4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
b'MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
1ZRTE 2D2CB 2WSFJ 2QIWA 2E74B 1S5LX 1Q90D 2E76B 2E75B 2QJKC 2QJPC 2WSEJ 2O01J 4Y28J 2K9YA 4I7ZB 1JB0J 5L8RJ 5KLIC 2WSCJ 3C8VA 2FYNC 5KKZC 2ZT9B 4OGQB 4PV1B 4KT0J 4H13B 1VF5B 2WPVB 2QSIA 4RKUJ 4H0LB 2YIUC 4IL6X 2QJYC 3LW5J 4H44B
chains in the Genus database with same CATH superfamily
2VWJA 4X66O 1FBMA 4LBEC 2E5YA 3E35A 3RK3D 1LUWA 4OPAA 2IFMA 4WY4B 2P4VA 3SYOA 3K3WA 1BS3A 1XMOB 1N32B 4GX0A 1J1DB 2YIUB 1SQPJ 1PZQA 1GN2A 3OGCC 3C3SA 3L70G 2N1TD 3AE4C 2B87A 1SFCA 2PYLA 1S5JA 5GTIE 4UB6E 2HEPA 1BZKA 4PDLA 5BXZA 4Q6GA 3V2RA 1IBLO 3U59A 2GM4A 5KHGA 1IK9A 4IYIA 4LF4B 2QM8A 1Q5OA 1MUUA 5LXTA 1K8AW 4LF9O 4JI2O 1WRGA 1D5NA 4DV6B 2M5AA 4XBFA 1AROP 4AHCA 1BDDA 1YI2V 4JZGA 1SQXE 1KKDA 3H1JG 1UIIA 3DXRB 3KHUA 3L71D 4PI0A 4N78E 1IJDB 4DR1O 2QKCA 4LLHA 5KLVH 3AE8C 1TGOA 1Y76A 3Q1MA 3HKCB 2XV5A 3AEAC 4JAVA 5B1NA 3BVOA 1WB8A 1HUCA 5AVUB 3QO7A 4O4LB 4YXWH 4IIJA 4RWUA 4CH5A 1AI5A 1GK6A 5CJ4A 2JWAA 1RSOA 2LFSA 3KG2A 4JZ2A 2RCVA 1NTZE 1XMQB 2VRZA 3L71J 1Q86Q 3IGAC 3CPWU 4DK0A 3CRMA 4P9OA 1YTZT 1TU3F 4OX9O 1KV4A 2QE7H 2IH3C 5TISE 1M1JC 1KN7A 4FLZA 2K3RA 4DJGA 2PGGA 5CBFA 1GN6A 2A9HA 1IFPA 4X66B 1X9VA 1EZVG 4J42A 1M1KW 1OCRC 2I1JA 5KLVK 3USSA 2Q3IA 1L0NH 1RPOA 5CCGA 3QH9A 2DMXA 3TNUA 4TOIA 5IE9A 2QR4A 1NHLA 2GUVA 5DECA 4OGQD 3LNMB 4D6TH 1KILC 1AP5A 1ZL8B 3A2FA 4CH4A 3UT5A 2ZE6A 1YIJV 1SQVE 2E5TA 5APUA 1OCRB 2F23A 4B7KA 1GO3F 3CX5H 5H2FH 4GX2A 1AJPA 1L2PA 3QTCA 5KMGA 5APWA 3L73G 2A79B 1PP9H 3NR7A 1IBLB 2FYUG 3PH0A 1US6A 3W7WA 2JIZG 5E1AC 5C8YB 2HLOA 3CXHF 2O57A 4NPFX 4AQYO 1WAZA 4LF9B 4LH7A 1FFXA 4JI2B 1NU1H 3MDSA 4L73A 5KAFH 5APQA 4N6JA 1M93A 1GDTA 3KYQA 1TA8A 3BASA 1KYOF 2ATKC 5LHHA 4JI0O 2Q7HA 5EC1C 2XAGA 3APOA 1JJ2U 4I9QA 1PL0A 1K4DC 1RQVA 2XAHA 3RVYA 4DR1B 5AG2A 4FFKA 4CC5A 2GTSA 3TXSA 4ZHQA 1GZLA 1Q82Q 4LNUB 4U7NA 5BZBA 3MAQA 2O1JA 4KJMA 1SQPG 3OTFA 3HD7D 4K0KO 1GM8A 3L4FA 1LGHB 5H9CA 2E75D 1PNMA 1PKXA 2EBOA 3VMAA 3WB1A 2OT5A 4Q20A 2A45H 1JUNA 2XAQA 2IBZE 1JMKC 1NU1K 2V4HA 2JR8A 2ITAA 2R9RB 3RL0B 1FJPA 3MGNA 3F5WC 4HYOA 2Z4EA 1K7DA 1VQ7P 4OX9B 2Y0IA 4I0XB 5B66E 2A45I 5GTHH 3S9OA 4PJ0Z 2IZ1A 3CCLV 2XTAA 1YQ3C 3S4RA 4DV1O 1T5EA 3SPHA 3OEEG 1BE3H 3D71A 4OPHA 2WLHA 3GHGA 3H1LH 3ETQA 3R2PA 3SSUA 1LTJC 1VF6A 2V4DA 3ASOC 3KZIH 3EFGA 1NH2D 1KD1W 4J9ZB 4PI2A 4M3LA 4EOTA 3CB2A 3MHHC 2AZ2A 1SQBH 1NTMD 3MD0A 1VP7A 1L0ND 4G27B 2K1EA 2X7RB 1Y66A 3OR7C 4Z1MH 1ZP0C 2BTOA 3CRQA 1LTJB 2GUSA 3L71G 4AQYB 3ZN1A 3ASOB 4NXMO 2JVDA 3CRAA 4GOEA 3BY6A 1Q2NA 4BRYB 1R73A 2N9YB 3CX5D 2P1JA 3FWNA 3QO5A 2Q6AA 4DR3O 5AW8B 1IURA 2ADPA 3ABVC 4PDVA 1DTOA 1YI2P 3K5OA 2KYVA 1NTMJ 1TVKB 4JI0B 4C7NB 1L0NJ 3RW0A 4R50A 1K05A 2P7JA 3ZRWB 1VQ4V 2WSEH 1CXZB 3U1CA 3JCUE 3IAYA 3HRNA 1VQ9V 1NR1A 3CD6V 3L70E 4DR7O 1QR9A 5ITZA 4I50B 4IT5A 1L8DA 1ZAUA 1SQBK 3AEDC 3RYHB 2QKSA 3PTZA 4K0KB 4RKUJ 3L35A 4O4JA 5IJ0A 2KG7B 2B9BA 4LFAO 4O4HB 4FK5C 3JSVC 3LW5H 3TSIA 1NAYA 4GUNA 3P32A 3H1KD 2XU6A 2AGAA 4G28B 2BSKB 3SJQC 4DR2O 1FYJA 3LSUA 1LWUC 4CH6A 1P84E 2RQ6A 3SJBC 3VQVA 3FYEB 5AW6B 3SWYA 3H1JE 1J2JB 3EFFK 2GTAA 5JH7A 4LP8A 5KTBA 1HNWB 3V5BA 1QL2A 2D2CD 1I5YA 4LC1A 1WT6A 4JI5O 1IK7A 2JJLA 3IFMA 3L9DA 4LFCB 1SZTA 1DD3A 3W7TA 4EFBA 2YIAA 3K04A 3SGIA 1YIJP 2YS8A 2GSMB 5AVYB 1THZA 3X2QC 3ZHVA 1NTZK 3NTNA 3OW2O 4B86A 2Y0CA 2ZYGA 2EIKC 1JMMA 1GRJA 1JY3O 5KLIC 3L36A 4J9YB 2M0BA 1VQ5V 1L4AD 2PF4E 4NXMB 3T97A 3X2QB 1AILA 5B5EH 2GBOA 5LYJA 2H94A 4MVMA 4BIOA 3U0ZA 1P7GA 1EZVE 2XNDH 5KLIB 1BDCA 1VQPV 1EFRG 4K35A 3Q5PA 2W0FC 4FIPC 3N4XA 4OWFA 3EHBB 1FOSE 5KKZB 3RT3C 2Q9LA 2CK3H 2F4VO 5C39A 5KLVG 4ASVA 1M9NA 1I7FA 4LR3A 3SPGA 4DR7B 1SQGA 2IJIA 2WLLA 5EZYA 4KXRA 1N73C 4YXWG 3TXQA 2FFDA 2FBWC 5GONA 1L1FA 3L73E 2FYUE 4LFAB 1XHXA 1KILE 1BSMA 1U57A 4YHHO 2NRGA 3K57A 3M0DC 4GLXA 4DR2B 5CA3A 5DJTB 1N73B 2M3BA 1JVMA 4O2BA 2QE7G 1G6UA 1CI6A 2UXXA 5KHIA 2ITCC 3E8FA 3CCLP 5L3CA 4OH8B 2W90A 2DWDC 3FFQA 1LNQA 2IU3A 1L0NG 1PIXA 2ZQMA 4FM0A 5B66Z 1Q6HA 3HE5A 1SQPE 3HUSC 5LP6C 4D6TG 2E43A 1M4UA 1ZRTD 2QJYC 3IR9A 4JF7A 3SWFA 1L0LD 3H32A 2WMMA 4DZOA 3D36C 2VQFO 2V1DA 1WMKA 1PP9G 1PV3A 2K9JA 1M56D 5JQGA 4JBZA 3EWKA 2ZIOA 3BA8A 1LT9A 1FXVA 2YC0A 2QJPC 3WU2E 2XAFA 2PYJA 3M8AA 1H2GA 5LP6B 4PELA 1XUQA 2EZPA 4YIOA 3SPJA 2WLJA 3K79A 3K5MA 4DR6B 1NU1G 2QJYB 4GDOA 1GU5A 3WUUA 5KX5A 3JAMN 2QWNB 1J5EO 1DX7A 5FPOA 2BTQA 4QMAA 1S4XA 4X64O 1L0LJ 5JJNB 1LR1A 5LGTA 3OD4A 2QJPB 3I5CA 1VQ4P 1GD2E 3JD0A 1UPGA 2F4VB 3M99B 1VQ9P 4WFAV 3CRRA 3CD6P 4DW0A 1FZBA 1Y8AA 1SVFA 2YIBD 4BIUA 3AEGC 3LDCA 4CS4A 2A45G 1FC2C 1HF9A 3JD4A 5IWAO 4FZ0A 1OCOC 3THOA 4H44D 1JJOA 3ASNB 4ZKUA 4YHHB 1SQQD 2IYPA 3HD7A 3L71E 3C90A 1LT1A 3FX7A 5LHGA 2YI9A 1RE4A 4MW8A 5D5QA 5DM6V 3KCXA 2YDEA 4Y99C 4R4MA 2LXBA 2AXTZ 2ZM6O 2QWPB 1IFJA 2C0XA 3HE4B 1Q81Q 2IJJA 3FWLA 2CH7B 2WT7B 3OE7G 5CHXA 5L3FA 1BE3G 2GA1A 4PD4H 3JATB 1PFIA 1SQQJ 3H1LG 1CW5A 2L35A 3Q3DA 2ZD9A 3QG5A 4Y99B 1MZEA 1Y67A 5CA1A 3LIEA 3OAAG 1V54B 2POHA 3HKEA 1OW7A 2DQ0A 2ILMA 2JDIH 4LF8B 1KB9E 3OMNB 4HZ3A 1PNLA 4PD4I 3RYFA 3RYIA 3QO8A 1OZ0A 3CI9A 3H25A 3DTUB 1SQBG 2FKXA 2UXDO 2ZXEB 1S5LH 4A7PA 2VQFB 3K08A 1GH6A 4X1IB 5IY5C 2PY5A 2Q8VA 4Z1MG 1MNGA 3AE2C 1VQ5P 1LUVA 2LJ2A 4DRXB 4QNHB 3LIDA 3VQWA 1OFCX 3CCJV 1SS1A 5CCGD 3L72D 4IGGA 4JGSA 4FVMA 3JAWB 2H8PC 4PV1D 1KD1Q 3C9IA 1N7SD 1D5AA 1F23A 1QVFO 5LGUA 1J5EB 5E79E 3T2MA 1LP1B 5IY5B 2Q6QA 4DV5O 4X64B 1VQPP 2Y48A 5DN6G 1QQCA 2Q7EA 1NWQA 2EULA 4WCEV 1QL1A 3K5BA 3P8CD 1EZVI 5LL6Y 2E76D 1R3LC 1GK4A 2YI8A 3L72J 4YJ3A 3N7NA 4GCZA 1KZUB 2PP6A 1JA8A 1JCCA 2KS1B 4LCUC 1HVVA 1AQ5A 5IWAB 1J95A 2IJKA 3RGBA 3CCSV 4LGDE 2ZE5A 4YJ2B 5AW9B 1JOYA 3BATA 3HKDA 1RF1C 2CTWA 2ZM6B 3AG7A 3W7XA 4W7YA 5DJUB 2ZDIA 1HW7A 2L5GB 3AEIA 1L0LG 4LF5O 1NZ6A 4X1YB 1QBZA 1ZWIC 3ETDA 2Q7GA 1EN4A 1PGPA 5KLVE 1G1XB 4HBNA 1Y9BA 2N9BA 1RF1B 4TV9A 2CDYA 1YXBA 2W6IG 1SQFA 1SFCC 1HJBA 1A02F 3JASA 1OV9A 1FD9A 1JTHA 3CEIA 2UXDB 1NS1A 2FYZA 4PD4D 3OW2U 4RQFA 2B87B 1SFCB 1R6KA 2WAMA 4ZIBA 5KAIH 3JD2A 4JAUA 1NQTA 1XREA 3K9AA 2XNDG 1EXJA 4DV5B 3WU2Z 4NPEA 3IC9A 4NVPA 1L0NE 3AE7C 1SQPK 1G2CA 2CK3G 2H43A 3ZHSA 2M5AB 1MZFA 3G4SV 1UIXA 4ZOLA 3VMXA 3VTPC 1S2EA 4D6TE 1NKNA 1WNSA 2E74D 1NVPD 2YXLA 4GKJO 3CX5E 5H2FE 3A0BH 4O2AB 3GWOA 1Q6UA 1W0KG 3UM7A 1PP9E 1F7YA 3PJSK 1FJKA 4J10A 3QVNA 2CGNA 3PP5A 4XFJA 1WA8A 3SPCA 1Z5WA 2YEVA 1SP4A 1YJWV 2GV9A 1NU1E 4IIJB 5CMUA 4TUYB 1UJWB 2KK7A 1GL2C 3R66A 5KAFE 3AE6C 1FZEA 3L37A 5J2UA 1H2NA 3Q4HA 2JP3A 1VF7A 2WPDG 3MHSC 5CA0B 2AW9A 1QNMA 5FNVA 4HAMA 4CC6A 4LF5B 3ZRSA 1VQMV 3STZC 5LOVA 2X6CA 1GL2B 2ZXXA 3TGUD 4UVCA 3RK2C 1ZOYC 5AVQB 3BRCA 2ZT9D 1P7BA 