2WSEH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wseH01
2J59M 2WSFH 2O01H 1NTZK 2WSEH 1SQBK 1SQPK 2FYUK 1NTMK 2LKMA 4IFDK 1L0NK 2WSCH 1L0LK 2OARA 1SQVK 3G3ZA 1SQXK 5KLVK 1NU1K 1SQQK 3M9QA 1NTKK 3CLQA 3LW5H
chains in the Genus database with same CATH superfamily
5AW7B 1VQLP 2IBZE 4YXDC 3F89A 2V7QH 1JM0A 2WPQA 2FXPA 3CCQP 3L71G 3ABVC 2H88C 1X79B 1KILD 5APXA 1JOCA 3FXEA 3G4SP 2KSJA 5KKZC 1L0LK 2HPCB 1BGYE 2BEQD 1PPJG 1JUNA 3KZIE 3L73J 3CWBJ 4N78E 3I56P 4UB8H 2Z5HA 3B4SA 4C7RA 2N1TB 1ZRTE 4I6MC 1K73Q 3H1JE 5E79H 3V2NA 2E75B 3PLNA 4ASWA 3CD6P 3HE4A 3BCCE 3V2PA 1PZQA 1ZR2A 2E75C 5KAIE 4YPCA 3AE6C 4OGQD 4LLHA 1JMMA 2ZYAA 3PJSK 1SQXJ 5KLIB 3P8CD 5CCGC 1L4AC 2R44A 3P32A 2WSFH 2WSSH 5KLIC 1KB9D 4DT0A 3S4RA 5B66H 1Q2NA 3AEFC 2NPSB 4JF7A 1SVFA 3KHUA 1MKMA 2FYUD 3L73G 3CWBG 1FZCB 2ZAEB 3MGNA 3L75J 2OYOA 2AEJA 2A06E 4Y28J 2WT7A 3VMAA 2Q9IA 1NTZJ 3B5ND 3H1LD 1BE3E 1VQ8P 1NVOA 1VQ7P 3Q2YA 1NU1E 1JCCA 3VN0A 3FGAD 2E42A 2JO1A 1RY3A 1SFCC 3L70J 3M06A 1SQXG 2YXRB 4H0LB 3TNUA 1QLED 1QVGO 2WTYA 3RL0B 3HUSA 2HODB 2R5DA 1BSNA 3E1IA 4H0LC 1URQB 3RK2B 4RJTA 1VF5D 1DD4A 1XTGB 1URQC 2Y0EA 1CSBA 2KI7B 1IFIA 1K05A 1KB9H 1S9KD 3C1LA 3WU2E 5CCHA 3SWFA 2KIKA 1KC8Q 3L75G 5AVUB 1H8AA 4I7ZB 1W2BO 1GD2E 2W8ZA 1K9MQ 4NPEA 3WUUA 1FZEA 1GK6A 4I7ZC 2QRXA 2L5GB 2ZYDA 2JWAA 4IFFA 1NOHA 1BSHA 3IFMA 3Q5RA 1JB0J 2HPCA 4OWFA 3EFFK 2E74D 3H25A 1NTKD 4RO0A 1ZOYC 3S9OA 3CXHI 1A02J 3L70G 5BVZA 1LNQA 1NTKG 1D7MA 1YBKA 2QJKC 3H1KE 1CW5A 3T97B 1P84E 2N1TA 3CI9A 1SQBE 3EWKA 3A7OA 2E76C 2P58A 2POHA 5AVSB 1NKNA 2ITAA 3L74E 5TJHA 4U3FD 1LP1B 1SQPK 5CMZA 1FOSE 1OWAA 3KDPB 1HWTC 1L0NK 2O1KA 4GOFA 2OYIB 1OMIA 1NTME 2ZVOB 2Y0CA 1Z56A 3L72D 4HJGH 3WUVA 2OYIC 4H44B 4IL6E 1YHQP 3BVHA 3L72G 1JEKA 1FDIA 2J5UA 2W6BA 1BCCE 2BCCE 1RF0C 3KYQA 2O01J 4H44C 4B86A 3VYIA 2D2CB 1VQ6P 2B9BA 2YXQB 5CBOA 1N7SD 1H89A 1T3JA 1SQQD 2NPSA 1NYHA 5AVQB 2W27A 2D2CC 2K9JA 5KAFH 1SQQG 1BGYJ 1FZCA 3M0AA 1EZVG 3AE9C 1GL2B 2MJZA 1M56D 1LTIC 3H32B 1R8EA 1S5LH 1ZR4A 3H1JJ 1JMBA 4HKZH 4EOTA 1OW8A 3BCCJ 1RQUA 3TGUG 1NO4A 4XE5B 4H13B 2RKLA 1P84I 2XV5A 1LT9B 3IAOA 1BDDA 1LWUB 1Q82Q 3JSVC 1HUCA 2G8YA 3ZDMA 4IFDK 2WZ7A 1NWQA 2ZXXA 1NAYA 2WSCH 1LT9C 2HODA 1ZP0C 1LWUC 1DEEG 1URQA 4GDOA 2IPPA 1YTZT 3LW5H 1LTAC 3H1ID 3E1RA 4O9BA 5AVTB 1YI2P 1OX3A 5APWA 3H1IG 1L0LE 1GU5A 4YXWH 4N6JA 3G71P 3RBZA 3HRNA 1LTJB 4PD4E 3UIAA 5BU8B 3JCUE 2KOGA 1SP4A 1G2CB 1BE3J 1LTJC 4CPGA 3BCCG 1NU1J 2K37A 2WITA 5KLVG 4D6TE 1GDTA 1LTSC 5APSA 1KYOI 1N73B 2QJPB 3U59A 3GHGB 3T97A 1RQVA 5B5EH 1N73C 2QJPC 3O8ZA 3CCVP 5APYA 2ZFCA 4L74A 3M9QA 1KQFB 5CHXA 1LP1A 1L0ND 5KJ7D 1HTLC 2IX7C 4GT1A 2FYZA 1JY2N 2FFDB 3IN6A 3W68A 5APTA 1SQXK 3CPWO 4UB6E 3TYYA 3CXHD 2FFDC 1M8OB 2A06G 1SQVD 3H6PA 3A0HH 1KD1Q 1RF1B 2R3CA 3CX5E 5AW6B 3AECC 2N9BA 1SQVG 2E74C 1J1DB 1RE4C 3PH0A 3MHVA 2GA1A 1HVVA 3L71D 3RBXA 2WQYC 1GL2A 1PP9D 1J1DC 1EC5A 1AVYA 1YTZI 1FBMA 1R5SA 1PP9G 3M9HA 3H32A 5KKZB 3H1KJ 3P7KA 4ZMDA 2K88A 1SQBJ 1USEA 3N4XA 1QGKB 3M0DA 1QL2A 2JWDA 3AE3C 3L74J 1PPJD 1EDLA 2B89A 3MZWB 4RKUJ 3A5TA 5APQA 4ZNCA 4EDFA 3D70A 1NTKK 1AFOA 4PJ0H 2FBWC 3AEBC 3FX0A 1M1KQ 1NTMJ 3V4QA 4R4LA 2WSEJ 4A7PA 3HD7B 1MV8A 3NMDA 3CXHH 5AVRB 3A0BE 1EZVI 1BCCJ 2AEMA 2BCCJ 3CC7P 1EXIA 1X8YA 2QM8A 1W2EA 2KZIA 5GTIH 2IFMA 3HD7C 3IR9A 5AVXB 1L4AB 1S4XA 2PAJA 3LIEA 2ZT9B 2QJYB 4PV1D 4Y99C 2MKVA 3H1KG 1FC2C 2ZT9C 5GTHH 1SQBG 2QJYC 2IBZI 2KNCB 2O3JA 2L91A 1G2CA 4WVZA 1PGPA 1A02F 1PGQA 2C9NY 4GIFA 3L73D 4BRYB 3CWBD 1SQQK 3H1HE 1JTHB 3RK3D 1N73A 1RE3C 3CC2P 1MFTA 2OYHB 3GHGA 1NTMG 1SQPE 2XU6A 4L73A 5AW2B 3Q5PA 2KYVA 2Y9ZA 1AJYA 1G1JA 1E5WA 2YKPA 1YQ3C 2OYHC 1IO4A 4UB8E 2PRRA 3FWLA 3AEDC 2WPRA 4JYBA 4XFJA 3MIWA 5E79E 1SFCB 2W83C 1J2JB 1U7JA 2R32A 3AE8C 3HTKB 1Y8AA 2LXBA 4KT0J 1LJ2A 4EYYQ 2FFDA 1SQXD 3L35A 