3S1KA

The development of peptide-based tools for the analysis of angiogenesis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
KEMHNAYAIEIALLPNLNDQQFHAFIWSLIDDPSQSANLLAEAKKLNDAQAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Z-domain
publication title The development of Peptide-based tools for the analysis of angiogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 18
structure length 52
sequence length 52
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3s1kA00
4KJMA 4WWIA 3FXDA 1DEEG 1MFTA 1SS1A 4GOEA 1H0TA 3RGUA 5CBOA 4IOIH 2UWJE 2LR2A 3ZDMA 1JM0A 2KZIA 2B88A 4K35A 2LXBA 2WMMA 4CPGA 1U7MA 2Q1KA 2R44A 4GOFA 3S1KA 2LXCB 3PH0A 1Y47A 5DJTB 1EDKA 2KI7B 2ZAEB 1NVOA 1U7JA 2I8DA 2OTKE 4K3AA 2B87A 3FXEA 2KS1B 3MHVA 1H0TB 5DJUB 4NPDA 4ZNCA 1EDJA 4MN4C 4HB1A 1EC5A 2JWDA 2SPZA 4EYYQ 1OVUA 1LP1A 1ZW0A 5EFWB 2M0BA 1EDIA 1BDDA 2K3RA 1FC2C 3QWOC 2HR3A 4JBZA 5C39A 2M5AA 1Q2NA 2QRXA 4ASWA 1S3JA 2B87B 1JMBA 1EDLA 1LT1A 2KIKA 4HJGH 4ZMDA 2P58A 2KZJA 1X0TA 3MZWB 2RKLA 4NPFX 1OVRA 1LP1B 5K5GB 4NPEA 2KUBA 4BXLA 5CBNA 2B89A 2QVAA 4ASVA 1BDCA 4HKZH 2M5AB 4GODA 1ZXGA 1OVVA
chains in the Genus database with same CATH superfamily
1IK7A 3D6YA 5KKZB 3R4YA 1NAFA 1BE3D 2QJYB 1L4AD 1SQPK 3HE5B 2W90A 2IPPA 3RL0B 3A0BH 1JOCA 2H89C 1IFIA 1NTKD 2H8PD 5DJTB 1N7SD 2WPVB 5B66E 5APTA 4H13B 3HE4B 5APXA 3AEGC 3M9HA 1SQPG 2IFNA 5AW8B 3SWYA 2WVRA 4L76A 1ZP0C 1VQ9P 2O01H 1WMKA 1HJBA 3TK1A 5AW9B 1USDA 2AEJA 3TSIA 1PPJG 2Y0CA 3P8CE 1NTMJ 5KLVK 3L36A 3V6IA 1D7MA 2OYIC 5L8RJ 1KV4A 2QJKC 3AECC 1PV3A 2MKVA 3TGUE 1ZN5A 2N9YB 3SFEC 3IF4A 1YTZI 3L74D 3PRJA 2YKPA 1CZQA 1EQ7A 4EOTA 2YIUB 3LIDA 1R8EA 4PJ0E 4JQ0D 5KTBA 5AVVB 5BU8B 1RE3A 1P84D 1W5CE 4PD4H 1KFNA 2DW3A 3L75G 1DIPA 1SQBD 2A06G 2P1JA 2Q7CA 2R3SA 2BCCJ 3CCVP 1EZVE 5AW6B 4H0LC 2LXCB 3L72E 1NJIQ 3RBXA 3WUUA 1FAVA 4L75A 1FDOA 3H1LE 5TISE 1L0LG 3WU2E 1M57D 3MHVA 4OWFA 2FFDB 1PZQA 5AVXB 1JB0J 4PD4I 1KMIZ 1KILC 2FYUJ 3TF5A 1FJKA 5BVZA 4OGQD 1M7LA 3C1LA 3V5BA 3G71P 3CD6P 1S3JA 2IYPA 3FWLA 3SWKA 2BASA 2WSFJ 3BASA 4AUWA 1OVRA 3CWBE 2C9NY 1FU1A 1OW8A 1JCCA 1NHLA 2E74B 5GTIE 1JY3O 2IZ1A 1LGHB 1ZXGA 2OYOA 1AVYA 1N8RQ 2ZT9B 1P84H 4Y28J 2J5UA 1S5LX 2Q6QA 2G8YA 1VQLP 3EFFK 1SQVD 1TU3F 4PV1C 3BCCJ 1PL5A 3FWNA 1NKNA 3W68A 2FYZA 1L0NE 1M1JB 3GHGB 2H7HA 3M06A 3CCSP 4D6TE 3TGUD 1HH0A 3V2QA 1S4XA 1LJ2A 2FXPA 3B5NC 5KKZC 4N78D 1URQA 2WQYC 3VMYA 3P8MC 2QJYC 1NU1J 5CCGD 3ITKA 2AXTH 1IJDB 1P84I 1PGPA 4I7ZB 3RL0C 2WSCH 2QJPC 4H13C 3AE4C 5KJ7C 3E1IA 2P10A 3ABVC 1URQB 1SQPJ 4OH8B 3L72D 1SFCD 3NFQA 3A0BE 1EXIA 3H1LD 3H6PA 3GF3A 5B66H 1VPCA 2QVAA 3NXSA 2GUSA 2FXOA 1IK9A 3U1CA 4IL6X 1H0TA 2UWJE 1MFZA 1A02F 2KZIA 3H1IE 1PP9J 5AW4B 1OZHA 1BGYG 1NWQA 1KORA 2YIUC 2JP3A 3L73D 3HUSB 3FXEA 3D70A 1L4AA 3CWBD 1H0TB 1AQTA 3L75J 1LTIC 1K04A 3AE3C 3AEDC 1YJWP 1NTKK 4PJ0H 3EQ2A 3A5TA 2W27A 1X22A 2QRXA 2QA4P 4I6MC 3OJAB 1RE3C 3C8VA 4HJGH 1L4AB 1L0ND 1AV1A 2P58A 4UB6E 2WT7A 1LTGC 1L0LJ 1HBWA 4R4MA 4M3LA 4N3YB 1N7SB 4I2LC 3L70E 4D6TD 1NTKE 5TISH 2PP6A 3A0HE 3U59A 1YHQP 2YXQB 1H8AA 3L37A 1T2KD 3T97B 5KAFE 