3S1KA

The development of peptide-based tools for the analysis of angiogenesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
b'KEMHNAYAIEIALLPNLNDQQFHAFIWSLIDDPSQSANLLAEAKKLNDAQAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Z-domain
publication title The development of Peptide-based tools for the analysis of angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3s1kA00
4ASVA 1EDIA 1S3JA 2I8DA 4GOFA 3ZDMA 1U7JA 1BDCA 2QVAA 2LXBA 4ASWA 4HB1A 3S1KA 1LP1B 1DEEG 2KI7B 4WWIA 1SS1A 2K3RA 4NPEA 2OTKE 2Q1KA 2RKLA 1H0TA 3MZWB 2KUBA 2KS1B 4GODA 1BDDA 2KIKA 5C39A 1ZW0A 5K5GB 1OVRA 2HR3A 4CPGA 1JMBA 1LP1A 2KZJA 3RGUA 4HJGH 1EDKA 4NPDA 2B87A 4HKZH 3FXDA 1OVVA 4ZNCA 2R44A 1X0TA 1ZXGA 1EC5A 4MN4C 3MHVA 2WMMA 2QRXA 2M5AB 2SPZA 2P58A 5DJTB 5DJUB 1Y47A 1NVOA 3QWOC 1JM0A 1MFTA 2UWJE 4EYYQ 1FC2C 4K35A 5CBOA 1EDLA 4KJMA 2LXCB 2KZIA 1U7MA 4BXLA 4ZMDA 2M5AA 1OVUA 5CBNA 1LT1A 2M0BA 2JWDA 2B89A 3PH0A 5EFWB 1Q2NA 4K3AA 2LR2A 4NPFX 1EDJA 2B87B 4GOEA 3FXEA 4IOIH 1H0TB 2ZAEB 4JBZA 2B88A
chains in the Genus database with same CATH superfamily
2HG5D 1URQC 1VQ6P 3L70J 1XTGB 1CSBA 5AVQB 1CW5A 3S1KA 1MUUA 2A06G 1N7SB 3JCUH 2A06D 1LTBC 2JDIH 4AUWA 2FYUE 2H7HA 3MZWB 4L73A 1JMMA 2YIUC 1VF5D 1M56D 3L37A 1GK4A 3L71E 3L72E 2OYHB 2IZ0A 2FYUG 2FYUD 2KYVA 1L4AB 2V7QJ 3VP9A 3L72G 3P32A 3L72D 2P7JA 4MN4C 1VQNP 3WUVA 1K73Q 4LGDE 3CCUP 2AXTE 2OYIC 1NTMG 2BCCE 1FE6A 1NTMD 2YKQA 1AA0A 1S4XA 3M0DC 2JEEA 1JY3O 2LXCB 3TNUA 4BXLA 1SQPJ 1SLQA 1NTKE 1CI6A 3H1IE 1SQVE 4HH2A 2ZAEB 1HJBA 3FWLA 4GIFA 1YQ3C 3GG2A 1MKMA 1NTKG 2QJYC 2Z5IA 2E75D 3JC22 1NTKD 3H1IG 1SQVG 5H2FE 1KN7A 1SQQK 4WY4D 3H1HJ 1GL2B 3H1ID 1LP1B 1SQVD 1KTMA 3HE5B 4GT1A 4YXWH 1MV8A 4BRYA 5AVTB 1DIPA 4L75A 4JPZB 3Q3DA 1LWUB 1KILB 4QMAA 2KOGA 5C39A 3JSVC 1PFIA 3AE2C 1IFJA 1FZAA 3U1AA 3BVHA 2O1JA 1G2CB 3RL0C 2XKMA 3HUSB 1YTZT 2Q3EA 1AVOA 3G9RA 2ITAA 2YXQB 3CI9A 2AXCA 3H1KJ 1ZLLA 2ZYDA 3C9IA 3PJSK 2FFDA 2IBZE 2WMMA 1GW3A 3CL3D 5B66H 1DEBA 2WT7A 1SFCA 3HE4A 3QWOC 1VF5B 2IBZG 1MFTA 3CLQA 3V4WA 2IBZD 1L0NE 1BE3G 1OW6A 1BE3D 3RBZA 3CCLP 3L73J 3WUUA 1LT1A 4HYTB 4PD4E 3L74J 4C7NB 2KSJA 1M1KQ 1L0NG 2G8YA 1OX3A 2P67A 1L0ND 1K9MQ 2E5YA 3M9QA 1YHQP 1EC5A 4UB8H 1SQXJ 2JO1A 2WPRA 2WPSA 2QM7A 2IFNA 4YTPC 1IFMA 4DT0A 2OTKE 3A0HH 1HWTC 1NAYA 3AECC 3CCJP 5KLIC 1KB9E 2G3AA 1UIXA 2Y9ZA 2XDJA 1SQBJ 5KLVE 4WB4A 2Q5UA 4H0LC 3OW2O 1KQSO 1GMJA 3E1RA 1KB9D 1Q86Q 1CZQA 3CC2P 2E76D 3G4SP 2E75B 3EWKA 4C46A 4DOJA 1SQVK 4WY4B 2HODB 2WPQA 4EIJA 1LTJB 1NYHA 1VQOP 3SFDC 5B5EH 4OGQC 1XTCC 2QJPC 4K35A 1RH5B 1OZHA 1K8AQ 2Y0EA 3U59A 2XNXA 3ABVC 1AJYA 5CBNA 1PGJA 1JEKA 5L8RJ 1KMIZ 3JCUE 3HD7D 2QA4P 1BCCE 1FZCB 1E5WA 3ITKA 2AEMA 3OA7A 2P2UA 3IN6A 2R3CA 1BSNA 1VDFA 4YPCA 1BCCD 2KI7B 5BU5A 1ZR2A 4IL6E 2OYIA 1RQUA 4GDOA 2CPBA 2RKLA 3CMEP 2KS1B 2YKPA 3HRNA 3OAKA 2Z4EA 1PL5A 2N1TD 1QVGO 4H44D 1UIIA 2HR3A 2KLUA 2J5UA 3N7NA 1ZV8A 4O9BA 1G1IA 1G1JA 1KFNA 1EDKA 1AVYA 1N73A 1M1JB 3TGUG 3BASA 2WSEJ 1NKNA 1IFPA 3TGUD 1KORA 3CWBE 1ZXGA 2RN0A 2WSSH 1AV1A 1RE4C 5E79H 1LTAC 3MD0A 3KYQA 3EFGA 1J1EB 2I1KA 4KT0J 