3S1KA

The development of peptide-based tools for the analysis of angiogenesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KEMHNAYAIEIALLPNLNDQQFHAFIWSLIDDPSQSANLLAEAKKLNDAQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The development of Peptide-based tools for the analysis of angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Z-domain
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3s1kA00
1LP1B 2R44A 1BDCA 2M0BA 3PH0A 4ASVA 3FXDA 1FC2C 2KUBA 1Q2NA 4HJGH 4GOEA 4GODA 1H0TB 3FXEA 4ZNCA 2B87B 3RGUA 5CBNA 1ZXGA 1NVOA 5DJTB 2B89A 1EDLA 4KJMA 1OVUA 5EFWB 2K3RA 4K35A 3MZWB 3S1KA 4JBZA 5DJUB 5CBOA 1OVRA 1MFTA 2QVAA 2KZJA 2LXBA 5C39A 4MN4C 1U7MA 2KS1B 2M5AB 2SPZA 2I8DA 2KZIA 1DEEG 4ASWA 1BDDA 1EDKA 2B87A 4EYYQ 2RKLA 4HKZH 1LP1A 1OVVA 1S3JA 1JMBA 3QWOC 1Y47A 3MHVA 2M5AA 1X0TA 2KI7B 4HB1A 2LXCB 4CPGA 4K3AA 4NPDA 1EDJA 1JM0A 2Q1KA 2OTKE 1EDIA 4IOIH 4NPEA 2ZAEB 2UWJE 2WMMA 1H0TA 5K5GB 4WWIA 1ZW0A 2KIKA 1U7JA 1LT1A 4NPFX 3ZDMA 2B88A 4ZMDA 2HR3A 1EC5A 2JWDA 2P58A 4BXLA 2QRXA 4GOFA 2LR2A 1SS1A
chains in the Genus database with same CATH superfamily
4JYCA 4PD4I 1MFZA 2E75B 1RHZB 2A45H 3VP9A 4EI2A 2JEEA 1M90Q 1KILC 1SQVG 1P84E 2QEXP 2YIUC 2IBZD 2FYUK 3HTKB 5E79H 2FYUE 3WU2H 1FZAA 1NKZB 1PP9G 3IAOA 5AVYB 3WUTA 1AVOA 2AXTE 2FYUJ 2P7JA 1VF5D 1PPJD 2D2CD 3FXDA 3EFGA 1YJWP 3NFQA 1KILE 2AEJA 2QSIA 1VDFA 1IFDA 1PL5A 3WU2E 1PGJA 3JSVC 3R4YA 1AQTA 1EZVE 2E76B 2KNCB 2O3JA 3AEEC 1KFNA 4UB6E 5KLVE 1LT9C 3V2RA 2GM4A 4GOEA 4AQRD 1IFJA 2Q7CA 3C9IA 5KLVJ 1Y9BA 5GTIH 3CCLP 1M8OB 1HTLC 3FXEA 1LTJB 2HODA 3L73D 1NHLA 3H1IG 1JY2O 3CX5H 2B87B 3CXHH 3L75D 4WY4C 1FOSE 3B5NC 3LW5J 4N78D 2J58A 4GT1A 1KQGB 1BSNA 3U1CA 2ZXXA 4XE5B 3H1JE 2K9YA 3P8CE 5B66H 5CMZA 2C9NY 1KC8Q 1VL2A 3MZWB 4A7PA 5KLIB 4M3LA 4U3FG 1YJNP 1TU3F 1KILB 1RF1C 4R4LA 4GIFA 1NKNA 1QLED 4JBZA 3H1JG 2E75C 5APXA 2WPRA 1NU1E 1GW4A 4BRYB 4DJGA 1AFOA 2W8ZA 3U1AA 2IFMA 3TNUA 1QX8A 4U3FE 2QIWA 1PV3A 2BCCD 1RE4A 2E43A 2YKOA 1AJYA 1PP9D 1SQVJ 3IR9A 4TT3H 1Q86Q 2NPSA 3OA7A 5BVZA 3L70D 2E74B 2HG5D 2IZ0A 1IO4A 2M5AB 1USEA 2SPZA 5KJ7D 1G1JA 2KP8A 2R5DA 1DX7A 3PRJA 4H44D 1CI6A 1M57D 1YYCA 2E5TA 2B87A 2DW3A 1LTJC 2OYHB 3MGNA 2J59M 2BCCJ 1JMMA 1FZEA 2KSEA 1KMIZ 1WMKA 2WPSA 1LJ2A 4Y99B 3Q5RA 3NXSA 1FJPA 5APUA 4TLFA 1FS0E 2HLOA 4HYTB 1S3JA 3CX5D 3UIAA 3BCCJ 2E76D 2CPBA 1JMBA 1KB9H 3EWKA 3Q5SA 1FAVA 4H13B 3P32A 4H44C 5L8RJ 3D6YA 4W7ZA 1KILA 4BRYA 2VRSA 2HFED 3RK3C 4RO0A 3HE4A 4OGQD 3MP7B 5CCGC 1HGZA 1LTTC 1SQQK 1QEXA 3RK3B 3VYIA 4CPGA 1JO5A 2JJLA 2Y0CA 1HGVA 1KFMA 2C0WA 4EDFA 1EDJA 2M3EA 1SQQD 2D2CC 3I55P 1E79H 3CL3D 5KAIE 2YKPA 3HRNA 2FYZA 2IYPA 2HYNA 3FWLA 2FXPA 3HUSA 2FXMA 1LT9A 3W68A 2E74D 2QJPC 1BE3E 1KILD 1Y8AA 4I6MC 1YTZT 1J1DB 5CCGA 2UWJE 3RK2D 5M1BA 2WMMA 2WSEJ 3FX0A 1PGOA 1KB9D 1RQVA 4KT0J 4WWIA 5KLVD 1A02J 1ZW0A 4I7ZB 2OYHA 2KLUA 4C46A 1GL2B 2OGUA 1ZP0C 2YXQB 4L74A 4RESB 2P2UA 3SFEC 5KTBA 5H2FH 3C8VA 2JWDA 3F89A 3VTPC 2ZT9B 1T3UA 3A0BE 3G9RA 2OTLP 2FYUD 1SFCD 2FYNB 4IL6E 4C7NA 1BE3G 5AW3B 1OZHA 1MV8A 1CW5A 3NMDA 1NTZK 1SQBK 2WSEH 1ZN5A 