2P7JA 1R5LA 3KHUA 5CCHD 1BCCJ 1JCDA 2WT7B 4BWNA 1SQQD 2LXBA 3S1KA 4Y99C 1SQXD 1AJYA 2E74C 3HD7A 1EZVI 3M0DA 5AW7B 1U7JA 2WZ7A 2YO3A 1A02J 4RESB 4L73A 1SQBK 2IZ0A 3IAOA 4YXDC 3CMEP 4C46A 1EC5A 3M9QA 1VF5D 1QEXA 1LP1A 1DD4A 3O6QA 3L74E 3RK2C 3CXHE 2QSIA 5GTIH 4U3FD 5C39A 4O9BA 2HG5D 3HD7B 2PFXA 4ASWA 2IBZE 1Q86Q 2KOGA 3H1ID 2GA1A 2HLOA 1KILE 2KZJA 3EFGA 1HWTC 1LP1B 1J1DC 4I7ZC 3RK3E 1JNMA 1RQVA 1T3UA 2V7QJ 2H43A 2ZXEB 2WSEH 3E1RA 1SS1A 2XNDH 4UB8E 3D6ZA 2N1TA 4XA4A 3USSA 2NPSD 2O1JA 3CC4P 1URQC 3GLMA 3AE9C 4OGQB 4CPGA 2OGUA 1FOSE 4GOFA 3CCEP 5AVZB 3HE4A 4HH2A 2ZAEB 1LTAC 1NU1G 2N1TB 1KQLA 2XKMA 3L70D 1EDJA 4HB1A 2A45G 1ZOYC 1YYCA 1SQVK 2NRGA 1KTMA 1EDIA 2VRSA 1PFIA 3A3YB 4KHXA 3CX5E 5APWA 1NTZE 2CPBA 2C9LY 2W6JH 1Q2NA 5CJ4A 3KPEA 1BGYJ 1KYOE 1VDFA 3GW6A 1J2JB 3Q3DA 3FX0A 1JY2O 2D2CC 3NTNA 1NAYA 2MJZA 2QM7A 3WMM0 3AEEC 2HODB 5CCGA 3G9RA 3E7KA 3KYQA 1SQVE 4EIJA 2BCCD 1AVOA 5K5GB 2E75C 2P2UA 1PGJA 3PJSK 5AW5B 2E76D 4H0LD 1PP9G 3V4WA 1VQPP 2FY8A 1RE4A 5KLVG 1KC8Q 1L4AC 4N78E 3VTPC 1H89A 3CXHD 1BE3J 2PAJA 1PPJE 4RO0A 1GDTA 1YTZT 1ZR2A 1YI2P 2AEFA 3H1KE 3B71A 1IFJA 3VN0A 1M1KQ 3GF7A 2IBZD 4GDOA 4DOJA 2JEEA 1NVOA 2FYUD 4IL6E 1KILD 1EZVG 3JSVC 4YTPC 2C0XA 2FFDA 4UB6H 2B9BA 3S9OA 1N7LA 3CCQP 3Q5PA 3A7OA 1SFCB 4C7NA 2YMKA 4GT1A 1NKZB 3RK3D 3AE6C 1KB9E 2JWAA 1FE6A 1USEA 3B4SA 3A0HH 2I1JA 1LTBC 2A06E 4H44D 2L91A 1Q82Q 2G3AA 5KAFH 1GL2A 1VQ5P 3B8EB 3CCUP 5AW1B 1VQOP 1J1EB 2E5YA 1QVFO 4C7NB 2ZVNB 1OXZA 2PRRA 4TT3H 4ZKUA 3LW5H 4PV1D 2OTJP 1MZ9A 4ASVA 1BDCA 1ZMEC 3S4RA 1BCCG 2XDJA 4GODA 3HD7C 3L73E 3M0DC 2QM8A 1BSNA 2W8ZA 2IYOA 5E79E 1GL2B 2KSEA 1L0NK 1M1JA 3GHGA 4IFMA 3CX5D 3CXHH 3SWFA 3B5ND 2KP8A 1NTZD 2WMMA 1KYOD 3RBZA 3BRVB 1CI6A 2JR8A 2WPRA 1W2EA 2HYNA 1S9KE 2WITA 1UIIA 3SSUA 4BRYA 1YITP 5AW0B 3D71A 1AQ5A 2JWDA 5KJ7D 1NOHA 4EYYQ 1SP4A 2WSCJ 2FYNC 1SQQK 2M0BA 3G4SP 4OGQC 5M1BA 1SQXK 2YO2A 4IFDK 1CI6B 4LGDE 1RY3A 3CXHI 4UB8H 3L71E 1GTWA 1H88A 1ZLLA 3FGAD 1JMBA 1PPJD 4BRYB 3L35A 1JMMA 2W6AA 2ZVOB 3PHLA 1ZRTE 3KDPB 1YBKA 2N1TC 3H1KD 1LTJB 3MZWB 4NPFX 1NO4A 3OA7A 2ZYDA 1SQQE 2YNYA 3U1AA 2PGDA 1SQXE 2AEMA 1N73B 1RH5B 3VOPA 2Q3IA 2OARA 1OVVA 4KJMA 1S5LH 3I55P 2Q9IA 2M3EA 5CBOA 1KB9D 4GKGA 3H1HE 5APQA 2J58A 3CX5H 4U7JA 1KZUB 1N2DC 3HUSA 2A06D 1KYOH 1BSHA 4U3FE 1S72P 3VYIA 3AE7C 4AYCA 3H1IG 1CSBA 2B87A 2NPSA 2YKOA 3V2RA 2R5BA 2KS1B 3PTZA 3H1JG 4MN4C 2O1KA 5CCGC 1JY2N 1GK6A 3CL3D 5KLVJ 1L0LD 1FC2C 2GUVA 2Z5IA 1AFOA 2M3BA 2Z4EA 1XTGB 2Y0EA 5AVTB 2KLUA 3MGNA 1ZR4A 3VP9A 1LT9A 2B87B 2NPSB 2QE7H 1KYOI 2L5GB 1N7SA 1JO5A 1LWUA 1RE4C 3TNUB 2V4HA 1FDIA 3H1LJ 1FZCA 1JY2P 5CBNA 1S9KD 4IL6H 1BE3G 3T97A 4RKUJ 2OYIB 1NTME 1YJ9P 2BEZF 3FXDA 2JDIH 1SLQA 1LT9B 1NTKG 5APSA 2WWWA 2LR2A 1IFPA 2FFDC 4RJTA 1KB9H 2KNCA 1RF1A 4A7PA 2Y9ZA 1YIJP 1LTTC 2ZFCA 1J1EC 1KN7A 1LWUB 3CCRP 2Q1KA 3H25A 1FS0E 2W6BA 3L71D 5H2FE 3P32A 4LC1A 2KI7B 3I56P 2WPSA 1FZCB 3RK2D 4L74A 4K3AA 2O01N 4JYCA 4AQRD 1ZRTD 3RL0g 1GL2C 2KNCB 1RF1B 5GTHE 2FBWC 1VQKP 2K3RA 2BCCE 3CC7P 2BEQD 2E76B 4H0LB 1GK4A 1KB9I 2QG4A 2FYUK 1IFMA 4JPZB 4WY4D 2ZT9C 3H1HD 1IFDA 5E79H 