4W7YA 4U3FG 1GK6A 1SQQJ 2K9JB 5TISH 5CMZA 5CCGD 1AQTA 1J1DC 3P8CE 3VYIA 4W80A 1EZVG 2E76B 2Q6QA 1KYOI 1EZVD 4C7RA 3AEAC 2K88A 3RK2D 2QEXP 5KLVK 2ZFCA 4OWFA 1U7JA 4XA4A 3P8CD 1YQ4C 2J59M 3H1LE 2O1KA 2V7QH 2LKMA 4A7PA 1H0TA 1IO4A 1GTWA 3WMM0 3RK3E 1ZW0A 1NTZE 1JCDA 2K1AA 3TF5A 3I56P 3WUTA 2M3BA 1ZN5A 5B66E 5AW0B 3HD7B 3H32B 3RK3D 3GHGC 1NTZG 3Q1MA 1IFDA 3VN0A 1NTZD 4ZNCA 3A3YB 2OGUA 1RF0A 2ZT9C 1P84I 3A5TA 3MGNA 3L71J 3L72J 4N6JA 1Y47A 3V4QA 4OH8B 2Q3IA 1Z56A 4EDFA 2N1TB 1YTZI 4H44B 2N9BA 4UB8E 1QL1A 3AE6C 1OXZA 5APWA 2A45I 2OQQA 4ZMDA 1PZQA 5KAIH 2WSFJ 2QJKC 2B89A 1JNMA 2LR2A 3GMAA 4GOEA 5AW6B 1JY3P 3A0HE 2BCCJ 5GTHH 3AE3C 3LW5J 2WSCH 4LC1A 1HJ0A 3CCRP 3Q5SA 2QVAA 4XFJA 2YNYA 3P7KA 1EZVI 1NU1E 4NPEA 1NH4A 1SQVJ 1TU3F 3MP7B 1W2BO 3L35A 1NU1G 2BEZF 1GD2E 1NU1D 1D7MA 1LT9B 1OW8A 2GM4A 5AVYB 2XZRA 1N7SA 4EOTA 1FZGA 3RK2B 4HKZH 3FXDA 5B5EE 2OTLP 2W8ZA 4JYCA 2L5GB 3C8VA 1FAVA 3H1JJ 4DZOA 2AEJA 3K5BA 2NPSD 2FYNC 4AYCA 1IC2A 2OYHA 1HUCA 2WTYA 2PRRA 3AEDC 2IYOA 4YXDC 1L4AA 3KQGA 1WT6A 3V2RA 1SFCD 1NVOA 1N7LA 1E79H 3L36A 4PV1D 1P84H 3AEGC 3PLNA 1NTME 2IPPA 3BCCE 4KJMA 3V5BA 1OFCX 1S5LX 2QG4A 3RK3B 1S9KE 5EFWB 2E42A 2E74C 2WQYC 3BCCG 4JBZA 2A45H 1VQ8P 5KAFH 4ZKUA 3BCCD 5KTBA 1NGMB 1FJPA 1RE4A 2YO2A 1PGPA 1S9KD 2HPCA 1Q81Q 1SS1A 2HLOA 1NWQA 4L74A 5KJ7A 3B5ND 1PP9E 1N73C 1MFZA 2JJLA 1RF1B 5AW7B 3G71P 4I7ZB 1KFMA 2KP8A 1IK9A 1ZP0C 5E79E 1PP9G 1JB0J 2PFXA 1LP1A 3RGUA 4HJGH 1PP9D 1CI6B 2BEQD 3HE5A 1SP4A 2O01J 3II6A 3WU2H 4L76A 1LWUA 3VOPA 1URQD 1W5CE 3SWKA 3KXDA 2C9NY 2OTJP 1JCCA 1G2CA 3CPWO 1NO4A 2WZ7A 5KLVJ 3HUSA 5AW5B 1QL2A 3VP8A 4EYYQ 3EFFK 3IFMA 1KD1Q 2W6JH 1LTGC 1FZFA 1HGVA 1YI2P 2QE7H 5TJHA 5AW4B 1BE3E 2R5DA 3KHUA 5AVWB 3GHGA 3AE5C 3BRVB 1R5LA 4H13C 1RQVA 1W2EA 2V4HA 2NPSB 2FFDB 1BDCA 1GDTA 1PGOA 2FYUK 2WT7B 2KNCA 1DEEG 2L91A 5KKZB 1SFCB 1YJWP 4PV1B 2WSEH 1K05A 2Q1KA 4C7NA 3FX0A 1BCCJ 3Q2YA 2H89C 1GU4A 3O6QB 3IR9A 3PRJA 2OYOA 4M3LA 5CHXA 1RF0C 4CPGA 2E43A 1JMBA 2IX7C 2KXPB 1NTMK 1QEXA 1FOSE 2D2CC 1M8OB 2FBWC 1SQPG 2Y0CA 1X79B 1SQPD 2KSEA 1VQMP 3B5NB 4Y99B 3M0AA 3EQ2A 1JY3N 1JM0A 1VQLP 4OVNF 3A0BH 5GTHE 3H1HG 1VQ5P 2K37A 1OW7A 3CWBJ 1NTKK 4WY4A 1NJIQ 2HODA 1WRGA 1LTTC 1KYOE 4JYBA 3RL0D 3CC7P 3PH0A 3H1KE 2PGDA 5GTIH 1M57D 1FDIA 1URQB 5APXA 3FGAD 2JKVA 3ZDMA 1KYOD 3VMAA 1JTHB 2YKOA 3V2NA 3H1KG 3H1KD 4JF7A 4WWIA 2KK7A 1N7SC 1FZCA 4H13D 2YIUB 2MJZA 1M7LA 4IFMA 2O01N 2Q9IA 3L73E 1GZLA 1FOSF 2OYHC 1Q90D 3H1LJ 1L4AC 2FXMA 1P84E 3L73G 2E5TA 3L73D 3TGUE 3L74G 5CJ0A 2P58A 3L74D 1YBKA 3M06A 2OYIB 2AXTH 1SQXG 2ZXXA 3V2QA 1P84D 3VMZA 1L0NK 1M1JA 1SQXD 3VTPC 3LW5H 3LIEA 1YJNP 4RJTA 1X9VA 1RY3A 1KQLA 1T8ZA 4B86A 4U3FE 1QLED 2JWDA 4N78D 3AEFC 2A45G 4H0LD 3Q5RA 1HBWA 5KJ7C 3AE1C 1Y9BA 3HTKA 1SQBG 2XU6A 2K9JA 1SQBD 5APTA 2QJYB 1EZVE 1EDIA 4U3FD 1S3JA 2JWAA 2LXBA 2R3SA 1YJ9P 1GL2C 1JY2O 4W7ZA 5BU8B 4OGQD 1BDDA 1FZBA 1LWUC 1KILC 4D6TE 2J58A 2QSIA 3L75E 3RL0B 2I1JA 3I55P 2N9YB 3HUSC 2B87A 4D6TG 4GKGA 1KV4A 4D6TD 3L75G 1YYCA 5AVUB 2YMKA 3L75D 1BGYE 2M5AB 1QVFO 3HD7A 1L2PA 3L4FA 3G6EP 1IFNA 1H8AA 1BGYG 