2WSEH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wseH01
1L0LK 1NTZK 1SQPK 1NTMK 2J59M 2OARA 2LKMA 3G3ZA 2WSCH 1NTKK 3M9QA 2O01H 1SQQK 1SQXK 1SQBK 2WSEH 3LW5H 2FYUK 1L0NK 1SQVK 3CLQA 4IFDK 5KLVK 2WSFH 1NU1K
chains in the Genus database with same CATH superfamily
2IFNA 4PD4D 1FJPA 1BCCG 1LTJA 2XNDH 2YIUC 2QJPC 2HODB 2ZVNB 1N2DC 3H1KG 3H1ID 4GIFA 2N1TB 2QJYC 4U3FG 3VOPA 2QM7A 3VTPC 3A5TA 4H0LB 1T2KC 1KC8Q 3Q5RA 3H32B 3M9QA 5AVSB 1WMKA 3AE7C 3BRTB 5AVYB 1FZCC 1VF5C 1ZRTE 3SWYA 1VQOP 2E43A 1EQ7A 1GK6A 1L4AC 1QGKB 1NTZJ 1FE6A 2K88A 1NTMJ 2YKOA 2ZT9D 3A0BE 1KMIZ 3MUDA 1SP4A 2CK3H 3NTNA 4CPGA 4RJTA 3CCJP 2E75D 1FC2C 1N7SA 2J5UA 2R44A 2E42A 1D7MA 5KKZC 3CI9A 3MHVA 4DOJA 3KPEA 3GLMA 1FZBA 2M0BA 1KZUB 1FS0E 1Q7YQ 1A02J 1BGYD 4I7ZB 1Q81Q 2BEZF 2PP6A 3B71A 3KYQA 1SQBJ 2WSCJ 4H44D 2CPSA 4IFMA 1SFCA 1X0TA 3A7OA 3AEDC 1OX3A 1ZP0C 2WPSA 3IFMA 1SFCD 1M57D 4PV1D 4WY4C 1LT9B 1SQVJ 1SQXJ 3AE9C 3WUUA 2XZRA 1YBKA 3L71E 1BE3G 3GG2A 3R4YA 1KYOI 1LP1B 3AE5C 3F89A 1GMJA 3TGUE 3CMEP 1AA0A 2QSIA 2FFDB 1SQBG 2Q5UA 1S5LE 2BCCJ 5KLVJ 1L0NG 3N7NA 1YJ9P 2QJPB 1KILD 1OW7A 1VPCA 2E76B 3H1KE 3P7KA 2FYNC 2O01N 5B66E 2FYUK 2KS1B 2NPSA 3RL0C 1Q2NA 2GM4A 5KLIB 2P10A 4W7ZA 3B4SA 4N78D 1LJ2A 1VQNP 4ASWA 1YJNP 1HGZA 3MTUE 4WY4A 2W27A 1H89A 1L0NE 1U7MA 1JMBA 1OFCX 2D2CC 2E74B 2GA1A 2IPPA 2G3AA 2IBZG 2JWAA 3UIAA 3V6IA 3CWBD 3L72G 5AVTB 1NTKG 2PRRA 2WMMA 1AJYA 2HG5D 5AVWB 5KTBA 1BDDA 4OH8B 4U3FJ 2Q9IA 4OGQB 1NYHA 3HE5B 2O01J 3M9BA 1HUCA 1X79B 3PP5A 4JYBA 4Y99B 5APQA 3B5NB 3FGAD 3RK2C 2HPCB 1BSNA 2KI7B 1DX7A 1KILE 3A0HE 3L73E 2Y0DA 5CCHD 2IX7C 3CCRP 1EDKA 3TGUG 1KB9D 4ZMDA 3CMAP 1PP9G 2W83C 3L74J 3U59A 3E1IA 4I2LC 3EFFK 1GTWA 2Y9YA 4OWFA 2WPQA 4RESB 2IBZI 1ZV8A 1DIPA 1DH3A 1ZMEC 1W5CE 2M3BA 3H1LD 3L75J 3PH0A 2YXRB 3RBZA 3NXSA 1VQ9P 5BU5A 1NU1D 2FBWC 2WT7B 3H25A 5KLVK 2WITA 4UB6H 1GW3A 1HTLC 1PZQA 3CX5I 2Q7CA 2E75B 1RQUA 1NTMG 1LNQA 1QL2A 1JCDA 2PAJA 2MKVA 3L73D 1SS1A 2HFED 2XNXA 3QH9A 1NTKE 4HKZH 3TYYA 5KLVE 5DJUB 4H13C 5H2FH 2JJLA 5BVZA 2POHA 1JY3O 4PJ0E 4UB8H 4ZNCA 4Z1MH 3H1KJ 2M3EA 2KNCB 3HUSC 3P8MC 2FYUG 1SFCB 1YTZT 5CBNA 3U1CA 1VQPP 1K9MQ 2Z5IA 4L74A 3SFDC 4WWIA 5CCHC 3CX5E 1PP9J 1YTZI 1GDTA 1VQ7P 1CW5A 3TGUJ 2KYVA 3C8VA 1FOSE 3S1KA 1T3UA 5B5EE 3L73G 1SQPJ 4HYTB 5CCGC 3WMM0 3H1JD 1KYOD 2WQYC 1GW4A 3BCCE 3C9IA 1KILB 1Y8AA 2ZXXA 1PGQA 2E5YA 1MFTA 2Z5HA 1NKNA 3AE1C 3L4FA 1EZVD 2I1JA 2NRGA 1PPJE 3SWKA 1KQSO 3CC7P 2A06G 2FYNB 2BEQD 2ZAEB 1VQKP 1G1IA 1N7LA 1VQ4P 2C9LY 2QEXP 1SQPK 2K37A 1EC5A 1G2CA 3HE5A 3KXDA 5GTHE 2N9BA 2C9NY 2AXTH 3IAOA 3HD7B 2HYNA 5CBOA 2AXTE 4HJGH 1PGJA 4YTPC 1BSHA 3A0HH 1PPJG 4C7NB 1XTGB 1YIJP 5CCHA 2P7JA 1AQ5A 2KLVA 3V2PA 1SQPE 2O01H 1LT9C 4YXWH 3PLNA 4WY4B 5KLVG 1SQBK 3L70G 4GT1A 1L0LD 2H7HA 3O6QB 1L0NK 1WT6A 5CCGA 5H2FE 3SFEC 2B89A 3CWBG 1AQTA 1KB9I 4WB4A 3MD0A 1J1DC 5CJ0A 2I1KA 3CXHD 4C7NA 3H32A 3RL0g 1RF1B 1OMIA 1H0TB 1NHLA 1SQVD 2N1TA 1SQXD 2PGDA 2QJKB 3T97A 2QVAA 1OVVA 1USEA 4XFJA 1Q86Q 4K35A 2KB7P 3Q5SA 2LKMA 2Z4EA 1QVGO 1SQPD 5BU8B 4KT0J 2MJZA 1NTKK 1OZHA 1IFIA 1LWUC 5APVA 2YMYA 3H1HE 1G1JA 4H0LC 1X9VA 1Y47A 4YXDC 2NPSD 1L0LE 1IFDA 1JM0A 2ITAA 1H0TA 3VYIA 1NAYA 1NTZG 1SQBD 3IN6A 3USSA 1RF1A 3H1HJ 2AEFA 2KXPB 2O3JA 2OYIA 4IL6H 3M0DC 2R3SA 3PJSK 1NTZD 1NVOA 4BWNA 1Q82Q 1OIPA 2R3CA 3HUSB 1J1EB 2BCCG 2FKWB 4ZKPA 3L72D 4KJMA 4H13B 1IFPA 1NTME 1P84D 1SQPG 2UWJE 3H6PA 3PRJA 3U1AA 1N7SC 1PGOA 3V2QA 5APXA 4GKGA 1YHQP 5APSA 2OTLP 4L73A 1SQVG 5CHXA 3L36A 4H44C 1GL2B 1LWUB 2FYZA 3GW6A 2O1JA 2KZJA 1M8OB 2J59M 1NTMK 2YKPA 4D6TE 2A45G 2RN0A 3JC22 1JTHB 3L70D 2IFMA 2Y0CA 3VMAA 2FYUJ 4DCKA 1AFOA 1R5LA 1KN7A 1OVRA 2E76D 1U7JA 3T97B 1S1CX 4EI2A 3C1LA 1N73B 2OTJP 1L0LG 2P2UA 4AQRD 1J1DB 2QRXA 2M8RA 1GL2A 4YPCA 3V5BA 3WUVA 1KQGB 1SVFA 3HD7D 2GUVA 2NZ2A 3NFQA 