3L74G 3CCJP 2P67A 1WRGA 1M1JC 3GHGC 2GM4A 1YQ4C 2FKWB 1OFCX 1GW4A 1G2CA 3KZIE 3MTUE 1URQD 3UIAA 1SQBG 1KILB 1K9MQ 3AE1C 2FYUE 1E79H 2WSEJ 1T2KC 1JY3N 1HF9A 1DEEG 2J59M 3MP7B 3RGUA 3IR9A 3NMDA 3RK3B 5CMZA 3TDKA 2OTLP 4N6JA 1G2CB 4H44B 1E5WA 1N73C 5AVSB 3N4XA 1Y9BA 2XU6A 1QL2A 2D2CD 1JY3P 2IX7C 1OVUA 3AE8C 2N9BA 1Q90D 5AVUB 1NTZK 4EI2A 4PV1B 1T6AA 3H32A 1FBMA 3V2PA 3BCCE 1NTMD 1VQ6P 2M5AA 2Q5UA 1NH4A 1DX7A 3GMAA 2HODA 1S5LE 3JCUE 4WVZA 2E75D 3PP5A 1GZLA 2I1KA 2V7QH 2O01J 3H1IJ 2YXRB 2KIKA 3K5BA 1FZEA 1QVGO 1NTZG 3KQGA 3B5NB 1QX8A 2HFED 3KXDA 1IC2A 3H1JJ 3MUDA 1X9VA 2K9JB 2Y0DA 4YXWH 1NU1E 3H32B 1RQUA 1QL1A 1GD2E 3HUSC 2K9YA 1GMJA 2QJPB 1KQFB 2M5AB 1SQVG 1FDMA 4WWIA 1MFTA 2H88C 1KQSO 1Q7YQ 2R3CA 2NPSC 1S2EA 2LKMA 1QGKB 2WPQA 1JM0A 1RHZB 3TGUG 1UIXA 3SFDC 1MUUA 1VQNP 1SQPE 4TLFA 4C7RA 2KYVA 1XTCC 3WUTA 2ITAA 2IDBA 3CC2P 3CMAP 1N86A 1SFCA 3H1KG 4OVNF 2O3JA 2RMZA 1LT9C 1OWAA 5APUA 3L70J 3II6A 5AW3B 1N7SC 1DD3A 1NTKJ 5B5EE 1LWUC 3BATA 5KLIB 1FOSF 1PP9E 3HTKA 1EXJA 3CLQA 1FZCC 3L72G 5KLVE 2KK7A 2XNXA 5AVRB 1LT1A 3OAKA 3H1LG 5KAIE 3VMXA 4XFJA 3M91A 3HD7D 1R5SA 1VQMP 1HVVA 3I5CA 1RF1C 5H2FH 3LW5J 2YMYA 1L0LK 3L75E 3AE5C 1K73Q 1ZV8A 4JYBA 4BXLA 2E76C 2B89A 3HTKB 1MKMA 2CPSA 1G1JA 1RF0A 1LNQA 3MIWA 3L74J 3Q5RA 5GTHH 2C0WA 1JTHA 1MV8A 3BCCD 3VMAA 3L73G 4ZKPA 1U7MA 1L0LE 3PH0A 1Y47A 3CWBG 5AVYB 2I8DA 1SQBJ 4LLHA 2CK3H 4JF7A 4KT0J 1G1IA 2OYHA 5DJUB 3RK3C 2ZJSE 2IFMA 1JTHB 1NU1D 2WSSH 3KZIH 3Q5SA 1DEBA 1BCCE 2N1TD 5BU5A 1HGVA 4DZOA 4YPCA 4JBZA 3RL0D 1HGZA 4Y99B 3VMZA 1L0NG 4H44C 1IZNB 5CCHA 1PGQA 2XV5A 1LTJA 4WB4A 1CW5A 1GU4A 4H13D 3TYYA 4D6TG 1X79B 4DJGA 2JO1A 1SQPD 4WBAA 2WSFH 1Y8AA 2OYHB 1K05A 3L71G 1VQ8P 2QIWA 1N73A 3Q1MA 1FZAA 3P8CD 4WY4A 3RK2B 2WTYA 1HJ0A 2KUBA 1SQQG 3O8ZA 4HYTB 2IBZI 1SQXG 3G3ZA 2K1AA 3MD0A 2K37A 1PP9D 2B88A 2Z5HA 1NTZJ 1IFNA 3OW2O 1QLED 2Q3EA 1EDKA 5KLVD 3H1HG 4WY4B 4R4LA 1VQ7P 3JCUH 1J1DB 2KS1A 3AE2C 3LIEA 1NGMB 3M9BA 2E5TA 1VF5B 1PIXA 3QH9A 4EDFA 1SQVJ 4U3FG 3G6EP 5CJ0A 3L75D 5AW2B 2SPZA 3Q2YA 1EZVD 3AEFC 2KLVA 4B86A 2XZRA 3MUDC 3C9IA 4W7YA 3TGUJ 5APYA 1M56D 2KSJA 2A45H 3L4FA 3TNUA 3CPWO 3H1KJ 1X8YA 2OYIA 2YKQA 5KLIC 1NTMK 3JC22 3CX5I 3H1JE 4W7ZA 3IFMA 3VP8A 3HRNA 4GOEA 1BGYE 1M8OB 1SFCC 2D2CB 2R32A 3L72J 2R5DA 1Z56A 5B5EH 1BCCD 1NYHA 2A45I 2NZ2A 2ZYAA 1NTMG 2HPCA 4K35A 1GL2D 1PGOA 1HUCA 5AVWB 3BVHA 2E75B 3L70G 2OTKE 2ZYGA 2E74D 4DCKA 2QJKB 2OQQA 5KAIH 2M8RA 4IFFA 2RH0A 1GU5A 2Y9YA 4PD4E 4XE5B 2ZT9D 2FXMA 1YJNP 4ZNCA 3F89A 1IO4A 1ZW0A 3CCLP 3R2PA 1BDDA 1BE3E 3QWOC 2HPCB 3WUVA 1VQ4P 3L73J 4DT0A 2RN0A 1Q81Q 3CWBJ 2POHA 4W80A 2ZXXA 2BCCG 1KFMA 1OIPA 3WU2H 1W2BO 4ZMDA 1GW3A 1RF0C 1KQGB 5TJHA 1FZFA 2RKLA 2KB7P 3IN6A 1KILA 5CHXA 5APVA 1L2PA 2E42A 2K88A 4NPEA 1KD1Q 2QEXP 1VL2A 3PLNA 1HTLC 1L0NJ 3P7KA 4IOIH 1SVFA 3F5HA 3BRTB 2IBZG 2JJLA 1M90Q 3ZDMA 2FYUG 3V2NA 4D6TJ 2OYHC 3M0AA 2R44A 2KXPB 1T3JA 3AEAC 3L71J 3CI9A 1FZBA 1OX3A 1FJPA 1AA0A 2AXCA 4Z1MH 5CCHC 1S1CX 1LTJC 1P84E 1SQQJ 4NPDA 3W67A 4GIFA 1SQBE 3A2AA 1SQXJ 5EFWB 4QMAA 3H1JD 2HR3A 3AEBC 3O6QB 3CCMP 1JUNA 4WY4C 1BGYD 1U57A 3B5NA 1OW7A 3H1HJ 1VF5C 1EDLA 2JKVA 5AVQB 3V4QA 3BCCG 3GG2A 1OMIA 1T8ZA 3HE5A 2K9JA 3N7NA 1X0TA 1LTSC 1K8AQ 1JEKA 1NU1K 4U3FJ 1YQ3C 3EWKA 1WT6A 1FZGA 2FYNB 4I1LA 2AXTE 1DH3A 2W83C 2E43A 4HKZH 1OW6A 4PD4D 5KJ7A
