3S1KA

The development of peptide-based tools for the analysis of angiogenesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KEMHNAYAIEIALLPNLNDQQFHAFIWSLIDDPSQSANLLAEAKKLNDAQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Z-domain
publication title The development of Peptide-based tools for the analysis of angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3s1kA00
3MZWB 2I8DA 2B89A 4BXLA 1EC5A 1EDJA 4IOIH 4ZMDA 2KUBA 1OVUA 2B87A 2Q1KA 4GODA 1H0TA 2QVAA 4NPDA 4MN4C 1JMBA 1S3JA 2KZJA 4HKZH 2LR2A 1SS1A 5CBNA 3S1KA 2ZAEB 3QWOC 1FC2C 4K35A 2QRXA 2R44A 1Q2NA 4WWIA 1EDLA 1X0TA 4KJMA 5CBOA 1LT1A 2JWDA 1BDDA 4K3AA 2RKLA 3RGUA 2KI7B 5EFWB 3ZDMA 2KS1B 2K3RA 1MFTA 4GOFA 2M0BA 1DEEG 1ZW0A 1JM0A 1EDIA 1LP1A 3PH0A 3FXDA 4HB1A 4NPEA 1OVVA 4CPGA 2HR3A 4HJGH 1ZXGA 3FXEA 1BDCA 4ASWA 1LP1B 1Y47A 4ZNCA 2OTKE 4GOEA 4JBZA 2KZIA 4ASVA 1OVRA 2LXBA 5DJUB 5K5GB 2KIKA 2LXCB 2M5AA 3MHVA 5C39A 2UWJE 1U7JA 2SPZA 2WMMA 1NVOA 2B87B 4NPFX 2M5AB 1U7MA 2B88A 5DJTB 4EYYQ 1EDKA 1H0TB 2P58A
chains in the Genus database with same CATH superfamily
3D71A 1X22A 1KYOH 3OJAB 1NTME 5APYA 3PLNA 1KQSO 3MIWA 2KSEA 2Z5HA 1S3JA 1HJBA 2KB7P 3AEAC 5APTA 1PPJE 3EWKA 3HTKA 2Q9IA 1YJ9P 4A7PA 1SQXJ 2O3JA 3AEEC 5CBOA 1M90Q 1LT9C 2RKLA 4I2LC 1LJ2A 3RL0g 5TISH 1FDIA 3L75E 4DCKA 3PHLA 3HRNA 2Q3EA 1AVYA 4GOFA 1VL2A 3ITKA 1SQVE 2OTLP 2QJPC 4R4MA 1BE3D 2M3EA 2QM7A 1S9KE 3CC2P 1SQBK 1GU5A 3CWBG 3CX5E 4TLFA 1NTMD 3GHGA 2OYIC 1Q81Q 4I6MC 1Y47A 1VQ7P 1PIXA 3GLMA 4JBZA 1PP9E 5B5EH 2CPSA 2G3AA 2XKMA 1PGPA 2QJKB 1DEBA 1PPJD 1SQQJ 2JJLA 2NPSB 4Y99B 4W80A 1T8ZA 1LTJC 3L75D 2P67A 3H1HG 3VMAA 1GMJA 5AVUB 1SQVD 1BSNA 3A3YB 5CCHC 1S9KD 1NTKG 3H1IE 1JTHB 3CX5D 1NHLA 1KC8Q 1KYOE 1LWUA 4U3FG 3HUSC 1VQLP 3RK2C 1JUNA 2ZT9B 3L73J 1J1DB 4YXDC 3B5NA 1FU1A 5AW7B 1EDLA 1IFMA 4M3LA 1PP9D 1JTHA 2YXRB 1NU1G 4JYCA 3FGAD 4GT1A 2KOGA 1WT6A 1JB0J 3JC22 1N2DC 2FYZA 2H43A 2Y0DA 1S5LX 1QL1A 1LP1A 2M3BA 4YPCA 1M57D 3U1CA 5KJ7A 2I1KA 2LKMA 1IC2A 4D6TE 3KZIH 4OH8B 5TISE 1S2EA 1H88A 2CPBA 2Z5IA 1HGZA 3N7NA 1VQ9P 4GOEA 5AW0B 1K9MQ 1LGHB 1OVRA 1GZLA 2R3SA 3TDKA 3H1ID 2IBZE 1RE4A 2Y9ZA 1KYOD 2KYVA 2D2CC 2E76C 1NH4A 2FBWC 2R5DA 1NVOA 4UB6E 5APSA 3H1LE 5AVZB 2WPSA 2OYHC 2K9JB 1H0TB 1VQKP 5AW6B 3AEDC 1ZN5A 1U57A 5KLVK 1X8YA 2O01N 1J1EB 4I1LA 2Q1KA 3L71G 2K9JA 1BE3J 1H0TA 2HYNA 2FXPA 3IAOA 4EI2A 3VMXA 2WPVB 2WT7B 5AW5B 3NFQA 4D6TD 3AE2C 5E79E 2QRXA 3V2PA 1Q82Q 2WSCJ 2AXTH 4KJMA 2W90A 3V2QA 2IBZD 3HD7D 2WT7A 4PJ0H 5AW3B 1SQBG 3MUDA 1S1CX 5EFWB 4H13D 3H1LD 1NTZK 2IYOA 1HJ0A 1JCCA 1FZCB 3L75J 2XV5A 1KILE 3QH9A 4CPGA 2E74D 1CI6B 3EFFK 2XU6A 3FXEA 2JP3A 1NKZB 4LGDE 1FZBA 1URQB 4H0LB 1SQVJ 1BSHA 3HE4B 1L4AC 2BCCG 2YO2A 1FJPA 2NRGA 1AFOA 1LTJB 2IFMA 2LXBA 3CCLP 5APQA 1PP9J 1U7MA 4TT3H 2AEJA 3JSVC 5AVWB 2I8DA 2H88C 1ZLLA 2Q5UA 4H44D 3G6EP 4XFJA 3RK2B 2ZVNB 1D7MA 4DJGA 3JCUH 2PGDA 1KILD 1YTZI 1IFDA 1HTLC 1VQ8P 1K05A 2P10A 2DW3A 1IFIA 3GF3A 1OZHA 1M1KQ 3H1IJ 3I5CA 1KYOI 1YJWP 3GG2A 3RK3E 2Y9YA 1VQ6P 3O6QB 1JY2N 3CI9A 1SQXE 1HWTC 2FXMA 3V5BA 2AXTE 2PP6A 3CMAP 2E76B 1BGYG 