4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
2O01J 1Q90D 2WPVB 4H0LB 4OGQB 4H44B 4H13B 4Y28J 5L8RJ 4I7ZB 2QJKC 2E75B 5KLIC 2ZT9B 2K9YA 3LW5J 2D2CB 1S5LX 1VF5B 5KKZC 4RKUJ 2QJYC 2QIWA 2WSEJ 2E74B 2FYNC 2WSFJ 2E76B 4PV1B 1ZRTE 3C8VA 1JB0J 4KT0J 2WSCJ 4IL6X 2QSIA 2QJPC 2YIUC
chains in the Genus database with same CATH superfamily
2I1JA 1CI6A 1LT9A 2AEFA 5AW7B 1KC8W 3VQYA 3ZHUA 1TA8A 1BCCE 5KMGA 3CS5A 4EOTA 1MG1A 4JPZB 3K0DA 4NTWA 3AE8C 3X2QC 1SQQK 1E1RG 1NTZK 4FIPC 4LFBB 4DXWA 1BHAA 3RYCB 2M5AB 1BSMA 2W6JG 3CXHF 1HF9A 4PV1B 4LF9B 4X89A 3APQA 2W90A 5AW4B 1EN4A 1W0KG 1Q86W 3L72J 3L71J 1JOYA 4RJTA 3TSIA 3FAVB 2MKVA 3ZHVA 3GG2A 2E3CA 4L75A 3H01A 5APWA 1NI8A 2H8PD 2JEXA 3CXHH 4K8XA 4GX5A 5KLVK 2LQTA 5E79H 1FDOA 1WRGA 4H13C 1YI2V 3MTUE 1MZFA 3HE5B 4JZGA 1WB8A 5GTIZ 1HNWO 4J9ZB 5IYZB 3IC7A 3AG3C 4O4HA 1KYOF 1WNSA 1V55C 3AE4C 2DYSC 4NPEA 4FLUA 1KILC 2GUVA 2V4HA 2DQ0A 1XOUA 5KLIB 3G6BA 3C8VA 5LMUB 1GM9A 4I0XB 4KHPO 2IJHA 3CSXA 1SESA 4JI4B 3CPWU 2ZVNB 5DJTB 5F2VO 2CAZC 1FAFA 3H1LH 4BR6A 3ZHSA 1YJ9P 2Y0CA 1EDIA 3G67A 3BFRA 1AI5A 2DE0X 5J2TB 1QVGU 2E5LB 3ZJZA 5KUKA 3OAAG 3QNEA 1BL8A 3JC22 5BR8O 2V4DA 5AW3B 3H6PA 1ZOYC 1GRJA 1JMMA 4O9BA 3JAWB 3KZIZ 2ZDIC 1K05A 4N3YB 1BCCH 2IFNA 2NNUA 3ZS8C 2KSDA 1RH5B 4JI6O 2OYHA 2DYRB 1DH3A 3H1HD 2ARHA 1N7SA 1U57A 1GN6A 2FYUK 1GN2A 3OTFA 4GKJO 4YXWH 1W2EA 3OD4A 3W67A 3SPHA 3CX5E 2P6JA 2R32A 4KHXA 1SQVE 3RK2D 2CTPA 2QEXV 1VF5D 2FXOA 1EZVG 3B5NA 5KLIC 4JAVA 1OCCC 3B5NB 2LGQA 2ZR3A 2LW1A 3HKEA 1CW5A 3JSLA 4FLZA 1BGYJ 2IDBA 4MVRA 3ZHRA 5CA3A 4MT8A 2GTSA 1YCIA 4LFBO 3H1IG 1Y74A 5LP6B 3CE2A 3AE7C 5LP6A 2M7WA 2KI7B 3G4SP 2B5UA 2Q1KA 3E83A 1KV4A 1HGVA 2EZPA 2XASA 1LTTC 1T8ZA 4BRYA 2K88A 2ZIOA 2WPQA 3CCRP 4WFHA 3IN6A 5JJNB 4EI2A 3CMEP 2HLDG 1KB9E 4G28B 4LP8A 3F5TA 4U3FJ 1MOFA 4DV1B 1VARA 2H94A 3RGBA 2QA4V 3L71G 1SS3A 4XA4A 1J5EB 1JTHB 1VQOP 4KJMA 4UCSA 5CBOA 1N8RW 1N36O 4I0XA 4ASUG 5AVXB 4DR1O 3JAKA 2YIAA 4LH7A 1X59A 4F6RB 1H88A 2AHYA 5GONB 4DV3O 1E1QG 5B5EE 5IJ9B 5GONA 4ZI7B 2R3SA 3BABA 4WCEV 1MABG 2X6CA 5ITZB 1ZMEC 1SA0A 4U3FH 5B66Z 1KC8Q 1UPGA 1Y4MA 5CMUA 1B06A 1DX7A 1FDMA 1L0LK 1D5NA 3VQWA 5LHGA 1SQBK 3G80A 3H1HJ 2YSUB 3LW5J 2E5LO 2JJ2G 1SQQG 1YYCA 4U7JA 1VF5B 5K1PA 2OYHC 1KB9H 2IBZD 2EILB 1JY3P 1R73A 3C3SA 4MTGA 4RUFA 5IT9N 2YXRB 4LF6O 2OTJV 5LA6B 3DC5A 2P7JA 2Q67A 4LNUB 3H1JJ 3AEBC 1GMGA 3TGUH 1EDJA 1VQNV 2BASA 3RL0g 3FB7C 3ZEDA 5KHKA 3AG1C 1G2CB 1PP9D 3G71P 4PJ0E 1WPXA 1S5JA 4NXMB 2LXBA 5AW5B 3HTKA 2QWRB 1XNRB 2P67A 4CC6A 3W7UA 1QHTA 3AG7A 3IC9A 2BTQB 3LSSA 1Q6HA 2AZ2A 3T1HO 4JI3O 1SQVH 3L4FA 2N05A 2BOCC 3V2QA 3BCCJ 4GZRB 1ZR4A 3L73E 1FJGB 4XDLA 3UO3A 1OCZB 2Y4UA 1FXKC 3Q5PA 1NH2D 3LDEA 4N78D 4UV9A 1UIXA 2CPSA 5CCGA 2WTYA 1R3JC 1NTKE 1JY2P 3E8HA 2UUAO 3M0AA 4JASA 2JKVA 2QE7H 3ZHTA 5DM6V 2KNCA 3L75J 3R4YA 4Z2WA 4C46A 1P4RA 3THOA 5LMUO 1DIPA 1FYJA 3JCUH 2FMLA 4E4EA 4B86A 1GZLA 1RQUA 1P84I 2QG4A 2OYHB 5FPOA 2Z5IA 4GCZA 2Z5UA 3E1IA 4O4LA 1SQBE 1D5AA 2UXXA 4LBEC 5B1BC 4DYLA 4B3RB 1ZRTE 2WITA 5CA1A 1FFXB 3BA8A 5KHGA 2ZXXA 3O6QB 4N23A 3SWYA 4UB6Z 1VEWA 3JALB 4CH3A 1M8OB 3E35A 2NPSA 3L71H 5J9PC 3L72H 1JY2N 4X64B 3VQXA 3L70H 3S3WA 2AEMA 3N2KB 5LXTB 3CCJP 2UXCB 2LP7A 1LGHB 4LNUA 2FFDC 1KP3A 1QL1A 3RFRA 3HD7C 1OX3A 1N34O 1FZBA 3WUTA 2N04A 3JD1A 4D6TE 3BA9A 1Q81W 2A06D 3B8EB 4LF5O 3F5HA 5CHXA 1SQXH 5C8YB 3H9VA 1XNQB 3SYOA 4YY3B 4P9PA 5LGNA 1YJNV 2HPCB 1JQ0A 1L0NH 2WPSA 3HPLC 2ZR2A 4KL1A 3CCVP 1QR8A 1H2MA 3BY6A 1RE3A 3O8ZA 3UKMA 1KD1W 1QNMA 1RSOA 5LMNB 1KILA 3L72E 2JWAA 4CH6A 3WB1A 4LR3A 1NZ6A 4UB8E 4CZZA 4EEQA 3WB2A 1OCCB 5EC2C 2J5UA 1RF1A 4JI2O 1TU3F 1YTZI 2HVKC 5D5PA 4FLYA 1L0NJ 2F23A 4L87A 3AG1B 1P84E 4X66O 2PRRA 2IJKA 2K9JA 4TLFA 3A0HZ 1VQ7V 1RHZB 3RYIB 4MSWC 5B1AC 2QJPB 4J9YB 3A2FA 2Q9IA 2HLOA 1Y76B 1SP4A 4FPPA 2ZIMA 1EZVE 5CA1B 1YI2P 5BXZA 3JD2A 1LT1A 3BATA 2A06H 1XBLA 4LH6A 3OUSA 2DWEC 4YJ3A 2YI8A 2CPBA 2HVJC 4H13D 4DOJA 4FFKA 1IK7A 1K4DC 4R4MA 4EYYQ 3LSQA 3JAWA 3JSVC 3ABKC 3RYHA 4GDOA 2NPSD 1LWUA 3SGIA 3L70D 2WVRA 1UFIA 2P4VA 4LWSB 5CA0B 2A9HA 1N7SB 1NKNA 4NTXA 5KLVH 4TV8B 5APTA 1OW6A 2KKWA 3GHGC 3OGIB 1FKAO 3SPJA 1YXBA 3EWKA 2NRGA 1A32A 3P30A 1JJOA 3FGAD 4K0KB 2JS3A 2V7QG 3HKEB 2VRZA 1F4MA 4UVCA 4DR4B 2RN0A 5H9CA 3N27A 2O01H 1MSWD 1S9KE 1XUQA 1KN7A 1KUQA 3K03A 1TVKA 1RM1C 3KCYA 1VQPV 2K37A 1FBMA 1J2JB 2QTOA 3CRAA 2WA3A 1N4CA 1Q82W 1J1DB 3H1LG 1FZFA 3BCCH 2ETNA 1RM1B 2UUAB 3N4XA 3L73H 4UXNA 1OZHA 4I4TA 2GDSA 4WY4A 4NVPA 5CB4A 1R3KC 2EINC 2PGGA 2ADQB 2Q6QA 3M0DC 2Q9LA 1GN3A 3BRCA 2CTWA 2GA1A 3CCJV 4H33A 3H1HG 1BGYE 3V6IA 1R5SA 3E89A 3KHUA 4WBAA 1KFMA 2MW2B 5TISE 3TGUJ 2E76D 5IYDO 3WUUA 1W2BO 1SQPD 1WT6A 3L74D 2H43A 1IO4A 3PLNA 2KG7A 2KXPB 4HBNA 5CCHA 2ZXWB 1FXKA 1RQVA 2CH7A 3ZHQA 3CRMA 1LUVA 4I50B 2OT5A 2Y69C 1NH4A 3ITKA 5ITZA 3PP5A 3IGAC 5C8YA 1FFXA 1AVOA 2XDJA 3GLMA 1WA8A 3HE5A 1IBMB 3CYOA 4WVZA 2ADPA 1IFNA 2ZVOB 3D36A 5BZBA 2C2AA 2LJ2A 2KZJA 1BE3D 3E86A 3K9SA 5BR8B 1VL2A 3A5TA 2IBZI 3AE5C 1EC5A 1VQLV 1SQQJ 2YEVB 2MK3A 4U3JB 2OIEA 4O4JB 2ZQMA 3L74E 3U10A 4TV9B 1NAYA 3NFQA 2IM9A 1MMMA 3ABMC 3VQVA 3CCUV 2PYJA 1XNQO 3MUDC 4J7KA 1XTGB 3D6YA 4WBNB 1AR1B 3LSUA 4GX0A 5B1AB 4DK1A 1WP7A 2AEJA 3CPWO 1ZLLA 2LR2A 2RH0A 5AVZB 1NTZG 1Q6IA 5CBHA 1S4XA 3AEFC 4E2LA 4DR3O 1Y47A 1LUWA 4DRXB 1QVGO 4GX2A 1H2NA 2K1EA 3OJAB 4DV0B 5CA0A 1XMQO 1UIIA 1PIXA 2IW5A 3ZIAG 1CSBA 2LFRA 1FC2C 2XNDH 3AG4B 3L74J 2UUCO 4DR2B 1Q6UA 1VF6C 5B3SB 4H44C 4JV5O 2V7QJ 4LF4O 1N86A 5KKZB 5AW1B 2WLLA 2CDYA 2YMKA 1HJBA 2G8YA 4PA7A 4J80A 2W0XA 1FDIA 1Q3EA 1YTFD 2N1TA 4DV5B 4DRXA 1TGOA 4PA9A 3ETDA 4FZ1A 3CC4V 1BCCJ 2ZE7A 2OARA 3A0RA 5KLVG 1NBMG 1Q7YQ 1DGSA 1G8MA 1GM7A 4H0LD 4AQYB 1DK1A 2PGDA 4IFDK 2WQYC 3I5DA 3H25A 3ZRXA 1M1JA 4IL6H 1KZUB 4RQFA 3K57A 1HUCA 3V2NA 3D36C 1ROPA 3RYFA 4WB4A 3ETGA 2KG7B 4ZOLB 5APUA 2ZNIA 1N7LA 4DR4O 5CJ0A 5KAFE 3ZN1A 2O3JA 3PJSK 2PYLA 5BMVA 2QJYC 2JIZG 3TCUA 1Q7YW 2FYNC 3T1YB 4Z1VA 1N32B 1V54C 3CX5D 3SDLA 2HJFC 1LP1B 2ZYAA 4MW3A 1IURA 1Q90D 1I5YA 2EZOA 1R6TA 4P9OA 1ZV8A 5JVDA 1OFCX 2JGDA 3CMAP 1EN6A 4JGSA 5HFMA 2FXPA 3U0ZA 1R1BA 1J1DC 1FXHA 4PV1D 3N2KA 5LXTA 2KP8A 2JJ1G 3E8FA 3QWOC 5A2QN 3AECC 4J7ZA 3H1JD 2WLKA 1OMIA 1I08A 2YNYA 1LT9B 1KFNA 5IJ9A 1Q2NA 1R8EA 2A79B 5B66E 3EQ2A 1F4NA 2MJZA 3LIEA 3M9HA 4WF9V 3S4RA 2UUCB 3RVYA 3PH0A 3ZX6A 3JD0A 4LF8O 3FX0A 1KB9D 1WPBA 2QWNB 1YJWV 3GWKC 2Q6AA 1RF0C 1URQC 3BCCD 5B66H 1M56C 1L0LJ 3SPIA 3CCEP 2XKMA 1XNRO 4CS2A 3CLQA 3O65A 4IL6Z 1GMJA 3NMDA 4O2AB 2JR8A 1M5IA 1BGYG 1IXBA 1W5CE 2ZE6A 4LF7B 4QJFB 1IBMO 1VMGA 1QQCA 3H32B 3JD3A 1K8AW 4MVSA 3N7NA 3AK3A 1JA8A 4PV1C 3H1LE 1WJZA 2YS8A 2UUBB 1H2LA 2G38A 1COWG 1RPOA 4EB6B 4DUZB 2B87B 1IX9A 4AQYO 