2WSEH

Improved model of plant photosystem i
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
69
Chain Sequence
DLEDIANTTGQWDVYGSDAPSPYNSLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSANAPQDVLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AT3G54890
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
total genus 4
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2009-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03244 PSI_PsaH Photosystem I reaction centre subunit VI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wseH01
1SQPK 2OARA 4IFDK 5KLVK 2J59M 3CLQA 1L0NK 2WSCH 1NTMK 2O01H 3G3ZA 2FYUK 1NTKK 1NTZK 1SQBK 2WSEH 1NU1K 3M9QA 1SQXK 2WSFH 1L0LK 1SQVK 2LKMA 3LW5H 1SQQK
chains in the Genus database with same CATH superfamily
1KYOH 1L0NJ 5APYA 3CX5I 2C9NY 3CLQA 4EOTA 1YJNP 2P7JA 5H2FE 1NGMB 3JC22 1VQ7P 5KLIC 3SSUA 3HUSB 3C8VA 5CJ0A 4GIFA 1KILB 1BE3D 4W7ZA 3EWKA 3AEFC 4IL6H 3QH9A 1PFIA 3K5BA 5L8RJ 3GHGB 1HWTC 5KAFH 1Y9BA 1YQ4C 2CK3H 3EFFK 3HD7A 1S5LH 1RQUA 2ZVOB 2IZ0A 2QJKB 1KB9I 3L71E 1RHZB 2OTKE 2HODA 3CX5D 3L4FA 2BCCE 2QJPC 4YXWH 2OTLP 3LW5J 3V5BA 1XTGB 4M3LA 1J2JB 2K9JA 5CCGD 1IFNA 1SQBD 4RKUJ 1ZOYC 1AV1A 4H44B 2E5TA 3L72E 2WMMA 1MFTA 4OGQC 1JM0A 1DIPA 1PGQA 1BE3G 2AXTH 3O6QB 2FBWC 2QG4A 1SVFA 2CPSA 3Q5SA 1NTKE 3IR9A 1Q90D 1LTGC 1SQVJ 1L0LE 3GW6A 3L35A 1KB9D 2A06D 1DD3A 1SFCA 2ZXEB 2N9BA 2NPSD 3RL0g 4PV1D 2FYUD 4C7RA 2HLOA 3B5NB 2W6BA 1IZNB 1YJWP 3VMXA 3AECC 2P2UA 4NPDA 2E5YA 3AE6C 1SQBG 2XNXA 5AW7B 3JCUE 2XZRA 1RE3A 4AYCA 3MIWA 2IDBA 1PP9D 2QA4P 2Y9ZA 1GL2C 5KKZB 1QEXA 2WZ7A 2YKQA 3KZIE 2YKOA 4H0LB 1LP1A 1M8OB 1AVYA 3H25A 2M5AA 5H2FH 1K05A 2E75B 3HD7D 1VQ9P 2A06G 1RQVA 1OW8A 2FYUG 1A02F 5AVQB 2QEXP 4LC1A 4HKZH 1RF1A 1EXJA 1T8ZA 3CCJP 2B87B 1L2PA 5BU5A 1NAFA 2YMYA 1G2CA 1QVFO 1Y47A 1KMIZ 3RK3D 2OYOA 1HBWA 5AW0B 2H89C 1PP9G 1IK7A 3RL0B 1J1DB 3TF5A 3PTZA 4RJTA 1IO4A 1BE3E 4JYBA 4RESB 1P84I 2WQYC 3NTNA 3P8CD 3U1CA 1J1EB 3Q5PA 4KHXA 3Q2YA 1Q81Q 2MJZA 5AVZB 1Q2NA 1VF5C 3CCUP 3H1JD 1N73B 1URQA 1Y8AA 2MKVA 1SFCD 4C7NB 4U3FD 1PGOA 2ZYGA 3CX5E 1T6AA 4H13C 1KV4A 2P58A 5CCHA 3BCCG 3M9HA 1FZCC 1X22A 2PRRA 1GTWA 2OYIB 3HUSA 1SQBE 1FU1A 2IPPA 1FC2C 4PD4D 3CD6P 3R4YA 1KILA 1GMJA 1SQPK 3H1KD 3H1IJ 4ZMDA 4U7JA 3BCCJ 3GHGA 1NTZJ 1LTJC 5TJHA 2SPZA 3ABVC 3CMAP 3RK2C 3SWYA 1OW6A 1BCCD 1N2DC 4K35A 3VP9A 1BGYD 1KB9E 3H1JG 5KJ7C 2A06E 3JCUH 2I1KA 3AEDC 3MHVA 5APUA 4U3FG 3A5TA 4WVZA 3I5CA 2R3CA 3I55P 1RY3A 3D6ZA 2D2CD 3H6PA 1YTZT 3RK3B 1K9MQ 1SQQK 3GF7A 3KZIH 3MTUE 2HYNA 1OVVA 4MN4C 4NPFX 4WBAA 1NKNA 2P67A 3O6QA 3CC4P 3H1KG 1EDIA 3H1LD 1GK4A 1NAYA 3CPWO 2KOGA 3P8MC 2KP8A 2GM4A 1EDLA 1NTMK 5AVWB 1N7SC 1BCCG 1JEKA 1K04A 1BGYG 1SLQA 1ZN5A 1OVUA 1M1JB 2Q5UA 3USSA 1VL2A 1URQD 3B5NA 2N1TB 2JWAA 2HG5D 1A02J 3C1LA 3B4SA 4L75A 3BCCE 3P32A 1H88A 3NMDA 4BXLA 2E74B 1JNMA 3FWLA 3L73J 4OVNF 1VDFA 1T2KC 1HF9A 4I7ZB 2OYHB 4A7PA 1KILD 2QM8A 3EFGA 2Q3IA 2KUBA 2KB7P 4YTPC 3PP5A 3H1LG 2JP3A 2KYVA 3GLMA 3IF4A 2KZJA 3CX5H 1HGZA 1ZLLA 3P8CE 2O1JA 2OQQA 3D71A 2FFDB 3WUVA 1AFOA 1FZCB 2R5BA 4WB4A 3H1JE 5AVUB 1DH3A 1JMMA 4U3FE 2B87A 3L74G 3L37A 2XV5A 2IYOA 1RH5B 4ZNCA 1H8AA 2KLVA 4H44D 1QGKB 2BCCJ 3CXHI 4JPZB 3VP8A 1CW5A 2LKMA 3PJSK 1KB9H 2UWJE 2XDJA 4LGDE 1P84E 4O9BA 1LTSC 5BU8B 1GDTA 4N78D 4I2LC 3TSIA 1W2BO 1ZRTD 4PJ0E 1MFZA 1LNQA 2KZIA 1SQXK 5AVSB 2Q1KA 1YI2P 4EDFA 1BCCE 3F5HA 3AE3C 1BGYE 5APTA 4C7NA 2AEMA 1NTKJ 3ITKA 2KS1B 1MV8A 2OTJP 3H1HD 2J58A 3B5ND 1L0LJ 3WU2E 1LWUC 3AEGC 3MP7B 3AE2C 2OYIA 1UIXA 5KLVJ 3CXHD 1KQLA 2E43A 2J59M 3Q1MA 5CCGC 1FDIA 1KQGB 1SQPD 2JEEA 1NU1K 1EXIA 1NKZB 4XA4A 3PHLA 4HJGH 3M0DC 1W5CE 3H1LE 2LXBA 3A3YB 4H0LD 3L75G 1N8RQ 3TNUB 4ASVA 1FZBA 5CMZA 2E42A 3CC7P 2E75D 3JSVC 3VOPA 1FZFA 1FZAA 3VMYA 5KAIE 4WY4B 2O3JA 1W2EA 1R5LA 3H1HG 1USEA 2POHA 1USDA 2JJLA 3L74E 2CPBA 2WPQA 3L75J 2NPSC 