYA 1SQPE 1HBWA 3SWYA 3MIWA 2IBZE 1SQXJ 4RESB 2FYUK 4RO0A 1U7JA 1KTMA 3H1IJ 3AEGC 2FFDB 2K9JA 4EIJA 2YO3A 2KNCB 2XZRA 1FJPA 3CC7P 1GK6A 1M8OB 3N7NA 4BRYA 3CCJP 3CC2P 2RH0A 4ZNCA 3A3YB 2KSEA 1VF5D 3T97B 1VQ9P 1AQ5A 3H1KD 3SFEC 3L72J 5KKZB 2H43A 4ZKUA 2P67A 4U3FE 4I1LA 3IR9A 1IFJA 1YTZI 2BCCG 1EZVE 1YHQP 1PV3A 2YNYA 1VQPP 2BCCE 5B5EH 1AVYA 5E79H 1GU4A 3ITKA 1L4AA 1U7MA 2GA1A 3L71E 3L74E 2Y0CA 2FYUJ 1S2EA 1NOHA 5CJ4A 4HB1A 1VQOP 1RQUA 4L73A 3Q1MA 2FY8A 1AV1A 5AVYB 3B5ND 3PP5A 3CX5H 3MHVA 1SQBK 3FGAD 4WY4C 3FX0A 1NTKG 1G1IA 2P1JA 4K35A 2GUSA 2QJPC 1K8AQ 3BATA 1FE6A 1NTKD 5B5EE 3L70D 1NU1G 4U7JA 2POHA 1L0LE 3D6ZA 2B9BA 4N78E 1ZRTE 1EZVI 3B71A 3G71P 2R3SA 3CXHH 1NU1E 3EWKA 1SQXE 4L76A 5APWA 1SP4A 2OYIB 1R5LA 1RE3C 4H0LC 2R5DA 3H1IE 2D2CC 1PZQA 2Q7CA 2KLVA 3RK2C 2M3EA 3Q2YA 2G3AA 4I7ZC 4JPZB 1K73Q 1PGQA 1FU1A 1KC8Q 4H44B 1FDOA 3CX5E 3PJSK 2WVRA 1LT9C 3RK3B 1FC2C 1SQVG 1S5LH 3KHUA 1S9KE 1RF0A 2B87A 1X8YA 1QL2A 1SQVD 2L5GB 2MKVA 4GODA 1SQBJ 2JDIH 4R4LA 2E76D 3LW5J 3CXHE 2L91A 4YXWH 1IJDB 3BCCJ 4L74A 4R4MA 1LTGC 3FXDA 3TNUB 1W2EA 2Z4EA 3VYIA 3L75E 3C1LA 2C0XA 1L0NG 1Q86Q 3V5BA 3II6A 4GDOA 1KQLA 1URQA 2ZT9C 2NPSA 1L0ND 2GUVA 1S72P 3P7KA 1N73C 1VQNP 1LTJA 3HE4A 1XTGB 1FZCA 2W6JH 2OYHB 3NTNA 3CX5I 1R5SA 3WUVA 1IFNA 1H0TB 1VQ4P 4XA4A 4IL6H 3H1HD 4DJGA 1JY2N 2IX7C 3CC4P 3LW5H 3HUSC 2P10A 2WSFJ 1SFCD 2HYNA 3CXHI 1KFMA 3AE8C 3KPEA 4D6TJ 3E1IA 4YPCA 4UB8E 5K5GB 2WPSA 2K9JB 3Q3DA 2KYVA 4I6MC 1EDKA 1OIPA 1KV4A 3EFFK 4BRYB 3GMAA 4B86A 3L73J 2SPZA 3H1LJ 2ZXXA 5CBNA 5BU8B 4W7ZA 1GMJA 1ZV8A 2E5TA 1LTAC 2ZXEB 2IFNA 1BDCA 3CCVP 3V2QA 4UB6E 3KZIH 2JKVA 3AE9C 1H88A 1Z56A 1N7SD 4IL6E 3L36A 2ZVOB 1GDTA 1YIJP 3KQGA 2WQYC 3BCCE 4LLHA 4DCKA 4ASWA 1RY3A 4EI2A 1BE3D 3VMYA 1IFMA 2K88A 1L4AB 2FXPA 2N9BA 1KN7A 3A2AA 4Y99C 1GW4A 4OVNF 1KYOD 3TGUE 1OFCX 1LP1A 1VF5C 3K5BA 3I55P 4XFJA 1EC5A 5KLIC 2N1TC 1Q7YQ 4H13C 1BGYE 1NTZG 4KJMA 2IDBA 1DD4A 2CPBA 2YKOA 3CWBJ 3KZIE 5AVVB 3HTKA 3D71A 2FYNB 3MP7B 2ZYGA 2Q1KA 1GTWA 5AVUB 3GG2A 3TK1A 1BSHA 1N7LA 2Z5HA 1N8RQ 1X0TA 2YIUC 4BWNA 4WY4A 2E75B 3EFGA 1KB9H 3WMM0 2QSIA 3H1JG 3HD7C 3U1CA 2G8YA 1JCDA 1RHZB 1BCCG 4D6TE 1CSBA 1BCCE 3B5NC 1FZAA 2I8DA 5CCGD 1WT6A 2QM8A 1RE3A 1PFIA 3RL0g 4OGQC 2AXCA 3GHGA 1GW3A 4PD4E 1PP9J 4H44D 3CI9A 1SQQD 4KT0J 3RK3D 3G3ZA 2QG4A 1T8ZA 3FWNA 1KB9E 2P2UA 1IZNB 2ZVNB 2R3CA 3IN6A 1LWUC 1J1EB 1GZLA 1LT1A 5GTHH 1OMIA 1URQB 2M0BA 2HFED 2NPSB 1WRGA 3HE5A 3AE6C 1LTJB 3H1KJ 3E7KA 5DJTB 3KYQA 1ZMEC 1NTKK 5GTIH 1FZCB 2W27A 3TNUA 3CL3D 2E74B 4LGDE 5H2FH 1EDJA 2E76C 3VTPC 3QWOC 1JEKA 1PPJE 1N73A 2O01J 3W67A 4PD4I 1S1CX 1KILC 5TISH 3AEFC 2IYOA 3AEEC 3U59A 4M3LA 3ZDMA 1KB9I 2CPSA 2KOGA 3B8EB 2KIKA 1P84E 4GIFA 3HUSA 3V4WA 3PH0A 1NTMG 5AW1B 3M0AA 1SQVK 1QL1A 1SQPG 2IBZG 5GTIE 1NTMD 1SQPD 5H2FE 3NXSA 3GF7A 1PGJA 2Z5IA 4EOTA 2A06E 1NTKJ 1UIXA 1HUCA 4HH2A 2PFXA 3L70J 3ABVC 4IFDK 1PP9E 1RH5B 3P8CE 3AE4C 2M5AB 1PGOA 5TISE 1L0NK 3D6YA 2HPCB 2V7QJ 3RBXA 1RF1A 2WSSH 3PRJA 4U3FG 1VQ8P 2UWJE 1JY3N 2O3JA 4BXLA 2AXTH 1HWTC 4U3FD 1EZVG 3F5HA 1U57A 1LP1B 2CK3H 2WPRA 1EZVD 3O8ZA 2OARA 3AE5C 1L4AD 2W6BA 2BCCD 2QJKB 1NVOA 1NHLA 1SQVJ 1N7SC 4HYTB 3HTKB 4C46A 4YTPC 3L71G 3AE2C 3L74G 2IBZI 5AVQB 1G1JA 2HG5D 2N1TA 3L71D 1YI2P 3L74D 2RMZA 5KLVE 2JWAA 5KAFE 2B88A 1JUNA 1JY2P 1OVRA 5KJ7A 4WY4B 3S9OA 2E42A 3O6QA 2KP8A 1L0NJ 1YTZT 2XU6A 3W68A 5APXA 2AXTE 3S4RA 3MUDC 1L0LG 3S1KA 2E75D 2Q5UA 4CPGA 1JCCA 1NGMB 1HH0A 3HD7A 4H0LB 3V4QA 2D2CB 1L0LD 2YXRB 2OGUA 3CLQA 1SQXG 1ZRTD 1NU1D 