4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
5L8RJ 4RKUJ 2QSIA 3C8VA 4I7ZB 4OGQB 2FYNC 3LW5J 1ZRTE 2D2CB 4PV1B 4Y28J 2WSCJ 5KKZC 2WSFJ 4H44B 5KLIC 2E76B 2WSEJ 2O01J 1VF5B 2WPVB 2QIWA 2E75B 2ZT9B 1JB0J 2K9YA 2E74B 2QJPC 2YIUC 4H13B 2QJYC 2QJKC 1Q90D 4H0LB 4KT0J 4IL6X 1S5LX
chains in the Genus database with same CATH superfamily
3AG4B 4ZKIA 1GN6A 4DUZO 1BE3G 1HBWA 2QKAA 2BEQD 4KP4A 2Y69B 1S5LZ 1LT9A 3ETGA 1LP1A 3S4RA 4FFBB 4BIZA 3EFFK 3CXHH 4QGPA 3ZHTA 4MVUA 4PD4H 4PHZA 1RFYA 5AVQB 5BU8B 5TISE 1PNMA 3H1KJ 1Q81Q 3V2RA 1W2BU 2BOBC 1QU7A 2W0FC 2RN9A 2YXHA 1ZWIC 2Q3EA 3AG3B 2UUBB 2R9RB 1YF2A 4GKJB 1M57D 3FB5C 4I1LA 2OTKE 5BVZA 5B3SB 2GUZB 4BWAA 3CWBH 1XNRO 3IR9A 2NLJC 3ETDA 5JH7B 3FAVB 2OTJV 4X1IB 5JJEB 1MZEA 1VF6C 2Z5HA 5KLVH 1Q3EA 1E79H 3OTOB 4R4LA 4MVOA 2PFXA 4LF5O 1J2JB 1NYHA 2Q9IA 1K3EA 3ZRWB 1VQ5V 1T3UA 4QE9A 2HG5C 3KZIZ 1RY3A 3TDKA 2QM4A 2FY8A 4YHHO 2WA3A 4ASUG 4LWSA 3U10A 5EIBC 2IBZH 2KNCB 1FOSE 2EJRA 3IC7A 5KHGA 2QDOA 5JJJB 3OMAB 4C7RA 2QJKB 3LNMB 2K9JA 5HFMA 1XNQB 3PP5A 4TV8A 3W7UA 2YI8A 4DV5B 1K9MW 3ZRVA 4IIJB 4MTFA 3MTUE 2KG7B 2IPPA 3K0DA 3OMIB 3UO3A 1G8MA 3OEHG 1D5AA 3BASA 5CMZA 1KB9F 2LGWA 1M1JB 3BHPA 2WPVB 2YIDA 1SQPJ 4X64B 4IFMA 3JCZA 4TV9B 1S5HC 3H25A 4O2AA 1ZV8A 5IT9N 4DOJA 4H13B 3ZRSA 3S3WA 2Z3YA 2KSEA 3W7XA 2AEJA 3ZJZA 4B3SB 3NFQA 2JEUA 2LP7A 1LNQA 2WSSG 3H1JJ 4DW1A 3P8CE 1FE6A 3BA8A 1L0NH 4Q20A 2JEEA 4PDRA 1FZFA 1ZW0A 4QNHB 1F4NA 4HBNA 1EZVI 1VQPV 2NPSD 4NTXA 2OYIC 3SJAC 1YCIA 2CK3H 2E76C 1AB3A 4H44B 3HUSC 3RVYA 1HR0O 1KC8W 1G6UA 1WMKA 1H2SB 2F23A 1JB0J 1SA0B 2YUAA 4UVAA 3E8HA 2UUBO 4R7CA 1YDXA 3H1KG 4NKGB 4O2BB 1XEQA 4GKJO 4PJ0Z 2QWPB 4XDKA 3ASNB 1PIXA 1DF5A 4GOEA 2RH0A 1L4AC 3BCCE 5DN6G 4JI3B 4UCSA 2WWWA 4KFMA 3L73G 4YTPC 1JY3N 2DWDC 1QLEC 4TT3H 1USDA 4NXMO 5LOVB 4D6TJ 1QNMA 4WB4A 4D7TA 2C0WA 3OTOO 1COWG 1CZQA 1GM8A 4PA9A 4LBEC 5KJ7C 2Q67A 2P4KA 4JF7A 3JD4A 3E1IA 1LTJB 4X1KA 5DJTB 2A7WA 3UT5B 1P84I 4I55B 3M9QA 1XNQO 1MSWD 3OM3B 3IJ4A 4DV5O 2Y0DA 4DR3B 4FLVA 2Q7EA 3L72D 3C3SA 2ITDC 3K57A 3SWFA 5J2UB 2HJDA 3RW0A 1RQUA 2DJVA 1CI6A 1EN4A 1HGVA 1RE4A 4P2ZA 4X1YB 2KQXA 1GMGA 4ASWA 2M0BA 1JEKA 2ARHA 2NNUA 3LSUA 1SQXJ 3VN0A 4IL6E 5LMUB 2BCCD 1XREA 3K0GA 5LHGA 1YI2P 3E2EA 1SQPG 1VL2A 1CSBA 1FU1A 1QVFO 2WVRA 4IT5A 1M9NA 3OAKA 4N78E 3AG1C 2O01H 3I5DA 1LWUC 1IXBA 1NJIW 1KILA 5B1AC 2W6IG 3H1JG 3VP8A 4G27B 5IYDO 1IXMA 3E8FA 4GX2A 2LXBA 2JGDA 4LFAB 5KA5A 5GTIH 2VRSA 1N2DC 1N7SC 2HVKC 3X2QB 4E4EA 3CLQA 3DC6A 3BPZA 3H1LE 3T1YB 3H1IG 4O4JA 3G6BA 1BGYJ 5EYPA 4IYHA 3VQYA 2CTWA 1EZVD 3CJHA 4AHCA 4TUYA 3C8VA 1ZAUA 1N4CA 1Q82W 3ZMZA 1RQVA 2CGOA 1H38A 2I8DA 1VQMV 1RE4C 5EC2C 5C8YA 3EXAA 4JI3O 4QPJA 3HE4A 4A5UB 1VF7A 2KB1A 2B9ZA 4DR1B 1MABG 2XAJA 5LGUA 5EC1C 4DV4B 4P30A 4KHXA 5IYBO 2UUCB 1KILC 4J9YB 2B9BA 5GTHZ 4OPHA 2Y0PA 1HWYA 4L73A 1RPOA 2YSUB 3AE2C 1URQD 4PV1C 4DCKA 1HF9A 1GRJA 4F6EA 4I0XB 1Q8IA 5CMUA 4DR3O 1UPGA 4WY4D 3VQWA 2GSMB 5A2QN 2ITCC 1AROP 1XMOO 2KKWA 5F2VO 4MW3A 2ZT9C 1P84D 2R5BA 3ZMVA 1KILE 5L3BA 1NTKJ 4OX9O 3CCLV 4XFJA 1SQBK 1BCCD 2WTYA 1MUUA 1WA8B 2NN4A 1T8ZA 4G2KA 5LMUO 2AZ2A 3VMZA 2F66C 4EB6B 3L70E 1VQ9P 1U96A 4MVQA 2IX7C 1SQXG 4JV5O 1RPRA 2Y4UA 3D3IA 4LFCB 3GF7A 2JVDA 1SQBD 4FFKA 4ZOLB 1NTZJ 2WSFJ 3B5NA 1JCDA 2Q6QA 3GHGC 4LF4O 1YEWA 4JYBA 4JI4B 1Q86W 1K7DA 3K5MA 2ZJSE 4LFAO 4M3LA 3M99B 4Y99C 1Q90D 2IJHA 1JQ0A 1QVGU 1Q6UA 4HKZH 3HD7D 2Q0AA 4R8CA 3LUTB 4UCOA 2R72A 2ZINA 1VQOP 1M7LA 1Q7YQ 1EXJA 1SQQJ 2MK3A 3NXSA 3JARB 2Q1KA 1PP9J 3L72H 2OYIB 2P7JA 3ASOC 1K34A 2E76B 5EZYB 1HNXB 1KB9D 2IBZG 2R70A 3HUSB 2A0LA 2QA4P 4YJ3B 2UXXA 1R8EA 2M7WA 3ZEDA 3CCMV 2YEVB 3SJBC 5IYZB 3V4WA 1I5YA 4XE5B 1OIPA 3HPLC 4DV4O 3BRTB 2ETNA 1F7YA 3J81N 5AVTB 2C2AA 1W2BO 3AECC 2PI5A 3H1KD 2UUCO 1N8RW 3CCEP 2BCCH 4J42A 3FB6C 4HB1A 1H89A 4DV0B 1L4AB 2AXTZ 1GK9A 5JJNB 2V4HA 2AHZA 3FXEA 1KYOH 5IWAB 1Q2NA 1QLEB 5B5EZ 2F95B 5H2FE 1RF0A 3M06A 3HKBB 1OFCX 1YIJP 2FFDC 5KMGA 3D8CA 3L71E 2CE4A 4LF8B 4R4MA 1NH2B 2I1JA 4ZKPA 2CUGA 2P4VA 2WLJA 1IDSA 1L0NG 1S5LX 1X79B 4EFEA 5FNVB 1AA0A 1FZCC 2NPSC 1EZVH 1NTKG 3M9BA 2BSKB 3IFXA 1EQ7A 2CK3G 4DR4B 3NMDA 1YQ3C 4JI0B 3WB0A 1GO3F 1WP8A 5KHIA 2PRRA 4RQEA 4CS4A 4N6JA 3CXHI 5IDJA 