chains in the Genus database with same CATH topology
4KJMA 4WWIA 3FXDA 1DEEG 1MFTA 1SS1A 4GOEA 1H0TA 3RGUA 5CBOA 4IOIH 2UWJE 2LR2A 3ZDMA 1JM0A 2KZIA 2B88A 4K35A 2LXBA 2WMMA 4CPGA 1U7MA 2Q1KA 2R44A 4GOFA 3S1KA 2LXCB 3PH0A 1Y47A 5DJTB 1EDKA 2KI7B 2ZAEB 1NVOA 1U7JA 2I8DA 2OTKE 4K3AA 2B87A 3FXEA 2KS1B 3MHVA 1H0TB 5DJUB 4NPDA 4ZNCA 1EDJA 4MN4C 4HB1A 1EC5A 2JWDA 2SPZA 4EYYQ 1OVUA 1LP1A 1ZW0A 5EFWB 2M0BA 1EDIA 1BDDA 2K3RA 1FC2C 3QWOC 2HR3A 4JBZA 5C39A 2M5AA 1Q2NA 2QRXA 4ASWA 1S3JA 2B87B 1JMBA 1EDLA 1LT1A 2KIKA 4HJGH 4ZMDA 2P58A 2KZJA 1X0TA 3MZWB 2RKLA 4NPFX 1OVRA 1LP1B 5K5GB 4NPEA 2KUBA 4BXLA 5CBNA 2B89A 2QVAA 4ASVA 1BDCA 4HKZH 2M5AB 4GODA 1ZXGA 1OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJM A;  4WWI A;  3FXD A;  1DEE G;  1MFT A;  1SS1 A;  4GOE A;  1H0T A;  3RGU A;  5CBO A;  4IOI H;  2UWJ E;  2LR2 A;  3ZDM A;  1JM0 A;  2KZI A;  2B88 A;  4K35 A;  2LXB A;  2WMM A;  4CPG A;  1U7M A;  2Q1K A;  2R44 A;  4GOF A;  3S1K A;  2LXC B;  3PH0 A;  1Y47 A;  5DJT B;  1EDK A;  2KI7 B;  2ZAE B;  1NVO A;  1U7J A;  2I8D A;  2OTK E;  4K3A A;  2B87 A;  3FXE A;  2KS1 B;  3MHV A;  1H0T B;  5DJU B;  4NPD A;  4ZNC A;  1EDJ A;  4MN4 C;  4HB1 A;  1EC5 A;  2JWD A;  2SPZ A;  4EYY Q;  1OVU A;  1LP1 A;  1ZW0 A;  5EFW B;  2M0B A;  1EDI A;  1BDD A;  2K3R A;  1FC2 C;  3QWO C;  2HR3 A;  4JBZ A;  5C39 A;  2M5A A;  1Q2N A;  2QRX A;  4ASW A;  1S3J A;  2B87 B;  1JMB A;  1EDL A;  1LT1 A;  2KIK A;  4HJG H;  4ZMD A;  2P58 A;  2KZJ A;  1X0T A;  3MZW B;  2RKL A;  4NPF X;  1OVR A;  1LP1 B;  5K5G B;  4NPE A;  2KUB A;  4BXL A;  5CBN A;  2B89 A;  2QVA A;  4ASV A;  1BDC A;  4HKZ H;  2M5A B;  4GOD A;  1ZXG A;  1OVV A; 
#chains in the Genus database with same CATH topology
 1IK7 A;  3D6Y A;  5KKZ B;  3R4Y A;  1NAF A;  1BE3 D;  2QJY B;  1L4A D;  1SQP K;  3HE5 B;  2W90 A;  2IPP A;  3RL0 B;  3A0B H;  1JOC A;  2H89 C;  1IFI A;  1NTK D;  2H8P D;  5DJT B;  1N7S D;  2WPV B;  5B66 E;  5APT A;  4H13 B;  3HE4 B;  5APX A;  3AEG C;  3M9H A;  1SQP G;  2IFN A;  5AW8 B;  3SWY A;  2WVR A;  4L76 A;  1ZP0 C;  1VQ9 P;  2O01 H;  1WMK A;  1HJB A;  3TK1 A;  5AW9 B;  1USD A;  2AEJ A;  3TSI A;  1PPJ G;  2Y0C A;  3P8C E;  1NTM J;  5KLV K;  3L36 A;  3V6I A;  1D7M A;  2OYI C;  5L8R J;  1KV4 A;  2QJK C;  3AEC C;  1PV3 A;  2MKV A;  3TGU E;  1ZN5 A;  2N9Y B;  3SFE C;  3IF4 A;  1YTZ I;  3L74 D;  3PRJ A;  2YKP A;  1CZQ A;  1EQ7 A;  4EOT A;  2YIU B;  3LID A;  1R8E A;  4PJ0 E;  4JQ0 D;  5KTB A;  5AVV B;  5BU8 B;  1RE3 A;  1P84 D;  1W5C E;  4PD4 H;  1KFN A;  2DW3 A;  3L75 G;  1DIP A;  1SQB D;  2A06 G;  2P1J A;  2Q7C A;  2R3S A;  2BCC J;  3CCV P;  1EZV E;  5AW6 B;  4H0L C;  2LXC B;  3L72 E;  1NJI Q;  3RBX A;  3WUU A;  1FAV A;  4L75 A;  1FDO A;  3H1L E;  5TIS E;  1L0L G;  3WU2 E;  1M57 D;  3MHV A;  4OWF A;  2FFD B;  1PZQ A;  5AVX B;  1JB0 J;  4PD4 I;  1KMI Z;  