3MTUE

Structure of the tropomyosin overlap complex from chicken smooth muscle
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
67
Chain Sequence
b'PEEHEDILNKLLDPQSERTEALQQLRVNYGSFVSEYNDLEEKVAHAKEENLNMHQMLDQTLLELNNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tropomyosin alpha-1 chain,Microtubule-associated protein RP/
publication title Structure of the tropomyosin overlap complex from chicken smooth muscle: insight into the diversity of N-terminal recognition .
pubmed doi rcsb
source organism Gallus gallus
molecule tags Contractile protein
total genus 23
structure length 67
sequence length 70
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3mtuE00
4IFFA 3OA7A 3MTUE 1NO4A 1NOHA
chains in the Genus database with same CATH superfamily
4W7ZA 4KHXA 3MIWA 3V2NA 1SQXE 3L75J 3H1JG 4H13C 5AVTB 2N1TB 1S4XA 2FYUE 1PGPA 2KLVA 4YXWH 1AA0A 4C7RA 2G8YA 1HH0A 3KHUA 1KC8Q 1J1DB 1LT1A 2Q7CA 1KB9E 5AW8B 1JMBA 3L73J 1QGKB 3A0HH 3OAKA 4W80A 3HD7C 2OYIC 1L0LE 2J58A 2KK7A 2I8DA 5CCHC 5AVWB 2BEQD 1NOHA 3FXEA 1L0NG 1FJKA 2FKWB 3GHGC 3AE8C 1GD2E 2K9JB 4KT0J 5M1BA 3P8CE 1L0NK 1RE3C 2ITAA 2PP6A 5AVSB 1NTKE 3M91A 1ZLLA 2J5UA 3CCJP 1FE6A 3WU2E 5AVUB 3CCUP 1T6AA 3A7OA 3RK2C 1EXJA 1IFMA 3CMEP 3MZWB 5GTHH 1L4AB 3L70G 2C9LY 3FWNA 5C39A 4AYCA 2FXOA 3V4WA 3L75D 2E74D 1OX3A 3CC7P 1RQVA 3CD6P 2JWAA 5KLVJ 1NTZE 1RF1A 1ZV8A 1HF9A 3PP5A 4DT0A 3L73D 1GTWA 3KDPB 3AE2C 1HJ0A 1VQ6P 1P84H 1GL2B 5AW5B 2LR2A 3H1HE 1Q81Q 2V4HA 4I6MC 4JYBA 3H1JD 1GU4A 2QG4A 4Z1MH 1N7SD 2W6JH 3V2RA 2CPBA 1K8AQ 3P8MC 5KKZC 1EZVG 3HUSA 2IFNA 3CCRP 4XFJA 3B5ND 3FGAD 4EOTA 3A3YB 4IFFA 2NPSD 1CZQA 1JO5A 3H1IG 3N7NA 1N8RQ 1AFOA 5H2FH 2K37A 1N2DC 2FBWC 3M9HA 3D70A 3CX5H 5CCHD 2M3EA 4JYCA 2YNYA 1XTCC 2O3JA 5CMZA 1EXIA 1SQPJ 2FYUG 2O01H 3H1LJ 1LTBC 1KYOE 2NZ2A 4PD4D 2Z5IA 1JCDA 5KLVD 1IJDB 3O6QB 1KZUB 2BCCD 2E42A 1JMMA 3CCSP 2QJKC 1NU1E 2QSIA 4Y99C 2FYUK 2HLOA 2WT7B 5DJUB 1FZCA 1X9VA 4ASWA 3WUTA 3T97B 2OQQA 1SQXJ 1KQSO 3SSUA 1URQC 1G2CB 3AE1C 2IZ0A 4JBZA 3W68A 5APYA 4K35A 5AW0B 3F89A 2W90A 2QE7H 3Q2YA 2YXRB 3L74G 2WSSH 1NTKG 2K1AA 1ZRTD 2H8PD 3OW2O 2WSEH 2M5AA 1L0LJ 4L73A 4TLFA 3R2PA 3A0HE 2P1JA 2A06E 2C0XA 1XTGB 3KQGA 1OXZA 4WBAA 3RK3C 2JWDA 1BE3E 1KD1Q 3CWBJ 3HE4A 4U3FG 2KLUA 2ZFCA 2QJYB 5APQA 1YQ4C 3BRTB 4L75A 3AEGC 3EQ2A 1BSNA 1SQVE 2WZ7A 3HTKB 3JSVC 2WWWA 1KILC 3H1LD 2Q3EA 2N1TA 3VMYA 1HVVA 1K04A 1K73Q 2G3AA 2JDIH 2OYOA 3GLMA 3LW5J 3I55P 3NMDA 4OWFA 3M0DC 2Y0EA 3O8ZA 4B86A 3GMAA 2JKVA 1R8EA 3BASA 3H1HG 1RY3A 3RL0C 1SQXD 2YKPA 1PPJE 1S1CX 3H25A 2ZT9B 1Q90D 2FYUD 2ZYDA 1LT9B 3E7KA 5K5GB 3IF4A 4N78E 3S4RA 2YO3A 1K9MQ 1IC2A 1NTZJ 2Q5UA 2K9JA 1PP9J 1KB9D 1YHQP 1LTJA 4PD4I 3ITKA 1L0LD 1P84E 3Q5SA 4NPFX 2WPSA 1FU1A 1JM0A 3MUDA 1CI6B 2PGDA 3KPEA 1ZXGA 3M9QA 2IYPA 1L4AA 4L76A 1S9KD 1M56D 1VDFA 3P8CD 1URQD 3FWLA 3SWFA 5GTIH 1NTKD 1VL2A 1W5CE 1BGYE 1GL2D 1JY3P 1N7SB 2E5YA 1USDA 5KLVE 3P32A 1RQUA 4H44C 5CCGD 2AXCA 5H2FE 2B88A 2Q3IA 2HYNA 5AW1B 5AW6B 1VF5C 3B5NB 3CCQP 1ZP0C 3CXHH 5KJ7A 2XU6A 3L35A 2NPSB 3RK3D 1Y8AA 1LP1B 1PV3A 3HD7B 2OYIB 4WY4C 3RGUA 4ZNCA 1NTZD 1X79B 3IAOA 3TNUB 1NU1J 1X0TA 3AECC 3U1CA 1ZRTE 4MN4C 3PH0A 2A06G 3H1HD 3GHGB 3AE9C 2E5TA 3TGUJ 4GT1A 2C9NY 5CBNA 4R4MA 2QVAA 5KLIC 1RF1C 3RK2B 3L75G 4TT3H 3L71E 1JY3N 3TF5A 3KYQA 1HUCA 1SQPE 2W27A 4GDOA 1KN7A 2KZIA 1Q82Q 4HKZH 5B66E 1SQQE 1KB9I 1MKMA 1BE3J 1JY3O 3L73G 2XV5A 3TDKA 1SQVJ 3HUSC 2Y0DA 3TK1A 3T97A 3H1KE 1S72P 2FFDC 4U7JA 2O1KA 3B8EB 2N9YB 4D6TJ 1KYOD 1YITP 2GA1A 4IL6H 1M57D 4C7NB 1NU1D 2E75C 3AE3C 3RBXA 1QEXA 3H32B 3CCMP 5KKZB 1ZMEC 1GDTA 1JUNA 1N73B 1LJ2A 3M9BA 1HJBA 1R5SA 1MUUA 1DIPA 3CWBE 2E76C 1YJWP 3CI9A 1FOSE 1S9KE 3N4XA 2QM8A 3L72J 1FZFA 3V4QA 4BXLA 3HTKA 1PFIA 1FZCC 4WY4D 2A06D 2P58A 5KLVG 5TISE 1VQ7P 1G1JA 4GIFA 2A45H 3BCCE 1PGOA 2BCCG 2ZT9D 4XA4A 1BE3D 