1B6QA 2KSEA 1SERA 2EILC 3N2KA 4JAAA 1BCCD 4O4IA 3LDEA 1Q7YW 3TNUB 2ZYAA 2W6BA 3RK2B 1VARA 3I5DA 1Q8IA 4RQEA 4MN4C 3SJAC 2P90A 3CCJP 2GUZA 3TGUJ 2EILB 3KXDA 1IZ3A 5GTHE 4I6MC 1W2BO 4NPDA 5B1BC 3DC5A 3IN6A 1BGYH 1AB3A 1BCCJ 4DV3O 4EB6B 4JQ0D 1BE3E 2PI5A 1Q3EA 4YXDC 3H1LE 3HTKB 1IFDA 2FMLA 1IBKO 2WPRA 5E79Z 4U3JA 5B1BB 1SETA 3KZIE 2YUAA 2PAJA 4GKJB 1F4NA 1SQBE 2B1GA 1NJIW 3RL0D 4ZHQB 3MUDA 1OW6A 1COWG 1N0NA 3TYYA 3H9VA 1KUQA 1AI6A 1SRYA 3CCSP 4FLUA 2JGDA 4E4EA 2YIBA 2JJ2G 3AE1C 1F51A 3ZHQA 1MMMA 1I08A 1M90Q 2AHZA 1QLED 5KJ7A 1RP3B 2BOCC 2L91A 3JSNA 3CWBD 3GHGC 1IXBA 1N7LA 2HFEC 3EVKA 1U97A 2WSFH 3K9SA 5L3EA 2Y9ZA 2KSJA 2YNYA 2JDIG 2W6JH 1WJZA 2QJ1A 1IO4A 3GHGB 3SWKA 4H13D 1JY3P 4IFDK 5CBGA 1MSWD 5K5GB 5GW7A 3CWBJ 1KP3A 3K0GA 4FMTA 4MSWC 3E1RA 1W59A 1X59A 1YBKA 1OHHG 3D6ZA 4RJTA 4FLTA 4KHPO 1MSDA 1M57C 1PL4A 3K58A 5CB4B 1QVFU 1NTMH 4DV3B 1OVVA 1MA1A 4WWIA 2OTKE 2V7QH 4NTWA 3C3TA 5AVXB 4J80A 4X62O 1Z5VA 3MIWA 3G4SP 3U1AA 2M6YA 5J2TB 1M1JB 1N7SA 4Y28J 4C7RA 1IBKB 3QNEA 1VF5D 4DCKA 2ARHA 4N23A 1QVGO 1M57B 1BGYD 1EN5A 5AW1B 2DOSA 2O01N 4KT0J 3T4DA 4DT0A 2QSIA 3OFNG 1EXIA 1PPJH 3J80N 3TK1A 5ITZB 4MVSA 2DN9A 3JYCA 5B3SC 1KILB 2RMZA 3CX5I 1YJWP 4LF7O 2Q5ZA 2UWJE 5H2FZ 3ABKC 3NMDA 1OWAA 4O4JB 5IJ0B 5B5EE 1DF4A 4H0LC 1ZSPA 3BCCH 2UUBO 1NTMK 1BGYJ 1HBWA 1L0NK 1LTSC 4F6RA 3K5NA 1SLQA 5EIBC 3T4ZA 3TJTA 2DW3A 4UB8H 5B3SB 1IXMA 4MVRA 2P67A 1HGZA 2Q0AA 3G67A 3ABKB 2P6JA 5KAFZ 4WY4A 4H0LB 3H1KH 5CBNA 2D3OW 2PTMA 1SA0A 3RK3C 4TLFA 3D3QA 5JH7B 4JI7O 4BR6A 5IYCO 2OGUA 4RAIA 2Q68A 3IAOA 4W80A 2B89A 4QPKA 3UKMA 3MHVA 2OCCC 2N1TC 3H01A 1HP8A 1VQNV 2A7WA 1DD4A 1ORQC 1R3JC 1H2KA 2HODA 3MZWB 4AI8A 3ETGA 1LTAC 2HP8A 1KECA 1FZAA 2JWDA 5CBOA 3F7YC 3ZRXA 2MW2B 4WBNB 3H1ID 2NZ2A 4WFFA 2WZ7A 1WPBA 4KHPB 2OCCB 2N1TB 3GWKC 3JD3A 2QEXV 5M1BA 4W7ZA 2RNBA 2NN4A 1E79H 4PJ0H 4AYCA 1NH4A 2DWEC 3VOUA 5CBHA 3T97B 4X62B 3L74H 5LYJB 1YQ4C 4QIWF 3LNNA 5GTHZ 2WSFJ 4L74A 3DXRA 4L87A 2CPBA 2HG5D 4DO2A 2RN0A 3CCEV 1JY2O 1FZCA 4NTYA 1Z2GA 2FFDC 1QLNA 1KTMA 3E22A 5BR8O 3CHXA 4KFMA 2QM4A 1HR0O 3BRVB 2BEZF 3BEHA 3WMM0 2KSDA 1Y4MA 1EZJA 1CP9A 3AEFC 2F93B 3B5ND 5AVTB 5GTIZ 2OIGA 4UB6Z 2XOKG 1XDCA 3CMAV 4LF7B 1NKZB 2JEEA 3P8MC 3WG7C 4N3YB 2JS3A 2QSAA 2FFDB 4DV7O 1AA0A 2O1KA 1RQUA 3TDKA 2UUBB 4D7TA 2IU0A 3V2PA 3IC7A 1Q43A 4JF3A 1PPJD 1WB7A 3HPLC 2K1AA 2WA3A 3AK1A 2V7QJ 5CCHD 3H6PA 1SESA 2ZAEB 3DGEA 3WG7B 3SPIA 3FB8C 4FM2A 2R3CA 3D8CA 2WPSA 3ABUA 1M8OB 3BCCD 1FXKA 5KHHA 2QWRB 4JI6O 4DUZO 5C93A 4JI7B 3CC4V 2KNCA 4I7ZC 3KQGA 1JY3N 1ZL8A 1GN3A 4IFFA 3HE5B 2UUCO 2UXCO 1LT9C 4OGQC 2HPCB 1CSBA 4ZKPA 1ZR4A 4PDRA 3BCCJ 4I7ZB 1ZLLA 3H32B 1OVUA 3WUVA 4FFBA 3V4QA 2K9JB 3V4WA 5JQGB 4DV1B 1HGVA 4I1LA 4OGQB 1LT9B 1BGYG 1W2BU 4B7EA 1L0LH 3HKBA 4PD4E 2YO2A 1P84F 3D3IA 5TISZ 1LWUB 3H1KJ 1JR9A 4AUWA 3ABTA 1M7LA 1X4TA 1W2EA 1I0HA 3G80A 3R4YA 1AVYA 2UXNA 1SS3A 1IC2A 3APQA 4DV0O 3KDPB 3LUTB 4LNUA 3PLNA 4D7SA 5AVRB 2AEFA 5BR8B 1S5LE 2GHYA 3BVHA 3N2GA 1HR0B 1YDXA 3L74D 4RO2A 1GW3A 1NTKD 2YSUB 2WWWA 3BRTB 1S9KD 3HD7C 5B1AC 3GW6A 4IL6H 3OMIB 4UCVA 1RE4C 4JTAB 3VN0A 2E75C 2K37A 5EFWB 4DV7B 4FLWA 4DR3B 3CXHH 2Y4TA 1L0LK 2EIKB 4N21A 1NJIQ 4A5UB 3II6A 4HYTB 4I2LC 1FE6A 1MFZA 4MS2A 3HD7B 5B1AB 1GK9A 1NT2B 1YTZI 3L74J 1K8AQ 3OT7A 1NTKJ 5B5EZ 2E75B 3CXHI 1KYOH 2K9YA 4YIPA 1JQ0A 2EJRA 1SQQH 3A8TA 4P2ZA 5LMNO 5AW2B 2OCHA 3W7SA 3ZJZA 3CCRV 3C8VA 2IPPA 1GTOA 4PA3A 4GKGA 3CLQA 4JI6B 3OJAB 2XUMA 4DUZB 4K8ZA 2W6JG 1FOSF 3MTUE 4DV4O 1R3KC 5LA6B 2CE4A 4FLYA 2JS5A 2P5OA 1CEZA 1HJ0A 1KYOI 3FYIB 1URQD 3JAKA 1DIPA 1XOUA 2WQYC 5KUMA 4Z2WA 3CXCU 2XHBA 2UUCB 2UXCB 3ZHUA 1VQNP 4DK1A 4KHXA 2NLJC 3RYFB 3RYIB 3IJ4A 4JI1O 3C1LA 1EBOA 5IYBO 2ZVOB 1SQXD 3SYAA 3RYCA 1OMIA 2Q73A 2QEXP 4TQDA 3UIAA 2K9PA 3PN1A 1NTMG 4N78D 1NH2B 1OX3A 2P22C 1SQQK 2V7QG 3QF7A 4U7OA 3IFXA 5FLXN 5K1PA 1K9MW 4JI5B 4C7NA 4L75A 1T6AA 4MVUA 2HJDA 5B1OA 1HTLC 3CCEP 3L72H 4FM1A 2R9IA 4IOIH 1QCEA 2FL4A 3UQ8A 3G71V 4DV0B 1SQXJ 1M1KQ 2LP7A 4I50A 1QVGU 2OQQA 1PD3A 1MZ9A 3SR2C 3RYHA 5JJEB 1PPJG 3RK3E 2C9LY 1X8YA 1RF0C 1KBHA 3HUSB 4YJ3B 3CMAP 1IX9A 1H2SB 2WPQA 5KAIE 2Q4PA 5IT9N 2UU9O 4UUJC 2MJZA 3BCCG 2BSKA 1ZN5A 3ICXA 2AXCA 2Z5HA 4GOFA 3N27A 2PI4A 2ZDIC 1VQOV 1YTFB 2EINC 1F4MA 5APVA 1D2DA 4MTOA 2Y69C 2YKOA 1U7MA 3CCQV 4NR1A 2PUSA 4NXNO 3P3PA 5LMNB 3CXHD 3H1KG 5FPRA 4UV9A 1SQVD 2R3SA 3AG4C 1TAEA 2VS0A 3CC7V 1HNXO 5H5NA 3A0BE 3CC4P 5AVVB 2D2CC 3J81N 4DV4B 3JCUZ 4YY3O 5BU5A 3JD1A 3BA9A 4ZKIA 1YYCA 4ZBMA 5BMVB 2WVRA 1Y74A 1KYOD 4ZI7A 3JCZA 5KJ7D 5APYA 3BFRA 4WFHA 3ZMZA 3AG4B 3CJHA 3JASB 2K88A 2DYSC 4X8AA 3ZIAG 3KKYA 3O65A 3H1HH 5IYDO 5FL7G 1JTHB 1SQVJ 4JI1B 4CPGA 1VMGA 2ZNIA 1N8RW 4LF6O 2R44A 2XDJA 1VL2A 1OCOB 1L4AC 1FDIA 2AXTH 1E79G 2DYSB 3OA7A 1YSCA 4U3FH 2OYHC 3AG3C 3L74G 1T2KD 1S72V 4HNAB 1L4AB 4X1KA 1JCHA 2NR5A 4I55B 1JFFA 1RHZB 3D70A 2Q69A 1G2CB 1ZMEC 2OYHB 1AQTA 2VRSA 1XQ8A 2ZR2A 3AG3B 3S3XA 4UCRA 4ZOLB 2WLIA 2OYIA 1KB9F 1XNQO 4R8CA 3VMZA 2ZYDA 5IDJA 2XT9A 4UCUA 2UU9B 3ZHRA 2NPSD 4FLXA 3JALB 2O3JA 3B2EE 1HNZO 1IBMO 3E86A 3K06A 2PRRA 1BGYE 3B5NA 4QE7A 4AQRD 1VQLV 2YEVB 1EC5A 2A0LA 1OXZA 3ABMC 2EIMC 1S77D 1N86A 2Q1KA 1B04A 1R5SA 2A06H 4NXNB 3Q4HB 3CCRP 2CTQA 3LSQA 5CCHA 1HNXB 2LGWA 5LBQA 2F1MA 4H33A 4MT8A 1YVWA 2WSSH 5D5PA 4YY3B 5L8RJ 3I55V 1SQXG 3ABMB 1N2DC 2EIMB 1VQKV 1IDSA 1T3UA 1RY3A 2ZVNB 1AI4A 4CS3A 1OIPA 3QWOC 4BAYA 3N2KB 3TGUH 4WY4D 2YICA 4O4IB 4WFGA 1M56C 5LP6A 1T8ZA 2LXCB 4LF6B 1TUBA 1PM9A 1JCDA 1S0VA 2Q5UA 1BCCH 3O6QA 2GUZB 4EIJA 2HR3A 3EXAA 3M7MX 3H1HD 3L70D 1M56B 1SKVA 1Q82W 4I5SA 2YMYA 1NBMG 1USEA 1HWYA 2LO1A 3G71P 1ZLZA 3O9OA 1BQ0A 4JV5O 3MUDC 4U3FD 2M3EA 5JVDA 1BHAA 4U3JB 4UV8A 3A5TA 5HFLA 1DEBA 1XNQB 3L70J 3H1HJ 3VMYA 4QPJA 4JI8O 1K92A 1SF9A 1GU4A 1P84D 2NNUA 4I9WA 2DJVA 4X20A 2KLVA 2M8RA 2QGNA 3IF4A 3Q5SA 1HNZB 3L75H 3H1JD 4H44C 2Q3EA 2OWOA 2FYNC 2W27A 5LXTB 1NTME 1VQOP 3V6IA 1B3QA 4JYBA 4U3FJ 3HE4A 5KAIZ 2C2AA 2WT7A 4GYCB 2G8YA 3CCQP 2LW7A 1CPYA 1SQQG 1GN4A 3OAKA 4NYKA 1R1BA 3PRJA 3ZRVA 4K8XA 4HH2A 2FYNB 3UO3A 3ZDMA 3H1JJ 3SDLA 3V2NA 2HJFC 3B09A 1PPJE 3AE3C 1XL6A 2SPZA 1Y76B 1AJYA 1AVMA 2A06D 1WLEA 1XNRO 2AEMA 3ITKA 3CWBH 4EYYQ 1RE3A 4CH3A 2XNXA 1KMIZ 1I5XA 1RSOB 2WPVB 3GVMA 1LTTC 3BCCE 1URQA 4GX1A 3FXEA 1I94O 4JPRA 2KQXA 4B3TO 4UB8E 1OZHA 4B08A 4RUEA 5CCGC 1ZR2A 4C7UA 1LP1A 4C46A 4PV1C 4H37A 1N7SC 4GT1A 2BEQD 4I4TA 2HHHO 3H1KE 3UO2A 1S72P 3RFRA 4J7JA 1JY2P 3AG2C 5IJ9A 4G2KA 3HB3B 3L72G 5K1XA 4PHZA 2YKPA 3L73D 2YMKA 1JMBA 2FYUD 1Q6IA 4PV1B 1KILD 1RFYA 4JV5B 1N7SB 2EX3A 1IFMA 2E76C 5BY1A 1K9MQ 1V55C 3A0HH 3UT5B 2LFRA 1QX8A 4LWSA 3SYCA 2KS1A 5BVZA 1PV0A 1N33O 1IZNB 2HYNA 1YEWA 4JI8B 1H0TA 2B88A 5JCOA 2E5LO 2BASA 1Y6XA 