1KIL C;  2FYU J;  3TF5 A;  1FJK A;  5BVZ A;  4OGQ D;  1M7L A;  3C1L A;  3V5B A;  3G71 P;  3CD6 P;  1S3J A;  2IYP A;  3FWL A;  3SWK A;  2BAS A;  2WSF J;  3BAS A;  4AUW A;  1OVR A;  3CWB E;  2C9N Y;  1FU1 A;  1OW8 A;  1JCC A;  1NHL A;  2E74 B;  5GTI E;  1JY3 O;  2IZ1 A;  1LGH B;  1ZXG A;  2OYO A;  1AVY A;  1N8R Q;  2ZT9 B;  1P84 H;  4Y28 J;  2J5U A;  1S5L X;  2Q6Q A;  2G8Y A;  1VQL P;  3EFF K;  1SQV D;  1TU3 F;  4PV1 C;  3BCC J;  1PL5 A;  3FWN A;  1NKN A;  3W68 A;  2FYZ A;  1L0N E;  1M1J B;  3GHG B;  2H7H A;  3M06 A;  3CCS P;  4D6T E;  3TGU D;  1HH0 A;  3V2Q A;  1S4X A;  1LJ2 A;  2FXP A;  3B5N C;  5KKZ C;  4N78 D;  1URQ A;  2WQY C;  3VMY A;  3P8M C;  2QJY C;  1NU1 J;  5CCG D;  3ITK A;  2AXT H;  1IJD B;  1P84 I;  1PGP A;  4I7Z B;  3RL0 C;  2WSC H;  2QJP C;  4H13 C;  3AE4 C;  5KJ7 C;  3E1I A;  2P10 A;  3ABV C;  1URQ B;  1SQP J;  4OH8 B;  3L72 D;  1SFC D;  3NFQ A;  3A0B E;  1EXI A;  3H1L D;  3H6P A;  3GF3 A;  5B66 H;  1VPC A;  2QVA A;  3NXS A;  2GUS A;  2FXO A;  1IK9 A;  3U1C A;  4IL6 X;  1H0T A;  2UWJ E;  1MFZ A;  1A02 F;  2KZI A;  3H1I E;  1PP9 J;  5AW4 B;  1OZH A;  1BGY G;  1NWQ A;  1KOR A;  2YIU C;  2JP3 A;  3L73 D;  3HUS B;  3FXE A;  3D70 A;  1L4A A;  3CWB D;  1H0T B;  1AQT A;  3L75 J;  1LTI C;  1K04 A;  3AE3 C;  3AED C;  1YJW P;  1NTK K;  4PJ0 H;  3EQ2 A;  3A5T A;  2W27 A;  1X22 A;  2QRX A;  2QA4 P;  4I6M C;  3OJA B;  1RE3 C;  3C8V A;  4HJG H;  1L4A B;  1L0N D;  1AV1 A;  2P58 A;  4UB6 E;  2WT7 A;  1LTG C;  1L0L J;  1HBW A;  4R4M A;  4M3L A;  4N3Y B;  1N7S B;  4I2L C;  3L70 E;  4D6T D;  1NTK E;  5TIS H;  2PP6 A;  3A0H E;  3U59 A;  1YHQ P;  2YXQ B;  1H8A A;  3L37 A;  1T2K D;  3T97 B;  5KAF E;  2P7J A;  1R5L A;  3KHU A;  5CCH D;  1BCC J;  1JCD A;  2WT7 B;  4BWN A;  1SQQ D;  2LXB A;  3S1K A;  4Y99 C;  1SQX D;  1AJY A;  2E74 C;  3HD7 A;  1EZV I;  3M0D A;  5AW7 B;  1U7J A;  2WZ7 A;  2YO3 A;  1A02 J;  4RES B;  4L73 A;  1SQB K;  2IZ0 A;  3IAO A;  4YXD C;  3CME P;  4C46 A;  1EC5 A;  3M9Q A;  1VF5 D;  1QEX A;  1LP1 A;  1DD4 A;  3O6Q A;  3L74 E;  3RK2 C;  3CXH E;  2QSI A;  5GTI H;  4U3F D;  5C39 A;  4O9B A;  2HG5 D;  3HD7 B;  2PFX A;  4ASW A;  2IBZ E;  1Q86 Q;  2KOG A;  3H1I D;  2GA1 A;  2HLO A;  1KIL E;  2KZJ A;  3EFG A;  1HWT C;  1LP1 B;  1J1D C;  4I7Z C;  3RK3 E;  1JNM A;  1RQV A;  1T3U A;  2V7Q J;  2H43 A;  2ZXE B;  2WSE H;  3E1R A;  1SS1 A;  2XND H;  4UB8 E;  3D6Z A;  2N1T A;  4XA4 A;  3USS A;  2NPS D;  2O1J A;  3CC4 P;  1URQ C;  3GLM A;  3AE9 C;  4OGQ B;  4CPG A;  2OGU A;  1FOS E;  4GOF A;  3CCE P;  5AVZ B;  3HE4 A;  4HH2 A;  2ZAE B;  1LTA C;  1NU1 G;  2N1T B;  1KQL A;  2XKM A;  3L70 D;  1EDJ A;  4HB1 A;  2A45 G;  1ZOY C;  1YYC A;  1SQV K;  2NRG A;  1KTM A;  1EDI A;  2VRS A;  1PFI A;  3A3Y B;  4KHX A;  3CX5 E;  5APW A;  1NTZ E;  2CPB A;  2C9L Y;  2W6J H;  1Q2N A;  5CJ4 A;  3KPE A;  1BGY J;  1KYO E;  1VDF A;  3GW6 A;  1J2J B;  3Q3D A;  3FX0 A;  1JY2 O;  2D2C C;  3NTN A;  1NAY A;  2MJZ A;  2QM7 A;  3WMM 0;  3AEE C;  2HOD B;  5CCG A;  3G9R A;  3E7K A;  3KYQ A;  1SQV E;  4EIJ A;  2BCC D;  1AVO