1RF0C 2RN0A 2C9NY 2HODA 5B66H 2ZVOB 1FBMA 2FFDB 3UIAA 1FDMA 1HVVA 2GUVA 4D6TJ 5KLVG 2UWJE 5KTBA 1NAFA 3N4XA 1P84H 2M5AB 1GDTA 1L0LE 1R5LA 2FFDA 2YO3A 1JM0A 3V6IA 3MZWB 2WVRA 3RK3D 3VN0A 2B89A 3GHGC 2KUBA 2QA4P 1G2CA 3H1LJ 4L73A 1W2EA 2GM4A 2GA1A 4H13B 2N1TD 4NPDA 3HD7A 1JY3P 4XA4A 2E75C 1IFJA 3L35A 1Q7YQ 1N86A 1GL2D 2WSCH 5CBNA 3S1KA 1Y9BA 3QWOC 2YXQB 1PFIA 1M8OB 4KT0J 1Q2NA 1NTZG 2E42A 3BASA 1RE3C 2QJKC 3K5BA 1GW3A 1BDDA 1N7SD 3T97B 3II6A 2KK7A 2MKVA 2NPSC 1SQXK 1DH3A 2KI7B 3ZDMA 1KQFB 1L0LD 1KTMA 2ZYGA 1PV3A 3MTUE 3LW5H 2XNDH 1T3UA 2O01J 1LWUC 1FJKA 3H6PA 5APVA 5GTIE 3O8ZA 3B5NC 1CSBA 4H44B 3CLQA 3CX5H 1T2KD 3CC7P 3D6ZA 1RF1B 3KXDA 1KILB 2ZT9C 1J1DC 3AE5C 5APUA 1ZR2A 2BEZF 2G8YA 5AVYB 1YIJP 4PD4H 4WY4D 3CPWO 1RF1A 3VTPC 1R8EA 5KJ7C 1KILA 3G3ZA 2WSSH 2R5BA 5B66E 3OW2O 4L74A 1SQQK 4PV1D 2ZJSE 1OVUA 1HGVA 4WVZA 4IFMA 4RKUJ 2R32A 1RHZB 1P84E 2KLUA 4N6JA 2YMYA 3VOPA 1LTBC 3L36A 1X79B 1SVFA 2P7JA 3S9OA 3L72E 5AVVB 1MKMA 4HYTB 1BE3E 1IO4A 4O9BA 2OGUA 3MP7B 2R44A 2OARA 1YYCA 2JWDA 4R4LA 4K3AA 3FWLA 3EFGA 4LC1A 3HTKB 2FXOA 4Z1MH 1JY2O 2WQYC 3CWBJ 3A2AA 1KN7A 4XE5B 3L70E 1EXJA 1J1EC 3H32A 3FXDA 3RK3B 1YITP 1BCCG 3H1KE 3H1JG 1P84D 2N9BA 3Q5RA 3M9HA 3GHGB 3MUDC 3L72D 3HE5A 3SWKA 1Q90D 3CCRP 2L5GB 3TGUE 1GD2E 3ABVC 3G71P 2N1TA 3L4FA 4UB6H 2E75B 1OX3A 2JO1A 2K88A 1VQOP 1EDJA 3KDPB 1GL2A 1L0LJ 1K8AQ 3BCCE 4L76A 1L0NE 1FZCC 3L70D 4PD4E 4DZOA 3AE8C 2ZYAA 1URQC 1UIXA 4H0LC 2L91A 4MN4C 1N7SA 1LTSC 1RQUA 2OYOA 1NU1J 2WTYA 3H1KD 1KD1Q 1SQXG 1QVGO 5E79H 1NTMK 1OW8A 1LWUB 4GIFA 3B5NB 3I56P 4YTPC 3TGUD 1PZQA 4WBAA 2IYPA 2O01H 2YKOA 1W2BO 4QMAA 3FX0A 2HR3A 3BCCD 1N7LA 1L0ND 3RBZA 1LP1B 4WY4A 2XDJA 3AE4C 4PD4D 1SFCD 2PFXA 2YIUB 1HH0A 1SQVK 2HLOA 2WSFJ 3CCSP 1SQQG 2KIKA 2AXCA 3SWYA 3AEGC 4U7JA 5M1BA 1FS0E 1PL5A 3CL3D 3AE7C 1IZNB 1Y8AA 3L71J 1OMIA 2A06G 3E7KA 3B8EB 3KPEA 2KSJA 2XZRA 2I1JA 3L73G 3F5HA 2BASA 1FC2C 2FFDC 3L72J 1HUCA 2FYUE 1IJDB 1ZR4A 1EZVE 3BATA 2D2CD 4I7ZB 3VYIA 1JNMA 1PGJA 1NGMB 4H13C 3L70J 3AEBC 1BDCA 1HF9A 1ZRTE 3L74E 3OAKA 2E74C 1S4XA 3H1KJ 3PRJA 2C9LY 3BRVB 5AVXB 1MUUA 1AA0A 1XTCC 4NPFX 2O1KA 3LW5J 1SQPE 1GK4A 4EYYQ 5AW1B 3TGUJ 2FYUD 1EZVD 3S4RA 1BE3G 5CCGD 1DIPA 3IFMA 3M0DA 3CX5I 4WB4A 2OYIA 1NTMG 3AE9C 4H44C 1TU3F 3BCCJ 1L0NJ 3A0BH 2QG4A 3V2NA 4GKGA 3VP9A 1RF1C 3CXHE 4PD4I 2ZAEB 4HH2A 1ZRTD 3L74D 4JQ0D 1N73A 1KILC 3V2RA 2J5UA 1PPJG 3M06A 1VF5D 2AEFA 3OA7A 4JPZB 4AYCA 1SFCA 3L75G 3R2PA 1RQVA 2M0BA 1SQPD 4LLHA 5APWA 2V7QJ 1SQVG 5CCHA 4HB1A 3C8VA 4HJGH 5GTIH 1KORA 3IN6A 1GTWA 3CWBE 4W7YA 1E79H 3WU2E 2WSFH 3EQ2A 5AVSB 3W68A 5BVZA 1ZMEC 1PP9G 1YBKA 1FE6A 2HODB 3CXHD 3AE3C 1A02J 1U7JA 4GDOA 1KB9H 1EDKA 2CK3H 3CCMP 4OGQD 3SFDC 4EOTA 4JF7A 3H1HE 1FOSE 1AQTA 4N78E 2QJYB 2FKWB 3L37A 3RK3C 2P1JA 3E1RA 1G2CB 5KLIB 1NTKE 2IBZI 3CWBD 2YMKA 4U3FE 3H1IG 2YKPA 2N1TC 3HD7B 1DD3A 1IK9A 5AVRB 1A02F 1H89A 1GL2C 1JY3N 1LT1A 1NU1E 1JCDA 3TK1A 3Q5PA 5AW9B 2K9YA 3A0BE 2WITA 2H7HA 2E74B 4N3YB 2V4HA 2FYUJ 4RO0A 1M7LA 3RL0D 1ZOYC 1N8RQ 3TF5A 1RY3A 4OWFA 3H1HD 2POHA 5AW8B 4N78D 3VMYA 4D6TG 2NZ2A 5KAFH 1NTKD 