5AW3B 4PV1C 1SQQD 1FS0E 1GL2A 1E5WA 5AVXB 3SFEC 3IFMA 1U7MA 3V6IA 3RBXA 3OJAB 1VQ4P 3RL0D 1LT1A 3T97B 2JR8A 3G3ZA 2OGUA 3SFDC 1OIPA 3KHUA 1PGPA 1GZLA 1FDMA 1CZQA 3VN0A 2E76B 1M1KQ 1AQ5A 5KLVE 2L91A 1NTMD 2ZT9B 3TYYA 3MUDA 5APQA 2GUVA 1M1JA 3II6A 1BE3J 3G71P 2N1TA 1YIJP 4BRYB 3W67A 4JBZA 5AW5B 1YBKA 2DW3A 2YXRB 2ZYAA 2QIWA 4KJMA 3HD7C 4EIJA 2M3EA 1P84H 1L4AC 1SQQG 2IFNA 1T3UA 1DX7A 3CL3D 3OA7A 3TGUD 1QL1A 4PJ0H 1KN7A 2OYHA 5APXA 1EC5A 2QJYC 3CWBD 3HRNA 1KYOD 2C9LY 1LT9B 3G9RA 3V4QA 3KXDA 4DCKA 2GUSA 2JO1A 3A0BE 1L0NK 1SQBJ 1OWAA 2P10A 2LR2A 2R44A 3WU2H 4YXDC 1S3JA 3L70D 4D6TD 3L75E 4JYCA 1JY2O 3ZDMA 1ZRTE 2FFDA 3GMAA 1NTMG 2O1KA 1S2EA 3QWOC 1FZCA 2YKPA 5EFWB 1LWUB 5KLIB 1OW7A 2B88A 3D70A 3AEAC 5B5EE 3H1HE 2Y0CA 5AW8B 3EQ2A 1FE6A 4XE5B 1SFCC 1BDCA 2Q6QA 3TGUG 4PD4I 3SWKA 4R4MA 1GL2D 2FYUJ 3CXHE 2FYNC 3CWBG 4WWIA 4DZOA 5KAIH 2YXQB 3MD0A 2QJPB 1EZVD 1HH0A 1D7MA 3P7KA 3L70G 4D6TG 2QSIA 2H8PD 2IFMA 1SQXD 1WT6A 1PP9J 1OVRA 1VQPP 3H32B 2KS1A 1VQKP 2N1TD 4GT1A 4HYTB 2P1JA 2IBZI 3VMZA 4OGQB 2XNDH 1NH4A 1BDDA 1IFIA 2E74D 1SQQE 2Y9YA 3BATA 1E79H 2WSSH 1PIXA 1SQVK 3I56P 1RF1C 4IFDK 3AE1C 1KQSO 1NU1D 1FJKA 5BVZA 2O01N 3LIEA 1YHQP 3E1RA 3F89A 5TISE 4NPEA 4Y99C 2BASA 3TNUA 1EZVG 4N6JA 1FZGA 5APWA 1IJDB 1SQXG 2Z5IA 2IX7C 1XTCC 1EQ7A 1NTME 3MGNA 1AVOA 2FYUE 2RH0A 4TT3H 4WY4A 2WTYA 2WSEH 1L4AB 3B8EB 2ITAA 1EDJA 1VQMP 2IBZD 1KTMA 3CCQP 3OAKA 1PPJD 3D6YA 1GL2B 3A0BH 1R8EA 1H0TB 1YITP 3H1JJ 1RE4A 1URQC 3TGUE 2RN0A 3IN6A 1PP9E 4U3FJ 1RF0C 2W6AA 4ZKPA 3CWBE 5CCHC 2YMKA 3T97A 1NU1G 1QVGO 3BRTB 1QLED 5AW1B 1KFMA 5B5EH 1OX3A 5CJ4A 3HE5B 3HUSC 2W27A 2Q3EA 2WITA 5KJ7D 1SS1A 3L70E 2KXPB 4D6TE 3M0AA 1S72P 4I6MC 2BEZF 3BRVB 4BRYA 3H1KJ 1BSHA 3L71D 1JY3O 3CXHH 4GDOA 3GHGC 1NO4A 2YO3A 3B71A 2IBZG 2V7QJ 2QJKC 1PPJG 2M0BA 1BCCJ 5AVVB 3RK3E 1BGYJ 3SWFA 2HR3A 2ZAEB 4YPCA 5GTHE 3U59A 1OFCX 1ZW0A 3L72D 4QMAA 3MZWB 1LT9A 1M56D 1VQ6P 1VF5B 2Z4EA 1ZP0C 1G1IA 1L0ND 1N7SD 1JY2P 5APVA 1Q7YQ 3PRJA 2NRGA 4XFJA 3S4RA 4H13B 3G6EP 2K88A 1SQXE 1LWUA 5E79E 1FOSF 3TK1A 3L71G 2Y0DA 1Q82Q 3H1LJ 4EYYQ 4WY4D 2HPCB 5GTIE 3M06A 1PGJA 1NTZK 3AE9C 1UIIA 5TISH 3A0HE 1LTAC 4PD4E 1YQ3C 3V2QA 1LTJB 1OXZA 4L76A 2GA1A 4HH2A 1R5SA 1NYHA 3L72G 3RK2B 3L74J 4AQRD 2M8RA 3H1KE 2G3AA 2YIUC 5CBOA 3Q5RA 1NU1E 4C46A 1ZR4A 1L0NG 1MKMA 4HB1A 3Q3DA 2KNCA 1FDOA 2W6JH 1HTLC 2E76D 3IAOA 3AE7C 4TLFA 3L36A 1KZUB 5KKZC 4AUWA 2ZT9D 1IFJA 3H32A 2WSCH 3KQGA 1U7JA 1U57A 4H0LC 3CCRP 2YNYA 1SP4A 3HTKB 2IBZE 2A45I 2K37A 4I1LA 4BWNA 2E75C 1PPJE 3W68A 1LJ2A 4DOJA 1GW4A 1SQVD 2I1JA 1LTIC 2WT7B 1N86A 1M7LA 3CCSP 1N7SB 5CHXA 4EI2A 3UIAA 2WWWA 1AA0A 2Q9IA 3R2PA 5AVTB 5DJTB 2WSEJ 3AE4C 3RL0C 1J1DC 4OWFA 4UB8E 3O8ZA 2V4HA 1VQLP 2KSEA 1MUUA 1VPCA 1FBMA 1L4AA 5GTHH 1FJPA 1J1EC 3RBZA 1EDKA 1X79B 2H88C 1N7LA 1YYCA 3HE4B 1N73C 1H0TA 2WVRA 3AEBC 3GG2A 2C0WA 1SQVG 2KLUA 1SQPG 5CBNA 1KYOI 1KILE 3FGAD 1GU5A 1TU3F 1NOHA 3H1HJ 1JCDA 2O01H 3M91A 5E79H 1IFPA 1HJBA 3CC2P 2JWDA 3WMM0 2OYIC 2W8ZA 3HE5A 2G8YA 1T3JA 1NJIQ 1QX8A 1L0NE 5GTIH 1VQ8P 1ZR2A 2LXCB 3GF3A 1DEBA 2KK7A 2W90A 1JY3P 1SQPJ 3A0HH 2RMZA 4PD4H 4W7YA 5AW4B 4GOFA 1JTHB 2A45G 2K9YA 3BASA 5DJUB 4OGQD 4KT0J 3VMAA 2XU6A 1GK6A 1HVVA 2V7QH 1VQNP 1S4XA 2KI7B 2YIUB 3NFQA 3V2NA 1VQOP 1WMKA 3OW2O 1NHLA 2Z5HA 4IOIH 2BEQD 1NWQA 2FYZA 2YO2A 3RK3C 1NVOA 2IZ1A 2ZXXA 3V4WA 1Z56A 1NTKK 4N78E 1SQQJ 1JMBA 5AVYB 1EZVI 5KTBA 2J5UA 4IFFA 2ZYDA 2R32A 1L0LK 1KQFB 3CMEP 1PL5A 5KLVK 5AVRB 2K1AA 2QM7A 4UB6E 2HPCA 1ZV8A 1L4AD 1OMIA 2JDIH 2PAJA 1JY2N 1YJ9P 1JO5A 1HGVA 2QRXA 1YTZI 2QE7H 3H1ID 1NTMJ 3BCCD 1DD4A 3MUDC 1NTZD 1M1JC 1S9KD 1LTJA 2N1TC 2PGDA 4DT0A 1MZ9A 1H89A 1SQVE 4LLHA 5AW2B 1SQPE 2WSFH 1KORA 4UB8H 1IK9A 1LGHB 5KJ7A 1ZXGA 3U1AA 2E74C 1FOSE 3KYQA 1RE3C 2KNCB 2WSCJ 3TGUJ 1IC2A 4I7ZC 2OYHC 1BSNA 3WUUA 2QVAA 3CWBJ 3CCMP 1PZQA 5B66E 1CI6B 2NPSB 4R4LA 4PV1B 3V2PA 