1S72P 3O6QA 1OW6A 3CCMP 3SSUA 1KILC 2ZXEB 3KDPB 1S4XA 3BCCG 2FXMA 1NWQA 1LTGC 1ZR4A 2R5DA 2J58A 1VQLP 1L4AA 3Q3DA 3ABVC 1ZOYC 1T3JA 4XE5B 4U3FE 4OGQD 1FZCA 3MGNA 2JO1A 4N3YB 1KFMA 2V7QJ 1AVYA 3W68A 3H1JG 4GOEA 3OAKA 3I55P 1S9KD 3EWKA 1GU5A 3MZWB 4IL6E 2YO3A 1PIXA 2N9YB 1EZVG 1HGVA 1IC2A 1LTJC 1NTZK 2K3RA 2QM8A 2VRSA 3L74G 3P8CE 3VMZA 1KTMA 2W6AA 4C7RA 1YITP 2WVRA 3RK2D 1HVVA 2K9YA 3FWLA 3G9RA 3OJAB 1EDIA 1EXIA 2HR3A 1KQLA 2E76C 2JEEA 3JSVC 3CX5H 1IK7A 4N78E 2O1KA 3RK3D 3CWBJ 1SQQK 1ZLLA 2E75C 1UIIA 2W6JH 2WWWA 3I5CA 3R2PA 4U3FD 2NPSB 4WVZA 1BCCD 5B66H 1A02F 3CWBE 2SPZA 1K05A 2RH0A 5APUA 3H1JJ 1SQVK 4GODA 4AYCA 4DT0A 2WPVB 3H1IJ 1URQD 3VMYA 4PD4H 2H43A 1SQQE 1RF0C 3V4QA 4EDFA 2WTYA 3L74D 1FAVA 5AW9B 1RF1C 3I56P 4NPDA 3L71D 1IK9A 1RH5B 1HJBA 1SFCC 3FWNA 2IZ0A 3BCCJ 3IF4A 3LW5J 3F5HA 4W80A 5AW0B 3TSIA 3VP9A 4EIJA 1NU1K 2W8ZA 1L0NJ 3H1LJ 4I7ZC 1ZR2A 1L0LK 1YQ3C 1EDJA 3AE3C 4EOTA 2C0WA 4TT3H 3CCQP 2ZT9B 1RE4A 3B5NA 4PV1C 1G2CB 4ZKUA 1NU1E 1YQ4C 2XU6A 2WT7A 1L4AB 1Q90D 1PL5A 4R4MA 5GTIE 2E74C 2JP3A 4H0LD 4RKUJ 2BCCE 4PD4I 4KHXA 1PP9D 2NPSC 1FZCB 5K5GB 1JOCA 5AVZB 1NTKD 1SLQA 4JPZB 1BE3E 2YIUB 2XV5A 3LIEA 1TU3F 1KD1Q 1JCCA 1H88A 2ZYGA 4IFFA 2QG4A 3GMAA 2OYHC 2H8PD 2M5AA 2OYIC 1N73A 1LP1A 2A06E 1SQQJ 1LTJB 1JY3N 2YKQA 3CCVP 2XKMA 1OVUA 1UIXA 3CXHH 1SQQG 1M90Q 4C46A 1FDMA 3G71P 2KZIA 2BCCD 3Q2YA 1NAFA 1GZLA 1PP9E 1S5LX 2OTKE 2D2CB 1K8AQ 3CC4P 3H1IE 5CJ4A 4QMAA 1FZEA 5TISE 1BE3D 3GHGA 3OW2O 1EDLA 2E74D 2Q3EA 3FX0A 3MIWA 1PV3A 5APYA 2L5GB 3RL0B 3AECC 4IFDK 4JBZA 1USDA 3CL3D 2P1JA 5AW5B 1SQBE 4WY4D 2H88C 2KLUA 5AW7B 3G4SP 1W2BO 1N73C 2YO2A 1M1JC 1QX8A 3E7KA 3EQ2A 4K3AA 2FXPA 3E1RA 1JUNA 1JY2P 2FYUE 2GUSA 1NKZB 1VL2A 5AW6B 2Y9ZA 2FFDC 1Y9BA 3W67A 5KKZB 2PFXA 3L35A 2WZ7A 3V2NA 3S4RA 1M1JB 3CX5D 2QJYB 2N1TC 3L72J 3M06A 1MFZA 4Y28J 4XA4A 1OXZA 2Q6QA 4D6TJ 1JTHA 1T6AA 3Q5PA 2A45I 3G6EP 2IBZE 3MP7B 2JKVA 1FDOA 1CI6B 1JY2O 1NO4A 3A0BH 4MN4C 3H1IG 4O9BA 5TJHA 1RE4C 3B5NC 3O8ZA 3LW5H 2V4HA 3HE4B 4IOIH 4Y99C 3V2RA 1NU1J 1PPJD 2KSEA 2FYUD 3BRVB 2C0XA 4I1LA 1IO4A 1NH4A 1JY3P 1GL2D 3TNUA 1PGPA 4UB8E 3EFGA 3H1KD 4HB1A 4DJGA 1VF5B 4BRYB 3H1HD 1HWTC 2N1TD 1N7SD 1FU1A 1N86A 1CI6A 3HD7A 1DEBA 3TF5A 2OYIB 2IZ1A 2JDIH 3D6YA 1GK4A 2QIWA 3G3ZA 1LGHB 3AE6C 3PTZA 1NGMB 3KHUA 1T2KD 2KSJA 4EYYQ 1N8RQ 1RE3A 1BGYE 1IJDB 4UB6E 1NU1G 2OGUA 3L70J 5AW2B 4B86A 2M5AB 3CCEP 3H1LG 3KZIE 3L72E 1JY2N 2G8YA 1BGYJ 1LT9A 2ZJSE 3QWOC 1YJWP 1R8EA 1KYOH 1SQXK 2W90A 1FDIA 1QL1A 1FJKA 1KB9H 1RF0A 2QA4P 1KILA 1IZNB 2ZYDA 3TGUD 3HTKB 2E5TA 2V7QH 4H44B 1LTSC 1MKMA 2RMZA 3L75D 4PD4E 4PV1B 4D6TD 2LXCB 2K1AA 3AE8C 3HRNA 2FY8A 1E5WA 2WSFH 3HE4A 3CCLP 1JEKA 5TISH 1DEEG 2CPBA 1RE3C 4R4LA 3L75G 3S9OA 1IFNA 1X22A 3M9HA 4L76A 4A7PA 1M1JA 1Z56A 4JF7A 3WU2E 3ITKA 3VN0A 2WSCH 3BATA 3L74E 3WU2H 2OYOA 3BVHA 1HBWA 2WPRA 1NTZE 2HODA 3GF7A 1YI2P 1PFIA 1S3JA 1T8ZA 1JO5A 1NOHA 1P84I 2B9BA 2IDBA 1KORA 3FXEA 4RO0A 5AVRB 3L75E 1URQC 1URQB 4JQ0D 4ASVA 3VP8A 2IYOA 1P84E 5CMZA 3JCUH 1P84H 1VQMP 1XTCC 3AEEC 3RK3B 5KAIH 4NPFX 3BASA 1VQ8P 1AV1A 1LTBC 3P8CD 5AVQB 1KQFB 3MUDC 1J2JB 5AW4B 1JMMA 3H1HG 5APTA 5AW1B 2KIKA 2B87B 3A2AA 1IFMA 2K9JA 3GHGB 3N4XA 2WSEJ 4TLFA 1FOSF 3RK3E 1KYOE 1AVOA 2AEJA 3BCCD 3D70A 1YYCA 4N6JA 1VF5D 1LTAC 4PJ0H 1L4AD 1M7LA 2KNCA 2L91A 2ZYAA 1R5SA 2KOGA 1BCCE 3NMDA 2ZT9C 4I6MC 1DD3A 3CCSP 1JB0J 3AEAC 2K9JB 1RQVA 1MV8A 2RKLA 1MZ9A 2YNYA 4LLHA 1L2PA 3HD7C 4M3LA 5E79E 2ZFCA 1LT1A 3B5ND 5KLVD 1FZGA 1H8AA 1L0ND 1OWAA 3HTKA 2IYPA 5KJ7C 5KAFH 1U57A 3L37A 1FZFA 2FXOA 4HH2A 2AXCA 2WSSH 3CCUP 3SWFA 5APWA 4GDOA 1S9KE 2KS1A 1NTKJ 2P67A 4L75A 3KQGA 5AW8B 5KJ7A 1KV4A 2YMKA 2KP8A 1CSBA 3A3YB 4IL6X 4LC1A 4DZOA 3II6A 1IFJA 1KB9E 2ZVOB 1MUUA 5DJTB 4H13D 4GOFA 1LTIC 2LR2A 3M0AA 3P32A 3Q1MA 1BGYG 1QLED 5GTHH 3CPWO 