3H1IG 1IC2A 2AEMA 1FZEA 1T6AA 3SWKA 2VRSA 4GOFA 3GHGB 5AW8B 3H1HJ 3H1ID 2C9NY 3L70E 1D7MA 1MV8A 3AEDC 1YQ3C 2LR2A 5AVXB 2XV5A 1LT9B 1T2KD 1VQKP 3BASA 1M1JC 1OZHA 1JM0A 1N86A 1OXZA 3A0BH 1Q90D 3CX5D 3JC22 4NPDA 5CCGC 1USEA 5KTBA 1S9KD 3L72E 2OYIC 1HGVA 1QX8A 3HE5B 1QVGO 4AYCA 2WWWA 1GL2A 3TYYA 1DEEG 1OW6A 3CXHD 1PGPA 3L75G 2ZT9B 1URQD 2FBWC 2K1AA 5APQA 2NPSD 3L75D 1KORA 3WU2H 3RK3C 1N73B 1YJ9P 4UB8H 3AEBC 2FYUE 3Q5PA 1HJ0A 2LXBA 4W80A 1BE3J 1IK7A 2E74D 2KK7A 3G4SP 4AQRD 3A0BE 1QLED 1Q2NA 2K37A 3C9IA 4WB4A 1KILE 2WITA 3M0DC 1EDLA 1QEXA 2WSEJ 3VOPA 3HUSB 4UB6H 1KILA 1MUUA 1FZGA 4DT0A 2WZ7A 5BVZA 4I2LC 1E79H 1ZR2A 1SQQK 1YYCA 2LXCB 5AW2B 3WU2E 1JO5A 2OYHC 3H1HE 2JWDA 3VMZA 4JF7A 2FXOA 1CW5A 2KUBA 1RF1B 3H32B 4RJTA 4RKUJ 1LTSC 4DOJA 2J59M 3I56P 3GW6A 2XDJA 5CCHC 1SQBG 1MFZA 2Y0DA 4Z1MH 2KS1B 4C7NB 2JJLA 1SQBE 3BCCG 1VQ7P 1NKNA 3V2NA 2YMYA 2IYPA 2M5AA 2PAJA 1KMIZ 2HPCA 4Y99B 3BCCD 3V2RA 2HLOA 1BSNA 2WSFH 5APYA 2N9YB 2ZAEB 5APUA 1JMMA 5AVTB 1SQQJ 4OWFA 5KLIB 2N1TB 4LC1A 3TGUG 4H13B 5CHXA 2P7JA 3PLNA 2WSCJ 2NZ2A 1EDIA 1CZQA 1JY2O 3TGUD 1BGYG 3M9HA 1AFOA 3O6QB 2W8ZA 4GOEA 3JSVC 1BGYD 2C9LY 3L37A 4JQ0D 1NTMK 3QH9A 1NTZD 2YIUB 1KQGB 1SQPK 2KLUA 1K04A 3MGNA 4WY4D 4PD4H 2ZJSE 4EYYQ 1N2DC 3HD7B 2Q3IA 4O9BA 4HKZH 1YBKA 2IPPA 4D6TG 3MUDA 3EQ2A 1X22A 2KZIA 3H1JD 1ZR4A 2FYNC 1BCCD 2D2CD 2JO1A 2OQQA 3F89A 4OGQB 1OW8A 3PTZA 1PL5A 3L73E 3H1LE 1HTLC 4MN4C 3P32A 2H89C 2XKMA 2E75C 2JP3A 1JY3P 4PV1B 3SWFA 1RE4C 4WVZA 4ZKPA 1GL2B 1NTMJ 2QJYC 1FJKA 4NPEA 1LT9A 1LWUB 4OH8B 1FAVA 1KB9D 1NKZB 1NAYA 2R5BA 1HJBA 1T2KC 1DIPA 1SQQE 1MZ9A 1HVVA 1P84H 3L35A 3JCUH 2PGDA 2A45I 1NH4A 2K3RA 5AW9B 2M3BA 4PJ0H 1A02F 3CCMP 4U3FJ 3PHLA 1AVOA 3CCRP 1PPJG 1L0LK 5AW7B 1AQTA 3RBZA 3R4YA 3CWBE 2WPVB 2P58A 3M9QA 1NU1K 1Y47A 3BRVB 1PPJD 2J58A 1KILB 4YXDC 2BCCJ 2JR8A 1URQC 2K9YA 3M0DA 3AECC 1VQMP 3E1RA 1LTJC 3RL0B 1KFNA 3WUUA 4HJGH 3L74J 2V4HA 1FZCC 4XE5B 4TT3H 2W90A 3D70A 3JCUE 1M7LA 1T3UA 2Y9ZA 2BASA 4PJ0E 1XTCC 2HODB 1LNQA 3H25A 3VN0A 2A06G 1ZOYC 2IBZD 1LGHB 1FOSF 3UIAA 1PP9G 2A06D 5L8RJ 2HR3A 5APVA 1JNMA 4QMAA 1L0LJ 1SFCC 3B4SA 2O01H 3P8CD 1SVFA 2I1KA 1NU1J 1J1DC 2QVAA 5KAFH 1ZLLA 5AW6B 4ZMDA 2QEXP 3H32A 5CCHA 3Q5RA 4EDFA 3L4FA 2WMMA 1LTBC 4ASVA 1M57D 2JEEA 2H8PD 1J2JB 1N7SB 1P84I 2FFDC 2KS1A 3H1KG 1OVVA 2J5UA 5APTA 4C7NA 2PRRA 3MTUE 3CCUP 3NFQA 4WBAA 3H1KE 2RKLA 2OTKE 3IFMA 1G2CB 2N1TD 1YQ4C 4H13D 1SLQA 5AVRB 4TLFA 1S3JA 5KLVG 1HGZA 1VPCA 5KJ7D 5KKZC 1M1KQ 2YXQB 1Y9BA 2BEZF 5DJUB 1KD1Q 3R2PA 5AVWB 5KLVD 2H7HA 3I5CA 1Y8AA 3FWLA 3A5TA 1DD3A 3L75J 2KI7B 3TF5A 2V7QH 2QJKC 2QJPB 2FYZA 4WWIA 3U1AA 3HD7D 5AW4B 1DX7A 2YKQA 2WT7A 1USDA 1UIIA 1JTHA 3FXEA 2XNXA 1NWQA 2IZ1A 3CMEP 5BU5A 2IZ0A 3RK2B 4N78D 3B5NA 1JY3O 1SQXD 4I7ZB 3L70G 3V2PA 3USSA 2QE7H 1M1JB 1NTKE 1VQ5P 3A7OA 4OGQD 2OYOA 5E79E 3IF4A 4PV1D 3GLMA 3LIDA 1RE4A 2O1JA 3L72G 1GL2D 2M8RA 4DZOA 3L72D 2LKMA 1Q81Q 3GHGC 5TJHA 1NTZK 3IAOA 2WTYA 1IFIA 3SFDC 1ZXGA 1FDIA 3KXDA 1MKMA 1LWUA
chains in the Genus database with same CATH topology