3I56P 3LIEA 1IO4A 1H88A 1YI2P 1NHLA 4OGQD 1U7MA 1G1IA 3CXHI 5KLVK 5AVQB 1SQVD 3ZDMA 1T2KC 2M0BA 2QJKB 3RK3E 4D6TD 1BGYJ 3IR9A 4Y99B 5GTIE 2D2CD 2HR3A 3G6EP 1LT9A 1SVFA 3WUVA 1JNMA 2R3SA 3CC2P 4PV1D 3A2AA 5KAIH 1OWAA 1AQTA 1GMJA 1PP9E 1URQB 2HODB 2P10A 2AXTE 1KILE 1KQGB 4RESB 4Y28J 4HJGH 3V6IA 1GK4A 2IYOA 4RO0A 1PPJD 1N7LA 2BASA 3CXHE 3E1IA 2H89C 4BRYB 5B5EH 2QM7A 2B87A 2ZYGA 2N1TC 2O01J 4N78D 1VQOP 1CI6A 5KAFH 3L70J 4WWIA 3CLQA 3L72D 5EFWB 4H13D 1KYOI 3M06A 1J1DC 3RK3B 4RJTA 1M1JC 3AEFC 3H1LG 2Y0CA 3UIAA 1H8AA 3GF3A 1P84D 1SFCC 4PJ0H 1LTSC 4JPZB 4UB8H 1N7SA 3BATA 1FZEA 2HPCB 3A0BH 3C9IA 2R5BA 1KILB 1OW7A 3D6ZA 3PJSK 3HD7D 1PZQA 1EDLA 1SQXG 3NTNA 3B5NA 3L71J 1X8YA 1DX7A 1LTJC 3U59A 2YKQA 1OIPA 5AW2B 1FC2C 2NPSA 1BGYD 2E76D 2WSEJ 2W6AA 1LP1A 1SQQJ 1JB0J 3HD7A 1SQXK 5CCHA 2R5DA 1QVFO 1FS0E 1L0LG 3CX5D 2JP3A 4IOIH 3H1KJ 2IZ1A 2JO1A 3RK2D 5AW9B 3GHGA 3TGUE 1VQMP 2YMYA 5BVZA 4ZKPA 1DH3A 3CWBG 1RE3A 2W6BA 5AVVB 1L0LK 1FAVA 4GKGA 3HE5B 1FBMA 2W8ZA 1QX8A 1J1EC 1X22A 2PFXA 1NTME 2M3BA 2OGUA 3SFEC 2KS1B 1LWUB 3L37A 1KV4A 4A7PA 2OTJP 1VQ9P 1CSBA 5KJ7C 3EFGA 1BCCJ 2WSFH 1YJ9P 1NTKK 2OTLP 2WVRA 3H6PA 4DOJA 3E1RA 1DEEG 4DZOA 1LTTC 5BU5A 3L71D 4LC1A 4H44B 1SQPD 3G3ZA 1M90Q 4D6TE 3S1KA 1SQQD 4OVNF 1NTZG 1M1KQ 1FDOA 3BCCJ 2FYNC 2OYHB 3OA7A 1P84I 2O1JA 4C7NA 1MV8A 3M0AA 5GTHE 3G4SP 2HFED 3NXSA 3NFQA 4M3LA 3FXDA 1NTZK 4WY4B 1EDKA 3H1KD 3QWOC 1YQ3C 4I7ZC 1NO4A 3CCVP 2WTYA 4GOEA 1SQBE 3QH9A 1N73A 2ZYAA 3R4YA 2H43A 2GUVA 4U3FJ 4OGQB 5AW3B 2YIUC 1RH5B 3GG2A 3L72E 5KAIE 4O9BA 3JCUH 1JCCA 1A02F 2D2CB 5KLIB 3G71P 1VQNP 1NAYA 2K3RA 2MKVA 2Z5HA 4H0LC 2QA4P 2FXMA 3PHLA 4PV1B 3CX5I 1FZGA 2I1KA 5B5EE 1EDIA 3CWBD 3Q1MA 3MD0A 2QJPC 5KAFE 2KIKA 3MP7B 2R32A 1LGHB 2KOGA 3AE4C 1NVOA 1QLED 3SFDC 1RE4A 1PL5A 2FYZA 1L0NE 3L4FA 4PJ0E 2KB7P 3BCCD 2OTKE 1FZBA 1Q86Q 4AQRD 2FFDB 1NU1G 4H13B 1NGMB 1URQA 2R44A 2HODA 3VMAA 3CX5E 2Z4EA 1KQLA 1GL2A 1OFCX 1LTIC 1NU1K 3AE6C 2AEMA 2V7QH 1Q2NA 1PGQA 5CCGA 2POHA 3C8VA 1OW8A 1FJPA 1HGZA 3L70E 1N86A 3AE5C 1PP9D 4IL6X 1KILD 1OVUA 2E76B 3USSA 1IK9A 1OMIA 1H89A 3CXHD 4RKUJ 1BE3G 1AVOA 1PGJA 2AEJA 5AVRB 2L91A 2M8RA 1W2BO 1FZCB 1LT9C 2SPZA 2WSCH 3CPWO 3RL0D 3PLNA 1SQVG 1NTMJ 1SLQA 2P67A 1FDMA 1H0TB 1S2EA 5CJ0A 4D6TG 2E74C 1AV1A 2RMZA 1SQVK 2VRSA 4WVZA 2P2UA 1NKNA 1EDJA 2Y9ZA 2ZAEB 1YTZI 2XDJA 3Q5PA 1GK6A 3O6QA 4QMAA 3AEDC 1IZNB 2WT7A 4HH2A 4BWNA 2W83C 1PPJG 5APSA 3AEAC 3H1IE 1G2CA 3V2PA 3RBZA 3FX0A 3B71A 5AVZB 3HE5A 4UB6H 3L72G 1BDDA 1Y9BA 2XZRA 2KS1A 1LWUA 1DD3A 1U57A 1AVYA 2FXPA 3K5BA 2KXPB 1KQFB 3W67A 3B5NC 3TGUD 1YTZT 1BDCA 1SQBJ 4H44D 2NPSC 1S3JA 1BCCE 1M1JB 1LTAC 2KSEA 1SFCB 1VF5D 1T3JA 1ZW0A 2KYVA 2RH0A 1NTMD 1YJNP 3H1JJ 1BGYG 2ZXEB 3JCUE 1VQLP 5AW7B 2E43A 2B9BA 2N9BA 4XE5B 4KJMA 1LTJB 3L36A 3L74E 2OYHA 3D71A 1SP4A 3VMXA 4LGDE 1S5LH 1TU3F 2XNXA 3KZIH 4WY4A 3CCEP 4HB1A 4DJGA 1L0NJ 1FZAA 1RF0A 1SS1A 1JOCA 4GODA 1VPCA 2H88C 4U3FE 4EYYQ 1IFPA 3P7KA 1JEKA 3TYYA 2AEFA 2P7JA 2IPPA 1VQPP 1KFMA 3VP9A 2IX7C 5CHXA 1J1EB 1SQBD 1VQ5P 3SWYA 2PAJA 2ZXXA 4I2LC 4L74A 1BSHA 2BCCJ 1KFNA 1NWQA 4JQ0D 2XNDH 2IBZI 1M8OB 4YPCA 2KSJA 5APXA 1UIIA 1Q7YQ 3L71G 1KORA 2YO2A 1YYCA 1SQPG 1SQQG 3KXDA 3V5BA 1L2PA 1UIXA 1LNQA 5CBOA 3MTUE 4IFMA 1N73C 3AE7C 1SQPK 2E75D 3GW6A 4GOFA 2FFDA 2WMMA 1IK7A 3I5CA 2DW3A 4HYTB 1SQQK 3Q5RA 4PD4H 1FDIA 3H1KG 2QIWA 2K9YA 4R4LA 1E5WA 2IBZE 2FYNB 1L0ND 1A02J 5DJTB 1GW4A 2CK3H 4N6JA 3CCLP 3PTZA 1M7LA 3EFFK 2R3CA 4I1LA 4C46A 3RL0B 1IFNA 2JJLA 1T8ZA 2OYIA 1OW6A 4I7ZB 3IN6A 2KNCB 3MUDC 2WSFJ 4CPGA 4NPDA 3TNUA 1L4AC 1ZN5A 1MFTA 1JTHB 1LTGC 1J2JB 2YIUB 1QVGO 3ABVC 1RE4C 4EDFA 1KTMA 1BCCG 3H1IJ 1AJYA 2GM4A 1IFJA 3D6YA 3S9OA 1Z56A 1NH4A 3B4SA 3L70D 1HTLC 3V2QA 4LLHA 1QL2A 4UB6E 4IL6E 3SWKA 2B89A 4H0LB 1T2KD 1MFZA 2XKMA 2WITA 1H0TA 1GZLA 1OVRA 2Q1KA 3C1LA 2FYUJ 2YKOA 1T3UA 2QJPB 2A45I 