1LTTC 3AEGC 2KUBA 2I8DA 1FBMA 3AEFC 2QE7H 3JCUE 5KAIE 3RBXA 3H1LE 1LWUA 1W2EA 2Q1KA 1SQXE 1EZVI 2IBZD 3GHGC 3D71A 1M1KQ 2HPCA 3RL0D 3WUTA 3V4WA 4U7JA 3GF3A 2HLOA 2WSFJ 2BASA 1BCCJ 2XDJA 5KLIC 1DD4A 1SQQD 2KK7A 5AW3B 3TK1A 3L73J 5GTIH 2AEMA 1BE3J 3AE2C 4AUWA 5EFWB 2A45H 2D2CD 1CZQA 2JWDA 2DW3A 3CXHI 3RK3C 3OA7A 3CLQA 5KJ7D 1SQXG 1QVFO 3AE4C 1ZW0A 2JR8A 1VQ6P 3VMXA 1QEXA 3B8EB 2R5BA 1K73Q 3CD6P 1URQA 1FZAA 2OQQA 3KZIH 1EXJA 1HF9A 2FFDA 5CCGD 3D6ZA 2QJKC 1S2EA 5AVUB 1NTMD 1X8YA 2OARA 4W7YA 3LIDA 5M1BA 3RGUA 5L8RJ 3M91A 2P58A 1K04A 5C39A 4D6TG 1HH0A 3CXHE 3M0DA 4WBAA 1ZXGA 3IR9A 1RY3A 2B88A 4NPEA 1SQVE 2YXQB 2R32A 3H1JE 1VDFA 4BXLA 3L70E 4BRYA 1RHZB 2OYHA 3FXDA 1BDCA 1GL2C 1L0LJ 2Y0EA 4OVNF 1EZVE 3RK2B 1VQ5P 1ZN5A 3HUSA 2B87A 3PHLA 1WRGA 2WSEH 3K5BA 4OGQC 3TDKA 3ZDMA 1N7SB 1ZRTD 5KAFE 3TNUB 1E79H 4JYCA 5B5EH 1NJIQ 2A06D 3AEBC 3L71G 5AVXB 1S5LH 1KFNA 1J1EC 5AVVB 1OW8A 5E79H 1GU4A 2H89C 2W6BA 1M56D 2OYHB 3CC2P 2LXBA 3L71J 4LGDE 1HJ0A 2Q3IA 1GD2E 1JNMA
chains in the Genus database with same CATH topology
2IFNA 1LTJA 5CJ4A 2HODB 4GIFA 1N2DC 3VOPA 3VTPC 2N1TB 2QM7A 3A5TA 1T2KC 3H32B 3M9QA 5AVSB 1FZCC 3BRTB 2E43A 3SWYA 1EQ7A 1GK6A 1L4AC 3NXSA 4EIJA 2YKOA 3MUDA 3NTNA 1SP4A 1N7SA 3CI9A 4DOJA 3KPEA 1FZBA 1KZUB 1A02J 2PP6A 3KYQA 4IFMA 2CPSA 1SFCA 3A7OA 2WPSA 3IFMA 1SFCD 4WY4C 1LT9B 2XZRA 2FFDB 2Q5UA 3N7NA 1KILD 1VPCA 3P7KA 2FYUK 2NPSA 3RL0C 2GM4A 4W7ZA 4N78D 1HGZA 3MTUE 4WY4A 2W27A 1H89A 2IPPA 3UIAA 5AVTB 2HG5D 5AVWB 5KTBA 4OH8B 2Q9IA 5AVYB 3HE5B 5APQA 3M9BA 1HUCA 1X79B 3PP5A 4JYBA 4Y99B 3RK2C 3B5NB 2HPCB 1DX7A 5CCHD 2IX7C 3U59A 3E1IA 4I2LC 1GTWA 2WPQA 4RESB 1ZV8A 1DH3A 2M3BA 5BU5A 2WT7B 5KLVK 2WITA 1GW3A 1HTLC 2Q7CA 1QL2A 1JCDA 2PAJA 2HFED 2XNXA 3TYYA 2JJLA 5BVZA 2POHA 1JY3O 3HUSC 3P8MC 1SFCB 1YTZT 3U1CA 2Z5IA 5CCHC 1CW5A 1YTZI 1GDTA 2KYVA 1FOSE 1T3UA 4HYTB 5CCGC 3WMM0 1GW4A 3C9IA 1KILB 2Z5HA 1NKNA 3L4FA 2I1JA 1G1IA 1N7LA 2C9LY 1SQPK 1G2CA 3HE5A 2C9NY 2N9BA 3HD7B 2HYNA 1AQ5A 4C7NB 1XTGB 5CCHA 2P7JA 2KLVA 3V2PA 2O01H 1LT9C 4WY4B 1SQBK 4GT1A 1L0NK 1WT6A 5CCGA 4WB4A 3MD0A 1J1DC 5CJ0A 2I1KA 4C7NA 1RF1B 3H32A 1NHLA 2N1TA 3T97A 2KB7P 2LKMA 2Z4EA 5BU8B 5AW1B 2MJZA 1NTKK 5APVA 1IFIA 1LWUC 2YMYA 1G1JA 1X9VA 2NPSD 1IFDA 3VYIA 1RF1A 2OYIA 3M0DC 2R3CA 3HUSB 1J1EB 2FKWB 4ZKPA 3U1AA 3V2QA 3H6PA 1N7SC 5APXA 4GKGA 5APSA 5CHXA 3L36A 1GL2B 1LWUB 2FYZA 2O1JA 2J59M 1NTMK 2YKPA 2A45G 1JTHB 2IFMA 1AFOA 1N73B 2P2UA 4AQRD 1J1DB 2M8RA 1GL2A 3V5BA 1SVFA 3HD7D 2GUVA 3NFQA 1KILC 2ZXEB 3KDPB 2FXMA 1NWQA 1LTGC 1ZR4A 2R5DA 2J58A 1L4AA 4XE5B 1T3JA 1FZCA 3MGNA 4N3YB 1KFMA 3OAKA 1S9KD 1GU5A 2H7HA 2YO3A 1HGVA 1IC2A 1LTJC 1NTZK 2QM8A 2VRSA 3P8CE 3VMZA 2W6AA 4C7RA 3RK2D 1HVVA 3OJAB 3RK3D 1KQLA 2JEEA 4N78E 2O1KA 1SQQK 1ZLLA 2WWWA 3I5CA 3R2PA 2NPSB 5APUA 4AYCA 1SQVK 1URQD 3VMYA 2H43A 1RF0C 3V4QA 1FAVA 5AW9B 1RF1C 1IK9A 1HJBA 1SFCC 3VP9A 3TSIA 5AW0B 2WTYA 4W80A 1A02F 1ZR2A 1NU1K 1L0LK 4EOTA 2C0WA 1RE4A 3B5NA 1G2CB 4ZKUA 2XU6A 2WT7A 1L4AB 1FZCB 4KHXA 2NPSC 1JOCA 5AVZB 1SLQA 2XV5A 3LIEA 1JCCA 1H88A 4IFFA 2OYHC 2H8PD 2OYIC 1N73A 1LTJB 1JY3N 2YKQA 2XKMA 4C46A 1FDMA 1NAFA 1GZLA 1FZEA 3GHGA 3RL0B 3MIWA 5APYA 2L5GB 4IFDK 3CL3D 5AW5B 2P1JA 1FZFA 4WY4D 5AW7B 1N73C 2YO2A 1M1JC 3EQ2A 1JUNA 1JY2P 2GUSA 1NKZB 5AW6B 2FFDC 3L35A 2WZ7A 3V2NA 1M1JB 2N1TC 3M06A 1MFZA 4XA4A 1OXZA 1JTHA 2A45I 1CI6B 1JY2O 1NO4A 4O9BA 1RE4C 3B5NC 3O8ZA 3LW5H 3HE4B 4Y99C 3V2RA 4I1LA 3BRVB 2C0XA 1IO4A 1NH4A 1JY3P 1GL2D 3TNUA 3EFGA 1HWTC 2N1TD 1N7SD 1FU1A 1N86A 1CI6A 3HD7A 1DEBA 2OYIB 1GK4A 3G3ZA 1LGHB 1T2KD 2KSJA 1RE3A 5AW2B 1IJDB 4B86A 1JY2N 1LT9A 1SQXK 1QL1A 1FJKA 1RF0A 1KILA 3HTKB 1LTSC 3HRNA 1E5WA 2WSFH 3HE4A 2CPBA 1RE3C 1IFNA 3M9HA 1M1JA 1Z56A 4JF7A 3VN0A 2WSCH 3BATA 1HBWA 3BVHA 2WPRA 2HODA 1PFIA 1JO5A 1T8ZA 1NOHA 5AVRB 