2ZKOA 1VPCA 1ZN5A 2EIJB 1VQ7P 2LXCB 2GV9A 1JCCA 3SJQC 3M0DA 2ZINA 1BDDA 4OX9B 1QLEB 3ASNC 1SZXA 2QWOB 2NPSC 1QU7A 2ZE5A 1AJPA 1TUBA 1S3JA 4DV4B 3DXRA 1SLQA 2Q69A 2P58A 4DUYO 1NS1A 3CD6P 1IZ3A 4H44D 4YJ2A 5EBLC 1MNGA 4GLXA 3RK2B 1KB9F 4U3FE 3HB3B 2R3CA 4YIPA 3B09A 1K33A 1X8YA 2OCCB 5KA5A 2I1KA 2DMXA 1J1EB 1PP9G 4FFBB 1I7FA 1NGMB 3TDKA 1FZCC 1FJPA 1S2EA 1GAXA 2QDOA 1L4AA 1JPXA 2EIMC 4FZ0A 1QBZA 5LHIA 1M56B 2E75B 4A7PA 4D6TJ 1WAZA 1GL2D 3QO5A 1IZNB 3R2PA 4WWIA 1HR0B 1AA0A 3A0HE 3HKBB 3A8TA 3CXCU 1KILD 4N78E 3KZIH 1URQD 3D71A 1LTJB 2CK3H 1EZVH 1W59A 5FNVA 1RE3C 3OA7A 3A0BZ 1VQ9V 1PL0A 5IY5B 3W7TA 3FKSG 4DR7O 4DR6B 2FY8A 1GDTA 4H0LB 4HJGH 1AB3A 1I94B 3CJHB 4YXWG 1QLEC 2H8PC 4AQRD 3FYIB 1BE3H 4GT1A 1IK9A 4R50A 5CCGD 1ORQC 4B3SO 1BCCG 3W68A 1IBKB 4J42A 1PP9H 3CMAV 2WLMA 5H2FH 1LWUC 2DQ3A 5EBWC 3CC7P 1JM0A 3WU2H 2ZNJA 1GTOA 3L72G 1U97A 1KILE 2UUBO 1QL2A 1UJWB 2ZT9C 3M91A 4NPFX 2NZ2A 5LHHA 2Q0AA 3HUSB 3L75G 1N73C 1HNZO 3E8BA 5L8RJ 4FLWA 4JZ2A 2B88A 4IHJA 4JI7O 3B4SA 3CXHD 1NT2B 2KLVA 2FTKA 2Q7HA 5APXA 1VF6A 3AE6C 1XL6A 2HODB 2SPZA 4X64O 1DTOA 1VP7A 5H2FE 1NTZD 2PY5A 3D8CA 2JEEA 1JJ2U 3L73D 5AVQB 1JY3N 1KQFB 1I5XA 1VIBA 2QE7G 2QVAA 1FOSF 3RN4A 3L71E 2DJVA 1XTCC 1BDCA 4YHHO 4QPJA 3K59A 1S1CX 2YIUB 5LYJB 2UXBO 1JCHA 3K5OA 1P7GA 4O4JA 4LF5B 3ZMUA 5JQGA 2AXTH 3M7MX 1PGQA 1H2SB 4DV6B 3K3WA 1P7BA 3T4ZA 4YY3O 1VQMV 2O1JA 2P4KA 3H1IH 4FLTA 5A9GA 1NQTA 4U7OA 1NVPD 5AVYB 1SF9A 2K9PA 1IFIA 1K34A 1GL2A 5DN6G 1KU9A 2A45G 3QO7A 1DEEG 3B77A 3JATB 1AJYA 1G6UA 1OCOC 2HHHO 4R6ZA 2WT7A 4DZOA 1Z5WA 1ZRTD 2BEQD 2VQFO 1S76D 3S1KA 1SQXG 4Y28J 3L71D 5KLVE 2Z5HA 1NU1D 3T97A 4WFGA 3KQGA 3RWRD 5LL6Y 4DR5B 2IZ0A 3LDCA 2XAQA 3VMZA 1SETA 2HJDA 2Z0AA 1FD9A 3OR7C 1IBKO 1XEQA 3L70J 2EX3A 3HE4A 3QG5A 3CCVV 4W80A 3P32A 1CXZB 4EIJA 3A0BE 1ZUQA 1PPJH 2CK3G 1SVFA 1Y74B 4MVMA 3UM7A 4HZ3A 4D6TD 1KYOH 1WP8A 3BASA 1K92A 2A06E 1SQQE 3BHPA 3CCQP 1IFJA 1U7JA 1AI6A 2QSAA 3K9AA 1SQFA 4GOFA 5KX5B 1HP8A 3OMIB 1USDA 4RKUJ 3G4SV 3H1IJ 3M06A 3G9RA 4RESB 4JI6B 3B40A 1QX8A 3L35A 4MN4C 1HWTC 2JO1A 3I5CA 5JWPA 1J95A 1TAEA 4PJ0Z 4MTXA 2IFMA 3FB6C 3A0BH 3AE2C 1OCRC 3P8CD 3HKDA 3ZRWB 3H1ID 3FD9A 1SKVA 4ICGA 2RMZA 2FYUD 3CWBD 2WLIA 3ETEA 3AEGC 2ZT9B 4MW8A 2N9YB 3FB8C 3FX7A 4X20B 1R6KA 2K9JB 4X88A 1LTBC 4DR6O 4ZMDA 1NTKJ 1VQNP 3D6ZA 1M57D 2E5TA 1FU1A 4IYHA 1OHHG 1ZL8A 1RPRA 2DYRC 4X1YB 2IJIA 1BGYD 4JF3A 3WG7B 3ABLC 4DT0A 2AXTZ 1S72V 4DR3B 3L37A 4IHJB 4JI1O 5IE9A 1X9VA 2CH7B 3L74G 2Q68A 3C1LA 5AW6B 2OTJP 2F43G 1VQKV 5IWAB 3H1IE 3II6A 4IGGA 3H1JG 1JMKC 2D3OW 1PZQA 1PKXA 1Q81Q 3L70E 1PNKA 1SQBG 2UWJE 3SR2C 1T2KD 1JUNA 2NLJC 1SQXK 5EZYA 1JFFA 4TQDA 3LW5H 2ZCEA 2HKOA 2N74A 4XE5B 4GX1A 1NYHA 2J59M 2IU3A 1VQ8V 1N7SD 2JDIG 2ITCC 1SS1A 4HKZH 2XAFA 1KD1Q 2OGUA 2OWOA 3J80N 3BCCG 2FYUH 3CWBH 2YIDA 3QF7A 4DV5O 3VYIA 4OWFA 3CRRA 2Y0EA 3UCSC 3CC2P 1SRYA 1YJWP 4I5SA 4M3LA 1IC2A 1SFCC 5H2FZ 2JWDA 1Z2GA 1CEZA 1ZLZA 4LF6B 5KJ7D 5KLVJ 4JYAB 4QMAA 1LJ2A 2DW3A 1M1JC 1K4CC 1YF2A 4UV8A 5EBMC 2P5OA 3C9IA 2HEPA 4R7CA 4HAMA 4TV8A 3P8MC 5E79Z 2WWWA 2R9RB 5AVSB 2ZYDA 2FFDA 1IXMA 2H89C 1RE4C 4CS3A 1X4TA 2Q0OC 2BSKA 2KYVA 3T1HB 2ZJSE 4TT3H 3JALA 4CH5A 4W4KA 4PI0A 3UIAA 2JEUA 1Z5VA 2EULA 3VTPC 4LF8B 2VWJA 1MUUA 1HBWA 2B9ZA 3Q1MA 1N73A 2FYUG 1BCCD 3CWBG 2F1MA 4FM1A 4HB1A 5B1NA 1KQGB 4X62B 4DV7B 5LMNO 1J1EC 1FZEA 2L6LA 1K3EA 2A0LA 3TXQA 2Q8VA 1NTKG 4MTOA 1EZJA 4OPAA 3IFXA 1JVMA 4R8CA 2E75C 2FFDB 1YJNP 4EKWA 2ZYGA 3OUFA 4X1KA 5APSA 1H38A 4B3RO 3KPEA 1R6NA 1PNMA 2IJJA 3E22A 2HR3A 4FMTA 5GTHZ 1M90W 1M57B 1KBHA 4J11A 3WFVA 1NTKK 4RQEA 1DD4A 2RNBA 4I50A 5KAIE 1VQ5P 1B3QA 5GTIE 2YUAA 2IZ1A 2XUMA 4PELA 3CX5F 3HD7D 4DW1A 4JTAB 2C0XA 1YQ3C 3CC7V 3AE3C 2KSEA 1V54B 2DOSA 4MVQA 1YBKA 2XV5A 1S5LX 5CBNA 5JH7B 4HYTB 1GL2C 1KORA 1D7MA 2GUSA 3VOPA 1NTZH 1BSNA 3FXEA 4XBFA 4LFAO 2BCCJ 2XTAA 3JD4A 3AEIA 2QKSA 4D7SA 5AVRB 2AZ0A 3STZC 4TV9A 4XDJA 2L91A 3PHLA 2KZIA 4U3JA 3BVOA 4F6RA 2ILMA 1W0JG 2E5YA 3ZMZA 3EFFK 5L3CA 3GVMA 2ODMA 3SJAC 5J2TA 5TISH 3QH9A 1NTMD 1EXIA 5CN0A 1Y9BA 2HP8A 4LGDE 1LTAC 1PL5A 2GUZA 2KOGA 3ML0A 4NPDA 1FZCB 2XOKG 5EYPB 5D5QA 3AE1C 1BS3A 1AQ5A 3RYCA 1L0LD 3CX5H 4O4HB 5IWAO 5GW7A 4PDVA 3BCCE 1N8RQ 4RUEA 1Z56A 4HNAB 2IYPA 3L75H 3DXRB 4GYCB 4OGQB 1NWQA 1ZTEA 1GW3A 4X62O 2WSEH 4W4LA 1JTHA 5KMGB 3CCEV 3MP7B 4HYOA 1G1IA 3H1LD 3U59A 2AGAA 1YVWA 2LGWA 2PI4A 1LWUB 2WLLB 5CBGA 4D6TG 3CRCA 1TVKB 1HNXO 1JY2O 1NTME 2M3BA 3JATA 2R5BA 2YKOA 1E79G 4CH4A 4XFJA 2YI9A 5KHIA 1PV3A 4ZHQB 1QCEA 1HDJA 3V5BA 3RK3E 1L0LE 3P3NA 4C7NA 3KYQA 2EJ7A 1BQZA 1I94O 4ZNCA 5IDJA 2HG5C 4IYIA 2QJKB 2QKAA 2ZXEB 4JYAO 1NJIW 2P7TC 1NU1H 1XILA 3FB5C 5EC1C 2KS1B 1SQPH 5CCHD 1URQB 1YITP 3EXAA 2EIMB 4TOIA 3RL0D 4DV4O 3E22B 1JCDA 4DUYB 5L3FA 2YXYA 4B3TO 1M1KQ 3K06A 1MV8A 4YHHB 4GKGA 2YIUC 2P22C 1MA1A 3RK3B 1HVVA 3P3PA 1XMOO 1RF1C 3GF7A 4L76A 3TF5A 2LW7A 3RYIA 3AEEC 3CRQA 4WY4D 3MUDA 2BTQA 1US6A 5B3SC 2E43A 3H1KJ 2OIGA 4JI8O 1EFRG 2RQ6A 3MHSC 4I6MC 4ZBMA 5TISZ 3QVNA 5APVA 1AP5A 2DWDC 3V2PA 1IBLO 5BVZA 3SSUA 5AG2A 1MKMA 2YXQB 4FFBA 3GWOA 2QM8A 2E76B 3E7KA 2D2CD 3SYQA 3QO8A 2Q3EA 4KT0J 1FAVA 3JASA 3HE4B 1JO5A 2QWPB 2WLHA 4J41A 2JGUA 5AVUB 1H0TB 1V9PA 3C3TA 2Y4TA 5CMZA 4DR5O 4I7ZB 1L4AC 2QJKC 2W8ZA 3OEHG 1SQVJ 4TUYA 1AR4A 1YEWA 4QGPA 3ABMB 2CE4A 4N21A 4CBCA 4FM2A 2WPDG 3APOA 1K5SA 4TWKA 2RDCA 2N1TD 2JVDA 4UB8H 1BGYH 2IU0A 3VN0A 4YJ2B 2EINB 4H37A 1HGZA 2QSIA 1FXKB 3SYCA 2FBWC 1GK9A 2QM7A 4OGQC 1S77D 1NU1J 3SYPA 3CC4P 4Y99B 4G27B 1VQ8P 4PA3A 3L70G 2RKLA 2HFEC 2XU6A 5E1AC 1J5EO 5GTHE 1S0VA 1OVVA 2R70A 4RWUA 4PD4F 3H1KE 2N9BA 4IL6E 5KAFZ 4BWAA 2PF4E 2QR4A 1EXJA 3K5BA 4JYCA 3FFQA 1SQBD 1N0NA 4OVNF 5KJ7C 1NTZE 3RBZA 2HYNA 1FXVA 2F66C 1AVMA 3Q2YA 1NJIQ 4JTDB 4O2BA 2ZT9D 4UCTA 3OEEG 1FS0E 2P10A 2VS0A 3AK2A 4I55B 3GHGA 3GF3A 3JCUZ 2ZE8A 3V2RA 5EK0A 1JNMA 4DV0O 3R65A 1M9NA 2OYIB 1VQ4P 1LTSC 4DW0A 2R9IA 5CCGC 1OCOB 2F4VO 1WMKA 3CCSV 2PZSA 3H1KH 3TNUA 2IH3C 2X6AA 3KCXA 1HH0A 2PAJA 2XT9A 2OYIC 2Z3YA 3AG2B 2QEXP 4C7NB 4KFMA 4NYKA 1YIJP 3A3YB 3P7KA 2WSCJ 3A2AA 2Q5ZA 4JI1B 3BVHA 3OGCC 4EFEA 4PDLA 1N33B 4PI2A 1HNXB 3U11A 1WB7A 5KLVD 5KX5A 1SQPG 4WY4C 4N6JA 4H0LC 2X7RB 1NTKD 5EIBD 1Y76A 4EDFA 4Z1MH 3ASOB 3L72D 3TYYA 3GHGB 1LNQA 1YDXA 2A3QA 5JVDB 3HUSA 3MHVA 2YO2A 4LLHA 1KECA 4C7UA 3HTKB 2BCCH 2Y48A 4EFBA 1LTJC 1P49A 1FPOA 2OTLV 3FAVA 2FB5A 2A7WA 2Y0PA 5C39A 1RF0A 2JP3A 2POHA 3MDSA 3G71V 2DYSB 2QTSA 2WSSG 1SQQD 5H6QA 5FLXN 5FPRA 3BRTB 2QGNA 1CZQA 5KTBA 4DV2O 2L35A 5B1OA 3ZDMA 3QTCA 1XREA 2LO1A 4DUZO 1VQPP 4GOEA 4DO2A 3L73G 3EHBB 1L0NK 2DN9A 4OH8B 2IBZG 1YTZT 5LA6A 3JCZA 3K5LA 3TGUG 3WUVA 3JASB 4GKKO 1AVYA 3EVKA 5AVVB 1L0NG 1JY3O 3ZMVA 4O4LB 3MAQA 2XAGA 