4B86A 3CCVP 2PFXA 2NZ2A 2VRSA 2ZJSE 3S1KA 3TDKA 3HTKA 3VTPC 3PLNA 3NXSA 3L70J 4D6TJ 2FFDC 1RF0A 3H1IG 1NTZG 3RGUA 4CPGA 2WT7A 1CSBA 2D2CC 1JB0J 2AEFA 2L5GB 2FXPA 1N7SA 4IL6X 1VF5D 2FXOA 3M9BA 4L74A 3CCEP 2PP6A 3KPEA 1P84D 2FY8A 1JUNA 3C9IA 4RO0A 1S5LX 5AW9B 3N7NA 3FXEA 2R3SA 4H13D 1ZMEC 2FXMA 5K5GB 3HD7B 3AE8C 1QL2A 4Z1MH 2AXCA 3L73D 3AEEC 2HODB 4Y28J 1KFNA 4W80A 2QJYB 2FKWB 3HE4A 4ASWA 2O01J 1AQTA 1SQXJ 2WPSA 2K9JB 3G4SP 1SQBK 1X8YA 4JF7A 3LW5H 2M3BA 1HUCA 3E1IA 1KYOE 2R5DA 2N9YB 5APSA 3RK2D 5AW6B 4UB6H 3CI9A 1FZEA 4GODA 1KILC 2Q7CA 2H43A 4GOEA 3L73G 4ZKUA 4K3AA 1NU1J 1SFCB 4IL6E 2BCCD 2FYUK 1JTHA 3FX0A 2FYNB 1PV3A 5KAFE 3FWNA 1M57D 5M1BA 1S5LE 3L74D 1KD1Q 2IYPA 2OARA 1WRGA 2K3RA 1S1CX 2KIKA 1K73Q 3H1IE 1G1JA 5CCHD 1JY3N 3VYIA 1NTZE 1JCCA 2ZVNB 2WPRA 1S9KE 4WY4C 1VQ5P 4N3YB 3V2RA 5C39A 5B66H 2B9BA 4H44C 3S9OA 2W83C 3LIDA 1NTKD 1EZVE 1RE4C 2XKMA 1AJYA 3PH0A 1L0LD 2A45H 1LP1B 1IFDA 2RKLA 3M9QA 2JKVA 2M5AB 5KLVD 4JQ0D 2AXTE 2AEJA 3E7KA 1KC8Q 2BCCG 2HFED 1LTTC 1T2KD 2E76C 3A2AA 5CCGA 1RF1B 4DJGA 3WUTA 2D2CB 4L73A 2ZFCA 2ZT9C 1K8AQ 2WSFJ 3A7OA 1X0TA 3N4XA 3B5NC 3M0DA 1LTBC 1G2CB 3L71J 2Y0EA 4GKGA 2H7HA 1HJ0A 4Y99B 2I8DA 3CCLP 1OZHA 2C0XA 1GW3A 1DEEG 1JOCA 4IFMA 3KDPB 2B89A 1NTKG 3AE5C 2WPVB 3BVHA 2KSJA 1L0LG 1IFMA 1FAVA 3L75D 1CI6A 1LT9C 3L72J 2NPSA 1GU4A 5KLVG 1GD2E 4OH8B 1N73A 3L73E 1X9VA 1M90Q 1URQB 1Q86Q 3FXDA
chains in the Genus database with same CATH topology
1URQD 3B5NA 2N1TB 4W7YA 5APYA 2N1TD 5AW4B 1JTHB 2A45G 2HG5D 4GT1A 1A02J 2C9NY 4HYTB 2P1JA 3BASA 3VMZA 3CLQA 1NH4A 4EOTA 2P7JA 3P32A 1H88A 2XU6A 3NMDA 1IFIA 1GK6A 1HVVA 1JNMA 1VDFA 3BATA 1T2KC 1SQVK 3HUSB 3NFQA 3V2NA 1NHLA 2Z5HA 5CJ0A 2OYHB 1RF1C 4GIFA 1KILB 1NWQA 1KILD 2QM8A 4IFDK 2FYZA 2YO2A 3EFGA 3RK3C 2Q3IA 4W7ZA 1FJKA 5BVZA 2KB7P 3V4WA 1PFIA 1Z56A 3LIEA 3PP5A 1NTKK 4N78E 2KYVA 5AVYB 1HGZA 3GHGB 1ZLLA 4Y99C 2BASA 4IFFA 3TNUA 5KTBA 2R32A 3P8CE 4N6JA 1HWTC 1L0LK 1FZGA 5APWA 3HD7A 1IJDB 2O1JA 2Z5IA 2FFDB 2IX7C 1XTCC 1EQ7A 5KLVK 3MGNA 5AVRB 1AFOA 1FZCB 2R5BA 2QM7A 4WB4A 5AVUB 2HODA 4WY4A 2WTYA 1DH3A 3L4FA 2HPCA 2WSEH 1ZV8A 1L4AB 1JMMA 3B8EB 1L4AD 2PAJA 1JY2N 3L37A 2XV5A 1JO5A 3V5BA 1XTGB 4M3LA 1J2JB 1HGVA 5CCGD 1YTZI 3OAKA 1H8AA 1GL2B 1IFNA 1M1JC 1S9KD 1LTJA 1RE4A 1URQC 2KLVA 2N1TC 1MZ9A 1H89A 4LLHA 3VP8A 5AW2B 1RF0C 2W6AA 4ZKPA 2WSFH 1CW5A 2LKMA 5CCHC 3T97A 1IK9A 1LGHB 2XDJA 5KJ7A 3U1AA 3BRTB 4LGDE 1FOSE 3KYQA 5AW1B 1RE3C 4O9BA 1KFMA 1LTSC 1SVFA 5BU8B 2CPSA 5CJ4A 1GDTA 3HE5B 3HUSC 2W27A 4N78D 3IR9A 4I2LC 1IC2A 3TSIA 2WITA 5KJ7D 1LTGC 2OYHC 1MFZA 1SQXK 5AVSB 3L35A 3M0AA 4I6MC 1CI6B 2NPSB 1SFCA 2ZXEB 2N9BA 3BRVB 2NPSD 3V2PA 5APTA 4C7NA 4B86A 1JY3O 3GHGC 1NO4A 2VRSA 4C7RA 2YO3A 2HLOA 1MV8A 3B5NB 3HTKA 3VTPC 2J58A 2W6BA 3B5ND 3NXSA 1LWUC 3VMXA 2FFDC 1RF0A 2P2UA 2OYIA 5AVVB 2XNXA 5AW7B 3SWFA 2XZRA 2WT7A 1KQLA 2E43A 1CSBA 1RE3A 4AYCA 2J59M 3U59A 3MIWA 2L5GB 1LT9A 5CCGC 1N7SA 2Z4EA 2JEEA 3M9BA 1NU1K 1GL2C 1NKZB 4XA4A 1G1IA 2WZ7A 2PP6A 3KPEA 1N7SD 3M0DC 2YKQA 1JY2P 2YKOA 5APVA 1JUNA 3C9IA 3A3YB 5AW9B 3N7NA 3TNUB 2FXMA 1FZBA 3HD7B 5CMZA 2E42A 3HD7D 1LWUA 1QL2A 1FOSF 3VOPA 3TK1A 1A02F 1FZFA 5AVQB 1FZAA 4LC1A 3VMYA 2HODB 4WY4B 1W2EA 1KFNA 4WY4D 1RF1A 4W80A 2HPCB 2POHA 1T8ZA 2JJLA 2FKWB 3HE4A 3M06A 2CPBA 5BU5A 1NAFA 2WPQA 2NPSC 2WPSA 5AW3B 1NTZK 1SQBK 2YMYA 1G2CA 1X8YA 1GL2A 4JF7A 1LTAC 1E5WA 3RK3D 5AVXB 1HBWA 3V2QA 1LTJB 3IFMA 3LW5H 5AW0B 1OXZA 2M3BA 1HUCA 3E1IA 4HH2A 2R5DA 3RK2B 3OJAB 3RL0B 5APSA 1J1DB 3RK2D 4AQRD 2M8RA 5AW6B 3RL0D 1IO4A 3CI9A 4JYBA 3G3ZA 4RESB 1FZEA 4C46A 1ZR4A 3NTNA 3P8CD 1KILC 3U1CA 1J1EB 1GZLA 1CZQA 3VN0A 1FDMA 2Q7CA 2H43A 4KHXA 1HTLC 2MJZA 5AVZB 1AQ5A 3L36A 3TYYA 1KZUB 3MUDA 4AUWA 5APQA 2GUVA 1IFJA 1M1JA 3H32A 1N73B 3II6A 2WSCH 3KQGA 4ZKUA 1URQA 1SFCB 2N1TA 2FYUK 1SFCD 4C7NB 1JTHA 2YNYA 5AW5B 1SP4A 3HTKB 5CCHA 2A45I 1FZCC 