2WSEH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords AT3G54890
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wseH01
1NTMK 1NTZK 2FYUK 1SQVK 1NU1K 2OARA 3LW5H 1SQBK 2WSCH 2LKMA 1SQQK 1SQPK 2J59M 1SQXK 5KLVK 1L0NK 1L0LK 1NTKK 4IFDK 3G3ZA 2WSEH 2O01H 2WSFH 3CLQA 3M9QA
chains in the Genus database with same CATH superfamily
3EQ2A 4RKUJ 3RL0C 3CWBE 1HBWA 1Y9BA 4BRYA 1YJ9P 1N8RQ 1OMIA 5AW0B 1KILE 2YNYA 1LGHB 1BE3J 3H32A 1P84I 1ZXGA 3NFQA 1IJDB 2QSIA 1JNMA 1JY3N 2OTJP 2C0XA 1NU1J 3E1IA 1JY3O 2E75C 3GW6A 5GTIE 3G6EP 4UB6H 1KYOH 1SQXG 5APYA 1CW5A 1FDOA 3O6QB 1NAYA 2QA4P 2QRXA 4L73A 3H1IE 1VDFA 3L74G 3RK3C 3TYYA 3TGUJ 3VMYA 2IFMA 1SP4A 3ZDMA 1X8YA 1X9VA 2FYUG 2QJPC 1JM0A 1GW3A 1OXZA 1USDA 1XTCC 3ABVC 1L0NE 3B4SA 1BGYJ 1E79H 1M57D 3HUSA 4H13D 4Y99B 5AVXB 4EDFA 3PRJA 1VQ9P 2IBZI 1KFNA 2OYOA 3AE5C 3HE5B 4WY4B 1KN7A 3GMAA 3MD0A 2I8DA 1JUNA 3QWOC 4C46A 4PV1B 4ASVA 3BATA 2E76D 1AVOA 2WVRA 1JY2O 3RGUA 3E1RA 3V4WA 3C8VA 3VYIA 1BGYD 5H2FH 3G4SP 2YMYA 1KYOD 1M1JA 2ZYGA 5AW1B 2KZIA 1NKNA 3AE1C 2NPSD 4OGQD 5CCGD 1NO4A 1P84E 3FXEA 1YTZT 4RESB 3TGUG 3CCRP 3CC2P 3B5NA 3H32B 3L74J 4TLFA 1S9KE 3L73G 2P2UA 3C9IA 1MFZA 3VMAA 3TF5A 3M0DC 2E75B 3RK3E 1KB9H 3L75G 4C7NB 1LP1A 4LLHA 3KXDA 3G3ZA 2R5DA 1BE3D 1SFCC 1FS0E 3EFFK 1NTME 1AVYA 3GHGC 4W80A 1NTMD 3R2PA 1FAVA 1NAFA 1ZV8A 2QJYC 2W83C 3L70J 5BVZA 2BASA 1DEBA 3BRTB 2KK7A 5CCHA 4ZMDA 5AW7B 4IL6X 1SQVD 2E74B 5GTHH 3H1LE 4RJTA 3JSVC 3FXDA 5EFWB 5KKZB 4QMAA 2OTLP 4KT0J 3H1JE 3A0HH 1HGVA 2Q1KA 3V2QA 1JMBA 1PGOA 1PP9G 1GL2D 2NZ2A 2QM7A 2RKLA 1KQLA 3L71D 4N3YB 2VRSA 3Q5PA 2ZT9C 3FWNA 1LTTC 1L0NG 1SQXK 3NTNA 3TSIA 1EXJA 5DJUB 2OTKE 3AE7C 3H6PA 5APTA 1H8AA 3CCEP 3MIWA 2Q9IA 1VQ8P 1LTJB 1URQA 2IFNA 4K35A 5CMZA 1EQ7A 1EDLA 2WSEH 3H1JJ 4H0LB 2P1JA 4IFMA 3L73E 4HH2A 2Y0DA 1VPCA 2HR3A 3CLQA 3HD7D 3WU2E 4K3AA 4KHXA 1EZVI 1ZMEC 1VF5D 3WUUA 1LWUA 2AEFA 2KB7P 3V4QA 5CCGA 3Q5SA 1A02F 2GUVA 1Q2NA 4XA4A 5AVWB 1OIPA 3HE5A 3AEBC 2ZXXA 3GF7A 4D6TJ 2M3BA 2O3JA 4LC1A 3RK2D 3HUSB 1LT9B 3P32A 1JO5A 2ZT9D 2NPSB 3B5NB 1WRGA 1NU1D 4OGQB 5E79H 1DEEG 1KQGB 2IPPA 3SFDC 1DIPA 2HG5D 1NYHA 1FZEA 2J58A 2N1TB 2LKMA 1URQD 3M9BA 2HLOA 3MTUE 3O6QA 1IZNB 3JCUE 1OX3A 1LWUB 1SQPK 3A3YB 3AE9C 2IX7C 1OWAA 2I1KA 5KLVK 1YI2P 1LWUC 1LTBC 2W90A 3L37A 3QH9A 3USSA 1KD1Q 2XKMA 1U7JA 3CXHE 4JQ0D 3S9OA 1NHLA 3ITKA 1KQSO 1GTWA 1M90Q 2N1TD 3N7NA 3I56P 2E42A 1NTZE 1NTMJ 1L0ND 1MFTA 2QEXP 2G8YA 1S3JA 1ZOYC 1LTGC 3CC4P 1J1DC 1M1JC 1NOHA 1OVVA 3L36A 4U7JA 3L4FA 2Z4EA 2M5AB 3RK2C 3V6IA 3VN0A 1GW4A 1VQ4P 4L74A 2FYUD 4GODA 3H1IG 2DW3A 3AEDC 3L74E 3UIAA 1VQ7P 3F89A 3L74D 4HB1A 1LTAC 1LTIC 3F5HA 1YJNP 1K04A 1KYOE 1J2JB 1JY3P 3R4YA 3HD7C 5L8RJ 4AYCA 4OGQC 2LR2A 3FWLA 5AW4B 2JDIH 5AVTB 1RF0A 2E5TA 2N1TA 3IF4A 2BCCD 2Y9YA 3SSUA 1SQBE 2BCCE 3IAOA 4EIJA 1FZCA 4YXWH 1JY2N 1QVFO 2B89A 3L70E 2JKVA 2Q3IA 1S4XA 1N2DC 4I6MC 1X0TA 2OGUA 4C7NA 1ZRTD 1KZUB 2P7JA 4H13C 3W67A 2BEZF 3L71G 3TGUE 3A7OA 3TGUD 1L0LG 1NVOA 2FKWB 1G1JA 2UWJE 5B5EH 1NTMK 4XE5B 3MP7B 1KILA 1J1DB 1M1JB 1AFOA 2JJLA 3KZIH 1S1CX 4C7RA 1PP9J 4PJ0E 1RF1C 4TT3H 3O8ZA 2BEQD 1FC2C 4WWIA 1BCCD 4HYTB 1PGQA 1BCCE 2Y0EA 4ZKUA 1H0TA 1GU5A 2RN0A 2WSCJ 1NTMG 4WY4A 1KMIZ 1N73C 1SVFA 2AEMA 2IBZE 3G9RA 4UB6E 3PP5A 1YBKA 3T97B 1NTKD 3CWBG 3L71J 4Z1MH 3HD7A 3L75D 4H44B 1YHQP 1HWTC 1FZFA 2Q7CA 3RBXA 4DZOA 3CPWO 1QLED 1SQXE 5TISE 1VQ6P 5AVZB 1KV4A 3L72D 4PD4I 2NPSC 3L72E 4OH8B 4B86A 3AE4C 1JCCA 2WITA 3L75J 1T8ZA 3LIEA 1NWQA 4PV1D 1JTHB 1FJKA 2HFED 3BASA 4U3FE 2O01J 2PGDA 4WY4C 1N73A 1AA0A 2M8RA 5KAIH 1SQPJ 3CXHI 2HPCA 1GK4A 2KUBA 2IYPA 3AE6C 5CCHD 2H7HA 1E5WA 1IO4A 4ASWA 1PP9D 1L4AB 1R5SA 2J59M 2K1AA 2LXBA 1U57A 5KJ7C 1VQKP 3OJAB 2O1KA 4HKZH 3D70A 1L0NK 3RK3D 5APVA 2FFDA 1PZQA 2XU6A 1ZR4A 2CPSA 5AW9B 2QJYB 3K5BA 2YIUC 1QGKB 3C1LA 