4BW9A 1AR5A 4TSFG 4B3MO 5TJHA 1GO3F 2C9LY 4JAUA 4CC5A 4LWSA 4MS2A 4UVBA 3ASNB 2EJRA 2NPSB 4CPGA 2C9NY 2XZRA 1H8HG 1ENVA 1NU1E 1K73Q 2Y9YA 1K5QA 3E8GA 1PD3A 2F4VB 1PPJD 2LKMA 2R72A 2R9AA 1M56D 4OPHA 1KYOI 4PA6A 1JOCA 4IL6X 2KLUA 2H7HA 1YIJV 1JR9A 1FE6A 2YMYA 3CCQV 4GKJB 1V55B 1NAFA 4LCUC 2P1JA 1K7DA 4NXNB 1N33O 2Y0DA 2RN9A 2Y0IA 2OYIA 1VQLP 1P84D 3CD6V 2WPRA 3RYHB 3W7XA 4UFZA 2VQEO 3Q4HA 2QJ1A 3HR0A 4UB6E 3HUSC 4X8AA 3RVZA 4DR7B 2Q4PA 4TQFA 1K73W 5LGUA 1VQ4V 4WFEA 1WA8B 2K3RA 1RY3A 1EZVD 1M7LA 2ZM6B 5EFWB 3B8MA 1SERA 1CP9A 2FYUJ 2D2CC 3CWBJ 2KS1A 2Q5UA 3CHXA 3KKYA 3SPGA 1ZSPA 2KNCB 3OTOB 4KHPB 4C7RA 1RFYA 1XQ8A 4B7EA 4DV1O 1FOSE 3A0HH 3WMM0 4FJCC 2XNDG 3T2MA 2C0WA 1USEA 2ATKC 4BIUA 5IYBO 5KKZC 4ZHQA 2UXNA 1QR9A 2YICA 2WT7B 4QIWF 2JK5C 1VDFA 2A45H 5AW2B 2OYOA 4P30A 3ZMSA 2BTOA 2E75D 4LC1A 1IFMA 2IPPA 3F5WC 4GKKB 1P84F 1S5LH 4IFFA 1BE3E 2BCCD 5EYPA 4YTPC 4U7NA 1OZ0A 3KZIE 3SJBC 1KILB 1X79B 1KYOE 3H1JH 1L2PA 1M90Q 3D70A 1P84H 1S9KD 4BIOA 4O4IB 1EDKA 2KB7P 1QVFU 4PD4I 5CCHC 3E2EA 1Q86Q 1VF7A 3GB7C 1T5EA 4W7YA 4JYBA 2ZAEB 3DC6A 3MGNA 4UCUA 5BU8B 2A45I 1HW7A 3CCMV 1MZEA 1MFZA 1SFCA 3SWKA 4BRYB 1AFOA 5CB4B 2W6JH 1DF4A 3MHHC 2Q7CA 5KJ7A 5AW0B 1GKFA 2UXBB 1GTWA 2Q73A 3F7VC 5B5EH 1LT9C 4DR2O 3I55P 3ABKB 1Y67A 2Q3IA 1NTMJ 3TXSA 1VQOV 4TUYB 4UVAA 4XDKA 3AEDC 1HWYA 1L8DA 2XAHA 1JX9A 3CC2V 3TK1A 3RGUA 3K79A 5KHJA 1AI4A 5FL7G 4DV7O 1AILA 2EILC 1SQPE 2P2UA 2OQQA 4FVMA 5IJ0B 2YXHA 4B08A 4ZI7A 2HHHB 1NR7A 2KIKA 3L75D 4JI3B 4J7JA 5CJ4A 1SC5B 1YHQV 3KXDA 1CI6B 1FJGO 2HODA 1EDLA 1L0LH 4FLXA 1YTFB 1A02J 1QGKB 4JF7A 1SQGA 2ZXWC 4EB6A 1N36B 3LNMB 3J7AU 1SQBH 3OFNG 5BY1A 2EIKC 2YDEA 4LFCB 1NVOA 1HNZB 3IFMA 1L4AD 4KP4A 3UT5B 3SYAA 2AXCA 4QE7A 1PFIA 3RL0B 1H8AA 1VQMP 3UT5A 3NTNA 4JI7B 1PM9A 3JAMN 5LBQA 3ETQA 4QE9A 3MD0A 3ABTA 3I56P 5GTHH 2FYZA 4B3MB 4O2BB 1VQ5V 2EBOA 3K58A 2GBOA 4GUNA 1KKCA 2ITDC 1SQPJ 2QIWA 3MIWA 4WBNA 3C90A 3L75E 3ZMTA 4YJ3B 4OGQD 3H32A 1XMOB 3IAYA 4UCVA 1RF1B 3JCUE 4UB8Z 1NU1K 3AE9C 4X9QA 4F4LA 1MFTA 2G3AA 1OCZC 4NB5A 1THZA 2WAMA 2NN4A 3IJ4A 4DV6O 5KAFH 1NTKH 1NKZB 4RAIA 4X65O 1OXZA 3CCMP 4AHCA 2X6BA 4PHZA 1F7YA 2FKXA 2BCCG 4NTYA 4BAYA 3K0GA 5K5GB 2W6BA 2PP6A 1LTJA 1F51A 3U1AA 2O1KA 3FXDA 5FNVB 4PD4E 2M5AA 2BSKB 3H1LJ 2GHYA 2WA4A 2VQFB 1VF5C 2WMMA 4RO0A 3ZCCA 1M4UA 3H1JE 4Q20A 3B2EE 1M1KW 1L4AB 4I7ZC 4JI5B 1BSHA 1EBOA 2IX7C 1GN4A 3STLC 4JAAA 3L9DA 1OW8A 1S5LZ 3USSA 1EN5A 3K08A 4B7KA 1VQ6P 3H1HE 3RK3D 2LFSA 3OTOO 2OYQA 1QVFO 2H88C 1G1XB 5BMVB 5EZYB 2WLNA 4PD4H 4JI2B 5IYZA 3SFDC 3X2QB 2XHBA 5AVWB 5AW9B 1SQVD 1T3UA 1OCRB 5AW8B 1NH2B 4O4IA 3F89A 4PDRA 2QWQB 1L0NE 4FM0A 1N0JA 4QNHB 1KP2A 2UXDB 1K04A 2XNXA 3L74H 3SPCA 1NTZJ 3ZRVA 1YQ4C 5LOVA 2CGOA 4AI8A 1Y66A 1QLED 1QLNA 1X22A 3M99B 1YITV 3FWLA 1VQKP 3V4QA 1S72P 2JRIA 1O9HA 5K1XA 3TNUB 2P06A 2Z4EA 3W7SA 3LNNA 2UXCO 5JH7A 5B5EZ 3U1CA 2OTKE 4X1IB 3AG3B 2AXTE 4H44B 4O2AA 3F7YC 2WLJA 2WSSH 4A5UB 1URQA 3BAAA 5L3DA 3BRVB 5LGTA 4L8JA 4WFAV 4CS4A 2K9YA 2YKQA 3S9OA 1L0ND 2QM4A 1ZWIC 4U3FD 5E79E 1HR0O 1N32O 4K3AA 2W6IG 2B1IA 1W2BU 4JI8B 1SQQH 1HTLC 5DEDA 3RL0C 2FL4A 3CXHI 3CMEV 2ITAA 1GU4A 4KUMA 1JB0J 2ZFCA 1H89A 4AILC 2Y9ZA 3OR6C 1ZXGA 3ASOC 1XHXA 3G3ZA 4I9QA 2HG5D 5GTIH 1OJHA 1YZBA 1B04A 1T6AA 3AG2C 3N2GA 3T97B 1H8EG 5AVTB 3TJTA 4GIFA 4HNAA 4LFCO 3R66A 3CCRV 2CUGA 5IY5C 1RE4A 1ZW0A 1HNWB 1D2DA 3OAKA 1X0TA 3NXSA 1M1JB 3VMXA 3IF4A 2B9BA 4UB6H 3B71A 2Y69B 4K8ZA 4DV2B 1H2KA 2OCHA 2VRSA 4FLVA 1DF5A 3OMNB 1JFFB 2YXLA 3H1KD 1Y8AA 2WSFH 1AP6A 2QA4P 1DLBA 4NKGB 3E1RA 2KQXA 1F23A 1PP9J 1LTGC 1KB9I 4DR1B 3ZRSA 3B8NA 3L73J 1PGPA 3S3XA 1S5LE 4BW5A 1BE3J 1SQVG 3RK2C 3O6QA 2PFXA 1AROP 5EIBC 4D7TA 3VP9A 5DJUB 5KAIH 3IAOA 5L3GA 1Q5OA 1Q8IA 1NU1G 1PGOA 2I8DA 2PUSA 3G6EV 4YXDC 3GW6A 2O01J 3AEAC 4JYYA 3UQ8A 1OIPA 2KSJA 3UO2A 1IDSA 3CXHE 1OW7A 2ZDIA 4JI4O 2HFED 1K8AQ 1FFTB 1MSDA 1H0TA 3PTZA 2QKCA 4UCOA 4LFAB 2E74C 4Y99C 5HFLA 1SA0B 1BHBA 1E79H 1GH6A 3W7WA 3FYEB 2RCVA 3RW0A 4D6TH 1B6QA 3VBBA 1LTIC 3ABUA 4AUWA 3VMYA 1O9GA 3VP8A 1SQXD 1ZP0C 2E74B 2WSFJ 2BE3A 2IBZE 1ZL8B 3JYCA 2R5DA 4NXNO 5M1BA 1XI1A 2AHZA 4QPKA 1S5HC 1OVUA 2VQEB 1AI7A 1NOHA 4Q6GA 4BXLA 1PP9E 3HKDB 2UU9B 2M6YA 2A06G 1AQTA 1OWAA 3M9QA 1EQ7A 4I1LA 5APQA 2E42A 1KQLA 1OVRA 3K5NA 2M3EA 3I55V 3VMAA 4BIZA 3A7OA 1I0HA 1K9MQ 2KB1A 3HD7A 3WU2Z 2DW4A 3HD7B 2R44A 1T2KC 4JV5B 1SQXE 2W0FC 1HJ0A 3K04A 2H3OA 1NTMK 2KK7A 2YKPA 4JI0B 3LIDA 1JEKA 1ZAUA 2WZ7A 4B3SB 5IJ0A 2OCCC 2AW9A 1T3JA 3CJHA 1G2CA 4I55A 1SZTA 3AG4C 1PL4A 1XDCA 1YJ9V 2QJYB 2CTQA 1G4YB 2K1AA 3RBXA 1BT8A 1BMFG 2BOBC 1M57C 1PGJA 1Q82Q 5DECA 2IYOA 2M8RA 2E74D 4F6EA 4NR1A 4ASVA 4WY4B 3CCUP 1SFCB 3G6EP 3I56V 1SQXJ 3T1CA 3PN1A 3HKCA 1URFA 3ICXA 4R4LA 2IH1C 3HKBA 3HKCB 4PJ0H 3LUTB 1BE3G 2X0LA 2HPCA 4BWNA 1PPJE 4JQ0D 2OTLP 5J2UA 3SJCC 2V7QH 4JTCB 2GM4A 2YIBD 1LP1A 3KG2A 2N1TC 3BEHA 5KAIZ 3CP1A 3WB0A 1XMQB 1KKDA 1SQPK 3JSNA 1FS0G 3MZWB 4J10A 3BPZA 4Z1MG 3JARA 2GUZB 2B87A 4L73A 2FXMA 3V4WA 3M8AA 4ZOLA 3VOUA 5KA6A 2WSCH 4ZIBA 4LF4B 2M0BA 1FZGA 1A02F 4WFFA 1VQ9P 1Y6XA 4UUJC 4PA4A 1AJQA 4NXMO 3ABVC 2QRXA 1KTMA 3D3QA 1R5LA 1M93A 2O01N 2NR5A 1G1JA 1EZVI 3GMAA 3RK3C 1NKDA 3OW2O 4ZKUA 4X1YA 2Q7GA 3CCLP 3JAKB 4L74A 4X1KB 4ZKPA 3ZN0A 2RMKB 1WN7A 1NR1A 1GU5A 1XL4A 2EIJC 3Q5SA 1K97A 5B1BB 2N1TB 1R3IC 1K9MW 5LOVB 2ZM6O 3EFGA 1VQ6V 3AK1A 1SFCD 4X20A 3ZRWA 1NTMH 4LF9O 1AV1A 3DTUB 2WLIB 1DEBA 2KUBA 5H6RA 1N2DC 4LF7O 3Q3DA 2YC0A 4MVUA 4X1IA 2E76C 3ZBHA 2F93B 1PV0A 5KHHA 4B3TB 3B5ND 4GODA 1E5WA 5JCOA 2QJPC 1L1FA 5L3EA 2ZD9A 1U96A 2IBZH 1GW4A 2GTAA 1IFDA 4HH2A 2CTRA 2F95B 3RT3C 2JDIH 4RO2A 4P2ZA 1PPJG 1IFPA 4JBZA 5J2UB 4X65B 1SQVK 5IYCO 3T1YO 1XHZA 1BZKA 1U7MA 3P8CE 3CL3D 2D2CB 2W83C 3O9OA 1IBLB 2FYUE 3CWBE 2YIBA 5KUMA 1FJKA 3JARB 1L0LG 3PRJA 3FWNA 4K0KO 4DCKA 1GD2E 3H1HH 3Q5RA 4KXRA 4DK0A 2RJZA 1H2GA 3K5MA 4ZKIA 3ABLB 1LR1A 2UU9O 1GK6A 2BEZF 1SQBJ 1WLEA 2W27A 1N34B 1RSOB 1JMBA 2GSMB 4X66B 3OM3B 5LP6C 2YEVA 3OMAB 3TETA 2WPVB 3B5NC 3CCSP 2B1GA 3LDDA 4U3FG 4H13B 2FYNB 1ZX3A 2YO3A 4IT5A 3WG7C 2XAJA 1PNLA 3SFEC 4I9WA 3TGUE 3OT7A 4UCRA 1NVPB 5CBFA 2P90A 1KQSU 3DGEA 1RP3B 4YIOA 4G2KA 2O57A 4MVZA 4TT3G 3RYFB 4JI0O 2PI5A 1GK4A 3WU2E 4OXSA 1IJDB 1OV9A 4PDMA 2WSEJ 1GL2B 1NTMG 1FZCA 5BU5A 1TUEB 5C93A 1YHQP 3CCLV 2W6AA 3H1KG 1DD3A 2Q7EA 1NHLA 4I4TB 3N2GB 1Q43A 1YSCA 5JJEB 4DJGA 2FKWB 3OE7G 3CB2A 3KDPB 4IIJB 5L3BA 2BCCE 3HRNA 2VWKA 5LYJA 4JI5O 4ASWA 5JQGB 4OX9O 1KYOD 5JCOC 2CGNA 2L5GB 2JS5A 3TGUD 3SWFA 1FZAA 2PTMA 4WFBV 2JJLA 5APYA 3M9BA 1QEXA 3D3IA 1R3LC 3NR7A 3J81N 2B89A 3L36A 5JJJB 1NO4A 4IFMA 3OW2U 1BQ0A 3Q4HB 1ZR2A 1KQSO 1TUBB 1IVSA 4MTFA 3T4DA 2UXDO 4YPCA 1CPYA 4FK5C 1AJNA 4IOIH 4DV3B 5H5NA 3DSQA 4MVOA 1N7SC 4IIJA 4ABMA 3CI9A 3CX5I 1KMIZ 3IR9A 2JGDB 4W7ZA 4K35A 3CEIA 1MZ9A 4PD4D 1GM8A 2J58A 4JPRA 4AYCA 2V1DA 1N73B 1EM1A 2EIKB 4I2LC