3OT7A 4FFBA 1NO4A 4PD4I 1P49A 4L8JA 5EBMC 3E83A 3VYIA 2H7HA 4H0LC 1OVVA 1ZMEC 1OCZC 4JI4O 3MHVA 1L0LE 1THZA 3MAQA 4C7NB 4J10A 3JCUE 4X20A 1KMIZ 3AEAC 3GMAA 2QJ1A 3DSQA 3OW2O 3A0BZ 4EFBA 1OCCC 1YJ9V 1NVOA 1SQPD 3THOA 4JF3A 4RESB 5AW5B 3V5BA 4TT3G 3AG1B 2OARA 3CCRP 3CMAV 1LWUB 2PP6A 3UQ8A 1AI4A 1BQ0A 5B1AB 3CC2P 4MVMA 3FAVA 4X1IA 1MZFA 3H1JD 4J7JA 4MTGA 4YJ2B 2V7QJ 4GKGA 4X1KB 1HNXO 1K4DC 4JYCA 1KFMA 1NTMJ 2JJ1G 1N7SB 1F4MA 5LGTA 3BVOA 1NAYA 1P84H 3H1HE 3AK3A 1BSNA 1OCOC 2LFSA 2MKVA 1OV9A 4PDLA 3V2PA 3N7NA 5J9PC 2XAFA 2WSCH 2IBZI 1VQ4P 1LTTC 1BCCH 3KKYA 4WFGA 2IYOA 2KNCA 3CX5F 2P06A 3UIAA 1ZX3A 3CEIA 1NKNA 4DV0O 3KPEA 4KUMA 4AUWA 2CTRA 2R44A 3K3WA 2RNBA 5E79H 2KG7A 3I56P 1SQBH 2DYSC 4AQRD 5IWAO 3PHLA 1ZR2A 1DIPA 2GHYA 4DUYB 2PI4A 1HJBA 4UB6E 2EJ7A 4NPFX 1KZUB 4JPRA 4CH5A 3T2MA 1L1FA 2YNYA 1M1JA 4U3FJ 1FZAA 2E75D 1K73Q 1AJQA 1LT1A 1KILB 4LF8O 4D6TD 3L74E 1QBZA 5CCGA 4TV9A 2L6LA 3LNNA 1PZQA 4YXDC 1LUVA 4O4IA 3CC2V 3PN1A 4PV1B 1M4UA 1Y76A 2YMKA 4DR4O 3B8MA 5CB4B 1NKDA 3KHUA 1KB9H 2JJLA 2ZT9B 2FB5A 3CJHB 5JCOA 1NHLA 5KAIE 1OCRC 1SQXK 1K8AQ 4UB8H 3R66A 3KCXA 4FLXA 4YY3O 4B3TB 4AQYO 3C1LA 2YXYA 3SWKA 2YXQB 2HVJC 1QHTA 4HJGH 4XA4A 2Q69A 3HE4B 1JJ2U 3H1KH 1SA0A 1U97A 1ZRTE 3JAMN 1EN6A 4FVMA 2FYUE 1KECA 4O2BA 1SQXD 3CMEP 3ETEA 4EDFA 4YPCA 5B1OA 1JMKC 3GF3A 3O65A 1AP5A 1NU1E 3AE4C 2LW7A 4P9OA 3GHGB 3NR7A 3ZS8C 5AW9B 1BE3E 1CXZB 2XV5A 1QVFU 1M56C 2OTLP 4IL6X 1VIBA 2J58A 3L9DA 2F1MA 1R1BA 3W7SA 1NTMG 3WU2Z 4DV2O 4K8ZA 4JAAA 2B1GA 1OXZA 4QJFB 4OGQD 4KL1A 2Q5UA 5LXTA 3TF5A 3UT5A 1YJWV 1NR7A 1ZOYC 1BGYD 2YIBA 1USEA 2WPQA 2RDCA 1HGZA 3AG2C 3ASOB 1N73C 2ADPA 4F4LA 1OVUA 5CA0B 3MUDC 5KTBA 4R6ZA 2HFEC 2IBZD 2JJ2G 2QSAA 1DD3A 1L2PA 4PDVA 5AW8B 1NQTA 4DUYO 3O6QB 1KUQA 4UXNA 1UIXA 3H32A 1AVYA 5L3EA 4I4TA 4X1YA 3FWLA 3A8TA 1U57A 3FKSG 1EBOA 1GL2A 1P84E 2NRGA 4U3FG 2HLDG 1U7MA 2UXDO 1S5LH 1PV3A 1G1JA 4X66O 4WCEV 4U7NA 2WLHA 3CX5I 2B87B 2SPZA 1H2MA 3CRMA 4LH7A 1VQKV 2UXCB 1YQ4C 3H1JH 2FFDB 1NTKK 4CS2A 1PPJH 4GT1A 4E2LA 1JY3P 3TXSA 1YTFD 3AE6C 1X22A 3RL0g 2DMXA 1FZCB 2WLKA 2NPSB 5BMVA 1SQVJ 1M90W 2PGGA 2D2CC 3L72G 3ZIAG 4MVRA 4ICGA 1NTKD 1GN2A 4I9WA 1TVKA 1LTBC 1NTZK 4UFZA 2KLVA 3CD6P 4YHHB 4DV3B 1Z56A 1JTHB 4LF9O 1ZR4A 1VQLP 3RK2D 1VQ7V 2LJ2A 4F6RB 2Q73A 4UVBA 1GL2C 3TGUJ 2BEZF 3KZIH 2ADQB 5CJ4A 2BCCG 3QH9A 4H0LB 4CC5A 1OCZB 1NTZD 3CCQP 3M7MX 3JALB 4UUJC 3FXDA 1XUQA 2EIJC 2Q5ZA 4IHJA 1JNMA 2O1JA 4GUNA 2IH3C 4D6TH 4FM0A 1T3JA 1OCCB 3G6EV 5B66E 2HLOA 1SQQK 1SQFA 3WB2A 1QVGO 1N36B 5LA6B 2Q7GA 4PA7A 1W2EA 1Q82Q 3F5WC 2XU6A 2LKMA 4I0XA 3I55P 1PNKA 1SQQD 4LNUB 2W90A 2JK5C 2GV9A 2KXPB 3II6A 3A0HE 1T2KC 1PP9D 1OCOB 3L73E 3P8MC 2F4VO 2W0XA 4I7ZC 4ZBMA 2GDSA 4O9BA 4DJGA 1DX7A 4MSWC 5LBQA 5IJ9B 1WA8A 3B09A 5KAFE 1HR0B 4EB6A 2UU9O 1SQXH 1TU3F 1FYJA 2AXCA 2YKQA 3J80N 1GTOA 3GG2A 5CCHD 2DYSB 2KSJA 4J80A 4PA3A 4X20B 3CCSP 4ZOLA 2UXCO 1VPCA 4JTAB 3T1HB 1SS3A 2UXNA 3L4FA 2WLNA 1FJPA 1IFNA 2N9BA 4L75A 4X89A 4JAUA 1FAVA 2O3JA 4QPKA 1IFIA 5APSA 3BVHA 2YMYA 4PJ0H 2PTMA 3CX5D 3SYPA 1R6KA 4DV1O 1QCEA 1R3KC 4NXMB 2HPCB 3RK3D 1DH3A 1G2CA 1BGYH 3TXQA 1SQPE 3USSA 4DV3O 3JARA 1KQFB 1J1DC 2R9IA 2XAQA 4MVSA 4OPAA 2OYIA 1BCCG 1OCRB 4O4LB 2Y0CA 5EZYA 3HUSA 1AR5A 2LXCB 1IFPA 1I94O 4YJ3A 2ZAEB 2GBOA 2N1TA 3FX0A 3W7WA 2YEVA 1Q86Q 5IYZA 5E1AC 2Q7HA 3V2NA 5D5PA 1D2DA 1WN7A 5CBGA 1SQBG 2ATKC 3Q5SA 5BY1A 2ZXXA 1N36O 2OCCC 3CCSV 3M8AA 3DTUB 3HKCA 2IFNA 1L4AA 2PGDA 3H1IE 4YIOA 1PV0A 3FWNA 2E75C 1KYOI 3Q2YA 3G9RA 1NTMK 3OW2U 1Y66A 2GTAA 4UV8A 4FLUA 3GVMA 4O4IB 1WP7A 1M56B 3HKBA 1XBLA 1Y76B 1KD1Q 3G67A 1BHAA 4RAIA 5KJ7A 3K59A 3VBBA 3CPWU 4JI7O 4Q6GA 4JI8O 1SRYA 1NTMD 3B5ND 1M1KQ 4KHPB 4L76A 5FNVA 3E8BA 1NTKH 1GN4A 2FTKA 4DV6O 2WA4A 1AP6A 3BATA 2BSKA 3SPGA 3SYOA 3AG2B 2P1JA 2PY5A 2N1TC 1S2EA 3VMXA 1N73B 3FGAD 1VF5D 3OMNB 3PH0A 1SFCD 2KSDA 2DYRC 1JVMA 2W8ZA 3D6ZA 1V55C 1NS1A 3T1HO 1EN5A 1NTZH 2WT7A 1YHQP 4UCRA 3HB3B 2WSFH 3L75E 2R5DA 2FYZA 2IJIA 5JVDB 4ZIBA 3BABA 1IX9A 4C7NA 4U3FD 3KCYA 3K5LA 1QEXA 2JWDA 2XKMA 3LSQA 1N33B 2UWJE 1PGQA 2L91A 4GDOA 1U7JA 4NXNO 1WRGA 4NB5A 1TUEB 1LWUA 2PAJA 1IK7A 3AEBC 3CXHE 2YC0A 4PD4E 1P7BA 2VS0A 1SQQH 1VDFA 5H9CA 4YJ2A 1RHZB 5LXTB 1DEEG 