3P8CD 2KSJA 4R4MA 5E79E 3FWNA 3MTUE 2QJKC 4BWNA 2AXTH 2FFDB 1CSBA 3E1RA 2R44A 3BCCG 1BDCA 1RF0A 2M0BA 3H1HG 2QG4A 3F5HA 4DCKA 1H8AA 3ABVC 1Q82Q 1JNMA 2IFNA 2PRRA 3FGAD 1S5LX 2YXRB 3E7KA 1L0NE 4L75A 3AEGC 4U3FD 3L4FA 5AW7B 2W90A 1NTZG 1FC2C 1SQBG 2BCCE 4H13D 3CPWO 4UB8H 4OGQB 4JQ0D 1X79B 1L4AA 2JR8A 2L5GB 3G4SP 2IPPA 2K37A 4WY4B 1GL2A 1PZQA 1EXIA 4I7ZC 1VQKP 1X8YA 3HD7D 3Q5PA 3CWBD 1P84I 4GODA 3V2NA 3L74E 1H0TB 2IBZE 2P10A 1ZR4A 3L73G 5AVZB 4DT0A 4AYCA 5KKZC 3CCMP 1KQLA 2M3BA 1JB0J 1JCDA 5CJ4A 1GW3A 1VQ9P 5AVXB 2MKVA 3KDPB 1OX3A 1NAYA 2N1TB 2RN0A 3M9BA 2JO1A 5DJTB 3TGUG 1K8AQ 3PHLA 1EDLA 1M1JB 1FZBA 1ZV8A 2K3RA 2WWWA 3BCCD 5KAFE 3B5ND 5AVQB 2H89C 1LWUA 1SQPE 2W6BA 2O01H 1LTSC 1NTKK 2WVRA 1JY3N 2YIUB 1D7MA 1VQ5P 2HPCB 4O9BA 2JWAA 5DJUB 3IFMA 2JDIH 2XNDH 4EOTA 3L75E 1K73Q 1OVRA 1MFTA 3VMZA 1FZFA 1SFCB 1SQXD 3HUSC 1N7SB 1MZ9A 2QVAA 3VOPA 5BU8B 3GG2A 2QM8A 4OWFA 3H32B 3L70J 4EIJA 1GK4A 1Q90D 2IBZG 5C39A 2Z5HA 4MN4C 3B71A 2XNXA 3I56P 2ZYGA 2OYHC 1T6AA 1SQXJ 3GF3A 5KLVG 2WQYC 3H1LJ 1KTMA 1EZVG 2KZIA 1Q7YQ 1NTMG 3KXDA 3L71D 2OTJP 1KB9I 1GK6A 3AE7C 1BDDA 3BRTB 3H1IJ 4I2LC 4QMAA 2FKWB 4EYYQ 2ITAA 2WPQA 1FDIA 2BEQD 2NZ2A 1N73C 2C9LY 2YNYA 3CCUP 5GTHE 2RKLA 1BCCG 1QGKB 3AE5C 3AEAC 3H1KE 3OAKA 4HKZH 4LGDE 2A45I 3G6EP 3CCEP 4KHXA 3SFDC 1IC2A 3H1HE 1L0LD 2FFDC 3RK2C 2QJKB 3QWOC 2K9JB 1RH5B 2D2CB 2WSCH 3MHVA 1YJ9P 1RF0C 1L0LK 3AE2C 2HPCA 1X0TA 3CCSP 2LKMA 1NTKD 2R3SA 1IFIA 1W2EA 3L73J 3CWBJ 1UIIA 2K1AA 3T97A 5B5EH 1JTHA 4N6JA 1VQNP 1KV4A 1CI6B 2E75D 4K3AA 1YITP 1EXJA 4B86A 3A7OA 5APSA 1JM0A 2WITA 4YXWH 1L4AC 2Q1KA 4ZKUA 1EDIA 2R5BA 1GL2C 2C0XA 3B5NB 1BCCJ 1SLQA 3HD7C 3LIEA 1FZCA 1QVFO 2QA4P 3U59A 3VMYA 3L70E 2A06G 3GMAA 2YKQA 2E5YA 3AE8C 3EQ2A 1T2KC 1NAFA 4Y99C 2WT7A 1HF9A 1KZUB 4UB8E 4PD4E 1G1IA 1ZOYC 2ZT9C 1N73B 1J2JB 1FDOA 1IZNB 3L70G 5TISH 1NO4A 1L0LJ 2V7QH 3P8MC 1N7SD 1LT1A 3PLNA 1K9MQ 1Z56A 4NPFX 1IK9A 1J1EB 2N1TA 2OYIC 2HR3A 1VQ7P 2YMYA 1AQ5A 1H0TA 3B4SA 3O6QA 5CJ0A 3CXHI 1LWUC 1BGYD 3HTKA 4L73A 3L72D 2A06E 1L0ND 2G3AA 3CI9A 3V2QA 2B9BA 4BXLA 1BSHA 3AEFC 1JY2P 1VQ6P 3Q1MA 3H1KJ 1ZMEC 5AVWB 2IZ1A 2XDJA 1N7SC 1P84H 1NU1J 3CXHD 4I1LA 2O01N 2QRXA 3HUSB 1LTIC 4LLHA 1MKMA 3CCVP 1SFCC 3N4XA 1SS1A 1LTAC 3OJAB 3SWKA 1LP1B 2OYOA 1S9KD 4RJTA 1KYOD 3AE4C 3PH0A 2N1TD 1QVGO 3L74J 5AW9B 1JTHB 1OWAA 1BCCE 2W83C 3H1KG 3TK1A 1LNQA 2JKVA 3EFFK 2R3CA 4WBAA 2KYVA 1FU1A 2NRGA 1JCCA 3V5BA 3BATA 4YPCA 3GLMA 3A0HE 3CC2P 1G2CA 1SQQJ 1Q2NA 5AW6B 4D6TD 2N9BA 2OYIB 1DD4A 4W80A 1JOCA 1IK7A 1GMJA 1N73A 2V7QJ 3AE6C 3KQGA 1SQPD 1NTZJ 1SQBJ 2ZFCA 3A0HH 3CC4P 3KPEA 4PJ0H 1T8ZA 4GDOA 5AW2B 4ZNCA 2R32A 4PV1B 3KHUA 2ZVNB 5KAFH 1NTZD 1N86A 1SQBD 1VPCA 3O6QB 5AVVB 2QJYC 4L76A 3RGUA 3VMXA 1OXZA 2FFDA 2IYOA 1SQXE 1NVOA 1WT6A 1SQXK 1L0LG 1ZXGA 2B89A 2O01J 3CCJP 1U57A 2FXOA 4KJMA 5AVSB 1VQMP 1OVUA 2M8RA 1PIXA 1FJKA 1N8RQ 3L75J 3WUVA 1RY3A 1L0NK 3L36A 3M91A 4K35A 1FE6A 4JYBA 1KORA 1X9VA 2WZ7A 3S4RA 2E42A 1M1KQ 1OW6A 3GF7A 1GZLA 2AEFA 4IL6X 3S1KA 2YO2A 1T3JA 3K5BA 1NTMD 3PJSK 3VMAA 1VQ4P 4OVNF 3WMM0 1KQFB 3HD7A 4D6TG 3IN6A 3TGUE 