1GL2C 3GF7A 2IFMA 3BCCG 1USEA 2FY8A 2RKLA 2RN0A 5CCGC 1WMKA 5E79H 5B66H 1VQKP 1GU5A 4EIJA 3VTPC 2WQYC 3JC22 5APTA 2ZVNB 3EWKA 5APUA 2KUBA 1W2EA 2N1TD 1HWTC 2BEZF 3MHVA 1VF5B 4AUWA 1HGVA 2C0WA 1PP9G 2YXQB 1EZVD 3L74J 2WPVB 3L75E 2PRRA 1QL1A 2YMKA 1NTKJ 1SFCD 5AVXB 1S5LE 2GUSA 3KZIE 4ZMDA 3G9RA 3PRJA 3H32A 4YTPC 1ZOYC 3BRVB 3H1ID 5APWA 1KB9H 3VMZA 1M1JA 3L73E 1PIXA 2ZVOB 1SFCA 1WRGA 2OARA 3VP8A 1WT6A 1CW5A 4DCKA 3LIDA 3H1JE 4ASVA 2LXCB 5APVA 4JF7A 1RF1B 5L8RJ 1U7JA 1BCCD 2V7QJ 3MGNA 4W7YA 1L4AD 1IFIA 4YXDC 2E74B 2H7HA 3CMAP 2KP8A 5BU8B 3WU2H 2WPRA 5TISH 3H1HJ 2IBZG 1NYHA 3F5HA 3LW5H 1LWUC 1ZR4A 2B87B 2CPSA 1EQ7A 1K05A 2L5GB 3RL0g 1ZR2A 4UB8E 3HUSB 3A0BE 3L74D 1GW3A 2QEXP 3Q3DA 2WSCJ 2QJYC 4PD4E 5KJ7D 2Y9YA 3TGUG 2JEEA 1JY2P 3II6A 1NAFA 2Q9IA 2AXTH 2E75B 2Q6QA 2BCCE 2IDBA 4BRYA 1D7MA 4U3FD 3WMM0 3U1AA 3BVHA 1NKZB 1NTMG 1NJIQ 2KZJA 1RHZB 2K88A 1OVVA 1YBKA 1OZHA 2OYHC 2LXBA 2JR8A 4IFDK 1Y47A 2MJZA 1R5LA 1NTMK 1EZVI 5AVYB 1FOSF 5KTBA 2HPCA 1MZ9A 2LKMA 1IFDA 1RF0C 2ZT9C 1DEBA 5CJ4A 1KILA 2UWJE 3HRNA 3TSIA 5AW4B 3AEBC 4OGQC 2NRGA 2HG5D 3WUUA 1HBWA 4K3AA 5TJHA 3AEEC 3CL3D 3M0DA 3VOPA 1AQ5A 1YIJP 2D2CC 3OJAB 3VYIA 2A45G 4ZKUA 4N3YB 1VQ4P 1DD4A 1E79H 1EZVE 2QRXA 4PV1C 2KNCA 2ZJSE 3A5TA 1VQ8P 2M5AB 1KYOH 4NPEA 1JY2N 3H1LE 1JTHA 1S5LX 5E79E 2J59M 2IBZD 1SQBG 1KMIZ 4H0LD 2KI7B 2O01N 3IFMA 4OH8B 2I1JA 3HE4B 1JY2O 2WPQA 4WB4A 1N7SC 3CC4P 3VN0A 1SQBK 1EC5A 4EI2A
chains in the Genus database with same CATH topology
4W7ZA 1NWQA 5KJ7C 4KHXA 1GL2D 3MIWA 3EFGA 3V2NA 2KSJA 1JY3P 5APXA 1N7SB 2WSFH 1NTKK 5AVTB 4DOJA 3H6PA 2N1TB 2YO2A 4DZOA 3P32A 1YYCA 5CCGD 2KLVA 1LTTC 5BU5A 4C7RA 1HH0A 2Q3IA 4LC1A 1J1DB 2HYNA 5AW1B 5AW6B 3V5BA 3B5NB 2Q7CA 3G3ZA 5AW8B 3MTUE 4IFMA 2XU6A 5KJ7A 1N73C 3L35A 1SQPK 2NPSB 3HD7C 3OAKA 4W80A 3RK3D 2OYIC 2FFDA 2J58A 5CCHC 5AVWB 3I5CA 4HYTB 1SQQK 2OYHB 1NOHA 3HD7B 3OA7A 2OYIB 2O1JA 4WY4C 4C7NA 1FJKA 1MV8A 3M0AA 1E5WA 1X79B 2HFED 2FKWB 3NXSA 3NFQA 3TNUB 4M3LA 1NTZK 4WY4B 3GHGC 1A02J 1GD2E 3U1CA 1GW4A 4N6JA 1NO4A 2WTYA 1M7LA 2R3CA 3P8CE 4I1LA 1L0NK 1RE3C 4C46A 1N73A 3RL0B 1IFNA 3GHGB 2PP6A 5AVSB 2JJLA 1T8ZA 2OYIA 2H43A 2GUVA 3M91A 1ZLLA 4GT1A 2C9NY 3TNUA 5AVUB 5AW3B 1L4AC 1ZN5A 3A7OA 1JTHB 3RK2C 1LTGC 1IFMA 1J2JB 4O9BA 1L4AB 1RF1C 1RE4C 3RK2B 1JCCA 1A02F 1JY3N 2C9LY 3KYQA 1HUCA 2GM4A 4AYCA 1IFJA 2W27A 3V4WA 1Z56A 2Z5HA 1NH4A 2FXMA 1FZGA 2I1KA 1HTLC 3V2QA 4LLHA 1QL2A 3MD0A 1T2KD 1MFZA 1JY3O 2R32A 2XKMA 2WITA 1GZLA 1LGHB 2KOGA 2XV5A 1RF1A 1ZV8A 1RE4A 2YKOA 1T3UA 2A45I 1GL2C 2FYZA 2IFMA 3PP5A 3HUSC 3TK1A 3T97A 1GTWA 3KDPB 2FFDC 3L4FA 2O1KA 1GL2B 3B8EB 5AW5B 2KB7P 5CCGC 1FZBA 4AQRD 2FFDB 4I6MC 4JYBA 1GU5A 4EIJA 1URQA 1GU4A 3VTPC 2HODA 5APTA 1N7SD 5APUA 4C7NB 2Z4EA 3V2RA 1W2EA 2N1TD 1KQLA 1GL2A 2CPBA 1HWTC 1LTIC 3P8MC 3HUSA 2IFNA 1NU1K 4AUWA 3H32B 1HGVA 2C0WA 1GDTA 1JUNA 5CCGA 2POHA 1N73B 3B5ND 3M9BA 1HJBA 1FJPA 4EOTA 1HGZA 1QL1A 3A3YB 1MUUA 1N86A 4IFFA 1SFCD 2NPSD 5AVXB 2GUSA 1CZQA 1JO5A 3CI9A 3N7NA 1KILD 1AFOA 1FOSE 1S9KE 1N2DC 3M9HA 3H32A 3N4XA 2QM8A 1FZFA 3V4QA 1IK9A 3BRVB 5APWA 5CCHD 3HTKA 1H89A 3VMZA 4JYCA 2YNYA 1XTCC 1PFIA 1M1JA 5CMZA 1FZCC 4WY4D 1SFCA 1WRGA 5AVRB 2OARA 3VP8A 1G1JA 1WT6A 2M8RA 4GIFA 2O01H 2A45H 1CW5A 1LTBC 1FZCB 1LT9C 2WSCH 3RL0D 4XA4A 2Z5IA 1JCDA 3LIDA 1SLQA 3LIEA 1IO4A 1IJDB 2P67A 1H88A 1NHLA 1FDMA 5APVA 1KZUB 1G1IA 2E42A 5CJ0A 5KLVK 5AVQB 4JF7A 1JMMA 4Y99C 1RF1B 2FYUK 2HLOA 2WT7B 1FZCA 3MGNA 1X9VA 4W7YA 1SQVK 2VRSA 1T2KC 2P2UA 1L4AD 1NKNA 1IFIA 4Y99B 3IR9A 1YTZI 2XDJA 2H7HA 2KP8A 5BU8B 1GK6A 1URQC 1LT9A 2WPRA 1G2CB 1SVFA 1JNMA 5APYA 3LW5H 1LWUC 3A2AA 5AW0B 2WT7A 1OWAA 1ZR4A 1URQB 4HH2A 2HODB 2CPSA 1EQ7A 4RESB 2L5GB 5APSA 1GK4A 1ZR2A 2H8PD 3HUSB 1G2CA 3V2PA 2WSEH 1GW3A 1N7LA 2BASA 3R2PA 3E1IA 5AVZB 1CSBA 2P1JA 2QM7A 3HE5A 2N1TC 4N78D 2C0XA 1CI6A 1XTGB 