3A3YB 2HPCA 4Y99B 4JYCA 3V2RA 3N4XA 2HLOA 2R3CA 1AQ5A 3VP9A 2WSFH 5APYA 1LWUC 2H43A 4ZKUA 1J1EB 2P67A 2ZFCA 4I1LA 1A02J 1GZLA 3IR9A 5APUA 1JMMA 1URQB 5AVTB 1IFJA 1YTZI 2HFED 2NPSB 2N1TB 1WRGA 3HE5A 4LC1A 5CHXA 2P7JA 1CZQA 2YNYA 1JY2O 2PP6A 1LTJB 5AW3B 3M9HA 1AFOA 3KYQA 1NTKK 3OJAB 1FZCB 2W27A 3TNUA 3CL3D 3VMXA 1GU4A 2O1KA 4LGDE 1X9VA 2C9LY 3L37A 1L4AA 1KILD 3VTPC 1NTMK 2Q9IA 1N73A 3BRTB 1SQPK 5AVZB 3MGNA 3TSIA 1NOHA 1LTTC 5CJ4A 4WY4D 5AW0B 1N2DC 3HD7B 3RL0D 5AVYB 2Q3IA 3B5ND 1KILC 3PP5A 3U59A 4O9BA 4M3LA 2IPPA 3MUDA 2CPSA 1SQBK 3EQ2A 2KOGA 3B8EB 4WY4C 4IFMA 3M9BA 1G1IA 2P1JA 3VP8A 5AW5B 3NMDA 4GIFA 2GUSA 3HUSA 3V4WA 1ZR4A 3BATA 1KZUB 5AW1B 3M0AA 1SQVK 2POHA 1QL1A 3LIEA 4N78E 2WPQA 5APWA 1SP4A 3NXSA 2OYIB 2HODA 1HTLC 1RE3C 3P32A 2XKMA 1CI6A 1SFCA 1JY3P 2R5DA 2Z5IA 3M91A 4EOTA 2Q7CA 1HUCA 2FXMA 2KLVA 4HH2A 3RK2C 3SWFA 1RE4C 4IFDK 4N3YB 1NAFA 4ZKPA 3P8CE 1GL2B 1LTIC 2WSEH 1FJKA 1FU1A 1FDMA 2E43A 1LT9A 1LWUB 1L0NK 2HPCB 4JYBA 1RF1A 4OH8B 1FAVA 1NKZB 1LT9C 3RK3B 2R5BA 1S9KE 1RF0A 1RF1C 1X8YA 1JY3N 1QL2A 1T2KC 1HJBA 3OAKA 4W7YA 2L5GB 5AVSB 2FFDA 1HWTC 1MZ9A 1HVVA 2I1JA 3L35A 4GT1A 2WPRA 3O8ZA 2OARA 2IFMA 2A45I 2A45H 1N7SA 1IJDB 1NH4A 1L4AD 2W6BA 5AW9B 1LTGC 2M3BA 3TNUB 1W2EA 1NHLA 4KHXA 2Z4EA 1A02F 1N7SC 4HYTB 3VYIA 3T97A 3HTKB 4C46A 2C0XA 1T3JA 3V5BA 1L0LK 5AW7B 1G2CA 2MJZA 3II6A 5AVQB 1KQLA 1G1JA 1URQA 3M9QA 1NU1K 3BRVB 2NPSA 2HG5D 2N1TA 2J58A 1KILB 1L4AC 2GUVA 2WT7B 1URQC 1JUNA 3P7KA 1N73C 1JTHB 1JY2P 3HRNA 1LTJA 3M0DA 3HE4A 5KJ7A 4WY4B 2E42A 1XTGB 1FZCA 1JOCA 1FZBA 1LTJC 1KFNA 3RL0B 2OYHB 3NTNA 1H8AA 2KP8A 5KJ7C 3B5NB 1YTZT 2XU6A 5APXA 1IFNA 1FZCC 4XE5B 4C7RA 2A45G 4XA4A 1FOSE 1M7LA 2Q5UA 1JCCA 1JY2N 1HH0A 3HD7A 3RK2D 1T3UA 2IX7C 5CJ0A 1E5WA 3LW5H 3V4QA 2BASA 2WSCH 3HUSC 1SFCD 3CLQA 1XTCC 2HYNA 2HODB 1KFMA 3KPEA 3VN0A 1IC2A 3E1IA 4IFFA 5APSA 1LGHB 5CMZA 1FZEA 1FOSF 4N6JA 3UIAA 2WPSA 2VRSA 5AW8B 3GHGB 1GD2E 2KYVA 4I6MC 2C9NY 1MV8A 1FBMA 5APVA 1JNMA 1M1JA 1SFCC 5AVXB 2XV5A 1LT9B 1T2KD 2O01H 3P8CD 2C0WA 1SVFA 2I1KA 3BASA 1J1DC 1M1JC 4B86A 5CCGA 1ZLLA 3MD0A 5AW6B 5BU8B 1N86A 4W7ZA 1EQ7A 1OXZA 1ZV8A 5KLVK 3H32A 5CCHA 1LTAC 5CCGC 2ZXEB 2OYIA 2IFNA 5KTBA 3V2QA 1S9KD 3L4FA 1LTBC 2OYIC 1HGVA 1H88A 1Z56A 3HE5B 4AYCA 1N7SD 1RF0C 2JEEA 2H8PD 2WWWA 1GL2A 1J2JB 3L36A 1GDTA 1N7SB 3TYYA 2FFDC 1ZN5A 2KSJA 5APTA 3KDPB 4C7NA 1GL2C 3KQGA 3M06A 3MTUE 4LLHA 4AUWA 1FZFA 3NFQA 4WBAA 1RY3A 1IFDA 1VDFA 3VMYA 1DEBA 1IFMA 1URQD 3IFMA 5APQA 1G2CB 2NPSD 2N1TD 1L4AB 1IK9A 2W6AA 2N9BA 2YO2A 1SLQA 5AVRB 3A2AA 3OA7A 3RK3C 1N73B 4Y99C 1H89A 1HGZA 1VPCA 2R32A 3P8MC 1GW4A 1LWUA 5KJ7D 1J1EC 1SQXK 3R2PA 5AVWB 2H7HA 3I5CA 4W80A 3HE4B 3A5TA 1X79B 1GU5A 2NPSC 2N1TC 4AQRD 3C9IA 4WB4A 2WITA 2CPBA 2YKOA 5AVVB 3HTKA 3M0DC 2FYZA 1NO4A 2FKWB 1GK4A 3U1AA 5AVUB 1GTWA 3HD7D 3VOPA 3HUSB 5AW4B 1DX7A 3TK1A 1KILA 2YKQA 1MUUA 1FZGA 1N7LA 2Z5HA 2WT7A 2YKPA 2KB7P 1JTHA 2QM7A 2XNXA 2WZ7A 1NWQA 3BVHA 4WY4A 5BVZA 4I2LC 3EFGA 5BU5A 4GKGA 3WMM0 1ZR2A 1SQQK 3RK2B 4N78D 1YYCA 3HD7C 5AW2B 3U1CA 2OYHA 1IO4A 1CI6B 1JCDA 3B5NA 1JY3O 1SFCB 1DH3A 1JO5A 1CSBA 3V2PA 3RL0C 2OYHC 1J1DB 1M1JB 3B5NC 1FZAA 3A7OA 1OWAA 5CCGD 3VMZA 1WT6A 4JF7A 2QM8A 2GM4A 5CCHD 1RE3A 3H6PA 1CW5A 1HBWA 1PFIA 3SWYA 1RF1B 3MIWA 3H32B 3LIDA 4RESB 1RE4A 2FYUK 2O1JA 1LTSC 4DOJA 1GL2D 2J59M 2M8RA 3GHGA 2FFDB 1GW3A 2XDJA 4DZOA 5CCHC 4EIJA 2YO3A 1MFZA 2XZRA 2LKMA 3CI9A 1FJPA 3GHGC 1NTZK 2WTYA 1GK6A 4C7NB 2JJLA 1IFIA 3N7NA 3RK3D 3G3ZA 1T8ZA 1NKNA 3V2NA 2YMYA 2PAJA 2P2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFF A;  1NO4 A;  1NOH A;  3MTU E;  3OA7 A; 
#chains in the Genus database with same CATH topology