2WSSH 1NTMK 3AECC 1GL2D 1NOHA 1FZCC 3RL0B 5CCHD 3GHGB 1SQPG 2WT7B 2RMZA 2I1JA 1SQPK 3H1KD 1IFNA 3MUDC 5KJ7C 1YHQP 1AVYA 1DH3A 3V4QA 1PGPA 1HUCA 2PAJA 3L74G 3L72J 4XFJA 1A02F 3KYQA 3II6A 3CD6P 1L0LE 5GTIE 2OYIA 1FOSF 2N1TC 1J1EC 4ASWA 2KS1A 3C1LA 1VQOP 1VF5B 1URQA 4PV1C 3H25A 3IF4A 2Y9ZA 1L0NG 2H7HA 5APVA 3P7KA 1FZGA 1BGYG 4OH8B 1YQ4C 1PFIA 1N7SA 5CHXA 1LP1A 1SQVE 5B66E 1LGHB 1W2BO 1NTMJ 1EQ7A 1SFCA 2JP3A 3BCCE 1NGMB 3BVHA 5B5EE 1Y47A 4OGQC 4IL6H 2K88A 3L71E 3SWYA 2M5AA 1SQVK 2XKMA 3CMAP 3T97B 5KAIH 2KI7B 4HB1A 5AW4B 2N9YB 2Q3IA 3Q2YA 3RL0g 3L35A 2WSFJ 2KXPB 1NTKJ 1P84D 5APQA 3M0DA 2OTKE 2KLVA 5KLIC 1HWTC 2Q5UA 4IOIH 1W5CE 1PPJE 3M9HA 4DZOA 3E1IA 5APWA 2W6AA 3CWBG 1IFMA 1IJDB 4C7RA 1NTKE 2A06D 3CCQP 2ZAEB 1H88A 3CLQA 1HVVA 1RE3C 3G71P 5K5GB 2POHA 3H1ID 1SQPJ 3N7NA 1VF5C 3PTZA 2KIKA 1URQB 3H1LE 1S4XA 3RBXA 3WUUA 4IFDK 1U7JA 4WB4A 3V4WA 5GTHH 5AVRB 3ZDMA 2B88A 2XV5A 4ZMDA 1GTWA 1EC5A 1S9KE 4DOJA 3L71J 3KZIE 3I5CA 5AW1B 4D6TJ 2P58A 3GW6A 2QE7H 1HJ0A 3H1HD 1NTKG 5TISE 1HJBA 3H1JJ 2P1JA 1M7LA 2WTYA 1NJIQ 2Q3EA 4PD4D 1PPJG 2O1KA 5APTA 1OMIA 5H2FE 1S5LH 3H1JD 1SP4A 2O1JA 1ZRTD 1XTGB 2IX7C 4GOFA 4XA4A 2LR2A 1JY3P 4JF7A 2H88C 1FZCB 1YQ3C 2Q9IA 1EZVD 5AVUB 2WSFH 3RBZA 2HODB 3W67A 3V2PA 3D71A 2FBWC 2G8YA 1ZLLA 1NU1D 3JCUE 3R2PA 5CCHA 2ZVOB 3MUDA 3AEBC 5AW8B 2KB7P 5KJ7A 5AVTB 3S9OA 1BGYE 3L72E 1L0NJ 1EZVI 4ASVA 1BGYJ 2NPSD 1R8EA 1KYOI 2P67A 1LTBC 2L91A 3ITKA 2KUBA 1M1JA 2RH0A 2W27A 3JCUH 1NYHA 4H13C 4PD4H 4YXDC 1Q81Q 3RK2B 1DIPA 5AW0B 3BRVB 1AA0A 5CCGD 1KQSO 1URQC 2BEZF 1PGQA 4HJGH 3LIDA 3RK3D 2H43A 3OW2O 1N2DC 4ZKPA 1JY3O 2XZRA 3TDKA 2KK7A 1HH0A 2H8PD 2MJZA 3KZIH 1BCCD 1GU4A 3TNUB 3G3ZA 1VQPP 1SQQG 4UB6H 2E76C 1S72P 1NTME 1S1CX 2ZJSE 5CBNA 1QL2A 3SWFA 4D6TE 1L4AB 3VN0A 3TGUD 3TGUJ 3D6ZA 1X22A 1K05A 3TYYA 1OW8A 1NU1G 1OFCX 1E5WA 1URQD 3MD0A 5EFWB 3LW5H 3A5TA 3CXHE 2Y0EA 3NTNA 5APYA 4U3FJ 1XTCC 2I1KA 2ZYDA 5TJHA 3GHGC 3HE5B 1DD3A 1DEBA 1YBKA 1KYOE 2KOGA 3BASA 4IFMA 3M0DC 5CBOA 3L75G 4N78E 2OARA 2ZT9D 3M0AA 3VP8A 1ZR2A 1NU1K 2AEMA 1VQ8P 1SVFA 3MIWA 5KKZB 1FBMA 4HH2A 2BASA 1S2EA 1SQQE 1N7LA 2IDBA 1KYOH 2KZJA 2W6JH 2Z5IA 3O8ZA 5AW5B 1RE3A 3TSIA 1UIXA 1RF1B 2LXBA 1LWUB 1WRGA 3V6IA 1AV1A 1JEKA 1QL1A 3HE4B 2ZYAA 2WPVB 2CPSA 1U7MA 2KS1B 1L2PA 1SQXG 1GDTA 2I8DA 4PJ0E 4WVZA 1DEEG 4RKUJ 1KN7A 3H1IE 1VQLP 3H1LD 1K04A 2E74C 1EDKA 1R5LA 2NPSB 1NH4A 1NTZE 1SQBE 2BCCG 1BE3J 3H6PA 3L73E 4IFFA 3AE3C 3H32A 3A3YB 4H0LD 1YI2P 1J1DC 1PP9E 3AE1C 2FYUG 3L72G 4JPZB 2QM7A 1LT9B 2XU6A 2ZXEB 3L37A 4Z1MH 1OVVA 1CZQA 3HD7B 1H89A 2Z4EA 1GD2E 3QH9A 3CMEP 4WY4A 3B5NA 1R5SA 1JY2N 2YO3A 1FDMA 1G2CB 3HE5A 1T2KD 3SSUA 1GU5A 5CCHC 3CCRP 1S5LE 1RQUA 1ZRTE 3M06A 4C7NB 1YTZI 2FYNC 2LXCB 3USSA 1L4AD 1USDA 1KB9E 5BU5A 2AXCA 2PFXA 1KD1Q 2YMKA 1RF1A 3PP5A 4NPDA 1M1JC 1MUUA 4H44B 3CC7P 1YIJP 2OQQA 1NWQA 4H0LC 3TF5A 2K9JA 2J5UA 2V4HA 3Q3DA 2QJYB 4NPEA 4LC1A 2A45G 2GUVA 2WSCJ 3H1LG 2Q6QA 2GA1A 4YTPC 4W7YA 1RE4C 2FY8A 4GKGA 3AEDC 3JC22 2QJPB 2NPSC 3CWBE 3M9QA 1HBWA 3RK3E 1LTGC 2Y0DA 3L74D 4N3YB 3D70A 1OW7A 2KNCA 4U7JA 2IBZI 1JUNA 3B8EB 4PV1D 2GUSA 3A2AA 3CX5I 1SQVD 3CX5E 4AUWA 1BE3D 1LTJA 3H1HJ 4WY4D 1OIPA 1IFPA 3GHGA 2PGDA 4Y28J 1PP9J 3RL0C 3RL0D 5KLVK 2Y9YA 3AE9C 1M56D 2PP6A 3L71G 3A0BH 4H0LB 2CK3H