5B5EE 1DH3A 2WTYA 2QJPB 2W6JH 3TK1A 2PFXA 1IFIA 2FBWC 1N7LA 1KYOI 4Y99C 4D6TD 3FX0A 5KKZC 1W5CE 1Q7YQ 4R4LA 3H1KG 3Q1MA 1YQ4C 2W8ZA 3H1HE 1OW8A 1EC5A 1BE3G 4YPCA 1SQVE 2RH0A 5AW6B 4YXDC 3BCCD 1NTZK 2KIKA 1N7SC 2V4HA 5KLIB 3AEFC 4MN4C 1Z56A 2KS1A 5APXA 2CPBA 2K88A 1Q82Q 1L4AA 1N7SD 1S5LX 1SQQD 1IFPA 1MUUA 1RH5B 2FXOA 2WSCH 1SQQE 3H1IJ 4H0LC 5C39A 4CPGA 3KZIE 1SQPD 1MZ9A 3W68A 3AE8C 2KZJA 1BCCG 3CI9A 3CCQP 2ZT9B 3B5ND 4IOIH 5APWA 3HE4A 2HPCB 5KLVG 1EZVE 2WT7A 1BGYG 2WWWA 4JPZB 3M0DA 4UB8H 2D2CD 1GL2A 1K05A 5AVSB 3D6YA 4OVNF 3B71A 2KXPB 2XNDH 4GIFA 1BDCA 1BDDA 1L0NJ 3BRVB 2IZ0A 2C0WA 5H2FE 1T2KC 1S5LE 1SQPG 1RF1B 2OYHC 1FE6A 2IDBA 5GTHE 2CK3H 1FBMA 2R5BA 1CI6A 1RF0C 1ZRTE 5AW2B 5KJ7D 2YO2A 3CMAP 1T6AA 2H8PD 1VF5B 3BVHA 1N7SA 2ZJSE 3GLMA 1FDIA 4EYYQ 1IFJA 1PPJG 3V2NA 3AE3C 1K8AQ 1PGPA 4RO0A 3T97A 2KNCA 5KLVJ 3AE2C 4IL6E 1G2CA 3M91A 4N78E 2K9JA 1VQ5P 1RE4C 1AJYA 1KILD 3NXSA 4IFFA 5B66E 4H44C 2N9YB 5E79E 1RQVA 3HUSC 4D6TG 5KAIE 1T3UA 3B5NC 1FJPA 1OFCX 1R5LA 5CJ4A 3PTZA 3EWKA 1JOCA 1GL2B 3HRNA 3P8CD 3S1KA 3P8CE 1X22A 3CCVP 1UIIA 2IBZD 2Z5IA 1KILB 1IFNA 5AW5B 1IK9A 2MJZA 1SQQJ 2R44A 3H1ID 1PPJD 2FFDB 2XDJA 1PPJE 1CZQA 2E74D 4JYBA 1Q81Q 3U1CA 4BWNA 3A0BH 1W2EA 2MKVA 3OA7A 3CC7P 4NPEA 2HODA 1SFCB 1QL1A 3BCCJ 3GHGB 2POHA 3AEAC 1ZLLA 2K37A 3H1KE 3PLNA 5APUA 3RL0D 1NJIQ 2WSFJ 1FDMA 2OYIB 4Y28J 2PAJA 1PL5A 3VTPC 1FZCB 1L4AC 3VOPA 1J1EB 5M1BA 1EDJA 1K73Q 2YKOA 3VMZA 2M0BA 3LW5H 2E5YA 5KLVD 5BU8B 3M9HA 5AW3B 2Q6QA 2YKQA 5KLVE 1SQBK 1L0LJ 4BXLA 2PRRA 1RQUA 4L76A 2V7QJ 1P84D 4PJ0H 2GA1A 1S9KD 3L72G 1U7MA 4W7ZA 1QVGO 1SQQG 1NH4A 1KTMA 3A0HE 4NPFX 2KNCB 1PV3A 1HGZA 1SQBD 4EI2A 1FOSF 5CCHC 3A2AA 1NTKK 4LGDE 2A06E 3BCCG 3L70D 2A06D 1RY3A 2ZFCA 3I5CA 1USEA 3HTKB 2OYHA 2AEJA 4PD4H 4I7ZC 4WY4D 1NTZJ 3SWYA 2WZ7A 4PV1C 2PP6A 3V2RA 2ZVOB 1A02J 1NGMB 1VL2A 1Y47A 2IYOA 1VQMP 3H1HD 1DD4A 3H1LD 4H13B 1IK7A 2G3AA 2QE7H 2W27A 1JEKA 1JTHA 2FXPA 3BCCE 3H1KJ 3HE4B 3A0BE 3L72J 1EZVG 2QG4A 5KAFE 2N9BA 4ZKPA 1L0LD 3WMM0 1M56D 1EDIA 1G1IA 2YIUB 4IL6H 2Z5HA 4DJGA 1PGJA 1FZCC 3KYQA 1BSNA 1GD2E 3SWFA 2R32A 2QJKB 1L0LK 1LT9A 2WSSH 3FGAD 1R8EA 1EZVD 2HYNA 4U3FJ 2ITAA 1BCCJ 1OW6A 2AXCA 2H89C 2N1TC 2ZYAA 1SS1A 2B87A 2BCCG 2W6BA 2AXTE 3AECC 2WPVB 3H1HG 2B9BA 2JO1A 3OAKA 3P7KA 2KSEA 1S5LH 4JF7A 1Q90D 1YJWP 2WPQA 2WQYC 3D6ZA 2K9YA 3CXHH 3L35A 3SFEC 2KP8A 2JP3A 2B88A 3TNUB 3IFMA 1KB9E 4N6JA 1LNQA 4U3FD 2QIWA 1FZAA 1SFCA 2IZ1A 2GUSA 3GHGA 4I1LA 4JBZA 1KQFB 3JC22 1NU1G 4OWFA 4YTPC 2FYUK 1LJ2A 1SQVK 3CL3D 3CWBD 1ZN5A 3KHUA 1PIXA 3M0AA 1NU1E 1TU3F 4R4MA 5TJHA 2OQQA 4N78D 2NRGA 1HJBA 1SQBG 1OVUA 1YTZI 4KJMA 2R3SA 1LTJC 1IFDA 1IFMA 1FOSE 3WUVA 1FU1A 1SQQK 2BCCJ 2LXCB 1RHZB 2XV5A 3MHVA 4NPDA 3TNUA 3M06A 1SLQA 3CX5I 1NTZG 1VF5C 2QJKC 3H1HJ 2WMMA 2E43A 1N73B 5APSA 1DD3A 1FZBA 2KI7B 3RL0B 1ZW0A 2FY8A 2K9JB 1GZLA 3CXHD 1EDKA 1NTZD 1HTLC 5APQA 1OW7A 2Y9ZA 1RE3C 3KDPB 2R3CA 3U59A 5CBOA 2FYZA 1N86A 3PHLA 4WVZA 2QVAA 4PD4E 1SQBJ 4ZNCA 3CMEP 4PD4D 1FZGA 2AXTH 1XTGB 2WPRA 1HH0A 3S4RA 2P10A 2ZAEB 2C9LY 3GF3A 2IBZG 3H1LG 1BGYE 1Y8AA 2KSJA 4I7ZB 5KJ7A 1ZR2A 2A45H 2YMKA 1H0TB 1NTKJ 2KOGA 5K5GB 2V7QH 2OYIA 3RBZA 5CHXA 5B66H 1VQOP 2L5GB 3CCLP 1QX8A 4HJGH 2FYNB 1LTSC 3CCSP 1URQC 3CX5E 2C9NY 1NKZB 5GTIH 3PH0A 3CX5D 3HTKA 1Q86Q 3L70G 4GKGA 1QEXA 3WUTA 2O01H 3G71P 3GG2A 1W2BO 1BE3E 1VQLP 2Y0CA 3IN6A 3CCMP 3M9QA 3AEGC 3Q2YA 2JEEA 2ZYDA 2NPSA 1D7MA 3WU2H 3E7KA 3IR9A 1UIXA 2A45I 1SQVG 2B87B 2Q5UA 1RE3A 2FXMA 4DT0A 2YXQB 3H1JD 1ZP0C 3PJSK 3MUDA 5AVVB 1L2PA 1MKMA 3L71E 1N7SB 2JR8A 2ZVNB 4GDOA 3H25A 2I1JA 1AV1A 2HODB 1IC2A 1KORA 1LTJA 1KB9I 1GL2C 1URQB 2A06G 3B8EB 4DCKA 1GDTA 4WB4A 4BRYB 2OYIC 4AQRD 3TDKA 3Q5RA 2M5AA 1NTKE 5BU5A 4O9BA 3L75E 1OZHA 4U3FG 1GU4A 1WMKA 2A45G 3L73D 3H1KD 1SQXD 2FYUJ 1SQVJ 3NMDA 1T2KD 1X79B 3H1LJ 