 4JYC A;  2Y0E A;  3N4X A;  5B66 H;  2RN0 A;  3VP9 A;  1SQV E;  4H44 C;  2ZFC A;  1A02 J;  2R44 A;  2OTL P;  2FYU G;  2H88 C;  1W2B O;  3G9R A;  2KXP B;  2NRG A;  2FYU D;  3V6I A;  2PP6 A;  1L2P A;  5AW3 B;  3AEA C;  1OVU A;  2KZJ A;  3OJA B;  1S5L X;  5M1B A;  3VMX A;  2O1K A;  1X9V A;  1KIL D;  2Q9I A;  3TDK A;  1L0N E;  1WMK A;  3BRT B;  3TGU J;  1R8E A;  5AVZ B;  3TSI A;  1LTT C;  5AW0 B;  2XND H;  1BGY J;  4IOI H;  3RL0 D;  1VQL P;  1S5L E;  1JMB A;  1NTZ J;  5B66 E;  2B89 A;  2ITA A;  4IFM A;  3H1H G;  1ZP0 C;  3M9B A;  2QRX A;  3VP8 A;  5AW5 B;  3NMD A;  1KZU B;  2DW3 A;  3LIE A;  1AA0 A;  2WPQ A;  2HOD A;  1K05 A;  1VL2 A;  3H1J J;  1CI6 A;  1SFC A;  1BCC J;  3M91 A;  2FXM A;  1SS1 A;  3CCL P;  3CCS P;  1KQF B;  1KYO H;  4N3Y B;  1NAF A;  4IL6 X;  1LTI C;  2WSE H;  3MZW B;  3GF3 A;  1W5C E;  1FDM A;  3AE3 C;  2E43 A;  1SQB D;  4JYB A;  3CPW O;  2BEQ D;  2ZYA A;  1RF1 C;  3OAK A;  4W7Y A;  1VF5 B;  5AVS B;  2FFD A;  1KQS O;  2I1J A;  2KNC A;  1BE3 G;  4GT1 A;  1PIX A;  2A45 H;  2IFM A;  1N7S A;  1BE3 E;  2QA4 P;  4KHX A;  3T97 A;  3CD6 P;  4NPF X;  1T3J A;  4L75 A;  1G2C A;  2MJZ A;  1EXJ A;  1MFT A;  2Y9Y A;  1KYO E;  1NJI Q;  3Q5S A;  1L4A C;  2WT7 B;  3VMA A;  1M56 D;  1JTH B;  3HRN A;  1NTZ E;  1JOC A;  1FZB A;  2Q6Q A;  1H8A A;  5KJ7 C;  3B5N B;  1OW7 A;  1FS0 E;  2Q3E A;  4C7R A;  1S4X A;  2A45 G;  4D6T D;  2AEJ A;  1FOS E;  4JBZ A;  2W83 C;  4H0L D;  3RK2 D;  5CJ0 A;  1E5W A;  2WSC H;  3L73 G;  3H1L G;  3A0H H;  3AE1 C;  1YIT P;  3CCE P;  1BDD A;  4IFF A;  3L73 D;  5APS A;  3H1L D;  3H1J E;  1ZW0 A;  5CMZ A;  1VQ6 P;  2QJY B;  4N6J A;  1OX3 A;  1YJW P;  5CBO A;  1GD2 E;  5C39 A;  1HF9 A;  1FBM A;  2QIW A;  1M1J A;  5KAI H;  1KYO I;  4PD4 D;  4Y28 J;  1YJN P;  2C0W A;  2AEF A;  1SQP J;  5CCG A;  5EFW B;  3MD0 A;  1M90 Q;  1JB0 J;  1EQ7 A;  2B87 B;  5KLV K;  1K9M Q;  2OYI A;  3G6E P;  4A7P A;  1SQQ G;  1RF0 C;  1RQV A;  3RK3 E;  4PV1 C;  1TU3 F;  1ZN5 A;  2KSJ A;  3KDP B;  2ZT9 D;  1GL2 C;  3M06 A;  3C8V A;  3A0H E;  4AUW A;  3RGU A;  1FZF A;  2E76 B;  1IFD A;  1VDF A;  2YMK A;  2O01 N;  1DEB A;  1LJ2 A;  1IK9 A;  2W6A A;  3CWB G;  2YO2 A;  1QGK B;  3OA7 A;  1H89 A;  1QVF O;  3CCQ P;  2R32 A;  3P8M C;  5KAI E;  3CWB D;  1J1E C;  1SQX K;  3HE4 B;  1X79 B;  1GU5 A;  2ZYD A;  2NPS C;  2E5Y A;  1NO4 A;  3L71 J;  2FKW B;  1GK4 A;  5KLV J;  2E74 C;  3CMA P;  2YKP A;  1P84 D;  1NYH A;  2KB7 P;  2QM7 A;  3AE7 C;  1EXI A;  3BVH A;  4GKG A;  3OW2 O;  4K3A A;  5GTH E;  2OYH A;  1IO4 A;  1CI6 B;  1SFC B;  1DH3 A;  1H0T A;  3WUT A;  3RL0 C;  2OTJ P;  1J1D B;  3SSU A;  1OWA A;  1Q82 Q;  1NTM E;  1PP9 D;  2GM4 A;  5CCH D;  1IFP A;  3H6P A;  1AJY A;  1SQP E;  1HBW A;  3SWY A;  3MIW A;  2IBZ E;  1SQX J;  4RES B;  2FYU K;  4RO0 A;  1U7J A;  1KTM A;  3H1I J;  3AEG C;  2FFD B;  2K9J A;  4EIJ A;  2YO3 A;  2KNC B;  2XZR A;  1FJP A;  3CC7 P;  1GK6 A;  1M8O B;  3N7N A;  4BRY A;  3CCJ P;  3CC2 P;  2RH0 A;  4ZNC A;  3A3Y B;  2KSE A;  1VF5 D;  3T97 B;  1VQ9 P;  1AQ5 A;  3H1K D;  3SFE C;  3L72 J;  5KKZ B;  2H43 A;  4ZKU A;  2P67 A;  4U3F E;  4I1L A;  3IR9 A;  1IFJ A;  1YTZ I;  2BCC G;  1EZV E;  1YHQ P;  1PV3 A;  2YNY A;  1VQP P;  2BCC E;  5B5E H;  1AVY A;  5E79 H;  1GU4 A;  3ITK A;  1L4A A;  1U7M A;  2GA1 A;  3L71 E;  3L74 E;  2Y0C A;  2FYU J;  1S2E A;  1NOH A;  5CJ4 A;  4HB1 A;  1VQO P;  1RQU A;  4L73 A;  3Q1M A;  2FY8 A;  1AV1 A;  5AVY B;  3B5N D;  3PP5 A;  3CX5 H;  3MHV A;  1SQB K;  3FGA D;  4WY4 C;  3FX0 A;  1NTK G;  1G1I A;  2P1J A;  4K35 A;  2GUS A;  2QJP C;  1K8A Q;  3BAT A;  1FE6 A;  1NTK D;  5B5E E;  3L70 D;  1NU1 G;  4U7J A;  2POH A;  1L0L E;  3D6Z A;  2B9B A;  4N78 E;  1ZRT E;  1EZV I;  3B71 A;  3G71 P;  2R3S A;  3CXH H;  1NU1 E;  3EWK A;  1SQX E;  4L76 