chains in the Genus database with same CATH topology
1LP1B 2R44A 1BDCA 2M0BA 3PH0A 4ASVA 3FXDA 1FC2C 2KUBA 1Q2NA 4HJGH 4GOEA 4GODA 1H0TB 3FXEA 4ZNCA 2B87B 3RGUA 5CBNA 1ZXGA 1NVOA 5DJTB 2B89A 1EDLA 4KJMA 1OVUA 5EFWB 2K3RA 4K35A 3MZWB 3S1KA 4JBZA 5DJUB 5CBOA 1OVRA 1MFTA 2QVAA 2KZJA 2LXBA 5C39A 4MN4C 1U7MA 2KS1B 2M5AB 2SPZA 2I8DA 2KZIA 1DEEG 4ASWA 1BDDA 1EDKA 2B87A 4EYYQ 2RKLA 4HKZH 1LP1A 1OVVA 1S3JA 1JMBA 3QWOC 1Y47A 3MHVA 2M5AA 1X0TA 2KI7B 4HB1A 2LXCB 4CPGA 4K3AA 4NPDA 1EDJA 1JM0A 2Q1KA 2OTKE 1EDIA 4IOIH 4NPEA 2ZAEB 2UWJE 2WMMA 1H0TA 5K5GB 4WWIA 1ZW0A 2KIKA 1U7JA 1LT1A 4NPFX 3ZDMA 2B88A 4ZMDA 2HR3A 1EC5A 2JWDA 2P58A 4BXLA 2QRXA 4GOFA 2LR2A 1SS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LP1 B;  2R44 A;  1BDC A;  2M0B A;  3PH0 A;  4ASV A;  3FXD A;  1FC2 C;  2KUB A;  1Q2N A;  4HJG H;  4GOE A;  4GOD A;  1H0T B;  3FXE A;  4ZNC A;  2B87 B;  3RGU A;  5CBN A;  1ZXG A;  1NVO A;  5DJT B;  2B89 A;  1EDL A;  4KJM A;  1OVU A;  5EFW B;  2K3R A;  4K35 A;  3MZW B;  3S1K A;  4JBZ A;  5DJU B;  5CBO A;  1OVR A;  1MFT A;  2QVA A;  2KZJ A;  2LXB A;  5C39 A;  4MN4 C;  1U7M A;  2KS1 B;  2M5A B;  2SPZ A;  2I8D A;  2KZI A;  1DEE G;  4ASW A;  1BDD A;  1EDK A;  2B87 A;  4EYY Q;  2RKL A;  4HKZ H;  1LP1 A;  1OVV A;  1S3J A;  1JMB A;  3QWO C;  1Y47 A;  3MHV A;  2M5A A;  1X0T A;  2KI7 B;  4HB1 A;  2LXC B;  4CPG A;  4K3A A;  4NPD A;  1EDJ A;  1JM0 A;  2Q1K A;  2OTK E;  1EDI A;  4IOI H;  4NPE A;  2ZAE B;  2UWJ E;  2WMM A;  1H0T A;  5K5G B;  4WWI A;  1ZW0 A;  2KIK A;  1U7J A;  1LT1 A;  4NPF X;  3ZDM A;  2B88 A;  4ZMD A;  2HR3 A;  1EC5 A;  2JWD A;  2P58 A;  4BXL A;  2QRX A;  4GOF A;  2LR2 A;  1SS1 A; 
#chains in the Genus database with same CATH topology
 4JYC A;  4PD4 I;  1MFZ A;  2E75 B;  1RHZ B;  2A45 H;  3VP9 A;  4EI2 A;  2JEE A;  1M90 Q;  1KIL C;  1SQV G;  1P84 E;  2QEX P;  2YIU C;  2IBZ D;  2FYU K;  3HTK B;  5E79 H;  2FYU E;  3WU2 H;  1FZA A;  1NKZ B;  1PP9 G;  3IAO A;  5AVY B;  3WUT A;  1AVO A;  2AXT E;  2FYU J;  2P7J A;  1VF5 D;  1PPJ D;  2D2C D;  3FXD A;  3EFG A;  1YJW P;  3NFQ A;  1KIL E;  2AEJ A;  2QSI A;  1VDF A;  1IFD A;  1PL5 A;  3WU2 E;  1PGJ A;  3JSV C;  3R4Y A;  1AQT A;  1EZV E;  2E76 B;  2KNC B;  2O3J A;  3AEE C;  1KFN A;  4UB6 E;  5KLV E;  1LT9 C;  3V2R A;  2GM4 A;  4GOE A;  4AQR D;  1IFJ A;  2Q7C A;  3C9I A;  5KLV J;  1Y9B A;  5GTI H;  3CCL P;  1M8O B;  1HTL C;  3FXE A;  1LTJ B;  2HOD A;  3L73 D;  1NHL A;  3H1I G;  1JY2 O;  3CX5 H;  2B87 B;  3CXH H;  3L75 D;  4WY4 C;  1FOS E;  3B5N C;  3LW5 J;  4N78 D;  2J58 A;  4GT1 A;  1KQG B;  1BSN A;  3U1C A;  2ZXX A;  4XE5 B;  3H1J E;  2K9Y A;  3P8C E;  5B66 H;  5CMZ A;  2C9N Y;  1KC8 Q;  1VL2 A;  3MZW B;  4A7P A;  5KLI B;  4M3L A;  4U3F G;  1YJN P;  1TU3 F;  1KIL B;  1RF1 C;  4R4L A;  4GIF A;  1NKN A;  1QLE D;  4JBZ A;  3H1J G;  2E75 C;  5APX A;  2WPR A;  1NU1 E;  1GW4 A;  4BRY B;  