4OVNF 2YIUB 1GW4A 2HG5D 1FJKA 2QG4A 5DJTB 1KYOD 2LKMA 1VQMP 1YITP 2YIUC 1L0LJ 3MUDA 1W5CE 4WY4B 1RF1A 1RE4A 1P84H 3L71E 4TLFA 1BDCA 2JEEA 4WY4C 1NGMB 1USDA 3CCRP 3L75D 3VP9A 5B66E 3AE1C 3Q5SA 1KILE 5TISH 1OXZA 3PTZA 1CI6B 4R4MA 2PFXA 4EI2A 3SFDC 4D6TJ 2OTJP 1DX7A 1IFPA 1NTZD 1QEXA 1FZGA 2M5AB 3CMAP 1WMKA 1NTZG 3GF3A 1R5LA 3K5BA 3L70D 1JY2P 3V5BA 5KLVK 1XTCC 2QJKB 1S72P 2IZ0A 2Q6QA 1KTMA 2E76B 2KZJA 1S1CX 1JY2O 1KFMA 2XNXA 2HR3A 3A2AA 1PIXA 3CL3D 1KYOH 2IYPA 3V6IA 3P8CE 5CCHD 5CCGA 1SLQA 1L4AA 1IFNA 3CCUP 4DOJA 3OW2O 3M91A 1VQ5P 1YJ9P 1KILB 1MFZA 1OW7A 2P10A 1NAFA 1KB9E 2UWJE 2BEZF 5KTBA 2FXOA 2ZYGA 1KILC 3SSUA 3TF5A 1Q7YQ 1IFMA 4W80A 2KNCA 2FYUE 3VMZA 3PP5A 1OVUA 1SQVK 1UIXA 4BRYA 3PRJA 1ZW0A 1EZVD 1JTHA 3AEAC 2M3EA 4GODA 2Z4EA 3MP7B 1U7MA 2KUBA 3CCJP 2YO2A 2OYHA 3H1LE 2N1TD 1FZBA 2JDIH 1X22A 1FE6A 1KQGB 2E75D 1HJ0A 1ZLLA 1N7LA 1Q90D 4OGQB 2E5YA 4XA4A 3TGUD 1SFCA 1GTWA 3N7NA 3HTKA 1DD3A 2IBZD 4OGQC 5BU5A 2Y9YA 2HYNA 1N8RQ 4U7JA 3VMYA 3AEEC 2HLOA 1PGJA 2IBZG 2VRSA 1OVRA 3AE4C 1M57D 4PV1C 1KV4A 2FXMA 1JNMA 2YNYA 1GU4A 2V7QJ 1WT6A 3TK1A 4WY4A 1S9KE 1OW6A 1ZV8A 2JKVA 5AVVB 2NPSD 2FY8A 5CBNA 1IC2A 1N2DC 3U1CA 1BGYD 3II6A 2JP3A 2WWWA 1J1EC 4L76A 2AXTH 2A45G 2DW3A 1BGYG 2Y0DA 4N78D 1CI6A 3D6ZA 3H1HJ 5KAFE 2LR2A 3EFGA 3B5NB 1ZRTD 2M5AA 1KFNA 2J59M 1S3JA 5APUA 1Y9BA 1SQPJ 3H1JD 1SQBK 3FWNA 1NHLA 4BXLA 1RHZB 1NTKE 2C9LY 2WVRA 5H2FH 3B5NC 3BCCD 1FS0E 3H1JG 3IF4A 1FOSF 1S5LE 5KLVD 2AEFA 5EFWB 4C7NB 1YJNP 4LGDE 2KLUA 2RMZA 2Q7CA 1FAVA 2QA4P 4I2LC 4H0LD 1NTMK 5CJ0A 1GZLA 4WWIA 3RL0D 1K8AQ 2Q1KA 4U3FE 1AV1A 1VF5B 1URQD 3RK2D 2XNDH 2WPVB 2W6JH 3MTUE 2ZJSE 1H0TB 2O01H 4ASVA 1VF5C 4DZOA 1EDKA 3AE5C 3L72E 1VDFA 2WSFJ 1LTTC 2P2UA 3L71J 1Y47A 4NPFX 1PFIA 4K35A 2OYIA 1QVFO 4QMAA 4JPZB 2FYNC 1KMIZ 2G3AA 1FDMA 1GK4A 1TU3F 1RF0A 1OZHA 2A06D 4IL6X 1YJWP 1SQQE 3KZIH 3GLMA 3GG2A 2K9YA 2O1JA 3G6EP 2E74B 1BE3D 3L36A 1NU1D 4C46A 3O6QB 1UIIA 2H89C 2P1JA 1DIPA 3R4YA 3WUTA 2Z5IA 5DJUB 1BE3G 3TNUB 1NU1G 1IZNB 1YYCA 3W67A 1N86A 4GKGA 1JCDA 1U57A 2HFED 2OTLP 4AQRD 3R2PA 5KAIH 3CCLP 3TGUE 4PD4I 3HUSC 1JY3N 2B88A 1T2KD 1JO5A 1NTZK 4L75A 1HJBA 4TT3H 5AW9B 5B5EE 3BATA 2Q3IA 3SWYA 5CCHC 4M3LA 2J58A 3CCMP 2AXCA 4H44D 1LT9A 5C39A 3V2RA 4YTPC 2B87B 1LWUA 1ZN5A 5AW3B 1VQ9P 3A3YB 1N7SB 2QM7A 1IFJA 2D2CD 1LGHB 3I5CA 3H1IE 4IFMA 4W7ZA 1N7SC 1EXJA 3A0HE 2FYUJ 1HH0A 2SPZA 1M90Q 1IK9A 1GL2D 4Z1MH 2KS1B 3PHLA 2WMMA 2KK7A 2QIWA 4Y99B 3KQGA 3VMXA 2N1TC 3H1KD 2IDBA 3KPEA 3B5NA 1P84D 2H8PD 1SQBD 3SWKA 3CX5I 3H1LJ 5KLVE 1FJPA 4W7YA 2KB7P 2YMKA 1G1IA 1SS1A 3L74D 2KP8A 1LTJA 3D6YA 3C8VA 1FZFA 2KLVA 3L74G 4H13D 4C7NA 1S5LX 5AVYB 2YKQA 1NTMD 3KXDA 3CCSP 2NZ2A 2M8RA 2GM4A 1L0NE 4PJ0E 3WU2H 1BCCD 2BCCD 2K9JB 5M1BA 1VL2A 4KJMA 2A45I 1H0TA 2NPSC 4AYCA 1BCCG 3I55P 2BCCG 1YIJP 2FYUG 3CXHE 3RL0g 2XZRA 2I8DA 3GF7A 1ZXGA 1FZCC 1KN7A 1K04A 5L8RJ 5GTIE 2BASA 1SQVE 4WB4A 2CK3H 1VQKP 1S2EA 3OJAB 3H1LG 2M3BA 3B71A 4HH2A 2C0WA 1T8ZA 3U1AA 3O6QA 1PP9E 3G9RA 1NTKJ 5GTHE 2QE7H 1VQOP 3EQ2A 2YO3A 3GW6A 5AW5B 1VPCA 1RH5B 1GMJA 1IK7A 4IOIH 2V4HA 3MD0A 3RL0C 5APVA 3RGUA 1DEBA 1AQTA 2JR8A 3LIDA 4HB1A 1DH3A 1PPJE 3RK2C 3F5HA 1MZ9A 1GW3A 1AVOA 2WSEH 4U3FJ 4IL6H 3OAKA 3CMEP 3ITKA 4DCKA 4EIJA 5KJ7C 2I1JA 2WSCJ 3CC4P 3L37A 3TSIA 3L72J 1OFCX 2GUSA 2B87A 2KXPB 1L0LD 3LW5J 2C0XA 2FKWB 2QVAA 1N7SA 2ZVNB 2QEXP 1L0LG 2NRGA 1SQQJ 3HD7A 4PD4D 1AA0A 1PV3A 3NFQA 1OIPA 3BRTB 3HE5B 3FXDA 1HF9A 3L4FA 1CZQA 3VTPC 2WPSA 3QH9A 4KHXA 2W90A 2KS1A 2QSIA 1FU1A 4D6TD 2OGUA 4I1LA 1T6AA 1FZAA 1FDOA 3VOPA 1JY3P 1M7LA 5TISE 4D6TG 2CPBA 3D71A 2LXCB 1T2KC 3L73E 5AVWB 3CWBE 3TGUJ 1M1JB 2GUVA 2Q3EA 2W6AA 4U3FG 1PL5A 2H7HA 1OVVA 2RH0A 1QL1A 1X9VA 1PGOA 3RK3E 4ZKUA 1JY3O 2RN0A 1M1JC 1NU1K 1RE3A 3Q3DA 4JQ0D 5K5GB 2OQQA 3AEGC 2KSEA 1EDIA 3G3ZA 1KZUB 