5KMGB 4BXLA 2YO3A 1E1QG 2KUBA 1AV1A 2O01H 1KB9H 3L73J 2E76B 3CP1A 5APXA 1Z56A 1VQLP 2FXOA 2FYUJ 1V55B 2GDSA 3B8MA 2ZFCA 1SC5B 3G6EV 4PJ0E 1FFXB 4NKGB 2DE0X 1YZBA 2WSCJ 5KA5A 4XDJA 2P58A 1H2MA 4JTDB 3ZBHA 3L74E 3F7VC 4F6EA 2WITA 1S9KE 4PA9A 3E8GA 1U96A 3T1CA 4X1YA 2KZJA 4F6RB 3F89A 3L75D 1MG1A 2YIUC 1NGMB 2OTLV 4HKZH 3I55P 2Y4UA 1VQKP 5AVSB 4EI2A 4TT3H 1XILA 5CN0A 2IZ0A 1SA0B 1XNRB 2W6AA 4EKWA 1H38A 1XTCC 1G8MA 5DEDA 2EIJC 5EYPA 1FZFA 2BCCH 3G6BA 1AVOA 3H1HG 2RDCA 2JRIA 3L75J 3AECC 1ZV8A 3STLC 3GB7C 1I94B 4B3TB 2W8ZA 2ZNJA 3U10A 2HODB 1VIBA 2XKMA 2EIJB 4U3FG 2ZR3A 4J7ZA 4UCTA 4UVBA 2LKMA 1VF6C 3CCUV 3E83A 2HHHB 3JARA 4MW3A 4UCOA 1URFA 1LTIC 1N8RQ 2FXMA 1FZCC 1P49A 3H1IH 4HJGH 4X89A 3ZEDA 1JPXA 1AFOA 2ADQB 1PNKA 3M0AA 3GF3A 2C9NY 2Y0DA 5H6QA 3NFQA 4O2AA 4NTXA 1OCZC 2R5BA 5A2QN 2E74C 2F95B 4PA6A 4ZNCA 4BWAA 1N33B 5AW3B 1EQ7A 1FZCB 2I8DA 2Z0AA 1MABG 3CCMV 5L3GA 3E22B 2E5LB 3WB0A 2JGUA 3CE2A 1FPOA 4L8JA 5IYZA 4AILC 1ZRTE 4TUYA 3M9QA 4FPPA 2LQTA 3ETEA 1KQLA 5A9GA 1L0LE 1OCZB 2E74B 1NVPB 5H6RA 2Q7CA 2R70A 1EDJA 1E1RG 5CA0A 2NPSA 2E3CA 2A06G 1AR4A 1FXKC 4GODA 3AE9C 1X22A 2XAJA 3RBXA 1KB9D 1R6TA 2DQ3A 1GL2A 1G1JA 4YPCA 4IHJA 1ZXGA 2FB5A 1W0JG 4MVQA 1NKDA 2WSSG 2QA4V 2M7WA 1LJ2A 2ZIMA 2Q9IA 2X6AA 1W5CE 1QR8A 1FXKB 4IL6E 3KPEA 2ZT9C 1AP6A 2OYQA 3FAVA 2YIDA 2YXYA 3SJCC 2KNCB 1MFTA 1HDJA 4TV8A 3TGUG 2O01J 2R72A 3CXHE 2N05A 3E8HA 2JO1A 4EFEA 3JC22 4X88A 1JEKA 3OM3B 1GW4A 2FKWB 1J1EC 2OARA 2YKQA 3Q2YA 2EZOA 1K33A 1YITV 1H2LA 2ZT9B 1BCCG 3K5LA 1VQMP 5KA6A 4YTPC 1B06A 1KYOE 2BCCD 5L3BA 3F5HA 4EB6A 3W7UA 1S76D 1SQQE 4FFBB 1JY2N 4KP4A 3OEHG 4UCSA 2J5UA 2QKAA 5KHKA 4WVZA 1J1EB 4DXWA 3HTKA 4UB8Z 4GIFA 3HKBB 2P4KA 2IFNA 2QIWA 1HWTC 2B1IA 1OJHA 4GZRB 2DYRC 4O9BA 1KQSU 2P7TC 4U7JA 1K73W 3RK3B 2Q0OC 3FB6C 2BCCJ 1QEXA 4EEQA 4CS2A 3A3YB 3RL0C 2ZCEA 3N2GB 3M9HA 2J58A 3L75G 1FFTB 2DYRB 2JJ1G 4RUFA 3ZMTA 2LR2A 1Q81W 4DV2O 1K5SA 3FB7C 4JYAO 3G6EP 3HR0A 1ZTEA 5KLVD 2QG4A 3Q5RA 1NTKH 1N34O 1EM1A 2X6BA 2YXQB 3D6YA 4JI3O 1KFMA 1XTGB 1N0JA 5AVZB 2H7HA 1WN7A 2W83C 1QLEC 1YHQV 3L72E 3H1IJ 1IFNA 4EDFA 3G3ZA 1SZXA 2QTOA 3HKCA 3OR6C 3RGUA 2OTLP 1GM7A 1A02J 3ABLC 1BSHA 4PA4A 3E8BA 4O4LA 1FDMA 4WF9V 5LGNA 3TETA 1HNWO 5KLVJ 3KZIZ 2WLLB 5EZYB 1QLEB 3CWBG 2PGDA 1X79B 5GONB 4LFCO 2ZE7A 2Z3YA 2FXPA 3P8CE 4H13C 4OVNF 3ABLB 1XI1A 5GTIH 4UB6H 3JAKB 2ZJSE 3ZMUA 1K3EA 3CMEV 1RH5B 2CPSA 1G4YB 2H89C 1NTKK 2BE3A 3VP9A 4O2BB 2H3OA 1MV8A 3A7OA 1CI6B 3ZMVA 5CB4A 2A3QA 4H13B 3CCUP 1GMGA 4D6TD 3RYCB 1OCCC 2MK3A 3WB2A 5LHIA 2KZIA 1O9HA 1PGQA 5J2TA 1USDA 1M1JA 3M9BA 4JI4O 1PP9D 1SQXH 1QU7A 2R5DA 2WLNA 1BHBA 1VF5C 4JYYA 1D7MA 2W0XA 1OVRA 1NI8A 1Q90D 5JJJB 1CZQA 1R3IC 4KL1A 1OCCB 1MOFA 2KKWA 1FDOA 1NU1D 2UUAO 5C8YA 4D6TJ 3H1HE 3CCMP 4HB1A 4R7CA 2IW5A 4UVAA 2FTKA 1KILA 4DR4O 2CUGA 3BHPA 5AW0B 1Q7YQ 2H88C 1VF5B 1YTFD 1AR5A 1PP9J 4PDMA 1S5HC 4MTXA 4DV2B 4JYAB 1KORA 2AXTE 1NTZH 1QHTA 3OUFA 2RJZA 4U3FE 1GTWA 2DW4A 3BAAA 1TUEB 1NR7A 1YF2A 3GLMA 1N34B 2CGOA 1BL8A 5KX5B 2CTRA 4FZ1A 4JI3B 2BTQB 1KC8W 1NU1J 2R32A 3S3WA 3K0DA 1SQXK 4X9QA 5TISH 3CC2V 4PD4F 5LMUO 2QA4P 1WP8A 2KXPB 2VWKA 3WFVA 1ZUQA 4TT3G 1H8AA 5L3DA 1Y47A 3AK3A 1KQFB 2BCCG 4KUMA 1FZGA 3RBZA 1SQVH 3FD9A 2AZ0A 1PL5A 1N36O 3S1KA 1BMFG 1Y74B 3LSSA 4ZI7B 2IDBA 3F5TA 4I0XA 4DW1A 1BE3D 1YITP 4IL6Z 2FY8A 4WBNA 1T3JA 3CJHB 3K03A 3E2EA 3B71A 5AW5B 2IJHA 3H1LD 4IFMA 4P30A 2P06A 2N1TA 2AEJA 3P3NA 2A06E 4FJCC 3E89A 2WTYA 2I1KA 5KKZC 2LGQA 4DR6O 3BPZA 4BW9A 2JEXA 3TF5A 1SQBD 2ODMA 3H1IG 4JI4B 2YXRB 1BE3J 3FKSG 5EBWC 3K59A 5AVWB 1JO5A 2HG5C 5CA1B 1OW8A 2OYIC 3H1LJ 3HKEB 3CCVV 4X1KB 1KFNA 2KB1A 2UUAB 1SQVK 2E42A 1ZX3A 3DC6A 1LTJA 1JFFB 2G3AA 3TGUE 4DR4B 1GMJA 4BRYA 1K04A 1SQBJ 3V2QA 3U11A 1UFIA 2WLIB 3B5NC 3RL0g 3CSXA 2OYIB 2H8PD 1BCCE 2Q67A 3LDDA 1VEWA 1MKMA 3RWRD 3FX0A 3B8NA 4P9PA 2IBZH 1S3JA 1TVKA 1DH3A 2ETNA 4B3SO 1YCIA 4GX5A 3CRCA 3ZRWA 1RM1C 5J9PC 1KKCA 3MP7B 1FAVA 3ZN0A 1ZW0A 1YHQP 2QTSA 4MVZA 2ZINA 1HH0A 3B5NB 1DGSA 5B66H 5CCHC 5LMUB 2X0LA 2PZSA 2IBZI 1NTZD 2Z5IA 1YJ9V 1EN6A 4DOJA 2WSEJ 3OTOO 1FU1A 1BT8A 1RM1B 2KG7A 4MTGA 1H8HG 3ML0A 2KOGA 2HKOA 2J59M 5CJ0A 4O4HA 1K4CC 2Y0EA 1GKFA 3B8EB 2P10A 3B77A 4MTFA 1JM0A 2HPCA 3NXSA 1XL4A 4J41A 4DR5O 2JEUA 4LF8O 3L75E 2KLUA 1N36B 1VQ8V 1ROPA 3CMEP 4WFEA 1NTZJ 2VQEO 3LW5J 4J7KA 4TQFA 3VYIA 1FS0G 1IFIA 3VOPA 2BOBC 3E7KA 3HKDB 2L6LA 1NOHA 3CS5A 3OGIB 1TUBB 5F2VO 3B40A 4MVOA 1PGOA 1LWUA 2F66C 2OTJV 5EBLC 1FAFA 3CL3D 2EINB 1SFCD 2MKVA 3O6QB 5KUKA 2Y69B 1N4CA 4TV9B 2KB7P 2ITDC 2RKLA 4IL6X 1NO4A 4J11A 5APTA 3JCUH 3M91A 3CWBE 3WUTA 3SYQA 1K5QA 2Y9YA 3L70H 2D2CB 3ASNC 1FKAO 2JKVA 4ASWA 1JX9A 5JVDB 5HFMA 4LH6A 2PFXA 1LTGC 3GF7A 4RO0A 2B5UA 1JB0J 2JK5C 1K73Q 1M90W 3ZX6A 4X20B 2IH1C 3R65A 3UCSC 1NTKG 4B3SB 4X65O 1PGJA 1P4RA 5TJHA 5EK0A 1DK1A 1K97A 2EJ7A 1P84H 3EQ2A 2N74A 1R8EA 3CC2P 3O8ZA 1GM9A 3W67A 3VP8A 1R5LA 1V54C 3H1JH 1DF5A 1XBLA 2Z5UA 2IBZD 1H89A 3OTOB 1AI7A 5LA6A 4DUYO 3A0HE 2P2UA 1P84I 3GG2A 4NB5A 1Q86W 1RE3C 3OUSA 4B3RO 2OIEA 1VQ6V 4BW5A 1S5LZ 4WFBV 4E2LA 2HVJC 1URQC 1YJNV 5JWPA 4LFBO 4DR5B 1N73A 1WA8B 3ZCCA 5CMZA 3P30A 1GL2D 3CPWO 1VPCA 2VQEB 3SYPA 4JPZB 3W68A 4TWKA 2C0WA 3FXDA 1RPRA 1EDIA 3M06A 2Y0PA 3SFDC 2KI7B 5J2UB 4PA7A 1R6NA 4QJFB 1URQB 3M0DA 1A32A 1V9PA 1DEEG 5FNVB 3I56V 3RK2D 5LOVB 1EZVH 3T1HO 4XDLA 3AG1C 4I4TB 3CCVP 5IJ9B 1AR1B 1M5IA 2HLDG 5JCOC 2BCCE 4W4KA 2ZKOA 1U7JA 3AEEC 2F43G 3HUSA 3FB5C 3P7KA 3AG1B 4JYCA 3GMAA 5BU8B 4TSFG 4F4LA 3AEBC 3L73H 4GKKO 2QWQB 1FXHA 1NAFA 4ZMDA 2FYUH 3D36A 4LWSB 4OXSA 5EC2C 1NTZG 5AW4B 5AW7B 1O9GA 4QE9A 1XHZA 4FLVA 1H0TB 2WSCH 4R6ZA 4ABMA 1KQGB 3VBBA 1RF0A 4XDKA 4X65B 1K34A 3RN4A 2B9ZA 3G9RA 2UXBO 2N04A 3T1YO 3H1IE 3VQYA 1KQSO 1S1CX 4K3AA 1YJ9P 2YXHA 3PHLA 2XASA 2XZRA 2RN9A 2QRXA 4DUYB 1KC8Q 4BWNA 4QGPA 3RVZA 4B3RB 3AK2A 5BMVA 2CTPA 1SQPH 4UXNA 4JTCB 4R4LA 1QGKB 1IBMB 4LFBB 1SQVG 4JASA 1FJGO 2FYUK 1VQ8P 2QVAA 5KJ7C 1H8EG 3ZHTA 1NYHA 1EDLA 3A0RA 2WA4A 2JGDB 4B3MO 5EYPB 2CH7A 3FGAD 3WU2H 1H88A 2IM9A 2LW1A 4WBAA 2OYOA 1AJNA 4H44B 4CBCA 3JATA 3CC7P 4CZZA 1BQZA 3KCYA 2HFED 2IYOA 2KP8A 2G38A 2OTJP 1S5LX 2WLMA 3T1HB 1XEQA 1T2KC 4HNAA 1L4AA 1JNMA 3JARB 4I55A 4ASUG 3CX5F 1XMOO 1N32O 2IX7C 2OYHA 3A0BZ 4X1IA 2QWOB 4XE5B 1JOCA 2QM7A 4WB4A 2ZXWC 4IYHA 4DRXA 5EBMC 1EZVD 1DLBA 4W4LA 3OMAB 3SFEC 3JAWA 4GKKB 1IVSA 3J7AU 3JALA 4L76A 2QDOA 1FS0E 1NVOA 4LF4O 1M57D 1E5WA 1GAXA 2IBZG 2NPSC 2ZXWB 3L71H 4XA4A 1ENVA 3B4SA 5IYZB 1G1IA 4DV6O 3VQXA 2UXBB 2RH0A 4ICGA 1LTBC 3T1YB 1WPXA 2R9AA 1BSNA 2RMKB 3DSQA 3AE5C 1WP7A 3CYOA 2NPSB 4RESB 3JSLA 3AG2B 4UFZA 2AHYA 2CAZC 4BIZA 5KHJA 4IHJB 1VQ6P 1VDFA 1KP2A 1YJNP 4Z1VA 1X0TA 3E1IA 5APSA 4YJ2A 2QJKC 3A2AA 1FJGB 3TCUA 4DYLA 2WLKA 1EDKA 3ZMSA 3A0HZ 1AJQA 1KU9A 4H0LD 3FAVB 1XMQO 4B3MB 2HVKC 4WY4C 4TV8B 5EIBD 1NTKE 1SQPD 3ZS8C 1KB9I 3BABA 2QJKB 1VQ7V 2KIKA 1J1DC 3I56P 1RF1A 5E79H 2ZE8A