2FYUJ 1HTLC 2UWJE 1VF5C 1BGYD 2POHA 3CD6P 4I1LA 2GUSA 4PD4H 1ZOYC 2W6BA 3QH9A 4UB6H 4R4LA 2YO3A 1A02F 2NZ2A 2FXOA 2I8DA 2BASA 3B71A 4IL6X 1NTMJ 3T97B 4U7JA 3BCCJ 1DD3A 1KC8Q 1IFIA 2O01H 5KLIB 2KUBA 3VMXA 1KB9H 2K9YA 3AEBC 3KPEA 2FYZA 4H0LB 1SQQG 3SFEC 3M91A 1NTKJ 1NKZB 3D71A 3BATA 3OJAB 3H1IJ 1PP9J 1OVVA 3TK1A 3GLMA 3NTNA 1L0LE 2E75C 4Z1MH 4PJ0H 1LT9A 2SPZA 2R5BA 4WY4C 1R5SA 2H88C 5DJUB 3MUDA 1EQ7A 3D6YA 4OGQB 5GTIE 5APYA 1L0LG 1LTJC 2QJPB 1L0LD 5AVSB 1JY2N 1U7MA 3KDPB 2O3JA 1FDOA 1VQKP 1RHZB 3FXEA 3AE9C 1FZCC 1VQ7P 3B8EB 3TSIA 2ZT9D 2M3EA 4HB1A 1HVVA 3NFQA 4KHXA 4IL6H 1BE3J 2ZYGA 5CCHA 2XNDH 3PTZA 2ZYAA 1WMKA 1NTZK 2GA1A 3M9HA 3CX5I 3L71G 2IYPA 4GODA 1M90Q 3L71D 5APQA 2IZ1A 1L0NJ 2PAJA 3KZIH 1VQPP 2FXPA 2JP3A 2KZJA 4NPDA 3D6ZA 4LLHA 1JUNA 4R4MA 1LGHB 1M1JC 5AVZB 2AEFA 1RF1A 2R44A 3C1LA 3CCVP 1X0TA 1PGQA 2WPVB 1N8RQ 1EXJA 3CC4P 3TNUB 2HPCB 1GW4A 1ZRTE 2BCCG 1JOCA 2BCCD 1GL2A 1X8YA 2M8RA 1S2EA 1J1EC 4IFFA 3L70E 1KILA 5APUA 5CBOA 5TISE 3IF4A 1ZRTD 2PP6A 3CXHI 2KZIA 1HF9A 2C0WA 1J1DB 2M0BA 1Q2NA 4NPFX 1EDJA 4RESB 5AW8B 3SWYA 3L70G 2YMYA 3G3ZA 4BRYB 3L70D 2E76C 4RKUJ 1IK7A 1VL2A 3H1JE 3RL0g 1NU1K 2WSCJ 1PPJE 1NOHA 1N2DC 2H8PD 5AVRB 3H1JG 4ZKPA 1L0LK 1S5LH 3H1JD 2W6AA 1PPJG 1FS0E 4WBAA 2KIKA 2RMZA 1PPJD 2NPSA 1MZ9A 3O8ZA 3M9BA 5K5GB 3P8MC 3CX5H 3HD7C 1JO5A 3GHGB 2DW3A 3A7OA 2E74D 3FWNA 2ZVNB 3HE4B 5M1BA 2QIWA 4XE5B 4WVZA 2RH0A 3O6QA 2ZT9B 3B4SA 3UIAA 1PV3A 5AVXB 1SQPE 2KNCB 1VPCA 2R32A 4BWNA 4UB6E 4IFDK 4I2LC 2FKWB 1ZR4A 2N1TC 1FZEA 3W68A 1HGZA 3I5CA 4H44C 4PD4D 3TGUJ 3RBXA 3H1HE 3GF3A 2KLVA 2QJKB 1LTIC 2Z5HA 2W27A 5KAIE 3B5NA 3NXSA 2OARA 5CJ4A 4IOIH 3CXHH 1LNQA 3H1HD 3S9OA 1NHLA 1OMIA 4U3FJ 2K3RA 4I6MC 1LTJA 2CPSA 5AW3B 1URQA 2KB7P 3CCQP 5KLVG 4TT3H 3Q5PA 2VRSA 1T2KC 1HH0A 1JY2P 5KLVD 1A02J 1JTHA 5CCGC 1OVRA 2ZVOB 4PJ0E 1FU1A 3V6IA 3F5HA 1LT9C 3GF7A 2P1JA 1USEA 3MUDC 2ZXEB 1FDMA 1FBMA 4N3YB 4RO0A 1YITP 1KQFB 3RK2C 1RE3C 2Y9YA 4Y28J 3W67A 2FYNB 2WVRA 4D6TJ 1DD4A 1SVFA 3L75J 5DJTB 3PHLA 1T6AA 3LIDA 3L74E 2IBZI 3R4YA 2YXRB 2XV5A 5BVZA 1SQXE 1VQ4P 2KS1A 2JR8A 3S4RA 3CMAP 1NTZJ 1OWAA 1BCCG 2WSFH 2IDBA 4EI2A 1BGYJ 1KQGB 1LTSC 3A2AA 2E74B 4TLFA 4K3AA 3RK3C 1S1CX 2P10A 4N78E 1GU5A 3AE8C 5CCHC 2D2CD 1AFOA 4PD4I 5KAFE 3M0DA 2GUVA 4ASVA 4GOFA 2CK3H 3BRTB 3F89A 1SQBE 3KZIE 4ASWA 3U1CA 3AE7C 1N73B 3SSUA 1SQPK 1OIPA 1Y8AA 1VQ9P 1FJKA 3AEEC 1RF1C 3NMDA 3MTUE 4DCKA 2FY8A 3SWFA 1BSHA 1T3UA 2Y0DA 1R8EA 1KB9I 5H2FH 4I7ZC 1K04A 4JQ0D 3CWBG 1IZNB 1N86A 3CWBD 3AE4C 3HTKB 1Q82Q 3WU2E 3USSA 1T2KD 1T3JA 5AW1B 1USDA 2HYNA 1NU1J 1N7SD 1YIJP 3PP5A 1QX8A 5AW9B 1FC2C 1DX7A 1EDLA 3CCMP 1DH3A 3V2PA 1L0LJ 2H43A 2M5AA 3VMYA 3H25A 1X22A 2W83C 3E1IA 3H32A 2B87B 1S5LE 1H0TB 4H13B 1ZMEC 1J2JB 1L4AD 4AQRD 2B88A 2NRGA 2MKVA 2Q7CA 3TDKA 3H1LG 2NPSC 2FFDC 3H1LD 1LJ2A 3CCEP 2W90A 3CX5E 5KKZC 1SFCC 1KZUB 4PV1C 1QGKB 5CCHD 3R2PA 2N1TA 5AW2B 5AVVB 3T97A 1U57A 3CX5D 3TYYA 4DJGA 1PIXA 1SQXK 3CCSP 2D2CB 1SQQE 5KJ7D 5APVA 2B9BA 3N4XA 2C9LY 2ZJSE 2QM8A 5APSA 2WITA 1H88A 2WWWA 3MHVA 2QRXA 1KILE 1GL2D 1SQQD 3B5NC 1AQ5A 3E7KA 4Y99C 3CXHE 1SQBK 3A0BE 2HFED 2IFMA 1NAFA 3GW6A 1IJDB 1H89A 1KILD 3IAOA 1Q7YQ 5CCGA 1S72P 2C0XA 1KYOH 1OVUA 3H6PA 3MIWA 3D70A 3CXHD 1EXIA 2A06E 1RE3A