chains in the Genus database with same CATH topology
1KQFB 3FGAD 1DD4A 2D2CC 3AE9C 2YMKA 1S1CX 2G3AA 2G8YA 3GF7A 3IN6A 4H0LC 3AEEC 1FDIA 1YQ3C 4Z1MH 3AE8C 3AE3C 3T97B 2D2CB 1S5LX 5KKZC 4H44D 1KORA 1MKMA 4H0LD 3Q5RA 2E76B 2D2CD 2JP3A 4PV1B 1HF9A 2BEZF 4KT0J 1NYHA 2E75D 2WQYC 3B71A 3H25A 1AJYA 2E74D 1NGMB 1ZMEC 2WPVB 1VF5C 2BEQD 2MKVA 4YTPC 2E76D 4H13B 4R4LA 4Y28J 4I7ZB 2QJKC 2E75B 1FDOA 3D70A 4I7ZC 3SFEC 1EXIA 1Y9BA 3LW5J 4H13C 4U7JA 1PL5A 1VF5B 1RQVA 1OW8A 3O6QA 2QJYC 3AE1C 3AE4C 2WSEJ 3D71A 2J5UA 2FYNC 3IAOA 2H88C 1TU3F 3C8VA 3SFDC 2QSIA 3AEBC 4YXDC 3GLMA 2FBWC 2O01J 1Q90D 3AEAC 4OGQC 3RL0g 1DD3A 4H0LB 4OGQB 3AEDC 1OW7A 2FXPA 4PV1D 1VL2A 2H89C 1K04A 3AE5C 3AECC 2E74C 3ABVC 1OMIA 1KTMA 1EXJA 1YQ4C 2OQQA 1ZOYC 4TT3H 1R8EA 3GMAA 4RKUJ 1K05A 1ZP0C 3G9RA 3D6YA 2E74B 2WSFJ 4XFJA 1PV3A 3Q1MA 1KILE 3Q5PA 3Q2YA 2JO1A 4IL6X 1UIXA 2ZT9C 1KQGB 2ZT9D 1U57A 2NZ2A 4H13D 3RK3E 2YIUC 1IK7A 2P10A 3AEFC 5M1BA 4R4MA 3AE2C 3Q5SA 3GF3A 4H44B 4GDOA 5L8RJ 3R4YA 1VF5D 1GMJA 3AEGC 1DIPA 5KLIC 2ZT9B 2K9YA 1PIXA 3S9OA 1RQUA 2E75C 1WMKA 1KMIZ 3Q3DA 2IDBA 3D6ZA 3AE6C 4PV1C 1OW6A 2E76C 2QIWA 3AE7C 3EWKA 4H44C 2V7QJ 1ZRTE 1JB0J 2WSCJ 4OGQD 2QJPC 1HJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 J;  1Q90 D;  2WPV B;  4H0L B;  4OGQ B;  4H44 B;  4H13 B;  4Y28 J;  5L8R J;  4I7Z B;  2QJK C;  2E75 B;  5KLI C;  2ZT9 B;  2K9Y A;  3LW5 J;  2D2C B;  1S5L X;  1VF5 B;  5KKZ C;  4RKU J;  2QJY C;  2QIW A;  2WSE J;  2E74 B;  2FYN C;  2WSF J;  2E76 B;  4PV1 B;  1ZRT E;  3C8V A;  1JB0 J;  4KT0 J;  2WSC J;  4IL6 X;  2QSI A;  2QJP C;  2YIU C; 
#chains in the Genus database with same CATH topology
 2I1J A;  1CI6 A;  1LT9 A;  2AEF A;  5AW7 B;  1KC8 W;  3VQY A;  3ZHU A;  1TA8 A;  1BCC E;  5KMG A;  3CS5 A;  4EOT A;  1MG1 A;  4JPZ B;  3K0D A;  4NTW A;  3AE8 C;  3X2Q C;  1SQQ K;  1E1R G;  1NTZ K;  4FIP C;  4LFB B;  4DXW A;  1BHA A;  3RYC B;  2M5A B;  1BSM A;  2W6J G;  3CXH F;  1HF9 A;  4PV1 B;  4LF9 B;  4X89 A;  3APQ A;  2W90 A;  5AW4 B;  1EN4 A;  1W0K G;  1Q86 W;  3L72 J;  3L71 J;  1JOY A;  4RJT A;  3TSI A;  3FAV B;  2MKV A;  3ZHV A;  3GG2 A;  2E3C A;  4L75 A;  3H01 A;  5APW A;  1NI8 A;  2H8P D;  2JEX A;  3CXH H;  4K8X A;  4GX5 A;  5KLV K;  2LQT A;  5E79 H;  1FDO A;  1WRG A;  4H13 C;  1YI2 V;  3MTU E;  1MZF A;  3HE5 B;  4JZG A;  1WB8 A;  5GTI Z;  1HNW O;  4J9Z B;  5IYZ B;  3IC7 A;  3AG3 C;  4O4H A;  1KYO F;  1WNS A;  1V55 C;  3AE4 C;  2DYS C;  4NPE A;  4FLU A;  1KIL C;  2GUV A;  2V4H A;  2DQ0 A;  1XOU A;  5KLI B;  3G6B A;  3C8V A;  5LMU B;  1GM9 A;  4I0X B;  4KHP O;  2IJH A;  3CSX A;  1SES A;  4JI4 B;  3CPW U;  2ZVN B;  5DJT B;  5F2V O;  2CAZ C;  1FAF A;  3H1L H;  4BR6 A;  3ZHS A;  1YJ9 P;  2Y0C A;  1EDI A;  3G67 A;  3BFR A;  1AI5 A;  2DE0 X;  5J2T B;  1QVG U;  2E5L B;  3ZJZ A;  5KUK A;  3OAA G;  3QNE A;  1BL8 A;  3JC2 2;  5BR8 O;  2V4D A;  5AW3 B;  3H6P A;  1ZOY C;  1GRJ A;  1JMM A;  4O9B A;  3JAW B;  3KZI Z;  2ZDI C;  1K05 A;  4N3Y B;  1BCC H;  2IFN A;  2NNU A;  3ZS8 C;  2KSD A;  1RH5 B;  4JI6 O;  2OYH A;  2DYR B;  1DH3 A;  3H1H D;  2ARH A;  1N7S A;  1U57 A;  1GN6 A;  2FYU K;  1GN2 A;  3OTF A;  4GKJ O;  4YXW H;  1W2E A;  3OD4 A;  3W67 A;  3SPH A;  3CX5 E;  2P6J A;  2R32 A;  4KHX A;  1SQV E;  3RK2 D;  2CTP A;  2QEX V;  1VF5 D;  2FXO A;  1EZV G;  3B5N A;  5KLI C;  4JAV A;  1OCC C;  3B5N B;  2LGQ A;  2ZR3 A;  2LW1 A;  3HKE A;  1CW5 A;  3JSL A;  4FLZ A;  1BGY J;  2IDB A;  4MVR A;  3ZHR A;  5CA3 A;  4MT8 A;  2GTS A;  1YCI A;  4LFB O;  3H1I G;  1Y74 A;  5LP6 B;  3CE2 A;  3AE7 C;  5LP6 A;  2M7W A;  2KI7 B;  3G4S P;  2B5U A;  2Q1K A;  3E83 A;  1KV4 A;  1HGV A;  2EZP A;  2XAS A;  1LTT C;  1T8Z A;  4BRY A;  2K88 A;  2ZIO A;  2WPQ A;  3CCR P;  4WFH A;  3IN6 A;  5JJN B;  4EI2 A;  3CME P;  2HLD G;  1KB9 E;  4G28 B;  4LP8 A;  3F5T A;  4U3F J;  1MOF A;  4DV1 B;  1VAR A;  2H94 A;  3RGB A;  2QA4 V;  3L71 G;  1SS3 A;  4XA4 A;  1J5E B;  1JTH B;  1VQO P;  4KJM A;  4UCS A;  5CBO A;  1N8R W;  1N36 O;  4I0X A;  4ASU G;  5AVX B;  4DR1 O;  3JAK A;  2YIA A;  4LH7 A;  1X59 A;  4F6R B;  1H88 A;  2AHY A;  5GON B;  4DV3 O;  1E1Q G;  5B5E E;  5IJ9 B;  5GON A;  4ZI7 B;  2R3S A;  3BAB A;  4WCE V;  1MAB G;  2X6C A;  5ITZ B;  1ZME C;  1SA0 A;  4U3F H;  5B66 Z;  1KC8 Q;  1UPG A;  1Y4M A;  5CMU A;  1B06 A;  1DX7 A;  1FDM A;  1L0L K;  1D5N A;  3VQW A;  5LHG A;  1SQB K;  3G80 A;  3H1H J;  2YSU B;  3LW5 J;  2E5L O;  2JJ2 G;  1SQQ G;  1YYC A;  4U7J A;  1VF5 B;  5K1P A;  2OYH C;  1KB9 H;  2IBZ D;  2EIL B;  1JY3 P;  1R73 A;  3C3S A;  4MTG A;  4RUF A;  5IT9 N;  2YXR B;  4LF6 O;  2OTJ V;  5LA6 B;  3DC5 A;  2P7J A;  2Q67 A;  4LNU B;  3H1J J;  3AEB C;  1GMG A;  3TGU H;  1EDJ A;  1VQN V;  2BAS A;  3RL0 g;  3FB7 C;  3ZED A;  5KHK A;  3AG1 C;  1G2C B;  1PP9 D;  3G71 P;  4PJ0 E;  1WPX A;  1S5J A;  4NXM B;  2LXB A;  5AW5 B;  3HTK A;  2QWR B;  1XNR B;  2P67 A;  4CC6 A;  3W7U A;  1QHT A;  3AG7 A;  3IC9 A;  2BTQ B;  3LSS A;  1Q6H A;  2AZ2 A;  3T1H O;  4JI3 O;  1SQV H;  3L4F A;  2N05 A;  2BOC C;  3V2Q A;  3BCC J;  4GZR B;  1ZR4 A;  3L73 E;  1FJG B;  4XDL A;  3UO3 A;  1OCZ B;  2Y4U A;  1FXK C;  3Q5P A;  1NH2 D;  3LDE A;  4N78 D;  4UV9 A;  1UIX A;  2CPS A;  5CCG A;  2WTY A;  1R3J C;  1NTK E;  1JY2 P;  3E8H A;  2UUA O;  3M0A A;  4JAS A;  2JKV A;  2QE7 H;  3ZHT A;  5DM6 V;  2KNC A;  3L75 J;  3R4Y A;  4Z2W A;  4C46 A;  1P4R A;  3THO A;  5LMU O;  1DIP A;  1FYJ A;  3JCU H;  2FML A;  4E4E A;  4B86 A;  1GZL A;  1RQU A;  1P84 I;  2QG4 A;  2OYH B;  5FPO A;  2Z5I A;  4GCZ A;  2Z5U A;  3E1I A;  4O4L A;  1SQB E;  1D5A A;  2UXX A;  4LBE C;  5B1B C;  4DYL A;  4B3R B;  1ZRT E;  2WIT A;  5CA1 A;  1FFX B;  3BA8 A;  5KHG A;  2ZXX A;  3O6Q B;  4N23 A;  3SWY A;  4UB6 Z;  1VEW A;  3JAL B;  4CH3 A;  1M8O B;  3E35 A;  2NPS A;  3L71 H;  5J9P C;  3L72 H;  1JY2 N;  4X64 B;  3VQX A;  3L70 H;  3S3W A;  2AEM A;  3N2K B;  5LXT B;  3CCJ P;  2UXC B;  2LP7 A;  1LGH B;  4LNU A;  2FFD C;  1KP3 A;  1QL1 A;  3RFR A;  3HD7 C;  1OX3 A;  1N34 O;  1FZB A;  3WUT A;  2N04 A;  3JD1 A;  4D6T E;  3BA9 A;  1Q81 W;  2A06 D;  3B8E B;  4LF5 O;  3F5H A;  5CHX A;  1SQX H;  5C8Y B;  3H9V A;  1XNQ B;  3SYO A;  4YY3 B;  4P9P A;  5LGN A;  1YJN V;  2HPC B;  1JQ0 A;  1L0N H;  2WPS A;  3HPL C;  2ZR2 A;  4KL1 A;  3CCV P;  1QR8 A;  1H2M A;  3BY6 A;  1RE3 A;  3O8Z A;  3UKM A;  1KD1 W;  1QNM A;  1RSO A;  5LMN B;  1KIL A;  3L72 E;  2JWA A;  4CH6 A;  3WB1 A;  4LR3 A;  1NZ6 A;  4UB8 E;  4CZZ A;  4EEQ A;  3WB2 A;  