2YKOA 2ZXEB 3HD7D 1QX8A 2XKMA 1H88A 2E43A 2R3SA 1SQXE 1EDJA 3CX5D 5AW0B 3H1IJ 3CCEP 2JJLA 1LTGC 5CCGD 1L4AD 4PD4H 1L2PA 2Q5UA 1KYOE 3E7KA 2IYOA 1GL2C 3JCUH 4BWNA 4MN4C 4PV1B 1T3UA 2ZT9D 3TDKA 2YMYA 1AQ5A 4NPDA 3B8EB 4HYTB 2M0BA 5CJ4A 2I1KA 3L75E 3M0DC 5KLVJ 1J1EB 2PGDA 4OH8B 3RK3B 4H13C 2OTKE 1HBWA 2H43A 1KB9I 1ZMEC 1NTZE 3RK3C 4N3YB 3Q1MA 3JC22 1E79H 2K1AA 4DJGA 3HE4B 4K3AA 3NTNA 3CLQA 1VQPP 3L70E 3BASA 4UB6H 5KJ7A 1KQSO 1NJIQ 2PP6A 2P7JA 1L0NJ 4ZKPA 1SFCD 2CPSA 1KQLA 1HGVA 4RESB 3NXSA 3AE7C 3CX5H 3WMM0 5AW8B 3S1KA 4AUWA 1IFDA 2P67A 1KORA 1VQ4P 5AW4B 1YQ4C 1VQNP 3VP8A 1SQVJ 2IFNA 1IJDB 4WY4D 2O01N 3GMAA 4WBAA 2XDJA 3P8MC 1X0TA 1NKZB 1Q81Q 2R5BA 3HE5A 5AVZB 2K3RA 2FYUK 3M9BA 2FYNB 3H1HD 1Q86Q 1PP9J 4GOEA 2OARA 5AW1B 2WT7B 3V4WA 3GHGC 1KILA 1MUUA 3H1HG 2A45H 1EQ7A 2AXTE 1SQPD 2E5TA 3V2QA 4JBZA 3OA7A 3BRVB 1M1JA 1SQPG 1EZVE 1L0NG 2N9YB 1HGZA 3QWOC 4LC1A 5H2FE 1WRGA 4JYCA 3SFEC 3A0BH 1LT1A 1NH4A 2E76D 3HUSB 1LTBC 3AE2C 3C9IA 2IZ1A 3MUDC 3USSA 1RF1C
chains in the Genus database with same CATH topology
5AW7B 2A45I 2NPSC 4AYCA 1LTAC 3P8CE 2WPQA 5CCHD 4O9BA 5CCGA 1SLQA 5AVTB 1L4AA 1IFNA 2XZRA 5APWA 1FZCC 4DOJA 3M91A 1KILB 1MFZA 1GU5A 1NAFA 1X79B 2BASA 1KILD 5APXA 4N6JA 5KTBA 4WB4A 1JOCA 2KSJA 1KILC 3OJAB 3HRNA 1LTJB 2M3BA 3UIAA 5BU8B 2KOGA 1L0LK 4HH2A 1IFMA 4W80A 1SP4A 1G2CB 2C0WA 2HPCB 3VMZA 3PP5A 1SQVK 1T8ZA 3U1AA 1LTJC 1JUNA 2WITA 1RF1C 1JTHA 4N78E 3EQ2A 1GDTA 2YO3A 1LTSC 5APSA 2Z4EA 5AW5B 2Z5HA 1N73B 3U59A 4C7RA 2N1TB 3GHGB 2YO2A 3T97A 1VPCA 2OYHA 4I6MC 2N1TD 1FZBA 3MD0A 3V2NA 1N73C 3RL0C 3O8ZA 5APVA 1DEBA 5APYA 3LIDA 2ZFCA 3HE4A 1ZLLA 3M9QA 1DH3A 3RK2C 3V2PA 1N7LA 1MZ9A 5CHXA 1GW3A 2WSEH 1ZR2A 4XA4A 5KJ7D 3OAKA 1HTLC 1SFCA 2IX7C 1GTWA 3N7NA 3HTKA 4GT1A 2FYZA 4LLHA 1JY2N 2FFDB 4EIJA 5KJ7C 5BU5A 1JMMA 2HYNA 2I1JA 3L37A 3TSIA 3VMYA 5APTA 1SQXK 3P8CD 5CCGC 2HLOA 3TYYA 1L4AC 3P32A 2VRSA 2WSFH 2FFDC 2GUSA 2C0XA 2FXMA 1JNMA 2YNYA 2FKWB 1GU4A 3H6PA 1N7SA 1WT6A 3TK1A 4WY4A 1RF1B 2R3CA 1S9KE 5AW6B 1ZV8A 2NPSB 5AVVB 4JF7A 2N9BA 3HD7A 2NPSD 1SVFA 3NFQA 1IC2A 1J1DB 3BRTB 1N2DC 1RE4C 3HE5B 3U1CA 3II6A 1HVVA 2WWWA 1FZCB 1J1EC 3MGNA 3L4FA 1CZQA 1GL2A 3VTPC 2WPSA 1J1DC 2A45G 4KHXA 4N78D 1CI6A 1FU1A 4I1LA 2WT7A 1YTZI 1FBMA 3M9HA 1FZAA 3H32A 3VOPA 3EFGA 3B5NB 3P7KA 2Q9IA 1KFNA 3B5ND 1JY3P 1M7LA 2J59M 5APUA 2CPBA 1SQBK 1NHLA 1JCCA 1T2KC 3N4XA 5AVWB 3VN0A 2C9LY 3M0DA 1M1JB 3B5NC 2GUVA 2W6AA 1QL2A 2H7HA 2E42A 1QL1A 1X9VA 1RY3A 1FOSF 4ZKUA 1SFCC 1JY3O 3A5TA 5APQA 1M1JC 4C7NB 1NU1K 4LGDE 1RE3A 1NTKK 3M06A 1AFOA 2Q7CA 1FAVA 3TNUA 4I2LC 2WTYA 1NTMK 3V4QA 3RL0B 5CJ0A 1GZLA 3HUSA 2HODB 2R5DA 3RL0D 3E1IA 1URQB 3RK2B 1URQD 3RK2D 3HD7B 1MV8A 3G3ZA 1KZUB 3NMDA 5AVRB 2YKOA 2ZXEB 3HD7D 1XTGB 2XKMA 3MTUE 1H88A 1URQC 2E43A 1X8YA 2O01H 1W2EA 2QM8A 1CSBA 1IFIA 4DZOA 2IFMA 3HD7C 1S9KD 1VDFA 5AW0B 1LTTC 2P2UA 5CCHA 3SWFA 3IR9A 1PFIA 2OYIA 5AVXB 1L4AB 2JJLA 5AVUB 1H8AA 1LTGC 5CCGD 2PAJA 1L4AD 3LIEA 1GD2E 2Q5UA 1GL2C 1FDMA 1GK4A 1T3UA 1RF0A 1FZEA 2YMYA 4Y99C 1GK6A 2L5GB 1AQ5A 3B8EB 4HYTB 4IFFA 1NOHA 2O1JA 3IFMA 5CJ4A 2I1KA 1G2CA 2HPCA 3L36A 1A02F 3M0DC 4C46A 2C9NY 4GIFA 2P1JA 1J1EB 1SQQK 1A02J 4OH8B 2Z5IA 1JTHB 3TNUB 5BVZA 3RK3B 1HBWA 2H43A 3RK3D 1YYCA 1CW5A 1N73A 1RE3C 1N86A 4GKGA 2OYHB 1JCDA 2N1TA 3GHGA 3CI9A 2XU6A 2HFED 5AW2B 3RK3C 4N3YB 2KYVA 3A7OA 3R2PA 4AQRD 1G1JA 1E5WA 2POHA 5AVSB 2YKPA 1NKNA 3HUSC 1JY3N 2OYHC 3HE4B 1IO4A 1T2KD 3NTNA 3CLQA 1JO5A 1NTZK 1HJBA 5AW9B 1SQPK 5CMZA 3BASA 5KJ7A 1FOSE 1OWAA 3KDPB 2WPRA 4JYBA 1HWTC 3MIWA 1SFCB 2PP6A 2P7JA 1J2JB 1L0NK 2O1KA 2R32A 4ZKPA 3HTKB 2OYIB 3BATA 1SFCD 2CPSA 1KQLA 2FFDA 2Q3IA 3SWYA 3L35A 1Z56A 1HGVA 5CCHC 4M3LA 4RESB 2OYIC 3NXSA 2J58A 1GW4A 2HG5D 3WMM0 1FJKA 1LT9A 3BVHA 5AW8B 3V2RA 1LWUA 1ZN5A 4AUWA 2W6BA 5AW3B 2LKMA 