4DJG A;  1AFO A;  2W8Z A;  3U1A A;  2IFM A;  3TNU A;  1QX8 A;  4U3F E;  2QIW A;  1PV3 A;  2BCC D;  1RE4 A;  2E43 A;  2YKO A;  1AJY A;  1PP9 D;  1SQV J;  3IR9 A;  4TT3 H;  1Q86 Q;  2NPS A;  3OA7 A;  5BVZ A;  3L70 D;  2E74 B;  2HG5 D;  2IZ0 A;  1IO4 A;  2M5A B;  1USE A;  2SPZ A;  5KJ7 D;  1G1J A;  2KP8 A;  2R5D A;  1DX7 A;  3PRJ A;  4H44 D;  1CI6 A;  1M57 D;  1YYC A;  2E5T A;  2B87 A;  2DW3 A;  1LTJ C;  2OYH B;  3MGN A;  2J59 M;  2BCC J;  1JMM A;  1FZE A;  2KSE A;  1KMI Z;  1WMK A;  2WPS A;  1LJ2 A;  4Y99 B;  3Q5R A;  3NXS A;  1FJP A;  5APU A;  4TLF A;  1FS0 E;  2HLO A;  4HYT B;  1S3J A;  3CX5 D;  3UIA A;  3BCC J;  2E76 D;  2CPB A;  1JMB A;  1KB9 H;  3EWK A;  3Q5S A;  1FAV A;  4H13 B;  3P32 A;  4H44 C;  5L8R J;  3D6Y A;  4W7Z A;  1KIL A;  4BRY A;  2VRS A;  2HFE D;  3RK3 C;  4RO0 A;  3HE4 A;  4OGQ D;  3MP7 B;  5CCG C;  1HGZ A;  1LTT C;  1SQQ K;  1QEX A;  3RK3 B;  3VYI A;  4CPG A;  1JO5 A;  2JJL A;  2Y0C A;  1HGV A;  1KFM A;  2C0W A;  4EDF A;  1EDJ A;  2M3E A;  1SQQ D;  2D2C C;  3I55 P;  1E79 H;  3CL3 D;  5KAI E;  2YKP A;  3HRN A;  2FYZ A;  2IYP A;  2HYN A;  3FWL A;  2FXP A;  3HUS A;  2FXM A;  1LT9 A;  3W68 A;  2E74 D;  2QJP C;  1BE3 E;  1KIL D;  1Y8A A;  4I6M C;  1YTZ T;  1J1D B;  5CCG A;  2UWJ E;  3RK2 D;  5M1B A;  2WMM A;  2WSE J;  3FX0 A;  1PGO A;  1KB9 D;  1RQV A;  4KT0 J;  4WWI A;  5KLV D;  1A02 J;  1ZW0 A;  4I7Z B;  2OYH A;  2KLU A;  4C46 A;  1GL2 B;  2OGU A;  1ZP0 C;  2YXQ B;  4L74 A;  4RES B;  2P2U A;  3SFE C;  5KTB A;  5H2F H;  3C8V A;  2JWD A;  3F89 A;  3VTP C;  2ZT9 B;  1T3U A;  3A0B E;  3G9R A;  2OTL P;  2FYU D;  1SFC D;  2FYN B;  4IL6 E;  4C7N A;  1BE3 G;  5AW3 B;  1OZH A;  1MV8 A;  1CW5 A;  3NMD A;  1NTZ K;  1SQB K;  2WSE H;  1ZN5 A;  3P8C D;  2KSJ A;  4R4M A;  5E79 E;  3FWN A;  3MTU E;  2QJK C;  4BWN A;  2AXT H;  2FFD B;  1CSB A;  3E1R A;  2R44 A;  3BCC G;  1BDC A;  1RF0 A;  2M0B A;  3H1H G;  2QG4 A;  3F5H A;  4DCK A;  1H8A A;  3ABV C;  1Q82 Q;  1JNM A;  2IFN A;  2PRR A;  3FGA D;  1S5L X;  2YXR B;  3E7K A;  1L0N E;  4L75 A;  3AEG C;  4U3F D;  3L4F A;  5AW7 B;  2W90 A;  1NTZ G;  1FC2 C;  1SQB G;  2BCC E;  4H13 D;  3CPW O;  4UB8 H;  4OGQ B;  4JQ0 D;  1X79 B;  1L4A A;  2JR8 A;  2L5G B;  3G4S P;  2IPP A;  2K37 A;  4WY4 B;  1GL2 A;  1PZQ A;  1EXI A;  4I7Z C;  1VQK P;  1X8Y A;  3HD7 D;  3Q5P A;  3CWB D;  1P84 I;  4GOD A;  3V2N A;  3L74 E;  1H0T B;  2IBZ E;  2P10 A;  1ZR4 A;  3L73 G;  5AVZ B;  4DT0 A;  4AYC A;  5KKZ C;  3CCM P;  1KQL A;  2M3B A;  1JB0 J;  1JCD A;  5CJ4 A;  1GW3 A;  1VQ9 P;  5AVX B;  2MKV A;  3KDP B;  1OX3 A;  1NAY A;  2N1T B;  2RN0 A;  3M9B A;  2JO1 A;  5DJT B;  3TGU G;  1K8A Q;  3PHL A;  1EDL A;  1M1J B;  1FZB A;  1ZV8 A;  2K3R A;  2WWW A;  3BCC D;  5KAF E;  3B5N D;  5AVQ B;  2H89 C;  1LWU A;  1SQP E;  2W6B A;  2O01 H;  1LTS C;  1NTK K;  2WVR A;  1JY3 N;  2YIU B;  1D7M A;  1VQ5 P;  2HPC B;  4O9B A;  2JWA A;  5DJU B;  3IFM A;  2JDI H;  2XND H;  4EOT A;  3L75 E;  1K73 Q;  1OVR A;  1MFT A;  3VMZ A;  1FZF A;  1SFC B;  1SQX D;  3HUS C;  1N7S B;  1MZ9 A;  2QVA