1URQC 1URQB 3VP8A 5CMZA 1XTCC 3RK3B 3BASA 1LTBC 3P8CD 5AVQB 1J2JB 5AW4B 1JMMA 5APTA 3A2AA 1IFMA 3GHGB 3N4XA 1FOSF 1YYCA 4N6JA 1LTAC 1L4AD 1M7LA 3NMDA 4I6MC 5AW3B 2KOGA 1MV8A 1MZ9A 2YNYA 4LLHA 3HD7C 4M3LA 1FZGA 2ZFCA 3B5ND 1H8AA 1OWAA 3HTKA 5KJ7C 3L37A 4HH2A 3SWFA 5APWA 1S9KE 2P67A 3KQGA 5AW8B 5KJ7A 2KP8A 1CSBA 3A3YB 4LC1A 4DZOA 3II6A 1IFJA 1MUUA 1LTIC 3M0AA 3P32A 2E42A 1LTTC 1FBMA 1LWUA 1W2EA 3GHGC 2HPCA 3RL0D 3V4WA 2HLOA 2BASA 2XDJA 3TK1A 1FJPA 4AUWA 2A45H 3RK3C 1CZQA 3OA7A 3CLQA 5KJ7D 3VMXA 3B8EB 2R5BA 1URQA 1FZAA 2FFDA 5CCGD 5AVUB 1X8YA 2OARA 4W7YA 3LIDA 3M91A 1HH0A 3M0DA 4WBAA 3IR9A 1RY3A 2R32A 1VDFA 2OYHA 1GL2C 3RK2B 1ZN5A 3HUSA 1WRGA 2WSEH 1N7SB 3TNUB 4JYCA 5AVXB 1KFNA 1J1EC 5AVVB 1GU4A 2W6BA 2OYHB 4LGDE 2Q3IA 1GD2E 1JNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L K;  1NTZ K;  1SQP K;  1NTM K;  2J59 M;  2OAR A;  2LKM A;  3G3Z A;  2WSC H;  1NTK K;  3M9Q A;  2O01 H;  1SQQ K;  1SQX K;  1SQB K;  2WSE H;  3LW5 H;  2FYU K;  1L0N K;  1SQV K;  3CLQ A;  4IFD K;  5KLV K;  2WSF H;  1NU1 K; 
#chains in the Genus database with same CATH topology
 2IFN A;  4PD4 D;  1FJP A;  1BCC G;  1LTJ A;  2XND H;  2YIU C;  2QJP C;  2HOD B;  2ZVN B;  1N2D C;  3H1K G;  3H1I D;  4GIF A;  2N1T B;  2QJY C;  4U3F G;  3VOP A;  2QM7 A;  3VTP C;  3A5T A;  4H0L B;  1T2K C;  1KC8 Q;  3Q5R A;  3H32 B;  3M9Q A;  5AVS B;  1WMK A;  3AE7 C;  3BRT B;  5AVY B;  1FZC C;  1VF5 C;  1ZRT E;  3SWY A;  1VQO P;  2E43 A;  1EQ7 A;  1GK6 A;  1L4A C;  1QGK B;  1NTZ J;  1FE6 A;  2K88 A;  1NTM J;  2YKO A;  2ZT9 D;  3A0B E;  1KMI Z;  3MUD A;  1SP4 A;  2CK3 H;  3NTN A;  4CPG A;  4RJT A;  3CCJ P;  2E75 D;  1FC2 C;  1N7S A;  2J5U A;  2R44 A;  2E42 A;  1D7M A;  5KKZ C;  3CI9 A;  3MHV A;  4DOJ A;  3KPE A;  3GLM A;  1FZB A;  2M0B A;  1KZU B;  1FS0 E;  1Q7Y Q;  1A02 J;  1BGY D;  4I7Z B;  1Q81 Q;  2BEZ F;  2PP6 A;  3B71 A;  3KYQ A;  1SQB J;  2WSC J;  4H44 D;  2CPS A;  4IFM A;  1SFC A;  1X0T A;  3A7O A;  3AED C;  1OX3 A;  1ZP0 C;  2WPS A;  3IFM A;  1SFC D;  1M57 D;  4PV1 D;  4WY4 C;  1LT9 B;  1SQV J;  1SQX J;  3AE9 C;  3WUU A;  2XZR A;  1YBK A;  3L71 E;  1BE3 G;  3GG2 A;  3R4Y A;  1KYO I;  1LP1 B;  3AE5 C;  3F89 A;  1GMJ A;  3TGU E;  3CME P;  1AA0 A;  2QSI A;  2FFD B;  1SQB G;  2Q5U A;  1S5L E;  2BCC J;  5KLV J;  1L0N G;  3N7N A;  1YJ9 P;  2QJP B;  1KIL D;  1OW7 A;  1VPC A;  2E76 B;  3H1K E;  3P7K A;  2FYN C;  2O01 N;  5B66 E;  2FYU K;  2KS1 B;  2NPS A;  3RL0 C;  1Q2N A;  2GM4 A;  5KLI B;  2P10 A;  4W7Z A;  3B4S A;  4N78 D;  1LJ2 A;  1VQN P;  4ASW A;  1YJN P;  1HGZ A;  3MTU E;  4WY4 A;  2W27 A;  1H89 A;  1L0N E;  1U7M A;  1JMB A;  1OFC X;  2D2C C;  2E74 B;  2GA1 A;  2IPP A;  2G3A A;  2IBZ G;  2JWA A;  3UIA A;  3V6I A;  3CWB D;  3L72 G;  5AVT B;  1NTK G;  2PRR A;  2WMM A;  1AJY A;  2HG5 D;  5AVW B;  5KTB A;  1BDD A;  4OH8 B;  4U3F J;  2Q9I A;  4OGQ B;  1NYH A;  3HE5 B;  2O01 J;  3M9B A;  1HUC A;  1X79 B;  3PP5 A;  4JYB A;  4Y99 B;  5APQ A;  3B5N B;  3FGA D;  3RK2 C;  2HPC B;  1BSN A;  2KI7 B;  1DX7 A;  1KIL E;  3A0H E;  3L73 E;  2Y0D A;  5CCH D;  2IX7 C;  3CCR P;  1EDK A;  3TGU G;  1KB9 D;  4ZMD A;  3CMA P;  1PP9 G;  2W83 C;  3L74 J;  3U59 A;  3E1I A;  4I2L C;  3EFF K;  1GTW A;  2Y9Y A;  4OWF A;  2WPQ A;  4RES B;  2IBZ I;  1ZV8 A;  1DIP A;  1DH3 A;  1ZME C;  1W5C E;  2M3B A;  3H1L D;  3L75 J;  3PH0 A;  2YXR B;  3RBZ A;  3NXS A;  1VQ9 P;  5BU5 A;  1NU1 D;  2FBW C;  2WT7 B;  3H25 A;  5KLV K;  2WIT A;  4UB6 H;  1GW3 A;  1HTL C;  1PZQ A;  3CX5 I;  2Q7C A;  2E75 B;  1RQU A;  1NTM G;  1LNQ A;  1QL2 A;  1JCD A;  2PAJ A;  2MKV A;  3L73 D;  1SS1 A;  2HFE D;  2XNX A;  3QH9 A;  1NTK E;  4HKZ H;  3TYY A;  5KLV E;  5DJU B;  4H13 C;  5H2F H;  2JJL A;  5BVZ A;  2POH A;  1JY3 O;  4PJ0 E;  4UB8 H;  