1IFDA 1RF0C 2P67A 3KYQA 4B86A 5AW4B 3VYIA 3MUDA 3A3YB 1N7SB 4WY4B 3VP8A 2QM7A 1IFJA 1N7SD 2IFNA 1IJDB 1LGHB 4WY4D 1H89A 1RF1A 1RE4A 1T3JA 3I5CA 2NPSA 4IFMA 2XDJA 4WBAA 4W7ZA 5AVQB 2W27A 2JEEA 1N7SC 3P8MC 4WY4C 1NKZB 2R5BA 3HE5A 5AVZB 3VP9A 2FYUK 1FZCA 3M0AA 1HH0A 3M9BA 1GL2B 1OXZA 1IK9A 1GL2D 1CI6B 2OARA 2MJZA 5AW1B 2WT7B 4Y99B 3KQGA 1LTIC 3V4WA 3VMXA 2N1TC 3GHGC 3H32B 1KILA 1DX7A 1MUUA 3KPEA 3B5NA 1FZGA 2A45H 1EQ7A 2H8PD 3V2QA 1FJPA 1ZR4A 4W7YA 2KB7P 3OA7A 1G1IA 4EOTA 3BRVB 1M1JA 1LTJA 2KP8A 1NO4A 1FZFA 1JY2P 2KLVA 4XE5B 1HGZA 3V5BA 5KLVK 4C7NA 5AVYB 1XTCC 2XV5A 2YKQA 4LC1A 1LT9B 1WRGA 4JYCA 1LWUB 1HUCA 4IFDK 2WZ7A 1NWQA 1JY2O 1NH4A 3HUSB 1LTBC 2WSCH 1KFMA 1LT9C 2HODA 2XNXA 1LWUC 1URQA 3C9IA 2M8RA 2GM4A 3A2AA 2IPPA 3CL3D 1YTZT 3LW5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  2WSF H;  2O01 H;  1NTZ K;  2WSE H;  1SQB K;  1SQP K;  2FYU K;  1NTM K;  2LKM A;  4IFD K;  1L0N K;  2WSC H;  1L0L K;  2OAR A;  1SQV K;  3G3Z A;  1SQX K;  5KLV K;  1NU1 K;  1SQQ K;  3M9Q A;  1NTK K;  3CLQ A;  3LW5 H; 
#chains in the Genus database with same CATH topology
 5AW7 B;  1VQL P;  2IBZ E;  4YXD C;  3F89 A;  2V7Q H;  1JM0 A;  2WPQ A;  2FXP A;  3CCQ P;  3L71 G;  3ABV C;  2H88 C;  1X79 B;  1KIL D;  5APX A;  1JOC A;  3FXE A;  3G4S P;  2KSJ A;  5KKZ C;  1L0L K;  2HPC B;  1BGY E;  2BEQ D;  1PPJ G;  1JUN A;  3KZI E;  3L73 J;  3CWB J;  4N78 E;  3I56 P;  4UB8 H;  2Z5H A;  3B4S A;  4C7R A;  2N1T B;  1ZRT E;  4I6M C;  1K73 Q;  3H1J E;  5E79 H;  3V2N A;  2E75 B;  3PLN A;  4ASW A;  3CD6 P;  3HE4 A;  3BCC E;  3V2P A;  1PZQ A;  1ZR2 A;  2E75 C;  5KAI E;  4YPC A;  3AE6 C;  4OGQ D;  4LLH A;  1JMM A;  2ZYA A;  3PJS K;  1SQX J;  5KLI B;  3P8C D;  5CCG C;  1L4A C;  2R44 A;  3P32 A;  2WSF H;  2WSS H;  5KLI C;  1KB9 D;  4DT0 A;  3S4R A;  5B66 H;  1Q2N A;  3AEF C;  2NPS B;  4JF7 A;  1SVF A;  3KHU A;  1MKM A;  2FYU D;  3L73 G;  3CWB G;  1FZC B;  2ZAE B;  3MGN A;  3L75 J;  2OYO A;  2AEJ A;  2A06 E;  4Y28 J;  2WT7 A;  3VMA A;  2Q9I A;  1NTZ J;  3B5N D;  3H1L D;  1BE3 E;  1VQ8 P;  1NVO A;  1VQ7 P;  3Q2Y A;  1NU1 E;  1JCC A;  3VN0 A;  3FGA D;  2E42 A;  2JO1 A;  1RY3 A;  1SFC C;  3L70 J;  3M06 A;  1SQX G;  2YXR B;  4H0L B;  3TNU A;  1QLE D;  1QVG O;  2WTY A;  3RL0 B;  3HUS A;  2HOD B;  2R5D A;  1BSN A;  3E1I A;  4H0L C;  1URQ B;  3RK2 B;  4RJT A;  1VF5 D;  1DD4 A;  1XTG B;  1URQ C;  2Y0E A;  1CSB A;  2KI7 B;  1IFI A;  1K05 A;  1KB9 H;  1S9K D;  3C1L A;  3WU2 E;  5CCH A;  3SWF A;  2KIK A;  1KC8 Q;  3L75 G;  5AVU B;  1H8A A;  4I7Z B;  1W2B O;  1GD2 E;  2W8Z A;  1K9M Q;  4NPE A;  3WUU A;  1FZE A;  1GK6 A;  4I7Z C;  2QRX A;  2L5G B;  2ZYD A;  2JWA A;  4IFF A;  1NOH A;  1BSH A;  3IFM A;  3Q5R A;  1JB0 J;  2HPC A;  4OWF A;  3EFF K;  2E74 D;  3H25 A;  1NTK D;  4RO0 A;  1ZOY C;  3S9O A;  3CXH I;  1A02 J;  3L70 G;  5BVZ A;  1LNQ A;  1NTK G;  1D7M A;  1YBK A;  2QJK C;  3H1K E;  1CW5 A;  3T97 B;  1P84 E;  2N1T A;  3CI9 A;  1SQB E;  3EWK A;  3A7O A;  2E76 C;  2P58 A;  2POH A;  5AVS B;  1NKN A;  2ITA A;  3L74 E;  5TJH A;  4U3F D;  1LP1 B;  1SQP K;  5CMZ A;  1FOS E;  1OWA A;  3KDP B;  1HWT C;  1L0N K;  2O1K A;  4GOF A;  2OYI B;  1OMI A;  1NTM E;  2ZVO B;  2Y0C A;  1Z56 A;  3L72 D;  4HJG H;  3WUV A;  2OYI C;  4H44 B;  4IL6 E;  1YHQ P;  3BVH A;  3L72 G;  1JEK A;  1FDI A;  2J5U A;  2W6B A;  1BCC E;  2BCC E;  1RF0 C;  3KYQ A;  2O01 J;  4H44 C;  4B86 A;  3VYI A;  2D2C B;  1VQ6 P;  2B9B A;  2YXQ B;  5CBO A;  1N7S D;  1H89 A;  1T3J A;  1SQQ D;  2NPS A;  1NYH A;  5AVQ B;  2W27 A;  2D2C C;  2K9J A;  5KAF H;  1SQQ G;  1BGY J;  1FZC A;  3M0A A;  1EZV G;  3AE9 C;  1GL2 B;  2MJZ A;  1M56 D;  1LTI C;  3H32 B;  1R8E A;  1S5L H;  1ZR4 A;  3H1J J;  1JMB A;  4HKZ H;  4EOT A;  1OW8 A;  3BCC J;  1RQU A;  