A;  5APW A;  1SP4 A;  2OYI B;  1R5L A;  1RE3 C;  4H0L C;  2R5D A;  3H1I E;  2D2C C;  1PZQ A;  2Q7C A;  2KLV A;  3RK2 C;  2M3E A;  3Q2Y A;  2G3A A;  4I7Z C;  4JPZ B;  1K73 Q;  1PGQ A;  1FU1 A;  1KC8 Q;  4H44 B;  1FDO A;  3CX5 E;  3PJS K;  2WVR A;  1LT9 C;  3RK3 B;  1FC2 C;  1SQV G;  1S5L H;  3KHU A;  1S9K E;  1RF0 A;  2B87 A;  1X8Y A;  1QL2 A;  1SQV D;  2L5G B;  2MKV A;  4GOD A;  1SQB J;  2JDI H;  4R4L A;  2E76 D;  3LW5 J;  3CXH E;  2L91 A;  4YXW H;  1IJD B;  3BCC J;  4L74 A;  4R4M A;  1LTG C;  3FXD A;  3TNU B;  1W2E A;  2Z4E A;  3VYI A;  3L75 E;  3C1L A;  2C0X A;  1L0N G;  1Q86 Q;  3V5B A;  3II6 A;  4GDO A;  1KQL A;  1URQ A;  2ZT9 C;  2NPS A;  1L0N D;  2GUV A;  1S72 P;  3P7K A;  1N73 C;  1VQN P;  1LTJ A;  3HE4 A;  1XTG B;  1FZC A;  2W6J H;  2OYH B;  3NTN A;  3CX5 I;  1R5S A;  3WUV A;  1IFN A;  1H0T B;  1VQ4 P;  4XA4 A;  4IL6 H;  3H1H D;  4DJG A;  1JY2 N;  2IX7 C;  3CC4 P;  3LW5 H;  3HUS C;  2P10 A;  2WSF J;  1SFC D;  2HYN A;  3CXH I;  1KFM A;  3AE8 C;  3KPE A;  4D6T J;  3E1I A;  4YPC A;  4UB8 E;  5K5G B;  2WPS A;  2K9J B;  3Q3D A;  2KYV A;  4I6M C;  1EDK A;  1OIP A;  1KV4 A;  3EFF K;  4BRY B;  3GMA A;  4B86 A;  3L73 J;  2SPZ A;  3H1L J;  2ZXX A;  5CBN A;  5BU8 B;  4W7Z A;  1GMJ A;  1ZV8 A;  2E5T A;  1LTA C;  2ZXE B;  2IFN A;  1BDC A;  3CCV P;  3V2Q A;  4UB6 E;  3KZI H;  2JKV A;  3AE9 C;  1H88 A;  1Z56 A;  1N7S D;  4IL6 E;  3L36 A;  2ZVO B;  1GDT A;  1YIJ P;  3KQG A;  2WQY C;  3BCC E;  4LLH A;  4DCK A;  4ASW A;  1RY3 A;  4EI2 A;  1BE3 D;  3VMY A;  1IFM A;  2K88 A;  1L4A B;  2FXP A;  2N9B A;  1KN7 A;  3A2A A;  4Y99 C;  1GW4 A;  4OVN F;  1KYO D;  3TGU E;  1OFC X;  1LP1 A;  1VF5 C;  3K5B A;  3I55 P;  4XFJ A;  1EC5 A;  5KLI C;  2N1T C;  1Q7Y Q;  4H13 C;  1BGY E;  1NTZ G;  4KJM A;  2IDB A;  1DD4 A;  2CPB A;  2YKO A;  3CWB J;  3KZI E;  5AVV B;  3HTK A;  3D71 A;  2FYN B;  3MP7 B;  2ZYG A;  2Q1K A;  1GTW A;  5AVU B;  3GG2 A;  3TK1 A;  1BSH A;  1N7L A;  2Z5H A;  1N8R Q;  1X0T A;  2YIU C;  4BWN A;  4WY4 A;  2E75 B;  3EFG A;  1KB9 H;  3WMM 0;  2QSI A;  3H1J G;  3HD7 C;  3U1C A;  2G8Y A;  1JCD A;  1RHZ B;  1BCC G;  4D6T E;  1CSB A;  1BCC E;  3B5N C;  1FZA A;  2I8D A;  5CCG D;  1WT6 A;  2QM8 A;  1RE3 A;  1PFI A;  3RL0 g;  4OGQ C;  2AXC A;  3GHG A;  1GW3 A;  4PD4 E;  1PP9 J;  4H44 D;  3CI9 A;  1SQQ D;  4KT0 J;  3RK3 D;  3G3Z A;  2QG4 A;  1T8Z A;  3FWN A;  1KB9 E;  2P2U A;  1IZN B;  2ZVN B;  2R3C A;  3IN6 A;  1LWU C;  1J1E B;  1GZL A;  1LT1 A;  5GTH H;  1OMI A;  1URQ B;  2M0B A;  2HFE D;  2NPS B;  1WRG A;  3HE5 A;  3AE6 C;  1LTJ B;  3H1K J;  3E7K A;  5DJT B;  3KYQ A;  1ZME C;  1NTK K;  5GTI H;  1FZC B;  2W27 A;  3TNU A;  3CL3 D;  2E74 B;  4LGD E;  5H2F H;  1EDJ A;  2E76 C;  3VTP C;  3QWO C;  1JEK A;  1PPJ E;  1N73 A;  2O01 J;  3W67 A;  4PD4 I;  1S1C X;  1KIL C;  5TIS H;  3AEF C;  2IYO A;  3AEE C;  3U59 A;  4M3L A;  3ZDM A;  1KB9 I;  2CPS A;  2KOG A;  3B8E B;  2KIK A;  1P84 E;  4GIF A;  3HUS A;  3V4W A;  3PH0 A;  1NTM G;  5AW1 B;  3M0A A;  1SQV K;  1QL1 A;  1SQP G;  2IBZ G;  5GTI E;  1NTM D;  1SQP D;  5H2F E;  3NXS A;  3GF7 A;  1PGJ A;  2Z5I A;  4EOT A;  2A06 E;  1NTK J;  1UIX A;  1HUC A;  4HH2 A;  2PFX A;  3L70 J;  3ABV C;  4IFD K;  1PP9 E;  1RH5 B;  3P8C E;  3AE4 C;  2M5A B;  1PGO A;  5TIS E;  1L0N K;  3D6Y A;  2HPC B;  2V7Q J;  3RBX A;  1RF1 A;  2WSS H;  3PRJ A;  4U3F G;  1VQ8 P;  2UWJ E;  1JY3 N;  2O3J A;  4BXL A;  2AXT H;  1HWT C;  4U3F D;  1EZV G;  3F5H A;  1U57 A;  1LP1 B;  