A;  3VOP A;  5BU8 B;  3GG2 A;  2QM8 A;  4OWF A;  3H32 B;  3L70 J;  4EIJ A;  1GK4 A;  1Q90 D;  2IBZ G;  5C39 A;  2Z5H A;  4MN4 C;  3B71 A;  2XNX A;  3I56 P;  2ZYG A;  2OYH C;  1T6A A;  1SQX J;  3GF3 A;  5KLV G;  2WQY C;  3H1L J;  1KTM A;  1EZV G;  2KZI A;  1Q7Y Q;  1NTM G;  3KXD A;  3L71 D;  2OTJ P;  1KB9 I;  1GK6 A;  3AE7 C;  1BDD A;  3BRT B;  3H1I J;  4I2L C;  4QMA A;  2FKW B;  4EYY Q;  2ITA A;  2WPQ A;  1FDI A;  2BEQ D;  2NZ2 A;  1N73 C;  2C9L Y;  2YNY A;  3CCU P;  5GTH E;  2RKL A;  1BCC G;  1QGK B;  3AE5 C;  3AEA C;  3H1K E;  3OAK A;  4HKZ H;  4LGD E;  2A45 I;  3G6E P;  3CCE P;  4KHX A;  3SFD C;  1IC2 A;  3H1H E;  1L0L D;  2FFD C;  3RK2 C;  2QJK B;  3QWO C;  2K9J B;  1RH5 B;  2D2C B;  2WSC H;  3MHV A;  1YJ9 P;  1RF0 C;  1L0L K;  3AE2 C;  2HPC A;  1X0T A;  3CCS P;  2LKM A;  1NTK D;  2R3S A;  1IFI A;  1W2E A;  3L73 J;  3CWB J;  1UII A;  2K1A A;  3T97 A;  5B5E H;  1JTH A;  4N6J A;  1VQN P;  1KV4 A;  1CI6 B;  2E75 D;  4K3A A;  1YIT P;  1EXJ A;  4B86 A;  3A7O A;  5APS A;  1JM0 A;  2WIT A;  4YXW H;  1L4A C;  2Q1K A;  4ZKU A;  1EDI A;  2R5B A;  1GL2 C;  2C0X A;  3B5N B;  1BCC J;  1SLQ A;  3HD7 C;  3LIE A;  1FZC A;  1QVF O;  2QA4 P;  3U59 A;  3VMY A;  3L70 E;  2A06 G;  3GMA A;  2YKQ A;  2E5Y A;  3AE8 C;  3EQ2 A;  1T2K C;  1NAF A;  4Y99 C;  2WT7 A;  1HF9 A;  1KZU B;  4UB8 E;  4PD4 E;  1G1I A;  1ZOY C;  2ZT9 C;  1N73 B;  1J2J B;  1FDO A;  1IZN B;  3L70 G;  5TIS H;  1NO4 A;  1L0L J;  2V7Q H;  3P8M C;  1N7S D;  1LT1 A;  3PLN A;  1K9M Q;  1Z56 A;  4NPF X;  1IK9 A;  1J1E B;  2N1T A;  2OYI C;  2HR3 A;  1VQ7 P;  2YMY A;  1AQ5 A;  1H0T A;  3B4S A;  3O6Q A;  5CJ0 A;  3CXH I;  1LWU C;  1BGY D;  3HTK A;  4L73 A;  3L72 D;  2A06 E;  1L0N D;  2G3A A;  3CI9 A;  3V2Q A;  2B9B A;  4BXL A;  1BSH A;  3AEF C;  1JY2 P;  1VQ6 P;  3Q1M A;  3H1K J;  1ZME C;  5AVW B;  2IZ1 A;  2XDJ A;  1N7S C;  1P84 H;  1NU1 J;  3CXH D;  4I1L A;  2O01 N;  2QRX A;  3HUS B;  1LTI C;  4LLH A;  1MKM A;  3CCV P;  1SFC C;  3N4X A;  1SS1 A;  1LTA C;  3OJA B;  3SWK A;  1LP1 B;  2OYO A;  1S9K D;  4RJT A;  1KYO D;  3AE4 C;  3PH0 A;  2N1T D;  1QVG O;  3L74 J;  5AW9 B;  1JTH B;  1OWA A;  1BCC E;  2W83 C;  3H1K G;  3TK1 A;  1LNQ A;  2JKV A;  3EFF K;  2R3C A;  4WBA A;  2KYV A;  1FU1 A;  2NRG A;  1JCC A;  3V5B A;  3BAT A;  4YPC A;  3GLM A;  3A0H E;  3CC2 P;  1G2C A;  1SQQ J;  1Q2N A;  5AW6 B;  4D6T D;  2N9B A;  2OYI B;  1DD4 A;  4W80 A;  1JOC A;  1IK7 A;  1GMJ A;  1N73 A;  2V7Q J;  3AE6 C;  3KQG A;  1SQP D;  1NTZ J;  1SQB J;  2ZFC A;  3A0H H;  3CC4 P;  3KPE A;  4PJ0 H;  1T8Z A;  4GDO A;  5AW2 B;  4ZNC A;  2R32 A;  4PV1 B;  3KHU A;  2ZVN B;  5KAF H;  1NTZ D;  1N86 A;  1SQB D;  1VPC A;  3O6Q B;  5AVV B;  2QJY C;  4L76 A;  3RGU A;  3VMX A;  1OXZ A;  2FFD A;  2IYO A;  1SQX E;  1NVO A;  1WT6 A;  1SQX K;  1L0L G;  1ZXG A;  2B89 A;  2O01 J;  3CCJ P;  1U57 A;  2FXO A;  4KJM A;  5AVS B;  1VQM P;  1OVU A;  2M8R A;  1PIX A;  1FJK A;  1N8R Q;  3L75 J;  3WUV A;  1RY3 A;  1L0N K;  3L36 A;  3M91 A;  4K35 A;  1FE6 A;  4JYB A;  1KOR A;  1X9V A;  2WZ7 A;  