1VQMP 3LIDA 3IR9A 4U3FD 5CCGA 4JYBA 3TSIA 2IBZG 3M91A 3L74J 3TYYA 1LTAC 3W67A 1UIIA 1LTGC 3H1LG 1NU1D 1AQ5A 2OQQA 4WY4C 1AV1A 4Y28J 1SQPJ 2NPSD 2KLVA 2YNYA 3L71E 1FZGA 1GW4A 1L0LK 2FY8A 1KB9E 4C7NB 4RESB 2K1AA 2LR2A 2YIUC 1E5WA 2A45H 4B86A 4C7NA 1T6AA 2ZT9D 1RE4C 1SQBE 5KKZB 3RGUA 2V7QH 1YI2P 2B9BA 1DEEG 2BEQD 3KHUA 2ZYDA 5CMZA 1G1JA 1R5SA 1QLED 2P2UA 4OGQB 1VQ5P 3C9IA 3L71D 3H32B 2BCCE 3M9BA 2WWWA 5AVQB 1NO4A 1KB9D 3Q2YA 1IFNA 3V4QA 1OW6A 1GU4A 4AQRD 3MHVA 2RMZA 1DD4A 1NYHA 3HE5B 3G4SP 2P58A 4I7ZC 4EDFA 1SQBD 5KAFE 3FWNA 5AVTB 3KYQA 2N1TB 2WSEJ 5AW2B 1RF0A 3AEFC 1VQNP 4GODA 1GL2B 2QVAA 1MZ9A 3H1HJ 3RL0B 3CCJP 2KZJA 1AJYA 4UB8H 1H8AA 3F89A 5GTHE 1SS1A 2BCCD 1DX7A 1JEKA 1YQ4C 1N7SB 2W27A 1NTKJ 2GUSA 3A5TA 2Q3IA 4U3FJ 1OWAA 1JY3O 3M0DC 1NAYA 3A0HH 1M1JB 4DOJA 3Q1MA 1QEXA 2K3RA 2JEEA 1RH5B 1ZW0A 3MD0A 2C0XA 3WUUA 4YXWH 1M1JA 1OIPA 1LNQA 1KMIZ 5L8RJ 2IPPA 2WPQA 5CJ4A 1BGYE 1N73C 3R4YA 1X9VA 4ASWA 1FOSF 3SWFA 1JOCA 5BU8B 1KQGB 1URQD 1RE3A 4H0LD 2E5TA 4WY4B 1VQ4P 1SLQA 1PGOA 5KLVE 1QX8A 3E1IA 1SFCC 2NPSA 2SPZA 2PAJA 2IZ0A 4PV1B 1K73Q 2IX7C 4ZKUA 1L0LG 1KQLA 1EC5A 2QE7H 1AVOA 5CCHD 3D70A 3B71A 2IFNA 3KQGA 3CCQP 4IFDK 1PGQA 4BRYB 2O1JA 2E5YA 1MV8A 3RK2D 1BGYD 2JR8A 4IL6X 4BRYA 1WMKA 3CXHH 4EIJA 1L0NK 1NTZE 1KB9I 3BRTB 2W6AA 5KLVD 1FDOA 2JWAA 3D6YA 4UB8E 3PTZA 1KFMA 2N9YB 1MFTA 1Z56A 1SQBJ 2HFED 1P84I 1EDIA 2QSIA 1ZP0C 1W5CE 2OTJP 4NPEA 2QJYC 1OVVA 1YHQP 1EXIA 3A0HE 1FZEA 5KLIC 3P8MC 3WUVA 3WU2H 4ZNCA 2IZ1A 2E76D 2OTKE 3CCVP 3AECC 3HD7C 5B5EE 1IFPA 2BCCJ 2VRSA 3PP5A 3WUTA 3I55P 2J59M 1NTZD 1LT9B 3GW6A 2WSEH 1NTMJ 1MFZA 3Q5SA 2QJPB 1LT9A 2W6JH 3TNUB 2JDIH 2W8ZA 3GF7A 5CCGC 3U59A 2OYIB 2ITAA 3V4WA 3L72G 3TNUA 3SFEC 1CZQA 4K35A 3P32A 1X0TA 3CMEP 4IL6H 1USDA 1N73B 2FYNC 1QVFO 3B4SA 1NOHA 1S5LH 1VPCA 4C46A 1FZCA 1VF5C 2KS1B 1CI6A 2KP8A 1URQA 3L70G 1L4AD 1SFCB 3HE4A 4IFFA 2Y0EA 3C1LA 1L2PA 2J58A 2FYUK 1BCCE 3H1JE 2KS1A 5APXA 3KZIE 1LTJA 3H1KG 3P8CE 2A45I 1BGYJ 5CJ0A 3HUSB 4ASVA 3VMZA 1KV4A 5DJUB 2XNXA 1JO5A 1SP4A 2H8PD 3WMM0 2M8RA 3TGUG 1NKNA 2QEXP 5KLVJ 5KKZC 1OXZA 3HUSA 1K04A 1T3JA 2WPRA 2R3CA 4BXLA 3H25A 4DT0A 1OFCX 3BCCG 3AE6C 4L75A 1L0NG 3RBXA 2MJZA 2W83C 4OGQC 1SQPK 1JMBA 2Y0CA 1BCCD 3SSUA 1WRGA 5CHXA 2E43A 3H1JD 4ZKPA 5TJHA 3M0AA 2RH0A 3P8CD 2WZ7A 1JY2P 3G9RA 1GK6A 1QL2A 4WWIA 3NMDA 2A45G 2D2CB 2ZFCA 2HG5D 3O6QA 2W6BA 1VDFA 4PJ0E 3IF4A 1VQPP 1LTIC 1FAVA 1NTZJ 1CW5A 2OYHB 2K37A 4AUWA 4W7ZA 5BU5A 1QGKB 5H2FH 5KAIH 3BVHA 2OYHA 2H89C 4IL6E 1ZXGA 4RJTA 2KNCB 1FZAA 1IK7A 1M56D 3RL0C 1S5LE 2C0WA 3NXSA 3CC4P 2QM8A 3CCUP 4C7RA 1SQQE 1N7SC 5K5GB 1SQXD 2M5AA 1FZFA 5C39A 1EZVI 2KNCA 2JKVA 3CCEP 2HPCB 3LIEA 2B87B 1M1JC 1Q86Q 5DJTB 1YJNP 3USSA 3Q3DA 2A06E 1NWQA 3VP8A 4IOIH 4ZMDA 2HPCA 2ZXXA 2B87A 1T2KC 2E75D 1YTZT 3JCUE 1EQ7A 2FYNB 3L73E 1L4AB 4Y99C 4HKZH 1OW7A 1S72P 3A7OA 1VF5B 5GTHH 3U1AA 1ZV8A 3T97A 3M9QA 1NJIQ 1G1IA 3PJSK 1L4AA 2PRRA 1SQQD 2AEMA 1XTGB 1NTKK 4PV1C 2FYUG 2ZXEB 1EZVG 3CD6P 3AE1C 1J2JB 5AW4B 3B5ND 2YKQA 4OVNF 3NTNA 2A06D 2IDBA 3PH0A 1HBWA 1NU1K 2Z4EA 2Q6QA 3P7KA 3CXHI 1YQ3C 3MGNA 3L74G 1BCCJ 3L73D 2KZIA 1JMMA 3H1JJ 1USEA 2LXCB 2Q7CA 5H2FE 5KAIE 5KJ7D 1KZUB 4KHXA 1KFNA 2KXPB 3GMAA 2WMMA 2B88A 4BWNA 2QIWA 1LTTC 1SQPG