1PP9H 1J1EC 1N7SA 4ZHQB 4IL6Z 5GTHH 2D2CB 1GAXA 2P2UA 3R2PA 4Y28J 3T97B 1KFNA 2OYHC 4LH6A 1XMOB 3UM7A 3CWBE 2OWOA 2K1EA 5LP6A 2WSEJ 3EHBB 3H32B 4I4TB 2ODMA 4OX9B 1WJZA 1B6QA 2RKLA 4GODA 1BDDA 5KLVE 1R6NA 1GL2B 2WPSA 2ZQMA 1Y6XA 4CZZA 5KHHA 1RE3C 3BCCJ 2EZPA 1PD3A 1T6AA 2YICA 4GX1A 1FOSF 1B3QA 2EIJB 4JV5B 4B3RO 3TETA 3GLMA 4K8XA 1GM9A 3JD1A 2IBZE 3OEEG 3OR6C 4UCTA 1XMQB 1KYOD 1MZ9A 3CX5H 3GWOA 2DW3A 4KHPO 4LF4B 3SYQA 1CW5A 3IC9A 1PPJG 3K58A 4LFBO 3JATB 1XI1A 1NOHA 3HKEB 1NH4A 1KQLA 5C93A 3TSIA 3QWOC 5BMVB 2NR5A 1M93A 4OH8B 4J41A 3OA7A 1D7MA 1KB9I 5CBFA 2QEXP 5CB4A 3K06A 1EFRG 1GU5A 5BU5A 1TVKB 4KXRA 4C46A 4GZRB 4I7ZB 2P7TC 5LP6C 3QO7A 1IC2A 3LSSA 3D71A 2WZ7A 2AEMA 4XDJA 4A7PA 1IJDB 5H5NA 1L0NE 2GUVA 2NZ2A 1WPXA 1N33O 2E74C 3Q3DA 2I1KA 1RP3B 1LGHB 4IHJB 4EYYQ 1YI2V 4FIPC 2PF4E 2QM7A 4D6TG 3GHGA 3SGIA 5LMNB 4AILC 3F5TA 4JI5O 2FYNC 1SQVK 3JSNA 4HNAB 5EK0A 2V7QH 2WMMA 1IBLB 4EOTA 5K1XA 2BTOA 1NTMH 4ASVA 2OGUA 3QNEA 1QR9A 4WFBV 2CTQA 3E22B 4LF6B 2AXTH 2ZXEB 3Q4HB 4JI1B 1MMMA 1CEZA 2N9YB 3BY6A 1SQVD 3G3ZA 5CBHA 3H1LJ 5B5EH 2QJYC 1J1DB 3OE7G 4DR7O 3JD2A 1NR1A 4H13D 4JBZA 5CA0A 1H2GA 1R3IC 3SPCA 1Q81W 2O1KA 4X88A 5FPOA 3O6QA 1X8YA 5FLXN 4FM2A 2IZ0A 3TGUD 5AW1B 1H2LA 1DD4A 1G1IA 4WFHA 2DN9A 2DQ3A 4B7EA 1XMQO 2OCCB 2ZE6A 4U3FH 1IFMA 4D7SA 1SLQA 3JASA 2QIWA 1LR1A 3PLNA 3V6IA 1M57C 4MT8A 2E75B 4RJTA 4FLZA 1FDOA 4JGSA 2A06D 2V1DA 3IF4A 1VARA 3A2FA 4WWIA 2VWJA 1TUBA 2O57A 4EEQA 5BR8B 2B87A 2P10A 3ML0A 2EIMC 1OWAA 1H8AA 2FFDA 1NBMG 5L3CA 3CC4P 4CH6A 4BAYA 1G2CB 2KB7P 1EDIA 1KN7A 3A0BH 2BTQA 4B86A 1BGYG 3STZC 1TGOA 5FPRA 1IO4A 4HH2A 2LQTA 1FZCA 2NPSA 5K5GB 1W59A 1PL5A 3SWYA 1K4CC 4AI8A 2N1TB 1DF4A 4JI6B 1SVFA 1VQ8P 4NTWA 5H2FZ 1GW4A 2DYRB 2ZYAA 1J5EO 3OUFA 4CC6A 1VQ9V 1JTHA 1V55B 3L70J 3L36A 2Y48A 3EVKA 4O4HB 5H6RA 2EZOA 5APXA 4F6RA 5GTIE 1I7FA 3VOUA 5KX5B 3HKCB 2YIBD 4PI2A 5LMNO 2E5YA 4TQDA 3P7KA 1TA8A 3JALA 3JC22 4U3JB 1AR4A 1BSMA 1IBLO 5DJUB 1MFTA 1VQNP 4GX5A 3G4SP 3TCUA 2KK7A 4LF6O 3FD9A 5LA6A 3D36C 4JI1O 4JI2B 1HUCA 1AQ5A 1OHHG 3JAWB 2Q0OC 1SETA 3ZX6A 2W6JG 1VQOV 5AW4B 1JCHA 2IZ1A 4JTDB 3M91A 4LNUA 1J1EB 1W0JG 4N23A 5CN0A 5EFWB 1R3LC 3JCUZ 3Q5PA 2L5GB 2QA4V 3APQA 2CPSA 5DM6V 2OYHB 1P4RA 1GK6A 3RBXA 3FB8C 3CCUP 3HE5B 5KLIC 2JS5A 1I5XA 4L74A 2QWQB 2H8PD 2RN0A 1MNGA 1AI7A 5IJ9A 1GTWA 5EBWC 2WT7B 4YY3B 1MG1A 4AQYB 3CCEV 2FL4A 4I9QA 1KKCA 1NTZG 3VTPC 3E8GA 3SFEC 4TOIA 4GX0A 4PA4A 4RKUJ 1KP2A 5L3GA 1AILA 5BR8O 1KKDA 1YYCA 2AEFA 1S4XA 2QWRB 4I50A 2XASA 4BR6A 1UFIA 1YIJV 1JX9A 3CPWO 1RSOB 2YXLA 5AVRB 3L71J 1PPJD 3ABVC 1SQQG 4N3YB 1BT8A 4R50A 4FMTA 3F89A 5B1BC 3SPIA 3IN6A 2HPCA 2XUMA 2FKWB 1FFTB 1SQVH 1VQ6P 3CRQA 4JI6O 1PP9G 3ZHVA 2N05A 2Q7CA 1FXKC 2KLUA 4UB6Z 1V54C 3SPHA 4DV2B 4JYAB 2YO2A 2FMLA 3QO5A 2WLLA 1IURA 4O4LA 5LP6B 4PDMA 1FZGA 4GOFA 2PYLA 2E3CA 2Q8VA 2QE7H 2OQQA 3WU2H 1IZ3A 1XTCC 3TGUH 2QG4A 3ABUA 4LCUC 2HR3A 5JQGA 1N7LA 4MN4C 1S1CX 3R4YA 1FZBA 4MW8A 3RYFB 2KIKA 5LL6Y 2E74B 1BQZA 2HG5D 3A7OA 1NZ6A 1L0LJ 4RQFA 3L72E 4JI2O 2ITAA 1ORQC 3MDSA 1N86A 2ZYDA 3W68A 2A06H 1S77D 5EIBD 2C9LY 2CGNA 5KAIZ 3CCRV 3OGIB 1IZNB 2RCVA 3MP7B 2FYNB 1ZUQA 3DC5A 2UXDB 4EI2A 1VEWA 2AZ0A 4X66B 3OTFA 1HVVA 1NGMB 1K9MQ 2BCCE 2H3OA 1EDKA 1JY3O 3P8CD 3ZHQA 3VOPA 3E1RA 1OX3A 3H1HJ 3ZHSA 3ABTA 1VQ4V 1XTGB 4FM1A 1KYOE 2QJYB 4KT0J 1WNSA 3CSXA 1N73A 1EM1A 1Y8AA 1ZL8A 1KORA 3MUDA 2M8RA 3N2GB 2IJKA 2RQ6A 3I56V 2QKCA 3J7AU 4GIFA 1YJNP 2Z5UA 5AVYB 1FJKA 4NVPA 3C9IA 4LF9B 1PL0A 4GLXA 3BCCD 1QX8A 4GYCB 1EZVE 2JWAA 5JVDA 3CE2A 1JY2O 1M57B 1GM7A 3TNUB 2G8YA 2YIAA 4X62B 5IE9A 1NKZB 3L74J 1WPBA 4JZ2A 3APOA 1YBKA 1URQC 2V7QG 2EIMB 1KC8Q 4K0KB 1JJOA 1FFXB 4WY4C 4NR1A 4JYAO 1M5IA 3QVNA 4XBFA 3PRJA 1L4AD 2LW1A 1WB8A 2M5AB 2G3AA 1O9HA 2ZIOA 3QTCA 4ZHQA 5J2TB 1HNZB 1LTIC 4L87A 1FXVA 3MHHC 2X6CA 4UCUA 1DK1A 4TLFA 3T97A 2VRZA 1K92A 3ABKC 1GU4A 3RWRD 2ZKOA 3ABMC 4DR2O 4Z2WA 1NVPD 5KJ7D 5FL7G 5GW7A 2F4VB 2ZYGA 4DRXA 4IFFA 2IYPA 3K5OA 5TISH 1NH2D 3CMEV 2Y9YA 2FYUJ 3G71P 1RF1C 3CCJP 5AG2A 1K97A 3A0RA 3JASB 1SF9A 3VQVA 1S72P 3P32A 2UU9B 2ZR3A 1NU1J 1ZSPA 2LO1A 1QR8A 1QGKB 1BCCE 4N78D 5H6QA 1TUBB 1BE3J 5D5QA 4Z1VA 4JASA 2K3RA 3M9HA 1JCCA 3CRRA 3HR0A 2OTLV 1Q7YW 3HD7C 