chains in the Genus database with same CATH topology
2D2CB 1WMKA 2IDBA 1PV3A 3Q5RA 3EWKA 1ZOYC 3D6YA 3B71A 3AE3C 2V7QJ 2QJPC 3GF7A 2ZT9D 4R4LA 4Y28J 1AJYA 1VF5D 1JB0J 1OMIA 1RQVA 4GDOA 3GF3A 3AE4C 1KMIZ 5KKZC 4KT0J 1NYHA 2E74C 2WPVB 2QSIA 2D2CD 3FGAD 1EXIA 4I7ZC 1IK7A 1R8EA 1DD3A 2E75D 1OW8A 4H44B 1ZRTE 2FXPA 4OGQC 4PV1C 4H13C 2OQQA 3IN6A 2E74B 1S5LX 2BEQD 4H0LC 3RK3E 2G3AA 1Y9BA 4YXDC 2H89C 4I7ZB 5L8RJ 5KLIC 1GMJA 1K04A 3AEGC 3AE9C 3RL0g 2YMKA 3S9OA 1HF9A 4OGQB 4PV1B 1YQ3C 4H13B 4H44D 1MKMA 2E76C 4H0LB 3D71A 3AE8C 3SFEC 3Q1MA 3AEAC 4R4MA 1OW6A 3Q5PA 3SFDC 3R4YA 2ZT9C 1VF5C 3IAOA 1Q90D 3O6QA 2E76B 2WSEJ 2O01J 1FDOA 2JO1A 1DD4A 1EXJA 2WSCJ 2D2CC 3AE1C 3Q2YA 3Q3DA 3AE7C 1TU3F 2FBWC 2ZT9B 2P10A 1ZP0C 4Z1MH 2H88C 2NZ2A 1VF5B 1OW7A 1UIXA 3AE5C 4YTPC 1KILE 2E75C 1KORA 2YIUC 1U57A 3H25A 1NGMB 5M1BA 2E74D 2J5UA 3AEEC 3GLMA 3LW5J 3ABVC 3T97B 3GMAA 1YQ4C 2WSFJ 3AE2C 4TT3H 3AEBC 1VL2A 2QIWA 1K05A 4XFJA 2QJKC 2E75B 3Q5SA 4OGQD 4PV1D 2K9YA 1FDIA 4H13D 4U7JA 4H44C 1KQGB 4H0LD 3C8VA 1KTMA 2FYNC 1PIXA 2BEZF 3AE6C 3AECC 3G9RA 2MKVA 3AEDC 2JP3A 4RKUJ 2G8YA 3AEFC 1HJ0A 3D6ZA 1DIPA 1S1CX 1KQFB 2WQYC 4IL6X 3D70A 2QJYC 2E76D 1ZMEC 1RQUA 1PL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  2D2C B;  2WSF J;  2QIW A;  2E74 B;  1S5L X;  1Q90 D;  2E76 B;  2E75 B;  2QJK C;  2QJP C;  2WSE J;  2O01 J;  4Y28 J;  2K9Y A;  4I7Z B;  1JB0 J;  5L8R J;  5KLI C;  2WSC J;  3C8V A;  2FYN C;  5KKZ C;  2ZT9 B;  4OGQ B;  4PV1 B;  4KT0 J;  4H13 B;  1VF5 B;  2WPV B;  2QSI A;  4RKU J;  4H0L B;  2YIU C;  4IL6 X;  2QJY C;  3LW5 J;  4H44 B; 
#chains in the Genus database with same CATH topology
 2VWJ A;  4X66 O;  1FBM A;  4LBE C;  2E5Y A;  3E35 A;  3RK3 D;  1LUW A;  4OPA A;  2IFM A;  4WY4 B;  2P4V A;  3SYO A;  3K3W A;  1BS3 A;  1XMO B;  1N32 B;  4GX0 A;  1J1D B;  2YIU B;  1SQP J;  1PZQ A;  1GN2 A;  3OGC C;  3C3S A;  3L70 G;  2N1T D;  3AE4 C;  2B87 A;  1SFC A;  2PYL A;  1S5J A;  5GTI E;  4UB6 E;  2HEP A;  1BZK A;  4PDL A;  5BXZ A;  4Q6G A;  3V2R A;  1IBL O;  3U59 A;  2GM4 A;  5KHG A;  1IK9 A;  4IYI A;  4LF4 B;  2QM8 A;  1Q5O A;  1MUU A;  5LXT A;  1K8A W;  4LF9 O;  4JI2 O;  1WRG A;  1D5N A;  4DV6 B;  2M5A A;  4XBF A;  1ARO P;  4AHC A;  1BDD A;  1YI2 V;  4JZG A;  1SQX E;  1KKD A;  3H1J G;  1UII A;  3DXR B;  3KHU A;  3L71 D;  4PI0 A;  4N78 E;  1IJD B;  4DR1 O;  2QKC A;  4LLH A;  5KLV H;  3AE8 C;  1TGO A;  1Y76 A;  3Q1M A;  3HKC B;  2XV5 A;  3AEA C;  4JAV A;  5B1N A;  3BVO A;  1WB8 A;  1HUC A;  5AVU B;  3QO7 A;  4O4L B;  4YXW H;  4IIJ A;  4RWU A;  4CH5 A;  1AI5 A;  1GK6 A;  5CJ4 A;  2JWA A;  1RSO A;  2LFS A;  3KG2 A;  4JZ2 A;  2RCV A;  1NTZ E;  1XMQ B;  2VRZ A;  3L71 J;  1Q86 Q;  3IGA C;  3CPW U;  4DK0 A;  3CRM A;  4P9O A;  1YTZ T;  1TU3 F;  4OX9 O;  1KV4 A;  2QE7 H;  2IH3 C;  5TIS E;  1M1J C;  1KN7 A;  4FLZ A;  2K3R A;  4DJG A;  2PGG A;  5CBF A;  1GN6 A;  2A9H A;  1IFP A;  4X66 B;  1X9V A;  1EZV G;  4J42 A;  1M1K W;  1OCR C;  2I1J A;  5KLV K;  3USS A;  2Q3I A;  1L0N H;  1RPO A;  5CCG A;  3QH9 A;  2DMX A;  3TNU A;  4TOI A;  5IE9 A;  2QR4 A;  1NHL A;  2GUV A;  5DEC A;  4OGQ D;  3LNM B;  4D6T H;  1KIL C;  1AP5 A;  1ZL8 B;  3A2F A;  4CH4 A;  3UT5 A;  2ZE6 A;  1YIJ V;  1SQV E;  2E5T A;  5APU A;  1OCR B;  2F23 A;  4B7K A;  1GO3 F;  3CX5 H;  5H2F H;  4GX2 A;  1AJP A;  1L2P A;  3QTC A;  5KMG A;  5APW A;  3L73 G;  2A79 B;  1PP9 H;  3NR7 A;  1IBL B;  2FYU G;  3PH0 A;  1US6 A;  3W7W A;  2JIZ G;  5E1A C;  5C8Y B;  2HLO A;  3CXH F;  2O57 A;  4NPF X;  4AQY O;  1WAZ A;  4LF9 B;  4LH7 A;  1FFX A;  4JI2 B;  1NU1 H;  3MDS A;  4L73 A;  5KAF H;  5APQ A;  4N6J A;  1M93 A;  1GDT A;  3KYQ A;  1TA8 A;  3BAS A;  1KYO F;  2ATK C;  5LHH A;  4JI0 O;  2Q7H A;  5EC1 C;  2XAG A;  3APO A;  1JJ2 U;  4I9Q A;  1PL0 A;  1K4D C;  1RQV A;  2XAH A;  3RVY A;  4DR1 B;  5AG2 A;  4FFK A;  4CC5 A;  2GTS A;  3TXS A;  4ZHQ A;  1GZL A;  1Q82 Q;  4LNU B;  4U7N A;  5BZB A;  3MAQ A;  2O1J A;  4KJM A;  1SQP G;  3OTF A;  3HD7 D;  4K0K O;  1GM8 A;  3L4F A;  1LGH B;  5H9C A;  2E75 D;  1PNM A;  1PKX A;  2EBO A;  3VMA A;  3WB1 A;  2OT5 A;  4Q20 A;  2A45 H;  1JUN A;  2XAQ A;  2IBZ E;  1JMK C;  1NU1 K;  2V4H A;  2JR8 A;  2ITA A;  2R9R B;  3RL0 B;  1FJP A;  3MGN A;  3F5W C;  4HYO A;  2Z4E A;  1K7D A;  1VQ7 P;  4OX9 B;  2Y0I A;  4I0X B;  5B66 E;  2A45 I;  5GTH H;  3S9O A;  4PJ0 Z;  2IZ1 A;  3CCL V;  2XTA A;  1YQ3 C;  3S4R A;  4DV1 O;  1T5E A;  3SPH A;  3OEE G;  1BE3 H;  3D71 A;  4OPH A;  2WLH A;  3GHG A;  3H1L H;  3ETQ A;  3R2P A;  3SSU A;  1LTJ C;  1VF6 A;  2V4D A;  3ASO C;  3KZI H;  3EFG A;  1NH2 D;  1KD1 W;  4J9Z B;  4PI2 A;  4M3L A;  4EOT A;  3CB2 A;  3MHH C;  2AZ2 A;  1SQB H;  1NTM D;  3MD0 A;  1VP7 A;  1L0N D;  4G27 B;  2K1E A;  2X7R B;  1Y66 A;  3OR7 C;  4Z1M H;  1ZP0 C;  2BTO A;  3CRQ A;  1LTJ B;  2GUS A;  3L71 G;  4AQY B;  3ZN1 A;  3ASO B;  4NXM O;  2JVD A;  3CRA A;  4GOE A;  3BY6 A;  1Q2N A;  4BRY B;  1R73 A;  2N9Y B;  3CX5 D;  2P1J A;  3FWN A;  3QO5 A;  2Q6A A;  4DR3 O;  5AW8 B;  1IUR A;  2ADP A;  3ABV C;  4PDV A;  1DTO A;  1YI2 P;  3K5O A;  2KYV A;  1NTM J;  1TVK B;  4JI0 B;  4C7N B;  1L0N J;  3RW0 A;  4R50 A;  1K05 A;  2P7J A;  3ZRW B;  1VQ4 V;  2WSE H;  1CXZ B;  3U1C A;  3JCU E;  3IAY A;  3HRN A;  1VQ9 V;  1NR1 A;  3CD6 V;  3L70 E;  4DR7 O;  1QR9 A;  5ITZ A;  4I50 B;  4IT5 A;  1L8D A;  1ZAU A;  1SQB K;  3AED C;  3RYH B;  2QKS A;  3PTZ A;  4K0K B;  4RKU J;  3L35 A;  4O4J A;  5IJ0 A;  2KG7 B;  2B9B A;  4LFA O;  4O4H B;  4FK5 C;  3JSV C;  3LW5 H;  3TSI A;  1NAY A;  4GUN A;  3P32 A;  3H1K D;  2XU6 A;  2AGA A;  4G28 B;  2BSK B;  3SJQ C;  4DR2 O;  1FYJ A;  3LSU A;  1LWU C;  4CH6 A;  1P84 E;  2RQ6 A;  3SJB C;  3VQV A;  3FYE B;  5AW6 B;  3SWY A;  3H1J E;  1J2J B;  3EFF K;  2GTA A;  5JH7 A;  4LP8 A;  5KTB A;  1HNW B;  3V5B A;  1QL2 A;  2D2C D;  1I5Y A;  4LC1 A;  1WT6 A;  4JI5 O;  1IK7 A;  2JJL A;  3IFM A;  3L9D A;  4LFC B;  1SZT A;  1DD3 A;  3W7T A;  4EFB A;  2YIA A;  3K04 A;  3SGI A;  1YIJ P;  2YS8 A;  2GSM B;  5AVY B;  1THZ A;  3X2Q C;  3ZHV A;  1NTZ K;  3NTN A;  3OW2 O;  4B86 A;  2Y0C A;  2ZYG A;  2EIK C;  1JMM A;  1GRJ A;  1JY3 O;  5KLI C;  3L36 A;  4J9Y B;  2M0B A;  1VQ5 V;  1L4A D;  2PF4 E;  4NXM B;  3T97 A;  3X2Q B;  1AIL A;  5B5E H;  2GBO A;  5LYJ A;  2H94 A;  4MVM A;  4BIO A;  3U0Z A;  1P7G A;  1EZV E;  2XND H;  5KLI B;  1BDC A;  1VQP V;  1EFR G;  4K35 A;  3Q5P A;  2W0F C;  4FIP C;  3N4X A;  4OWF A;  3EHB B;  