3TGU G;  1NO4 A;  4XE5 B;  4H13 B;  2RKL A;  1P84 I;  2XV5 A;  1LT9 B;  3IAO A;  1BDD A;  1LWU B;  1Q82 Q;  3JSV C;  1HUC A;  2G8Y A;  3ZDM A;  4IFD K;  2WZ7 A;  1NWQ A;  2ZXX A;  1NAY A;  2WSC H;  1LT9 C;  2HOD A;  1ZP0 C;  1LWU C;  1DEE G;  1URQ A;  4GDO A;  2IPP A;  1YTZ T;  3LW5 H;  1LTA C;  3H1I D;  3E1R A;  4O9B A;  5AVT B;  1YI2 P;  1OX3 A;  5APW A;  3H1I G;  1L0L E;  1GU5 A;  4YXW H;  4N6J A;  3G71 P;  3RBZ A;  3HRN A;  1LTJ B;  4PD4 E;  3UIA A;  5BU8 B;  3JCU E;  2KOG A;  1SP4 A;  1G2C B;  1BE3 J;  1LTJ C;  4CPG A;  3BCC G;  1NU1 J;  2K37 A;  2WIT A;  5KLV G;  4D6T E;  1GDT A;  1LTS C;  5APS A;  1KYO I;  1N73 B;  2QJP B;  3U59 A;  3GHG B;  3T97 A;  1RQV A;  5B5E H;  1N73 C;  2QJP C;  3O8Z A;  3CCV P;  5APY A;  2ZFC A;  4L74 A;  3M9Q A;  1KQF B;  5CHX A;  1LP1 A;  1L0N D;  5KJ7 D;  1HTL C;  2IX7 C;  4GT1 A;  2FYZ A;  1JY2 N;  2FFD B;  3IN6 A;  3W68 A;  5APT A;  1SQX K;  3CPW O;  4UB6 E;  3TYY A;  3CXH D;  2FFD C;  1M8O B;  2A06 G;  1SQV D;  3H6P A;  3A0H H;  1KD1 Q;  1RF1 B;  2R3C A;  3CX5 E;  5AW6 B;  3AEC C;  2N9B A;  1SQV G;  2E74 C;  1J1D B;  1RE4 C;  3PH0 A;  3MHV A;  2GA1 A;  1HVV A;  3L71 D;  3RBX A;  2WQY C;  1GL2 A;  1PP9 D;  1J1D C;  1EC5 A;  1AVY A;  1YTZ I;  1FBM A;  1R5S A;  1PP9 G;  3M9H A;  3H32 A;  5KKZ B;  3H1K J;  3P7K A;  4ZMD A;  2K88 A;  1SQB J;  1USE A;  3N4X A;  1QGK B;  3M0D A;  1QL2 A;  2JWD A;  3AE3 C;  3L74 J;  1PPJ D;  1EDL A;  2B89 A;  3MZW B;  4RKU J;  3A5T A;  5APQ A;  4ZNC A;  4EDF A;  3D70 A;  1NTK K;  1AFO A;  4PJ0 H;  2FBW C;  3AEB C;  3FX0 A;  1M1K Q;  1NTM J;  3V4Q A;  4R4L A;  2WSE J;  4A7P A;  3HD7 B;  1MV8 A;  3NMD A;  3CXH H;  5AVR B;  3A0B E;  1EZV I;  1BCC J;  2AEM A;  2BCC J;  3CC7 P;  1EXI A;  1X8Y A;  2QM8 A;  1W2E A;  2KZI A;  5GTI H;  2IFM A;  3HD7 C;  3IR9 A;  5AVX B;  1L4A B;  1S4X A;  2PAJ A;  3LIE A;  2ZT9 B;  2QJY B;  4PV1 D;  4Y99 C;  2MKV A;  3H1K G;  1FC2 C;  2ZT9 C;  5GTH H;  1SQB G;  2QJY C;  2IBZ I;  2KNC B;  2O3J A;  2L91 A;  1G2C A;  4WVZ A;  1PGP A;  1A02 F;  1PGQ A;  2C9N Y;  4GIF A;  3L73 D;  4BRY B;  3CWB D;  1SQQ K;  3H1H E;  1JTH B;  3RK3 D;  1N73 A;  1RE3 C;  3CC2 P;  1MFT A;  2OYH B;  3GHG A;  1NTM G;  1SQP E;  2XU6 A;  4L73 A;  5AW2 B;  3Q5P A;  2KYV A;  2Y9Z A;  1AJY A;  1G1J A;  1E5W A;  2YKP A;  1YQ3 C;  2OYH C;  1IO4 A;  4UB8 E;  2PRR A;  3FWL A;  3AED C;  2WPR A;  4JYB A;  4XFJ A;  3MIW A;  5E79 E;  1SFC B;  2W83 C;  1J2J B;  1U7J A;  2R32 A;  3AE8 C;  3HTK B;  1Y8A A;  2LXB A;  4KT0 J;  1LJ2 A;  4EYY Q;  2FFD A;  1SQX D;  3L35 A;  4OVN F;  2YIU B;  1GW4 A;  2HG5 D;  1FJK A;  2QG4 A;  5DJT B;  1KYO D;  2LKM A;  1VQM P;  1YIT P;  2YIU C;  1L0L J;  3MUD A;  1W5C E;  4WY4 B;  1RF1 A;  1RE4 A;  1P84 H;  3L71 E;  4TLF A;  1BDC A;  2JEE A;  4WY4 C;  1NGM B;  1USD A;  3CCR P;  3L75 D;  3VP9 A;  5B66 E;  3AE1 C;  3Q5S A;  1KIL E;  5TIS H;  1OXZ A;  3PTZ A;  1CI6 B;  4R4M A;  2PFX A;  4EI2 A;  3SFD C;  4D6T J;  2OTJ P;  1DX7 A;  1IFP A;  1NTZ D;  1QEX A;  1FZG A;  2M5A B;  3CMA P;  1WMK A;  1NTZ G;  3GF3 A;  1R5L A;  3K5B A;  3L70 D;  1JY2 P;  3V5B A;  5KLV K;  1XTC C;  2QJK B;  1S72 P;  2IZ0 A;  2Q6Q A;  1KTM A;  2E76 B;  2KZJ A;  1S1C X;  1JY2 O;  1KFM A;  2XNX A;  2HR3 A;  3A2A A;  1PIX A;  3CL3 D;  1KYO H;  2IYP A;  3V6I A;  3P8C E;  5CCH D;  5CCG A;  1SLQ A;  1L4A A;  1IFN A;  3CCU P;  4DOJ A;  3OW2 O;  3M91 A;  1VQ5 P;  1YJ9 P;  1KIL B;  1MFZ A;  1OW7 A;  2P10 A;  1NAF A;  1KB9 E;  2UWJ E;  2BEZ F;  5KTB A;  2FXO A;  2ZYG A;  1KIL C;  3SSU A;  3TF5 A;  1Q7Y Q;  1IFM A;  4W80 A;  2KNC A;  2FYU E;  3VMZ A;  3PP5 A;  1OVU A;  1SQV K;  1UIX A;  4BRY A;  3PRJ A;  1ZW0 A;  1EZV D;  1JTH A;  3AEA C;  2M3E A;  4GOD A;  2Z4E A;  3MP7 B;  1U7M A;  2KUB A;  3CCJ P;  2YO2 A;  2OYH A;  3H1L E;  2N1T D;  1FZB A;  2JDI H;  1X22 A;  1FE6 A;  1KQG B;  2E75 D;  1HJ0 A;  1ZLL A;  1N7L A;  1Q90 D;  4OGQ B;  2E5Y A;  4XA4 A;  3TGU D;  1SFC A;  1GTW A;  3N7N A;  3HTK A;  1DD3 A;  2IBZ D;  4OGQ C;  5BU5 A;  2Y9Y A;  2HYN A;  1N8R Q;  4U7J A;  3VMY A;  3AEE C;  2HLO A;  1PGJ A;  2IBZ G;  2VRS A;  1OVR A;  3AE4 C;  1M57 D;  4PV1 C;  1KV4 A;  2FXM A;  1JNM A;  2YNY A;  1GU4 A;  2V7Q J;  1WT6 A;  3TK1 A;  4WY4 A;  1S9K E;  1OW6 A;  1ZV8 A;  2JKV A;  5AVV B;  2NPS D;  2FY8 A;  5CBN A;  1IC2 A;  1N2D C;  3U1C A;  1BGY D;  3II6 A;  2JP3 A;  2WWW A;  1J1E C;  4L76 A;  2AXT H;  2A45 G;  2DW3 A;  1BGY G;  2Y0D A;  4N78 D;  1CI6 A;  3D6Z A;  3H1H J;  5KAF E;  2LR2 A;  3EFG A;  3B5N B;  1ZRT D;  2M5A A;  1KFN A;  2J59 M;  1S3J A;  5APU A;  1Y9B A;  1SQP J;  3H1J D;  1SQB K;  3FWN A;  1NHL A;  4BXL A;  1RHZ B;  1NTK E;  2C9L Y;  2WVR A;  5H2F H;  3B5N C;  3BCC D;  1FS0 E;  3H1J G;  3IF4 A;  1FOS F;  1S5L E;  5KLV D;  2AEF A;  5EFW B;  4C7N B;  1YJN P;  4LGD E;  2KLU A;  2RMZ A;  2Q7C A;  1FAV A;  2QA4 P;  4I2L C;  4H0L D;  1NTM K;  5CJ0 A;  1GZL A;  4WWI A;  3RL0 D;  1K8A Q;  2Q1K A;  4U3F E;  1AV1 A;  1VF5 B;  1URQ D;  3RK2 D;  2XND H;  2WPV B;  2W6J H;  3MTU E;  2ZJS E;  1H0T B;  2O01 H;  4ASV A;  1VF5 C;  4DZO A;  1EDK A;  3AE5 C;  3L72 E;  1VDF A;  2WSF J;  1LTT C;  2P2U A;  3L71 J;  1Y47 A;  4NPF X;  1PFI A;  4K35 A;  2OYI A;  1QVF O;  4QMA A;  4JPZ B;  2FYN C;  1KMI Z;  2G3A A;  1FDM A;  1GK4 A;  1TU3 F;  1RF0 A;  1OZH A;  2A06 D;  4IL6 X;  1YJW P;  1SQQ E;  3KZI H;  3GLM A;  3GG2 A;  2K9Y A;  2O1J A;  3G6E P;  2E74 B;  1BE3 D;  3L36 A;  1NU1 D;  4C46 A;  3O6Q B;  1UII A;  2H89 C;  2P1J A;  1DIP A;  3R4Y A;  3WUT A;  2Z5I A;  5DJU B;  1BE3 G;  3TNU B;  1NU1 G;  1IZN B;  1YYC A;  3W67 A;  1N86 A;  4GKG A;  1JCD A;  1U57 A;  2HFE D;  2OTL P;  4AQR D;  3R2P A;  5KAI H;  3CCL P;  3TGU E;  4PD4 I;  3HUS C;  1JY3 N;  2B88 A;  1T2K D;  1JO5 A;  1NTZ K;  4L75 A;  1HJB A;  4TT3 H;  5AW9 B;  5B5E E;  3BAT A;  2Q3I A;  3SWY A;  5CCH C;  4M3L A;  2J58 A;  3CCM P;  2AXC A;  4H44 D;  1LT9 A;  5C39 A;  3V2R A;  4YTP C;  2B87 B;  1LWU A;  1ZN5 A;  5AW3 B;  1VQ9 P;  3A3Y B;  1N7S B;  2QM7 A;  1IFJ A;  2D2C D;  1LGH B;  3I5C A;  3H1I E;  4IFM A;  4W7Z A;  1N7S C;  1EXJ A;  3A0H E;  2FYU J;  1HH0 A;  2SPZ A;  1M90 Q;  1IK9 A;  1GL2 D;  4Z1M H;  2KS1 B;  3PHL A;  2WMM A;  2KK7 A;  2QIW A;  4Y99 B;  3KQG A;  3VMX A;  2N1T C;  3H1K D;  2IDB A;  3KPE A;  3B5N A;  1P84 D;  2H8P D;  1SQB D;  3SWK A;  3CX5 I;  3H1L J;  5KLV E;  1FJP A;  4W7Y A;  2KB7 P;  2YMK A;  1G1I A;  1SS1 A;  3L74 D;  2KP8 A;  1LTJ A;  3D6Y A;  3C8V A;  1FZF A;  2KLV A;  3L74 G;  4H13 D;  4C7N A;  1S5L X;  5AVY B;  2YKQ A;  1NTM D;  3KXD A;  3CCS P;  2NZ2 A;  2M8R A;  2GM4 A;  1L0N E;  4PJ0 E;  3WU2 H;  1BCC D;  2BCC D;  2K9J B;  5M1B A;  1VL2 A;  4KJM A;  2A45 I;  1H0T A;  2NPS C;  4AYC A;  1BCC G;  3I55 P;  2BCC G;  1YIJ P;  2FYU G;  3CXH E;  3RL0 g;  2XZR A;  2I8D A;  3GF7 A;  1ZXG A;  1FZC C;  1KN7 A;  1K04 A;  5L8R J;  5GTI E;  2BAS A;  1SQV E;  4WB4 A;  2CK3 H;  1VQK P;  1S2E A;  3OJA B;  3H1L G;  2M3B A;  3B71 A;  4HH2 A;  2C0W A;  1T8Z A;  3U1A A;  3O6Q A;  1PP9 E;  3G9R A;  1NTK J;  5GTH E;  2QE7 H;  1VQO P;  3EQ2 A;  2YO3 A;  3GW6 A;  5AW5 B;  1VPC A;  1RH5 B;  1GMJ A;  1IK7 A;  4IOI H;  2V4H A;  3MD0 A;  3RL0 C;  5APV A;  3RGU A;  1DEB A;  1AQT A;  2JR8 A;  3LID A;  4HB1 A;  1DH3 A;  1PPJ E;  3RK2 C;  3F5H A;  1MZ9 A;  1GW3 A;  1AVO A;  2WSE H;  4U3F J;  4IL6 H;  3OAK A;  3CME P;  3ITK A;  4DCK A;  4EIJ A;  5KJ7 C;  2I1J A;  2WSC J;  3CC4 P;  3L37 A;  3TSI A;  3L72 J;  1OFC X;  2GUS A;  2B87 A;  2KXP B;  1L0L D;  3LW5 J;  2C0X A;  2FKW B;  2QVA A;  