1OCC B;  5EC2 C;  2J5U A;  1RF1 A;  4JI2 O;  1TU3 F;  1YTZ I;  2HVK C;  5D5P A;  4FLY A;  1L0N J;  2F23 A;  4L87 A;  3AG1 B;  1P84 E;  4X66 O;  2PRR A;  2IJK A;  2K9J A;  4TLF A;  3A0H Z;  1VQ7 V;  1RHZ B;  3RYI B;  4MSW C;  5B1A C;  2QJP B;  4J9Y B;  3A2F A;  2Q9I A;  2HLO A;  1Y76 B;  1SP4 A;  4FPP A;  2ZIM A;  1EZV E;  5CA1 B;  1YI2 P;  5BXZ A;  3JD2 A;  1LT1 A;  3BAT A;  2A06 H;  1XBL A;  4LH6 A;  3OUS A;  2DWE C;  4YJ3 A;  2YI8 A;  2CPB A;  2HVJ C;  4H13 D;  4DOJ A;  4FFK A;  1IK7 A;  1K4D C;  4R4M A;  4EYY Q;  3LSQ A;  3JAW A;  3JSV C;  3ABK C;  3RYH A;  4GDO A;  2NPS D;  1LWU A;  3SGI A;  3L70 D;  2WVR A;  1UFI A;  2P4V A;  4LWS B;  5CA0 B;  2A9H A;  1N7S B;  1NKN A;  4NTX A;  5KLV H;  4TV8 B;  5APT A;  1OW6 A;  2KKW A;  3GHG C;  3OGI B;  1FKA O;  3SPJ A;  1YXB A;  3EWK A;  2NRG A;  1A32 A;  3P30 A;  1JJO A;  3FGA D;  4K0K B;  2JS3 A;  2V7Q G;  3HKE B;  2VRZ A;  1F4M A;  4UVC A;  4DR4 B;  2RN0 A;  5H9C A;  3N27 A;  2O01 H;  1MSW D;  1S9K E;  1XUQ A;  1KN7 A;  1KUQ A;  3K03 A;  1TVK A;  1RM1 C;  3KCY A;  1VQP V;  2K37 A;  1FBM A;  1J2J B;  2QTO A;  3CRA A;  2WA3 A;  1N4C A;  1Q82 W;  1J1D B;  3H1L G;  1FZF A;  3BCC H;  2ETN A;  1RM1 B;  2UUA B;  3N4X A;  3L73 H;  4UXN A;  1OZH A;  4I4T A;  2GDS A;  4WY4 A;  4NVP A;  5CB4 A;  1R3K C;  2EIN C;  2PGG A;  2ADQ B;  2Q6Q A;  3M0D C;  2Q9L A;  1GN3 A;  3BRC A;  2CTW A;  2GA1 A;  3CCJ V;  4H33 A;  3H1H G;  1BGY E;  3V6I A;  1R5S A;  3E89 A;  3KHU A;  4WBA A;  1KFM A;  2MW2 B;  5TIS E;  3TGU J;  2E76 D;  5IYD O;  3WUU A;  1W2B O;  1SQP D;  1WT6 A;  3L74 D;  2H43 A;  1IO4 A;  3PLN A;  2KG7 A;  2KXP B;  4HBN A;  5CCH A;  2ZXW B;  1FXK A;  1RQV A;  2CH7 A;  3ZHQ A;  3CRM A;  1LUV A;  4I50 B;  2OT5 A;  2Y69 C;  1NH4 A;  3ITK A;  5ITZ A;  3PP5 A;  3IGA C;  5C8Y A;  1FFX A;  1AVO A;  2XDJ A;  3GLM A;  1WA8 A;  3HE5 A;  1IBM B;  3CYO A;  4WVZ A;  2ADP A;  1IFN A;  2ZVO B;  3D36 A;  5BZB A;  2C2A A;  2LJ2 A;  2KZJ A;  1BE3 D;  3E86 A;  3K9S A;  5BR8 B;  1VL2 A;  3A5T A;  2IBZ I;  3AE5 C;  1EC5 A;  1VQL V;  1SQQ J;  2YEV B;  2MK3 A;  4U3J B;  2OIE A;  4O4J B;  2ZQM A;  3L74 E;  3U10 A;  4TV9 B;  1NAY A;  3NFQ A;  2IM9 A;  1MMM A;  3ABM C;  3VQV A;  3CCU V;  2PYJ A;  1XNQ O;  3MUD C;  4J7K A;  1XTG B;  3D6Y A;  4WBN B;  1AR1 B;  3LSU A;  4GX0 A;  5B1A B;  4DK1 A;  1WP7 A;  2AEJ A;  3CPW O;  1ZLL A;  2LR2 A;  2RH0 A;  5AVZ B;  1NTZ G;  1Q6I A;  5CBH A;  1S4X A;  3AEF C;  4E2L A;  4DR3 O;  1Y47 A;  1LUW A;  4DRX B;  1QVG O;  4GX2 A;  1H2N A;  2K1E A;  3OJA B;  4DV0 B;  5CA0 A;  1XMQ O;  1UII A;  1PIX A;  2IW5 A;  3ZIA G;  1CSB A;  2LFR A;  1FC2 C;  2XND H;  3AG4 B;  3L74 J;  2UUC O;  4DR2 B;  1Q6U A;  1VF6 C;  5B3S B;  4H44 C;  4JV5 O;  2V7Q J;  4LF4 O;  1N86 A;  5KKZ B;  5AW1 B;  2WLL A;  2CDY A;  2YMK A;  1HJB A;  2G8Y A;  4PA7 A;  4J80 A;  2W0X A;  1FDI A;  1Q3E A;  1YTF D;  2N1T A;  4DV5 B;  4DRX A;  1TGO A;  4PA9 A;  3ETD A;  4FZ1 A;  3CC4 V;  1BCC J;  2ZE7 A;  2OAR A;  3A0R A;  5KLV G;  1NBM G;  1Q7Y Q;  1DGS A;  1G8M A;  1GM7 A;  4H0L D;  4AQY B;  1DK1 A;  2PGD A;  4IFD K;  2WQY C;  3I5D A;  3H25 A;  3ZRX A;  1M1J A;  4IL6 H;  1KZU B;  4RQF A;  3K57 A;  1HUC A;  3V2N A;  3D36 C;  1ROP A;  3RYF A;  4WB4 A;  3ETG A;  2KG7 B;  4ZOL B;  5APU A;  2ZNI A;  1N7L A;  4DR4 O;  5CJ0 A;  5KAF E;  3ZN1 A;  2O3J A;  3PJS K;  2PYL A;  5BMV A;  2QJY C;  2JIZ G;  3TCU A;  1Q7Y W;  2FYN C;  3T1Y B;  4Z1V A;  1N32 B;  1V54 C;  3CX5 D;  3SDL A;  2HJF C;  1LP1 B;  2ZYA A;  4MW3 A;  1IUR A;  1Q90 D;  1I5Y A;  2EZO A;  1R6T A;  4P9O A;  1ZV8 A;  5JVD A;  1OFC X;  2JGD A;  3CMA P;  1EN6 A;  4JGS A;  5HFM A;  2FXP A;  3U0Z A;  1R1B A;  1J1D C;  1FXH A;  4PV1 D;  3N2K A;  5LXT A;  2KP8 A;  2JJ1 G;  3E8F A;  3QWO C;  5A2Q N;  3AEC C;  4J7Z A;  3H1J D;  2WLK A;  1OMI A;  1I08 A;  2YNY A;  1LT9 B;  1KFN A;  5IJ9 A;  1Q2N A;  1R8E A;  2A79 B;  5B66 E;  3EQ2 A;  1F4N A;  2MJZ A;  3LIE A;  3M9H A;  4WF9 V;  3S4R A;  2UUC B;  3RVY A;  3PH0 A;  3ZX6 A;  3JD0 A;  4LF8 O;  3FX0 A;  1KB9 D;  1WPB A;  2QWN B;  1YJW V;  3GWK C;  2Q6A A;  1RF0 C;  1URQ C;  3BCC D;  5B66 H;  1M56 C;  1L0L J;  3SPI A;  3CCE P;  2XKM A;  1XNR O;  4CS2 A;  3CLQ A;  3O65 A;  4IL6 Z;  1GMJ A;  3NMD A;  4O2A B;  2JR8 A;  1M5I A;  1BGY G;  1IXB A;  1W5C E;  2ZE6 A;  4LF7 B;  4QJF B;  1IBM O;  1VMG A;  1QQC A;  3H32 B;  3JD3 A;  1K8A W;  4MVS A;  3N7N A;  3AK3 A;  1JA8 A;  4PV1 C;  3H1L E;  1WJZ A;  2YS8 A;  2UUB B;  1H2L A;  2G38 A;  1COW G;  1RPO A;  4EB6 B;  4DUZ B;  2B87 B;  1IX9 A;  4AQY O;  2ZKO A;  1VPC A;  1ZN5 A;  2EIJ B;  1VQ7 P;  2LXC B;  2GV9 A;  1JCC A;  3SJQ C;  3M0D A;  2ZIN A;  1BDD A;  4OX9 B;  1QLE B;  3ASN C;  1SZX A;  2QWO B;  2NPS C;  1QU7 A;  2ZE5 A;  1AJP A;  1TUB A;  1S3J A;  4DV4 B;  3DXR A;  1SLQ A;  2Q69 A;  2P58 A;  4DUY O;  1NS1 A;  3CD6 P;  1IZ3 A;  4H44 D;  4YJ2 A;  5EBL C;  1MNG A;  4GLX A;  3RK2 B;  1KB9 F;  4U3F E;  3HB3 B;  2R3C A;  4YIP A;  3B09 A;  1K33 A;  1X8Y A;  2OCC B;  5KA5 A;  2I1K A;  2DMX A;  1J1E B;  1PP9 G;  4FFB B;  1I7F A;  1NGM B;  3TDK A;  1FZC C;  1FJP A;  1S2E A;  1GAX A;  2QDO A;  1L4A A;  1JPX A;  2EIM C;  4FZ0 A;  1QBZ A;  5LHI A;  1M56 B;  2E75 B;  4A7P A;  4D6T J;  1WAZ A;  1GL2 D;  3QO5 A;  1IZN B;  3R2P A;  4WWI A;  1HR0 B;  1AA0 A;  3A0H E;  3HKB B;  3A8T A;  3CXC U;  1KIL D;  4N78 E;  3KZI H;  1URQ D;  3D71 A;  1LTJ B;  2CK3 H;  1EZV H;  1W59 A;  5FNV A;  1RE3 C;  3OA7 A;  3A0B Z;  1VQ9 V;  1PL0 A;  5IY5 B;  3W7T A;  3FKS G;  4DR7 O;  4DR6 B;  2FY8 A;  1GDT A;  4H0L B;  4HJG H;  1AB3 A;  1I94 B;  3CJH B;  4YXW G;  1QLE C;  2H8P C;  4AQR D;  3FYI B;  1BE3 H;  4GT1 A;  1IK9 A;  4R50 A;  5CCG D;  1ORQ C;  4B3S O;  1BCC G;  3W68 A;  1IBK B;  4J42 A;  1PP9 H;  3CMA V;  2WLM A;  5H2F H;  1LWU C;  2DQ3 A;  5EBW C;  3CC7 P;  1JM0 A;  3WU2 H;  2ZNJ A;  1GTO A;  3L72 G;  1U97 A;  1KIL E;  2UUB O;  1QL2 A;  1UJW B;  2ZT9 C;  3M91 A;  4NPF X;  2NZ2 A;  5LHH A;  2Q0A A;  3HUS B;  3L75 G;  1N73 C;  1HNZ O;  3E8B A;  5L8R J;  4FLW A;  4JZ2 A;  2B88 A;  4IHJ A;  4JI7 O;  3B4S A;  3CXH D;  1NT2 B;  2KLV A;  2FTK A;  2Q7H A;  5APX A;  1VF6 A;  3AE6 C;  1XL6 A;  2HOD B;  2SPZ A;  4X64 O;  1DTO A;  1VP7 A;  5H2F E;  1NTZ D;  2PY5 A;  3D8C A;  2JEE A;  1JJ2 U;  3L73 D;  5AVQ B;  1JY3 N;  1KQF B;  1I5X A;  1VIB A;  2QE7 G;  2QVA A;  1FOS F;  3RN4 A;  3L71 E;  2DJV A;  1XTC C;  1BDC A;  4YHH O;  4QPJ A;  3K59 A;  1S1C X;  2YIU B;  5LYJ B;  2UXB O;  1JCH A;  3K5O A;  1P7G A;  4O4J A;  4LF5 B;  3ZMU A;  5JQG A;  2AXT H;  3M7M X;  1PGQ A;  1H2S B;  4DV6 B;  3K3W A;  