chains in the Genus database with same CATH topology
3MZWB 2I8DA 2B89A 4BXLA 1EC5A 1EDJA 4IOIH 4ZMDA 2KUBA 1OVUA 2B87A 2Q1KA 4GODA 1H0TA 2QVAA 4NPDA 4MN4C 1JMBA 1S3JA 2KZJA 4HKZH 2LR2A 1SS1A 5CBNA 3S1KA 2ZAEB 3QWOC 1FC2C 4K35A 2QRXA 2R44A 1Q2NA 4WWIA 1EDLA 1X0TA 4KJMA 5CBOA 1LT1A 2JWDA 1BDDA 4K3AA 2RKLA 3RGUA 2KI7B 5EFWB 3ZDMA 2KS1B 2K3RA 1MFTA 4GOFA 2M0BA 1DEEG 1ZW0A 1JM0A 1EDIA 1LP1A 3PH0A 3FXDA 4HB1A 4NPEA 1OVVA 4CPGA 2HR3A 4HJGH 1ZXGA 3FXEA 1BDCA 4ASWA 1LP1B 1Y47A 4ZNCA 2OTKE 4GOEA 4JBZA 2KZIA 4ASVA 1OVRA 2LXBA 5DJUB 5K5GB 2KIKA 2LXCB 2M5AA 3MHVA 5C39A 2UWJE 1U7JA 2SPZA 2WMMA 1NVOA 2B87B 4NPFX 2M5AB 1U7MA 2B88A 5DJTB 4EYYQ 1EDKA 1H0TB 2P58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZW B;  2I8D A;  2B89 A;  4BXL A;  1EC5 A;  1EDJ A;  4IOI H;  4ZMD A;  2KUB A;  1OVU A;  2B87 A;  2Q1K A;  4GOD A;  1H0T A;  2QVA A;  4NPD A;  4MN4 C;  1JMB A;  1S3J A;  2KZJ A;  4HKZ H;  2LR2 A;  1SS1 A;  5CBN A;  3S1K A;  2ZAE B;  3QWO C;  1FC2 C;  4K35 A;  2QRX A;  2R44 A;  1Q2N A;  4WWI A;  1EDL A;  1X0T A;  4KJM A;  5CBO A;  1LT1 A;  2JWD A;  1BDD A;  4K3A A;  2RKL A;  3RGU A;  2KI7 B;  5EFW B;  3ZDM A;  2KS1 B;  2K3R A;  1MFT A;  4GOF A;  2M0B A;  1DEE G;  1ZW0 A;  1JM0 A;  1EDI A;  1LP1 A;  3PH0 A;  3FXD A;  4HB1 A;  4NPE A;  1OVV A;  4CPG A;  2HR3 A;  4HJG H;  1ZXG A;  3FXE A;  1BDC A;  4ASW A;  1LP1 B;  1Y47 A;  4ZNC A;  2OTK E;  4GOE A;  4JBZ A;  2KZI A;  4ASV A;  1OVR A;  2LXB A;  5DJU B;  5K5G B;  2KIK A;  2LXC B;  2M5A A;  3MHV A;  5C39 A;  2UWJ E;  1U7J A;  2SPZ A;  2WMM A;  1NVO A;  2B87 B;  4NPF X;  2M5A B;  1U7M A;  2B88 A;  5DJT B;  4EYY Q;  1EDK A;  1H0T B;  2P58 A; 
#chains in the Genus database with same CATH topology
 3D71 A;  1X22 A;  1KYO H;  3OJA B;  1NTM E;  5APY A;  3PLN A;  1KQS O;  3MIW A;  2KSE A;  2Z5H A;  1S3J A;  1HJB A;  2KB7 P;  3AEA C;  5APT A;  1PPJ E;  3EWK A;  3HTK A;  2Q9I A;  1YJ9 P;  4A7P A;  1SQX J;  2O3J A;  3AEE C;  5CBO A;  1M90 Q;  1LT9 C;  2RKL A;  4I2L C;  1LJ2 A;  3RL0 g;  5TIS H;  1FDI A;  3L75 E;  4DCK A;  3PHL A;  3HRN A;  2Q3E A;  1AVY A;  4GOF A;  1VL2 A;  3ITK A;  1SQV E;  2OTL P;  2QJP C;  4R4M A;  1BE3 D;  2M3E A;  2QM7 A;  1S9K E;  3CC2 P;  1SQB K;  1GU5 A;  3CWB G;  3CX5 E;  4TLF A;  1NTM D;  3GHG A;  2OYI C;  1Q81 Q;  4I6M C;  1Y47 A;  1VQ7 P;  1PIX A;  3GLM A;  4JBZ A;  1PP9 E;  5B5E H;  2CPS A;  2G3A A;  2XKM A;  1PGP A;  2QJK B;  1DEB A;  1PPJ D;  1SQQ J;  2JJL A;  2NPS B;  4Y99 B;  4W80 A;  1T8Z A;  1LTJ C;  3L75 D;  2P67 A;  3H1H G;  3VMA A;  1GMJ A;  5AVU B;  1SQV D;  1BSN A;  3A3Y B;  5CCH C;  1S9K D;  1NTK G;  3H1I E;  1JTH B;  3CX5 D;  1NHL A;  1KC8 Q;  1KYO E;  1LWU A;  4U3F G;  3HUS C;  1VQL P;  3RK2 C;  1JUN A;  2ZT9 B;  3L73 J;  1J1D B;  4YXD C;  3B5N A;  1FU1 A;  5AW7 B;  1EDL A;  1IFM A;  4M3L A;  1PP9 D;  1JTH A;  2YXR B;  1NU1 G;  4JYC A;  3FGA D;  4GT1 A;  2KOG A;  