1QL2A 3RK2B 3MGNA 3RK3B 3RL0g 3V2PA 5TISH 4EOTA 4DOJA 1VQNP 1L4AD 2K3RA 3AEEC 1KC8Q 1RE4A 1YYCA 5AVUB 1S72P 2OYHB 1OVRA 1WT6A 1SFCD 3U1AA 5AVQB 5CBNA 4WBAA 3HD7B 1YQ3C 3KPEA 1EXIA 3D71A 3I55P 4AUWA 4H0LD 5AVYB 1H89A 3V5BA 2E74C 1HF9A 2JWDA 1AQTA 1CI6B 1PP9E 1JMMA 3N4XA 4GOFA 1JB0J 1HVVA 1CSBA 2H88C 4I2LC 4A7PA 1KFMA 3LW5J 1PFIA 1JCDA 2QM8A 4GT1A 5CCGC 3VMXA 2SPZA 1P84H 1JY2P 1S2EA 4L75A 2KLVA 3EFGA 2KYVA 5AW8B 2WT7B 2E76C 5DJTB 3CWBJ 4D6TE 4H44D 1KILC 2XZRA 1M7LA 2XNXA 2YXRB 4GOEA 1YIJP 2FYNC 3OW2O 3MZWB 2O1JA 1LT1A 4W7YA 3KQGA 2YO3A 3VP9A 2KS1B 2GM4A 1NU1K 2Q3EA 3MUDC 3VP8A 3CCUP 2FYUE 3A5TA 2OARA 1NTKG 2P58A 1HJ0A 1L0LE 2ZXEB 1HUCA 3Q3DA 2YKPA 1AQ5A 1MV8A 3II6A 2W6AA 1BSHA 2O01N 1SQPE 1J1EC 1M8OB 4UB8E 1H88A 1GK6A 1LT9C 2D2CB 3CX5H 2RMZA 3LIDA 2H43A 2P67A 2E75D 2D2CC 2WSEJ 3H1JG 1YITP 5KAFH 3JCUH 1DX7A 1K9MQ 2JWAA 1G2CB 2WPSA 5KTBA 2M3EA 1VQPP 5AVRB 3CD6P 4IFDK 2L91A 1SQXJ 3SWKA 1M1KQ 3L73J 2WSFH 2E76B 4M3LA 5CJ0A 3CCJP 4XFJA 2FFDC 2J5UA 5KLIC 2KLUA 1KB9D 4JYCA 1GMJA 1RF1A 3P8MC 1T3JA 1LP1B
chains in the Genus database with same CATH topology
3EQ2A 1HBWA 5AW0B 2YNYA 1LGHB 3H32A 3NFQA 1IJDB 1JNMA 1JY3N 2C0XA 3E1IA 1JY3O 5APYA 1CW5A 1VDFA 3RK3C 3TYYA 3VMYA 2IFMA 1SP4A 1X8YA 1X9VA 3B5NA 5CHXA 1GW3A 1OXZA 5AVTB 1XTCC 3HUSA 4Y99B 5AVXB 1KFNA 3HE5B 4WY4B 3MD0A 1JUNA 4C46A 3BATA 1JY2O 3V4WA 3VYIA 2YMYA 1M1JA 5AW1B 5CCGD 1NKNA 2NPSD 1NO4A 4RESB 1YTZT 3H32B 1S9KE 2P2UA 3C9IA 1MFZA 3M0DC 4C7NB 4LLHA 3G3ZA 2R5DA 1SFCC 3GHGC 4W80A 3R2PA 1FAVA 1NAFA 1ZV8A 5BVZA 2BASA 1DEBA 3BRTB 5CCHA 5AW7B 1HGVA 3V2QA 2QM7A 4N3YB 1GL2D 1KQLA 2VRSA 3NTNA 1LTTC 3TSIA 1SQXK 3H6PA 5APTA 1H8AA 3MIWA 2Q9IA 1LTJB 1URQA 2IFNA 5CMZA 1EQ7A 2WSEH 2P1JA 4IFMA 4HH2A 1VPCA 3CLQA 3HD7D 4KHXA 1LWUA 2KB7P 3V4QA 5CCGA 1A02F 2GUVA 4XA4A 5AVWB 3HE5A 2M3BA 4LC1A 3RK2D 3HUSB 1LT9B 3P32A 1JO5A 3B5NB 2NPSB 3V2RA 1WRGA 2IPPA 2HG5D 2N1TB 1FZEA 2J58A 3MTUE 1URQD 3M9BA 2HLOA 2LKMA 1SQPK 3A3YB 1LWUB 2IX7C 1OWAA 2I1KA 5KLVK 1LWUC 1LTBC 3L37A 2XKMA 1NHLA 2E42A 1GTWA 2N1TD 3N7NA 1LTGC 1J1DC 1M1JC 1NOHA 3L36A 3L4FA 3RK2C 3VN0A 1GW4A 1AFOA 3UIAA 1LTAC 1LTIC 1J2JB 1JY3P 3HD7C 4AYCA 5AW4B 1RF0A 2N1TA 4EIJA 1FZCA 1JY2N 2Q3IA 4I6MC 1N2DC 4C7NA 2P7JA 1KZUB 3A7OA 2FKWB 1G1JA 1NTMK 4XE5B 1KILA 1J1DB 1M1JB 2JJLA 4C7RA 1RF1C 3O8ZA 4HYTB 4ZKUA 1GU5A 4WY4A 1N73C 1SVFA 3PP5A 3HD7A 1HWTC 1FZFA 2Q7CA 4DZOA 5AVZB 2NPSC 4OH8B 4B86A 1JCCA 2WITA 1T8ZA 3LIEA 1NWQA 1JTHB 1FJKA 2HFED 3BASA 4WY4C 1N73A 2M8RA 2HPCA 1GK4A 5CCHD 1E5WA 1IO4A 1L4AB 2J59M 5KJ7C 3OJAB 2O1KA 1L0NK 3RK3D 5APVA 2FFDA 2XU6A 1ZR4A 2CPSA 5AW9B 1DH3A 2WTYA 3TK1A 1IFIA 1N7LA 4Y99C 3RL0C 5AW6B 1FOSE 1NTZK 1N7SC 1Z56A 5APXA 2CPBA 1L4AA 1N7SD 2C9NY 1MUUA 2WSCH 1MZ9A 3CI9A 2HPCB 3B5ND 5APWA 3HE4A 2WT7A 2WWWA 3M0DA 1GL2A 5AVSB 4GIFA 3BRVB 1T2KC 2C0WA 2OYHC 1RF1B 2R5BA 1FBMA 1CI6A 1RF0C 5AW2B 5KJ7D 2YO2A 3BVHA 2H8PD 1N7SA 1IFJA 3V2NA 3T97A 1G2CA 3M91A 4N78E 1RE4C 1KILD 3NXSA 4IFFA 3HUSC 1FJPA 1T3UA 3B5NC 5CJ4A 3HRNA 1JOCA 1GL2B 3P8CD 3P8CE 2Z5IA 1KILB 1IFNA 5AW5B 1IK9A 2MJZA 2FFDB 2XDJA 1CZQA 4JYBA 3U1CA 1W2EA 3OA7A 2HODA 1SFCB 1QL1A 3GHGB 3RL0D 2POHA 1ZLLA 5APUA 1FDMA 2OYIB 2PAJA 3VTPC 1FZCB 1L4AC 3VOPA 1J1EB 2YKOA 3VMZA 3LW5H 3M9HA 5AW3B 2YKQA 1SQBK 1S9KD 4W7ZA 1NH4A 1HGZA 1FOSF 5CCHC 3A2AA 1NTKK 4LGDE 1RY3A 2ZFCA 3I5CA 2OYHA 3HTKB 4WY4D 3SWYA 2WZ7A 2PP6A 1A02J 2W27A 3HE4B 1JTHA 2N9BA 4ZKPA 3WMM0 1G1IA 2Z5HA 1FZCC 3KYQA 1GD2E 3SWFA 2R32A 1L0LK 1LT9A 2HYNA 2N1TC 3OAKA 2W6BA 3P7KA 4JF7A 2WPQA 3L35A 2KP8A 3TNUB 2H7HA 3IFMA 4N6JA 1FZAA 1SFCA 3GHGA 2GUSA 4I1LA 2FYUK 1SQVK 3CL3D 3M0AA 1ZN5A 4N78D 1HJBA 1YTZI 1LTJC 1IFDA 1IFMA 1FU1A 1SQQK 2XV5A 3TNUA 5BU8B 3M06A 1SLQA 2E43A 1N73B 5APSA 1FZBA 3RL0B 1GZLA 1HTLC 5APQA 1RE3C 3KDPB 2R3CA 3U59A 2FYZA 1N86A 1FZGA 