A;  5K5G B;  2E75 C;  2P2U A;  1PGJ A;  3PJS K;  5AW5 B;  2E76 D;  4H0L D;  1PP9 G;  3V4W A;  1VQP P;  2FY8 A;  1RE4 A;  5KLV G;  1KC8 Q;  1L4A C;  4N78 E;  3VTP C;  1H89 A;  3CXH D;  1BE3 J;  2PAJ A;  1PPJ E;  4RO0 A;  1GDT A;  1YTZ T;  1ZR2 A;  1YI2 P;  2AEF A;  3H1K E;  3B71 A;  1IFJ A;  3VN0 A;  1M1K Q;  3GF7 A;  2IBZ D;  4GDO A;  4DOJ A;  2JEE A;  1NVO A;  2FYU D;  4IL6 E;  1KIL D;  1EZV G;  3JSV C;  4YTP C;  2C0X A;  2FFD A;  4UB6 H;  2B9B A;  3S9O A;  1N7L A;  3CCQ P;  3Q5P A;  3A7O A;  1SFC B;  4C7N A;  2YMK A;  4GT1 A;  1NKZ B;  3RK3 D;  3AE6 C;  1KB9 E;  2JWA A;  1FE6 A;  1USE A;  3B4S A;  3A0H H;  2I1J A;  1LTB C;  2A06 E;  4H44 D;  2L91 A;  1Q82 Q;  2G3A A;  5KAF H;  1GL2 A;  1VQ5 P;  3B8E B;  3CCU P;  5AW1 B;  1VQO P;  1J1E B;  2E5Y A;  1QVF O;  4C7N B;  2ZVN B;  1OXZ A;  2PRR A;  4TT3 H;  4ZKU A;  3LW5 H;  4PV1 D;  2OTJ P;  1MZ9 A;  4ASV A;  1BDC A;  1ZME C;  3S4R A;  1BCC G;  2XDJ A;  4GOD A;  3HD7 C;  3L73 E;  3M0D C;  2QM8 A;  1BSN A;  2W8Z A;  2IYO A;  5E79 E;  1GL2 B;  2KSE A;  1L0N K;  1M1J A;  3GHG A;  4IFM A;  3CX5 D;  3CXH H;  3SWF A;  3B5N D;  2KP8 A;  1NTZ D;  2WMM A;  1KYO D;  3RBZ A;  3BRV B;  1CI6 A;  2JR8 A;  2WPR A;  1W2E A;  2HYN A;  1S9K E;  2WIT A;  1UII A;  3SSU A;  4BRY A;  1YIT P;  5AW0 B;  3D71 A;  1AQ5 A;  2JWD A;  5KJ7 D;  1NOH A;  4EYY Q;  1SP4 A;  2WSC J;  2FYN C;  1SQQ K;  2M0B A;  3G4S P;  4OGQ C;  5M1B A;  1SQX K;  2YO2 A;  4IFD K;  1CI6 B;  4LGD E;  1RY3 A;  3CXH I;  4UB8 H;  3L71 E;  1GTW A;  1H88 A;  1ZLL A;  3FGA D;  1JMB A;  1PPJ D;  4BRY B;  3L35 A;  1JMM A;  2W6A A;  2ZVO B;  3PHL A;  1ZRT E;  3KDP B;  1YBK A;  2N1T C;  3H1K D;  1LTJ B;  3MZW B;  4NPF X;  1NO4 A;  3OA7 A;  2ZYD A;  1SQQ E;  2YNY A;  3U1A A;  2PGD A;  1SQX E;  2AEM A;  1N73 B;  1RH5 B;  3VOP A;  2Q3I A;  2OAR A;  1OVV A;  4KJM A;  1S5L H;  3I55 P;  2Q9I A;  2M3E A;  5CBO A;  1KB9 D;  4GKG A;  3H1H E;  5APQ A;  2J58 A;  3CX5 H;  4U7J A;  1KZU B;  1N2D C;  3HUS A;  2A06 D;  1KYO H;  1BSH A;  4U3F E;  1S72 P;  3VYI A;  3AE7 C;  4AYC A;  3H1I G;  1CSB A;  2B87 A;  2NPS A;  2YKO A;  3V2R A;  2R5B A;  2KS1 B;  3PTZ A;  3H1J G;  4MN4 C;  2O1K A;  5CCG C;  1JY2 N;  1GK6 A;  3CL3 D;  5KLV J;  1L0L D;  1FC2 C;  2GUV A;  2Z5I A;  1AFO A;  2M3B A;  2Z4E A;  1XTG B;  2Y0E A;  5AVT B;  2KLU A;  3MGN A;  1ZR4 A;  3VP9 A;  1LT9 A;  2B87 B;  2NPS B;  2QE7 H;  1KYO I;  2L5G B;  1N7S A;  1JO5 A;  1LWU A;  1RE4 C;  3TNU B;  2V4H A;  1FDI A;  3H1L J;  1FZC A;  1JY2 P;  5CBN A;  1S9K D;  4IL6 H;  1BE3 G;  3T97 A;  4RKU J;  2OYI B;  1NTM E;  1YJ9 P;  2BEZ F;  3FXD A;  2JDI H;  1SLQ A;  1LT9 B;  1NTK G;  5APS A;  2WWW A;  2LR2 A;  1IFP A;  2FFD C;  4RJT A;  1KB9 H;  2KNC A;  1RF1 A;  4A7P A;  2Y9Z A;  1YIJ P;  1LTT C;  2ZFC A;  1J1E C;  1KN7 A;  1LWU B;  3CCR P;  2Q1K A;  3H25 A;  1FS0 E;  2W6B A;  3L71 D;  5H2F E;  3P32 A;  4LC1 A;  2KI7 B;  3I56 P;  2WPS A;  1FZC B;  3RK2 D;  4L74 A;  4K3A A;  2O01 N;  4JYC A;  4AQR D;  1ZRT D;  3RL0 g;  1GL2 C;  2KNC B;  1RF1 B;  5GTH E;  2FBW C;  1VQK P;  