2CK3 H;  2WPR A;  1EZV D;  3O8Z A;  2OAR A;  3AE5 C;  1L4A D;  2W6B A;  2BCC D;  2QJK B;  1NVO A;  1NHL A;  1SQV J;  1N7S C;  4HYT B;  3HTK B;  4C46 A;  4YTP C;  3L71 G;  3AE2 C;  3L74 G;  2IBZ I;  5AVQ B;  1G1J A;  2HG5 D;  2N1T A;  3L71 D;  1YI2 P;  3L74 D;  2RMZ A;  5KLV E;  2JWA A;  5KAF E;  2B88 A;  1JUN A;  1JY2 P;  1OVR A;  5KJ7 A;  4WY4 B;  3S9O A;  2E42 A;  3O6Q A;  2KP8 A;  1L0N J;  1YTZ T;  2XU6 A;  3W68 A;  5APX A;  2AXT E;  3S4R A;  3MUD C;  1L0L G;  3S1K A;  2E75 D;  2Q5U A;  4CPG A;  1JCC A;  1NGM B;  1HH0 A;  3HD7 A;  4H0L B;  3V4Q A;  2D2C B;  1L0L D;  2YXR B;  2OGU A;  3CLQ A;  1SQX G;  1ZRT D;  1NU1 D;  3H1I G;  1IC2 A;  2AEM A;  1FZE A;  1T6A A;  3SWK A;  2VRS A;  4GOF A;  3GHG B;  5AW8 B;  3H1H J;  3H1I D;  2C9N Y;  3L70 E;  1D7M A;  1MV8 A;  3AED C;  1YQ3 C;  2LR2 A;  5AVX B;  2XV5 A;  1LT9 B;  1T2K D;  1VQK P;  3BAS A;  1M1J C;  1OZH A;  1JM0 A;  1N86 A;  1OXZ A;  3A0B H;  1Q90 D;  3CX5 D;  3JC2 2;  4NPD A;  5CCG C;  1USE A;  5KTB A;  1S9K D;  3L72 E;  2OYI C;  1HGV A;  1QX8 A;  3HE5 B;  1QVG O;  4AYC A;  2WWW A;  1GL2 A;  3TYY A;  1DEE G;  1OW6 A;  3CXH D;  1PGP A;  3L75 G;  2ZT9 B;  1URQ D;  2FBW C;  2K1A A;  5APQ A;  2NPS D;  3L75 D;  1KOR A;  3WU2 H;  3RK3 C;  1N73 B;  1YJ9 P;  4UB8 H;  3AEB C;  2FYU E;  3Q5P A;  1HJ0 A;  2LXB A;  4W80 A;  1BE3 J;  1IK7 A;  2E74 D;  2KK7 A;  3G4S P;  4AQR D;  3A0B E;  1QLE D;  1Q2N A;  2K37 A;  3C9I A;  4WB4 A;  1KIL E;  2WIT A;  3M0D C;  1EDL A;  1QEX A;  2WSE J;  3VOP A;  3HUS B;  4UB6 H;  1KIL A;  1MUU A;  1FZG A;  4DT0 A;  2WZ7 A;  5BVZ A;  4I2L C;  1E79 H;  1ZR2 A;  1SQQ K;  1YYC A;  2LXC B;  5AW2 B;  3WU2 E;  1JO5 A;  2OYH C;  3H1H E;  2JWD A;  3VMZ A;  4JF7 A;  2FXO A;  1CW5 A;  2KUB A;  1RF1 B;  3H32 B;  4RJT A;  4RKU J;  1LTS C;  4DOJ A;  2J59 M;  3I56 P;  3GW6 A;  2XDJ A;  5CCH C;  1SQB G;  1MFZ A;  2Y0D A;  4Z1M H;  2KS1 B;  4C7N B;  2JJL A;  1SQB E;  3BCC G;  1VQ7 P;  1NKN A;  3V2N A;  2YMY A;  2IYP A;  2M5A A;  2PAJ A;  1KMI Z;  2HPC A;  4Y99 B;  3BCC D;  3V2R A;  2HLO A;  1BSN A;  2WSF H;  5APY A;  2N9Y B;  2ZAE B;  5APU A;  1JMM A;  5AVT B;  1SQQ J;  4OWF A;  5KLI B;  2N1T B;  4LC1 A;  3TGU G;  4H13 B;  5CHX A;  2P7J A;  3PLN A;  2WSC J;  2NZ2 A;  1EDI A;  1CZQ A;  1JY2 O;  3TGU D;  1BGY G;  3M9H A;  1AFO A;  3O6Q B;  2W8Z A;  4GOE A;  3JSV C;  1BGY D;  2C9L Y;  3L37 A;  4JQ0 D;  1NTM K;  3QH9 A;  1NTZ D;  2YIU B;  1KQG B;  1SQP K;  2KLU A;  1K04 A;  3MGN A;  4WY4 D;  4PD4 H;  2ZJS E;  4EYY Q;  1N2D C;  3HD7 B;  2Q3I A;  4O9B A;  4HKZ H;  1YBK A;  2IPP A;  4D6T G;  3MUD A;  3EQ2 A;  1X22 A;  2KZI A;  3H1J D;  1ZR4 A;  2FYN C;  1BCC D;  2D2C D;  2JO1 A;  2OQQ A;  3F89 A;  4OGQ B;  1OW8 A;  3PTZ A;  1PL5 A;  3L73 E;  3H1L E;  1HTL C;  4MN4 C;  3P32 A;  2H89 C;  2XKM A;  2E75 C;  2JP3 A;  1JY3 P;  4PV1 B;  3SWF A;  1RE4 C;  4WVZ A;  4ZKP A;  1GL2 B;  1NTM J;  2QJY C;  1FJK A;  4NPE A;  1LT9 A;  1LWU B;  4OH8 B;  1FAV A;  1KB9 D;  1NKZ B;  1NAY A;  2R5B A;  1HJB A;  1T2K C;  1DIP A;  1SQQ E;  1MZ9 A;  1HVV A;  1P84 H;  3L35 A;  3JCU H;  2PGD A;  2A45 I;  1NH4 A;  2K3R A;  5AW9 B;  2M3B A;  4PJ0 H;  1A02 F;  3CCM P;  4U3F J;  3PHL A;  1AVO A;  3CCR P;  1PPJ G;  1L0L K;  5AW7 B;  1AQT A;  3RBZ A;  3R4Y A;  3CWB E;  2WPV B;  2P58 A;  3M9Q A;  1NU1 K;  1Y47 A;  3BRV B;  1PPJ D;  2J58 A;  1KIL B;  4YXD C;  2BCC J;  2JR8 A;  1URQ C;  2K9Y A;  3M0D A;  3AEC C;  1VQM P;  3E1R A;  1LTJ C;  3RL0 B;  