chains in the Genus database with same CATH topology
4ASVA 1EDIA 1S3JA 2I8DA 4GOFA 3ZDMA 1U7JA 1BDCA 2QVAA 2LXBA 4ASWA 4HB1A 3S1KA 1LP1B 1DEEG 2KI7B 4WWIA 1SS1A 2K3RA 4NPEA 2OTKE 2Q1KA 2RKLA 1H0TA 3MZWB 2KUBA 2KS1B 4GODA 1BDDA 2KIKA 5C39A 1ZW0A 5K5GB 1OVRA 2HR3A 4CPGA 1JMBA 1LP1A 2KZJA 3RGUA 4HJGH 1EDKA 4NPDA 2B87A 4HKZH 3FXDA 1OVVA 4ZNCA 2R44A 1X0TA 1ZXGA 1EC5A 4MN4C 3MHVA 2WMMA 2QRXA 2M5AB 2SPZA 2P58A 5DJTB 5DJUB 1Y47A 1NVOA 3QWOC 1JM0A 1MFTA 2UWJE 4EYYQ 1FC2C 4K35A 5CBOA 1EDLA 4KJMA 2LXCB 2KZIA 1U7MA 4BXLA 4ZMDA 2M5AA 1OVUA 5CBNA 1LT1A 2M0BA 2JWDA 2B89A 3PH0A 5EFWB 1Q2NA 4K3AA 2LR2A 4NPFX 1EDJA 2B87B 4GOEA 3FXEA 4IOIH 1H0TB 2ZAEB 4JBZA 2B88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASV A;  1EDI A;  1S3J A;  2I8D A;  4GOF A;  3ZDM A;  1U7J A;  1BDC A;  2QVA A;  2LXB A;  4ASW A;  4HB1 A;  3S1K A;  1LP1 B;  1DEE G;  2KI7 B;  4WWI A;  1SS1 A;  2K3R A;  4NPE A;  2OTK E;  2Q1K A;  2RKL A;  1H0T A;  3MZW B;  2KUB A;  2KS1 B;  4GOD A;  1BDD A;  2KIK A;  5C39 A;  1ZW0 A;  5K5G B;  1OVR A;  2HR3 A;  4CPG A;  1JMB A;  1LP1 A;  2KZJ A;  3RGU A;  4HJG H;  1EDK A;  4NPD A;  2B87 A;  4HKZ H;  3FXD A;  1OVV A;  4ZNC A;  2R44 A;  1X0T A;  1ZXG A;  1EC5 A;  4MN4 C;  3MHV A;  2WMM A;  2QRX A;  2M5A B;  2SPZ A;  2P58 A;  5DJT B;  5DJU B;  1Y47 A;  1NVO A;  3QWO C;  1JM0 A;  1MFT A;  2UWJ E;  4EYY Q;  1FC2 C;  4K35 A;  5CBO A;  1EDL A;  4KJM A;  2LXC B;  2KZI A;  1U7M A;  4BXL A;  4ZMD A;  2M5A A;  1OVU A;  5CBN A;  1LT1 A;  2M0B A;  2JWD A;  2B89 A;  3PH0 A;  5EFW B;  1Q2N A;  4K3A A;  2LR2 A;  4NPF X;  1EDJ A;  2B87 B;  4GOE A;  3FXE A;  4IOI H;  1H0T B;  2ZAE B;  4JBZ A;  2B88 A; 
#chains in the Genus database with same CATH topology
 2HG5 D;  1URQ C;  1VQ6 P;  3L70 J;  1XTG B;  1CSB A;  5AVQ B;  1CW5 A;  3S1K A;  1MUU A;  2A06 G;  1N7S B;  3JCU H;  2A06 D;  1LTB C;  2JDI H;  4AUW A;  2FYU E;  2H7H A;  3MZW B;  4L73 A;  1JMM A;  2YIU C;  1VF5 D;  1M56 D;  3L37 A;  1GK4 A;  3L71 E;  3L72 E;  2OYH B;  2IZ0 A;  2FYU G;  2FYU D;  2KYV A;  1L4A B;  2V7Q J;  3VP9 A;  3L72 G;  3P32 A;  3L72 D;  2P7J A;  4MN4 C;  1VQN P;  3WUV A;  1K73 Q;  4LGD E;  3CCU P;  2AXT E;  2OYI C;  1NTM G;  2BCC E;  1FE6 A;  1NTM D;  2YKQ A;  1AA0 A;  1S4X A;  3M0D C;  2JEE A;  1JY3 O;  2LXC B;  3TNU A;  4BXL A;  1SQP J;  1SLQ A;  1NTK E;  1CI6 A;  3H1I E;  1SQV E;  4HH2 A;  2ZAE B;  1HJB A;  3FWL A;  4GIF A;  1YQ3 C;  3GG2 A;  1MKM A;  1NTK G;  2QJY C;  2Z5I A;  2E75 D;  3JC2 2;  1NTK D;  3H1I G;  1SQV G;  5H2F E;  1KN7 A;  1SQQ K;  4WY4 D;  3H1H J;  1GL2 B;  3H1I D;  1LP1 B;  1SQV D;  1KTM A;  3HE5 B;  4GT1 A;  4YXW H;  1MV8 A;  4BRY A;  5AVT B;  1DIP A;  4L75 A;  4JPZ B;  3Q3D A;  1LWU B;  1KIL B;  4QMA A;  2KOG A;  5C39 A;  3JSV C;  1PFI A;  3AE2 C;  1IFJ A;  1FZA A;  3U1A A;  3BVH A;  2O1J A;  1G2C B;  3RL0 C;  2XKM A;  3HUS B;  1YTZ T;  2Q3E A;  1AVO A;  3G9R