3S4R A;  2E42 A;  1M1K Q;  1OW6 A;  3GF7 A;  1GZL A;  2AEF A;  4IL6 X;  3S1K A;  2YO2 A;  1T3J A;  3K5B A;  1NTM D;  3PJS K;  3VMA A;  1VQ4 P;  4OVN F;  3WMM 0;  1KQF B;  3HD7 A;  4D6T G;  3IN6 A;  3TGU E;  2WSS H;  1NTM K;  3AEC C;  1GL2 D;  1NOH A;  1FZC C;  3RL0 B;  5CCH D;  3GHG B;  1SQP G;  2WT7 B;  2RMZ A;  2I1J A;  1SQP K;  3H1K D;  1IFN A;  3MUD C;  5KJ7 C;  1YHQ P;  1AVY A;  1DH3 A;  3V4Q A;  1PGP A;  1HUC A;  2PAJ A;  3L74 G;  3L72 J;  4XFJ A;  1A02 F;  3KYQ A;  3II6 A;  3CD6 P;  1L0L E;  5GTI E;  2OYI A;  1FOS F;  2N1T C;  1J1E C;  4ASW A;  2KS1 A;  3C1L A;  1VQO P;  1VF5 B;  1URQ A;  4PV1 C;  3H25 A;  3IF4 A;  2Y9Z A;  1L0N G;  2H7H A;  5APV A;  3P7K A;  1FZG A;  1BGY G;  4OH8 B;  1YQ4 C;  1PFI A;  1N7S A;  5CHX A;  1LP1 A;  1SQV E;  5B66 E;  1LGH B;  1W2B O;  1NTM J;  1EQ7 A;  1SFC A;  2JP3 A;  3BCC E;  1NGM B;  3BVH A;  5B5E E;  1Y47 A;  4OGQ C;  4IL6 H;  2K88 A;  3L71 E;  3SWY A;  2M5A A;  1SQV K;  2XKM A;  3CMA P;  3T97 B;  5KAI H;  2KI7 B;  4HB1 A;  5AW4 B;  2N9Y B;  2Q3I A;  3Q2Y A;  3RL0 g;  3L35 A;  2WSF J;  2KXP B;  1NTK J;  1P84 D;  5APQ A;  3M0D A;  2OTK E;  2KLV A;  5KLI C;  1HWT C;  2Q5U A;  4IOI H;  1W5C E;  1PPJ E;  3M9H A;  4DZO A;  3E1I A;  5APW A;  2W6A A;  3CWB G;  1IFM A;  1IJD B;  4C7R A;  1NTK E;  2A06 D;  3CCQ P;  2ZAE B;  1H88 A;  3CLQ A;  1HVV A;  1RE3 C;  3G71 P;  5K5G B;  2POH A;  3H1I D;  1SQP J;  3N7N A;  1VF5 C;  3PTZ A;  2KIK A;  1URQ B;  3H1L E;  1S4X A;  3RBX A;  3WUU A;  4IFD K;  1U7J A;  4WB4 A;  3V4W A;  5GTH H;  5AVR B;  3ZDM A;  2B88 A;  2XV5 A;  4ZMD A;  1GTW A;  1EC5 A;  1S9K E;  4DOJ A;  3L71 J;  3KZI E;  3I5C A;  5AW1 B;  4D6T J;  2P58 A;  3GW6 A;  2QE7 H;  1HJ0 A;  3H1H D;  1NTK G;  5TIS E;  1HJB A;  3H1J J;  2P1J A;  1M7L A;  2WTY A;  1NJI Q;  2Q3E A;  4PD4 D;  1PPJ G;  2O1K A;  5APT A;  1OMI A;  5H2F E;  1S5L H;  3H1J D;  1SP4 A;  2O1J A;  1ZRT D;  1XTG B;  2IX7 C;  4GOF A;  4XA4 A;  2LR2 A;  1JY3 P;  4JF7 A;  2H88 C;  1FZC B;  1YQ3 C;  2Q9I A;  1EZV D;  5AVU B;  2WSF H;  3RBZ A;  2HOD B;  3W67 A;  3V2P A;  3D71 A;  2FBW C;  2G8Y A;  1ZLL A;  1NU1 D;  3JCU E;  3R2P A;  5CCH A;  2ZVO B;  3MUD A;  3AEB C;  5AW8 B;  2KB7 P;  5KJ7 A;  5AVT B;  3S9O A;  1BGY E;  3L72 E;  1L0N J;  1EZV I;  4ASV A;  1BGY J;  2NPS D;  1R8E A;  1KYO I;  2P67 A;  1LTB C;  2L91 A;  3ITK A;  2KUB A;  1M1J A;  2RH0 A;  2W27 A;  3JCU H;  1NYH A;  4H13 C;  4PD4 H;  4YXD C;  1Q81 Q;  3RK2 B;  1DIP A;  5AW0 B;  3BRV B;  1AA0 A;  5CCG D;  1KQS O;  1URQ C;  2BEZ F;  1PGQ A;  4HJG H;  3LID A;  3RK3 D;  2H43 A;  3OW2 O;  1N2D C;  4ZKP A;  1JY3 O;  2XZR A;  3TDK A;  2KK7 A;  1HH0 A;  2H8P D;  2MJZ A;  3KZI H;  1BCC D;  1GU4 A;  3TNU B;  3G3Z A;  1VQP P;  1SQQ G;  4UB6 H;  2E76 C;  1S72 P;  1NTM E;  1S1C X;  2ZJS E;  5CBN A;  1QL2 A;  3SWF A;  4D6T E;  1L4A B;  3VN0 A;  3TGU D;  3TGU J;  3D6Z A;  1X22 A;  1K05 A;  3TYY A;  1OW8 A;  1NU1 G;  1OFC X;  1E5W A;  1URQ D;  3MD0 A;  5EFW B;  3LW5 H;  3A5T A;  3CXH E;  2Y0E A;  3NTN A;  5APY A;  4U3F J;  1XTC C;  