1HJ0A 2EBOA 1JFFB 2Q4PA 4GKKB 5GONA 3QO8A 3WUTA 5AW0B 5E79E 4J11A 3JATA 1SQBE 3SR2C 3HKEA 1K5QA 2BTQB 1PM9A 3BEHA 3HKDB 4LLHA 5C39A 3RYIB 4DV1B 5DECA 3H1LD 1YTZT 3B77A 3UKMA 2ZM6B 5ITZA 1DEBA 2IJJA 2JO1A 3AE8C 3CXCU 3JD3A 3DXRA 3FFQA 3CI9A 5B66Z 2KP8A 1YITP 2QVAA 5KLIB 4UVCA 3ZMUA 2N04A 4B7KA 1NJIQ 4U7JA 1I94B 3BA9A 2KS1B 1DLBA 1N7SD 2QRXA 4X62O 1A02F 3VMAA 1IVSA 2QSIA 1HP8A 5CJ0A 3OD4A 2P58A 1KB9E 3I5CA 3A0HZ 4K0KO 2Q68A 4FLTA 4UB8E 4MVZA 4W4LA 2HODB 2A3QA 3AEIA 2QR4A 4HNAA 1M8OB 3CP1A 1SS1A 3H1KE 1HNZO 5KAFZ 1AVOA 2OIGA 4IFDK 5B1BB 5TISZ 3E22A 1XHZA 3H6PA 3Q4HA 3HTKB 3VMYA 2IW5A 3IGAC 4ABMA 4X9QA 1FXKB 4PI0A 1V54B 1K5SA 4JI7B 4WVZA 1KILD 4JI8B 1ZP0C 2WSEH 5CBOA 1JA8A 1VP7A 5HFLA 3CD6V 2OTJP 4DV6B 1PNLA 3U11A 3CL3D 4PV1D 1VQLV 3F7VC 3L70D 3AE1C 3BAAA 2FYUG 1Y74B 1ZN5A 3T4DA 4ZMDA 3FB7C 3BCCH 3RYHB 3CCQV 2YIUC 2JKVA 2V4DA 2CTPA 1SQGA 1MA1A 1OZHA 2ZT9D 3WUUA 4MS2A 2BOCC 1PKXA 2CAZC 2A45G 3RL0D 3ZHUA 4I50B 4GKKO 3IAOA 4CH3A 2M6YA 1EDJA 1VMGA 2K88A 1QQCA 1PGOA 3RGBA 1G4YB 3VP9A 3KYQA 3ABLC 1AJNA 2ZM6O 1GH6A 1FS0G 4NXNB 1S0VA 1P84F 3I55V 1SQVG 1AJPA 4FZ0A 5EBLC 3SJQC 1AV1A 2HYNA 2E43A 2BASA 2QJPC 4QIWF 3B71A 1S5LE 1WLEA 3L73J 2WLLB 5KHKA 4ZI7B 2FBWC 2QWNB 1JPXA 3AE5C 3F5HA 4N21A 1SZXA 2QE7G 2J59M 3OAAG 1YXBA 5JQGB 3K9SA 2UXBB 3H1JE 3LW5J 4NPDA 1PPJE 1FPOA 2P6JA 3TGUG 1OZ0A 4FZ1A 3DGEA 5IJ0A 3P30A 4IL6H 4O4HA 1K73W 2ZE8A 4CBCA 4DR5O 1VQPP 5KX5A 2XTAA 3S1KA 1S3JA 4TWKA 3K08A 1LT9C 1IBKO 2A06G 4U3JA 2KI7B 1NT2B 4NTYA 2XT9A 1V9PA 2HHHB 2CPBA 1URQB 4B3RB 1R73A 2JEXA 4OXSA 2XZRA 2W6JH 3VQXA 4QE7A 3L71D 3JAWA 3SDLA 2A79B 4WY4B 1Z2GA 3STLC 2WQYC 3KZIE 4NPEA 3D6YA 1E1QG 2IU3A 1K8AW 3H1LH 4LFBB 1N8RQ 2M3BA 2EINC 4LR3A 2E5LB 4D6TE 3C3TA 1XL4A 5APWA 1Y67A 3ICXA 1Z5VA 3WMM0 2OYHA 1ZL8B 1IFDA 2XHBA 3ABKB 1E5WA 3PJSK 1L0LK 3TYYA 2EIKC 3HE5A 3ABMB 3MGNA 4JQ0D 2IU0A 3LIEA 2VWKA 1XHXA 3ZHRA 3ETQA 1ZXGA 3RYCA 1FJGB 4DR6B 4WFEA 3ZMTA 2JDIH 1S76D 1XQ8A 2ZCEA 3O8ZA 3K04A 1RF1B 1L0LD 2A45I 1JUNA 2ZNJA 1RE3A 3H1IJ 1FDMA 3NTNA 1Q6HA 4LC1A 1I0HA 3IFMA 1KQSO 4LGDE 3HD7B 1A32A 4WF9V 2X7RB 3E35A 1RSOA 4FLYA 1SQXE 2YKOA 5AVUB 4JI5B 4OVNF 4H0LD 2WLIB 4OGQC 3AEFC 1WB7A 3WB1A 5AVSB 4J9ZB 1JOCA 3H1HD 2UUAB 2IDBA 2K37A 2VQFB 2PYJA 2KOGA 1JMBA 1GD2E 2X0LA 2UXBO 2K9PA 3CC7P 5APQA 4B3MB 3K03A 1YSCA 5AW2B 1MOFA 1OW8A 2JR8A 3M0AA 4GCZA 2FXOA 2ZVNB 4DRXB 3L70H 4ZNCA 4PJ0E 3A5TA 4WBNB 3AE3C 4DR7B 1E1RG 1EC5A 4HYOA 2YXRB 4TSFG 1BSHA 1BMFG 1H2NA 4MTXA 1YHQV 2JGUA 2KUBA 2DOSA 2B5UA 3L75J 1N32B 3RYFA 1BGYE 1YZBA 2WITA 2HHHO 2QKSA 1N34B 4X8AA 1TAEA 2B89A 3L74D 5KA6A 1PL4A 1VQMP 5AW6B 2KZJA 1JY2N 3ZMSA 2P67A 3ZN0A 5GONB 2W6BA 3H01A 2W83C 2QM8A 2Z4EA 4QMAA 1FDIA 3B8EB 1H0TB 3AEEC 4X64O 2E5LO 3B40A 3KQGA 3JSVC 3OR7C 2FXMA 3BRCA 2JRIA 2F43G 3E86A 4G28B 3U59A 2JIZG 4CH4A 5ITZB 1K05A 1X9VA 4B3SO 3DXRB 3GB7C 2FYUK 2OIEA 3MD0A 3CC7V 3RFRA 1NI8A 3B8NA 1FJGO 1S9KD 4RWUA 4DR6O 2Q3IA 3CWBJ 1Q6IA 2XOKG 1NU1K 1KP3A 2ZDIA 1FXHA 2ZE7A 4OWFA 3RK2C 2GM4A 5K1PA 1GN3A 3N2GA 1N0JA 1ZRTD 1WT6A 2FYUD 3L35A 4YXWH 5KLVJ 1NWQA 5CCHA 1J5EB 5AVWB 4XDLA 1FAFA 2FKXA 2P22C 2YIUB 2X6BA 1HDJA 1LJ2A 1XL6A 1NTKE 4BXLA 1NU1D 5BXZA 1PFIA 3JSLA 1IFJA 2YDEA 3N4XA 4TQFA 2WAMA 3C90A 2LR2A 5H2FH 3CCLP 1BE3D 3TNUA 2R32A 4EKWA 2ZE5A 3Q5RA 2QGNA 3AK1A 1URFA 3L71H 1YTZI 2BE3A 1BZKA 2UUAO 2VQFO 2MJZA 1FFXA 3ABLB 3KDPB 5AVVB 2A9HA 1NTZE 2CH7B 5LYJB 4B3MO 5APYA 3N2KA 4H37A 3RN4A 2PZSA 2QEXV 3SFDC 2ZXWC 3SPJA 1SERA 2M5AA 2QJPB 5CCGD 5J2TA 3OFNG 2F93B 4NYKA 1R6TA 5B1NA 1DGSA 2ZDIC 3CXHF 5KUKA 1M56D 3OUSA 4PD4F 3AE7C 1N32O 1XOUA 4J7ZA 2ZIMA 2JS3A 5CCHC 3E89A 4IGGA 1SQQE 1N34O 3AK2A 3L75G 1AVMA 3BCCG 2XNXA 1L0LH 1JOYA 3R65A 3JAKB 1UJWB 1L0NJ 1PP9E 3JCUH 1G1XB 3RL0C 5GTHE 4H44D 5TJHA 4PA6A 1BL8A 2GUSA 1LT9B 3CS5A 2H94A 1LP1B 3A3YB 4DK0A 1PGPA 1SC5B 2HFED 2O01N 1AQTA 1RH5B 3CCMP 5LGNA 2XAGA 4FJCC 5KHJA 5AW7B 4WBAA 3D36A 2GTSA 1JFFA 1R5LA 1Q5OA 3RK3C 4HYTB 4BW5A 1HNWB 3H1HH 1EXIA 5GTIZ 1GK4A 1HWTC 3HKDA 2D3OW 3B4SA 3EFGA 3RYIA 1EDLA 4WFAV 2EINB 1H8EG 1LTGC 3ZCCA 1R5SA 3K9AA 4LP8A 3CWBG 3CX5E 1Y47A 1ENVA 4BIOA 5CA1A 2EIKB 1SFCA 1KBHA 2B1IA 3T1YO 2K1AA 5IJ0B 3RK3E 5KLVG 3L37A 1E79G 4UB6H 3RBZA 2KS1A 4K35A 