4ZNC A;  4Z1M H;  3H1K J;  2M3E A;  2KNC B;  3HUS C;  3P8M C;  2FYU G;  1SFC B;  1YTZ T;  5CBN A;  3U1C A;  1VQP P;  1K9M Q;  2Z5I A;  4L74 A;  3SFD C;  4WWI A;  5CCH C;  3CX5 E;  1PP9 J;  1YTZ I;  1GDT A;  1VQ7 P;  1CW5 A;  3TGU J;  2KYV A;  3C8V A;  1FOS E;  3S1K A;  1T3U A;  5B5E E;  3L73 G;  1SQP J;  4HYT B;  5CCG C;  3WMM 0;  3H1J D;  1KYO D;  2WQY C;  1GW4 A;  3BCC E;  3C9I A;  1KIL B;  1Y8A A;  2ZXX A;  1PGQ A;  2E5Y A;  1MFT A;  2Z5H A;  1NKN A;  3AE1 C;  3L4F A;  1EZV D;  2I1J A;  2NRG A;  1PPJ E;  3SWK A;  1KQS O;  3CC7 P;  2A06 G;  2FYN B;  2BEQ D;  2ZAE B;  1VQK P;  1G1I A;  1N7L A;  1VQ4 P;  2C9L Y;  2QEX P;  1SQP K;  2K37 A;  1EC5 A;  1G2C A;  3HE5 A;  3KXD A;  5GTH E;  2N9B A;  2C9N Y;  2AXT H;  3IAO A;  3HD7 B;  2HYN A;  5CBO A;  2AXT E;  4HJG H;  1PGJ A;  4YTP C;  1BSH A;  3A0H H;  1PPJ G;  4C7N B;  1XTG B;  1YIJ P;  5CCH A;  2P7J A;  1AQ5 A;  2KLV A;  3V2P A;  1SQP E;  2O01 H;  1LT9 C;  4YXW H;  3PLN A;  4WY4 B;  5KLV G;  1SQB K;  3L70 G;  4GT1 A;  1L0L D;  2H7H A;  3O6Q B;  1L0N K;  1WT6 A;  5CCG A;  5H2F E;  3SFE C;  2B89 A;  3CWB G;  1AQT A;  1KB9 I;  4WB4 A;  3MD0 A;  1J1D C;  5CJ0 A;  2I1K A;  3CXH D;  4C7N A;  3H32 A;  3RL0 g;  1RF1 B;  1OMI A;  1H0T B;  1NHL A;  1SQV D;  2N1T A;  1SQX D;  2PGD A;  2QJK B;  3T97 A;  2QVA A;  1OVV A;  1USE A;  4XFJ A;  1Q86 Q;  4K35 A;  2KB7 P;  3Q5S A;  2LKM A;  2Z4E A;  1QVG O;  1SQP D;  5BU8 B;  4KT0 J;  2MJZ A;  1NTK K;  1OZH A;  1IFI A;  1LWU C;  5APV A;  2YMY A;  3H1H E;  1G1J A;  4H0L C;  1X9V A;  1Y47 A;  4YXD C;  2NPS D;  1L0L E;  1IFD A;  1JM0 A;  2ITA A;  1H0T A;  3VYI A;  1NAY A;  1NTZ G;  1SQB D;  3IN6 A;  3USS A;  1RF1 A;  3H1H J;  2AEF A;  2KXP B;  2O3J A;  2OYI A;  4IL6 H;  3M0D C;  2R3S A;  3PJS K;  1NTZ D;  1NVO A;  4BWN A;  1Q82 Q;  1OIP A;  2R3C A;  3HUS B;  1J1E B;  2BCC G;  2FKW B;  4ZKP A;  3L72 D;  4KJM A;  4H13 B;  1IFP A;  1NTM E;  1P84 D;  1SQP G;  2UWJ E;  3H6P A;  3PRJ A;  3U1A A;  1N7S C;  1PGO A;  3V2Q A;  5APX A;  4GKG A;  1YHQ P;  5APS A;  2OTL P;  4L73 A;  1SQV G;  5CHX A;  3L36 A;  4H44 C;  1GL2 B;  1LWU B;  2FYZ A;  3GW6 A;  2O1J A;  2KZJ A;  1M8O B;  2J59 M;  1NTM K;  2YKP A;  4D6T E;  2A45 G;  2RN0 A;  3JC2 2;  1JTH B;  3L70 D;  2IFM A;  2Y0C A;  3VMA A;  2FYU J;  4DCK A;  1AFO A;  1R5L A;  1KN7 A;  1OVR A;  2E76 D;  1U7J A;  3T97 B;  1S1C X;  4EI2 A;  3C1L A;  1N73 B;  2OTJ P;  1L0L G;  2P2U A;  4AQR D;  1J1D B;  2QRX A;  2M8R A;  1GL2 A;  4YPC A;  3V5B A;  3WUV A;  1KQG B;  1SVF A;  3HD7 D;  2GUV A;  2NZ2 A;  3NFQ A;  1S72 P;  3O6Q A;  1OW6 A;  3CCM P;  3SSU A;  1KIL C;  2ZXE B;  3KDP B;  1S4X A;  3BCC G;  2FXM A;  1NWQ A;  1LTG C;  1ZR4 A;  2R5D A;  2J58 A;  1VQL P;  1L4A A;  3Q3D A;  3ABV C;  1ZOY C;  1T3J A;  4XE5 B;  4U3F E;  4OGQ D;  1FZC A;  3MGN A;  2JO1 A;  4N3Y B;  1KFM A;  2V7Q J;  1AVY A;  3W68 A;  3H1J G;  4GOE A;  3OAK A;  3I55 P;  1S9K D;  3EWK A;  1GU5 A;  3MZW B;  4IL6 E;  2YO3 A;  1PIX A;  2N9Y B;  1EZV G;  1HGV A;  1IC2 A;  1LTJ C;  1NTZ K;  2K3R A;  2QM8 A;  2VRS A;  3L74 G;  3P8C E;  3VMZ A;  1KTM A;  2W6A A;  4C7R A;  1YIT P;  2WVR A;  3RK2 D;  1HVV A;  2K9Y A;  3FWL A;  3G9R A;  3OJA B;  1EDI A;  1EXI A;  2HR3 A;  1KQL A;  2E76 C;  2JEE A;  3JSV C;  3CX5 H;  1IK7 A;  4N78 E;  2O1K A;  3RK3 D;  3CWB J;  1SQQ K;  1ZLL A;  2E75 C;  1UII A;  2W6J H;  2WWW A;  3I5C A;  3R2P A;  4U3F D;  2NPS B;  4WVZ A;  1BCC D;  5B66 H;  1A02 F;  3CWB E;  2SPZ A;  1K05 A;  2RH0 A;  5APU A;  3H1J J;  1SQV K;  4GOD A;  4AYC A;  4DT0 A;  2WPV B;  3H1I J;  1URQ D;  3VMY A;  4PD4 H;  2H43 A;  1SQQ E;  1RF0 C;  3V4Q A;  4EDF A;  2WTY A;  3L74 D;  1FAV A;  5AW9 B;  1RF1 C;  3I56 P;  4NPD A;  3L71 D;  1IK9 A;  1RH5 B;  1HJB A;  1SFC C;  3FWN A;  2IZ0 A;  3BCC J;  3IF4 A;  3LW5 J;  3F5H A;  4W80 A;  5AW0 B;  3TSI A;  3VP9 A;  4EIJ A;  1NU1 K;  2W8Z A;  1L0N J;  3H1L J;  4I7Z C;  1ZR2 A;  1L0L K;  1YQ3 C;  1EDJ A;  3AE3 C;  4EOT A;  2C0W A;  4TT3 H;  3CCQ P;  2ZT9 B;  1RE4 A;  3B5N A;  4PV1 C;  1G2C B;  4ZKU A;  1NU1 E;  1YQ4 C;  2XU6 A;  2WT7 A;  1L4A B;  1Q90 D;  1PL5 A;  4R4M A;  5GTI E;  2E74 C;  2JP3 A;  4H0L D;  4RKU J;  2BCC E;  4PD4 I;  4KHX A;  1PP9 D;  2NPS C;  1FZC B;  5K5G B;  1JOC A;  5AVZ B;  1NTK D;  1SLQ A;  4JPZ B;  1BE3 E;  2YIU B;  2XV5 A;  3LIE A;  1TU3 F;  1KD1 Q;  1JCC A;  1H88 A;  2ZYG A;  4IFF A;  2QG4 A;  3GMA A;  2OYH C;  2H8P D;  2M5A A;  2OYI C;  1N73 A;  1LP1 A;  2A06 E;  1SQQ J;  1LTJ B;  1JY3 N;  2YKQ A;  3CCV P;  2XKM A;  1OVU A;  1UIX A;  3CXH H;  1SQQ G;  1M90 Q;  4C46 A;  1FDM A;  3G71 P;  2KZI A;  2BCC D;  3Q2Y A;  1NAF A;  1GZL A;  1PP9 E;  1S5L X;  2OTK E;  2D2C B;  1K8A Q;  3CC4 P;  3H1I E;  5CJ4 A;  4QMA A;  1FZE A;  5TIS E;  1BE3 D;  3GHG A;  3OW2 O;  1EDL A;  2E74 D;  2Q3E A;  3FX0 A;  3MIW A;  1PV3 A;  5APY A;  2L5G B;  3RL0 B;  3AEC C;  4IFD K;  4JBZ A;  1USD A;  3CL3 D;  2P1J A;  5AW5 B;  1SQB E;  4WY4 D;  2H88 C;  2KLU A;  5AW7 B;  3G4S P;  1W2B O;  1N73 C;  2YO2 A;  1M1J C;  1QX8 A;  3E7K A;  3EQ2 A;  4K3A A;  2FXP A;  3E1R A;  1JUN A;  1JY2 P;  2FYU E;  2GUS A;  1NKZ B;  1VL2 A;  5AW6 B;  2Y9Z A;  2FFD C;  1Y9B A;  3W67 A;  5KKZ B;  2PFX A;  3L35 A;  2WZ7 A;  3V2N A;  3S4R A;  1M1J B;  3CX5 D;  2QJY B;  2N1T C;  3L72 J;  3M06 A;  1MFZ A;  4Y28 J;  4XA4 A;  1OXZ A;  2Q6Q A;  4D6T J;  1JTH A;  1T6A A;  3Q5P A;  2A45 I;  3G6E P;  2IBZ E;  3MP7 B;  2JKV A;  1FDO A;  1CI6 B;  1JY2 O;  1NO4 A;  3A0B H;  4MN4 C;  3H1I G;  4O9B A;  5TJH A;  1RE4 C;  3B5N C;  3O8Z A;  3LW5 H;  2V4H A;  3HE4 B;  4IOI H;  4Y99 C;  3V2R A;  1NU1 J;  1PPJ D;  2KSE A;  2FYU D;  3BRV B;  2C0X A;  4I1L A;  1IO4 A;  1NH4 A;  1JY3 P;  1GL2 D;  3TNU A;  1PGP A;  4UB8 E;  3EFG A;  3H1K D;  4HB1 A;  4DJG A;  1VF5 B;  4BRY B;  3H1H D;  1HWT C;  2N1T D;  1N7S D;  1FU1 A;  1N86 A;  1CI6 A;  3HD7 A;  1DEB A;  3TF5 A;  2OYI B;  2IZ1 A;  2JDI H;  3D6Y A;  1GK4 A;  2QIW A;  3G3Z A;  1LGH B;  3AE6 C;  3PTZ A;  1NGM B;  3KHU A;  1T2K D;  2KSJ A;  4EYY Q;  1N8R Q;  1RE3 A;  1BGY E;  1IJD B;  4UB6 E;  1NU1 G;  2OGU A;  3L70 J;  5AW2 B;  4B86 A;  2M5A B;  3CCE P;  3H1L G;  3KZI E;  3L72 E;  1JY2 N;  2G8Y A;  1BGY J;  1LT9 A;  2ZJS E;  3QWO C;  1YJW P;  1R8E A;  1KYO H;  1SQX K;  2W90 A;  1FDI A;  1QL1 A;  1FJK A;  1KB9 H;  1RF0 A;  2QA4 P;  1KIL A;  1IZN B;  2ZYD A;  3TGU D;  3HTK B;  2E5T A;  2V7Q H;  4H44 B;  1LTS C;  1MKM A;  2RMZ A;  3L75 D;  4PD4 E;  4PV1 B;  4D6T D;  2LXC B;  2K1A A;  3AE8 C;  3HRN A;  2FY8 A;  1E5W A;  2WSF H;  3HE4 A;  3CCL P;  1JEK A;  5TIS H;  1DEE G;  2CPB A;  1RE3 C;  4R4L A;  3L75 G;  3S9O A;  1IFN A;  1X22 A;  3M9H A;  4L76 A;  4A7P A;  1M1J A;  1Z56 A;  4JF7 A;  3WU2 E;  3ITK A;  3VN0 A;  2WSC H;  3BAT A;  3L74 E;  3WU2 H;  2OYO A;  3BVH A;  1HBW A;  2WPR A;  1NTZ E;  2HOD A;  3GF7 A;  1YI2 P;  1PFI A;  1S3J A;  1T8Z A;  1JO5 A;  1NOH A;  1P84 I;  2B9B A;  2IDB A;  1KOR A;  3FXE A;  4RO0 A;  5AVR B;  3L75 E;  1URQ C;  1URQ B;  4JQ0 D;  4ASV A;  3VP8 A;  2IYO A;  1P84 E;  5CMZ A;  3JCU H;  1P84 H;  1VQM P;  1XTC C;  3AEE C;  3RK3 B;  5KAI H;  4NPF X;  3BAS A;  1VQ8 P;  1AV1 A;  1LTB C;  3P8C D;  5AVQ B;  1KQF B;  3MUD C;  1J2J B;  5AW4 B;  1JMM A;  3H1H G;  5APT A;  5AW1 B;  2KIK A;  2B87 B;  3A2A A;  1IFM A;  2K9J A;  3GHG B;  3N4X A;  2WSE J;  4TLF A;  1FOS F;  3RK3 E;  1KYO E;  1AVO A;  2AEJ A;  3BCC D;  3D70 A;  1YYC A;  4N6J A;  1VF5 D;  1LTA C;  4PJ0 H;  1L4A D;  1M7L A;  2KNC A;  2L91 A;  2ZYA A;  1R5S A;  2KOG A;  1BCC E;  3NMD