1XTGB 2WPRA 1HH0A 2C9LY 2KSJA 5KJ7A 1ZR2A 2A45H 2KOGA 2OYIA 2L5GB 1LTSC 1URQC 1NKZB 3HTKA 4GKGA 2O01H 3M9QA 2JEEA 2NPSA 3IR9A 2A45I 2Q5UA 1RE3A 2FXMA 3MUDA 5AVVB 1N7SB 2I1JA 2HODB 1IC2A 1LTJA 1URQB 1GL2C 1GDTA 3B8EB 4WB4A 2OYIC 4AQRD 5BU5A 4O9BA 1GU4A 2A45G 3NMDA 1T2KD 1X79B 1QL2A 3RK2B 3MGNA 3RK3B 3V2PA 4EOTA 4DOJA 1L4AD 2OYHB 1RE4A 1YYCA 5AVUB 1WT6A 1SFCD 3U1AA 5AVQB 4WBAA 3HD7B 3KPEA 4AUWA 5AVYB 1H89A 3V5BA 1CI6B 1JMMA 3N4XA 1HVVA 1CSBA 4I2LC 1KFMA 1PFIA 1JCDA 2QM8A 4GT1A 5CCGC 3VMXA 1JY2P 2KLVA 3EFGA 2KYVA 5AW8B 2WT7B 1KILC 2XZRA 1M7LA 2XNXA 2O1JA 4W7YA 3KQGA 2YO3A 3VP9A 2GM4A 1NU1K 3VP8A 3A5TA 2OARA 2ZXEB 1HUCA 1AQ5A 2YKPA 1MV8A 3II6A 2W6AA 1J1EC 1H88A 1GK6A 1LT9C 2H43A 3LIDA 2P67A 1DX7A 1G2CB 2WPSA 5KTBA 4IFDK 5AVRB 2Z4EA 4M3LA 2WSFH 5CJ0A 2FFDC 4JYCA 1RF1A 3P8MC 1T3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM K;  1NTZ K;  2FYU K;  1SQV K;  1NU1 K;  2OAR A;  3LW5 H;  1SQB K;  2WSC H;  2LKM A;  1SQQ K;  1SQP K;  2J59 M;  1SQX K;  5KLV K;  1L0N K;  1L0L K;  1NTK K;  4IFD K;  3G3Z A;  2WSE H;  2O01 H;  2WSF H;  3CLQ A;  3M9Q A; 
#chains in the Genus database with same CATH topology
 3EQ2 A;  4RKU J;  3RL0 C;  3CWB E;  1HBW A;  1Y9B A;  4BRY A;  1YJ9 P;  1N8R Q;  1OMI A;  5AW0 B;  1KIL E;  2YNY A;  1LGH B;  1BE3 J;  3H32 A;  1P84 I;  1ZXG A;  3NFQ A;  1IJD B;  2QSI A;  1JNM A;  1JY3 N;  2OTJ P;  2C0X A;  1NU1 J;  3E1I A;  1JY3 O;  2E75 C;  3GW6 A;  5GTI E;  3G6E P;  4UB6 H;  1KYO H;  1SQX G;  5APY A;  1CW5 A;  1FDO A;  3O6Q B;  1NAY A;  2QA4 P;  2QRX A;  4L73 A;  3H1I E;  1VDF A;  3L74 G;  3RK3 C;  3TYY A;  3TGU J;  3VMY A;  2IFM A;  1SP4 A;  3ZDM A;  1X8Y A;  1X9V A;  2FYU G;  2QJP C;  1JM0 A;  1GW3 A;  1OXZ A;  1USD A;  1XTC C;  3ABV C;  1L0N E;  3B4S A;  1BGY J;  1E79 H;  1M57 D;  3HUS A;  4H13 D;  4Y99 B;  5AVX B;  4EDF A;  3PRJ A;  1VQ9 P;  2IBZ I;  1KFN A;  2OYO A;  3AE5 C;  3HE5 B;  4WY4 B;  1KN7 A;  3GMA A;  3MD0 A;  2I8D A;  1JUN A;  3QWO C;  4C46 A;  4PV1 B;  4ASV A;  3BAT A;  2E76 D;  1AVO A;  2WVR A;  1JY2 O;  3RGU A;  3E1R A;  3V4W A;  3C8V A;  3VYI A;  1BGY D;  5H2F H;  3G4S P;  2YMY A;  1KYO D;  1M1J A;  2ZYG A;  5AW1 B;  2KZI A;  1NKN A;  3AE1 C;  2NPS D;  4OGQ D;  5CCG D;  1NO4 A;  1P84 E;  3FXE A;  1YTZ T;  4RES B;  3TGU G;  3CCR P;  3CC2 P;  3B5N A;  3H32 B;  3L74 J;  4TLF A;  1S9K E;  3L73 G;  2P2U A;  3C9I A;  1MFZ A;  3VMA A;  3TF5 A;  3M0D C;  2E75 B;  3RK3 E;  1KB9 H;  3L75 G;  4C7N B;  1LP1 A;  4LLH A;  3KXD A;  3G3Z A;  2R5D A;  1BE3 D;  1SFC C;  1FS0 E;  3EFF K;  1NTM E;  1AVY A;  3GHG C;  4W80 A;  1NTM D;  3R2P A;  1FAV A;  1NAF A;  1ZV8 A;  2QJY C;  2W83 C;  3L70 J;  5BVZ A;  2BAS A;  1DEB A;  3BRT B;  2KK7 A;  5CCH A;  4ZMD A;  5AW7 B;  4IL6 X;  1SQV D;  2E74 B;  5GTH H;  3H1L E;  4RJT A;  3JSV C;  3FXD A;  5EFW B;  5KKZ B;  4QMA A;  2OTL P;  4KT0 J;  3H1J E;  3A0H H;  1HGV A;  2Q1K A;  3V2Q A;  1JMB A;  1PGO A;  1PP9 G;  1GL2 D;  2NZ2 A;  2QM7 A;  2RKL A;  1KQL A;  3L71 D;  4N3Y B;  2VRS A;  3Q5P A;  2ZT9 C;  3FWN A;  1LTT C;  1L0N G;  1SQX K;  3NTN A;  3TSI A;  1EXJ A;  5DJU B;  2OTK E;  3AE7 C;  3H6P A;  5APT A;  1H8A A;  3CCE P;  3MIW A;  2Q9I A;  1VQ8 P;  1LTJ B;  1URQ A;  2IFN A;  4K35 A;  5CMZ A;  1EQ7 A;  1EDL A;  2WSE H;  3H1J J;  4H0L B;  2P1J A;  4IFM A;  3L73 E;  4HH2 A;  2Y0D A;  1VPC A;  2HR3 A;  3CLQ A;  3HD7 D;  3WU2 E;  4K3A A;  4KHX A;  1EZV I;  1ZME C;  1VF5 D;  3WUU A;  1LWU A;  2AEF A;  2KB7 P;  3V4Q A;  5CCG A;  3Q5S A;  1A02 F;  2GUV A;  1Q2N A;  4XA4 A;  5AVW B;  1OIP A;  3HE5 A;  3AEB C;  2ZXX A;  3GF7 A;  4D6T J;  2M3B A;  2O3J A;  4LC1 A;  3RK2 D;  3HUS B;  1LT9 B;  3P32 A;  1JO5 A;  2ZT9 D;  2NPS B;  3B5N B;  1WRG A;  1NU1 D;  4OGQ B;  5E79 H;  1DEE G;  1KQG B;  2IPP A;  