1FOS E;  5KKZ B;  3RT3 C;  2Q9L A;  2CK3 H;  2F4V O;  5C39 A;  5KLV G;  4ASV A;  1M9N A;  1I7F A;  4LR3 A;  3SPG A;  4DR7 B;  1SQG A;  2IJI A;  2WLL A;  5EZY A;  4KXR A;  1N73 C;  4YXW G;  3TXQ A;  2FFD A;  2FBW C;  5GON A;  1L1F A;  3L73 E;  2FYU E;  4LFA B;  1XHX A;  1KIL E;  1BSM A;  1U57 A;  4YHH O;  2NRG A;  3K57 A;  3M0D C;  4GLX A;  4DR2 B;  5CA3 A;  5DJT B;  1N73 B;  2M3B A;  1JVM A;  4O2B A;  2QE7 G;  1G6U A;  1CI6 A;  2UXX A;  5KHI A;  2ITC C;  3E8F A;  3CCL P;  5L3C A;  4OH8 B;  2W90 A;  2DWD C;  3FFQ A;  1LNQ A;  2IU3 A;  1L0N G;  1PIX A;  2ZQM A;  4FM0 A;  5B66 Z;  1Q6H A;  3HE5 A;  1SQP E;  3HUS C;  5LP6 C;  4D6T G;  2E43 A;  1M4U A;  1ZRT D;  2QJY C;  3IR9 A;  4JF7 A;  3SWF A;  1L0L D;  3H32 A;  2WMM A;  4DZO A;  3D36 C;  2VQF O;  2V1D A;  1WMK A;  1PP9 G;  1PV3 A;  2K9J A;  1M56 D;  5JQG A;  4JBZ A;  3EWK A;  2ZIO A;  3BA8 A;  1LT9 A;  1FXV A;  2YC0 A;  2QJP C;  3WU2 E;  2XAF A;  2PYJ A;  3M8A A;  1H2G A;  5LP6 B;  4PEL A;  1XUQ A;  2EZP A;  4YIO A;  3SPJ A;  2WLJ A;  3K79 A;  3K5M A;  4DR6 B;  1NU1 G;  2QJY B;  4GDO A;  1GU5 A;  3WUU A;  5KX5 A;  3JAM N;  2QWN B;  1J5E O;  1DX7 A;  5FPO A;  2BTQ A;  4QMA A;  1S4X A;  4X64 O;  1L0L J;  5JJN B;  1LR1 A;  5LGT A;  3OD4 A;  2QJP B;  3I5C A;  1VQ4 P;  1GD2 E;  3JD0 A;  1UPG A;  2F4V B;  3M99 B;  1VQ9 P;  4WFA V;  3CRR A;  3CD6 P;  4DW0 A;  1FZB A;  1Y8A A;  1SVF A;  2YIB D;  4BIU A;  3AEG C;  3LDC A;  4CS4 A;  2A45 G;  1FC2 C;  1HF9 A;  3JD4 A;  5IWA O;  4FZ0 A;  1OCO C;  3THO A;  4H44 D;  1JJO A;  3ASN B;  4ZKU A;  4YHH B;  1SQQ D;  2IYP A;  3HD7 A;  3L71 E;  3C90 A;  1LT1 A;  3FX7 A;  5LHG A;  2YI9 A;  1RE4 A;  4MW8 A;  5D5Q A;  5DM6 V;  3KCX A;  2YDE A;  4Y99 C;  4R4M A;  2LXB A;  2AXT Z;  2ZM6 O;  2QWP B;  1IFJ A;  2C0X A;  3HE4 B;  1Q81 Q;  2IJJ A;  3FWL A;  2CH7 B;  2WT7 B;  3OE7 G;  5CHX A;  5L3F A;  1BE3 G;  2GA1 A;  4PD4 H;  3JAT B;  1PFI A;  1SQQ J;  3H1L G;  1CW5 A;  2L35 A;  3Q3D A;  2ZD9 A;  3QG5 A;  4Y99 B;  1MZE A;  1Y67 A;  5CA1 A;  3LIE A;  3OAA G;  1V54 B;  2POH A;  3HKE A;  1OW7 A;  2DQ0 A;  2ILM A;  2JDI H;  4LF8 B;  1KB9 E;  3OMN B;  4HZ3 A;  1PNL A;  4PD4 I;  3RYF A;  3RYI A;  3QO8 A;  1OZ0 A;  3CI9 A;  3H25 A;  3DTU B;  1SQB G;  2FKX A;  2UXD O;  2ZXE B;  1S5L H;  4A7P A;  2VQF B;  3K08 A;  1GH6 A;  4X1I B;  5IY5 C;  2PY5 A;  2Q8V A;  4Z1M G;  1MNG A;  3AE2 C;  1VQ5 P;  1LUV A;  2LJ2 A;  4DRX B;  4QNH B;  3LID A;  3VQW A;  1OFC X;  3CCJ V;  1SS1 A;  5CCG D;  3L72 D;  4IGG A;  4JGS A;  4FVM A;  3JAW B;  2H8P C;  4PV1 D;  1KD1 Q;  3C9I A;  1N7S D;  1D5A A;  1F23 A;  1QVF O;  5LGU A;  1J5E B;  5E79 E;  3T2M A;  1LP1 B;  5IY5 B;  2Q6Q A;  4DV5 O;  4X64 B;  1VQP P;  2Y48 A;  5DN6 G;  1QQC A;  2Q7E A;  1NWQ A;  2EUL A;  4WCE V;  1QL1 A;  3K5B A;  3P8C D;  1EZV I;  5LL6 Y;  2E76 D;  1R3L C;  1GK4 A;  2YI8 A;  3L72 J;  4YJ3 A;  3N7N A;  4GCZ A;  1KZU B;  2PP6 A;  1JA8 A;  1JCC A;  2KS1 B;  4LCU C;  1HVV A;  1AQ5 A;  5IWA B;  1J95 A;  2IJK A;  3RGB A;  3CCS V;  4LGD E;  2ZE5 A;  4YJ2 B;  5AW9 B;  1JOY A;  3BAT A;  3HKD A;  1RF1 C;  2CTW A;  2ZM6 B;  3AG7 A;  3W7X A;  4W7Y A;  5DJU B;  2ZDI A;  1HW7 A;  2L5G B;  3AEI A;  1L0L G;  4LF5 O;  1NZ6 A;  4X1Y B;  1QBZ A;  1ZWI C;  3ETD A;  2Q7G A;  1EN4 A;  1PGP A;  5KLV E;  1G1X B;  4HBN A;  1Y9B A;  2N9B A;  1RF1 B;  4TV9 A;  2CDY A;  1YXB A;  2W6I G;  1SQF A;  1SFC C;  1HJB A;  1A02 F;  3JAS A;  1OV9 A;  1FD9 A;  1JTH A;  3CEI A;  2UXD B;  1NS1 A;  2FYZ A;  4PD4 D;  3OW2 U;  4RQF A;  2B87 B;  1SFC B;  1R6K A;  2WAM A;  4ZIB A;  5KAI H;  3JD2 A;  4JAU A;  1NQT A;  1XRE A;  3K9A A;  2XND G;  1EXJ A;  4DV5 B;  3WU2 Z;  4NPE A;  3IC9 A;  4NVP A;  1L0N E;  3AE7 C;  1SQP K;  1G2C A;  2CK3 G;  2H43 A;  3ZHS A;  2M5A B;  1MZF A;  3G4S V;  1UIX A;  4ZOL A;  3VMX A;  3VTP C;  1S2E A;  4D6T E;  1NKN A;  1WNS A;  2E74 D;  1NVP D;  2YXL A;  4GKJ O;  3CX5 E;  5H2F E;  3A0B H;  4O2A B;  3GWO A;  1Q6U A;  1W0K G;  3UM7 A;  1PP9 E;  1F7Y A;  3PJS K;  1FJK A;  4J10 A;  3QVN A;  2CGN A;  3PP5 A;  4XFJ A;  1WA8 A;  3SPC A;  1Z5W A;  2YEV A;  1SP4 A;  1YJW V;  2GV9 A;  1NU1 E;  4IIJ B;  5CMU A;  4TUY B;  1UJW B;  2KK7 A;  1GL2 C;  3R66 A;  5KAF E;  3AE6 C;  1FZE A;  3L37 A;  5J2U A;  1H2N A;  3Q4H A;  2JP3 A;  1VF7 A;  2WPD G;  3MHS C;  5CA0 B;  2AW9 A;  1QNM A;  5FNV A;  4HAM A;  4CC6 A;  4LF5 B;  3ZRS A;  1VQM V;  3STZ C;  5LOV A;  2X6C A;  1GL2 B;  2ZXX A;  3TGU D;  4UVC A;  3RK2 C;  1ZOY C;  5AVQ B;  3BRC A;  2ZT9 D;  1P7B A;  1B6Q A;  2KSE A;  1SER A;  2EIL C;  3N2K A;  4JAA A;  1BCC D;  4O4I A;  3LDE A;  1Q7Y W;  3TNU B;  2ZYA A;  2W6B A;  3RK2 B;  1VAR A;  3I5D A;  1Q8I A;  4RQE A;  4MN4 C;  3SJA C;  2P90 A;  3CCJ P;  2GUZ A;  3TGU J;  2EIL B;  3KXD A;  1IZ3 A;  5GTH E;  4I6M C;  1W2B O;  4NPD A;  5B1B C;  3DC5 A;  3IN6 A;  1BGY H;  1AB3 A;  1BCC J;  4DV3 O;  4EB6 B;  4JQ0 D;  1BE3 E;  2PI5 A;  1Q3E A;  4YXD C;  3H1L E;  3HTK B;  1IFD A;  2FML A;  1IBK O;  2WPR A;  5E79 Z;  4U3J A;  5B1B B;  1SET A;  3KZI E;  2YUA A;  2PAJ A;  4GKJ B;  1F4N A;  1SQB E;  2B1G A;  1NJI W;  3RL0 D;  4ZHQ B;  3MUD A;  1OW6 A;  1COW G;  1N0N A;  3TYY A;  3H9V A;  1KUQ A;  1AI6 A;  1SRY A;  3CCS P;  4FLU A;  2JGD A;  4E4E A;  2YIB A;  2JJ2 G;  3AE1 C;  1F51 A;  3ZHQ A;  1MMM A;  1I08 A;  1M90 Q;  2AHZ A;  1QLE D;  5KJ7 A;  1RP3 B;  2BOC C;  2L91 A;  3JSN A;  3CWB D;  3GHG C;  1IXB A;  1N7L A;  2HFE C;  3EVK A;  1U97 A;  2WSF H;  3K9S A;  5L3E A;  2Y9Z A;  2KSJ A;  2YNY A;  2JDI G;  2W6J H;  1WJZ A;  2QJ1 A;  1IO4 A;  3GHG B;  3SWK A;  4H13 D;  1JY3 P;  4IFD K;  5CBG A;  1MSW D;  5K5G B;  5GW7 A;  3CWB J;  1KP3 A;  3K0G A;  4FMT A;  4MSW C;  3E1R A;  1W59 A;  1X59 A;  1YBK A;  1OHH G;  3D6Z A;  4RJT A;  4FLT A;  4KHP O;  1MSD A;  1M57 C;  1PL4 A;  3K58 A;  5CB4 B;  1QVF U;  1NTM H;  4DV3 B;  1OVV A;  1MA1 A;  4WWI A;  2OTK E;  2V7Q H;  4NTW A;  3C3T A;  5AVX B;  4J80 A;  4X62 O;  1Z5V A;  3MIW A;  3G4S P;  3U1A A;  2M6Y A;  5J2T B;  1M1J B;  1N7S A;  4Y28 J;  4C7R A;  1IBK B;  3QNE A;  1VF5 D;  4DCK A;  2ARH A;  4N23 A;  1QVG O;  1M57 B;  1BGY D;  1EN5 A;  5AW1 B;  2DOS A;  2O01 N;  4KT0 J;  3T4D A;  4DT0 A;  2QSI A;  3OFN G;  1EXI A;  1PPJ H;  3J80 N;  3TK1 A;  5ITZ B;  4MVS A;  2DN9 A;  3JYC A;  5B3S C;  1KIL B;  2RMZ A;  3CX5 I;  1YJW P;  4LF7 O;  2Q5Z A;  2UWJ E;  5H2F Z;  3ABK C;  3NMD A;  1OWA A;  4O4J B;  5IJ0 B;  5B5E E;  1DF4 A;  4H0L C;  1ZSP A;  3BCC H;  2UUB O;  1NTM K;  1BGY J;  1HBW A;  1L0N K;  1LTS C;  4F6R A;  3K5N A;  1SLQ A;  5EIB C;  3T4Z A;  3TJT A;  2DW3 A;  4UB8 H;  5B3S B;  1IXM A;  4MVR A;  2P67 A;  1HGZ A;  2Q0A A;  3G67 A;  3ABK B;  2P6J A;  5KAF Z;  4WY4 A;  4H0L B;  3H1K H;  5CBN A;  2D3O W;  2PTM A;  1SA0 A;  3RK3 C;  4TLF A;  3D3Q A;  5JH7 B;  4JI7 O;  4BR6 A;  5IYC O;  2OGU A;  4RAI A;  2Q68 A;  3IAO A;  4W80 A;  2B89 A;  4QPK A;  3UKM A;  3MHV A;  2OCC C;  2N1T C;  3H01 A;  1HP8 A;  1VQN V;  2A7W A;  1DD4 A;  1ORQ C;  1R3J C;  1H2K A;  2HOD A;  3MZW B;  4AI8 A;  3ETG A;  1LTA C;  2HP8 A;  1KEC A;  1FZA A;  2JWD A;  5CBO A;  3F7Y C;  3ZRX A;  2MW2 B;  4WBN B;  3H1I D;  2NZ2 A;  4WFF A;  2WZ7 A;  1WPB A;  4KHP B;  2OCC B;  2N1T B;  3GWK C;  3JD3 A;  2QEX V;  5M1B A;  4W7Z A;  2RNB A;  2NN4 A;  1E79 H;  4PJ0 H;  4AYC A;  1NH4 A;  2DWE C;  3VOU A;  5CBH A;  3T97 B;  4X62 B;  3L74 H;  5LYJ B;  1YQ4 C;  4QIW F;  3LNN A;  5GTH Z;  2WSF J;  4L74 A;  3DXR A;  4L87 A;  2CPB A;  2HG5 D;  4DO2 A;  2RN0 A;  3CCE V;  1JY2 O;  1FZC A;  4NTY A;  1Z2G A;  2FFD C;  1QLN A;  1KTM A;  3E22 A;  5BR8 O;  3CHX A;  4KFM A;  2QM4 A;  1HR0 O;  3BRV B;  2BEZ F;  3BEH A;  3WMM 0;  2KSD A;  1Y4M A;  1EZJ A;  1CP9 A;  3AEF C;  2F93 B;  3B5N D;  5AVT B;  5GTI Z;  2OIG A;  4UB6 Z;  2XOK G;  1XDC A;  3CMA V;  4LF7 B;  1NKZ B;  2JEE A;  3P8M C;  3WG7 C;  4N3Y B;  2JS3 A;  2QSA A;  2FFD B;  4DV7 O;  1AA0 A;  2O1K A;  1RQU A;  3TDK A;  2UUB B;  4D7T A;  2IU0 A;  3V2P A;  3IC7 A;  1Q43 A;  4JF3 A;  1PPJ D;  1WB7 A;  3HPL C;  2K1A A;  2WA3 A;  3AK1 A;  2V7Q J;  5CCH D;  3H6P A;  1SES A;  2ZAE B;  3DGE A;  3WG7 B;  3SPI A;  3FB8 C;  4FM2 A;  2R3C A;  3D8C A;  2WPS A;  3ABU A;  1M8O B;  3BCC D;  1FXK A;  5KHH A;  2QWR B;  4JI6 O;  4DUZ O;  5C93 A;  4JI7 B;  3CC4 V;  2KNC A;  4I7Z C;  3KQG A;  1JY3 N;  1ZL8 A;  1GN3 A;  4IFF A;  3HE5 B;  2UUC O;  2UXC O;  1LT9 C;  4OGQ C;  2HPC B;  1CSB A;  4ZKP A;  1ZR4 A;  4PDR A;  3BCC J;  4I7Z B;  1ZLL A;  3H32 B;  1OVU A;  3WUV A;  4FFB A;  3V4Q A;  2K9J B;  3V4W A;  5JQG B;  4DV1 B;  1HGV A;  4I1L A;  4OGQ B;  1LT9 B;  1BGY G;  1W2B U;  4B7E A;  1L0L H;  3HKB A;  4PD4 E;  2YO2 A;  1P84 F;  3D3I A;  5TIS Z;  1LWU B;  3H1K J;  1JR9 A;  4AUW A;  3ABT A;  1M7L A;  1X4T A;  1W2E A;  1I0H A;  3G80 A;  3R4Y A;  1AVY A;  2UXN A;  1SS3 A;  1IC2 A;  3APQ A;  4DV0 O;  3KDP B;  3LUT B;  4LNU A;  3PLN A;  4D7S A;  5AVR B;  2AEF A;  5BR8 B;  1S5L E;  2GHY A;  3BVH A;  3N2G A;  1HR0 B;  1YDX A;  3L74 D;  4RO2 A;  1GW3 A;  1NTK D;  2YSU B;  2WWW A;  3BRT B;  1S9K D;  3HD7 C;  5B1A C;  3GW6 A;  4IL6 H;  3OMI B;  4UCV A;  1RE4 C;  4JTA B;  3VN0 A;  2E75 C;  2K37 A;  5EFW B;  4DV7 B;  4FLW A;  4DR3 B;  3CXH H;  2Y4T A;  1L0L K;  2EIK B;  4N21 A;  1NJI Q;  4A5U B;  3II6 A;  4HYT B;  4I2L C;  1FE6 A;  1MFZ A;  4MS2 A;  3HD7 B;  5B1A B;  1GK9 A;  1NT2 B;  1YTZ I;  3L74 J;  1K8A Q;  3OT7 A;  1NTK J;  5B5E Z;  2E75 B;  3CXH I;  1KYO H;  2K9Y A;  4YIP A;  1JQ0 A;  2EJR A;  1SQQ H;  3A8T A;  4P2Z A;  5LMN O;  5AW2 B;  2OCH A;  3W7S A;  3ZJZ A;  3CCR V;  3C8V A;  2IPP A;  1GTO A;  4PA3 A;  4GKG A;  3CLQ A;  4JI6 B;  3OJA B;  2XUM A;  4DUZ B;  4K8Z A;  2W6J G;  1FOS F;  3MTU E;  4DV4 O;  1R3K C;  5LA6 B;  2CE4 A;  4FLY A;  2JS5 A;  2P5O A;  1CEZ A;  1HJ0 A;  1KYO I;  3FYI B;  1URQ D;  3JAK A;  1DIP A;  1XOU A;  2WQY C;  5KUM A;  4Z2W A;  3CXC U;  2XHB A;  2UUC B;  2UXC B;  3ZHU A;  1VQN P;  4DK1 A;  4KHX A;  2NLJ C;  3RYF B;  3RYI B;  3IJ4 A;  4JI1 O;  3C1L A;  1EBO A;  5IYB O;  2ZVO B;  1SQX D;  3SYA A;  3RYC A;  1OMI A;  2Q73 A;  2QEX P;  4TQD A;  3UIA A;  2K9P A;  3PN1 A;  1NTM G;  4N78 D;  1NH2 B;  1OX3 A;  2P22 C;  1SQQ K;  2V7Q G;  3QF7 A;  4U7O A;  3IFX A;  5FLX N;  5K1P A;  1K9M W;  4JI5 B;  4C7N A;  4L75 A;  1T6A A;  4MVU A;  2HJD A;  5B1O A;  1HTL C;  3CCE P;  3L72 H;  4FM1 A;  2R9I A;  4IOI H;  1QCE A;  2FL4 A;  3UQ8 A;  3G71 V;  4DV0 B;  1SQX J;  1M1K Q;  2LP7 A;  4I50 A;  1QVG U;  2OQQ A;  1PD3 A;  1MZ9 A;  3SR2 C;  3RYH A;  5JJE B;  1PPJ G;  3RK3 E;  2C9L Y;  1X8Y A;  1RF0 C;  1KBH A;  3HUS B;  4YJ3 B;  3CMA P;  1IX9 A;  1H2S B;  2WPQ A;  5KAI E;  2Q4P A;  5IT9 N;  2UU9 O;  4UUJ C;  2MJZ A;  3BCC G;  2BSK A;  1ZN5 A;  3ICX A;  2AXC A;  2Z5H A;  4GOF A;  3N27 A;  2PI4 A;  2ZDI C;  1VQO V;  1YTF B;  2EIN C;  1F4M A;  5APV A;  1D2D A;  4MTO A;  2Y69 C;  2YKO A;  1U7M A;  3CCQ V;  4NR1 A;  2PUS A;  4NXN O;  3P3P A;  5LMN B;  3CXH D;  3H1K G;  5FPR A;  4UV9 A;  1SQV D;  2R3S A;  3AG4 C;  1TAE A;  2VS0 A;  3CC7 V;  1HNX O;  5H5N A;  3A0B E;  3CC4 P;  5AVV B;  2D2C C;  3J81 N;  4DV4 B;  3JCU Z;  4YY3 O;  5BU5 A;  3JD1 A;  3BA9 A;  4ZKI A;  1YYC A;  4ZBM A;  5BMV B;  2WVR A;  1Y74 A;  1KYO D;  4ZI7 A;  3JCZ A;  5KJ7 D;  5APY A;  3BFR A;  4WFH A;  3ZMZ A;  3AG4 B;  3CJH A;  3JAS B;  2K88 A;  2DYS C;  4X8A A;  3ZIA G;  3KKY A;  3O65 A;  3H1H H;  5IYD O;  5FL7 G;  1JTH B;  1SQV J;  4JI1 B;  4CPG A;  1VMG A;  2ZNI A;  1N8R W;  4LF6 O;  2R44 A;  2XDJ A;  1VL2 A;  1OCO B;  1L4A C;  1FDI A;  2AXT H;  1E79 G;  2DYS B;  3OA7 A;  1YSC A;  4U3F H;  2OYH C;  3AG3 C;  3L74 G;  1T2K D;  1S72 V;  4HNA B;  1L4A B;  4X1K A;  1JCH A;  2NR5 A;  4I55 B;  1JFF A;  1RHZ B;  3D70 A;  2Q69 A;  1G2C B;  1ZME C;  2OYH B;  1AQT A;  2VRS A;  1XQ8 A;  2ZR2 A;  3AG3 B;  3S3X A;  4UCR A;  4ZOL B;  2WLI A;  2OYI A;  1KB9 F;  1XNQ O;  4R8C A;  3VMZ A;  2ZYD A;  5IDJ A;  2XT9 A;  4UCU A;  2UU9 B;  3ZHR A;  2NPS D;  4FLX A;  3JAL B;  2O3J A;  3B2E E;  1HNZ O;  1IBM O;  3E86 A;  3K06 A;  2PRR A;  1BGY E;  3B5N A;  4QE7 A;  4AQR D;  1VQL V;  2YEV B;  1EC5 A;  2A0L A;  1OXZ A;  3ABM C;  2EIM C;  1S77 D;  1N86 A;  2Q1K A;  1B04 A;  1R5S A;  2A06 H;  4NXN B;  3Q4H B;  3CCR P;  2CTQ A;  3LSQ A;  5CCH A;  1HNX B;  2LGW A;  5LBQ A;  2F1M A;  4H33 A;  4MT8 A;  1YVW A;  2WSS H;  5D5P A;  4YY3 B;  5L8R J;  3I55 V;  1SQX G;  3ABM B;  1N2D C;  2EIM B;  1VQK V;  1IDS A;  1T3U A;  1RY3 A;  2ZVN B;  1AI4 A;  4CS3 A;  1OIP A;  3QWO C;  4BAY A;  3N2K B;  3TGU H;  4WY4 D;  2YIC A;  4O4I B;  4WFG A;  1M56 C;  5LP6 A;  1T8Z A;  2LXC B;  4LF6 B;  1TUB A;  1PM9 A;  1JCD A;  1S0V A;  2Q5U A;  1BCC H;  3O6Q A;  2GUZ B;  4EIJ A;  2HR3 A;  3EXA A;  3M7M X;  3H1H D;  3L70 D;  1M56 B;  1SKV A;  1Q82 W;  4I5S A;  2YMY A;  1NBM G;  1USE A;  1HWY A;  2LO1 A;  3G71 P;  1ZLZ A;  3O9O A;  1BQ0 A;  4JV5 O;  3MUD C;  4U3F D;  2M3E A;  5JVD A;  1BHA A;  4U3J B;  4UV8 A;  3A5T A;  5HFL A;  1DEB A;  1XNQ B;  3L70 J;  3H1H J;  3VMY A;  4QPJ A;  4JI8 O;  1K92 A;  1SF9 A;  1GU4 A;  1P84 D;  2NNU A;  4I9W A;  2DJV A;  4X20 A;  2KLV A;  2M8R A;  2QGN A;  3IF4 A;  3Q5S A;  1HNZ B;  3L75 H;  3H1J D;  4H44 C;  2Q3E A;  2OWO A;  2FYN C;  2W27 A;  5LXT B;  1NTM