A;  2ITA A;  2YXQ B;  3CI9 A;  2AXC A;  3H1K J;  1ZLL A;  2ZYD A;  3C9I A;  3PJS K;  2FFD A;  2IBZ E;  2WMM A;  1GW3 A;  3CL3 D;  5B66 H;  1DEB A;  2WT7 A;  1SFC A;  3HE4 A;  3QWO C;  1VF5 B;  2IBZ G;  1MFT A;  3CLQ A;  3V4W A;  2IBZ D;  1L0N E;  1BE3 G;  1OW6 A;  1BE3 D;  3RBZ A;  3CCL P;  3L73 J;  3WUU A;  1LT1 A;  4HYT B;  4PD4 E;  3L74 J;  4C7N B;  2KSJ A;  1M1K Q;  1L0N G;  2G8Y A;  1OX3 A;  2P67 A;  1L0N D;  1K9M Q;  2E5Y A;  3M9Q A;  1YHQ P;  1EC5 A;  4UB8 H;  1SQX J;  2JO1 A;  2WPR A;  2WPS A;  2QM7 A;  2IFN A;  4YTP C;  1IFM A;  4DT0 A;  2OTK E;  3A0H H;  1HWT C;  1NAY A;  3AEC C;  3CCJ P;  5KLI C;  1KB9 E;  2G3A A;  1UIX A;  2Y9Z A;  2XDJ A;  1SQB J;  5KLV E;  4WB4 A;  2Q5U A;  4H0L C;  3OW2 O;  1KQS O;  1GMJ A;  3E1R A;  1KB9 D;  1Q86 Q;  1CZQ A;  3CC2 P;  2E76 D;  3G4S P;  2E75 B;  3EWK A;  4C46 A;  4DOJ A;  1SQV K;  4WY4 B;  2HOD B;  2WPQ A;  4EIJ A;  1LTJ B;  1NYH A;  1VQO P;  3SFD C;  5B5E H;  4OGQ C;  1XTC C;  2QJP C;  4K35 A;  1RH5 B;  1OZH A;  1K8A Q;  2Y0E A;  3U59 A;  2XNX A;  3ABV C;  1AJY A;  5CBN A;  1PGJ A;  1JEK A;  5L8R J;  1KMI Z;  3JCU E;  3HD7 D;  2QA4 P;  1BCC E;  1FZC B;  1E5W A;  3ITK A;  2AEM A;  3OA7 A;  2P2U A;  3IN6 A;  2R3C A;  1BSN A;  1VDF A;  4YPC A;  1BCC D;  2KI7 B;  5BU5 A;  1ZR2 A;  4IL6 E;  2OYI A;  1RQU A;  4GDO A;  2CPB A;  2RKL A;  3CME P;  2KS1 B;  2YKP A;  3HRN A;  3OAK A;  2Z4E A;  1PL5 A;  2N1T D;  1QVG O;  4H44 D;  1UII A;  2HR3 A;  2KLU A;  2J5U A;  3N7N A;  1ZV8 A;  4O9B A;  1G1I A;  1G1J A;  1KFN A;  1EDK A;  1AVY A;  1N73 A;  1M1J B;  3TGU G;  3BAS A;  2WSE J;  1NKN A;  1IFP A;  3TGU D;  1KOR A;  3CWB E;  1ZXG A;  2RN0 A;  2WSS H;  1AV1 A;  1RE4 C;  5E79 H;  1LTA C;  3MD0 A;  3KYQ A;  3EFG A;  1J1E B;  2I1K A;  4KT0 J;  4W7Y A;  4U3F G;  1GK6 A;  1SQQ J;  2K9J B;  5TIS H;  5CMZ A;  5CCG D;  1AQT A;  1J1D C;  3P8C E;  3VYI A;  4W80 A;  1EZV G;  2E76 B;  2Q6Q A;  1KYO I;  1EZV D;  4C7R A;  3AEA C;  2K88 A;  3RK2 D;  2QEX P;  5KLV K;  2ZFC A;  4OWF A;  1U7J A;  4XA4 A;  3P8C D;  1YQ4 C;  2J59 M;  3H1L E;  2O1K A;  2V7Q H;  2LKM A;  4A7P A;  1H0T A;  1IO4 A;  1GTW A;  3WMM 0;  3RK3 E;  1ZW0 A;  1NTZ E;  1JCD A;  2K1A A;  3TF5 A;  3I56 P;  3WUT A;  2M3B A;  1ZN5 A;  5B66 E;  5AW0 B;  3HD7 B;  3H32 B;  3RK3 D;  3GHG C;  1NTZ G;  3Q1M A;  1IFD A;  3VN0 A;  1NTZ D;  4ZNC A;  3A3Y B;  2OGU A;  1RF0 A;  2ZT9 C;  1P84 I;  3A5T A;  3MGN A;  3L71 J;  3L72 J;  4N6J A;  1Y47 A;  3V4Q A;  4OH8 B;  2Q3I A;  1Z56 A;  4EDF A;  2N1T B;  1YTZ I;  4H44 B;  2N9B A;  4UB8 E;  1QL1 A;  3AE6 C;  1OXZ A;  5APW A;  2A45 I;  2OQQ A;  4ZMD A;  1PZQ A;  5KAI H;  2WSF J;  2QJK C;  2B89 A;  1JNM A;  2LR2 A;  3GMA A;  4GOE A;  5AW6 B;  1JY3 P;  3A0H E;  2BCC J;  5GTH H;  3AE3 C;  3LW5 J;  2WSC H;  4LC1 A;  1HJ0 A;  3CCR P;  3Q5S A;  2QVA A;  4XFJ A;  2YNY A;  3P7K A;  1EZV I;  1NU1 E;  4NPE A;  1NH4 A;  1SQV J;  1TU3 F;  3MP7 B;  1W2B O;  3L35 A;  1NU1 G;  2BEZ F;  1GD2 E;  1NU1 D;  1D7M A;  1LT9 B;  1OW8 A;  2GM4 A;  5AVY B;  2XZR A;  1N7S A;  4EOT