4LWSB 4DK1A 4KJMA 2D2CD 1AI6A 4W80A 5APVA 2K9JB 3L74H 3IAYA 2R3SA 1M90Q 4TV8B 1KD1W 3EQ2A 2WLMA 4DR1O 2WPDG 5L3FA 2HODA 2EX3A 4PELA 3RGUA 1M1KW 1KV4A 1FBMA 5L3DA 3CC4V 1ZLLA 4BRYA 2QTSA 2XNDH 1SZTA 3UCSC 3UO2A 1GL2D 1HH0A 3B5NC 2DQ0A 4OGQB 3H1LG 2LFRA 2ZVOB 1W5CE 1AJYA 2IH1C 4RUEA 4JAVA 5DEDA 3HTKA 5KAIH 5KUMA 1YJ9P 2RMKB 3L73D 1FXKA 4O2AB 3W7TA 2FXPA 3E7KA 1I08A 2P90A 4FPPA 1VQ8V 1UIIA 1VF5C 3CMAP 2O01J 1SFCC 4RUFA 1LUWA 3CB2A 2KZIA 1SKVA 4P9PA 1NVPB 1RM1C 1F23A 3RYCB 3K79A 4Z1MH 2GA1A 2FYUH 3GWKC 1NTME 4ZKUA 2JDIG 1Y74A 2AXTE 2HJFC 1NU1H 4AYCA 4JPZB 4I5SA 3RYHA 1T2KD 3CRAA 2G38A 2A45H 5B5EE 1FKAO 1BE3H 4DXWA 1XDCA 5CHXA 1VQNV 4DV7B 5KKZC 3AG7A 3G4SV 4LFCO 1L8DA 2EILC 1HNWO 3H9VA 1SQPK 3U1CA 2HP8A 1XILA 2OT5A 5M1BA 3ITKA 2DWEC 1H2KA 3JD0A 1YTFB 1WAZA 2N74A 4U3FE 3SSUA 2YS8A 3WG7C 5APUA 1RF0C 2B88A 4X65B 1P7GA 3CCUV 4ZI7A 2W27A 2GUZA 2IM9A 2H89C 5IY5C 1OW6A 2RMZA 5JH7A 3L70G 2R3CA 3RK2B 4K3AA 2ZNIA 3Q1MA 2OYQA 2Y9ZA 3FYIB 2HEPA 5LHHA 4DR2B 1X0TA 3A0BE 2AHYA 3ZRWA 1GKFA 1KU9A 2E5TA 4DZOA 3AG4C 3H1ID 1BHBA 5L8RJ 2Y69C 4IOIH 1BDCA 1CI6B 2POHA 3LDCA 3GW6A 3BFRA 4IIJA 1URQA 1OJHA 1KQSU 3FX7A 4U7OA 3RT3C 1GW3A 1KTMA 1EZJA 4WY4A 3AG3C 1VQ6V 4CS3A 3MZWB 1AFOA 3ZDMA 2WPRA 2K9YA 1IBMB 2Z5IA 2ZFCA 4RO0A 2ZR2A 1CPYA 2ZXWB 5B3SC 1BS3A 4FK5C 3TK1A 1FZEA 3MHSC 3KG2A 2QWOB 2JGDB 1OW7A 2WSSH 3P3NA 1HW7A 1FC2C 3LDEA 1KQGB 4JI0O 4H33A 4YXWG 4DV7O 3RVZA 1DTOA 4O4JB 3L75D 1YJWP 5EYPB 1GZLA 3G80A 1RF1A 3HRNA 3M0DA 3D70A 1NAFA 4TUYB 4W4KA 2HKOA 3RL0B 2E76D 1HTLC 3AE9C 5B66H 3AEDC 4RO2A 3L72J 3D3QA 3CCVP 1K04A 1S9KE 2N1TD 2QJKC 3OJAB 2XAHA 2OCHA 2H43A 3QF7A 5C8YB 4WFFA 4BW9A 1ZLZA 3BRVB 1J95A 3L71G 2E42A 1R3JC 3LDDA 2R9AA 2AGAA 4J7KA 2Y0EA 3CXHD 3HD7A 2J5UA 4PD4D 2C9NY 2LGQA 1QL2A 1X4TA 3RK3B 1YVWA 4HAMA 4W7ZA 3LIDA 1JO5A 4X65O 1CP9A 3N2KB 1PGJA 1US6A 2BCCJ 2WLIA 1M1JC 3A0HH 2Q6AA 3S3XA 2H88C 3L73H 2W6AA 1H8HG 1A02J 2L35A 3P3PA 5CCGC 4CPGA 1QLED 3O9OA 5KLVK 4H13C 4FLWA 5LOVA 1D5NA 3LW5H 4W7YA 3WUVA 4Y99B 3K5NA 3CWBD 1VQKP 2X6AA 5KAFH 5IYCO 5AVXB 4WBNA 1N0NA 4I6MC 2VQEB 1FS0E 4MTOA 5KLVD 4DYLA 1YJNV 1LTJA 5E79Z 3M0DC 1L0LG 5JCOC 2C0XA 1SQVE 2JP3A 3MIWA 4LF7B 4IYIA 4BIUA 4DW0A 4I55A 3SYAA 4H44C 2YO3A 4UV9A 1MKMA 3CCVV 3T1CA 1QL1A 2ILMA 3WFVA 5A9GA 4B08A 2RJZA 5J2UA 4BWNA 5CBNA 3WU2E 4DUZB 1B04A 1MFZA 3ZN1A 1IBMO 3TGUE 3KXDA 4JTCB 3ASNC 3V4QA 1VQ7P 5BZBA 4EIJA 2XDJA 2YI9A 3ZRXA 5JWPA 3CRCA 1GDTA 3B5NB 4DT0A 1OVRA 3T4ZA 1H0TA 3H1HG 1T5EA 1Q43A 1JMMA 1S5JA 1ROPA 1SQPH 3PTZA 3JYCA 4UCVA 1FD9A 3G6EP 2A06E 3CYOA 4JZGA 4JYYA 1L0NK 2YKPA 2EULA 1LTAC 5CA1B 1VF5B 4UB8Z 1SFCB 3SYCA 1QLNA 2CDYA 1RM1B 2DE0X 1LTJC 3W67A 1XNRB 5AW3B 3EWKA 1K33A 3G71V 4HZ3A 4I2LC 3CCJV 4B3TO 1L0ND 2M3EA 3K5BA 3H1IH 1S72V 1SP4A 1H88A 1KYOF 3OGCC 2ZD9A 3F7YC 3V2QA 4LF5B 2WSCJ 1LTSC 3L74G 2Q9LA 4DR5B 1SESA 1BCCJ 2QTOA 5KKZB 2Z0AA 2DW4A 1Y9BA 2AW9A 2P5OA 2KYVA 3U1AA 5CA3A 4DO2A 2EILB 1JM0A 3FYEB 4BRYB 1IBKB 3SJCC 3B2EE 2XNDG 3CHXA 1MSDA 5AVZB 5LHIA 1SQBJ 2E74D 1X59A 1W0KG 2CH7A 3ZBHA 5LYJA 1JY2P 4YIPA 3WG7B 1ZTEA 2IFMA 1O9GA 2Y0IA 4C7UA 3A2AA 5KMGB 2VQEO 1YITV 1Y4MA 1AI5A 3AEGC 2H8PC 1MV8A 4LF7O 2PUSA 5IY5B 3TJTA 2Y4TA 4Z1MG 1OMIA 1VF6A 1Z5WA 3X2QC 2MW2B 3L75H 1F51A 1GMJA 5APTA 1IK9A 3U0ZA 1B06A 2OYOA 1AR1B 1VQ5P 1EZVG 1NU1G 3QG5A 1JR9A 3JAKA 3N27A 3S9OA
chains in the Genus database with same CATH topology
3H25A 1PIXA 2BEQD 4I7ZB 3LW5J 3AE2C 4PV1C 1ZRTE 1HF9A 3D71A 1YQ3C 2JP3A 2H89C 4YTPC 2JO1A 1EXIA 3AE8C 1OW6A 4H44C 4TT3H 1NGMB 3GF3A 3AE4C 1MKMA 3Q1MA 2ZT9C 2NZ2A 2E74C 3Q3DA 1FDIA 1KILE 3FGAD 1VF5D 3AEEC 4U7JA 4H0LC 1ZMEC 4XFJA 3D6ZA 4KT0J 4IL6X 1KMIZ 1K05A 3AEAC 3GMAA 5L8RJ 2QSIA 4I7ZC 1KORA 3RK3E 2FYNC 2WQYC 4OGQD 3Q5PA 3D6YA 3GF7A 1RQUA 1ZOYC 2D2CD 4R4LA 1NYHA 2WSFJ 5KLIC 1TU3F 4GDOA 1KTMA 2V7QJ 1VF5B 1DD3A 2K9YA 1IK7A 2G8YA 3AEBC 2QJYC 1Q90D 3EWKA 2MKVA 3SFEC 1UIXA 4H13D 4RKUJ 1VL2A 4OGQB 1U57A 1ZP0C 3O6QA 1EXJA 1OW7A 1AJYA 2D2CB 3T97B 4Y28J 3Q5RA 2WSCJ 1KQGB 4PV1D 1DD4A 1PV3A 2G3AA 2FXPA 1Y9BA 2E76B 2WSEJ 3AE1C 1VF5C 2O01J 1DIPA 2WPVB 3D70A 1YQ4C 2QIWA 3ABVC 2E75B 1R8EA 2E76D 3AE9C 3IN6A 3AEDC 1KQFB 4Z1MH 2YIUC 1FDOA 1K04A 3SFDC 4H13B 2QJKC 2ZT9D 2E75D 