1P7B A;  3T4Z A;  4YY3 O;  1VQM V;  2O1J A;  2P4K A;  3H1I H;  4FLT A;  5A9G A;  1NQT A;  4U7O A;  1NVP D;  5AVY B;  1SF9 A;  2K9P A;  1IFI A;  1K34 A;  1GL2 A;  5DN6 G;  1KU9 A;  2A45 G;  3QO7 A;  1DEE G;  3B77 A;  3JAT B;  1AJY A;  1G6U A;  1OCO C;  2HHH O;  4R6Z A;  2WT7 A;  4DZO A;  1Z5W A;  1ZRT D;  2BEQ D;  2VQF O;  1S76 D;  3S1K A;  1SQX G;  4Y28 J;  3L71 D;  5KLV E;  2Z5H A;  1NU1 D;  3T97 A;  4WFG A;  3KQG A;  3RWR D;  5LL6 Y;  4DR5 B;  2IZ0 A;  3LDC A;  2XAQ A;  3VMZ A;  1SET A;  2HJD A;  2Z0A A;  1FD9 A;  3OR7 C;  1IBK O;  1XEQ A;  3L70 J;  2EX3 A;  3HE4 A;  3QG5 A;  3CCV V;  4W80 A;  3P32 A;  1CXZ B;  4EIJ A;  3A0B E;  1ZUQ A;  1PPJ H;  2CK3 G;  1SVF A;  1Y74 B;  4MVM A;  3UM7 A;  4HZ3 A;  4D6T D;  1KYO H;  1WP8 A;  3BAS A;  1K92 A;  2A06 E;  1SQQ E;  3BHP A;  3CCQ P;  1IFJ A;  1U7J A;  1AI6 A;  2QSA A;  3K9A A;  1SQF A;  4GOF A;  5KX5 B;  1HP8 A;  3OMI B;  1USD A;  4RKU J;  3G4S V;  3H1I J;  3M06 A;  3G9R A;  4RES B;  4JI6 B;  3B40 A;  1QX8 A;  3L35 A;  4MN4 C;  1HWT C;  2JO1 A;  3I5C A;  5JWP A;  1J95 A;  1TAE A;  4PJ0 Z;  4MTX A;  2IFM A;  3FB6 C;  3A0B H;  3AE2 C;  1OCR C;  3P8C D;  3HKD A;  3ZRW B;  3H1I D;  3FD9 A;  1SKV A;  4ICG A;  2RMZ A;  2FYU D;  3CWB D;  2WLI A;  3ETE A;  3AEG C;  2ZT9 B;  4MW8 A;  2N9Y B;  3FB8 C;  3FX7 A;  4X20 B;  1R6K A;  2K9J B;  4X88 A;  1LTB C;  4DR6 O;  4ZMD A;  1NTK J;  1VQN P;  3D6Z A;  1M57 D;  2E5T A;  1FU1 A;  4IYH A;  1OHH G;  1ZL8 A;  1RPR A;  2DYR C;  4X1Y B;  2IJI A;  1BGY D;  4JF3 A;  3WG7 B;  3ABL C;  4DT0 A;  2AXT Z;  1S72 V;  4DR3 B;  3L37 A;  4IHJ B;  4JI1 O;  5IE9 A;  1X9V A;  2CH7 B;  3L74 G;  2Q68 A;  3C1L A;  5AW6 B;  2OTJ P;  2F43 G;  1VQK V;  5IWA B;  3H1I E;  3II6 A;  4IGG A;  3H1J G;  1JMK C;  2D3O W;  1PZQ A;  1PKX A;  1Q81 Q;  3L70 E;  1PNK A;  1SQB G;  2UWJ E;  3SR2 C;  1T2K D;  1JUN A;  2NLJ C;  1SQX K;  5EZY A;  1JFF A;  4TQD A;  3LW5 H;  2ZCE A;  2HKO A;  2N74 A;  4XE5 B;  4GX1 A;  1NYH A;  2J59 M;  2IU3 A;  1VQ8 V;  1N7S D;  2JDI G;  2ITC C;  1SS1 A;  4HKZ H;  2XAF A;  1KD1 Q;  2OGU A;  2OWO A;  3J80 N;  3BCC G;  2FYU H;  3CWB H;  2YID A;  3QF7 A;  4DV5 O;  3VYI A;  4OWF A;  3CRR A;  2Y0E A;  3UCS C;  3CC2 P;  1SRY A;  1YJW P;  4I5S A;  4M3L A;  1IC2 A;  1SFC C;  5H2F Z;  2JWD A;  1Z2G A;  1CEZ A;  1ZLZ A;  4LF6 B;  5KJ7 D;  5KLV J;  4JYA B;  4QMA A;  1LJ2 A;  2DW3 A;  1M1J C;  1K4C C;  1YF2 A;  4UV8 A;  5EBM C;  2P5O A;  3C9I A;  2HEP A;  4R7C A;  4HAM A;  4TV8 A;  3P8M C;  5E79 Z;  2WWW A;  2R9R B;  5AVS B;  2ZYD A;  2FFD A;  1IXM A;  2H89 C;  1RE4 C;  4CS3 A;  1X4T A;  2Q0O C;  2BSK A;  2KYV A;  3T1H B;  2ZJS E;  4TT3 H;  3JAL A;  4CH5 A;  4W4K A;  4PI0 A;  3UIA A;  2JEU A;  1Z5V A;  2EUL A;  3VTP C;  4LF8 B;  2VWJ A;  1MUU A;  1HBW A;  2B9Z A;  3Q1M A;  1N73 A;  2FYU G;  1BCC D;  3CWB G;  2F1M A;  4FM1 A;  4HB1 A;  5B1N A;  1KQG B;  4X62 B;  4DV7 B;  5LMN O;  1J1E C;  1FZE A;  2L6L A;  1K3E A;  2A0L A;  3TXQ A;  2Q8V A;  1NTK G;  4MTO A;  1EZJ A;  4OPA A;  3IFX A;  1JVM A;  4R8C A;  2E75 C;  2FFD B;  1YJN P;  4EKW A;  2ZYG A;  3OUF A;  4X1K A;  5APS A;  1H38 A;  4B3R O;  3KPE A;  1R6N A;  1PNM A;  2IJJ A;  3E22 A;  2HR3 A;  4FMT A;  5GTH Z;  1M90 W;  1M57 B;  1KBH A;  4J11 A;  3WFV A;  1NTK K;  4RQE A;  1DD4 A;  2RNB A;  4I50 A;  5KAI E;  1VQ5 P;  1B3Q A;  5GTI E;  2YUA A;  2IZ1 A;  2XUM A;  4PEL A;  3CX5 F;  3HD7 D;  4DW1 A;  4JTA B;  2C0X A;  1YQ3 C;  3CC7 V;  3AE3 C;  2KSE A;  1V54 B;  2DOS A;  4MVQ A;  1YBK A;  2XV5 A;  1S5L X;  5CBN A;  5JH7 B;  4HYT B;  1GL2 C;  1KOR A;  1D7M A;  2GUS A;  3VOP A;  1NTZ H;  1BSN A;  3FXE A;  4XBF A;  4LFA O;  2BCC J;  2XTA A;  3JD4 A;  3AEI A;  2QKS A;  4D7S A;  5AVR B;  2AZ0 A;  3STZ C;  4TV9 A;  4XDJ A;  2L91 A;  3PHL A;  2KZI A;  4U3J A;  3BVO A;  4F6R A;  2ILM A;  1W0J G;  2E5Y A;  3ZMZ A;  3EFF K;  5L3C A;  3GVM A;  2ODM A;  3SJA C;  5J2T A;  5TIS H;  3QH9 A;  1NTM D;  1EXI A;  5CN0 A;  1Y9B A;  2HP8 A;  4LGD E;  1LTA C;  1PL5 A;  2GUZ A;  2KOG A;  3ML0 A;  4NPD A;  1FZC B;  2XOK G;  5EYP B;  5D5Q A;  3AE1 C;  1BS3 A;  1AQ5 A;  3RYC A;  1L0L D;  3CX5 H;  4O4H B;  5IWA O;  5GW7 A;  4PDV A;  3BCC E;  1N8R Q;  4RUE A;  1Z56 A;  4HNA B;  2IYP A;  3L75 H;  3DXR B;  4GYC B;  4OGQ B;  1NWQ A;  1ZTE A;  1GW3 A;  4X62 O;  2WSE H;  4W4L A;  1JTH A;  5KMG B;  3CCE V;  3MP7 B;  4HYO A;  1G1I A;  3H1L D;  3U59 A;  2AGA A;  1YVW A;  2LGW A;  2PI4 A;  1LWU B;  2WLL B;  5CBG A;  4D6T G;  3CRC A;  1TVK B;  1HNX O;  1JY2 O;  1NTM E;  2M3B A;  3JAT A;  2R5B A;  2YKO A;  1E79 G;  4CH4 A;  4XFJ A;  2YI9 A;  5KHI A;  1PV3 A;  4ZHQ B;  1QCE A;  1HDJ A;  3V5B A;  3RK3 E;  1L0L E;  3P3N A;  4C7N A;  3KYQ A;  2EJ7 A;  1BQZ A;  1I94 O;  4ZNC A;  5IDJ A;  2HG5 C;  4IYI A;  2QJK B;  2QKA A;  2ZXE B;  4JYA O;  1NJI W;  2P7T C;  1NU1 H;  1XIL A;  3FB5 C;  5EC1 C;  2KS1 B;  1SQP H;  5CCH D;  1URQ B;  1YIT P;  3EXA A;  2EIM B;  4TOI A;  3RL0 D;  4DV4 O;  3E22 B;  1JCD A;  4DUY B;  5L3F A;  2YXY A;  4B3T O;  1M1K Q;  3K06 A;  1MV8 A;  4YHH B;  4GKG A;  2YIU C;  2P22 C;  1MA1 A;  3RK3 B;  1HVV A;  3P3P A;  1XMO O;  1RF1 C;  3GF7 A;  4L76 A;  3TF5 A;  2LW7 A;  3RYI A;  3AEE C;  3CRQ A;  4WY4 D;  3MUD A;  2BTQ A;  1US6 A;  5B3S C;  2E43 A;  3H1K J;  2OIG A;  4JI8 O;  1EFR G;  2RQ6 A;  3MHS C;  4I6M C;  4ZBM A;  5TIS Z;  3QVN A;  5APV A;  1AP5 A;  2DWD C;  3V2P A;  1IBL O;  5BVZ A;  3SSU A;  5AG2 A;  1MKM A;  2YXQ B;  4FFB A;  3GWO A;  2QM8 A;  2E76 B;  3E7K A;  2D2C D;  3SYQ A;  3QO8 A;  2Q3E A;  4KT0 J;  1FAV A;  3JAS A;  3HE4 B;  1JO5 A;  2QWP B;  2WLH A;  4J41 A;  2JGU A;  5AVU B;  1H0T B;  1V9P A;  3C3T A;  2Y4T A;  5CMZ A;  4DR5 O;  4I7Z B;  1L4A C;  2QJK C;  2W8Z A;  3OEH G;  1SQV J;  4TUY A;  1AR4 A;  1YEW A;  4QGP A;  3ABM B;  2CE4 A;  4N21 A;  4CBC A;  4FM2 A;  2WPD G;  3APO A;  1K5S A;  4TWK A;  2RDC A;  2N1T D;  2JVD A;  4UB8 H;  1BGY H;  2IU0 A;  3VN0 A;  4YJ2 B;  2EIN B;  4H37 A;  1HGZ A;  2QSI A;  1FXK B;  3SYC A;  2FBW C;  1GK9 A;  2QM7 A;  4OGQ C;  1S77 D;  1NU1 J;  3SYP A;  3CC4 P;  4Y99 B;  4G27 B;  1VQ8 P;  4PA3 A;  3L70 G;  2RKL A;  2HFE C;  2XU6 A;  5E1A C;  1J5E O;  5GTH E;  1S0V A;  1OVV A;  2R70 A;  4RWU A;  4PD4 F;  3H1K E;  2N9B A;  4IL6 E;  5KAF Z;  4BWA A;  2PF4 E;  2QR4 A;  1EXJ A;  3K5B A;  4JYC A;  3FFQ A;  1SQB D;  1N0N A;  4OVN F;  5KJ7 C;  1NTZ E;  3RBZ A;  2HYN A;  1FXV A;  2F66 C;  1AVM A;  3Q2Y A;  1NJI Q;  4JTD B;  4O2B A;  2ZT9 D;  4UCT A;  3OEE G;  1FS0 E;  2P10 A;  2VS0 A;  3AK2 A;  4I55 B;  3GHG A;  3GF3 A;  3JCU Z;  2ZE8 A;  3V2R A;  5EK0 A;  1JNM A;  