A;  1FZG A;  3RK2 B;  4HKZ H;  3FXD A;  5B5E E;  2OTL P;  2W8Z A;  4JYC A;  2L5G B;  3C8V A;  1FAV A;  3H1J J;  4DZO A;  2AEJ A;  3K5B A;  2NPS D;  2FYN C;  4AYC A;  1IC2 A;  2OYH A;  1HUC A;  2WTY A;  2PRR A;  3AED C;  2IYO A;  4YXD C;  1L4A A;  3KQG A;  1WT6 A;  3V2R A;  1SFC D;  1NVO A;  1N7L A;  1E79 H;  3L36 A;  4PV1 D;  1P84 H;  3AEG C;  3PLN A;  1NTM E;  2IPP A;  3BCC E;  4KJM A;  3V5B A;  1OFC X;  1S5L X;  2QG4 A;  3RK3 B;  1S9K E;  5EFW B;  2E42 A;  2E74 C;  2WQY C;  3BCC G;  4JBZ A;  2A45 H;  1VQ8 P;  5KAF H;  4ZKU A;  3BCC D;  5KTB A;  1NGM B;  1FJP A;  1RE4 A;  2YO2 A;  1PGP A;  1S9K D;  2HPC A;  1Q81 Q;  1SS1 A;  2HLO A;  1NWQ A;  4L74 A;  5KJ7 A;  3B5N D;  1PP9 E;  1N73 C;  1MFZ A;  2JJL A;  1RF1 B;  5AW7 B;  3G71 P;  4I7Z B;  1KFM A;  2KP8 A;  1IK9 A;  1ZP0 C;  5E79 E;  1PP9 G;  1JB0 J;  2PFX A;  1LP1 A;  3RGU A;  4HJG H;  1PP9 D;  1CI6 B;  2BEQ D;  3HE5 A;  1SP4 A;  2O01 J;  3II6 A;  3WU2 H;  4L76 A;  1LWU A;  3VOP A;  1URQ D;  1W5C E;  3SWK A;  3KXD A;  2C9N Y;  2OTJ P;  1JCC A;  1G2C A;  3CPW O;  1NO4 A;  2WZ7 A;  5KLV J;  3HUS A;  5AW5 B;  1QL2 A;  3VP8 A;  4EYY Q;  3EFF K;  3IFM A;  1KD1 Q;  2W6J H;  1LTG C;  1FZF A;  1HGV A;  1YI2 P;  2QE7 H;  5TJH A;  5AW4 B;  1BE3 E;  2R5D A;  3KHU A;  5AVW B;  3GHG A;  3AE5 C;  3BRV B;  1R5L A;  4H13 C;  1RQV A;  1W2E A;  2V4H A;  2NPS B;  2FFD B;  1BDC A;  1GDT A;  1PGO A;  2FYU K;  2WT7 B;  2KNC A;  1DEE G;  2L91 A;  5KKZ B;  1SFC B;  1YJW P;  4PV1 B;  2WSE H;  1K05 A;  2Q1K A;  4C7N A;  3FX0 A;  1BCC J;  3Q2Y A;  2H89 C;  1GU4 A;  3O6Q B;  3IR9 A;  3PRJ A;  2OYO A;  4M3L A;  5CHX A;  1RF0 C;  4CPG A;  2E43 A;  1JMB A;  2IX7 C;  2KXP B;  1NTM K;  1QEX A;  1FOS E;  2D2C C;  1M8O B;  2FBW C;  1SQP G;  2Y0C A;  1X79 B;  1SQP D;  2KSE A;  1VQM P;  3B5N B;  4Y99 B;  3M0A A;  3EQ2 A;  1JY3 N;  1JM0 A;  1VQL P;  4OVN F;  3A0B H;  5GTH E;  3H1H G;  1VQ5 P;  2K37 A;  1OW7 A;  3CWB J;  1NTK K;  4WY4 A;  1NJI Q;  2HOD A;  1WRG A;  1LTT C;  1KYO E;  4JYB A;  3RL0 D;  3CC7 P;  3PH0 A;  3H1K E;  2PGD A;  5GTI H;  1M57 D;  1FDI A;  1URQ B;  5APX A;  3FGA D;  2JKV A;  3ZDM A;  1KYO D;  3VMA A;  1JTH B;  2YKO A;  3V2N A;  3H1K G;  3H1K D;  4JF7 A;  4WWI A;  2KK7 A;  1N7S C;  1FZC A;  4H13 D;  2YIU B;  2MJZ A;  1M7L A;  4IFM A;  2O01 N;  2Q9I A;  3L73 E;  1GZL A;  1FOS F;  2OYH C;  1Q90 D;  3H1L J;  1L4A C;  2FXM A;  1P84 E;  3L73 G;  2E5T A;  3L73 D;  3TGU E;  3L74 G;  5CJ0 A;  2P58 A;  3L74 D;  1YBK A;  3M06 A;  2OYI B;  2AXT H;  1SQX G;  2ZXX A;  3V2Q A;  1P84 D;  3VMZ A;  1L0N K;  1M1J A;  1SQX D;  3VTP C;  3LW5 H;  3LIE A;  1YJN P;  4RJT A;  1X9V A;  1RY3 A;  1KQL A;  1T8Z A;  4B86 A;  4U3F E;  1QLE D;  2JWD A;  4N78 D;  3AEF C;  2A45 G;  4H0L D;  3Q5R A;  1HBW A;  5KJ7 C;  3AE1 C;  1Y9B A;  3HTK A;  1SQB G;  2XU6 A;  2K9J A;  1SQB D;  5APT A;  2QJY B;  1EZV E;  1EDI A;  4U3F D;  1S3J A;  2JWA A;  2LXB A;  2R3S A;  1YJ9 P;  1GL2 C;  1JY2 O;  4W7Z A;  5BU8 B;  4OGQ D;  1BDD A;  1FZB A;  1LWU C;  1KIL C;  4D6T E;  2J58 A;  2QSI