A;  2ZT9 C;  4I6M C;  1DD3 A;  3CCS P;  1JB0 J;  3AEA C;  2K9J B;  1RQV A;  1MV8 A;  2RKL A;  1MZ9 A;  2YNY A;  4LLH A;  1L2P A;  3HD7 C;  4M3L A;  5E79 E;  2ZFC A;  1LT1 A;  3B5N D;  5KLV D;  1FZG A;  1H8A A;  1L0N D;  1OWA A;  3HTK A;  2IYP A;  5KJ7 C;  5KAF H;  1U57 A;  3L37 A;  1FZF A;  2FXO A;  4HH2 A;  2AXC A;  2WSS H;  3CCU P;  3SWF A;  5APW A;  4GDO A;  1S9K E;  2KS1 A;  1NTK J;  2P67 A;  4L75 A;  3KQG A;  5AW8 B;  5KJ7 A;  1KV4 A;  2YMK A;  2KP8 A;  1CSB A;  3A3Y B;  4IL6 X;  4LC1 A;  4DZO A;  3II6 A;  1IFJ A;  1KB9 E;  2ZVO B;  1MUU A;  5DJT B;  4H13 D;  4GOF A;  1LTI C;  2LR2 A;  3M0A A;  3P32 A;  3Q1M A;  1BGY G;  1QLE D;  5GTH H;  3CPW O;  1LTT C;  3AEG C;  2KUB A;  2I8D A;  1FBM A;  3AEF C;  2QE7 H;  3JCU E;  5KAI E;  3RBX A;  3H1L E;  1LWU A;  1W2E A;  2Q1K A;  1SQX E;  1EZV I;  2IBZ D;  3GHG C;  3D71 A;  1M1K Q;  2HPC A;  3RL0 D;  3WUT A;  3V4W A;  4U7J A;  3GF3 A;  2HLO A;  2WSF J;  2BAS A;  1BCC J;  2XDJ A;  5KLI C;  1DD4 A;  1SQQ D;  2KK7 A;  5AW3 B;  3TK1 A;  3L73 J;  5GTI H;  2AEM A;  1BE3 J;  3AE2 C;  4AUW A;  5EFW B;  2A45 H;  2D2C D;  1CZQ A;  2JWD A;  2DW3 A;  3CXH I;  3RK3 C;  3OA7 A;  3CLQ A;  5KJ7 D;  1SQX G;  1QVF O;  3AE4 C;  1ZW0 A;  2JR8 A;  1VQ6 P;  3VMX A;  1QEX A;  3B8E B;  2R5B A;  1K73 Q;  3CD6 P;  1URQ A;  1FZA A;  2OQQ A;  3KZI H;  1EXJ A;  1HF9 A;  2FFD A;  5CCG D;  3D6Z A;  2QJK C;  1S2E A;  5AVU B;  1NTM D;  1X8Y A;  2OAR A;  4W7Y A;  3LID A;  5M1B A;  3RGU A;  5L8R J;  3M91 A;  2P58 A;  1K04 A;  5C39 A;  4D6T G;  1HH0 A;  3CXH E;  3M0D A;  4WBA A;  1ZXG A;  3IR9 A;  1RY3 A;  2B88 A;  4NPE A;  1SQV E;  2YXQ B;  2R32 A;  3H1J E;  1VDF A;  4BXL A;  3L70 E;  4BRY A;  1RHZ B;  2OYH A;  3FXD A;  1BDC A;  1GL2 C;  1L0L J;  2Y0E A;  4OVN F;  1EZV E;  3RK2 B;  1VQ5 P;  1ZN5 A;  3HUS A;  2B87 A;  3PHL A;  1WRG A;  2WSE H;  3K5B A;  4OGQ C;  3TDK A;  3ZDM A;  1N7S B;  1ZRT D;  5KAF E;  3TNU B;  1E79 H;  4JYC A;  5B5E H;  1NJI Q;  2A06 D;  3AEB C;  3L71 G;  5AVX B;  1S5L H;  1KFN A;  1J1E C;  5AVV B;  1OW8 A;  5E79 H;  1GU4 A;  2H89 C;  2W6B A;  1M56 D;  2OYH B;  3CC2 P;  2LXB A;  3L71 J;  4LGD E;  1HJ0 A;  2Q3I A;  1GD2 E;  1JNM A; 
#chains in the Genus database with same CATH homology
 2IFN A;  1LTJ A;  5CJ4 A;  2HOD B;  4GIF A;  1N2D C;  3VOP A;  3VTP C;  2N1T B;  2QM7 A;  3A5T A;  1T2K C;  3H32 B;  3M9Q A;  5AVS B;  1FZC C;  3BRT B;  2E43 A;  3SWY A;  1EQ7 A;  1GK6 A;  1L4A C;  3NXS A;  4EIJ A;  2YKO A;  3MUD A;  3NTN A;  1SP4 A;  1N7S A;  3CI9 A;  4DOJ A;  3KPE A;  1FZB A;  1KZU B;  1A02 J;  2PP6 A;  3KYQ A;  4IFM A;  2CPS A;  1SFC A;  3A7O A;  2WPS A;  3IFM A;  1SFC D;  4WY4 C;  1LT9 B;  2XZR A;  2FFD B;  2Q5U A;  3N7N A;  1KIL D;  1VPC A;  3P7K A;  2FYU K;  2NPS A;  3RL0 C;  2GM4 A;  4W7Z A;  4N78 D;  1HGZ A;  3MTU E;  4WY4 A;  2W27 A;  1H89 A;  2IPP A;  3UIA A;  5AVT B;  2HG5 D;  5AVW B;  5KTB A;  4OH8 B;  2Q9I A;  5AVY B;  3HE5 B;  5APQ A;  3M9B A;  1HUC A;  1X79 B;  3PP5 A;  4JYB A;  4Y99 B;  3RK2 C;  3B5N B;  2HPC B;  1DX7 A;  5CCH D;  2IX7 C;  3U59 A;  3E1I A;  4I2L C;  1GTW A;  2WPQ A;  4RES B;  1ZV8 A;  1DH3 A;  2M3B A;  5BU5 A;  2WT7 B;  5KLV K;  2WIT A;  1GW3 A;  1HTL C;  2Q7C A;  1QL2 A;  1JCD A;  2PAJ A;  2HFE D;  2XNX A;  3TYY A;  2JJL A;  5BVZ A;  2POH A;  1JY3 O;  3HUS C;  3P8M C;  1SFC B;  1YTZ T;  3U1C A;  2Z5I A;  5CCH C;  1CW5 A;  1YTZ I;  1GDT A;  2KYV A;  1FOS E;  1T3U A;  4HYT B;  5CCG C;  3WMM 0;  1GW4 A;  3C9I A;  1KIL B;  2Z5H A;  1NKN A;  3L4F A;  2I1J A;  1G1I A;  1N7L A;  2C9L Y;  1SQP K;  1G2C A;  3HE5 A;  2C9N Y;  2N9B A;  3HD7 B;  2HYN A;  1AQ5 A;  4C7N B;  1XTG B;  5CCH A;  2P7J A;  2KLV A;  3V2P A;  2O01 H;  1LT9 C;  4WY4 B;  1SQB K;  4GT1 A;  1L0N K;  1WT6 A;  