1WT6 A;  1JB0 J;  3JC2 2;  1N2D C;  2FYZ A;  2H43 A;  2Y0D A;  1S5L X;  1QL1 A;  1LP1 A;  2M3B A;  4YPC A;  1M57 D;  3U1C A;  5KJ7 A;  2I1K A;  2LKM A;  1IC2 A;  4D6T E;  3KZI H;  4OH8 B;  5TIS E;  1S2E A;  1H88 A;  2CPB A;  2Z5I A;  1HGZ A;  3N7N A;  1VQ9 P;  4GOE A;  5AW0 B;  1K9M Q;  1LGH B;  1OVR A;  1GZL A;  2R3S A;  3TDK A;  3H1I D;  2IBZ E;  1RE4 A;  2Y9Z A;  1KYO D;  2KYV A;  2D2C C;  2E76 C;  1NH4 A;  2FBW C;  2R5D A;  1NVO A;  4UB6 E;  5APS A;  3H1L E;  5AVZ B;  2WPS A;  2OYH C;  2K9J B;  1H0T B;  1VQK P;  5AW6 B;  3AED C;  1ZN5 A;  1U57 A;  5KLV K;  1X8Y A;  2O01 N;  1J1E B;  4I1L A;  2Q1K A;  3L71 G;  2K9J A;  1BE3 J;  1H0T A;  2HYN A;  2FXP A;  3IAO A;  4EI2 A;  3VMX A;  2WPV B;  2WT7 B;  5AW5 B;  3NFQ A;  4D6T D;  3AE2 C;  5E79 E;  2QRX A;  3V2P A;  1Q82 Q;  2WSC J;  2AXT H;  4KJM A;  2W90 A;  3V2Q A;  2IBZ D;  3HD7 D;  2WT7 A;  4PJ0 H;  5AW3 B;  1SQB G;  3MUD A;  1S1C X;  5EFW B;  4H13 D;  3H1L D;  1NTZ K;  2IYO A;  1HJ0 A;  1JCC A;  1FZC B;  3L75 J;  2XV5 A;  1KIL E;  3QH9 A;  4CPG A;  2E74 D;  1CI6 B;  3EFF K;  2XU6 A;  3FXE A;  2JP3 A;  1NKZ B;  4LGD E;  1FZB A;  1URQ B;  4H0L B;  1SQV J;  1BSH A;  3HE4 B;  1L4A C;  2BCC G;  2YO2 A;  1FJP A;  2NRG A;  1AFO A;  1LTJ B;  2IFM A;  2LXB A;  3CCL P;  5APQ A;  1PP9 J;  1U7M A;  4TT3 H;  2AEJ A;  3JSV C;  5AVW B;  2I8D A;  2H88 C;  1ZLL A;  2Q5U A;  4H44 D;  3G6E P;  4XFJ A;  3RK2 B;  2ZVN B;  1D7M A;  4DJG A;  3JCU H;  2PGD A;  1KIL D;  1YTZ I;  1IFD A;  1HTL C;  1VQ8 P;  1K05 A;  2P10 A;  2DW3 A;  1IFI A;  3GF3 A;  1OZH A;  1M1K Q;  3H1I J;  3I5C A;  1KYO I;  1YJW P;  3GG2 A;  3RK3 E;  2Y9Y A;  1VQ6 P;  3O6Q B;  1JY2 N;  3CI9 A;  1SQX E;  1HWT C;  2FXM A;  3V5B A;  2AXT E;  2PP6 A;  3CMA P;  2E76 B;  1BGY G;  1RF0 C;  2RN0 A;  2C9N Y;  2HOD A;  5B66 H;  2ZVO B;  1FBM A;  2FFD B;  3UIA A;  1FDM A;  1HVV A;  2GUV A;  4D6T J;  5KLV G;  2UWJ E;  5KTB A;  1NAF A;  3N4X A;  1P84 H;  2M5A B;  1GDT A;  1L0L E;  1R5L A;  2FFD A;  2YO3 A;  1JM0 A;  3V6I A;  3MZW B;  2WVR A;  3RK3 D;  3VN0 A;  2B89 A;  3GHG C;  2KUB A;  2QA4 P;  1G2C A;  3H1L J;  4L73 A;  1W2E A;  2GM4 A;  2GA1 A;  4H13 B;  2N1T D;  4NPD A;  3HD7 A;  1JY3 P;  4XA4 A;  2E75 C;  1IFJ A;  3L35 A;  1Q7Y Q;  1N86 A;  1GL2 D;  2WSC H;  5CBN A;  3S1K A;  1Y9B A;  3QWO C;  2YXQ B;  1PFI A;  1M8O B;  4KT0 J;  1Q2N A;  1NTZ G;  2E42 A;  3BAS A;  1RE3 C;  2QJK C;  3K5B A;  1GW3 A;  1BDD A;  1N7S D;  3T97 B;  3II6 A;  2KK7 A;  2MKV A;  2NPS C;  1SQX K;  1DH3 A;  2KI7 B;  3ZDM A;  1KQF B;  1L0L D;  1KTM A;  2ZYG A;  1PV3 A;  3MTU E;  3LW5 H;  2XND H;  1T3U A;  2O01 J;  1LWU C;  1FJK A;  3H6P A;  5APV A;  5GTI E;  3O8Z A;  3B5N C;  1CSB A;  4H44 B;  3CLQ A;  3CX5 H;  1T2K D;  3CC7 P;  3D6Z A;  1RF1 B;  3KXD A;  1KIL B;  2ZT9 C;  1J1D C;  3AE5 C;  5APU A;  1ZR2 A;  2BEZ F;  2G8Y A;  5AVY B;  1YIJ P;  4PD4 H;  4WY4 D;  3CPW O;  1RF1 A;  3VTP C;  1R8E A;  5KJ7 C;  1KIL A;  3G3Z A;  2WSS H;  2R5B A;  5B66 E;  3OW2 O;  4L74 A;  1SQQ K;  4PV1 D;  2ZJS E;  1OVU A;  1HGV A;  