1N7S A;  2ZVN B;  2QEX P;  1L0L G;  2NRG A;  1SQQ J;  3HD7 A;  4PD4 D;  1AA0 A;  1PV3 A;  3NFQ A;  1OIP A;  3BRT B;  3HE5 B;  3FXD A;  1HF9 A;  3L4F A;  1CZQ A;  3VTP C;  2WPS A;  3QH9 A;  4KHX A;  2W90 A;  2KS1 A;  2QSI A;  1FU1 A;  4D6T D;  2OGU A;  4I1L A;  1T6A A;  1FZA A;  1FDO A;  3VOP A;  1JY3 P;  1M7L A;  5TIS E;  4D6T G;  2CPB A;  3D71 A;  2LXC B;  1T2K C;  3L73 E;  5AVW B;  3CWB E;  3TGU J;  1M1J B;  2GUV A;  2Q3E A;  2W6A A;  4U3F G;  1PL5 A;  2H7H A;  1OVV A;  2RH0 A;  1QL1 A;  1X9V A;  1PGO A;  3RK3 E;  4ZKU A;  1JY3 O;  2RN0 A;  1M1J C;  1NU1 K;  1RE3 A;  3Q3D A;  4JQ0 D;  5K5G B;  2OQQ A;  3AEG C;  2KSE A;  1EDI A;  3G3Z A;  1KZU B;  2YKO A;  2ZXE B;  3HD7 D;  1QX8 A;  2XKM A;  1H88 A;  2E43 A;  2R3S A;  1SQX E;  1EDJ A;  3CX5 D;  5AW0 B;  3H1I J;  3CCE P;  2JJL A;  1LTG C;  5CCG D;  1L4A D;  4PD4 H;  1L2P A;  2Q5U A;  1KYO E;  3E7K A;  2IYO A;  1GL2 C;  3JCU H;  4BWN A;  4MN4 C;  4PV1 B;  1T3U A;  2ZT9 D;  3TDK A;  2YMY A;  1AQ5 A;  4NPD A;  3B8E B;  4HYT B;  2M0B A;  5CJ4 A;  2I1K A;  3L75 E;  3M0D C;  5KLV J;  1J1E B;  2PGD A;  4OH8 B;  3RK3 B;  4H13 C;  2OTK E;  1HBW A;  2H43 A;  1KB9 I;  1ZME C;  1NTZ E;  3RK3 C;  4N3Y B;  3Q1M A;  3JC2 2;  1E79 H;  2K1A A;  4DJG A;  3HE4 B;  4K3A A;  3NTN A;  3CLQ A;  1VQP P;  3L70 E;  3BAS A;  4UB6 H;  5KJ7 A;  1KQS O;  1NJI Q;  2PP6 A;  2P7J A;  1L0N J;  4ZKP A;  1SFC D;  2CPS A;  1KQL A;  1HGV A;  4RES B;  3NXS A;  3AE7 C;  3CX5 H;  3WMM 0;  5AW8 B;  3S1K A;  4AUW A;  1IFD A;  2P67 A;  1KOR A;  1VQ4 P;  5AW4 B;  1YQ4 C;  1VQN P;  3VP8 A;  1SQV J;  2IFN A;  1IJD B;  4WY4 D;  2O01 N;  3GMA A;  4WBA A;  2XDJ A;  3P8M C;  1X0T A;  1NKZ B;  1Q81 Q;  2R5B A;  3HE5 A;  5AVZ B;  2K3R A;  2FYU K;  3M9B A;  2FYN B;  3H1H D;  1Q86 Q;  1PP9 J;  4GOE A;  2OAR A;  5AW1 B;  2WT7 B;  3V4W A;  3GHG C;  1KIL A;  1MUU A;  3H1H G;  2A45 H;  1EQ7 A;  2AXT E;  1SQP D;  2E5T A;  3V2Q A;  4JBZ A;  3OA7 A;  3BRV B;  1M1J A;  1SQP G;  1EZV E;  1L0N G;  2N9Y B;  1HGZ A;  3QWO C;  4LC1 A;  5H2F E;  1WRG A;  4JYC A;  3SFE C;  3A0B H;  1LT1 A;  1NH4 A;  2E76 D;  3HUS B;  1LTB C;  3AE2 C;  3C9I A;  2IZ1 A;  3MUD C;  3USS A;  1RF1 C; 
#chains in the Genus database with same CATH homology
 5AW7 B;  2A45 I;  2NPS C;  4AYC A;  1LTA C;  3P8C E;  2WPQ A;  5CCH D;  4O9B A;  5CCG A;  1SLQ A;  5AVT B;  1L4A A;  1IFN A;  2XZR A;  5APW A;  1FZC C;  4DOJ A;  3M91 A;  1KIL B;  1MFZ A;  1GU5 A;  1NAF A;  1X79 B;  2BAS A;  1KIL D;  5APX A;  4N6J A;  5KTB A;  4WB4 A;  1JOC A;  2KSJ A;  1KIL C;  3OJA B;  3HRN A;  1LTJ B;  2M3B A;  3UIA A;  5BU8 B;  2KOG A;  1L0L K;  4HH2 A;  1IFM A;  4W80 A;  1SP4 A;  1G2C B;  2C0W A;  2HPC B;  3VMZ A;  3PP5 A;  1SQV K;  1T8Z A;  3U1A A;  1LTJ C;  1JUN A;  2WIT A;  1RF1 C;  1JTH A;  4N78 E;  3EQ2 A;  1GDT A;  2YO3 A;  1LTS C;  5APS A;  2Z4E A;  5AW5 B;  2Z5H A;  1N73 B;  3U59 A;  4C7R A;  2N1T B;  3GHG B;  2YO2 A;  3T97 A;  1VPC A;  2OYH A;  4I6M C;  2N1T D;  1FZB A;  3MD0 A;  3V2N A;  1N73 C;  3RL0 C;  3O8Z A;  5APV A;  1DEB A;  5APY A;  3LID A;  2ZFC A;  3HE4 A;  1ZLL A;  3M9Q A;  1DH3 A;  3RK2 C;  3V2P A;  1N7L A;  1MZ9 A;  5CHX A;  1GW3 A;  2WSE H;  1ZR2 A;  4XA4 A;  5KJ7 D;  3OAK A;  1HTL C;  1SFC A;  2IX7 C;  1GTW A;  3N7N A;  3HTK A;  4GT1 A;  2FYZ A;  4LLH A;  1JY2 N;  2FFD B;  4EIJ A;  5KJ7 C;  5BU5 A;  1JMM A;  2HYN A;  2I1J A;  3L37 A;  3TSI A;  3VMY A;  5APT A;  1SQX K;  3P8C D;  5CCG C;  2HLO A;  3TYY A;  1L4A C;  3P32 A;  2VRS A;  2WSF H;  2FFD C;  2GUS A;  2C0X A;  2FXM A;  1JNM A;  2YNY A;  2FKW B;  1GU4 A;  3H6P A;  1N7S A;  1WT6 A;  3TK1 A;  4WY4 A;  1RF1 B;  2R3C A;  1S9K E;  5AW6 B;  1ZV8 A;  2NPS B;  5AVV B;  4JF7 A;  2N9B A;  3HD7 A;  2NPS D;  1SVF A;  3NFQ A;  