2E74D 2P10A 3AECC 4H0LD 3AE6C 3C8VA 3AEFC 4OGQC 3RL0g 3IAOA 3AE7C 1RQVA 2D2CC 2J5UA 3GLMA 4YXDC 4PV1B 2IDBA 3AEGC 5KKZC 2YMKA 2OQQA 3Q5SA 2E76C 4H44B 2H88C 1OW8A 1OMIA 1PL5A 1S1CX 3R4YA 2E75C 1WMKA 3Q2YA 1GMJA 4H44D 2ZT9B 3G9RA 3AE3C 1JB0J 2E74B 1HJ0A 2QJPC 4H13C 3B71A 5M1BA 2BEZF 4H0LB 4R4MA 3S9OA 2FBWC 3AE5C 1S5LX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R J;  4RKU J;  2QSI A;  3C8V A;  4I7Z B;  4OGQ B;  2FYN C;  3LW5 J;  1ZRT E;  2D2C B;  4PV1 B;  4Y28 J;  2WSC J;  5KKZ C;  2WSF J;  4H44 B;  5KLI C;  2E76 B;  2WSE J;  2O01 J;  1VF5 B;  2WPV B;  2QIW A;  2E75 B;  2ZT9 B;  1JB0 J;  2K9Y A;  2E74 B;  2QJP C;  2YIU C;  4H13 B;  2QJY C;  2QJK C;  1Q90 D;  4H0L B;  4KT0 J;  4IL6 X;  1S5L X; 
#chains in the Genus database with same CATH topology
 3AG4 B;  4ZKI A;  1GN6 A;  4DUZ O;  1BE3 G;  1HBW A;  2QKA A;  2BEQ D;  4KP4 A;  2Y69 B;  1S5L Z;  1LT9 A;  3ETG A;  1LP1 A;  3S4R A;  4FFB B;  4BIZ A;  3EFF K;  3CXH H;  4QGP A;  3ZHT A;  4MVU A;  4PD4 H;  4PHZ A;  1RFY A;  5AVQ B;  5BU8 B;  5TIS E;  1PNM A;  3H1K J;  1Q81 Q;  3V2R A;  1W2B U;  2BOB C;  1QU7 A;  2W0F C;  2RN9 A;  2YXH A;  1ZWI C;  2Q3E A;  3AG3 B;  2UUB B;  2R9R B;  1YF2 A;  4GKJ B;  1M57 D;  3FB5 C;  4I1L A;  2OTK E;  5BVZ A;  5B3S B;  2GUZ B;  4BWA A;  3CWB H;  1XNR O;  3IR9 A;  2NLJ C;  3ETD A;  5JH7 B;  3FAV B;  2OTJ V;  4X1I B;  5JJE B;  1MZE A;  1VF6 C;  2Z5H A;  5KLV H;  1Q3E A;  1E79 H;  3OTO B;  4R4L A;  4MVO A;  2PFX A;  4LF5 O;  1J2J B;  1NYH A;  2Q9I A;  1K3E A;  3ZRW B;  1VQ5 V;  1T3U A;  4QE9 A;  2HG5 C;  3KZI Z;  1RY3 A;  3TDK A;  2QM4 A;  2FY8 A;  4YHH O;  2WA3 A;  4ASU G;  4LWS A;  3U10 A;  5EIB C;  2IBZ H;  2KNC B;  1FOS E;  2EJR A;  3IC7 A;  5KHG A;  2QDO A;  5JJJ B;  3OMA B;  4C7R A;  2QJK B;  3LNM B;  2K9J A;  5HFM A;  1XNQ B;  3PP5 A;  4TV8 A;  3W7U A;  2YI8 A;  4DV5 B;  1K9M W;  3ZRV A;  4IIJ B;  4MTF A;  3MTU E;  2KG7 B;  2IPP A;  3K0D A;  3OMI B;  3UO3 A;  1G8M A;  3OEH G;  1D5A A;  3BAS A;  5CMZ A;  1KB9 F;  2LGW A;  1M1J B;  3BHP A;  2WPV B;  2YID A;  1SQP J;  4X64 B;  4IFM A;  3JCZ A;  4TV9 B;  1S5H C;  3H25 A;  4O2A A;  1ZV8 A;  5IT9 N;  4DOJ A;  4H13 B;  3ZRS A;  3S3W A;  2Z3Y A;  2KSE A;  3W7X A;  2AEJ A;  3ZJZ A;  4B3S B;  3NFQ A;  2JEU A;  2LP7 A;  1LNQ A;  2WSS G;  3H1J J;  4DW1 A;  3P8C E;  1FE6 A;  3BA8 A;  1L0N H;  4Q20 A;  2JEE A;  4PDR A;  1FZF A;  1ZW0 A;  4QNH B;  1F4N A;  4HBN A;  1EZV I;  1VQP V;  2NPS D;  4NTX A;  2OYI C;  3SJA C;  1YCI A;  2CK3 H;  2E76 C;  1AB3 A;  4H44 B;  3HUS C;  3RVY A;  1HR0 O;  1KC8 W;  1G6U A;  1WMK A;  1H2S B;  2F23 A;  1JB0 J;  1SA0 B;  2YUA A;  4UVA A;  3E8H A;  2UUB O;  4R7C A;  1YDX A;  3H1K G;  4NKG B;  4O2B B;  1XEQ A;  4GKJ O;  4PJ0 Z;  2QWP B;  4XDK A;  3ASN B;  1PIX A;  1DF5 A;  4GOE A;  2RH0 A;  1L4A C;  3BCC E;  5DN6 G;  4JI3 B;  4UCS A;  2WWW A;  4KFM A;  3L73 G;  4YTP C;  1JY3 N;  2DWD C;  1QLE C;  4TT3 H;  1USD A;  4NXM O;  5LOV B;  4D6T J;  1QNM A;  4WB4 A;  4D7T A;  2C0W A;  3OTO O;  1COW G;  1CZQ A;  1GM8 A;  4PA9 A;  4LBE C;  5KJ7 C;  2Q67 A;  2P4K A;  4JF7 A;  3JD4 A;  3E1I A;  1LTJ B;  4X1K A;  5DJT B;  2A7W A;  3UT5 B;  1P84 I;  4I55 B;  3M9Q A;  1XNQ O;  1MSW D;  3OM3 B;  3IJ4 A;  4DV5 O;  2Y0D A;  4DR3 B;  4FLV A;  2Q7E A;  3L72 D;  3C3S A;  2ITD C;  3K57 A;  3SWF A;  5J2U B;  2HJD A;  3RW0 A;  1RQU A;  2DJV A;  1CI6 A;  1EN4 A;  1HGV A;  1RE4 A;  4P2Z A;  4X1Y B;  2KQX A;  1GMG A;  4ASW A;  2M0B A;  1JEK A;  2ARH A;  2NNU A;  3LSU A;  1SQX J;  3VN0 A;  4IL6 E;  5LMU B;  2BCC D;  1XRE A;  3K0G A;  5LHG A;  1YI2 P;  3E2E A;  1SQP G;  1VL2 A;  1CSB A;  1FU1 A;  1QVF O;  2WVR A;  4IT5 A;  1M9N A;  3OAK A;  4N78 E;  3AG1 C;  2O01 H;  3I5D A;  1LWU C;  1IXB A;  1NJI W;  1KIL A;  5B1A C;  2W6I G;  3H1J G;  3VP8 A;  4G27 B;  5IYD O;  1IXM A;  3E8F A;  4GX2 A;  2LXB A;  2JGD A;  4LFA B;  5KA5 A;  5GTI H;  2VRS A;  1N2D C;  1N7S C;  2HVK C;  3X2Q B;  4E4E A;  3CLQ A;  3DC6 A;  3BPZ A;  3H1L E;  3T1Y B;  3H1I G;  4O4J A;  3G6B A;  1BGY J;  5EYP A;  4IYH A;  3VQY A;  2CTW A;  1EZV D;  3CJH A;  4AHC A;  4TUY A;  3C8V A;  1ZAU A;  1N4C A;  1Q82 W;  3ZMZ A;  1RQV A;  2CGO A;  1H38 A;  2I8D A;  1VQM V;  1RE4 C;  5EC2 C;  5C8Y A;  3EXA A;  4JI3 O;  4QPJ A;  3HE4 A;  4A5U B;  1VF7 A;  2KB1 A;  2B9Z A;  4DR1 B;  1MAB G;  2XAJ A;  5LGU A;  5EC1 C;  4DV4 B;  4P30 A;  4KHX A;  5IYB O;  2UUC B;  1KIL C;  4J9Y B;  2B9B A;  5GTH Z;  4OPH A;  2Y0P A;  1HWY A;  4L73 A;  1RPO A;  2YSU B;  3AE2 C;  1URQ D;  4PV1 C;  4DCK A;  1HF9 A;  1GRJ A;  4F6E A;  4I0X B;  1Q8I A;  5CMU A;  4DR3 O;  1UPG A;  4WY4 D;  3VQW A;  2GSM B;  5A2Q N;  2ITC C;  1ARO P;  1XMO O;  2KKW A;  5F2V O;  4MW3 A;  2ZT9 C;  1P84 D;  2R5B A;  3ZMV A;  1KIL E;  5L3B A;  1NTK J;  4OX9 O;  3CCL V;  4XFJ A;  1SQB K;  1BCC D;  2WTY A;  1MUU A;  1WA8 B;  2NN4 A;  1T8Z A;  4G2K A;  5LMU O;  2AZ2 A;  3VMZ A;  2F66 C;  4EB6 B;  3L70 E;  1VQ9 P;  1U96 A;  4MVQ A;  2IX7 C;  1SQX G;  4JV5 O;  1RPR A;  2Y4U A;  3D3I A;  4LFC B;  3GF7 A;  2JVD A;  1SQB D;  4FFK A;  4ZOL B;  1NTZ J;  2WSF J;  3B5N A;  1JCD A;  2Q6Q A;  3GHG C;  4LF4 O;  1YEW A;  4JYB A;  4JI4 B;  1Q86 W;  1K7D A;  3K5M A;  2ZJS E;  4LFA O;  4M3L A;  3M99 B;  4Y99 C;  1Q90 D;  2IJH A;  1JQ0 A;  1QVG U;  1Q6U A;  4HKZ H;  3HD7 D;  2Q0A A;  4R8C A;  3LUT B;  4UCO A;  2R72 A;  2ZIN A;  1VQO P;  1M7L A;  1Q7Y Q;  1EXJ A;  1SQQ J;  2MK3 A;  3NXS A;  3JAR B;  2Q1K A;  1PP9 J;  3L72 H;  2OYI B;  2P7J A;  3ASO C;  1K34 A;  2E76 B;  5EZY B;  1HNX B;  1KB9 D;  2IBZ G;  2R70 A;  3HUS B;  2A0L A;  2QA4 P;  4YJ3 B;  2UXX A;  1R8E A;  2M7W A;  3ZED A;  3CCM V;  2YEV B;  3SJB C;  5IYZ B;  3V4W A;  1I5Y A;  4XE5 B;  1OIP A;  3HPL C;  4DV4 O;  3BRT B;  2ETN A;  1F7Y A;  3J81 N;  5AVT B;  2C2A A;  1W2B O;  3AEC C;  2PI5 A;  3H1K D;  2UUC O;  1N8R W;  3CCE P;  2BCC H;  4J42 A;  3FB6 C;  4HB1 A;  1H89 A;  4DV0 B;  1L4A B;  2AXT Z;  1GK9 A;  5JJN B;  2V4H A;  2AHZ A;  3FXE A;  1KYO H;  5IWA B;  1Q2N A;  1QLE B;  5B5E Z;  2F95 B;  5H2F E;  1RF0 A;  3M06 A;  3HKB B;  1OFC X;  1YIJ P;  2FFD C;  5KMG A;  3D8C A;  3L71 E;  2CE4 A;  4LF8 B;  4R4M A;  1NH2 B;  2I1J A;  4ZKP A;  2CUG A;  2P4V A;  2WLJ A;  1IDS A;  1L0N G;  1S5L X;  1X79 B;  4EFE A;  5FNV B;  1AA0 A;  1FZC C;  2NPS C;  1EZV H;  1NTK G;  3M9B A;  2BSK B;  3IFX A;  1EQ7 A;  2CK3 G;  4DR4 B;  3NMD A;  1YQ3 C;  4JI0 B;  3WB0 A;  1GO3 F;  1WP8 A;  5KHI A;  2PRR A;  4RQE A;  4CS4 A;  4N6J A;  3CXH I;  5IDJ A;  3OT7 A;  4FFB A;  1NO4 A;  4PD4 I;  1P49 A;  4L8J A;  5EBM C;  3E83 A;  3VYI A;  2H7H A;  4H0L C;  1OVV A;  1ZME C;  1OCZ C;  4JI4 O;  3MHV A;  1L0L E;  1THZ A;  3MAQ A;  4C7N B;  4J10 A;  3JCU E;  4X20 A;  1KMI Z;  3AEA C;  3GMA A;  2QJ1 A;  3DSQ A;  3OW2 O;  3A0B Z;  4EFB A;  1OCC C;  1YJ9 V;  1NVO A;  1SQP D;  3THO A;  4JF3 A;  4RES B;  5AW5 B;  3V5B A;  4TT3 G;  3AG1 B;  2OAR A;  3CCR P;  3CMA V;  1LWU B;  2PP6 A;  3UQ8 A;  1AI4 A;  1BQ0 A;  5B1A B;  3CC2 P;  4MVM A;  3FAV A;  4X1I A;  1MZF A;  3H1J D;  4J7J A;  4MTG A;  4YJ2 B;  2V7Q J;  4GKG A;  4X1K B;  1HNX O;  1K4D C;  4JYC A;  1KFM A;  1NTM J;  2JJ1 G;  1N7S B;  1F4M A;  5LGT A;  3BVO A;  1NAY A;  1P84 H;  3H1H E;  3AK3 A;  1BSN A;  1OCO C;  2LFS A;  2MKV A;  1OV9 A;  4PDL A;  3V2P A;  3N7N A;  5J9P C;  2XAF A;  2WSC H;  2IBZ I;  1VQ4 P;  1LTT C;  1BCC H;  3KKY A;  4WFG A;  2IYO A;  2KNC A;  3CX5 F;  2P06 A;  3UIA A;  1ZX3 A;  3CEI A;  1NKN A;  4DV0 O;  3KPE A;  4KUM A;  4AUW A;  2CTR A;  2R44 A;  3K3W A;  2RNB A;  5E79 H;  2KG7 A;  3I56 P;  1SQB H;  2DYS C;  4AQR D;  5IWA O;  3PHL A;  1ZR2 A;  1DIP A;  2GHY A;  4DUY B;  2PI4 A;  1HJB A;  4UB6 E;  2EJ7 A;  4NPF X;  1KZU B;  4JPR A;  4CH5 A;  3T2M A;  1L1F A;  2YNY A;  1M1J A;  4U3F J;  1FZA A;  2E75 D;  1K73 Q;  1AJQ A;  1LT1 A;  1KIL B;  4LF8 O;  4D6T D;  3L74 E;  1QBZ A;  5CCG A;  4TV9 A;  2L6L A;  3LNN A;  1PZQ A;  4YXD C;  1LUV A;  4O4I A;  3CC2 V;  3PN1 A;  4PV1 B;  1M4U A;  1Y76 A;  2YMK A;  4DR4 O;  3B8M A;  5CB4 B;  1NKD A;  3KHU A;  1KB9 H;  2JJL A;  2ZT9 B;  2FB5 A;  3CJH B;  5JCO A;  1NHL A;  5KAI E;  1OCR C;  1SQX K;  1K8A Q;  4UB8 H;  3R66 A;  3KCX A;  4FLX A;  4YY3 O;  4B3T B;  4AQY O;  3C1L A;  2YXY A;  3SWK A;  2YXQ B;  2HVJ C;  1QHT A;  4HJG H;  4XA4 A;  2Q69 A;  3HE4 B;  1JJ2 U;  