2K3R A;  2BCC E;  3CC7 P;  2BEQ D;  2E76 B;  4H0L B;  1GK4 A;  1KB9 I;  2QG4 A;  2FYU K;  1IFM A;  4JPZ B;  4WY4 D;  2ZT9 C;  3H1H D;  1IFD A;  5E79 H;  3L74 G;  3CCJ P;  2P67 A;  1WRG A;  1M1J C;  3GHG C;  2GM4 A;  1YQ4 C;  2FKW B;  1OFC X;  1GW4 A;  1G2C A;  3KZI E;  3MTU E;  1URQ D;  3UIA A;  1SQB G;  1KIL B;  1K9M Q;  3AE1 C;  2FYU E;  1E79 H;  2WSE J;  1T2K C;  1JY3 N;  1HF9 A;  1DEE G;  2J59 M;  3MP7 B;  3RGU A;  3IR9 A;  3NMD A;  3RK3 B;  5CMZ A;  3TDK A;  2OTL P;  4N6J A;  1G2C B;  4H44 B;  1E5W A;  1N73 C;  5AVS B;  3N4X A;  1Y9B A;  2XU6 A;  1QL2 A;  2D2C D;  1JY3 P;  2IX7 C;  1OVU A;  3AE8 C;  2N9B A;  1Q90 D;  5AVU B;  1NTZ K;  4EI2 A;  4PV1 B;  1T6A A;  3H32 A;  1FBM A;  3V2P A;  3BCC E;  1NTM D;  1VQ6 P;  2M5A A;  2Q5U A;  1NH4 A;  1DX7 A;  3GMA A;  2HOD A;  1S5L E;  3JCU E;  4WVZ A;  2E75 D;  3PP5 A;  1GZL A;  2I1K A;  2V7Q H;  2O01 J;  3H1I J;  2YXR B;  2KIK A;  3K5B A;  1FZE A;  1QVG O;  1NTZ G;  3KQG A;  3B5N B;  1QX8 A;  2HFE D;  3KXD A;  1IC2 A;  3H1J J;  3MUD A;  1X9V A;  2K9J B;  2Y0D A;  4YXW H;  1NU1 E;  3H32 B;  1RQU A;  1QL1 A;  1GD2 E;  3HUS C;  2K9Y A;  1GMJ A;  2QJP B;  1KQF B;  2M5A B;  1SQV G;  1FDM A;  4WWI A;  1MFT A;  2H88 C;  1KQS O;  1Q7Y Q;  2R3C A;  2NPS C;  1S2E A;  2LKM A;  1QGK B;  2WPQ A;  1JM0 A;  1RHZ B;  3TGU G;  1UIX A;  3SFD C;  1MUU A;  1VQN P;  1SQP E;  4TLF A;  4C7R A;  2KYV A;  1XTC C;  3WUT A;  2ITA A;  2IDB A;  3CC2 P;  3CMA P;  1N86 A;  1SFC A;  3H1K G;  4OVN F;  2O3J A;  2RMZ A;  1LT9 C;  1OWA A;  5APU A;  3L70 J;  3II6 A;  5AW3 B;  1N7S C;  1DD3 A;  1NTK J;  5B5E E;  1LWU C;  3BAT A;  5KLI B;  1FOS F;  1PP9 E;  3HTK A;  1EXJ A;  3CLQ A;  1FZC C;  3L72 G;  5KLV E;  2KK7 A;  2XNX A;  5AVR B;  1LT1 A;  3OAK A;  3H1L G;  5KAI E;  3VMX A;  4XFJ A;  3M91 A;  3HD7 D;  1R5S A;  1VQM P;  1HVV A;  3I5C A;  1RF1 C;  5H2F H;  3LW5 J;  2YMY A;  1L0L K;  3L75 E;  3AE5 C;  1K73 Q;  1ZV8 A;  4JYB A;  4BXL A;  2E76 C;  2B89 A;  3HTK B;  1MKM A;  2CPS A;  1G1J A;  1RF0 A;  1LNQ A;  3MIW A;  3L74 J;  3Q5R A;  5GTH H;  2C0W A;  1JTH A;  1MV8 A;  3BCC D;  3VMA A;  3L73 G;  4ZKP A;  1U7M A;  1L0L E;  3PH0 A;  1Y47 A;  3CWB G;  5AVY B;  2I8D A;  1SQB J;  4LLH A;  2CK3 H;  4JF7 A;  4KT0 J;  1G1I A;  2OYH A;  5DJU B;  3RK3 C;  2ZJS E;  2IFM A;  1JTH B;  1NU1 D;  2WSS H;  3KZI H;  3Q5S A;  1DEB A;  1BCC E;  2N1T D;  5BU5 A;  1HGV A;  4DZO A;  4YPC A;  4JBZ A;  3RL0 D;  1HGZ A;  4Y99 B;  3VMZ A;  1L0N G;  4H44 C;  1IZN B;  5CCH A;  1PGQ A;  2XV5 A;  1LTJ A;  4WB4 A;  1CW5 A;  1GU4 A;  4H13 D;  3TYY A;  4D6T G;  1X79 B;  4DJG A;  2JO1 A;  1SQP D;  4WBA A;  2WSF H;  1Y8A A;  2OYH B;  1K05 A;  3L71 G;  1VQ8 P;  2QIW A;  1N73 A;  3Q1M A;  1FZA A;  3P8C D;  4WY4 A;  3RK2 B;  2WTY A;  1HJ0 A;  2KUB A;  1SQQ G;  3O8Z A;  4HYT B;  2IBZ I;  1SQX G;  3G3Z A;  2K1A A;  3MD0 A;  2K37 A;  1PP9 D;  2B88 A;  2Z5H A;  1NTZ J;  1IFN A;  3OW2 O;  1QLE D;  2Q3E A;  1EDK A;  5KLV D;  3H1H G;  4WY4 B;  4R4L A;  1VQ7 P;  3JCU H;  1J1D B;  2KS1 A;  3AE2 C;  3LIE A;  1NGM B;  