3M9HA 4I1LA 3HD7C 4EIJA 1GTWA 2OARA 1WRGA 1L4AC 2IFNA 1T3UA 1G1JA 1DX7A 2OYIB 4DOJA 1GW4A 3CL3D 5CCHD 1JY3N 3HUSA 3VYIA 1JCCA 2WPRA 3OA7A 1S9KE 1FU1A 1QL1A 2IPPA 4WY4C 2I1JA 1LTIC 5APXA 2OYHA 2WT7B 1KILA 4N3YB 1N86A 3V2RA 3HRNA 1M7LA 2C9LY 1LT9B 1SQPK 1N7SB 3V4QA 5CHXA 3LIDA 3UIAA 2GUSA 2WWWA 1L0NK 3GHGA 1LTJC 1RE4C 2XKMA 1OWAA 2Q9IA 3R2PA 5AVTB 2A45H 1IFDA 4JYCA 1JY2O 3RK2C 3SWYA 3RL0C 2FFDA 3M9QA 1J1DC 2O1KA 1N2DC 1FZCA 2YKPA 3O8ZA 3VP9A 1MUUA 1LWUB 5KJ7C 1VPCA 1FBMA 2I1KA 1L4AA 2HFED 5APUA 1FJPA 1J1EC 1LTTC 1T2KD 3A5TA 3A2AA 5CCGA 3I5CA 1RF1B 1X79B 2R3CA 5AW8B 1N7LA 1YYCA 1RY3A 2ZFCA 3H6PA 3HE4B 1YTZT 3RK3B 1N73C 3EQ2A 4XE5B 3A7OA 1SQQK 3N4XA 1SFCC 3B5NC 3M0DA 3MTUE 1LTBC 1G2CB 2C0WA 2HYNA 1GL2D 4GKGA 2H7HA 4Y99B 1GU5A 1NOHA 4WBAA 1JCDA 1NKNA 2O01H 3M91A 2P67A 2C0XA 1GW3A 1HJBA 4DZOA 1JOCA 3WMM0 2OYIC 4IFMA 3KDPB 3HE5A 1T3JA 1GK4A 3MD0A 2KOGA 3BVHA 1HH0A 2KSJA 1ZR2A 3P8MC 3P7KA 1IFMA 2H8PD 2KP8A 1DEBA 2GM4A 2IFMA 1FAVA 1WT6A 1CI6A 1LT9C 1NTMK 1N7SC 5AVWB 2NPSA 1GU4A 1GD2E 1JY3P 4OH8B 1SLQA 1ZN5A 1M1JB 3H32B 1N73A 1X9VA 2Q5UA 1URQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP K;  2OAR A;  4IFD K;  5KLV K;  2J59 M;  3CLQ A;  1L0N K;  2WSC H;  1NTM K;  2O01 H;  3G3Z A;  2FYU K;  1NTK K;  1NTZ K;  1SQB K;  2WSE H;  1NU1 K;  3M9Q A;  1SQX K;  2WSF H;  1L0L K;  1SQV K;  2LKM A;  3LW5 H;  1SQQ K; 
#chains in the Genus database with same CATH topology
 1KYO H;  1L0N J;  5APY A;  3CX5 I;  2C9N Y;  3CLQ A;  4EOT A;  1YJN P;  2P7J A;  5H2F E;  1NGM B;  3JC2 2;  1VQ7 P;  5KLI C;  3SSU A;  3HUS B;  3C8V A;  5CJ0 A;  4GIF A;  1KIL B;  1BE3 D;  4W7Z A;  3EWK A;  3AEF C;  4IL6 H;  3QH9 A;  1PFI A;  3K5B A;  5L8R J;  3GHG B;  1HWT C;  5KAF H;  1Y9B A;  1YQ4 C;  2CK3 H;  3EFF K;  3HD7 A;  1S5L H;  1RQU A;  2ZVO B;  2IZ0 A;  2QJK B;  1KB9 I;  3L71 E;  1RHZ B;  2OTK E;  2HOD A;  3CX5 D;  3L4F A;  2BCC E;  2QJP C;  4YXW H;  2OTL P;  3LW5 J;  3V5B A;  1XTG B;  4M3L A;  1J2J B;  2K9J A;  5CCG D;  1IFN A;  1SQB D;  4RKU J;  1ZOY C;  1AV1 A;  4H44 B;  2E5T A;  3L72 E;  2WMM A;  1MFT A;  4OGQ C;  1JM0 A;  1DIP A;  1PGQ A;  1BE3 G;  2AXT H;  3O6Q B;  2FBW C;  2QG4 A;  1SVF A;  2CPS A;  3Q5S A;  1NTK E;  3IR9 A;  1Q90 D;  1LTG C;  1SQV J;  1L0L E;  3GW6 A;  3L35 A;  1KB9 D;  2A06 D;  1DD3 A;  1SFC A;  2ZXE B;  2N9B A;  2NPS D;  3RL0 g;  4PV1 D;  2FYU D;  4C7R A;  2HLO A;  3B5N B;  2W6B A;  1IZN B;  1YJW P;  3VMX A;  3AEC C;  2P2U A;  4NPD A;  2E5Y A;  3AE6 C;  1SQB G;  2XNX A;  5AW7 B;  3JCU E;  2XZR A;  1RE3 A;  4AYC A;  3MIW A;  2IDB A;  1PP9 D;  2QA4 P;  2Y9Z A;  1GL2 C;  5KKZ B;  1QEX A;  2WZ7 A;  2YKQ A;  3KZI E;  2YKO A;  4H0L B;  1LP1 A;  1M8O B;  1AVY A;  3H25 A;  2M5A A;  5H2F H;  1K05 A;  2E75 B;  3HD7 D;  1VQ9 P;  2A06 G;  1RQV A;  1OW8 A;  2FYU G;  1A02 F;  5AVQ B;  2QEX P;  4LC1 A;  4HKZ H;  1RF1 A;  1EXJ A;  1T8Z A;  3CCJ P;  2B87 B;  1L2P A;  5BU5 A;  1NAF A;  2YMY A;  1G2C A;  1QVF O;  1Y47 A;  1KMI Z;  3RK3 D;  2OYO A;  1HBW A;  5AW0 B;  2H89 C;  1PP9 G;  1IK7 A;  3RL0 B;  1J1D B;  3TF5 A;  3PTZ A;  4RJT A;  1IO4 A;  1BE3 E;  4JYB A;  4RES B;  1P84 I;  2WQY C;  3NTN A;  3P8C D;  3U1C A;  1J1E B;  3Q5P A;  4KHX A;  3Q2Y A;  1Q81 Q;  2MJZ A;  5AVZ B;  1Q2N A;  1VF5 C;  3CCU P;  3H1J D;  1N73 B;  1URQ A;  1Y8A A;  2MKV A;  1SFC D;  4C7N B;  4U3F D;  1PGO A;  2ZYG A;  3CX5 E;  1T6A A;  4H13 C;  1KV4 A;  2P58 A;  5CCH A;  3BCC G;  3M9H A;  1FZC C;  1X22 A;  2PRR A;  1GTW A;  2OYI B;  3HUS A;  1SQB E;  1FU1 A;  2IPP A;  1FC2 C;  4PD4 D;  3CD6 P;  3R4Y A;  1KIL A;  1GMJ A;  1SQP K;  3H1K D;  3H1I J;  4ZMD A;  4U7J A;  3BCC J;  3GHG A;  1NTZ J;  1LTJ C;  5TJH A;  2SPZ A;  3ABV C;  3CMA P;  3RK2 C;  3SWY A;  1OW6 A;  1BCC D;  1N2D C;  4K35 A;  3VP9 A;  1BGY D;  1KB9 E;  3H1J G;  5KJ7 C;  2A06 E;  