E;  1VQO P;  3V6I A;  1B3Q A;  4JYB A;  4U3F J;  3HE4 A;  5KAI Z;  2C2A A;  2WT7 A;  4GYC B;  2G8Y A;  3CCQ P;  2LW7 A;  1CPY A;  1SQQ G;  1GN4 A;  3OAK A;  4NYK A;  1R1B A;  3PRJ A;  3ZRV A;  4K8X A;  4HH2 A;  2FYN B;  3UO3 A;  3ZDM A;  3H1J J;  3SDL A;  3V2N A;  2HJF C;  3B09 A;  1PPJ E;  3AE3 C;  1XL6 A;  2SPZ A;  1Y76 B;  1AJY A;  1AVM A;  2A06 D;  1WLE A;  1XNR O;  2AEM A;  3ITK A;  3CWB H;  4EYY Q;  1RE3 A;  4CH3 A;  2XNX A;  1KMI Z;  1I5X A;  1RSO B;  2WPV B;  3GVM A;  1LTT C;  3BCC E;  1URQ A;  4GX1 A;  3FXE A;  1I94 O;  4JPR A;  2KQX A;  4B3T O;  4UB8 E;  1OZH A;  4B08 A;  4RUE A;  5CCG C;  1ZR2 A;  4C7U A;  1LP1 A;  4C46 A;  4PV1 C;  4H37 A;  1N7S C;  4GT1 A;  2BEQ D;  4I4T A;  2HHH O;  3H1K E;  3UO2 A;  1S72 P;  3RFR A;  4J7J A;  1JY2 P;  3AG2 C;  5IJ9 A;  4G2K A;  3HB3 B;  3L72 G;  5K1X A;  4PHZ A;  2YKP A;  3L73 D;  2YMK A;  1JMB A;  2FYU D;  1Q6I A;  4PV1 B;  1KIL D;  1RFY A;  4JV5 B;  1N7S B;  2EX3 A;  1IFM A;  2E76 C;  5BY1 A;  1K9M Q;  1V55 C;  3A0H H;  3UT5 B;  2LFR A;  1QX8 A;  4LWS A;  3SYC A;  2KS1 A;  5BVZ A;  1PV0 A;  1N33 O;  1IZN B;  2HYN A;  1YEW A;  4JI8 B;  1H0T A;  2B88 A;  5JCO A;  2E5L O;  2BAS A;  1Y6X A;  5KMG B;  4BXL A;  2YO3 A;  1E1Q G;  2KUB A;  1AV1 A;  2O01 H;  1KB9 H;  3L73 J;  2E76 B;  3CP1 A;  5APX A;  1Z56 A;  1VQL P;  2FXO A;  2FYU J;  1V55 B;  2GDS A;  3B8M A;  2ZFC A;  1SC5 B;  3G6E V;  4PJ0 E;  1FFX B;  4NKG B;  2DE0 X;  1YZB A;  2WSC J;  5KA5 A;  4XDJ A;  2P58 A;  1H2M A;  4JTD B;  3ZBH A;  3L74 E;  3F7V C;  4F6E A;  2WIT A;  1S9K E;  4PA9 A;  3E8G A;  1U96 A;  3T1C A;  4X1Y A;  2KZJ A;  4F6R B;  3F89 A;  3L75 D;  1MG1 A;  2YIU C;  1NGM B;  2OTL V;  4HKZ H;  3I55 P;  2Y4U A;  1VQK P;  5AVS B;  4EI2 A;  4TT3 H;  1XIL A;  5CN0 A;  2IZ0 A;  1SA0 B;  1XNR B;  2W6A A;  4EKW A;  1H38 A;  1XTC C;  1G8M A;  5DED A;  2EIJ C;  5EYP A;  1FZF A;  2BCC H;  3G6B A;  1AVO A;  3H1H G;  2RDC A;  2JRI A;  3L75 J;  3AEC C;  1ZV8 A;  3STL C;  3GB7 C;  1I94 B;  4B3T B;  2W8Z A;  2ZNJ A;  3U10 A;  2HOD B;  1VIB A;  2XKM A;  2EIJ B;  4U3F G;  2ZR3 A;  4J7Z A;  4UCT A;  4UVB A;  2LKM A;  1VF6 C;  3CCU V;  3E83 A;  2HHH B;  3JAR A;  4MW3 A;  4UCO A;  1URF A;  1LTI C;  1N8R Q;  2FXM A;  1FZC C;  1P49 A;  3H1I H;  4HJG H;  4X89 A;  3ZED A;  1JPX A;  1AFO A;  2ADQ B;  1PNK A;  3M0A A;  3GF3 A;  2C9N Y;  2Y0D A;  5H6Q A;  3NFQ A;  4O2A A;  4NTX A;  1OCZ C;  2R5B A;  5A2Q N;  2E74 C;  2F95 B;  4PA6 A;  4ZNC A;  4BWA A;  1N33 B;  5AW3 B;  1EQ7 A;  1FZC B;  2I8D A;  2Z0A A;  1MAB G;  3CCM V;  5L3G A;  3E22 B;  2E5L B;  3WB0 A;  2JGU A;  3CE2 A;  1FPO A;  4L8J A;  5IYZ A;  4AIL C;  1ZRT E;  4TUY A;  3M9Q A;  4FPP A;  2LQT A;  3ETE A;  1KQL A;  5A9G A;  1L0L E;  1OCZ B;  2E74 B;  1NVP B;  5H6R A;  2Q7C A;  2R70 A;  1EDJ A;  1E1R G;  5CA0 A;  2NPS A;  2E3C A;  2A06 G;  1AR4 A;  1FXK C;  4GOD A;  3AE9 C;  1X22 A;  2XAJ A;  3RBX A;  1KB9 D;  1R6T A;  2DQ3 A;  1GL2 A;  1G1J A;  4YPC A;  4IHJ A;  1ZXG A;  2FB5 A;  1W0J G;  4MVQ A;  1NKD A;  2WSS G;  2QA4 V;  2M7W A;  1LJ2 A;  2ZIM A;  2Q9I A;  2X6A A;  1W5C E;  1QR8 A;  1FXK B;  4IL6 E;  3KPE A;  2ZT9 C;  1AP6 A;  2OYQ A;  3FAV A;  2YID A;  2YXY A;  3SJC C;  2KNC B;  1MFT A;  1HDJ A;  4TV8 A;  3TGU G;  2O01 J;  2R72 A;  3CXH E;  2N05 A;  3E8H A;  2JO1 A;  4EFE A;  3JC2 2;  4X88 A;  1JEK A;  3OM3 B;  1GW4 A;  2FKW B;  1J1E C;  2OAR A;  2YKQ A;  3Q2Y A;  2EZO A;  1K33 A;  1YIT V;  1H2L A;  2ZT9 B;  1BCC G;  3K5L A;  1VQM P;  5KA6 A;  4YTP C;  1B06 A;  1KYO E;  2BCC D;  5L3B A;  3F5H A;  4EB6 A;  3W7U A;  1S76 D;  1SQQ E;  4FFB B;  1JY2 N;  4KP4 A;  3OEH G;  4UCS A;  2J5U A;  2QKA A;  5KHK A;  4WVZ A;  1J1E B;  4DXW A;  3HTK A;  4UB8 Z;  4GIF A;  3HKB B;  2P4K A;  2IFN A;  2QIW A;  1HWT C;  2B1I A;  1OJH A;  4GZR B;  2DYR C;  4O9B A;  1KQS U;  2P7T C;  4U7J A;  1K73 W;  3RK3 B;  2Q0O C;  3FB6 C;  2BCC J;  1QEX A;  4EEQ A;  4CS2 A;  3A3Y B;  3RL0 C;  2ZCE A;  3N2G B;  3M9H A;  2J58 A;  3L75 G;  1FFT B;  2DYR B;  2JJ1 G;  4RUF A;  3ZMT A;  2LR2 A;  1Q81 W;  4DV2 O;  1K5S A;  3FB7 C;  4JYA O;  3G6E P;  3HR0 A;  1ZTE A;  5KLV D;  2QG4 A;  3Q5R A;  1NTK H;  1N34 O;  1EM1 A;  2X6B A;  2YXQ B;  3D6Y A;  4JI3 O;  1KFM A;  1XTG B;  1N0J A;  5AVZ B;  2H7H A;  1WN7 A;  2W83 C;  1QLE C;  1YHQ V;  3L72 E;  3H1I J;  1IFN A;  4EDF A;  3G3Z A;  1SZX A;  2QTO A;  3HKC A;  3OR6 C;  3RGU A;  2OTL P;  1GM7 A;  1A02 J;  3ABL C;  1BSH A;  4PA4 A;  3E8B A;  4O4L A;  1FDM A;  4WF9 V;  5LGN A;  3TET A;  1HNW O;  5KLV J;  3KZI Z;  2WLL B;  5EZY B;  1QLE B;  3CWB G;  2PGD A;  1X79 B;  5GON B;  4LFC O;  2ZE7 A;  2Z3Y A;  2FXP A;  3P8C E;  4H13 C;  4OVN F;  3ABL B;  1XI1 A;  5GTI H;  4UB6 H;  3JAK B;  2ZJS E;  3ZMU A;  1K3E A;  3CME V;  1RH5 B;  2CPS A;  1G4Y B;  2H89 C;  1NTK K;  2BE3 A;  3VP9 A;  4O2B B;  2H3O A;  1MV8 A;  3A7O A;  1CI6 B;  3ZMV A;  5CB4 A;  2A3Q A;  4H13 B;  3CCU P;  1GMG A;  4D6T D;  3RYC B;  1OCC C;  2MK3 A;  3WB2 A;  5LHI A;  2KZI A;  1O9H A;  1PGQ A;  5J2T A;  1USD A;  1M1J A;  3M9B A;  4JI4 O;  1PP9 D;  1SQX H;  1QU7 A;  2R5D A;  2WLN A;  1BHB A;  1VF5 C;  4JYY A;  1D7M A;  2W0X A;  1OVR A;  1NI8 A;  1Q90 D;  5JJJ B;  1CZQ A;  1R3I C;  4KL1 A;  1OCC B;  1MOF A;  2KKW A;  1FDO A;  1NU1 D;  2UUA O;  5C8Y A;  4D6T J;  3H1H E;  3CCM P;  4HB1 A;  4R7C A;  2IW5 A;  4UVA A;  2FTK A;  1KIL A;  4DR4 O;  2CUG A;  3BHP A;  5AW0 B;  1Q7Y Q;  2H88 C;  1VF5 B;  1YTF D;  1AR5 A;  1PP9 J;  4PDM A;  1S5H C;  4MTX A;  4DV2 B;  4JYA B;  1KOR A;  2AXT E;  1NTZ H;  1QHT A;  3OUF A;  2RJZ A;  4U3F E;  1GTW A;  2DW4 A;  3BAA A;  1TUE B;  1NR7 A;  1YF2 A;  3GLM A;  1N34 B;  2CGO A;  1BL8 A;  5KX5 B;  2CTR A;  4FZ1 A;  4JI3 B;  2BTQ B;  1KC8 W;  1NU1 J;  2R32 A;  3S3W A;  3K0D A;  1SQX K;  4X9Q A;  5TIS H;  3CC2 V;  4PD4 F;  5LMU O;  2QA4 P;  1WP8 A;  2KXP B;  2VWK A;  3WFV A;  1ZUQ A;  4TT3 G;  1H8A A;  5L3D A;  1Y47 A;  3AK3 A;  1KQF B;  2BCC G;  4KUM A;  1FZG A;  3RBZ A;  1SQV H;  3FD9 A;  2AZ0 A;  1PL5 A;  1N36 O;  3S1K A;  1BMF G;  1Y74 B;  3LSS A;  4ZI7 B;  2IDB A;  3F5T A;  4I0X A;  4DW1 A;  1BE3 D;  1YIT P;  4IL6 Z;  2FY8 A;  4WBN A;  1T3J A;  3CJH B;  3K03 A;  3E2E A;  3B71 A;  5AW5 B;  2IJH A;  3H1L D;  4IFM A;  4P30 A;  2P06 A;  2N1T A;  2AEJ A;  3P3N A;  2A06 E;  4FJC C;  3E89 A;  2WTY A;  2I1K A;  5KKZ C;  2LGQ A;  4DR6 O;  3BPZ A;  4BW9 A;  2JEX A;  3TF5 A;  1SQB D;  2ODM A;  3H1I G;  4JI4 B;  2YXR B;  1BE3 J;  3FKS G;  5EBW C;  3K59 A;  5AVW B;  1JO5 A;  2HG5 C;  5CA1 B;  1OW8 A;  2OYI C;  3H1L J;  3HKE B;  3CCV V;  4X1K B;  1KFN A;  2KB1 A;  