4WVZ A;  4IFM A;  4RKU J;  2R32 A;  1RHZ B;  1P84 E;  2KLU A;  4N6J A;  2YMY A;  3VOP A;  1LTB C;  3L36 A;  1X79 B;  1SVF A;  2P7J A;  3S9O A;  3L72 E;  5AVV B;  1MKM A;  4HYT B;  1BE3 E;  1IO4 A;  4O9B A;  2OGU A;  3MP7 B;  2R44 A;  2OAR A;  1YYC A;  2JWD A;  4R4L A;  4K3A A;  3FWL A;  3EFG A;  4LC1 A;  3HTK B;  2FXO A;  4Z1M H;  1JY2 O;  2WQY C;  3CWB J;  3A2A A;  1KN7 A;  4XE5 B;  3L70 E;  1EXJ A;  1J1E C;  3H32 A;  3FXD A;  3RK3 B;  1YIT P;  1BCC G;  3H1K E;  3H1J G;  1P84 D;  2N9B A;  3Q5R A;  3M9H A;  3GHG B;  3MUD C;  3L72 D;  3HE5 A;  3SWK A;  1Q90 D;  3CCR P;  2L5G B;  3TGU E;  1GD2 E;  3ABV C;  3G71 P;  2N1T A;  3L4F A;  4UB6 H;  2E75 B;  1OX3 A;  2JO1 A;  2K88 A;  1VQO P;  1EDJ A;  3KDP B;  1GL2 A;  1L0L J;  1K8A Q;  3BCC E;  4L76 A;  1L0N E;  1FZC C;  3L70 D;  4PD4 E;  4DZO A;  3AE8 C;  2ZYA A;  1URQ C;  1UIX A;  4H0L C;  2L91 A;  4MN4 C;  1N7S A;  1LTS C;  1RQU A;  2OYO A;  1NU1 J;  2WTY A;  3H1K D;  1KD1 Q;  1SQX G;  1QVG O;  5E79 H;  1NTM K;  1OW8 A;  1LWU B;  4GIF A;  3B5N B;  3I56 P;  4YTP C;  3TGU D;  1PZQ A;  4WBA A;  2IYP A;  2O01 H;  2YKO A;  1W2B O;  4QMA A;  3FX0 A;  2HR3 A;  3BCC D;  1N7L A;  1L0N D;  3RBZ A;  1LP1 B;  4WY4 A;  2XDJ A;  3AE4 C;  4PD4 D;  1SFC D;  2PFX A;  2YIU B;  1HH0 A;  1SQV K;  2HLO A;  2WSF J;  3CCS P;  1SQQ G;  2KIK A;  2AXC A;  3SWY A;  3AEG C;  4U7J A;  5M1B A;  1FS0 E;  1PL5 A;  3CL3 D;  3AE7 C;  1IZN B;  1Y8A A;  3L71 J;  1OMI A;  2A06 G;  3E7K A;  3B8E B;  3KPE A;  2KSJ A;  2XZR A;  2I1J A;  3L73 G;  3F5H A;  2BAS A;  1FC2 C;  2FFD C;  3L72 J;  1HUC A;  2FYU E;  1IJD B;  1ZR4 A;  1EZV E;  3BAT A;  2D2C D;  4I7Z B;  3VYI A;  1JNM A;  1PGJ A;  1NGM B;  4H13 C;  3L70 J;  3AEB C;  1BDC A;  1HF9 A;  1ZRT E;  3L74 E;  3OAK A;  2E74 C;  1S4X A;  3H1K J;  3PRJ A;  2C9L Y;  3BRV B;  5AVX B;  1MUU A;  1AA0 A;  1XTC C;  4NPF X;  2O1K A;  3LW5 J;  1SQP E;  1GK4 A;  4EYY Q;  5AW1 B;  3TGU J;  2FYU D;  1EZV D;  3S4R A;  1BE3 G;  5CCG D;  1DIP A;  3IFM A;  3M0D A;  3CX5 I;  4WB4 A;  2OYI A;  1NTM G;  3AE9 C;  4H44 C;  1TU3 F;  3BCC J;  1L0N J;  3A0B H;  2QG4 A;  3V2N A;  4GKG A;  3VP9 A;  1RF1 C;  3CXH E;  4PD4 I;  2ZAE B;  4HH2 A;  1ZRT D;  3L74 D;  4JQ0 D;  1N73 A;  1KIL C;  3V2R A;  2J5U A;  1PPJ G;  3M06 A;  1VF5 D;  2AEF A;  3OA7 A;  4JPZ B;  4AYC A;  1SFC A;  3L75 G;  3R2P A;  1RQV A;  2M0B A;  1SQP D;  4LLH A;  5APW A;  2V7Q J;  1SQV G;  5CCH A;  4HB1 A;  3C8V A;  4HJG H;  5GTI H;  1KOR A;  3IN6 A;  1GTW A;  3CWB E;  4W7Y A;  1E79 H;  3WU2 E;  2WSF H;  3EQ2 A;  5AVS B;  3W68 A;  5BVZ A;  1ZME C;  1PP9 G;  1YBK A;  1FE6 A;  2HOD B;  3CXH D;  3AE3 C;  1A02 J;  1U7J A;  4GDO A;  1KB9 H;  1EDK A;  2CK3 H;  3CCM P;  4OGQ D;  3SFD C;  4EOT A;  4JF7 A;  3H1H E;  1FOS E;  1AQT A;  4N78 E;  2QJY B;  2FKW B;  3L37 A;  3RK3 C;  2P1J A;  3E1R A;  1G2C B;  5KLI B;  1NTK E;  2IBZ I;  3CWB D;  2YMK A;  4U3F E;  3H1I G;  2YKP A;  2N1T C;  3HD7 B;  1DD3 A;  1IK9 A;  5AVR B;  1A02 F;  1H89 A;  1GL2 C;  1JY3 N;  1LT1 A;  1NU1 E;  1JCD A;  3TK1 A;  