3JCU H;  2I1K A;  3AED C;  3MHV A;  5APU A;  4U3F G;  3A5T A;  4WVZ A;  3I5C A;  2R3C A;  3I55 P;  1RY3 A;  3D6Z A;  2D2C D;  3H6P A;  1YTZ T;  3RK3 B;  1K9M Q;  1SQQ K;  3GF7 A;  3KZI H;  3MTU E;  2HYN A;  1OVV A;  4MN4 C;  4NPF X;  4WBA A;  1NKN A;  2P67 A;  3O6Q A;  3CC4 P;  3H1K G;  1EDI A;  3H1L D;  1GK4 A;  1NAY A;  3CPW O;  2KOG A;  3P8M C;  2KP8 A;  2GM4 A;  1EDL A;  1NTM K;  5AVW B;  1N7S C;  1BCC G;  1JEK A;  1K04 A;  1BGY G;  1SLQ A;  1ZN5 A;  1OVU A;  1M1J B;  2Q5U A;  3USS A;  1VL2 A;  1URQ D;  3B5N A;  2N1T B;  2JWA A;  2HG5 D;  1A02 J;  3C1L A;  3B4S A;  4L75 A;  3BCC E;  3P32 A;  1H88 A;  3NMD A;  4BXL A;  2E74 B;  1JNM A;  3FWL A;  3L73 J;  4OVN F;  1VDF A;  1T2K C;  1HF9 A;  4I7Z B;  2OYH B;  4A7P A;  1KIL D;  2QM8 A;  3EFG A;  2Q3I A;  2KUB A;  2KB7 P;  4YTP C;  3PP5 A;  3H1L G;  2JP3 A;  2KYV A;  3GLM A;  3IF4 A;  2KZJ A;  3CX5 H;  1HGZ A;  1ZLL A;  3P8C E;  2O1J A;  2OQQ A;  3D71 A;  2FFD B;  3WUV A;  1AFO A;  1FZC B;  2R5B A;  4WB4 A;  3H1J E;  5AVU B;  1DH3 A;  1JMM A;  4U3F E;  2B87 A;  3L74 G;  3L37 A;  2XV5 A;  2IYO A;  1RH5 B;  4ZNC A;  1H8A A;  2KLV A;  4H44 D;  1QGK B;  2BCC J;  3CXH I;  4JPZ B;  3VP8 A;  1CW5 A;  2LKM A;  3PJS K;  1KB9 H;  2UWJ E;  2XDJ A;  4LGD E;  1P84 E;  4O9B A;  1LTS C;  5BU8 B;  1GDT A;  4N78 D;  4I2L C;  3TSI A;  1W2B O;  1ZRT D;  4PJ0 E;  1MFZ A;  1LNQ A;  2KZI A;  1SQX K;  5AVS B;  2Q1K A;  1YI2 P;  4EDF A;  1BCC E;  3F5H A;  3AE3 C;  1BGY E;  5APT A;  4C7N A;  2AEM A;  1NTK J;  3ITK A;  2KS1 B;  1MV8 A;  2OTJ P;  3H1H D;  2J58 A;  3B5N D;  1L0L J;  3WU2 E;  1LWU C;  3AEG C;  3MP7 B;  3AE2 C;  2OYI A;  1UIX A;  5KLV J;  3CXH D;  1KQL A;  2E43 A;  2J59 M;  3Q1M A;  5CCG C;  1FDI A;  1KQG B;  1SQP D;  2JEE A;  1NU1 K;  1EXI A;  1NKZ B;  4XA4 A;  3PHL A;  4HJG H;  3M0D C;  1W5C E;  3H1L E;  2LXB A;  3A3Y B;  4H0L D;  3L75 G;  1N8R Q;  3TNU B;  4ASV A;  1FZB A;  5CMZ A;  2E42 A;  3CC7 P;  2E75 D;  3JSV C;  3VOP A;  1FZF A;  1FZA A;  3VMY A;  5KAI E;  4WY4 B;  2O3J A;  1W2E A;  1R5L A;  3H1H G;  1USE A;  2POH A;  1USD A;  2JJL A;  3L74 E;  2CPB A;  2WPQ A;  3L75 J;  2NPS C;  5AW3 B;  4PV1 C;  1SQQ D;  1FS0 E;  1GL2 A;  1E5W A;  5AVX B;  3SFE C;  3IFM A;  1U7M A;  3V6I A;  3RBX A;  3OJA B;  1VQ4 P;  3RL0 D;  1LT1 A;  3T97 B;  2JR8 A;  3G3Z A;  2OGU A;  3SFD C;  1OIP A;  3KHU A;  1PGP A;  1GZL A;  1FDM A;  1CZQ A;  3VN0 A;  2E76 B;  1M1K Q;  1AQ5 A;  5KLV E;  2L91 A;  1NTM D;  2ZT9 B;  3TYY A;  3MUD A;  5APQ A;  2GUV A;  1M1J A;  3II6 A;  1BE3 J;  3G71 P;  2N1T A;  1YIJ P;  4BRY B;  3W67 A;  4JBZ A;  5AW5 B;  1YBK A;  2DW3 A;  2YXR B;  2ZYA A;  2QIW A;  4KJM A;  3HD7 C;  4EIJ A;  2M3E A;  1P84 H;  1L4A C;  1SQQ G;  2IFN A;  1T3U A;  1DX7 A;  3CL3 D;  3OA7 A;  3TGU D;  1QL1 A;  4PJ0 H;  1KN7 A;  2OYH A;  5APX A;  1EC5 A;  2QJY C;  3CWB D;  3HRN A;  1KYO D;  2C9L Y;  1LT9 B;  3G9R A;  3V4Q A;  3KXD A;  4DCK A;  2GUS A;  2JO1 A;  3A0B E;  1L0N K;  1SQB J;  1OWA A;  2P10 A;  2LR2 A;  2R44 A;  3WU2 H;  4YXD C;  1S3J A;  3L70 D;  4D6T D;  3L75 E;  4JYC A;  1JY2 O;  3ZDM A;  1ZRT E;  2FFD A;  3GMA A;  1NTM G;  2O1K A;  1S2E A;  3QWO C;  1FZC A;  2YKP A;  5EFW B;  1LWU B;  5KLI B;  1OW7 A;  2B88 A;  3D70 A;  3AEA C;  5B5E E;  3H1H E;  2Y0C A;  5AW8 B;  3EQ2 A;  1FE6 A;  4XE5 B;  1SFC C;  1BDC A;  2Q6Q A;  3TGU G;  4PD4 I;  3SWK A;  4R4M A;  1GL2 D;  2FYU J;  3CXH E;  2FYN C;  3CWB G;  4WWI A;  4DZO A;  5KAI H;  2YXQ B;  3MD0 A;  2QJP B;  1EZV D;  1HH0 A;  1D7M A;  3P7K A;  3L70 G;  4D6T G;  2QSI A;  2H8P D;  2IFM A;  1SQX D;  1WT6 A;  1PP9 J;  1OVR A;  1VQP P;  3H32 B;  2KS1 A;  1VQK P;  2N1T D;  4GT1 A;  4HYT B;  2P1J A;  2IBZ I;  3VMZ A;  4OGQ B;  2XND H;  1NH4 A;  1BDD A;  1IFI A;  2E74 D;  1SQQ E;  2Y9Y A;  3BAT A;  1E79 H;  2WSS H;  1PIX A;  1SQV