2I1K A;  2ZYD A;  5TJH A;  3GHG C;  3HE5 B;  1DD3 A;  1DEB A;  1YBK A;  1KYO E;  2KOG A;  3BAS A;  4IFM A;  3M0D C;  5CBO A;  3L75 G;  4N78 E;  2OAR A;  2ZT9 D;  3M0A A;  3VP8 A;  1ZR2 A;  1NU1 K;  2AEM A;  1VQ8 P;  1SVF A;  3MIW A;  5KKZ B;  1FBM A;  4HH2 A;  2BAS A;  1S2E A;  1SQQ E;  1N7L A;  2IDB A;  1KYO H;  2KZJ A;  2W6J H;  2Z5I A;  3O8Z A;  5AW5 B;  1RE3 A;  3TSI A;  1UIX A;  1RF1 B;  2LXB A;  1LWU B;  1WRG A;  3V6I A;  1AV1 A;  1JEK A;  1QL1 A;  3HE4 B;  2ZYA A;  2WPV B;  2CPS A;  1U7M A;  2KS1 B;  1L2P A;  1SQX G;  1GDT A;  2I8D A;  4PJ0 E;  4WVZ A;  1DEE G;  4RKU J;  1KN7 A;  3H1I E;  1VQL P;  3H1L D;  1K04 A;  2E74 C;  1EDK A;  1R5L A;  2NPS B;  1NH4 A;  1NTZ E;  1SQB E;  2BCC G;  1BE3 J;  3H6P A;  3L73 E;  4IFF A;  3AE3 C;  3H32 A;  3A3Y B;  4H0L D;  1YI2 P;  1J1D C;  1PP9 E;  3AE1 C;  2FYU G;  3L72 G;  4JPZ B;  2QM7 A;  1LT9 B;  2XU6 A;  2ZXE B;  3L37 A;  4Z1M H;  1OVV A;  1CZQ A;  3HD7 B;  1H89 A;  2Z4E A;  1GD2 E;  3QH9 A;  3CME P;  4WY4 A;  3B5N A;  1R5S A;  1JY2 N;  2YO3 A;  1FDM A;  1G2C B;  3HE5 A;  1T2K D;  3SSU A;  1GU5 A;  5CCH C;  3CCR P;  1S5L E;  1RQU A;  1ZRT E;  3M06 A;  4C7N B;  1YTZ I;  2FYN C;  2LXC B;  3USS A;  1L4A D;  1USD A;  1KB9 E;  5BU5 A;  2AXC A;  2PFX A;  1KD1 Q;  2YMK A;  1RF1 A;  3PP5 A;  4NPD A;  1M1J C;  1MUU A;  4H44 B;  3CC7 P;  1YIJ P;  2OQQ A;  1NWQ A;  4H0L C;  3TF5 A;  2K9J A;  2J5U A;  2V4H A;  3Q3D A;  2QJY B;  4NPE A;  4LC1 A;  2A45 G;  2GUV A;  2WSC J;  3H1L G;  2Q6Q A;  2GA1 A;  4YTP C;  4W7Y A;  1RE4 C;  2FY8 A;  4GKG A;  3AED C;  3JC2 2;  2QJP B;  2NPS C;  3CWB E;  3M9Q A;  1HBW A;  3RK3 E;  1LTG C;  2Y0D A;  3L74 D;  4N3Y B;  3D70 A;  1OW7 A;  2KNC A;  4U7J A;  2IBZ I;  1JUN A;  3B8E B;  4PV1 D;  2GUS A;  3A2A A;  3CX5 I;  1SQV D;  3CX5 E;  4AUW A;  1BE3 D;  1LTJ A;  3H1H J;  4WY4 D;  1OIP A;  1IFP A;  3GHG A;  2PGD A;  4Y28 J;  1PP9 J;  3RL0 C;  3RL0 D;  5KLV K;  2Y9Y A;  3AE9 C;  1M56 D;  2PP6 A;  3L71 G;  3A0B H;  4H0L B;  2CK3 H; 
#chains in the Genus database with same CATH homology
 1LP1 B;  2R44 A;  1BDC A;  2M0B A;  3PH0 A;  4ASV A;  3FXD A;  1FC2 C;  2KUB A;  1Q2N A;  4HJG H;  4GOE A;  4GOD A;  1H0T B;  3FXE A;  4ZNC A;  2B87 B;  3RGU A;  5CBN A;  1ZXG A;  1NVO A;  5DJT B;  2B89 A;  1EDL A;  4KJM A;  1OVU A;  5EFW B;  2K3R A;  4K35 A;  3MZW B;  3S1K A;  4JBZ A;  5DJU B;  5CBO A;  1OVR A;  1MFT A;  2QVA A;  2KZJ A;  2LXB A;  5C39 A;  4MN4 C;  1U7M A;  2KS1 B;  2M5A B;  2SPZ A;  2I8D A;  2KZI A;  1DEE G;  4ASW A;  1BDD A;  1EDK A;  2B87 A;  4EYY Q;  2RKL A;  4HKZ H;  1LP1 A;  1OVV A;  1S3J A;  1JMB A;  3QWO C;  1Y47 A;  3MHV A;  2M5A A;  1X0T A;  2KI7 B;  4HB1 A;  2LXC B;  4CPG A;  4K3A A;  4NPD A;  1EDJ A;  1JM0 A;  2Q1K A;  2OTK E;  1EDI A;  4IOI H;  4NPE A;  2ZAE B;  2UWJ E;  2WMM A;  1H0T A;  5K5G B;  4WWI A;  1ZW0 A;  2KIK A;  1U7J A;  1LT1 A;  4NPF X;  3ZDM A;  2B88 A;  4ZMD A;  2HR3 A;  1EC5 A;  2JWD A;  2P58 A;  4BXL A;  2QRX A;  4GOF A;  2LR2 A;  1SS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...