2XZRA 3KQGA 1LWUA 1OXZA 4WBAA 5KJ7D 3RK3C 2JEEA 3HE4A 1JY2P 3CLQA 2ZFCA 3II6A 3M06A 1NAFA 1J1DC 3BRTB 5APQA 2Q9IA 3B5NC 3RK3B 1M1JC 1YTZT 3EQ2A 3UIAA 1H8AA 1SFCC 2WZ7A 3HTKB 3U1AA 3WMM0 1LTSC 3BVHA 2NPSC 1NKZB 2WWWA 1N7SA 1M1JB 1KILC 3BATA 1LTAC 1FZEA 2HPCB 3C9IA 2N1TA 3VMYA 1SFCB 2OYHC 2R5BA 1T3JA 1HVVA 2KYVA 4IFDK 1KILB 2MJZA 3HD7D 3NMDA 1NTMK 3M0DC 2ZXEB 3NTNA 5AVYB 1FOSF 3B5NA 3O8ZA 4B86A 5KTBA 1X8YA 2HPCA 1MZ9A 1DX7A 2LKMA 1IFDA 1LTJC 3BASA 5AW7B 3U59A 1RY3A 3RL0C 2YKQA 1RF0C 5AW2B 2NPSA 2E43A 1DEBA 5CJ4A 1KILA 2YKPA 2W6AA 3HRNA 5AW4B 3TSIA 2N9BA 4XE5B 1LTJB 3L36A 2OYHA 1SP4A 3HD7A 1SQXK 3VMXA 4LGDE 2HG5D 5CCHA 1LT9B 1HBWA 4N78E 2XNXA 2YO3A 2R5DA 3CL3D 1IC2A 3M0DA 4WY4A 3VOPA 2Q5UA 1AQ5A 3OJAB 1LTJA 3VYIA 1FZAA 3RK2D 2A45G 4ZKUA 5AW9B 3GHGA 1RF0A 1JOCA 2YMYA 4N3YB 1VPCA 5BVZA 4ZKPA 3A5TA 1DH3A 1RE3A 2WPSA 3P7KA 2W6BA 5AVVB 3TYYA 1L0LK 1JY2N 1FAVA 4GKGA 1FU1A 1JTHA 3HE5B 1FBMA 3MUDA 2P7JA 2IPPA 1J1EC 2J59M 1CI6B 2M3BA 3KPEA 3M9QA 1LWUB 1L4AA 1KFMA 3IFMA 4OH8B 3VP9A 1S9KD 2I1JA 2IX7C 3L37A 5CHXA 1J1EB 3HE4B 1VDFA 3P8CD 3SWYA 2PAJA 1JY2O 1URQD 4I2LC 2WPQA 4WB4A 3SWFA 1N7SC 3VN0A 1KFNA 1SQBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFF A;  3OA7 A;  3MTU E;  1NO4 A;  1NOH A; 
#chains in the Genus database with same CATH topology
 4W7Z A;  4KHX A;  3MIW A;  3V2N A;  1SQX E;  3L75 J;  3H1J G;  4H13 C;  5AVT B;  2N1T B;  1S4X A;  2FYU E;  1PGP A;  2KLV A;  4YXW H;  1AA0 A;  4C7R A;  2G8Y A;  1HH0 A;  3KHU A;  1KC8 Q;  1J1D B;  1LT1 A;  2Q7C A;  1KB9 E;  5AW8 B;  1JMB A;  3L73 J;  1QGK B;  3A0H H;  3OAK A;  4W80 A;  3HD7 C;  2OYI C;  1L0L E;  2J58 A;  2KK7 A;  2I8D A;  5CCH C;  5AVW B;  2BEQ D;  1NOH A;  3FXE A;  1L0N G;  1FJK A;  2FKW B;  3GHG C;  3AE8 C;  1GD2 E;  2K9J B;  4KT0 J;  5M1B A;  3P8C E;  1L0N K;  1RE3 C;  2ITA A;  2PP6 A;  5AVS B;  1NTK E;  3M91 A;  1ZLL A;  2J5U A;  3CCJ P;  1FE6 A;  3WU2 E;  5AVU B;  3CCU P;  1T6A A;  3A7O A;  3RK2 C;  1EXJ A;  1IFM A;  3CME P;  3MZW B;  5GTH H;  1L4A B;  3L70 G;  2C9L Y;  3FWN A;  5C39 A;  4AYC A;  2FXO A;  3V4W A;  3L75 D;  2E74 D;  1OX3 A;  3CC7 P;  1RQV A;  3CD6 P;  2JWA A;  5KLV J;  1NTZ E;  1RF1 A;  1ZV8 A;  1HF9 A;  3PP5 A;  4DT0 A;  3L73 D;  1GTW A;  3KDP B;  3AE2 C;  1HJ0 A;  1VQ6 P;  1P84 H;  1GL2 B;  5AW5 B;  2LR2 A;  3H1H E;  1Q81 Q;  2V4H A;  4I6M C;  4JYB A;  3H1J D;  1GU4 A;  2QG4 A;  4Z1M H;  1N7S D;  2W6J H;  3V2R A;  2CPB A;  1K8A Q;  3P8M C;  5KKZ C;  1EZV G;  3HUS A;  2IFN A;  3CCR P;  4XFJ A;  3B5N D;  3FGA D;  4EOT A;  3A3Y B;  4IFF A;  2NPS D;  1CZQ A;  1JO5 A;  3H1I G;  3N7N A;  1N8R Q;  1AFO A;  5H2F H;  2K37 A;  1N2D C;  2FBW C;  3M9H A;  3D70 A;  3CX5 H;  5CCH D;  2M3E A;  4JYC A;  2YNY A;  1XTC C;  2O3J A;  5CMZ A;  1EXI A;  1SQP J;  2FYU G;  2O01 H;  3H1L J;  1LTB C;  1KYO E;  2NZ2 A;  4PD4 D;  2Z5I A;  1JCD A;  5KLV D;  1IJD B;  3O6Q B;  1KZU B;  2BCC D;  2E42 A;  1JMM A;  3CCS P;  2QJK C;  1NU1 E;  2QSI A;  4Y99 C;  2FYU K;  2HLO A;  2WT7 B;  5DJU B;  1FZC A;  1X9V A;  4ASW A;  3WUT A;  3T97 B;  2OQQ A;  1SQX J;  1KQS O;  3SSU A;  1URQ C;  1G2C B;  3AE1 C;  2IZ0 A;  4JBZ A;  3W68 A;  5APY A;  4K35 A;  5AW0 B;  3F89 A;  2W90 A;  2QE7 H;  3Q2Y A;  2YXR B;  3L74 G;  2WSS H;  1NTK G;  2K1A A;  1ZRT D;  2H8P D;  3OW2 O;  2WSE H;  2M5A A;  1L0L J;  4L73 A;  4TLF A;  3R2P A;  3A0H E;  2P1J A;  2A06 E;  2C0X A;  1XTG B;  3KQG A;  1OXZ A;  4WBA A;  3RK3 C;  2JWD A;  1BE3 E;  1KD1 Q;  3CWB J;  3HE4 A;  4U3F G;  2KLU A;  2ZFC A;  2QJY B;  5APQ A;  1YQ4 C;  3BRT B;  4L75 A;  3AEG C;  3EQ2 A;  1BSN A;  1SQV E;  2WZ7 A;  3HTK B;  3JSV C;  2WWW A;  1KIL C;  3H1L D;  2Q3E A;  2N1T A;  3VMY A;  1HVV A;  1K04 A;  1K73 Q;  2G3A A;  2JDI H;  2OYO A;  3GLM A;  3LW5 J;  3I55 P;  3NMD A;  4OWF A;  3M0D