A;  3L75 E;  3RL0 B;  2I1J A;  3I55 P;  2N9Y B;  3HUS C;  2B87 A;  4D6T G;  4GKG A;  1KV4 A;  4D6T D;  3L75 G;  1YYC A;  5AVU B;  2YMK A;  3L75 D;  1BGY E;  2M5A B;  1QVF O;  3HD7 A;  1L2P A;  3L4F A;  3G6E P;  1IFN A;  1H8A A;  1BGY G;  2FYU J;  1HTL C;  2UWJ E;  1VF5 C;  1BGY D;  2POH A;  3CD6 P;  4I1L A;  2GUS A;  4PD4 H;  1ZOY C;  2W6B A;  3QH9 A;  4UB6 H;  4R4L A;  2YO3 A;  1A02 F;  2NZ2 A;  2FXO A;  2I8D A;  2BAS A;  3B71 A;  4IL6 X;  1NTM J;  3T97 B;  4U7J A;  3BCC J;  1DD3 A;  1KC8 Q;  1IFI A;  2O01 H;  5KLI B;  2KUB A;  3VMX A;  1KB9 H;  2K9Y A;  3AEB C;  3KPE A;  2FYZ A;  4H0L B;  1SQQ G;  3SFE C;  3M91 A;  1NTK J;  1NKZ B;  3D71 A;  3BAT A;  3OJA B;  3H1I J;  1PP9 J;  1OVV A;  3TK1 A;  3GLM A;  3NTN A;  1L0L E;  2E75 C;  4Z1M H;  4PJ0 H;  1LT9 A;  2SPZ A;  2R5B A;  4WY4 C;  1R5S A;  2H88 C;  5DJU B;  3MUD A;  1EQ7 A;  3D6Y A;  4OGQ B;  5GTI E;  5APY A;  1L0L G;  1LTJ C;  2QJP B;  1L0L D;  5AVS B;  1JY2 N;  1U7M A;  3KDP B;  2O3J A;  1FDO A;  1VQK P;  1RHZ B;  3FXE A;  3AE9 C;  1FZC C;  1VQ7 P;  3B8E B;  3TSI A;  2ZT9 D;  2M3E A;  4HB1 A;  1HVV A;  3NFQ A;  4KHX A;  4IL6 H;  1BE3 J;  2ZYG A;  5CCH A;  2XND H;  3PTZ A;  2ZYA A;  1WMK A;  1NTZ K;  2GA1 A;  3M9H A;  3CX5 I;  3L71 G;  2IYP A;  4GOD A;  1M90 Q;  3L71 D;  5APQ A;  2IZ1 A;  1L0N J;  2PAJ A;  3KZI H;  1VQP P;  2FXP A;  2JP3 A;  2KZJ A;  4NPD A;  3D6Z A;  4LLH A;  1JUN A;  4R4M A;  1LGH B;  1M1J C;  5AVZ B;  2AEF A;  1RF1 A;  2R44 A;  3C1L A;  3CCV P;  1X0T A;  1PGQ A;  2WPV B;  1N8R Q;  1EXJ A;  3CC4 P;  3TNU B;  2HPC B;  1GW4 A;  1ZRT E;  2BCC G;  1JOC A;  2BCC D;  1GL2 A;  1X8Y A;  2M8R A;  1S2E A;  1J1E C;  4IFF A;  3L70 E;  1KIL A;  5APU A;  5CBO A;  5TIS E;  3IF4 A;  1ZRT D;  2PP6 A;  3CXH I;  2KZI A;  1HF9 A;  2C0W A;  1J1D B;  2M0B A;  1Q2N A;  4NPF X;  1EDJ A;  4RES B;  5AW8 B;  3SWY A;  3L70 G;  2YMY A;  3G3Z A;  4BRY B;  3L70 D;  2E76 C;  4RKU J;  1IK7 A;  1VL2 A;  3H1J E;  3RL0 g;  1NU1 K;  2WSC J;  1PPJ E;  1NOH A;  1N2D C;  2H8P D;  5AVR B;  3H1J G;  4ZKP A;  1L0L K;  1S5L H;  3H1J D;  2W6A A;  1PPJ G;  1FS0 E;  4WBA A;  2KIK A;  2RMZ A;  1PPJ D;  2NPS A;  1MZ9 A;  3O8Z A;  3M9B A;  5K5G B;  3P8M C;  3CX5 H;  3HD7 C;  1JO5 A;  3GHG B;  2DW3 A;  3A7O A;  2E74 D;  3FWN A;  2ZVN B;  3HE4 B;  5M1B A;  2QIW A;  4XE5 B;  4WVZ A;  2RH0 A;  3O6Q A;  2ZT9 B;  3B4S A;  3UIA A;  1PV3 A;  5AVX B;  1SQP E;  2KNC B;  1VPC A;  2R32 A;  4BWN A;  4UB6 E;  4IFD K;  4I2L C;  2FKW B;  1ZR4 A;  2N1T C;  1FZE A;  3W68 A;  1HGZ A;  3I5C A;  4H44 C;  4PD4 D;  3TGU J;  3RBX A;  3H1H E;  3GF3 A;  2KLV A;  2QJK B;  1LTI C;  2Z5H A;  2W27 A;  5KAI E;  3B5N A;  3NXS A;  2OAR A;  5CJ4 A;  4IOI H;  3CXH H;  1LNQ A;  3H1H D;  3S9O A;  1NHL A;  1OMI A;  4U3F J;  2K3R A;  4I6M C;  1LTJ A;  2CPS A;  5AW3 B;  1URQ A;  2KB7 P;  3CCQ P;  5KLV G;  4TT3 H;  3Q5P A;  2VRS A;  1T2K C;  1HH0 A;  1JY2 P;  5KLV D;  1A02 J;  1JTH A;  5CCG C;  1OVR A;  2ZVO B;  4PJ0 E;  1FU1 A;  3V6I A;  3F5H A;  1LT9 C;  3GF7 A;  2P1J A;  1USE A;  3MUD