1IC2 A;  1J1D B;  3BRT B;  1N2D C;  1RE4 C;  3HE5 B;  3U1C A;  3II6 A;  1HVV A;  2WWW A;  1FZC B;  1J1E C;  3MGN A;  3L4F A;  1CZQ A;  1GL2 A;  3VTP C;  2WPS A;  1J1D C;  2A45 G;  4KHX A;  4N78 D;  1CI6 A;  1FU1 A;  4I1L A;  2WT7 A;  1YTZ I;  1FBM A;  3M9H A;  1FZA A;  3H32 A;  3VOP A;  3EFG A;  3B5N B;  3P7K A;  2Q9I A;  1KFN A;  3B5N D;  1JY3 P;  1M7L A;  2J59 M;  5APU A;  2CPB A;  1SQB K;  1NHL A;  1JCC A;  1T2K C;  3N4X A;  5AVW B;  3VN0 A;  2C9L Y;  3M0D A;  1M1J B;  3B5N C;  2GUV A;  2W6A A;  1QL2 A;  2H7H A;  2E42 A;  1QL1 A;  1X9V A;  1RY3 A;  1FOS F;  4ZKU A;  1SFC C;  1JY3 O;  3A5T A;  5APQ A;  1M1J C;  4C7N B;  1NU1 K;  4LGD E;  1RE3 A;  1NTK K;  3M06 A;  1AFO A;  2Q7C A;  1FAV A;  3TNU A;  4I2L C;  2WTY A;  1NTM K;  3V4Q A;  3RL0 B;  5CJ0 A;  1GZL A;  3HUS A;  2HOD B;  2R5D A;  3RL0 D;  3E1I A;  1URQ B;  3RK2 B;  1URQ D;  3RK2 D;  3HD7 B;  1MV8 A;  3G3Z A;  1KZU B;  3NMD A;  5AVR B;  2YKO A;  2ZXE B;  3HD7 D;  1XTG B;  2XKM A;  3MTU E;  1H88 A;  1URQ C;  2E43 A;  1X8Y A;  2O01 H;  1W2E A;  2QM8 A;  1CSB A;  1IFI A;  4DZO A;  2IFM A;  3HD7 C;  1S9K D;  1VDF A;  5AW0 B;  1LTT C;  2P2U A;  5CCH A;  3SWF A;  3IR9 A;  1PFI A;  2OYI A;  5AVX B;  1L4A B;  2JJL A;  5AVU B;  1H8A A;  1LTG C;  5CCG D;  2PAJ A;  1L4A D;  3LIE A;  1GD2 E;  2Q5U A;  1GL2 C;  1FDM A;  1GK4 A;  1T3U A;  1RF0 A;  1FZE A;  2YMY A;  4Y99 C;  1GK6 A;  2L5G B;  1AQ5 A;  3B8E B;  4HYT B;  4IFF A;  1NOH A;  2O1J A;  3IFM A;  5CJ4 A;  2I1K A;  1G2C A;  2HPC A;  3L36 A;  1A02 F;  3M0D C;  4C46 A;  2C9N Y;  4GIF A;  2P1J A;  1J1E B;  1SQQ K;  1A02 J;  4OH8 B;  2Z5I A;  1JTH B;  3TNU B;  5BVZ A;  3RK3 B;  1HBW A;  2H43 A;  3RK3 D;  1YYC A;  1CW5 A;  1N73 A;  1RE3 C;  1N86 A;  4GKG A;  2OYH B;  1JCD A;  2N1T A;  3GHG A;  3CI9 A;  2XU6 A;  2HFE D;  5AW2 B;  3RK3 C;  4N3Y B;  2KYV A;  3A7O A;  3R2P A;  4AQR D;  1G1J A;  1E5W A;  2POH A;  5AVS B;  2YKP A;  1NKN A;  3HUS C;  1JY3 N;  2OYH C;  3HE4 B;  1IO4 A;  1T2K D;  3NTN A;  3CLQ A;  1JO5 A;  1NTZ K;  1HJB A;  5AW9 B;  1SQP K;  5CMZ A;  3BAS A;  5KJ7 A;  1FOS E;  1OWA A;  3KDP B;  2WPR A;  4JYB A;  1HWT C;  3MIW A;  1SFC B;  2PP6 A;  2P7J A;  1J2J B;  1L0N K;  2O1K A;  2R32 A;  4ZKP A;  3HTK B;  2OYI B;  3BAT A;  1SFC D;  2CPS A;  1KQL A;  2FFD A;  2Q3I A;  3SWY A;  3L35 A;  1Z56 A;  1HGV A;  5CCH C;  4M3L A;  4RES B;  2OYI C;  3NXS A;  2J58 A;  1GW4 A;  2HG5 D;  3WMM 0;  1FJK A;  1LT9 A;  3BVH A;  5AW8 B;  3V2R A;  1LWU A;  1ZN5 A;  4AUW A;  2W6B A;  5AW3 B;  2LKM A;  1IFD A;  1RF0 C;  2P67 A;  3KYQ A;  4B86 A;  5AW4 B;  3VYI A;  3MUD A;  3A3Y B;  1N7S B;  4WY4 B;  3VP8 A;  2QM7 A;  1IFJ A;  1N7S D;  2IFN A;  1IJD B;  1LGH B;  4WY4 D;  1H89 A;  1RF1 A;  1RE4 A;  1T3J A;  3I5C A;  2NPS A;  4IFM A;  2XDJ A;  4WBA A;  4W7Z A;  5AVQ B;  2W27 A;  2JEE A;  1N7S C;  3P8M C;  4WY4 C;  1NKZ B;  2R5B A;  3HE5 A;  5AVZ B;  3VP9 A;  2FYU K;  1FZC A;  3M0A A;  1HH0 A;  3M9B A;  1GL2 B;  1OXZ A;  1IK9 A;  1GL2 D;  1CI6 B;  2OAR A;  2MJZ A;  5AW1 B;  2WT7 B;  4Y99 B;  3KQG A;  1LTI C;  3V4W A;  3VMX A;  2N1T C;  3GHG C;  3H32 B;  1KIL A;  1DX7 A;  1MUU A;  3KPE A;  3B5N A;  1FZG A;  2A45 H;  1EQ7 A;  2H8P D;  3V2Q A;  1FJP A;  1ZR4 A;  4W7Y A;  2KB7 P;  3OA7 A;  1G1I A;  4EOT A;  3BRV B;  1M1J A;  1LTJ A;  2KP8 A;  1NO4 A;  1FZF A;  1JY2 P;  2KLV A;  4XE5 B;  1HGZ A;  3V5B A;  5KLV K;  4C7N A;  5AVY B;  1XTC C;  2XV5 A;  2YKQ A;  4LC1 A;  1LT9 B;  1WRG A;  4JYC A;  1LWU B;  1HUC A;  4IFD K;  2WZ7 A;  1NWQ A;  1JY2 O;  1NH4 A;  3HUS B;  1LTB C;  2WSC H;  1KFM A;  1LT9 C;  2HOD A;  2XNX A;  1LWU C;  1URQ A;  3C9I A;  2M8R A;  2GM4 A;  3A2A A;  2IPP A;  3CL3 D;  1YTZ T;  3LW5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...