1KFN A;  3WUU A;  4HJG H;  3L74 J;  2V4H A;  1FZC C;  4XE5 B;  4TT3 H;  2W90 A;  3D70 A;  3JCU E;  1M7L A;  1T3U A;  2Y9Z A;  2BAS A;  4PJ0 E;  1XTC C;  2HOD B;  1LNQ A;  3H25 A;  3VN0 A;  2A06 G;  1ZOY C;  2IBZ D;  1LGH B;  1FOS F;  3UIA A;  1PP9 G;  2A06 D;  5L8R J;  2HR3 A;  5APV A;  1JNM A;  4QMA A;  1L0L J;  1SFC C;  3B4S A;  2O01 H;  3P8C D;  1SVF A;  2I1K A;  1NU1 J;  1J1D C;  2QVA A;  5KAF H;  1ZLL A;  5AW6 B;  4ZMD A;  2QEX P;  3H32 A;  5CCH A;  3Q5R A;  4EDF A;  3L4F A;  2WMM A;  1LTB C;  4ASV A;  1M57 D;  2JEE A;  2H8P D;  1J2J B;  1N7S B;  1P84 I;  2FFD C;  2KS1 A;  3H1K G;  1OVV A;  2J5U A;  5APT A;  4C7N A;  2PRR A;  3MTU E;  3CCU P;  3NFQ A;  4WBA A;  3H1K E;  2RKL A;  2OTK E;  3IFM A;  1G2C B;  2N1T D;  1YQ4 C;  4H13 D;  1SLQ A;  5AVR B;  4TLF A;  1S3J A;  5KLV G;  1HGZ A;  1VPC A;  5KJ7 D;  5KKZ C;  1M1K Q;  2YXQ B;  1Y9B A;  2BEZ F;  5DJU B;  1KD1 Q;  3R2P A;  5AVW B;  5KLV D;  2H7H A;  3I5C A;  1Y8A A;  3FWL A;  3A5T A;  1DD3 A;  3L75 J;  2KI7 B;  3TF5 A;  2V7Q H;  2QJK C;  2QJP B;  2FYZ A;  4WWI A;  3U1A A;  3HD7 D;  5AW4 B;  1DX7 A;  2YKQ A;  2WT7 A;  1USD A;  1UII A;  1JTH A;  3FXE A;  2XNX A;  1NWQ A;  2IZ1 A;  3CME P;  5BU5 A;  2IZ0 A;  3RK2 B;  4N78 D;  3B5N A;  1JY3 O;  1SQX D;  4I7Z B;  3L70 G;  3V2P A;  3USS A;  2QE7 H;  1M1J B;  1NTK E;  1VQ5 P;  3A7O A;  4OGQ D;  2OYO A;  5E79 E;  3IF4 A;  4PV1 D;  3GLM A;  3LID A;  1RE4 A;  2O1J A;  3L72 G;  1GL2 D;  2M8R A;  4DZO A;  3L72 D;  2LKM A;  1Q81 Q;  3GHG C;  5TJH A;  1NTZ K;  3IAO A;  2WTY A;  1IFI A;  3SFD C;  1ZXG A;  1FDI A;  3KXD A;  1MKM A;  1LWU A; 
#chains in the Genus database with same CATH homology
 3A3Y B;  2HPC A;  4Y99 B;  4JYC A;  3V2R A;  3N4X A;  2HLO A;  2R3C A;  1AQ5 A;  3VP9 A;  2WSF H;  5APY A;  1LWU C;  2H43 A;  4ZKU A;  1J1E B;  2P67 A;  2ZFC A;  4I1L A;  1A02 J;  1GZL A;  3IR9 A;  5APU A;  1JMM A;  1URQ B;  5AVT B;  1IFJ A;  1YTZ I;  2HFE D;  2NPS B;  2N1T B;  1WRG A;  3HE5 A;  4LC1 A;  5CHX A;  2P7J A;  1CZQ A;  2YNY A;  1JY2 O;  2PP6 A;  1LTJ B;  5AW3 B;  3M9H A;  1AFO A;  3KYQ A;  1NTK K;  3OJA B;  1FZC B;  2W27 A;  3TNU A;  3CL3 D;  3VMX A;  1GU4 A;  2O1K A;  4LGD E;  1X9V A;  2C9L Y;  3L37 A;  1L4A A;  1KIL D;  3VTP C;  1NTM K;  2Q9I A;  1N73 A;  3BRT B;  1SQP K;  5AVZ B;  3MGN A;  3TSI A;  1NOH A;  1LTT C;  5CJ4 A;  4WY4 D;  5AW0 B;  1N2D C;  3HD7 B;  3RL0 D;  5AVY B;  2Q3I A;  3B5N D;  1KIL C;  3PP5 A;  3U59 A;  4O9B A;  4M3L A;  2IPP A;  3MUD A;  2CPS A;  1SQB K;  3EQ2 A;  2KOG A;  3B8E B;  4WY4 C;  4IFM A;  3M9B A;  1G1I A;  2P1J A;  3VP8 A;  5AW5 B;  3NMD A;  4GIF A;  2GUS A;  3HUS A;  3V4W A;  1ZR4 A;  3BAT A;  1KZU B;  5AW1 B;  3M0A A;  1SQV K;  2POH A;  1QL1 A;  3LIE A;  4N78 E;  2WPQ A;  5APW A;  1SP4 A;  3NXS A;  2OYI B;  2HOD A;  1HTL C;  1RE3 C;  3P32 A;  2XKM A;  1CI6 A;  1SFC A;  1JY3 P;  2R5D A;  2Z5I A;  3M91 A;  4EOT A;  2Q7C A;  1HUC A;  2FXM A;  2KLV A;  4HH2 A;  3RK2 C;  3SWF A;  1RE4 C;  4IFD K;  4N3Y B;  1NAF A;  4ZKP A;  3P8C E;  1GL2 B;  1LTI C;  2WSE H;  1FJK A;  1FU1 A;  1FDM A;  2E43 A;  1LT9 A;  1LWU B;  1L0N K;  2HPC B;  4JYB A;  1RF1 A;  4OH8 B;  1FAV A;  1NKZ B;  1LT9 C;  3RK3 B;  2R5B A;  1S9K E;  1RF0 A;  1RF1 C;  1X8Y A;  1JY3 N;  1QL2 A;  1T2K C;  1HJB A;  3OAK A;  4W7Y A;  2L5G B;  5AVS B;  2FFD A;  1HWT C;  1MZ9 A;  1HVV A;  2I1J A;  3L35 A;  4GT1 A;  2WPR A;  3O8Z A;  2OAR A;  2IFM A;  2A45 I;  2A45 H;  1N7S A;  1IJD B;  1NH4 