3SFD C;  1DIP A;  2HG5 D;  1NYH A;  1FZE A;  2J58 A;  2N1T B;  2LKM A;  1URQ D;  3M9B A;  2HLO A;  3MTU E;  3O6Q A;  1IZN B;  3JCU E;  1OX3 A;  1LWU B;  1SQP K;  3A3Y B;  3AE9 C;  2IX7 C;  1OWA A;  2I1K A;  5KLV K;  1YI2 P;  1LWU C;  1LTB C;  2W90 A;  3L37 A;  3QH9 A;  3USS A;  1KD1 Q;  2XKM A;  1U7J A;  3CXH E;  4JQ0 D;  3S9O A;  1NHL A;  3ITK A;  1KQS O;  1GTW A;  1M90 Q;  2N1T D;  3N7N A;  3I56 P;  2E42 A;  1NTZ E;  1NTM J;  1L0N D;  1MFT A;  2QEX P;  2G8Y A;  1S3J A;  1ZOY C;  1LTG C;  3CC4 P;  1J1D C;  1M1J C;  1NOH A;  1OVV A;  3L36 A;  4U7J A;  3L4F A;  2Z4E A;  2M5A B;  3RK2 C;  3V6I A;  3VN0 A;  1GW4 A;  1VQ4 P;  4L74 A;  2FYU D;  4GOD A;  3H1I G;  2DW3 A;  3AED C;  3L74 E;  3UIA A;  1VQ7 P;  3F89 A;  3L74 D;  4HB1 A;  1LTA C;  1LTI C;  3F5H A;  1YJN P;  1K04 A;  1KYO E;  1J2J B;  1JY3 P;  3R4Y A;  3HD7 C;  5L8R J;  4AYC A;  4OGQ C;  2LR2 A;  3FWL A;  5AW4 B;  2JDI H;  5AVT B;  1RF0 A;  2E5T A;  2N1T A;  3IF4 A;  2BCC D;  2Y9Y A;  3SSU A;  1SQB E;  2BCC E;  3IAO A;  4EIJ A;  1FZC A;  4YXW H;  1JY2 N;  1QVF O;  2B89 A;  3L70 E;  2JKV A;  2Q3I A;  1S4X A;  1N2D C;  4I6M C;  1X0T A;  2OGU A;  4C7N A;  1ZRT D;  1KZU B;  2P7J A;  4H13 C;  3W67 A;  2BEZ F;  3L71 G;  3TGU E;  3A7O A;  3TGU D;  1L0L G;  1NVO A;  2FKW B;  1G1J A;  2UWJ E;  5B5E H;  1NTM K;  4XE5 B;  3MP7 B;  1KIL A;  1J1D B;  1M1J B;  1AFO A;  2JJL A;  3KZI H;  1S1C X;  4C7R A;  1PP9 J;  4PJ0 E;  1RF1 C;  4TT3 H;  3O8Z A;  2BEQ D;  1FC2 C;  4WWI A;  1BCC D;  4HYT B;  1PGQ A;  1BCC E;  2Y0E A;  4ZKU A;  1H0T A;  1GU5 A;  2RN0 A;  2WSC J;  1NTM G;  4WY4 A;  1KMI Z;  1N73 C;  1SVF A;  2AEM A;  2IBZ E;  3G9R A;  4UB6 E;  3PP5 A;  1YBK A;  3T97 B;  1NTK D;  3CWB G;  3L71 J;  4Z1M H;  3HD7 A;  3L75 D;  4H44 B;  1YHQ P;  1HWT C;  1FZF A;  2Q7C A;  3RBX A;  4DZO A;  3CPW O;  1QLE D;  1SQX E;  5TIS E;  1VQ6 P;  5AVZ B;  1KV4 A;  3L72 D;  4PD4 I;  2NPS C;  3L72 E;  4OH8 B;  4B86 A;  3AE4 C;  1JCC A;  2WIT A;  3L75 J;  1T8Z A;  3LIE A;  1NWQ A;  4PV1 D;  1JTH B;  1FJK A;  2HFE D;  3BAS A;  4U3F E;  2O01 J;  2PGD A;  4WY4 C;  1N73 A;  1AA0 A;  2M8R A;  5KAI H;  1SQP J;  3CXH I;  2HPC A;  1GK4 A;  2KUB A;  2IYP A;  3AE6 C;  5CCH D;  2H7H A;  1E5W A;  1IO4 A;  4ASW A;  1PP9 D;  1L4A B;  1R5S A;  2J59 M;  2K1A A;  2LXB A;  1U57 A;  5KJ7 C;  1VQK P;  3OJA B;  2O1K A;  4HKZ H;  3D70 A;  1L0N K;  3RK3 D;  5APV A;  2FFD A;  1PZQ A;  2XU6 A;  1ZR4 A;  2CPS A;  5AW9 B;  2QJY B;  3K5B A;  2YIU C;  1QGK B;  3C1L A;  5B5E E;  1DH3 A;  2WTY A;  2QJP B;  2W6J H;  3TK1 A;  2PFX A;  1IFI A;  2FBW C;  1N7L A;  1KYO I;  4Y99 C;  4D6T D;  3FX0 A;  5KKZ C;  1W5C E;  1Q7Y Q;  4R4L A;  3H1K G;  3Q1M A;  1YQ4 C;  2W8Z A;  3H1H E;  1OW8 A;  1EC5 A;  1BE3 G;  4YPC A;  1SQV E;  2RH0 A;  5AW6 B;  4YXD C;  3BCC D;  1NTZ K;  2KIK A;  1N7S C;  2V4H A;  5KLI B;  3AEF C;  4MN4 C;  1Z56 A;  2KS1 A;  5APX A;  2CPB A;  2K88 A;  1Q82 Q;  1L4A A;  1N7S D;  1S5L X;  1SQQ D;  1IFP A;  1MUU A;  1RH5 B;  2FXO A;  2WSC H;  1SQQ E;  3H1I J;  4H0L C;  5C39 A;  4CPG A;  3KZI E;  1SQP D;  1MZ9 A;  3W68 A;  3AE8 C;  2KZJ A;  1BCC G;  3CI9 A;  3CCQ P;  2ZT9 B;  3B5N D;  4IOI H;  5APW A;  3HE4 A;  2HPC B;  5KLV G;  1EZV E;  2WT7 A;  1BGY G;  2WWW A;  4JPZ B;  3M0D A;  4UB8 H;  2D2C D;  1GL2 A;  1K05 A;  5AVS B;  3D6Y A;  4OVN F;  3B71 A;  2KXP B;  2XND H;  4GIF A;  1BDC A;  1BDD A;  1L0N J;  3BRV B;  2IZ0 A;  2C0W A;  5H2F E;  1T2K C;  1S5L E;  1SQP G;  1RF1 B;  2OYH C;  1FE6 A;  2IDB A;  5GTH E;  2CK3 H;  1FBM A;  2R5B A;  1CI6 A;  1RF0 C;  1ZRT E;  5AW2 B;  5KJ7 D;  2YO2 A;  3CMA P;  1T6A A;  2H8P D;  1VF5 B;  3BVH A;  1N7S A;  2ZJS E;  3GLM A;  1FDI A;  4EYY Q;  1IFJ A;  1PPJ G;  3V2N A;  3AE3 C;  1K8A Q;  1PGP A;  4RO0 A;  3T97 