C;  2Y0E A;  3O8Z A;  4B86 A;  3GMA A;  2JKV A;  1R8E A;  3BAS A;  3H1H G;  1RY3 A;  3RL0 C;  1SQX D;  2YKP A;  1PPJ E;  1S1C X;  3H25 A;  2ZT9 B;  1Q90 D;  2FYU D;  2ZYD A;  1LT9 B;  3E7K A;  5K5G B;  3IF4 A;  4N78 E;  3S4R A;  2YO3 A;  1K9M Q;  1IC2 A;  1NTZ J;  2Q5U A;  2K9J A;  1PP9 J;  1KB9 D;  1YHQ P;  1LTJ A;  4PD4 I;  3ITK A;  1L0L D;  1P84 E;  3Q5S A;  4NPF X;  2WPS A;  1FU1 A;  1JM0 A;  3MUD A;  1CI6 B;  2PGD A;  3KPE A;  1ZXG A;  3M9Q A;  2IYP A;  1L4A A;  4L76 A;  1S9K D;  1M56 D;  1VDF A;  3P8C D;  1URQ D;  3FWL A;  3SWF A;  5GTI H;  1NTK D;  1VL2 A;  1W5C E;  1BGY E;  1GL2 D;  1JY3 P;  1N7S B;  2E5Y A;  1USD A;  5KLV E;  3P32 A;  1RQU A;  4H44 C;  5CCG D;  2AXC A;  5H2F E;  2B88 A;  2Q3I A;  2HYN A;  5AW1 B;  5AW6 B;  1VF5 C;  3B5N B;  3CCQ P;  1ZP0 C;  3CXH H;  5KJ7 A;  2XU6 A;  3L35 A;  2NPS B;  3RK3 D;  1Y8A A;  1LP1 B;  1PV3 A;  3HD7 B;  2OYI B;  4WY4 C;  3RGU A;  4ZNC A;  1NTZ D;  1X79 B;  3IAO A;  3TNU B;  1NU1 J;  1X0T A;  3AEC C;  3U1C A;  1ZRT E;  4MN4 C;  3PH0 A;  2A06 G;  3H1H D;  3GHG B;  3AE9 C;  2E5T A;  3TGU J;  4GT1 A;  2C9N Y;  5CBN A;  4R4M A;  2QVA A;  5KLI C;  1RF1 C;  3RK2 B;  3L75 G;  4TT3 H;  3L71 E;  1JY3 N;  3TF5 A;  3KYQ A;  1HUC A;  1SQP E;  2W27 A;  4GDO A;  1KN7 A;  2KZI A;  1Q82 Q;  4HKZ H;  5B66 E;  1SQQ E;  1KB9 I;  1MKM A;  1BE3 J;  1JY3 O;  3L73 G;  2XV5 A;  3TDK A;  1SQV J;  3HUS C;  2Y0D A;  3TK1 A;  3T97 A;  3H1K E;  1S72 P;  2FFD C;  4U7J A;  2O1K A;  3B8E B;  2N9Y B;  4D6T J;  1KYO D;  1YIT P;  2GA1 A;  4IL6 H;  1M57 D;  4C7N B;  1NU1 D;  2E75 C;  3AE3 C;  3RBX A;  1QEX A;  3H32 B;  3CCM P;  5KKZ B;  1ZME C;  1GDT A;  1JUN A;  1N73 B;  1LJ2 A;  3M9B A;  1HJB A;  1R5S A;  1MUU A;  1DIP A;  3CWB E;  2E76 C;  1YJW P;  3CI9 A;  1FOS E;  1S9K E;  3N4X A;  2QM8 A;  3L72 J;  1FZF A;  3V4Q A;  4BXL A;  3HTK A;  1PFI A;  1FZC C;  4WY4 D;  2A06 D;  2P58 A;  5KLV G;  5TIS E;  1VQ7 P;  1G1J A;  4GIF A;  2A45 H;  3BCC E;  1PGO A;  2BCC G;  2ZT9 D;  4XA4 A;  1BE3 D;  3I56 P;  3LIE A;  1IO4 A;  1H88 A;  1YI2 P;  1NHL A;  4OGQ D;  1U7M A;  1G1I A;  3CXH I;  5KLV K;  5AVQ B;  1SQV D;  3ZDM A;  1T2K C;  2M0B A;  2QJK B;  3RK3 E;  4D6T D;  1BGY J;  3IR9 A;  4Y99 B;  5GTI E;  2D2C D;  2HR3 A;  3G6E P;  1LT9 A;  1SVF A;  3WUV A;  1JNM A;  2R3S A;  3CC2 P;  4PV1 D;  3A2A A;  5KAI H;  1OWA A;  1AQT A;  1GMJ A;  1PP9 E;  1URQ B;  2HOD B;  2P10 A;  2AXT E;  1KIL E;  1KQG B;  4RES B;  4Y28 J;  4HJG H;  3V6I A;  1GK4 A;  2IYO A;  4RO0 A;  1PPJ D;  1N7L A;  2BAS A;  3CXH E;  3E1I A;  2H89 C;  4BRY B;  5B5E H;  2QM7 A;  2B87 A;  2ZYG A;  2N1T C;  2O01 J;  4N78 D;  1VQO P;  1CI6 A;  5KAF H;  3L70 J;  4WWI A;  3CLQ A;  3L72 D;  5EFW B;  4H13 D;  1KYO I;  3M06 A;  1J1D C;  3RK3 B;  4RJT A;  1M1J C;  3AEF C;  3H1L G;  2Y0C A;  3UIA A;  1H8A A;  3GF3 A;  1P84 D;  1SFC C;  4PJ0 H;  1LTS C;  4JPZ B;  4UB8 H;  1N7S A;  3BAT A;  1FZE A;  2HPC B;  3A0B H;  3C9I A;  2R5B A;  1KIL B;  1OW7 A;  3D6Z A;  3PJS K;  3HD7 D;  1PZQ A;  1EDL A;  1SQX G;  3NTN A;  3B5N A;  3L71 J;  1X8Y A;  1DX7 A;  1LTJ C;  3U59 A;  2YKQ A;  1OIP A;  5AW2 B;  1FC2 C;  2NPS A;  1BGY D;  2E76 D;  2WSE J;  2W6A A;  1LP1 A;  1SQQ J;  1JB0 J;  3HD7 A;  1SQX K;  5CCH A;  2R5D A;  1QVF O;  1FS0 E;  1L0L G;  3CX5 D;  2JP3 A;  4IOI H;  3H1K J;  2IZ1 A;  2JO1 A;  3RK2 D;  5AW9 B;  3GHG A;  3TGU E;  1VQM P;  2YMY A;  5BVZ A;  4ZKP A;  1DH3 A;  3CWB G;  1RE3 A;  2W6B A;  5AVV B;  1L0L K;  1FAV A;  4GKG A;  3HE5 B;  1FBM A;  2W8Z A;  1QX8 A;  1J1E C;  1X22 A;  2PFX A;  1NTM E;  2M3B A;  2OGU A;  3SFE C;  2KS1 B;  1LWU B;  3L37 A;  1KV4 A;  4A7P A;  2OTJ P;  1VQ9 P;  1CSB A;  5KJ7 C;  3EFG A;  1BCC J;  2WSF H;  1YJ9 P;  1NTK K;  2OTL P;  2WVR A;  3H6P A;  4DOJ A;  3E1R A;  1DEE G;  4DZO A;  1LTT