2UUA B;  1SQV K;  2E42 A;  1ZX3 A;  3DC6 A;  1LTJ A;  1JFF B;  2G3A A;  3TGU E;  4DR4 B;  1GMJ A;  4BRY A;  1K04 A;  1SQB J;  3V2Q A;  3U11 A;  1UFI A;  2WLI B;  3B5N C;  3RL0 g;  3CSX A;  2OYI B;  2H8P D;  1BCC E;  2Q67 A;  3LDD A;  1VEW A;  1MKM A;  3RWR D;  3FX0 A;  3B8N A;  4P9P A;  2IBZ H;  1S3J A;  1TVK A;  1DH3 A;  2ETN A;  4B3S O;  1YCI A;  4GX5 A;  3CRC A;  3ZRW A;  1RM1 C;  5J9P C;  1KKC A;  3MP7 B;  1FAV A;  3ZN0 A;  1ZW0 A;  1YHQ P;  2QTS A;  4MVZ A;  2ZIN A;  1HH0 A;  3B5N B;  1DGS A;  5B66 H;  5CCH C;  5LMU B;  2X0L A;  2PZS A;  2IBZ I;  1NTZ D;  2Z5I A;  1YJ9 V;  1EN6 A;  4DOJ A;  2WSE J;  3OTO O;  1FU1 A;  1BT8 A;  1RM1 B;  2KG7 A;  4MTG A;  1H8H G;  3ML0 A;  2KOG A;  2HKO A;  2J59 M;  5CJ0 A;  4O4H A;  1K4C C;  2Y0E A;  1GKF A;  3B8E B;  2P10 A;  3B77 A;  4MTF A;  1JM0 A;  2HPC A;  3NXS A;  1XL4 A;  4J41 A;  4DR5 O;  2JEU A;  4LF8 O;  3L75 E;  2KLU A;  1N36 B;  1VQ8 V;  1ROP A;  3CME P;  4WFE A;  1NTZ J;  2VQE O;  3LW5 J;  4J7K A;  4TQF A;  3VYI A;  1FS0 G;  1IFI A;  3VOP A;  2BOB C;  3E7K A;  3HKD B;  2L6L A;  1NOH A;  3CS5 A;  3OGI B;  1TUB B;  5F2V O;  3B40 A;  4MVO A;  1PGO A;  1LWU A;  2F66 C;  2OTJ V;  5EBL C;  1FAF A;  3CL3 D;  2EIN B;  1SFC D;  2MKV A;  3O6Q B;  5KUK A;  2Y69 B;  1N4C A;  4TV9 B;  2KB7 P;  2ITD C;  2RKL A;  4IL6 X;  1NO4 A;  4J11 A;  5APT A;  3JCU H;  3M91 A;  3CWB E;  3WUT A;  3SYQ A;  1K5Q A;  2Y9Y A;  3L70 H;  2D2C B;  3ASN C;  1FKA O;  2JKV A;  4ASW A;  1JX9 A;  5JVD B;  5HFM A;  4LH6 A;  2PFX A;  1LTG C;  3GF7 A;  4RO0 A;  2B5U A;  1JB0 J;  2JK5 C;  1K73 Q;  1M90 W;  3ZX6 A;  4X20 B;  2IH1 C;  3R65 A;  3UCS C;  1NTK G;  4B3S B;  4X65 O;  1PGJ A;  1P4R A;  5TJH A;  5EK0 A;  1DK1 A;  1K97 A;  2EJ7 A;  1P84 H;  3EQ2 A;  2N74 A;  1R8E A;  3CC2 P;  3O8Z A;  1GM9 A;  3W67 A;  3VP8 A;  1R5L A;  1V54 C;  3H1J H;  1DF5 A;  1XBL A;  2Z5U A;  2IBZ D;  1H89 A;  3OTO B;  1AI7 A;  5LA6 A;  4DUY O;  3A0H E;  2P2U A;  1P84 I;  3GG2 A;  4NB5 A;  1Q86 W;  1RE3 C;  3OUS A;  4B3R O;  2OIE A;  1VQ6 V;  4BW5 A;  1S5L Z;  4WFB V;  4E2L A;  2HVJ C;  1URQ C;  1YJN V;  5JWP A;  4LFB O;  4DR5 B;  1N73 A;  1WA8 B;  3ZCC A;  5CMZ A;  3P30 A;  1GL2 D;  3CPW O;  1VPC A;  2VQE B;  3SYP A;  4JPZ B;  3W68 A;  4TWK A;  2C0W A;  3FXD A;  1RPR A;  1EDI A;  3M06 A;  2Y0P A;  3SFD C;  2KI7 B;  5J2U B;  4PA7 A;  1R6N A;  4QJF B;  1URQ B;  3M0D A;  1A32 A;  1V9P A;  1DEE G;  5FNV B;  3I56 V;  3RK2 D;  5LOV B;  1EZV H;  3T1H O;  4XDL A;  3AG1 C;  4I4T B;  3CCV P;  5IJ9 B;  1AR1 B;  1M5I A;  2HLD G;  5JCO C;  2BCC E;  4W4K A;  2ZKO A;  1U7J A;  3AEE C;  2F43 G;  3HUS A;  3FB5 C;  3P7K A;  3AG1 B;  4JYC A;  3GMA A;  5BU8 B;  4TSF G;  4F4L A;  3AEB C;  3L73 H;  4GKK O;  2QWQ B;  1FXH A;  1NAF A;  4ZMD A;  2FYU H;  3D36 A;  4LWS B;  4OXS A;  5EC2 C;  1NTZ G;  5AW4 B;  5AW7 B;  1O9G A;  4QE9 A;  1XHZ A;  4FLV A;  1H0T B;  2WSC H;  4R6Z A;  4ABM A;  1KQG B;  3VBB A;  1RF0 A;  4XDK A;  4X65 B;  1K34 A;  3RN4 A;  2B9Z A;  3G9R A;  2UXB O;  2N04 A;  3T1Y O;  3H1I E;  3VQY A;  1KQS O;  1S1C X;  4K3A A;  1YJ9 P;  2YXH A;  3PHL A;  2XAS A;  2XZR A;  2RN9 A;  2QRX A;  4DUY B;  1KC8 Q;  4BWN A;  4QGP A;  3RVZ A;  4B3R B;  3AK2 A;  5BMV A;  2CTP A;  1SQP H;  4UXN A;  4JTC B;  4R4L A;  1QGK B;  1IBM B;  4LFB B;  1SQV G;  4JAS A;  1FJG O;  2FYU K;  1VQ8 P;  2QVA A;  5KJ7 C;  1H8E G;  3ZHT A;  1NYH A;  1EDL A;  3A0R A;  2WA4 A;  2JGD B;  4B3M O;  5EYP B;  2CH7 A;  3FGA D;  3WU2 H;  1H88 A;  2IM9 A;  2LW1 A;  4WBA A;  2OYO A;  1AJN A;  4H44 B;  4CBC A;  3JAT A;  3CC7 P;  4CZZ A;  1BQZ A;  3KCY A;  2HFE D;  2IYO A;  2KP8 A;  2G38 A;  2OTJ P;  1S5L X;  2WLM A;  3T1H B;  1XEQ A;  1T2K C;  4HNA A;  1L4A A;  1JNM A;  3JAR B;  4I55 A;  4ASU G;  3CX5 F;  1XMO O;  1N32 O;  2IX7 C;  2OYH A;  3A0B Z;  4X1I A;  2QWO B;  4XE5 B;  1JOC A;  2QM7 A;  4WB4 A;  2ZXW C;  4IYH A;  4DRX A;  5EBM C;  1EZV D;  1DLB A;  4W4L A;  3OMA B;  3SFE C;  3JAW A;  4GKK B;  1IVS A;  3J7A U;  3JAL A;  4L76 A;  2QDO A;  1FS0 E;  1NVO A;  4LF4 O;  1M57 D;  1E5W A;  1GAX A;  2IBZ G;  2NPS C;  2ZXW B;  3L71 H;  4XA4 A;  1ENV A;  3B4S A;  5IYZ B;  1G1I A;  4DV6 O;  3VQX A;  2UXB B;  2RH0 A;  4ICG A;  1LTB C;  3T1Y B;  1WPX A;  2R9A A;  1BSN A;  2RMK B;  3DSQ A;  3AE5 C;  1WP7 A;  3CYO A;  2NPS B;  4RES B;  3JSL A;  3AG2 B;  4UFZ A;  2AHY A;  2CAZ C;  4BIZ A;  5KHJ A;  4IHJ B;  1VQ6 P;  1VDF A;  1KP2 A;  1YJN P;  4Z1V A;  1X0T A;  3E1I A;  5APS A;  4YJ2 A;  2QJK C;  3A2A A;  1FJG B;  3TCU A;  4DYL A;  2WLK A;  1EDK A;  3ZMS A;  3A0H Z;  1AJQ A;  1KU9 A;  4H0L D;  3FAV B;  1XMQ O;  4B3M B;  2HVK C;  4WY4 C;  4TV8 B;  5EIB D;  1NTK E;  1SQP D;  3ZS8 C;  1KB9 I;  3BAB A;  2QJK B;  1VQ7 V;  2KIK A;  1J1D C;  3I56 P;  1RF1 A;  5E79 H;  2ZE8 A; 
#chains in the Genus database with same CATH homology
 2D2C B;  1WMK A;  2IDB A;  1PV3 A;  3Q5R A;  3EWK A;  1ZOY C;  3D6Y A;  3B71 A;  3AE3 C;  2V7Q J;  2QJP C;  3GF7 A;  2ZT9 D;  4R4L A;  4Y28 J;  1AJY A;  1VF5 D;  1JB0 J;  1OMI A;  1RQV A;  4GDO A;  3GF3 A;  3AE4 C;  1KMI Z;  5KKZ C;  4KT0 J;  1NYH A;  2E74 C;  2WPV B;  2QSI A;  2D2C D;  3FGA D;  1EXI A;  4I7Z C;  1IK7 A;  1R8E A;  1DD3 A;  2E75 D;  1OW8 A;  4H44 B;  1ZRT E;  2FXP A;  4OGQ C;  4PV1 C;  4H13 C;  2OQQ A;  3IN6 A;  2E74 B;  1S5L X;  2BEQ D;  4H0L C;  3RK3 E;  2G3A A;  1Y9B A;  4YXD C;  2H89 C;  4I7Z B;  5L8R J;  5KLI C;  1GMJ A;  1K04 A;  3AEG C;  3AE9 C;  3RL0 g;  2YMK A;  3S9O A;  1HF9 A;  4OGQ B;  4PV1 B;  1YQ3 C;  4H13 B;  4H44 D;  1MKM A;  2E76 C;  4H0L B;  3D71 A;  3AE8 C;  3SFE C;  3Q1M A;  3AEA C;  4R4M A;  1OW6 A;  3Q5P A;  3SFD C;  3R4Y A;  2ZT9 C;  1VF5 C;  3IAO A;  1Q90 D;  3O6Q A;  2E76 B;  2WSE J;  2O01 J;  1FDO A;  2JO1 A;  1DD4 A;  1EXJ A;  2WSC J;  2D2C C;  3AE1 C;  3Q2Y A;  3Q3D A;  3AE7 C;  1TU3 F;  2FBW C;  2ZT9 B;  2P10 A;  1ZP0 C;  4Z1M H;  2H88 C;  2NZ2 A;  1VF5 B;  1OW7 A;  1UIX A;  3AE5 C;  4YTP C;  1KIL E;  2E75 C;  1KOR A;  2YIU C;  1U57 A;  3H25 A;  1NGM B;  5M1B A;  2E74 D;  2J5U A;  3AEE C;  3GLM A;  3LW5 J;  3ABV C;  3T97 B;  3GMA A;  1YQ4 C;  2WSF J;  3AE2 C;  4TT3 H;  3AEB C;  1VL2 A;  2QIW A;  1K05 A;  4XFJ A;  2QJK C;  2E75 B;  3Q5S A;  4OGQ D;  4PV1 D;  2K9Y A;  1FDI A;  4H13 D;  4U7J A;  4H44 C;  1KQG B;  4H0L D;  3C8V A;  1KTM A;  2FYN C;  1PIX A;  2BEZ F;  3AE6 C;  3AEC C;  3G9R A;  2MKV A;  3AED C;  2JP3 A;  4RKU J;  2G8Y A;  3AEF C;  1HJ0 A;  3D6Z A;  1DIP A;  1S1C X;  1KQF B;  2WQY C;  4IL6 X;  3D70 A;  2QJY C;  2E76 D;  1ZME C;  1RQU A;  1PL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...