3Q5P A;  5AW9 B;  2K9Y A;  3A0B E;  2WIT A;  2H7H A;  2E74 B;  4N3Y B;  2V4H A;  2FYU J;  4RO0 A;  1M7L A;  3RL0 D;  1ZOY C;  1N8R Q;  3TF5 A;  1RY3 A;  4OWF A;  3H1H D;  2POH A;  5AW8 B;  4N78 D;  3VMY A;  4D6T G;  2NZ2 A;  5KAF H;  1NTK D;  1VQM P;  3LID A;  3IR9 A;  4U3F D;  5CCG A;  4JYB A;  3TSI A;  2IBZ G;  3M91 A;  3L74 J;  3TYY A;  1LTA C;  3W67 A;  1UII A;  1LTG C;  3H1L G;  1NU1 D;  1AQ5 A;  2OQQ A;  4WY4 C;  1AV1 A;  4Y28 J;  1SQP J;  2NPS D;  2KLV A;  2YNY A;  3L71 E;  1FZG A;  1GW4 A;  1L0L K;  2FY8 A;  1KB9 E;  4C7N B;  4RES B;  2K1A A;  2LR2 A;  2YIU C;  1E5W A;  2A45 H;  4B86 A;  4C7N A;  1T6A A;  2ZT9 D;  1RE4 C;  1SQB E;  5KKZ B;  3RGU A;  2V7Q H;  1YI2 P;  2B9B A;  1DEE G;  2BEQ D;  3KHU A;  2ZYD A;  5CMZ A;  1G1J A;  1R5S A;  1QLE D;  2P2U A;  4OGQ B;  1VQ5 P;  3C9I A;  3L71 D;  3H32 B;  2BCC E;  3M9B A;  2WWW A;  5AVQ B;  1NO4 A;  1KB9 D;  3Q2Y A;  1IFN A;  3V4Q A;  1OW6 A;  1GU4 A;  4AQR D;  3MHV A;  2RMZ A;  1DD4 A;  1NYH A;  3HE5 B;  3G4S P;  2P58 A;  4I7Z C;  4EDF A;  1SQB D;  5KAF E;  3FWN A;  5AVT B;  3KYQ A;  2N1T B;  2WSE J;  5AW2 B;  1RF0 A;  3AEF C;  1VQN P;  4GOD A;  1GL2 B;  2QVA A;  1MZ9 A;  3H1H J;  3RL0 B;  3CCJ P;  2KZJ A;  1AJY A;  4UB8 H;  1H8A A;  3F89 A;  5GTH E;  1SS1 A;  2BCC D;  1DX7 A;  1JEK A;  1YQ4 C;  1N7S B;  2W27 A;  1NTK J;  2GUS A;  3A5T A;  2Q3I A;  4U3F J;  1OWA A;  1JY3 O;  3M0D C;  1NAY A;  3A0H H;  1M1J B;  4DOJ A;  3Q1M A;  1QEX A;  2K3R A;  2JEE A;  1RH5 B;  1ZW0 A;  3MD0 A;  2C0X A;  3WUU A;  4YXW H;  1M1J A;  1OIP A;  1LNQ A;  1KMI Z;  5L8R J;  2IPP A;  2WPQ A;  5CJ4 A;  1BGY E;  1N73 C;  3R4Y A;  1X9V A;  4ASW A;  1FOS F;  3SWF A;  1JOC A;  5BU8 B;  1KQG B;  1URQ D;  1RE3 A;  4H0L D;  2E5T A;  4WY4 B;  1VQ4 P;  1SLQ A;  1PGO A;  5KLV E;  1QX8 A;  3E1I A;  1SFC C;  2NPS A;  2SPZ A;  2PAJ A;  2IZ0 A;  4PV1 B;  1K73 Q;  2IX7 C;  4ZKU A;  1L0L G;  1KQL A;  1EC5 A;  2QE7 H;  1AVO A;  5CCH D;  3D70 A;  3B71 A;  2IFN A;  3KQG A;  3CCQ P;  4IFD K;  1PGQ A;  4BRY B;  2O1J A;  2E5Y A;  1MV8 A;  3RK2 D;  1BGY D;  2JR8 A;  4IL6 X;  4BRY A;  1WMK A;  3CXH H;  4EIJ A;  1L0N K;  1NTZ E;  1KB9 I;  3BRT B;  2W6A A;  5KLV D;  1FDO A;  2JWA A;  3D6Y A;  4UB8 E;  3PTZ A;  1KFM A;  2N9Y B;  1MFT A;  1Z56 A;  1SQB J;  2HFE D;  1P84 I;  1EDI A;  2QSI A;  1ZP0 C;  1W5C E;  2OTJ P;  4NPE A;  2QJY C;  1OVV A;  1YHQ P;  1EXI A;  3A0H E;  1FZE A;  5KLI C;  3P8M C;  3WUV A;  3WU2 H;  4ZNC A;  2IZ1 A;  2E76 D;  2OTK E;  3CCV P;  3AEC C;  3HD7 C;  5B5E E;  1IFP A;  2BCC J;  2VRS A;  3PP5 A;  3WUT A;  3I55 P;  2J59 M;  1NTZ D;  1LT9 B;  3GW6 A;  2WSE H;  1NTM J;  1MFZ A;  3Q5S A;  2QJP B;  1LT9 A;  2W6J H;  3TNU B;  2JDI H;  2W8Z A;  3GF7 A;  5CCG C;  3U59 A;  2OYI B;  2ITA A;  3V4W A;  3L72 G;  3TNU A;  3SFE C;  1CZQ A;  4K35 A;  3P32 A;  1X0T A;  3CME P;  4IL6 H;  1USD A;  1N73 B;  2FYN C;  1QVF O;  3B4S A;  1NOH A;  1S5L H;  1VPC A;  4C46 A;  1FZC A;  1VF5 C;  2KS1 B;  1CI6 A;  2KP8 A;  1URQ A;  3L70 G;  1L4A D;  1SFC B;  3HE4 A;  4IFF A;  