4DV0 O;  3R65 A;  1M9N A;  2OYI B;  1VQ4 P;  1LTS C;  4DW0 A;  2R9I A;  5CCG C;  1OCO B;  2F4V O;  1WMK A;  3CCS V;  2PZS A;  3H1K H;  3TNU A;  2IH3 C;  2X6A A;  3KCX A;  1HH0 A;  2PAJ A;  2XT9 A;  2OYI C;  2Z3Y A;  3AG2 B;  2QEX P;  4C7N B;  4KFM A;  4NYK A;  1YIJ P;  3A3Y B;  3P7K A;  2WSC J;  3A2A A;  2Q5Z A;  4JI1 B;  3BVH A;  3OGC C;  4EFE A;  4PDL A;  1N33 B;  4PI2 A;  1HNX B;  3U11 A;  1WB7 A;  5KLV D;  5KX5 A;  1SQP G;  4WY4 C;  4N6J A;  4H0L C;  2X7R B;  1NTK D;  5EIB D;  1Y76 A;  4EDF A;  4Z1M H;  3ASO B;  3L72 D;  3TYY A;  3GHG B;  1LNQ A;  1YDX A;  2A3Q A;  5JVD B;  3HUS A;  3MHV A;  2YO2 A;  4LLH A;  1KEC A;  4C7U A;  3HTK B;  2BCC H;  2Y48 A;  4EFB A;  1LTJ C;  1P49 A;  1FPO A;  2OTL V;  3FAV A;  2FB5 A;  2A7W A;  2Y0P A;  5C39 A;  1RF0 A;  2JP3 A;  2POH A;  3MDS A;  3G71 V;  2DYS B;  2QTS A;  2WSS G;  1SQQ D;  5H6Q A;  5FLX N;  5FPR A;  3BRT B;  2QGN A;  1CZQ A;  5KTB A;  4DV2 O;  2L35 A;  5B1O A;  3ZDM A;  3QTC A;  1XRE A;  2LO1 A;  4DUZ O;  1VQP P;  4GOE A;  4DO2 A;  3L73 G;  3EHB B;  1L0N K;  2DN9 A;  4OH8 B;  2IBZ G;  1YTZ T;  5LA6 A;  3JCZ A;  3K5L A;  3TGU G;  3WUV A;  3JAS B;  4GKK O;  1AVY A;  3EVK A;  5AVV B;  1L0N G;  1JY3 O;  3ZMV A;  4O4L B;  3MAQ A;  2XAG A;  4BW9 A;  1AR5 A;  4TSF G;  4B3M O;  5TJH A;  1GO3 F;  2C9L Y;  4JAU A;  4CC5 A;  4LWS A;  4MS2 A;  4UVB A;  3ASN B;  2EJR A;  2NPS B;  4CPG A;  2C9N Y;  2XZR A;  1H8H G;  1ENV A;  1NU1 E;  1K73 Q;  2Y9Y A;  1K5Q A;  3E8G A;  1PD3 A;  2F4V B;  1PPJ D;  2LKM A;  2R72 A;  2R9A A;  1M56 D;  4OPH A;  1KYO I;  4PA6 A;  1JOC A;  4IL6 X;  2KLU A;  2H7H A;  1YIJ V;  1JR9 A;  1FE6 A;  2YMY A;  3CCQ V;  4GKJ B;  1V55 B;  1NAF A;  4LCU C;  2P1J A;  1K7D A;  4NXN B;  1N33 O;  2Y0D A;  2RN9 A;  2Y0I A;  2OYI A;  1VQL P;  1P84 D;  3CD6 V;  2WPR A;  3RYH B;  3W7X A;  4UFZ A;  2VQE O;  3Q4H A;  2QJ1 A;  3HR0 A;  4UB6 E;  3HUS C;  4X8A A;  3RVZ A;  4DR7 B;  2Q4P A;  4TQF A;  1K73 W;  5LGU A;  1VQ4 V;  4WFE A;  1WA8 B;  2K3R A;  1RY3 A;  1EZV D;  1M7L A;  2ZM6 B;  5EFW B;  3B8M A;  1SER A;  1CP9 A;  2FYU J;  2D2C C;  3CWB J;  2KS1 A;  2Q5U A;  3CHX A;  3KKY A;  3SPG A;  1ZSP A;  2KNC B;  3OTO B;  4KHP B;  4C7R A;  1RFY A;  1XQ8 A;  4B7E A;  4DV1 O;  1FOS E;  3A0H H;  3WMM 0;  4FJC C;  2XND G;  3T2M A;  2C0W A;  1USE A;  2ATK C;  4BIU A;  5IYB O;  5KKZ C;  4ZHQ A;  2UXN A;  1QR9 A;  2YIC A;  2WT7 B;  4QIW F;  2JK5 C;  1VDF A;  2A45 H;  5AW2 B;  2OYO A;  4P30 A;  3ZMS A;  2BTO A;  2E75 D;  4LC1 A;  1IFM A;  2IPP A;  3F5W C;  4GKK B;  1P84 F;  1S5L H;  4IFF A;  1BE3 E;  2BCC D;  5EYP A;  4YTP C;  4U7N A;  1OZ0 A;  3KZI E;  3SJB C;  1KIL B;  1X79 B;  1KYO E;  3H1J H;  1L2P A;  1M90 Q;  3D70 A;  1P84 H;  1S9K D;  4BIO A;  4O4I B;  1EDK A;  2KB7 P;  1QVF U;  4PD4 I;  5CCH C;  3E2E A;  1Q86 Q;  1VF7 A;  3GB7 C;  1T5E A;  4W7Y A;  4JYB A;  2ZAE B;  3DC6 A;  3MGN A;  4UCU A;  5BU8 B;  2A45 I;  1HW7 A;  3CCM V;  1MZE A;  1MFZ A;  1SFC A;  3SWK A;  4BRY B;  1AFO A;  5CB4 B;  2W6J H;  1DF4 A;  3MHH C;  2Q7C A;  5KJ7 A;  5AW0 B;  1GKF A;  2UXB B;  1GTW A;  2Q73 A;  3F7V C;  5B5E H;  1LT9 C;  4DR2 O;  3I55 P;  3ABK B;  1Y67 A;  2Q3I A;  1NTM J;  3TXS A;  1VQO V;  4TUY B;  4UVA A;  4XDK A;  3AED C;  1HWY A;  1L8D A;  2XAH A;  1JX9 A;  3CC2 V;  3TK1 A;  3RGU A;  3K79 A;  5KHJ A;  1AI4 A;  5FL7 G;  4DV7 O;  1AIL A;  2EIL C;  1SQP E;  2P2U A;  2OQQ A;  4FVM A;  5IJ0 B;  2YXH A;  4B08 A;  4ZI7 A;  2HHH B;  1NR7 A;  2KIK A;  3L75 D;  4JI3 B;  4J7J A;  5CJ4 A;  1SC5 B;  1YHQ V;  3KXD A;  1CI6 B;  1FJG O;  2HOD A;  1EDL A;  1L0L H;  4FLX A;  1YTF B;  1A02 J;  1QGK B;  4JF7 A;  1SQG A;  2ZXW C;  4EB6 A;  1N36 B;  3LNM B;  3J7A U;  1SQB H;  3OFN G;  5BY1 A;  2EIK C;  2YDE A;  4LFC B;  1NVO A;  1HNZ B;  3IFM A;  1L4A D;  4KP4 A;  3UT5 B;  3SYA A;  2AXC A;  4QE7 A;  1PFI A;  3RL0 B;  1H8A A;  1VQM P;  3UT5 A;  3NTN A;  4JI7 B;  1PM9 A;  3JAM N;  5LBQ A;  3ETQ A;  4QE9 A;  3MD0 A;  3ABT A;  3I56 P;  5GTH H;  2FYZ A;  4B3M B;  4O2B B;  1VQ5 V;  2EBO A;  3K58 A;  2GBO A;  4GUN A;  1KKC A;  2ITD C;  1SQP J;  2QIW A;  3MIW A;  4WBN A;  3C90 A;  3L75 E;  3ZMT A;  4YJ3 B;  4OGQ D;  3H32 A;  1XMO B;  3IAY A;  4UCV A;  1RF1 B;  3JCU E;  4UB8 Z;  1NU1 K;  3AE9 C;  4X9Q A;  4F4L A;  1MFT A;  2G3A A;  1OCZ C;  4NB5 A;  1THZ A;  2WAM A;  2NN4 A;  3IJ4 A;  4DV6 O;  5KAF H;  1NTK H;  1NKZ B;  4RAI A;  4X65 O;  1OXZ A;  3CCM P;  4AHC A;  2X6B A;  4PHZ A;  1F7Y A;  2FKX A;  2BCC G;  4NTY A;  4BAY A;  3K0G A;  5K5G B;  2W6B A;  2PP6 A;  1LTJ A;  1F51 A;  3U1A A;  2O1K A;  3FXD A;  5FNV B;  4PD4 E;  2M5A A;  2BSK B;  3H1L J;  2GHY A;  2WA4 A;  2VQF B;  1VF5 C;  2WMM A;  4RO0 A;  3ZCC A;  1M4U A;  3H1J E;  4Q20 A;  3B2E E;  1M1K W;  1L4A B;  4I7Z C;  4JI5 B;  1BSH A;  1EBO A;  2IX7 C;  1GN4 A;  3STL C;  4JAA A;  3L9D A;  1OW8 A;  1S5L Z;  3USS A;  1EN5 A;  3K08 A;  4B7K A;  1VQ6 P;  3H1H E;  3RK3 D;  2LFS A;  3OTO O;  2OYQ A;  1QVF O;  2H88 C;  1G1X B;  5BMV B;  5EZY B;  2WLN A;  4PD4 H;  4JI2 B;  5IYZ A;  3SFD C;  3X2Q B;  2XHB A;  5AVW B;  5AW9 B;  1SQV D;  1T3U A;  1OCR B;  5AW8 B;  1NH2 B;  4O4I A;  3F89 A;  4PDR A;  2QWQ B;  1L0N E;  4FM0 A;  1N0J A;  4QNH B;  1KP2 A;  2UXD B;  1K04 A;  2XNX A;  3L74 H;  3SPC A;  1NTZ J;  3ZRV A;  1YQ4 C;  5LOV A;  2CGO A;  4AI8 A;  1Y66 A;  1QLE D;  1QLN A;  1X22 A;  3M99 B;  1YIT V;  3FWL A;  1VQK P;  3V4Q A;  1S72 P;  2JRI A;  1O9H A;  5K1X A;  3TNU B;  2P06 A;  2Z4E A;  3W7S A;  3LNN A;  2UXC O;  5JH7 A;  5B5E Z;  3U1C A;  2OTK E;  4X1I B;  3AG3 B;  2AXT E;  4H44 B;  4O2A A;  3F7Y C;  2WLJ A;  2WSS H;  4A5U B;  1URQ A;  3BAA A;  5L3D A;  3BRV B;  5LGT A;  4L8J A;  4WFA V;  4CS4 A;  2K9Y A;  2YKQ A;  3S9O A;  1L0N D;  2QM4 A;  1ZWI C;  4U3F D;  5E79 E;  1HR0 O;  1N32 O;  4K3A A;  2W6I G;  2B1I A;  1W2B U;  4JI8 B;  1SQQ H;  1HTL C;  5DED A;  3RL0 C;  2FL4 A;  3CXH I;  3CME V;  2ITA A;  1GU4 A;  4KUM A;  1JB0 J;  2ZFC A;  1H89 A;  4AIL C;  2Y9Z A;  3OR6 C;  1ZXG A;  3ASO C;  1XHX A;  3G3Z A;  4I9Q A;  2HG5 D;  5GTI H;  1OJH A;  1YZB A;  1B04 A;  1T6A A;  3AG2 C;  3N2G A;  3T97 B;  1H8E G;  5AVT B;  3TJT A;  4GIF A;  4HNA A;  4LFC O;  3R66 A;  3CCR V;  2CUG A;  5IY5 C;  1RE4 A;  1ZW0 A;  1HNW B;  1D2D A;  3OAK A;  1X0T A;  3NXS A;  1M1J B;  3VMX A;  3IF4 A;  2B9B A;  4UB6 H;  3B71 A;  2Y69 B;  4K8Z A;  4DV2 B;  1H2K A;  2OCH A;  2VRS A;  4FLV A;  1DF5 A;  3OMN B;  1JFF B;  2YXL A;  3H1K D;  1Y8A A;  2WSF H;  1AP6 A;  2QA4 P;  1DLB A;  4NKG B;  3E1R A;  2KQX A;  1F23 A;  1PP9 J;  1LTG C;  1KB9 I;  4DR1 B;  3ZRS A;  3B8N