A;  2KNC A;  5KLV J;  3AE2 C;  4IL6 E;  1G2C A;  3M91 A;  4N78 E;  2K9J A;  1VQ5 P;  1RE4 C;  1AJY A;  1KIL D;  3NXS A;  4IFF A;  5B66 E;  4H44 C;  2N9Y B;  5E79 E;  1RQV A;  3HUS C;  4D6T G;  5KAI E;  1T3U A;  3B5N C;  1FJP A;  1OFC X;  1R5L A;  5CJ4 A;  3PTZ A;  3EWK A;  1JOC A;  1GL2 B;  3HRN A;  3P8C D;  3S1K A;  3P8C E;  1X22 A;  3CCV P;  1UII A;  2IBZ D;  2Z5I A;  1KIL B;  1IFN A;  5AW5 B;  1IK9 A;  2MJZ A;  1SQQ J;  2R44 A;  3H1I D;  1PPJ D;  2FFD B;  2XDJ A;  1PPJ E;  1CZQ A;  2E74 D;  4JYB A;  1Q81 Q;  3U1C A;  4BWN A;  3A0B H;  1W2E A;  2MKV A;  3OA7 A;  3CC7 P;  4NPE A;  2HOD A;  1SFC B;  1QL1 A;  3BCC J;  3GHG B;  2POH A;  3AEA C;  1ZLL A;  2K37 A;  3H1K E;  3PLN A;  5APU A;  3RL0 D;  1NJI Q;  2WSF J;  1FDM A;  2OYI B;  4Y28 J;  2PAJ A;  1PL5 A;  3VTP C;  1FZC B;  1L4A C;  3VOP A;  1J1E B;  5M1B A;  1EDJ A;  1K73 Q;  2YKO A;  3VMZ A;  2M0B A;  3LW5 H;  2E5Y A;  5KLV D;  5BU8 B;  3M9H A;  5AW3 B;  2Q6Q A;  2YKQ A;  5KLV E;  1SQB K;  1L0L J;  4BXL A;  2PRR A;  1RQU A;  4L76 A;  2V7Q J;  1P84 D;  4PJ0 H;  2GA1 A;  1S9K D;  3L72 G;  1U7M A;  4W7Z A;  1QVG O;  1SQQ G;  1NH4 A;  1KTM A;  3A0H E;  4NPF X;  2KNC B;  1PV3 A;  1HGZ A;  1SQB D;  4EI2 A;  1FOS F;  5CCH C;  3A2A A;  1NTK K;  4LGD E;  2A06 E;  3BCC G;  3L70 D;  2A06 D;  1RY3 A;  2ZFC A;  3I5C A;  1USE A;  3HTK B;  2OYH A;  2AEJ A;  4PD4 H;  4I7Z C;  4WY4 D;  1NTZ J;  3SWY A;  2WZ7 A;  4PV1 C;  2PP6 A;  3V2R A;  2ZVO B;  1A02 J;  1NGM B;  1VL2 A;  1Y47 A;  2IYO A;  1VQM P;  3H1H D;  1DD4 A;  3H1L D;  4H13 B;  1IK7 A;  2G3A A;  2QE7 H;  2W27 A;  1JEK A;  1JTH A;  2FXP A;  3BCC E;  3H1K J;  3HE4 B;  3A0B E;  3L72 J;  1EZV G;  2QG4 A;  5KAF E;  2N9B A;  4ZKP A;  1L0L D;  3WMM 0;  1M56 D;  1EDI A;  1G1I A;  2YIU B;  4IL6 H;  2Z5H A;  4DJG A;  1PGJ A;  1FZC C;  3KYQ A;  1BSN A;  1GD2 E;  3SWF A;  2R32 A;  2QJK B;  1L0L K;  1LT9 A;  2WSS H;  3FGA D;  1R8E A;  1EZV D;  2HYN A;  4U3F J;  2ITA A;  1BCC J;  1OW6 A;  2AXC A;  2H89 C;  2N1T C;  2ZYA A;  1SS1 A;  2B87 A;  2BCC G;  2W6B A;  2AXT E;  3AEC C;  2WPV B;  3H1H G;  2B9B A;  2JO1 A;  3OAK A;  3P7K A;  2KSE A;  1S5L H;  4JF7 A;  1Q90 D;  1YJW P;  2WPQ A;  2WQY C;  3D6Z A;  2K9Y A;  3CXH H;  3L35 A;  3SFE C;  2KP8 A;  2JP3 A;  2B88 A;  3TNU B;  3IFM A;  1KB9 E;  4N6J A;  1LNQ A;  4U3F D;  2QIW A;  1FZA A;  1SFC A;  2IZ1 A;  2GUS A;  3GHG A;  4I1L A;  4JBZ A;  1KQF B;  3JC2 2;  1NU1 G;  4OWF A;  4YTP C;  2FYU K;  1LJ2 A;  1SQV K;  3CL3 D;  3CWB D;  1ZN5 A;  3KHU A;  1PIX A;  3M0A A;  1NU1 E;  1TU3 F;  4R4M A;  5TJH A;  2OQQ A;  4N78 D;  2NRG A;  1HJB A;  1SQB G;  1OVU A;  1YTZ I;  4KJM A;  2R3S A;  1LTJ C;  1IFD A;  1IFM A;  1FOS E;  3WUV A;  1FU1 A;  1SQQ K;  2BCC J;  2LXC B;  1RHZ B;  2XV5 A;  3MHV A;  4NPD A;  3TNU A;  3M06 A;  1SLQ A;  3CX5 I;  1NTZ G;  1VF5 C;  2QJK C;  3H1H J;  2WMM A;  2E43 A;  1N73 B;  5APS A;  1DD3 A;  1FZB A;  2KI7 B;  3RL0 B;  1ZW0 A;  2FY8 A;  2K9J B;  1GZL A;  3CXH D;  1EDK A;  1NTZ D;  1HTL C;  5APQ A;  1OW7 A;  2Y9Z A;  1RE3 C;  3KDP B;  2R3C A;  3U59 A;  5CBO A;  2FYZ A;  1N86 A;  3PHL A;  4WVZ A;  2QVA A;  4PD4 E;  1SQB J;  4ZNC A;  3CME P;  4PD4 D;  1FZG A;  2AXT H;  1XTG B;  2WPR A;  1HH0 A;  3S4R A;  2P10 A;  2ZAE B;  2C9L Y;  3GF3 A;  2IBZ G;  3H1L G;  1BGY E;  1Y8A A;  2KSJ A;  4I7Z B;  5KJ7 A;  1ZR2 A;  2A45 H;  2YMK A;  1H0T B;  1NTK J;  2KOG A;  5K5G B;  2V7Q H;  2OYI A;  3RBZ A;  5CHX A;  5B66 H;  1VQO P;  2L5G B;  3CCL P;  1QX8 A;  4HJG H;  2FYN B;  1LTS C;  3CCS P;  1URQ C;  3CX5 E;  2C9N Y;  1NKZ B;  5GTI H;  3PH0 A;  3CX5 D;  3HTK A;  1Q86 Q;  3L70 G;  4GKG A;  1QEX A;  3WUT A;  2O01 H;  3G71 P;  3GG2 A;  1W2B O;  1BE3 E;  1VQL P;  2Y0C A;  3IN6 A;  3CCM P;  3M9Q A;  3AEG C;  3Q2Y A;  