2Y0E A;  3C1L A;  1L2P A;  2J58 A;  2FYU K;  1BCC E;  3H1J E;  2KS1 A;  5APX A;  3KZI E;  1LTJ A;  3H1K G;  3P8C E;  2A45 I;  1BGY J;  5CJ0 A;  3HUS B;  4ASV A;  3VMZ A;  1KV4 A;  5DJU B;  2XNX A;  1JO5 A;  1SP4 A;  2H8P D;  3WMM 0;  2M8R A;  3TGU G;  1NKN A;  2QEX P;  5KLV J;  5KKZ C;  1OXZ A;  3HUS A;  1K04 A;  1T3J A;  2WPR A;  2R3C A;  4BXL A;  3H25 A;  4DT0 A;  1OFC X;  3BCC G;  3AE6 C;  4L75 A;  1L0N G;  3RBX A;  2MJZ A;  2W83 C;  4OGQ C;  1SQP K;  1JMB A;  2Y0C A;  1BCC D;  3SSU A;  1WRG A;  5CHX A;  2E43 A;  3H1J D;  4ZKP A;  5TJH A;  3M0A A;  2RH0 A;  3P8C D;  2WZ7 A;  1JY2 P;  3G9R A;  1GK6 A;  1QL2 A;  4WWI A;  3NMD A;  2A45 G;  2D2C B;  2ZFC A;  2HG5 D;  3O6Q A;  2W6B A;  1VDF A;  4PJ0 E;  3IF4 A;  1VQP P;  1LTI C;  1FAV A;  1NTZ J;  1CW5 A;  2OYH B;  2K37 A;  4AUW A;  4W7Z A;  5BU5 A;  1QGK B;  5H2F H;  5KAI H;  3BVH A;  2OYH A;  2H89 C;  4IL6 E;  1ZXG A;  4RJT A;  2KNC B;  1FZA A;  1IK7 A;  1M56 D;  3RL0 C;  1S5L E;  2C0W A;  3NXS A;  3CC4 P;  2QM8 A;  3CCU P;  4C7R A;  1SQQ E;  1N7S C;  5K5G B;  1SQX D;  2M5A A;  1FZF A;  5C39 A;  1EZV I;  2KNC A;  2JKV A;  3CCE P;  2HPC B;  3LIE A;  2B87 B;  1M1J C;  1Q86 Q;  5DJT B;  1YJN P;  3USS A;  3Q3D A;  2A06 E;  1NWQ A;  3VP8 A;  4IOI H;  4ZMD A;  2HPC A;  2ZXX A;  2B87 A;  1T2K C;  2E75 D;  1YTZ T;  3JCU E;  1EQ7 A;  2FYN B;  3L73 E;  1L4A B;  4Y99 C;  4HKZ H;  1OW7 A;  1S72 P;  3A7O A;  1VF5 B;  5GTH H;  3U1A A;  1ZV8 A;  3T97 A;  3M9Q A;  1NJI Q;  1G1I A;  3PJS K;  1L4A A;  2PRR A;  1SQQ D;  2AEM A;  1XTG B;  1NTK K;  4PV1 C;  2FYU G;  2ZXE B;  1EZV G;  3CD6 P;  3AE1 C;  1J2J B;  5AW4 B;  3B5N D;  2YKQ A;  4OVN F;  3NTN A;  2A06 D;  2IDB A;  3PH0 A;  1HBW A;  1NU1 K;  2Z4E A;  2Q6Q A;  3P7K A;  3CXH I;  1YQ3 C;  3MGN A;  3L74 G;  1BCC J;  3L73 D;  2KZI A;  1JMM A;  3H1J J;  1USE A;  2LXC B;  2Q7C A;  5H2F E;  5KAI E;  5KJ7 D;  1KZU B;  4KHX A;  1KFN A;  2KXP B;  3GMA A;  2WMM A;  2B88 A;  4BWN A;  2QIW A;  1LTT C;  1SQP G; 
#chains in the Genus database with same CATH homology
 3MZW B;  2I8D A;  2B89 A;  4BXL A;  1EC5 A;  1EDJ A;  4IOI H;  4ZMD A;  2KUB A;  1OVU A;  2B87 A;  2Q1K A;  4GOD A;  1H0T A;  2QVA A;  4NPD A;  4MN4 C;  1JMB A;  1S3J A;  2KZJ A;  4HKZ H;  2LR2 A;  1SS1 A;  5CBN A;  3S1K A;  2ZAE B;  3QWO C;  1FC2 C;  4K35 A;  2QRX A;  2R44 A;  1Q2N A;  4WWI A;  1EDL A;  1X0T A;  4KJM A;  5CBO A;  1LT1 A;  2JWD A;  1BDD A;  4K3A A;  2RKL A;  3RGU A;  2KI7 B;  5EFW B;  3ZDM A;  2KS1 B;  2K3R A;  1MFT A;  4GOF A;  2M0B A;  1DEE G;  1ZW0 A;  1JM0 A;  1EDI A;  1LP1 A;  3PH0 A;  3FXD A;  4HB1 A;  4NPE A;  1OVV A;  4CPG A;  2HR3 A;  4HJG H;  1ZXG A;  3FXE A;  1BDC A;  4ASW A;  1LP1 B;  1Y47 A;  4ZNC A;  2OTK E;  4GOE A;  4JBZ A;  2KZI A;  4ASV A;  1OVR A;  2LXB A;  5DJU B;  5K5G B;  2KIK A;  2LXC B;  2M5A A;  3MHV A;  5C39 A;  2UWJ E;  1U7J A;  2SPZ A;  2WMM A;  1NVO A;  2B87 B;  4NPF X;  2M5A B;  1U7M A;  2B88 A;  5DJT B;  4EYY Q;  1EDK A;  1H0T B;  2P58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...