C;  2ZXE B;  1FDM A;  1FBM A;  4N3Y B;  4RO0 A;  1YIT P;  1KQF B;  3RK2 C;  1RE3 C;  2Y9Y A;  4Y28 J;  3W67 A;  2FYN B;  2WVR A;  4D6T J;  1DD4 A;  1SVF A;  3L75 J;  5DJT B;  3PHL A;  1T6A A;  3LID A;  3L74 E;  2IBZ I;  3R4Y A;  2YXR B;  2XV5 A;  5BVZ A;  1SQX E;  1VQ4 P;  2KS1 A;  2JR8 A;  3S4R A;  3CMA P;  1NTZ J;  1OWA A;  1BCC G;  2WSF H;  2IDB A;  4EI2 A;  1BGY J;  1KQG B;  1LTS C;  3A2A A;  2E74 B;  4TLF A;  4K3A A;  3RK3 C;  1S1C X;  2P10 A;  4N78 E;  1GU5 A;  3AE8 C;  5CCH C;  2D2C D;  1AFO A;  4PD4 I;  5KAF E;  3M0D A;  2GUV A;  4ASV A;  4GOF A;  2CK3 H;  3BRT B;  3F89 A;  1SQB E;  3KZI E;  4ASW A;  3U1C A;  3AE7 C;  1N73 B;  3SSU A;  1SQP K;  1OIP A;  1Y8A A;  1VQ9 P;  1FJK A;  3AEE C;  1RF1 C;  3NMD A;  3MTU E;  4DCK A;  2FY8 A;  3SWF A;  1BSH A;  1T3U A;  2Y0D A;  1R8E A;  1KB9 I;  5H2F H;  4I7Z C;  1K04 A;  4JQ0 D;  3CWB G;  1IZN B;  1N86 A;  3CWB D;  3AE4 C;  3HTK B;  1Q82 Q;  3WU2 E;  3USS A;  1T2K D;  1T3J A;  5AW1 B;  1USD A;  2HYN A;  1NU1 J;  1N7S D;  1YIJ P;  3PP5 A;  1QX8 A;  5AW9 B;  1FC2 C;  1DX7 A;  1EDL A;  3CCM P;  1DH3 A;  3V2P A;  1L0L J;  2H43 A;  2M5A A;  3VMY A;  3H25 A;  1X22 A;  2W83 C;  3E1I A;  3H32 A;  2B87 B;  1S5L E;  1H0T B;  4H13 B;  1ZME C;  1J2J B;  1L4A D;  4AQR D;  2B88 A;  2NRG A;  2MKV A;  2Q7C A;  3TDK A;  3H1L G;  2NPS C;  2FFD C;  3H1L D;  1LJ2 A;  3CCE P;  2W90 A;  3CX5 E;  5KKZ C;  1SFC C;  1KZU B;  4PV1 C;  1QGK B;  5CCH D;  3R2P A;  2N1T A;  5AW2 B;  5AVV B;  3T97 A;  1U57 A;  3CX5 D;  3TYY A;  4DJG A;  1PIX A;  1SQX K;  3CCS P;  2D2C B;  1SQQ E;  5KJ7 D;  5APV A;  2B9B A;  3N4X A;  2C9L Y;  2ZJS E;  2QM8 A;  5APS A;  2WIT A;  1H88 A;  2WWW A;  3MHV A;  2QRX A;  1KIL E;  1GL2 D;  1SQQ D;  3B5N C;  1AQ5 A;  3E7K A;  4Y99 C;  3CXH E;  1SQB K;  3A0B E;  2HFE D;  2IFM A;  1NAF A;  3GW6 A;  1IJD B;  1H89 A;  1KIL D;  3IAO A;  1Q7Y Q;  5CCG A;  1S72 P;  2C0X A;  1KYO H;  1OVU A;  3H6P A;  3MIW A;  3D70 A;  3CXH D;  1EXI A;  2A06 E;  1RE3 A; 
#chains in the Genus database with same CATH homology
 4ASV A;  1EDI A;  1S3J A;  2I8D A;  4GOF A;  3ZDM A;  1U7J A;  1BDC A;  2QVA A;  2LXB A;  4ASW A;  4HB1 A;  3S1K A;  1LP1 B;  1DEE G;  2KI7 B;  4WWI A;  1SS1 A;  2K3R A;  4NPE A;  2OTK E;  2Q1K A;  2RKL A;  1H0T A;  3MZW B;  2KUB A;  2KS1 B;  4GOD A;  1BDD A;  2KIK A;  5C39 A;  1ZW0 A;  5K5G B;  1OVR A;  2HR3 A;  4CPG A;  1JMB A;  1LP1 A;  2KZJ A;  3RGU A;  4HJG H;  1EDK A;  4NPD A;  2B87 A;  4HKZ H;  3FXD A;  1OVV A;  4ZNC A;  2R44 A;  1X0T A;  1ZXG A;  1EC5 A;  4MN4 C;  3MHV A;  2WMM A;  2QRX A;  2M5A B;  2SPZ A;  2P58 A;  5DJT B;  5DJU B;  1Y47 A;  1NVO A;  3QWO C;  1JM0 A;  1MFT A;  2UWJ E;  4EYY Q;  1FC2 C;  4K35 A;  5CBO A;  1EDL A;  4KJM A;  2LXC B;  2KZI A;  1U7M A;  4BXL A;  4ZMD A;  2M5A A;  1OVU A;  5CBN A;  1LT1 A;  2M0B A;  2JWD A;  2B89 A;  3PH0 A;  5EFW B;  1Q2N A;  4K3A A;  2LR2 A;  4NPF X;  1EDJ A;  2B87 B;  4GOE A;  3FXE A;  4IOI H;  1H0T B;  2ZAE B;  4JBZ A;  2B88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...