5CCG A;  4WB4 A;  3MD0 A;  1J1D C;  5CJ0 A;  2I1K A;  4C7N A;  1RF1 B;  3H32 A;  1NHL A;  2N1T A;  3T97 A;  2KB7 P;  2LKM A;  2Z4E A;  5BU8 B;  5AW1 B;  2MJZ A;  1NTK K;  5APV A;  1IFI A;  1LWU C;  2YMY A;  1G1J A;  1X9V A;  2NPS D;  1IFD A;  3VYI A;  1RF1 A;  2OYI A;  3M0D C;  2R3C A;  3HUS B;  1J1E B;  2FKW B;  4ZKP A;  3U1A A;  3V2Q A;  3H6P A;  1N7S C;  5APX A;  4GKG A;  5APS A;  5CHX A;  3L36 A;  1GL2 B;  1LWU B;  2FYZ A;  2O1J A;  2J59 M;  1NTM K;  2YKP A;  2A45 G;  1JTH B;  2IFM A;  1AFO A;  1N73 B;  2P2U A;  4AQR D;  1J1D B;  2M8R A;  1GL2 A;  3V5B A;  1SVF A;  3HD7 D;  2GUV A;  3NFQ A;  1KIL C;  2ZXE B;  3KDP B;  2FXM A;  1NWQ A;  1LTG C;  1ZR4 A;  2R5D A;  2J58 A;  1L4A A;  4XE5 B;  1T3J A;  1FZC A;  3MGN A;  4N3Y B;  1KFM A;  3OAK A;  1S9K D;  1GU5 A;  2H7H A;  2YO3 A;  1HGV A;  1IC2 A;  1LTJ C;  1NTZ K;  2QM8 A;  2VRS A;  3P8C E;  3VMZ A;  2W6A A;  4C7R A;  3RK2 D;  1HVV A;  3OJA B;  3RK3 D;  1KQL A;  2JEE A;  4N78 E;  2O1K A;  1SQQ K;  1ZLL A;  2WWW A;  3I5C A;  3R2P A;  2NPS B;  5APU A;  4AYC A;  1SQV K;  1URQ D;  3VMY A;  2H43 A;  1RF0 C;  3V4Q A;  1FAV A;  5AW9 B;  1RF1 C;  1IK9 A;  1HJB A;  1SFC C;  3VP9 A;  3TSI A;  5AW0 B;  2WTY A;  4W80 A;  1A02 F;  1ZR2 A;  1NU1 K;  1L0L K;  4EOT A;  2C0W A;  1RE4 A;  3B5N A;  1G2C B;  4ZKU A;  2XU6 A;  2WT7 A;  1L4A B;  1FZC B;  4KHX A;  2NPS C;  1JOC A;  5AVZ B;  1SLQ A;  2XV5 A;  3LIE A;  1JCC A;  1H88 A;  4IFF A;  2OYH C;  2H8P D;  2OYI C;  1N73 A;  1LTJ B;  1JY3 N;  2YKQ A;  2XKM A;  4C46 A;  1FDM A;  1NAF A;  1GZL A;  1FZE A;  3GHG A;  3RL0 B;  3MIW A;  5APY A;  2L5G B;  4IFD K;  3CL3 D;  5AW5 B;  2P1J A;  1FZF A;  4WY4 D;  5AW7 B;  1N73 C;  2YO2 A;  1M1J C;  3EQ2 A;  1JUN A;  1JY2 P;  2GUS A;  1NKZ B;  5AW6 B;  2FFD C;  3L35 A;  2WZ7 A;  3V2N A;  1M1J B;  2N1T C;  3M06 A;  1MFZ A;  4XA4 A;  1OXZ A;  1JTH A;  2A45 I;  1CI6 B;  1JY2 O;  1NO4 A;  4O9B A;  1RE4 C;  3B5N C;  3O8Z A;  3LW5 H;  3HE4 B;  4Y99 C;  3V2R A;  4I1L A;  3BRV B;  2C0X A;  1IO4 A;  1NH4 A;  1JY3 P;  1GL2 D;  3TNU A;  3EFG A;  1HWT C;  2N1T D;  1N7S D;  1FU1 A;  1N86 A;  1CI6 A;  3HD7 A;  1DEB A;  2OYI B;  1GK4 A;  3G3Z A;  1LGH B;  1T2K D;  2KSJ A;  1RE3 A;  5AW2 B;  1IJD B;  4B86 A;  1JY2 N;  1LT9 A;  1SQX K;  1QL1 A;  1FJK A;  1RF0 A;  1KIL A;  3HTK B;  1LTS C;  3HRN A;  1E5W A;  2WSF H;  3HE4 A;  2CPB A;  1RE3 C;  1IFN A;  3M9H A;  1M1J A;  1Z56 A;  4JF7 A;  3VN0 A;  2WSC H;  3BAT A;  1HBW A;  3BVH A;  2WPR A;  2HOD A;  1PFI A;  1JO5 A;  1T8Z A;  1NOH A;  5AVR B;  1URQ C;  1URQ B;  3VP8 A;  5CMZ A;  1XTC C;  3RK3 B;  3BAS A;  1LTB C;  3P8C D;  5AVQ B;  1J2J B;  5AW4 B;  1JMM A;  5APT A;  3A2A A;  1IFM A;  3GHG B;  3N4X A;  1FOS F;  1YYC A;  4N6J A;  1LTA C;  1L4A D;  1M7L A;  3NMD A;  4I6M C;  5AW3 B;  2KOG A;  1MV8 A;  1MZ9 A;  2YNY A;  4LLH A;  3HD7 C;  4M3L A;  1FZG A;  2ZFC A;  3B5N D;  1H8A A;  1OWA A;  3HTK A;  5KJ7 C;  3L37 A;  4HH2 A;  3SWF A;  5APW A;  1S9K E;  2P67 A;  3KQG A;  5AW8 B;  5KJ7 A;  2KP8 A;  1CSB A;  3A3Y B;  4LC1 A;  4DZO A;  3II6 A;  1IFJ A;  1MUU A;  1LTI C;  3M0A A;  3P32 A;  2E42 A;  1LTT C;  1FBM A;  1LWU A;  1W2E A;  3GHG C;  2HPC A;  3RL0 D;  3V4W A;  2HLO A;  2BAS A;  2XDJ A;  3TK1 A;  1FJP A;  4AUW A;  2A45 H;  3RK3 C;  1CZQ A;  3OA7 A;  3CLQ A;  5KJ7 D;  3VMX A;  3B8E B;  2R5B A;  1URQ A;  1FZA A;  2FFD A;  5CCG D;  5AVU B;  1X8Y A;  2OAR A;  4W7Y A;  3LID A;  3M91 A;  1HH0 A;  3M0D A;  4WBA A;  3IR9 A;  1RY3 A;  2R32 A;  1VDF A;  2OYH A;  1GL2 C;  3RK2 B;  1ZN5 A;  3HUS A;  1WRG A;  2WSE H;  1N7S B;  3TNU B;  4JYC A;  5AVX B;  1KFN A;  1J1E C;  5AVV B;  1GU4 A;  2W6B A;  2OYH B;  4LGD E;  2Q3I A;  1GD2 E;  1JNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...