C;  5BU5 A;  3L71 D;  4LC1 A;  4H44 B;  1SQP D;  3G3Z A;  1M90 Q;  4D6T E;  3S1K A;  1SQQ D;  4OVN F;  1NTZ G;  1M1K Q;  1FDO A;  3BCC J;  2FYN C;  2OYH B;  3OA7 A;  1P84 I;  2O1J A;  4C7N A;  1MV8 A;  3M0A A;  5GTH E;  3G4S P;  2HFE D;  3NXS A;  3NFQ A;  4M3L A;  3FXD A;  1NTZ K;  4WY4 B;  1EDK A;  3H1K D;  3QWO C;  1YQ3 C;  4I7Z C;  1NO4 A;  3CCV P;  2WTY A;  4GOE A;  1SQB E;  3QH9 A;  1N73 A;  2ZYA A;  3R4Y A;  2H43 A;  2GUV A;  4U3F J;  4OGQ B;  5AW3 B;  2YIU C;  1RH5 B;  3GG2 A;  3L72 E;  5KAI E;  4O9B A;  3JCU H;  1JCC A;  1A02 F;  2D2C B;  5KLI B;  3G71 P;  1VQN P;  1NAY A;  2K3R A;  2MKV A;  2Z5H A;  4H0L C;  2QA4 P;  2FXM A;  3PHL A;  4PV1 B;  3CX5 I;  1FZG A;  2I1K A;  5B5E E;  1EDI A;  3CWB D;  3Q1M A;  3MD0 A;  2QJP C;  5KAF E;  2KIK A;  3MP7 B;  2R32 A;  1LGH B;  2KOG A;  3AE4 C;  1NVO A;  1QLE D;  3SFD C;  1RE4 A;  1PL5 A;  2FYZ A;  1L0N E;  3L4F A;  4PJ0 E;  2KB7 P;  3BCC D;  2OTK E;  1FZB A;  1Q86 Q;  4AQR D;  2FFD B;  1NU1 G;  4H13 B;  1NGM B;  1URQ A;  2R44 A;  2HOD A;  3VMA A;  3CX5 E;  2Z4E A;  1KQL A;  1GL2 A;  1OFC X;  1LTI C;  1NU1 K;  3AE6 C;  2AEM A;  2V7Q H;  1Q2N A;  1PGQ A;  5CCG A;  2POH A;  3C8V A;  1OW8 A;  1FJP A;  1HGZ A;  3L70 E;  1N86 A;  3AE5 C;  1PP9 D;  4IL6 X;  1KIL D;  1OVU A;  2E76 B;  3USS A;  1IK9 A;  1OMI A;  1H89 A;  3CXH D;  4RKU J;  1BE3 G;  1AVO A;  1PGJ A;  2AEJ A;  5AVR B;  2L91 A;  2M8R A;  1W2B O;  1FZC B;  1LT9 C;  2SPZ A;  2WSC H;  3CPW O;  3RL0 D;  3PLN A;  1SQV G;  1NTM J;  1SLQ A;  2P67 A;  1FDM A;  1H0T B;  1S2E A;  5CJ0 A;  4D6T G;  2E74 C;  1AV1 A;  2RMZ A;  1SQV K;  2VRS A;  4WVZ A;  2P2U A;  1NKN A;  1EDJ A;  2Y9Z A;  2ZAE B;  1YTZ I;  2XDJ A;  3Q5P A;  1GK6 A;  3O6Q A;  4QMA A;  3AED C;  1IZN B;  2WT7 A;  4HH2 A;  4BWN A;  2W83 C;  1PPJ G;  5APS A;  3AEA C;  3H1I E;  1G2C A;  3V2P A;  3RBZ A;  3FX0 A;  3B71 A;  5AVZ B;  3HE5 A;  4UB6 H;  3L72 G;  1BDD A;  1Y9B A;  2XZR A;  2KS1 A;  1LWU A;  1DD3 A;  1U57 A;  1AVY A;  2FXP A;  3K5B A;  2KXP B;  1KQF B;  3W67 A;  3B5N C;  3TGU D;  1YTZ T;  1BDC A;  1SQB J;  4H44 D;  2NPS C;  1S3J A;  1BCC E;  1M1J B;  1LTA C;  2KSE A;  1SFC B;  1VF5 D;  1T3J A;  1ZW0 A;  2KYV A;  2RH0 A;  1NTM D;  1YJN P;  3H1J J;  1BGY G;  2ZXE B;  3JCU E;  1VQL P;  5AW7 B;  2E43 A;  2B9B A;  2N9B A;  4XE5 B;  4KJM A;  1LTJ B;  3L36 A;  3L74 E;  2OYH A;  3D71 A;  1SP4 A;  3VMX A;  4LGD E;  1S5L H;  1TU3 F;  2XNX A;  3KZI H;  4WY4 A;  3CCE P;  4HB1 A;  4DJG A;  1L0N J;  1FZA A;  1RF0 A;  1SS1 A;  1JOC A;  4GOD A;  1VPC A;  2H88 C;  4U3F E;  4EYY Q;  1IFP A;  3P7K A;  1JEK A;  3TYY A;  2AEF A;  2P7J A;  2IPP A;  1VQP P;  1KFM A;  3VP9 A;  2IX7 C;  5CHX A;  1J1E B;  1SQB D;  1VQ5 P;  3SWY A;  2PAJ A;  2ZXX A;  4I2L C;  4L74 A;  1BSH A;  2BCC J;  1KFN A;  1NWQ A;  4JQ0 D;  2XND H;  2IBZ I;  1M8O B;  4YPC A;  2KSJ A;  5APX A;  1UII A;  1Q7Y Q;  3L71 G;  1KOR A;  2YO2 A;  1YYC A;  1SQP G;  1SQQ G;  3KXD A;  3V5B A;  1L2P A;  1UIX A;  1LNQ A;  5CBO A;  3MTU E;  4IFM A;  1N73 C;  3AE7 C;  1SQP K;  2E75 D;  3GW6 A;  4GOF A;  2FFD A;  2WMM A;  1IK7 A;  3I5C A;  2DW3 A;  4HYT B;  1SQQ K;  3Q5R A;  4PD4 H;  1FDI A;  3H1K G;  2QIW A;  2K9Y A;  4R4L A;  1E5W A;  2IBZ E;  2FYN B;  1L0N D;  1A02 J;  5DJT B;  1GW4 A;  2CK3 H;  4N6J A;  3CCL P;  3PTZ A;  1M7L A;  3EFF K;  2R3C A;  4I1L A;  4C46 A;  3RL0 B;  1IFN A;  2JJL A;  1T8Z A;  2OYI A;  1OW6 A;  4I7Z B;  3IN6 A;  2KNC B;  3MUD C;  2WSF J;  4CPG A;  4NPD A;  3TNU A;  1L4A C;  1ZN5 A;  1MFT A;  1JTH B;  1LTG C;  1J2J B;  2YIU B;  1QVG O;  3ABV C;  1RE4 C;  4EDF A;  1KTM A;  1BCC G;  3H1I J;  1AJY A;  2GM4 A;  1IFJ A;  3D6Y A;  3S9O A;  1Z56 A;  1NH4 A;  3B4S A;  3L70 D;  1HTL C;  3V2Q A;  4LLH A;  1QL2 A;  4UB6 E;  4IL6 E;  3SWK A;  2B89 A;  4H0L B;  