2JEE A;  2ZYD A;  2NPS A;  1D7M A;  3WU2 H;  3E7K A;  3IR9 A;  1UIX A;  2A45 I;  1SQV G;  2B87 B;  2Q5U A;  1RE3 A;  2FXM A;  4DT0 A;  2YXQ B;  3H1J D;  1ZP0 C;  3PJS K;  3MUD A;  5AVV B;  1L2P A;  1MKM A;  3L71 E;  1N7S B;  2JR8 A;  2ZVN B;  4GDO A;  3H25 A;  2I1J A;  1AV1 A;  2HOD B;  1IC2 A;  1KOR A;  1LTJ A;  1KB9 I;  1GL2 C;  1URQ B;  2A06 G;  3B8E B;  4DCK A;  1GDT A;  4WB4 A;  4BRY B;  2OYI C;  4AQR D;  3TDK A;  3Q5R A;  2M5A A;  1NTK E;  5BU5 A;  4O9B A;  3L75 E;  1OZH A;  4U3F G;  1GU4 A;  1WMK A;  2A45 G;  3L73 D;  3H1K D;  1SQX D;  2FYU J;  1SQV J;  3NMD A;  1T2K D;  1X79 B;  3H1L J;  1QL2 A;  3RK2 B;  3MGN A;  3RK3 B;  3RL0 g;  3V2P A;  5TIS H;  4EOT A;  4DOJ A;  1VQN P;  1L4A D;  2K3R A;  3AEE C;  1KC8 Q;  1RE4 A;  1YYC A;  5AVU B;  1S72 P;  2OYH B;  1OVR A;  1WT6 A;  1SFC D;  3U1A A;  5AVQ B;  5CBN A;  4WBA A;  3HD7 B;  1YQ3 C;  3KPE A;  1EXI A;  3D71 A;  3I55 P;  4AUW A;  4H0L D;  5AVY B;  1H89 A;  3V5B A;  2E74 C;  1HF9 A;  2JWD A;  1AQT A;  1CI6 B;  1PP9 E;  1JMM A;  3N4X A;  4GOF A;  1JB0 J;  1HVV A;  1CSB A;  2H88 C;  4I2L C;  4A7P A;  1KFM A;  3LW5 J;  1PFI A;  1JCD A;  2QM8 A;  4GT1 A;  5CCG C;  3VMX A;  2SPZ A;  1P84 H;  1JY2 P;  1S2E A;  4L75 A;  2KLV A;  3EFG A;  2KYV A;  5AW8 B;  2WT7 B;  2E76 C;  5DJT B;  3CWB J;  4D6T E;  4H44 D;  1KIL C;  2XZR A;  1M7L A;  2XNX A;  2YXR B;  4GOE A;  1YIJ P;  2FYN C;  3OW2 O;  3MZW B;  2O1J A;  1LT1 A;  4W7Y A;  3KQG A;  2YO3 A;  3VP9 A;  2KS1 B;  2GM4 A;  1NU1 K;  2Q3E A;  3MUD C;  3VP8 A;  3CCU P;  2FYU E;  3A5T A;  2OAR A;  1NTK G;  2P58 A;  1HJ0 A;  1L0L E;  2ZXE B;  1HUC A;  3Q3D A;  2YKP A;  1AQ5 A;  1MV8 A;  3II6 A;  2W6A A;  1BSH A;  2O01 N;  1SQP E;  1J1E C;  1M8O B;  4UB8 E;  1H88 A;  1GK6 A;  1LT9 C;  2D2C B;  3CX5 H;  2RMZ A;  3LID A;  2H43 A;  2P67 A;  2E75 D;  2D2C C;  2WSE J;  3H1J G;  1YIT P;  5KAF H;  3JCU H;  1DX7 A;  1K9M Q;  2JWA A;  1G2C B;  2WPS A;  5KTB A;  2M3E A;  1VQP P;  5AVR B;  3CD6 P;  4IFD K;  2L91 A;  1SQX J;  3SWK A;  1M1K Q;  3L73 J;  2WSF H;  2E76 B;  4M3L A;  5CJ0 A;  3CCJ P;  4XFJ A;  2FFD C;  2J5U A;  5KLI C;  2KLU A;  1KB9 D;  4JYC A;  1GMJ A;  1RF1 A;  3P8M C;  1T3J A;  1LP1 B; 
#chains in the Genus database with same CATH homology
 3EQ2 A;  1HBW A;  5AW0 B;  2YNY A;  1LGH B;  3H32 A;  3NFQ A;  1IJD B;  1JNM A;  1JY3 N;  2C0X A;  3E1I A;  1JY3 O;  5APY A;  1CW5 A;  1VDF A;  3RK3 C;  3TYY A;  3VMY A;  2IFM A;  1SP4 A;  1X8Y A;  1X9V A;  3B5N A;  5CHX A;  1GW3 A;  1OXZ A;  5AVT B;  1XTC C;  3HUS A;  4Y99 B;  5AVX B;  1KFN A;  3HE5 B;  4WY4 B;  3MD0 A;  1JUN A;  4C46 A;  3BAT A;  1JY2 O;  3V4W A;  3VYI A;  2YMY A;  1M1J A;  5AW1 B;  5CCG D;  1NKN A;  2NPS D;  1NO4 A;  4RES B;  1YTZ T;  3H32 B;  1S9K E;  2P2U A;  3C9I A;  1MFZ A;  3M0D C;  4C7N B;  4LLH A;  3G3Z A;  2R5D A;  1SFC C;  3GHG C;  4W80 A;  3R2P A;  1FAV A;  1NAF A;  1ZV8 A;  5BVZ A;  2BAS A;  1DEB A;  3BRT B;  5CCH A;  5AW7 B;  1HGV A;  3V2Q A;  2QM7 A;  4N3Y B;  1GL2 D;  1KQL A;  2VRS A;  3NTN A;  1LTT C;  3TSI A;  1SQX K;  3H6P A;  5APT A;  1H8A A;  3MIW A;  2Q9I A;  1LTJ B;  1URQ A;  2IFN A;  5CMZ A;  1EQ7 A;  2WSE H;  2P1J A;  4IFM A;  4HH2 A;  1VPC A;  3CLQ A;  3HD7 D;  4KHX A;  1LWU A;  2KB7 P;  3V4Q A;  5CCG A;  1A02 F;  2GUV A;  4XA4 A;  5AVW B;  3HE5 A;  2M3B A;  4LC1 A;  3RK2 D;  3HUS B;  1LT9 B;  3P32 A;  1JO5 A;  3B5N B;  2NPS B;  3V2R A;  1WRG A;  2IPP A;  2HG5 D;  2N1T B;  1FZE A;  2J58 A;  3MTU E;  1URQ D;  3M9B A;  2HLO A;  2LKM A;  1SQP K;  3A3Y B;  1LWU B;  2IX7 C;  1OWA A;  2I1K A;  5KLV K;  1LWU C;  1LTB C;  3L37 A;  2XKM A;  1NHL A;  2E42 A;  1GTW A;  2N1T D;  3N7N A;  1LTG C;  1J1D C;  1M1J C;  1NOH A;  3L36 A;  3L4F A;  3RK2 C;  3VN0 A;  1GW4 A;  1AFO A;  