K;  3I56 P;  1RF1 C;  4IFD K;  3AE1 C;  1KQS O;  1NU1 D;  1FJK A;  5BVZ A;  2O01 N;  3LIE A;  1YHQ P;  3E1R A;  3F89 A;  5TIS E;  4NPE A;  4Y99 C;  2BAS A;  3TNU A;  1EZV G;  4N6J A;  1FZG A;  5APW A;  1IJD B;  1SQX G;  2Z5I A;  2IX7 C;  1XTC C;  1EQ7 A;  1NTM E;  3MGN A;  1AVO A;  2FYU E;  2RH0 A;  4TT3 H;  4WY4 A;  2WTY A;  2WSE H;  1L4A B;  3B8E B;  2ITA A;  1EDJ A;  1VQM P;  2IBZ D;  1KTM A;  3CCQ P;  3OAK A;  1PPJ D;  3D6Y A;  1GL2 B;  3A0B H;  1R8E A;  1H0T B;  1YIT P;  3H1J J;  1RE4 A;  1URQ C;  3TGU E;  2RN0 A;  3IN6 A;  1PP9 E;  4U3F J;  1RF0 C;  2W6A A;  4ZKP A;  3CWB E;  5CCH C;  2YMK A;  3T97 A;  1NU1 G;  1QVG O;  3BRT B;  1QLE D;  5AW1 B;  1KFM A;  5B5E H;  1OX3 A;  5CJ4 A;  3HE5 B;  3HUS C;  2W27 A;  2Q3E A;  2WIT A;  5KJ7 D;  1SS1 A;  3L70 E;  2KXP B;  4D6T E;  3M0A A;  1S72 P;  4I6M C;  2BEZ F;  3BRV B;  4BRY A;  3H1K J;  1BSH A;  3L71 D;  1JY3 O;  3CXH H;  4GDO A;  3GHG C;  1NO4 A;  2YO3 A;  3B71 A;  2IBZ G;  2V7Q J;  2QJK C;  1PPJ G;  2M0B A;  1BCC J;  5AVV B;  3RK3 E;  1BGY J;  3SWF A;  2HR3 A;  2ZAE B;  4YPC A;  5GTH E;  3U59 A;  1OFC X;  1ZW0 A;  3L72 D;  4QMA A;  3MZW B;  1LT9 A;  1M56 D;  1VQ6 P;  1VF5 B;  2Z4E A;  1ZP0 C;  1G1I A;  1L0N D;  1N7S D;  1JY2 P;  5APV A;  1Q7Y Q;  3PRJ A;  2NRG A;  4XFJ A;  3S4R A;  4H13 B;  3G6E P;  2K88 A;  1SQX E;  1LWU A;  5E79 E;  1FOS F;  3TK1 A;  3L71 G;  2Y0D A;  1Q82 Q;  3H1L J;  4EYY Q;  4WY4 D;  2HPC B;  5GTI E;  3M06 A;  1PGJ A;  1NTZ K;  3AE9 C;  1UII A;  5TIS H;  3A0H E;  1LTA C;  4PD4 E;  1YQ3 C;  3V2Q A;  1LTJ B;  1OXZ A;  4L76 A;  2GA1 A;  4HH2 A;  1R5S A;  1NYH A;  3L72 G;  3RK2 B;  3L74 J;  4AQR D;  2M8R A;  3H1K E;  2G3A A;  2YIU C;  5CBO A;  3Q5R A;  1NU1 E;  4C46 A;  1ZR4 A;  1L0N G;  1MKM A;  4HB1 A;  3Q3D A;  2KNC A;  1FDO A;  2W6J H;  1HTL C;  2E76 D;  3IAO A;  3AE7 C;  4TLF A;  3L36 A;  1KZU B;  5KKZ C;  4AUW A;  2ZT9 D;  1IFJ A;  3H32 A;  2WSC H;  3KQG A;  1U7J A;  1U57 A;  4H0L C;  3CCR P;  2YNY A;  1SP4 A;  3HTK B;  2IBZ E;  2A45 I;  2K37 A;  4I1L A;  4BWN A;  2E75 C;  1PPJ E;  3W68 A;  1LJ2 A;  4DOJ A;  1GW4 A;  1SQV D;  2I1J A;  1LTI C;  2WT7 B;  1N86 A;  1M7L A;  3CCS P;  1N7S B;  5CHX A;  4EI2 A;  3UIA A;  2WWW A;  1AA0 A;  2Q9I A;  3R2P A;  5AVT B;  5DJT B;  2WSE J;  3AE4 C;  3RL0 C;  1J1D C;  4OWF A;  4UB8 E;  3O8Z A;  2V4H A;  1VQL P;  2KSE A;  1MUU A;  1VPC A;  1FBM A;  1L4A A;  5GTH H;  1FJP A;  1J1E C;  3RBZ A;  1EDK A;  1X79 B;  2H88 C;  1N7L A;  1YYC A;  3HE4 B;  1N73 C;  1H0T A;  2WVR A;  3AEB C;  3GG2 A;  2C0W A;  1SQV G;  2KLU A;  1SQP G;  5CBN A;  1KYO I;  1KIL E;  3FGA D;  1GU5 A;  1TU3 F;  1NOH A;  3H1H J;  1JCD A;  2O01 H;  3M91 A;  5E79 H;  1IFP A;  1HJB A;  3CC2 P;  2JWD A;  3WMM 0;  2OYI C;  2W8Z A;  3HE5 A;  2G8Y A;  1T3J A;  1NJI Q;  1QX8 A;  1L0N E;  5GTI H;  1VQ8 P;  1ZR2 A;  2LXC B;  3GF3 A;  1DEB A;  2KK7 A;  2W90 A;  1JY3 P;  1SQP J;  3A0H H;  2RMZ A;  4PD4 H;  4W7Y A;  5AW4 B;  4GOF A;  1JTH B;  2A45 G;  2K9Y A;  3BAS A;  5DJU B;  4OGQ D;  4KT0 J;  3VMA A;  2XU6 A;  1GK6 A;  1HVV A;  2V7Q H;  1VQN P;  1S4X A;  2KI7 B;  2YIU B;  3NFQ A;  3V2N A;  1VQO P;  1WMK A;  3OW2 O;  1NHL A;  2Z5H A;  4IOI H;  2BEQ D;  1NWQ A;  2FYZ A;  2YO2 A;  3RK3 C;  1NVO A;  2IZ1 A;  2ZXX A;  3V4W A;  1Z56 A;  1NTK K;  4N78 E;  1SQQ J;  1JMB A;  5AVY B;  1EZV I;  5KTB A;  2J5U A;  4IFF A;  2ZYD A;  2R32 A;  1L0L K;  1KQF B;  3CME P;  1PL5 A;  5KLV K;  5AVR B;  2K1A A;  2QM7 A;  4UB6 E;  2HPC A;  1ZV8 A;  1L4A D;  1OMI A;  2JDI H;  2PAJ A;  1JY2 N;  1YJ9 P;  1JO5 A;  1HGV A;  2QRX A;  1YTZ I;  2QE7 H;  3H1I D;  1NTM J;  3BCC D;  1DD4 A;  3MUD C;  1NTZ D;  1M1J C;  1S9K D;  1LTJ A;  2N1T C;  2PGD A;  4DT0 A;  1MZ9 A;  1H89 A;  1SQV E;  4LLH A;  5AW2 B;  1SQP E;  2WSF H;  1KOR A;  4UB8 H;  1IK9 A;  1LGH B;  