1T2K D;  1MFZ A;  2XKM A;  2WIT A;  1H0T A;  1GZL A;  1OVR A;  2Q1K A;  3C1L A;  2FYU J;  2YKO A;  1T3U A;  2QJP B;  2A45 I;  1GL2 C;  3GF7 A;  2IFM A;  3BCC G;  1USE A;  2FY8 A;  2RKL A;  2RN0 A;  5CCG C;  1WMK A;  5E79 H;  5B66 H;  1VQK P;  1GU5 A;  4EIJ A;  3VTP C;  2WQY C;  3JC2 2;  5APT A;  2ZVN B;  3EWK A;  5APU A;  2KUB A;  1W2E A;  2N1T D;  1HWT C;  2BEZ F;  3MHV A;  1VF5 B;  4AUW A;  1HGV A;  2C0W A;  1PP9 G;  2YXQ B;  1EZV D;  3L74 J;  2WPV B;  3L75 E;  2PRR A;  1QL1 A;  2YMK A;  1NTK J;  1SFC D;  5AVX B;  1S5L E;  2GUS A;  3KZI E;  4ZMD A;  3G9R A;  3PRJ A;  3H32 A;  4YTP C;  1ZOY C;  3BRV B;  3H1I D;  5APW A;  1KB9 H;  3VMZ A;  1M1J A;  3L73 E;  1PIX A;  2ZVO B;  1SFC A;  1WRG A;  2OAR A;  3VP8 A;  1WT6 A;  1CW5 A;  4DCK A;  3LID A;  3H1J E;  4ASV A;  2LXC B;  5APV A;  4JF7 A;  1RF1 B;  5L8R J;  1U7J A;  1BCC D;  2V7Q J;  3MGN A;  4W7Y A;  1L4A D;  1IFI A;  4YXD C;  2E74 B;  2H7H A;  3CMA P;  2KP8 A;  5BU8 B;  3WU2 H;  2WPR A;  5TIS H;  3H1H J;  2IBZ G;  1NYH A;  3F5H A;  3LW5 H;  1LWU C;  1ZR4 A;  2B87 B;  2CPS A;  1EQ7 A;  1K05 A;  2L5G B;  3RL0 g;  1ZR2 A;  4UB8 E;  3HUS B;  3A0B E;  3L74 D;  1GW3 A;  2QEX P;  3Q3D A;  2WSC J;  2QJY C;  4PD4 E;  5KJ7 D;  2Y9Y A;  3TGU G;  2JEE A;  1JY2 P;  3II6 A;  1NAF A;  2Q9I A;  2AXT H;  2E75 B;  2Q6Q A;  2BCC E;  2IDB A;  4BRY A;  1D7M A;  4U3F D;  3WMM 0;  3U1A A;  3BVH A;  1NKZ B;  1NTM G;  1NJI Q;  2KZJ A;  1RHZ B;  2K88 A;  1OVV A;  1YBK A;  1OZH A;  2OYH C;  2LXB A;  2JR8 A;  4IFD K;  1Y47 A;  2MJZ A;  1R5L A;  1NTM K;  1EZV I;  5AVY B;  1FOS F;  5KTB A;  2HPC A;  1MZ9 A;  2LKM A;  1IFD A;  1RF0 C;  2ZT9 C;  1DEB A;  5CJ4 A;  1KIL A;  2UWJ E;  3HRN A;  3TSI A;  5AW4 B;  3AEB C;  4OGQ C;  2NRG A;  2HG5 D;  3WUU A;  1HBW A;  4K3A A;  5TJH A;  3AEE C;  3CL3 D;  3M0D A;  3VOP A;  1AQ5 A;  1YIJ P;  2D2C C;  3OJA B;  3VYI A;  2A45 G;  4ZKU A;  4N3Y B;  1VQ4 P;  1DD4 A;  1E79 H;  1EZV E;  2QRX A;  4PV1 C;  2KNC A;  2ZJS E;  3A5T A;  1VQ8 P;  2M5A B;  1KYO H;  4NPE A;  1JY2 N;  3H1L E;  1JTH A;  1S5L X;  5E79 E;  2J59 M;  2IBZ D;  1SQB G;  1KMI Z;  4H0L D;  2KI7 B;  2O01 N;  3IFM A;  4OH8 B;  2I1J A;  3HE4 B;  1JY2 O;  2WPQ A;  4WB4 A;  1N7S C;  3CC4 P;  3VN0 A;  1SQB K;  1EC5 A;  4EI2 A; 
#chains in the Genus database with same CATH homology
 4W7Z A;  1NWQ A;  5KJ7 C;  4KHX A;  1GL2 D;  3MIW A;  3EFG A;  3V2N A;  2KSJ A;  1JY3 P;  5APX A;  1N7S B;  2WSF H;  1NTK K;  5AVT B;  4DOJ A;  3H6P A;  2N1T B;  2YO2 A;  4DZO A;  3P32 A;  1YYC A;  5CCG D;  2KLV A;  1LTT C;  5BU5 A;  4C7R A;  1HH0 A;  2Q3I A;  4LC1 A;  1J1D B;  2HYN A;  5AW1 B;  5AW6 B;  3V5B A;  3B5N B;  2Q7C A;  3G3Z A;  5AW8 B;  3MTU E;  4IFM A;  2XU6 A;  5KJ7 A;  1N73 C;  3L35 A;  1SQP K;  2NPS B;  3HD7 C;  3OAK A;  4W80 A;  3RK3 D;  2OYI C;  2FFD A;  2J58 A;  5CCH C;  5AVW B;  3I5C A;  4HYT B;  1SQQ K;  2OYH B;  1NOH A;  3HD7 B;  3OA7 A;  2OYI B;  2O1J A;  4WY4 C;  4C7N A;  1FJK A;  1MV8 A;  3M0A A;  1E5W A;  1X79 B;  2HFE D;  2FKW B;  3NXS A;  3NFQ A;  3TNU B;  4M3L A;  1NTZ K;  4WY4 B;  3GHG C;  1A02 J;  1GD2 E;  3U1C A;  1GW4 A;  4N6J A;  1NO4 A;  2WTY A;  1M7L A;  2R3C A;  3P8C E;  4I1L A;  1L0N K;  1RE3 C;  4C46 A;  1N73 A;  3RL0 B;  1IFN A;  3GHG B;  2PP6 A;  5AVS B;  2JJL A;  1T8Z A;  2OYI A;  2H43 A;  2GUV A;  3M91 A;  1ZLL A;  4GT1 A;  2C9N Y;  3TNU A;  5AVU B;  5AW3 B;  1L4A C;  1ZN5 A;  3A7O A;  1JTH B;  3RK2 C;  1LTG C;  1IFM A;  1J2J B;  4O9B A;  1L4A B;  1RF1 C;  1RE4 C;  3RK2 B;  1JCC A;  1A02 F;  1JY3 N;  2C9L Y;  3KYQ A;  1HUC A;  2GM4 A;  4AYC A;  1IFJ A;  2W27 A;  3V4W A;  1Z56 A;  2Z5H A;  1NH4 A;  2FXM A;  1FZG A;  2I1K A;  1HTL C;  3V2Q A;  4LLH A;  1QL2 A;  3MD0 A;  1T2K D;  1MFZ A;  1JY3 O;  2R32 A;  2XKM A;  2WIT A;  1GZL A;  1LGH B;  