3M9B A;  2E5T A;  1VF5 B;  1PIX A;  3QH9 A;  4EDF A;  1SQV J;  4U3F G;  3G6E P;  5CJ0 A;  3L75 D;  5AW2 B;  2SPZ A;  3Q2Y A;  1EZV D;  3AEF C;  2KLV A;  4B86 A;  2XZR A;  3MUD C;  3C9I A;  4W7Y A;  3TGU J;  5APY A;  1M56 D;  2KSJ A;  2A45 H;  3L4F A;  3TNU A;  3CPW O;  3H1K J;  1X8Y A;  2OYI A;  2YKQ A;  5KLI C;  1NTM K;  3JC2 2;  3CX5 I;  3H1J E;  4W7Z A;  3IFM A;  3VP8 A;  3HRN A;  4GOE A;  1BGY E;  1M8O B;  1SFC C;  2D2C B;  2R32 A;  3L72 J;  2R5D A;  1Z56 A;  5B5E H;  1BCC D;  1NYH A;  2A45 I;  2NZ2 A;  2ZYA A;  1NTM G;  2HPC A;  4K35 A;  1GL2 D;  1PGO A;  1HUC A;  5AVW B;  3BVH A;  2E75 B;  3L70 G;  2OTK E;  2ZYG A;  2E74 D;  4DCK A;  2QJK B;  2OQQ A;  5KAI H;  2M8R A;  4IFF A;  2RH0 A;  1GU5 A;  2Y9Y A;  4PD4 E;  4XE5 B;  2ZT9 D;  2FXM A;  1YJN P;  4ZNC A;  3F89 A;  1IO4 A;  1ZW0 A;  3CCL P;  3R2P A;  1BDD A;  1BE3 E;  3QWO C;  2HPC B;  3WUV A;  1VQ4 P;  3L73 J;  4DT0 A;  2RN0 A;  1Q81 Q;  3CWB J;  2POH A;  4W80 A;  2ZXX A;  2BCC G;  1KFM A;  1OIP A;  3WU2 H;  1W2B O;  4ZMD A;  1GW3 A;  1RF0 C;  1KQG B;  5TJH A;  1FZF A;  2RKL A;  2KB7 P;  3IN6 A;  1KIL A;  5CHX A;  5APV A;  1L2P A;  2E42 A;  2K88 A;  4NPE A;  1KD1 Q;  2QEX P;  1VL2 A;  3PLN A;  1HTL C;  1L0N J;  3P7K A;  4IOI H;  1SVF A;  3F5H A;  3BRT B;  2IBZ G;  2JJL A;  1M90 Q;  3ZDM A;  2FYU G;  3V2N A;  4D6T J;  2OYH C;  3M0A A;  2R44 A;  2KXP B;  1T3J A;  3AEA C;  3L71 J;  3CI9 A;  1FZB A;  1OX3 A;  1FJP A;  1AA0 A;  2AXC A;  4Z1M H;  5CCH C;  1S1C X;  1LTJ C;  1P84 E;  1SQQ J;  4NPD A;  3W67 A;  4GIF A;  1SQB E;  3A2A A;  1SQX J;  5EFW B;  4QMA A;  3H1J D;  2HR3 A;  3AEB C;  3O6Q B;  3CCM P;  1JUN A;  4WY4 C;  1BGY D;  1U57 A;  3B5N A;  1OW7 A;  3H1H J;  1VF5 C;  1EDL A;  2JKV A;  5AVQ B;  3V4Q A;  3BCC G;  3GG2 A;  1OMI A;  1T8Z A;  3HE5 A;  2K9J A;  3N7N A;  1X0T A;  1LTS C;  1K8A Q;  1JEK A;  1NU1 K;  4U3F J;  1YQ3 C;  3EWK A;  1WT6 A;  1FZG A;  2FYN B;  4I1L A;  2AXT E;  1DH3 A;  2W83 C;  2E43 A;  4HKZ H;  1OW6 A;  4PD4 D;  5KJ7 A; 
#chains in the Genus database with same CATH homology
 4KJM A;  4WWI A;  3FXD A;  1DEE G;  1MFT A;  1SS1 A;  4GOE A;  1H0T A;  3RGU A;  5CBO A;  4IOI H;  2UWJ E;  2LR2 A;  3ZDM A;  1JM0 A;  2KZI A;  2B88 A;  4K35 A;  2LXB A;  2WMM A;  4CPG A;  1U7M A;  2Q1K A;  2R44 A;  4GOF A;  3S1K A;  2LXC B;  3PH0 A;  1Y47 A;  5DJT B;  1EDK A;  2KI7 B;  2ZAE B;  1NVO A;  1U7J A;  2I8D A;  2OTK E;  4K3A A;  2B87 A;  3FXE A;  2KS1 B;  3MHV A;  1H0T B;  5DJU B;  4NPD A;  4ZNC A;  1EDJ A;  4MN4 C;  4HB1 A;  1EC5 A;  2JWD A;  2SPZ A;  4EYY Q;  1OVU A;  1LP1 A;  1ZW0 A;  5EFW B;  2M0B A;  1EDI A;  1BDD A;  2K3R A;  1FC2 C;  3QWO C;  2HR3 A;  4JBZ A;  5C39 A;  2M5A A;  1Q2N A;  2QRX A;  4ASW A;  1S3J A;  2B87 B;  1JMB A;  1EDL A;  1LT1 A;  2KIK A;  4HJG H;  4ZMD A;  2P58 A;  2KZJ A;  1X0T A;  3MZW B;  2RKL A;  4NPF X;  1OVR A;  1LP1 B;  5K5G B;  4NPE A;  2KUB A;  4BXL A;  5CBN A;  2B89 A;  2QVA A;  4ASV A;  1BDC A;  4HKZ H;  2M5A B;  4GOD A;  1ZXG A;  1OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...