5KJ7 A;  1ZXG A;  3U1A A;  2E74 C;  1FOS E;  3KYQ A;  1RE3 C;  2KNC B;  2WSC J;  3TGU J;  1IC2 A;  4I7Z C;  2OYH C;  1BSN A;  3WUU A;  2QVA A;  3CWB J;  3CCM P;  1PZQ A;  5B66 E;  1CI6 B;  2NPS B;  4R4L A;  4PV1 B;  3V2P A;  4B86 A;  3CCV P;  2PFX A;  2NZ2 A;  2VRS A;  2ZJS E;  3S1K A;  3TDK A;  3HTK A;  3VTP C;  3PLN A;  3NXS A;  3L70 J;  4D6T J;  2FFD C;  1RF0 A;  3H1I G;  1NTZ G;  3RGU A;  4CPG A;  2WT7 A;  1CSB A;  2D2C C;  1JB0 J;  2AEF A;  2L5G B;  2FXP A;  1N7S A;  4IL6 X;  1VF5 D;  2FXO A;  3M9B A;  4L74 A;  3CCE P;  2PP6 A;  3KPE A;  1P84 D;  2FY8 A;  1JUN A;  3C9I A;  4RO0 A;  1S5L X;  5AW9 B;  3N7N A;  3FXE A;  2R3S A;  4H13 D;  1ZME C;  2FXM A;  5K5G B;  3HD7 B;  3AE8 C;  1QL2 A;  4Z1M H;  2AXC A;  3L73 D;  3AEE C;  2HOD B;  4Y28 J;  1KFN A;  4W80 A;  2QJY B;  2FKW B;  3HE4 A;  4ASW A;  2O01 J;  1AQT A;  1SQX J;  2WPS A;  2K9J B;  3G4S P;  1SQB K;  1X8Y A;  4JF7 A;  3LW5 H;  2M3B A;  1HUC A;  3E1I A;  1KYO E;  2R5D A;  2N9Y B;  5APS A;  3RK2 D;  5AW6 B;  4UB6 H;  3CI9 A;  1FZE A;  4GOD A;  1KIL C;  2Q7C A;  2H43 A;  4GOE A;  3L73 G;  4ZKU A;  4K3A A;  1NU1 J;  1SFC B;  4IL6 E;  2BCC D;  2FYU K;  1JTH A;  3FX0 A;  2FYN B;  1PV3 A;  5KAF E;  3FWN A;  1M57 D;  5M1B A;  1S5L E;  3L74 D;  1KD1 Q;  2IYP A;  2OAR A;  1WRG A;  2K3R A;  1S1C X;  2KIK A;  1K73 Q;  3H1I E;  1G1J A;  5CCH D;  1JY3 N;  3VYI A;  1NTZ E;  1JCC A;  2ZVN B;  2WPR A;  1S9K E;  4WY4 C;  1VQ5 P;  4N3Y B;  3V2R A;  5C39 A;  5B66 H;  2B9B A;  4H44 C;  3S9O A;  2W83 C;  3LID A;  1NTK D;  1EZV E;  1RE4 C;  2XKM A;  1AJY A;  3PH0 A;  1L0L D;  2A45 H;  1LP1 B;  1IFD A;  2RKL A;  3M9Q A;  2JKV A;  2M5A B;  5KLV D;  4JQ0 D;  2AXT E;  2AEJ A;  3E7K A;  1KC8 Q;  2BCC G;  2HFE D;  1LTT C;  1T2K D;  2E76 C;  3A2A A;  5CCG A;  1RF1 B;  4DJG A;  3WUT A;  2D2C B;  4L73 A;  2ZFC A;  2ZT9 C;  1K8A Q;  2WSF J;  3A7O A;  1X0T A;  3N4X A;  3B5N C;  3M0D A;  1LTB C;  1G2C B;  3L71 J;  2Y0E A;  4GKG A;  2H7H A;  1HJ0 A;  4Y99 B;  2I8D A;  3CCL P;  1OZH A;  2C0X A;  1GW3 A;  1DEE G;  1JOC A;  4IFM A;  3KDP B;  2B89 A;  1NTK G;  3AE5 C;  2WPV B;  3BVH A;  2KSJ A;  1L0L G;  1IFM A;  1FAV A;  3L75 D;  1CI6 A;  1LT9 C;  3L72 J;  2NPS A;  1GU4 A;  5KLV G;  1GD2 E;  4OH8 B;  1N73 A;  3L73 E;  1X9V A;  1M90 Q;  1URQ B;  1Q86 Q;  3FXD A; 
#chains in the Genus database with same CATH homology
 1URQ D;  3B5N A;  2N1T B;  4W7Y A;  5APY A;  2N1T D;  5AW4 B;  1JTH B;  2A45 G;  2HG5 D;  4GT1 A;  1A02 J;  2C9N Y;  4HYT B;  2P1J A;  3BAS A;  3VMZ A;  3CLQ A;  1NH4 A;  4EOT A;  2P7J A;  3P32 A;  1H88 A;  2XU6 A;  3NMD A;  1IFI A;  1GK6 A;  1HVV A;  1JNM A;  1VDF A;  3BAT A;  1T2K C;  1SQV K;  3HUS B;  3NFQ A;  3V2N A;  1NHL A;  2Z5H A;  5CJ0 A;  2OYH B;  1RF1 C;  4GIF A;  1KIL B;  1NWQ A;  1KIL D;  2QM8 A;  4IFD K;  2FYZ A;  2YO2 A;  3EFG A;  3RK3 C;  2Q3I A;  4W7Z A;  1FJK A;  5BVZ A;  2KB7 P;  3V4W A;  1PFI A;  1Z56 A;  3LIE A;  3PP5 A;  1NTK K;  4N78 E;  2KYV A;  5AVY B;  1HGZ A;  3GHG B;  1ZLL A;  4Y99 C;  2BAS A;  4IFF A;  3TNU A;  5KTB A;  2R32 A;  3P8C E;  4N6J A;  1HWT C;  1L0L K;  1FZG A;  5APW A;  3HD7 A;  1IJD B;  2O1J A;  2Z5I A;  2FFD B;  2IX7 C;  1XTC C;  1EQ7 A;  5KLV K;  3MGN A;  5AVR B;  1AFO A;  1FZC B;  2R5B A;  2QM7 A;  4WB4 A;  5AVU B;  2HOD A;  4WY4 A;  2WTY A;  1DH3 A;  3L4F A;  2HPC A;  2WSE H;  1ZV8 A;  1L4A B;  1JMM A;  3B8E B;  1L4A D;  2PAJ A;  1JY2 N;  3L37 A;  2XV5 A;  1JO5 A;  3V5B A;  1XTG B;  4M3L A;  1J2J B;  1HGV A;  5CCG D;  1YTZ I;  3OAK A;  1H8A A;  1GL2 B;  1IFN A;  1M1J C;  1S9K D;  1LTJ A;  1RE4 A;  1URQ C;  2KLV A;  2N1T C;  1MZ9 A;  1H89 A;  4LLH A;  3VP8 A;  5AW2 B;  1RF0 C;  2W6A A;  4ZKP A;  2WSF H;  1CW5 A;  2LKM A;  5CCH C;  3T97 A;  1IK9 A;  1LGH B;  2XDJ A;  5KJ7 A;  3U1A A;  3BRT B;  4LGD E;  1FOS E;  