2KOG A;  2XV5 A;  1RF1 A;  1ZV8 A;  1RE4 A;  2YKO A;  1T3U A;  2A45 I;  1GL2 C;  2FYZ A;  2IFM A;  3PP5 A;  3HUS C;  3TK1 A;  3T97 A;  1GTW A;  3KDP B;  2FFD C;  3L4F A;  2O1K A;  1GL2 B;  3B8E B;  5AW5 B;  2KB7 P;  5CCG C;  1FZB A;  4AQR D;  2FFD B;  4I6M C;  4JYB A;  1GU5 A;  4EIJ A;  1URQ A;  1GU4 A;  3VTP C;  2HOD A;  5APT A;  1N7S D;  5APU A;  4C7N B;  2Z4E A;  3V2R A;  1W2E A;  2N1T D;  1KQL A;  1GL2 A;  2CPB A;  1HWT C;  1LTI C;  3P8M C;  3HUS A;  2IFN A;  1NU1 K;  4AUW A;  3H32 B;  1HGV A;  2C0W A;  1GDT A;  1JUN A;  5CCG A;  2POH A;  1N73 B;  3B5N D;  3M9B A;  1HJB A;  1FJP A;  4EOT A;  1HGZ A;  1QL1 A;  3A3Y B;  1MUU A;  1N86 A;  4IFF A;  1SFC D;  2NPS D;  5AVX B;  2GUS A;  1CZQ A;  1JO5 A;  3CI9 A;  3N7N A;  1KIL D;  1AFO A;  1FOS E;  1S9K E;  1N2D C;  3M9H A;  3H32 A;  3N4X A;  2QM8 A;  1FZF A;  3V4Q A;  1IK9 A;  3BRV B;  5APW A;  5CCH D;  3HTK A;  1H89 A;  3VMZ A;  4JYC A;  2YNY A;  1XTC C;  1PFI A;  1M1J A;  5CMZ A;  1FZC C;  4WY4 D;  1SFC A;  1WRG A;  5AVR B;  2OAR A;  3VP8 A;  1G1J A;  1WT6 A;  2M8R A;  4GIF A;  2O01 H;  2A45 H;  1CW5 A;  1LTB C;  1FZC B;  1LT9 C;  2WSC H;  3RL0 D;  4XA4 A;  2Z5I A;  1JCD A;  3LID A;  1SLQ A;  3LIE A;  1IO4 A;  1IJD B;  2P67 A;  1H88 A;  1NHL A;  1FDM A;  5APV A;  1KZU B;  1G1I A;  2E42 A;  5CJ0 A;  5KLV K;  5AVQ B;  4JF7 A;  1JMM A;  4Y99 C;  1RF1 B;  2FYU K;  2HLO A;  2WT7 B;  1FZC A;  3MGN A;  1X9V A;  4W7Y A;  1SQV K;  2VRS A;  1T2K C;  2P2U A;  1L4A D;  1NKN A;  1IFI A;  4Y99 B;  3IR9 A;  1YTZ I;  2XDJ A;  2H7H A;  2KP8 A;  5BU8 B;  1GK6 A;  1URQ C;  1LT9 A;  2WPR A;  1G2C B;  1SVF A;  1JNM A;  5APY A;  3LW5 H;  1LWU C;  3A2A A;  5AW0 B;  2WT7 A;  1OWA A;  1ZR4 A;  1URQ B;  4HH2 A;  2HOD B;  2CPS A;  1EQ7 A;  4RES B;  2L5G B;  5APS A;  1GK4 A;  1ZR2 A;  2H8P D;  3HUS B;  1G2C A;  3V2P A;  2WSE H;  1GW3 A;  1N7L A;  2BAS A;  3R2P A;  3E1I A;  5AVZ B;  1CSB A;  2P1J A;  2QM7 A;  3HE5 A;  2N1T C;  4N78 D;  2C0X A;  1CI6 A;  1XTG B;  2XZR A;  3KQG A;  1LWU A;  1OXZ A;  4WBA A;  5KJ7 D;  3RK3 C;  2JEE A;  3HE4 A;  1JY2 P;  3CLQ A;  2ZFC A;  3II6 A;  3M06 A;  1NAF A;  1J1D C;  3BRT B;  5APQ A;  2Q9I A;  3B5N C;  3RK3 B;  1M1J C;  1YTZ T;  3EQ2 A;  3UIA A;  1H8A A;  1SFC C;  2WZ7 A;  3HTK B;  3U1A A;  3WMM 0;  1LTS C;  3BVH A;  2NPS C;  1NKZ B;  2WWW A;  1N7S A;  1M1J B;  1KIL C;  3BAT A;  1LTA C;  1FZE A;  2HPC B;  3C9I A;  2N1T A;  3VMY A;  1SFC B;  2OYH C;  2R5B A;  1T3J A;  1HVV A;  2KYV A;  4IFD K;  1KIL B;  2MJZ A;  3HD7 D;  3NMD A;  1NTM K;  3M0D C;  2ZXE B;  3NTN A;  5AVY B;  1FOS F;  3B5N A;  3O8Z A;  4B86 A;  5KTB A;  1X8Y A;  2HPC A;  1MZ9 A;  1DX7 A;  2LKM A;  1IFD A;  1LTJ C;  3BAS A;  5AW7 B;  3U59 A;  1RY3 A;  3RL0 C;  2YKQ A;  1RF0 C;  5AW2 B;  2NPS A;  2E43 A;  1DEB A;  5CJ4 A;  1KIL A;  2YKP A;  2W6A A;  3HRN A;  5AW4 B;  3TSI A;  2N9B A;  4XE5 B;  1LTJ B;  3L36 A;  2OYH A;  1SP4 A;  3HD7 A;  1SQX K;  3VMX A;  4LGD E;  2HG5 D;  5CCH A;  1LT9 B;  1HBW A;  4N78 E;  2XNX A;  2YO3 A;  2R5D A;  3CL3 D;  1IC2 A;  3M0D A;  4WY4 A;  3VOP A;  2Q5U A;  1AQ5 A;  3OJA B;  1LTJ A;  3VYI A;  1FZA A;  3RK2 D;  2A45 G;  4ZKU A;  5AW9 B;  3GHG A;  1RF0 A;  1JOC A;  2YMY A;  4N3Y B;  1VPC A;  5BVZ A;  4ZKP A;  3A5T A;  1DH3 A;  1RE3 A;  2WPS A;  3P7K A;  2W6B A;  5AVV B;  3TYY A;  1L0L K;  1JY2 N;  1FAV A;  4GKG A;  1FU1 A;  1JTH A;  3HE5 B;  1FBM A;  3MUD A;  2P7J A;  2IPP A;  1J1E C;  2J59 M;  1CI6 B;  2M3B A;  3KPE A;  3M9Q A;  1LWU B;  1L4A A;  1KFM A;  3IFM A;  4OH8 B;  3VP9 A;  1S9K D;  2I1J A;  2IX7 C;  3L37 A;  5CHX A;  1J1E B;  3HE4 B;  1VDF A;  3P8C D;  3SWY A;  2PAJ A;  1JY2 O;  1URQ D;  4I2L C;  2WPQ A;  4WB4 A;  3SWF A;  1N7S C;  3VN0 A;  1KFN A;  1SQB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...