A;  1L4A D;  2W6B A;  5AW9 B;  1LTG C;  2M3B A;  3TNU B;  1W2E A;  1NHL A;  4KHX A;  2Z4E A;  1A02 F;  1N7S C;  4HYT B;  3VYI A;  3T97 A;  3HTK B;  4C46 A;  2C0X A;  1T3J A;  3V5B A;  1L0L K;  5AW7 B;  1G2C A;  2MJZ A;  3II6 A;  5AVQ B;  1KQL A;  1G1J A;  1URQ A;  3M9Q A;  1NU1 K;  3BRV B;  2NPS A;  2HG5 D;  2N1T A;  2J58 A;  1KIL B;  1L4A C;  2GUV A;  2WT7 B;  1URQ C;  1JUN A;  3P7K A;  1N73 C;  1JTH B;  1JY2 P;  3HRN A;  1LTJ A;  3M0D A;  3HE4 A;  5KJ7 A;  4WY4 B;  2E42 A;  1XTG B;  1FZC A;  1JOC A;  1FZB A;  1LTJ C;  1KFN A;  3RL0 B;  2OYH B;  3NTN A;  1H8A A;  2KP8 A;  5KJ7 C;  3B5N B;  1YTZ T;  2XU6 A;  5APX A;  1IFN A;  1FZC C;  4XE5 B;  4C7R A;  2A45 G;  4XA4 A;  1FOS E;  1M7L A;  2Q5U A;  1JCC A;  1JY2 N;  1HH0 A;  3HD7 A;  3RK2 D;  1T3U A;  2IX7 C;  5CJ0 A;  1E5W A;  3LW5 H;  3V4Q A;  2BAS A;  2WSC H;  3HUS C;  1SFC D;  3CLQ A;  1XTC C;  2HYN A;  2HOD B;  1KFM A;  3KPE A;  3VN0 A;  1IC2 A;  3E1I A;  4IFF A;  5APS A;  1LGH B;  5CMZ A;  1FZE A;  1FOS F;  4N6J A;  3UIA A;  2WPS A;  2VRS A;  5AW8 B;  3GHG B;  1GD2 E;  2KYV A;  4I6M C;  2C9N Y;  1MV8 A;  1FBM A;  5APV A;  1JNM A;  1M1J A;  1SFC C;  5AVX B;  2XV5 A;  1LT9 B;  1T2K D;  2O01 H;  3P8C D;  2C0W A;  1SVF A;  2I1K A;  3BAS A;  1J1D C;  1M1J C;  4B86 A;  5CCG A;  1ZLL A;  3MD0 A;  5AW6 B;  5BU8 B;  1N86 A;  4W7Z A;  1EQ7 A;  1OXZ A;  1ZV8 A;  5KLV K;  3H32 A;  5CCH A;  1LTA C;  5CCG C;  2ZXE B;  2OYI A;  2IFN A;  5KTB A;  3V2Q A;  1S9K D;  3L4F A;  1LTB C;  2OYI C;  1HGV A;  1H88 A;  1Z56 A;  3HE5 B;  4AYC A;  1N7S D;  1RF0 C;  2JEE A;  2H8P D;  2WWW A;  1GL2 A;  1J2J B;  3L36 A;  1GDT A;  1N7S B;  3TYY A;  2FFD C;  1ZN5 A;  2KSJ A;  5APT A;  3KDP B;  4C7N A;  1GL2 C;  3KQG A;  3M06 A;  3MTU E;  4LLH A;  4AUW A;  1FZF A;  3NFQ A;  4WBA A;  1RY3 A;  1IFD A;  1VDF A;  3VMY A;  1DEB A;  1IFM A;  1URQ D;  3IFM A;  5APQ A;  1G2C B;  2NPS D;  2N1T D;  1L4A B;  1IK9 A;  2W6A A;  2N9B A;  2YO2 A;  1SLQ A;  5AVR B;  3A2A A;  3OA7 A;  3RK3 C;  1N73 B;  4Y99 C;  1H89 A;  1HGZ A;  1VPC A;  2R32 A;  3P8M C;  1GW4 A;  1LWU A;  5KJ7 D;  1J1E C;  1SQX K;  3R2P A;  5AVW B;  2H7H A;  3I5C A;  4W80 A;  3HE4 B;  3A5T A;  1X79 B;  1GU5 A;  2NPS C;  2N1T C;  4AQR D;  3C9I A;  4WB4 A;  2WIT A;  2CPB A;  2YKO A;  5AVV B;  3HTK A;  3M0D C;  2FYZ A;  1NO4 A;  2FKW B;  1GK4 A;  3U1A A;  5AVU B;  1GTW A;  3HD7 D;  3VOP A;  3HUS B;  5AW4 B;  1DX7 A;  3TK1 A;  1KIL A;  2YKQ A;  1MUU A;  1FZG A;  1N7L A;  2Z5H A;  2WT7 A;  2YKP A;  2KB7 P;  1JTH A;  2QM7 A;  2XNX A;  2WZ7 A;  1NWQ A;  3BVH A;  4WY4 A;  5BVZ A;  4I2L C;  3EFG A;  5BU5 A;  4GKG A;  3WMM 0;  1ZR2 A;  1SQQ K;  3RK2 B;  4N78 D;  1YYC A;  3HD7 C;  5AW2 B;  3U1C A;  2OYH A;  1IO4 A;  1CI6 B;  1JCD A;  3B5N A;  1JY3 O;  1SFC B;  1DH3 A;  1JO5 A;  1CSB A;  3V2P A;  3RL0 C;  2OYH C;  1J1D B;  1M1J B;  3B5N C;  1FZA A;  3A7O A;  1OWA A;  5CCG D;  3VMZ A;  1WT6 A;  4JF7 A;  2QM8 A;  2GM4 A;  5CCH D;  1RE3 A;  3H6P A;  1CW5 A;  1HBW A;  1PFI A;  3SWY A;  1RF1 B;  3MIW A;  3H32 B;  3LID A;  4RES B;  1RE4 A;  2FYU K;  2O1J A;  1LTS C;  4DOJ A;  1GL2 D;  2J59 M;  2M8R A;  3GHG A;  2FFD B;  1GW3 A;  2XDJ A;  4DZO A;  5CCH C;  4EIJ A;  2YO3 A;  1MFZ A;  2XZR A;  2LKM A;  3CI9 A;  1FJP A;  3GHG C;  1NTZ K;  2WTY A;  1GK6 A;  4C7N B;  2JJL A;  1IFI A;  3N7N A;  3RK3 D;  3G3Z A;  1T8Z A;  1NKN A;  3V2N A;  2YMY A;  2PAJ A;  2P2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...