3KYQ A;  5AW1 B;  1RE3 C;  4O9B A;  1KFM A;  1LTS C;  1SVF A;  5BU8 B;  2CPS A;  5CJ4 A;  1GDT A;  3HE5 B;  3HUS C;  2W27 A;  4N78 D;  3IR9 A;  4I2L C;  1IC2 A;  3TSI A;  2WIT A;  5KJ7 D;  1LTG C;  2OYH C;  1MFZ A;  1SQX K;  5AVS B;  3L35 A;  3M0A A;  4I6M C;  1CI6 B;  2NPS B;  1SFC A;  2ZXE B;  2N9B A;  3BRV B;  2NPS D;  3V2P A;  5APT A;  4C7N A;  4B86 A;  1JY3 O;  3GHG C;  1NO4 A;  2VRS A;  4C7R A;  2YO3 A;  2HLO A;  1MV8 A;  3B5N B;  3HTK A;  3VTP C;  2J58 A;  2W6B A;  3B5N D;  3NXS A;  1LWU C;  3VMX A;  2FFD C;  1RF0 A;  2P2U A;  2OYI A;  5AVV B;  2XNX A;  5AW7 B;  3SWF A;  2XZR A;  2WT7 A;  1KQL A;  2E43 A;  1CSB A;  1RE3 A;  4AYC A;  2J59 M;  3U59 A;  3MIW A;  2L5G B;  1LT9 A;  5CCG C;  1N7S A;  2Z4E A;  2JEE A;  3M9B A;  1NU1 K;  1GL2 C;  1NKZ B;  4XA4 A;  1G1I A;  2WZ7 A;  2PP6 A;  3KPE A;  1N7S D;  3M0D C;  2YKQ A;  1JY2 P;  2YKO A;  5APV A;  1JUN A;  3C9I A;  3A3Y B;  5AW9 B;  3N7N A;  3TNU B;  2FXM A;  1FZB A;  3HD7 B;  5CMZ A;  2E42 A;  3HD7 D;  1LWU A;  1QL2 A;  1FOS F;  3VOP A;  3TK1 A;  1A02 F;  1FZF A;  5AVQ B;  1FZA A;  4LC1 A;  3VMY A;  2HOD B;  4WY4 B;  1W2E A;  1KFN A;  4WY4 D;  1RF1 A;  4W80 A;  2HPC B;  2POH A;  1T8Z A;  2JJL A;  2FKW B;  3HE4 A;  3M06 A;  2CPB A;  5BU5 A;  1NAF A;  2WPQ A;  2NPS C;  2WPS A;  5AW3 B;  1NTZ K;  1SQB K;  2YMY A;  1G2C A;  1X8Y A;  1GL2 A;  4JF7 A;  1LTA C;  1E5W A;  3RK3 D;  5AVX B;  1HBW A;  3V2Q A;  1LTJ B;  3IFM A;  3LW5 H;  5AW0 B;  1OXZ A;  2M3B A;  1HUC A;  3E1I A;  4HH2 A;  2R5D A;  3RK2 B;  3OJA B;  3RL0 B;  5APS A;  1J1D B;  3RK2 D;  4AQR D;  2M8R A;  5AW6 B;  3RL0 D;  1IO4 A;  3CI9 A;  4JYB A;  3G3Z A;  4RES B;  1FZE A;  4C46 A;  1ZR4 A;  3NTN A;  3P8C D;  1KIL C;  3U1C A;  1J1E B;  1GZL A;  1CZQ A;  3VN0 A;  1FDM A;  2Q7C A;  2H43 A;  4KHX A;  1HTL C;  2MJZ A;  5AVZ B;  1AQ5 A;  3L36 A;  3TYY A;  1KZU B;  3MUD A;  4AUW A;  5APQ A;  2GUV A;  1IFJ A;  1M1J A;  3H32 A;  1N73 B;  3II6 A;  2WSC H;  3KQG A;  4ZKU A;  1URQ A;  1SFC B;  2N1T A;  2FYU K;  1SFC D;  4C7N B;  1JTH A;  2YNY A;  5AW5 B;  1SP4 A;  3HTK B;  5CCH A;  2A45 I;  1FZC C;  3M9H A;  4I1L A;  3HD7 C;  4EIJ A;  1GTW A;  2OAR A;  1WRG A;  1L4A C;  2IFN A;  1T3U A;  1G1J A;  1DX7 A;  2OYI B;  4DOJ A;  1GW4 A;  3CL3 D;  5CCH D;  1JY3 N;  3HUS A;  3VYI A;  1JCC A;  2WPR A;  3OA7 A;  1S9K E;  1FU1 A;  1QL1 A;  2IPP A;  4WY4 C;  2I1J A;  1LTI C;  5APX A;  2OYH A;  2WT7 B;  1KIL A;  4N3Y B;  1N86 A;  3V2R A;  3HRN A;  1M7L A;  2C9L Y;  1LT9 B;  1SQP K;  1N7S B;  3V4Q A;  5CHX A;  3LID A;  3UIA A;  2GUS A;  2WWW A;  1L0N K;  3GHG A;  1LTJ C;  1RE4 C;  2XKM A;  1OWA A;  2Q9I A;  3R2P A;  5AVT B;  2A45 H;  1IFD A;  4JYC A;  1JY2 O;  3RK2 C;  3SWY A;  3RL0 C;  2FFD A;  3M9Q A;  1J1D C;  2O1K A;  1N2D C;  1FZC A;  2YKP A;  3O8Z A;  3VP9 A;  1MUU A;  1LWU B;  5KJ7 C;  1VPC A;  1FBM A;  2I1K A;  1L4A A;  2HFE D;  5APU A;  1FJP A;  1J1E C;  1LTT C;  1T2K D;  3A5T A;  3A2A A;  5CCG A;  3I5C A;  1RF1 B;  1X79 B;  2R3C A;  5AW8 B;  1N7L A;  1YYC A;  1RY3 A;  2ZFC A;  3H6P A;  3HE4 B;  1YTZ T;  3RK3 B;  1N73 C;  3EQ2 A;  4XE5 B;  3A7O A;  1SQQ K;  3N4X A;  1SFC C;  3B5N C;  3M0D A;  3MTU E;  1LTB C;  1G2C B;  2C0W A;  2HYN A;  1GL2 D;  4GKG A;  2H7H A;  4Y99 B;  1GU5 A;  1NOH A;  4WBA A;  1JCD A;  1NKN A;  2O01 H;  3M91 A;  2P67 A;  2C0X A;  1GW3 A;  1HJB A;  4DZO A;  1JOC A;  3WMM 0;  2OYI C;  4IFM A;  3KDP B;  3HE5 A;  1T3J A;  1GK4 A;  3MD0 A;  2KOG A;  3BVH A;  1HH0 A;  2KSJ A;  1ZR2 A;  3P8M C;  3P7K A;  1IFM A;  2H8P D;  2KP8 A;  1DEB A;  2GM4 A;  2IFM A;  1FAV A;  1WT6 A;  1CI6 A;  1LT9 C;  1NTM K;  1N7S C;  5AVW B;  2NPS A;  1GU4 A;  1GD2 E;  1JY3 P;  4OH8 B;  1SLQ A;  1ZN5 A;  1M1J B;  3H32 B;  1N73 A;  1X9V A;  2Q5U A;  1URQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...