3UIA A;  1LTA C;  1LTI C;  1J2J B;  1JY3 P;  3HD7 C;  4AYC A;  5AW4 B;  1RF0 A;  2N1T A;  4EIJ A;  1FZC A;  1JY2 N;  2Q3I A;  4I6M C;  1N2D C;  4C7N A;  2P7J A;  1KZU B;  3A7O A;  2FKW B;  1G1J A;  1NTM K;  4XE5 B;  1KIL A;  1J1D B;  1M1J B;  2JJL A;  4C7R A;  1RF1 C;  3O8Z A;  4HYT B;  4ZKU A;  1GU5 A;  4WY4 A;  1N73 C;  1SVF A;  3PP5 A;  3HD7 A;  1HWT C;  1FZF A;  2Q7C A;  4DZO A;  5AVZ B;  2NPS C;  4OH8 B;  4B86 A;  1JCC A;  2WIT A;  1T8Z A;  3LIE A;  1NWQ A;  1JTH B;  1FJK A;  2HFE D;  3BAS A;  4WY4 C;  1N73 A;  2M8R A;  2HPC A;  1GK4 A;  5CCH D;  1E5W A;  1IO4 A;  1L4A B;  2J59 M;  5KJ7 C;  3OJA B;  2O1K A;  1L0N K;  3RK3 D;  5APV A;  2FFD A;  2XU6 A;  1ZR4 A;  2CPS A;  5AW9 B;  1DH3 A;  2WTY A;  3TK1 A;  1IFI A;  1N7L A;  4Y99 C;  3RL0 C;  5AW6 B;  1FOS E;  1NTZ K;  1N7S C;  1Z56 A;  5APX A;  2CPB A;  1L4A A;  1N7S D;  2C9N Y;  1MUU A;  2WSC H;  1MZ9 A;  3CI9 A;  2HPC B;  3B5N D;  5APW A;  3HE4 A;  2WT7 A;  2WWW A;  3M0D A;  1GL2 A;  5AVS B;  4GIF A;  3BRV B;  1T2K C;  2C0W A;  2OYH C;  1RF1 B;  2R5B A;  1FBM A;  1CI6 A;  1RF0 C;  5AW2 B;  5KJ7 D;  2YO2 A;  3BVH A;  2H8P D;  1N7S A;  1IFJ A;  3V2N A;  3T97 A;  1G2C A;  3M91 A;  4N78 E;  1RE4 C;  1KIL D;  3NXS A;  4IFF A;  3HUS C;  1FJP A;  1T3U A;  3B5N C;  5CJ4 A;  3HRN A;  1JOC A;  1GL2 B;  3P8C D;  3P8C E;  2Z5I A;  1KIL B;  1IFN A;  5AW5 B;  1IK9 A;  2MJZ A;  2FFD B;  2XDJ A;  1CZQ A;  4JYB A;  3U1C A;  1W2E A;  3OA7 A;  2HOD A;  1SFC B;  1QL1 A;  3GHG B;  3RL0 D;  2POH A;  1ZLL A;  5APU A;  1FDM A;  2OYI B;  2PAJ A;  3VTP C;  1FZC B;  1L4A C;  3VOP A;  1J1E B;  2YKO A;  3VMZ A;  3LW5 H;  3M9H A;  5AW3 B;  2YKQ A;  1SQB K;  1S9K D;  4W7Z A;  1NH4 A;  1HGZ A;  1FOS F;  5CCH C;  3A2A A;  1NTK K;  4LGD E;  1RY3 A;  2ZFC A;  3I5C A;  2OYH A;  3HTK B;  4WY4 D;  3SWY A;  2WZ7 A;  2PP6 A;  1A02 J;  2W27 A;  3HE4 B;  1JTH A;  2N9B A;  4ZKP A;  3WMM 0;  1G1I A;  2Z5H A;  1FZC C;  3KYQ A;  1GD2 E;  3SWF A;  2R32 A;  1L0L K;  1LT9 A;  2HYN A;  2N1T C;  3OAK A;  2W6B A;  3P7K A;  4JF7 A;  2WPQ A;  3L35 A;  2KP8 A;  3TNU B;  2H7H A;  3IFM A;  4N6J A;  1FZA A;  1SFC A;  3GHG A;  2GUS A;  4I1L A;  2FYU K;  1SQV K;  3CL3 D;  3M0A A;  1ZN5 A;  4N78 D;  1HJB A;  1YTZ I;  1LTJ C;  1IFD A;  1IFM A;  1FU1 A;  1SQQ K;  2XV5 A;  3TNU A;  5BU8 B;  3M06 A;  1SLQ A;  2E43 A;  1N73 B;  5APS A;  1FZB A;  3RL0 B;  1GZL A;  1HTL C;  5APQ A;  1RE3 C;  3KDP B;  2R3C A;  3U59 A;  2FYZ A;  1N86 A;  1FZG A;  1XTG B;  2WPR A;  1HH0 A;  2C9L Y;  2KSJ A;  5KJ7 A;  1ZR2 A;  2A45 H;  2KOG A;  2OYI A;  2L5G B;  1LTS C;  1URQ C;  1NKZ B;  3HTK A;  4GKG A;  2O01 H;  3M9Q A;  2JEE A;  2NPS A;  3IR9 A;  2A45 I;  2Q5U A;  1RE3 A;  2FXM A;  3MUD A;  5AVV B;  1N7S B;  2I1J A;  2HOD B;  1IC2 A;  1LTJ A;  1URQ B;  1GL2 C;  1GDT A;  3B8E B;  4WB4 A;  2OYI C;  4AQR D;  5BU5 A;  4O9B A;  1GU4 A;  2A45 G;  3NMD A;  1T2K D;  1X79 B;  1QL2 A;  3RK2 B;  3MGN A;  3RK3 B;  3V2P A;  4EOT A;  4DOJ A;  1L4A D;  2OYH B;  1RE4 A;  1YYC A;  5AVU B;  1WT6 A;  1SFC D;  3U1A A;  5AVQ B;  4WBA A;  3HD7 B;  3KPE A;  4AUW A;  5AVY B;  1H89 A;  3V5B A;  1CI6 B;  1JMM A;  3N4X A;  1HVV A;  1CSB A;  4I2L C;  1KFM A;  1PFI A;  1JCD A;  2QM8 A;  4GT1 A;  5CCG C;  3VMX A;  1JY2 P;  2KLV A;  3EFG A;  2KYV A;  5AW8 B;  2WT7 B;  1KIL C;  2XZR A;  1M7L A;  2XNX A;  2O1J A;  4W7Y A;  3KQG A;  2YO3 A;  3VP9 A;  2GM4 A;  1NU1 K;  3VP8 A;  3A5T A;  2OAR A;  2ZXE B;  1HUC A;  1AQ5 A;  2YKP A;  1MV8 A;  3II6 A;  2W6A A;  1J1E C;  1H88 A;  1GK6 A;  1LT9 C;  2H43 A;  3LID A;  2P67 A;  1DX7 A;  1G2C B;  2WPS A;  5KTB A;  4IFD K;  5AVR B;  2Z4E A;  4M3L A;  2WSF H;  5CJ0 A;  2FFD C;  4JYC A;  1RF1 A;  3P8M C;  1T3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...