A;  3L73 J;  1PGP A;  3S3X A;  1S5L E;  4BW5 A;  1BE3 J;  1SQV G;  3RK2 C;  3O6Q A;  2PFX A;  1ARO P;  5EIB C;  4D7T A;  3VP9 A;  5DJU B;  5KAI H;  3IAO A;  5L3G A;  1Q5O A;  1Q8I A;  1NU1 G;  1PGO A;  2I8D A;  2PUS A;  3G6E V;  4YXD C;  3GW6 A;  2O01 J;  3AEA C;  4JYY A;  3UQ8 A;  1OIP A;  2KSJ A;  3UO2 A;  1IDS A;  3CXH E;  1OW7 A;  2ZDI A;  4JI4 O;  2HFE D;  1K8A Q;  1FFT B;  1MSD A;  1H0T A;  3PTZ A;  2QKC A;  4UCO A;  4LFA B;  2E74 C;  4Y99 C;  5HFL A;  1SA0 B;  1BHB A;  1E79 H;  1GH6 A;  3W7W A;  3FYE B;  2RCV A;  3RW0 A;  4D6T H;  1B6Q A;  3VBB A;  1LTI C;  3ABU A;  4AUW A;  3VMY A;  1O9G A;  3VP8 A;  1SQX D;  1ZP0 C;  2E74 B;  2WSF J;  2BE3 A;  2IBZ E;  1ZL8 B;  3JYC A;  2R5D A;  4NXN O;  5M1B A;  1XI1 A;  2AHZ A;  4QPK A;  1S5H C;  1OVU A;  2VQE B;  1AI7 A;  1NOH A;  4Q6G A;  4BXL A;  1PP9 E;  3HKD B;  2UU9 B;  2M6Y A;  2A06 G;  1AQT A;  1OWA A;  3M9Q A;  1EQ7 A;  4I1L A;  5APQ A;  2E42 A;  1KQL A;  1OVR A;  3K5N A;  2M3E A;  3I55 V;  3VMA A;  4BIZ A;  3A7O A;  1I0H A;  1K9M Q;  2KB1 A;  3HD7 A;  3WU2 Z;  2DW4 A;  3HD7 B;  2R44 A;  1T2K C;  4JV5 B;  1SQX E;  2W0F C;  1HJ0 A;  3K04 A;  2H3O A;  1NTM K;  2KK7 A;  2YKP A;  4JI0 B;  3LID A;  1JEK A;  1ZAU A;  2WZ7 A;  4B3S B;  5IJ0 A;  2OCC C;  2AW9 A;  1T3J A;  3CJH A;  1G2C A;  4I55 A;  1SZT A;  3AG4 C;  1PL4 A;  1XDC A;  1YJ9 V;  2QJY B;  2CTQ A;  1G4Y B;  2K1A A;  3RBX A;  1BT8 A;  1BMF G;  2BOB C;  1M57 C;  1PGJ A;  1Q82 Q;  5DEC A;  2IYO A;  2M8R A;  2E74 D;  4F6E A;  4NR1 A;  4ASV A;  4WY4 B;  3CCU P;  1SFC B;  3G6E P;  3I56 V;  1SQX J;  3T1C A;  3PN1 A;  3HKC A;  1URF A;  3ICX A;  4R4L A;  2IH1 C;  3HKB A;  3HKC B;  4PJ0 H;  3LUT B;  1BE3 G;  2X0L A;  2HPC A;  4BWN A;  1PPJ E;  4JQ0 D;  2OTL P;  5J2U A;  3SJC C;  2V7Q H;  4JTC B;  2GM4 A;  2YIB D;  1LP1 A;  3KG2 A;  2N1T C;  3BEH A;  5KAI Z;  3CP1 A;  3WB0 A;  1XMQ B;  1KKD A;  1SQP K;  3JSN A;  1FS0 G;  3MZW B;  4J10 A;  3BPZ A;  4Z1M G;  3JAR A;  2GUZ B;  2B87 A;  4L73 A;  2FXM A;  3V4W A;  3M8A A;  4ZOL A;  3VOU A;  5KA6 A;  2WSC H;  4ZIB A;  4LF4 B;  2M0B A;  1FZG A;  1A02 F;  4WFF A;  1VQ9 P;  1Y6X A;  4UUJ C;  4PA4 A;  1AJQ A;  4NXM O;  3ABV C;  2QRX A;  1KTM A;  3D3Q A;  1R5L A;  1M93 A;  2O01 N;  2NR5 A;  1G1J A;  1EZV I;  3GMA A;  3RK3 C;  1NKD A;  3OW2 O;  4ZKU A;  4X1Y A;  2Q7G A;  3CCL P;  3JAK B;  4L74 A;  4X1K B;  4ZKP A;  3ZN0 A;  2RMK B;  1WN7 A;  1NR1 A;  1GU5 A;  1XL4 A;  2EIJ C;  3Q5S A;  1K97 A;  5B1B B;  2N1T B;  1R3I C;  1K9M W;  5LOV B;  2ZM6 O;  3EFG A;  1VQ6 V;  3AK1 A;  1SFC D;  4X20 A;  3ZRW A;  1NTM H;  4LF9 O;  1AV1 A;  3DTU B;  2WLI B;  1DEB A;  2KUB A;  5H6R A;  1N2D C;  4LF7 O;  3Q3D A;  2YC0 A;  4MVU A;  4X1I A;  2E76 C;  3ZBH A;  2F93 B;  1PV0 A;  5KHH A;  4B3T B;  3B5N D;  4GOD A;  1E5W A;  5JCO A;  2QJP C;  1L1F A;  5L3E A;  2ZD9 A;  1U96 A;  2IBZ H;  1GW4 A;  2GTA A;  1IFD A;  4HH2 A;  2CTR A;  2F95 B;  3RT3 C;  2JDI H;  4RO2 A;  4P2Z A;  1PPJ G;  1IFP A;  4JBZ A;  5J2U B;  4X65 B;  1SQV K;  5IYC O;  3T1Y O;  1XHZ A;  1BZK A;  1U7M A;  3P8C E;  3CL3 D;  2D2C B;  2W83 C;  3O9O A;  1IBL B;  2FYU E;  3CWB E;  2YIB A;  5KUM A;  1FJK A;  3JAR B;  1L0L G;  3PRJ A;  3FWN A;  4K0K O;  4DCK A;  1GD2 E;  3H1H H;  3Q5R A;  4KXR A;  4DK0 A;  2RJZ A;  1H2G A;  3K5M A;  4ZKI A;  3ABL B;  1LR1 A;  2UU9 O;  1GK6 A;  2BEZ F;  1SQB J;  1WLE A;  2W27 A;  1N34 B;  1RSO B;  1JMB A;  2GSM B;  4X66 B;  3OM3 B;  5LP6 C;  2YEV A;  3OMA B;  3TET A;  2WPV B;  3B5N C;  3CCS P;  2B1G A;  3LDD A;  4U3F G;  4H13 B;  2FYN B;  1ZX3 A;  2YO3 A;  4IT5 A;  3WG7 C;  2XAJ A;  1PNL A;  3SFE C;  4I9W A;  3TGU E;  3OT7 A;  4UCR A;  1NVP B;  5CBF A;  2P90 A;  1KQS U;  3DGE A;  1RP3 B;  4YIO A;  4G2K A;  2O57 A;  4MVZ A;  4TT3 G;  3RYF B;  4JI0 O;  2PI5 A;  1GK4 A;  3WU2 E;  4OXS A;  1IJD B;  1OV9 A;  4PDM A;  2WSE J;  1GL2 B;  1NTM G;  1FZC A;  5BU5 A;  1TUE B;  5C93 A;  1YHQ P;  3CCL V;  2W6A A;  3H1K G;  1DD3 A;  2Q7E A;  1NHL A;  4I4T B;  3N2G B;  1Q43 A;  1YSC A;  5JJE B;  4DJG A;  2FKW B;  3OE7 G;  3CB2 A;  3KDP B;  4IIJ B;  5L3B A;  2BCC E;  3HRN A;  2VWK A;  5LYJ A;  4JI5 O;  4ASW A;  5JQG B;  4OX9 O;  1KYO D;  5JCO C;  2CGN A;  2L5G B;  2JS5 A;  3TGU D;  3SWF A;  1FZA A;  2PTM A;  4WFB V;  2JJL A;  5APY A;  3M9B A;  1QEX A;  3D3I A;  1R3L C;  3NR7 A;  3J81 N;  2B89 A;  3L36 A;  5JJJ B;  1NO4 A;  4IFM A;  3OW2 U;  1BQ0 A;  3Q4H B;  1ZR2 A;  1KQS O;  1TUB B;  1IVS A;  4MTF A;  3T4D A;  2UXD O;  4YPC A;  1CPY A;  4FK5 C;  1AJN A;  4IOI H;  4DV3 B;  5H5N A;  3DSQ A;  4MVO A;  1N7S C;  4IIJ A;  4ABM A;  3CI9 A;  3CX5 I;  1KMI Z;  3IR9 A;  2JGD B;  4W7Z A;  4K35 A;  3CEI A;  1MZ9 A;  4PD4 D;  1GM8 A;  2J58 A;  4JPR A;  4AYC A;  2V1D A;  1N73 B;  1EM1 A;  2EIK B;  4I2L C; 
#chains in the Genus database with same CATH homology
 1KQF B;  3FGA D;  1DD4 A;  2D2C C;  3AE9 C;  2YMK A;  1S1C X;  2G3A A;  2G8Y A;  3GF7 A;  3IN6 A;  4H0L C;  3AEE C;  1FDI A;  1YQ3 C;  4Z1M H;  3AE8 C;  3AE3 C;  3T97 B;  2D2C B;  1S5L X;  5KKZ C;  4H44 D;  1KOR A;  1MKM A;  4H0L D;  3Q5R A;  2E76 B;  2D2C D;  2JP3 A;  4PV1 B;  1HF9 A;  2BEZ F;  4KT0 J;  1NYH A;  2E75 D;  2WQY C;  3B71 A;  3H25 A;  1AJY A;  2E74 D;  1NGM B;  1ZME C;  2WPV B;  1VF5 C;  2BEQ D;  2MKV A;  4YTP C;  2E76 D;  4H13 B;  4R4L A;  4Y28 J;  4I7Z B;  2QJK C;  2E75 B;  1FDO A;  3D70 A;  4I7Z C;  3SFE C;  1EXI A;  1Y9B A;  3LW5 J;  4H13 C;  4U7J A;  1PL5 A;  1VF5 B;  1RQV A;  1OW8 A;  3O6Q A;  2QJY C;  3AE1 C;  3AE4 C;  2WSE J;  3D71 A;  2J5U A;  2FYN C;  3IAO A;  2H88 C;  1TU3 F;  3C8V A;  3SFD C;  2QSI A;  3AEB C;  4YXD C;  3GLM A;  2FBW C;  2O01 J;  1Q90 D;  3AEA C;  4OGQ C;  3RL0 g;  1DD3 A;  4H0L B;  4OGQ B;  3AED C;  1OW7 A;  2FXP A;  4PV1 D;  1VL2 A;  2H89 C;  1K04 A;  3AE5 C;  3AEC C;  2E74 C;  3ABV C;  1OMI A;  1KTM A;  1EXJ A;  1YQ4 C;  2OQQ A;  1ZOY C;  4TT3 H;  1R8E A;  3GMA A;  4RKU J;  1K05 A;  1ZP0 C;  3G9R A;  3D6Y A;  2E74 B;  2WSF J;  4XFJ A;  1PV3 A;  3Q1M A;  1KIL E;  3Q5P A;  3Q2Y A;  2JO1 A;  4IL6 X;  1UIX A;  2ZT9 C;  1KQG B;  2ZT9 D;  1U57 A;  2NZ2 A;  4H13 D;  3RK3 E;  2YIU C;  1IK7 A;  2P10 A;  3AEF C;  5M1B A;  4R4M A;  3AE2 C;  3Q5S A;  3GF3 A;  4H44 B;  4GDO A;  5L8R J;  3R4Y A;  1VF5 D;  1GMJ A;  3AEG C;  1DIP A;  5KLI C;  2ZT9 B;  2K9Y A;  1PIX A;  3S9O A;  1RQU A;  2E75 C;  1WMK A;  1KMI Z;  3Q3D A;  2IDB A;  3D6Z A;  3AE6 C;  4PV1 C;  1OW6 A;  2E76 C;  2QIW A;  3AE7 C;  3EWK A;  4H44 C;  2V7Q J;  1ZRT E;  1JB0 J;  2WSC J;  4OGQ D;  2QJP C;  1HJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...