3H1K H;  1SA0 A;  1U97 A;  1ZRT E;  3JAM N;  1EN6 A;  4FVM A;  2FYU E;  1KEC A;  4O2B A;  1SQX D;  3CME P;  3ETE A;  4EDF A;  4YPC A;  5B1O A;  1JMK C;  3GF3 A;  3O65 A;  1AP5 A;  1NU1 E;  3AE4 C;  2LW7 A;  4P9O A;  3GHG B;  3NR7 A;  3ZS8 C;  5AW9 B;  1BE3 E;  1CXZ B;  2XV5 A;  1QVF U;  1M56 C;  2OTL P;  4IL6 X;  1VIB A;  2J58 A;  3L9D A;  2F1M A;  1R1B A;  3W7S A;  1NTM G;  3WU2 Z;  4DV2 O;  4K8Z A;  4JAA A;  2B1G A;  1OXZ A;  4QJF B;  4OGQ D;  4KL1 A;  2Q5U A;  5LXT A;  3TF5 A;  3UT5 A;  1YJW V;  1NR7 A;  1ZOY C;  1BGY D;  2YIB A;  1USE A;  2WPQ A;  2RDC A;  1HGZ A;  3AG2 C;  3ASO B;  1N73 C;  2ADP A;  4F4L A;  1OVU A;  5CA0 B;  3MUD C;  5KTB A;  4R6Z A;  2HFE C;  2IBZ D;  2JJ2 G;  2QSA A;  1DD3 A;  1L2P A;  4PDV A;  5AW8 B;  1NQT A;  4DUY O;  3O6Q B;  1KUQ A;  4UXN A;  1UIX A;  3H32 A;  1AVY A;  5L3E A;  4I4T A;  4X1Y A;  3FWL A;  3A8T A;  1U57 A;  3FKS G;  1EBO A;  1GL2 A;  1P84 E;  2NRG A;  4U3F G;  2HLD G;  1U7M A;  2UXD O;  1S5L H;  1PV3 A;  1G1J A;  4X66 O;  4WCE V;  4U7N A;  2WLH A;  3CX5 I;  2B87 B;  2SPZ A;  1H2M A;  3CRM A;  4LH7 A;  1VQK V;  2UXC B;  1YQ4 C;  3H1J H;  2FFD B;  1NTK K;  4CS2 A;  1PPJ H;  4GT1 A;  4E2L A;  1JY3 P;  3TXS A;  1YTF D;  3AE6 C;  1X22 A;  3RL0 g;  2DMX A;  1FZC B;  2WLK A;  2NPS B;  5BMV A;  1SQV J;  1M90 W;  2PGG A;  2D2C C;  3L72 G;  3ZIA G;  4MVR A;  4ICG A;  1NTK D;  1GN2 A;  4I9W A;  1TVK A;  1LTB C;  1NTZ K;  4UFZ A;  2KLV A;  3CD6 P;  4YHH B;  4DV3 B;  1Z56 A;  1JTH B;  4LF9 O;  1ZR4 A;  1VQL P;  3RK2 D;  1VQ7 V;  2LJ2 A;  4F6R B;  2Q73 A;  4UVB A;  1GL2 C;  3TGU J;  2BEZ F;  3KZI H;  2ADQ B;  5CJ4 A;  2BCC G;  3QH9 A;  4H0L B;  4CC5 A;  1OCZ B;  1NTZ D;  3CCQ P;  3M7M X;  3JAL B;  4UUJ C;  3FXD A;  1XUQ A;  2EIJ C;  2Q5Z A;  4IHJ A;  1JNM A;  2O1J A;  4GUN A;  2IH3 C;  4D6T H;  4FM0 A;  1T3J A;  1OCC B;  3G6E V;  5B66 E;  2HLO A;  1SQQ K;  1SQF A;  3WB2 A;  1QVG O;  1N36 B;  5LA6 B;  2Q7G A;  4PA7 A;  1W2E A;  1Q82 Q;  3F5W C;  2XU6 A;  2LKM A;  4I0X A;  3I55 P;  1PNK A;  1SQQ D;  4LNU B;  2W90 A;  2JK5 C;  2GV9 A;  2KXP B;  3II6 A;  3A0H E;  1T2K C;  1PP9 D;  1OCO B;  3L73 E;  3P8M C;  2F4V O;  2W0X A;  4I7Z C;  4ZBM A;  2GDS A;  4O9B A;  4DJG A;  1DX7 A;  4MSW C;  5LBQ A;  5IJ9 B;  1WA8 A;  3B09 A;  5KAF E;  1HR0 B;  4EB6 A;  2UU9 O;  1SQX H;  1TU3 F;  1FYJ A;  2AXC A;  2YKQ A;  3J80 N;  1GTO A;  3GG2 A;  5CCH D;  2DYS B;  2KSJ A;  4J80 A;  4PA3 A;  4X20 B;  3CCS P;  4ZOL A;  2UXC O;  1VPC A;  4JTA B;  3T1H B;  1SS3 A;  2UXN A;  3L4F A;  2WLN A;  1FJP A;  1IFN A;  2N9B A;  4L75 A;  4X89 A;  4JAU A;  1FAV A;  2O3J A;  4QPK A;  1IFI A;  5APS A;  3BVH A;  2YMY A;  4PJ0 H;  2PTM A;  3CX5 D;  3SYP A;  1R6K A;  4DV1 O;  1QCE A;  1R3K C;  4NXM B;  2HPC B;  3RK3 D;  1DH3 A;  1G2C A;  1BGY H;  3TXQ A;  1SQP E;  3USS A;  4DV3 O;  3JAR A;  1KQF B;  1J1D C;  2R9I A;  2XAQ A;  4MVS A;  4OPA A;  2OYI A;  1BCC G;  1OCR B;  4O4L B;  2Y0C A;  5EZY A;  3HUS A;  1AR5 A;  2LXC B;  1IFP A;  1I94 O;  4YJ3 A;  2ZAE B;  2GBO A;  2N1T A;  3FX0 A;  3W7W A;  2YEV A;  1Q86 Q;  5IYZ A;  5E1A C;  2Q7H A;  3V2N A;  5D5P A;  1D2D A;  1WN7 A;  5CBG A;  1SQB G;  2ATK C;  3Q5S A;  5BY1 A;  2ZXX A;  1N36 O;  2OCC C;  3CCS V;  3M8A A;  3DTU B;  3HKC A;  2IFN A;  1L4A A;  2PGD A;  3H1I E;  4YIO A;  1PV0 A;  3FWN A;  2E75 C;  1KYO I;  3Q2Y A;  3G9R A;  1NTM K;  3OW2 U;  1Y66 A;  2GTA A;  4UV8 A;  4FLU A;  3GVM A;  4O4I B;  1WP7 A;  1M56 B;  3HKB A;  1XBL A;  1Y76 B;  1KD1 Q;  3G67 A;  1BHA A;  4RAI A;  5KJ7 A;  3K59 A;  3VBB A;  3CPW U;  4JI7 O;  4Q6G A;  4JI8 O;  1SRY A;  1NTM D;  3B5N D;  1M1K Q;  4KHP B;  4L76 A;  5FNV A;  3E8B A;  1NTK H;  1GN4 A;  2FTK A;  4DV6 O;  2WA4 A;  1AP6 A;  3BAT A;  2BSK A;  3SPG A;  3SYO A;  3AG2 B;  2P1J A;  2PY5 A;  2N1T C;  1S2E A;  3VMX A;  1N73 B;  3FGA D;  1VF5 D;  3OMN B;  3PH0 A;  1SFC D;  2KSD A;  2DYR C;  1JVM A;  2W8Z A;  3D6Z A;  1V55 C;  1NS1 A;  3T1H O;  1EN5 A;  1NTZ H;  2WT7 A;  1YHQ P;  4UCR A;  3HB3 B;  2WSF H;  3L75 E;  2R5D A;  2FYZ A;  2IJI A;  5JVD B;  4ZIB A;  3BAB A;  1IX9 A;  4C7N A;  4U3F D;  3KCY A;  3K5L A;  1QEX A;  2JWD A;  2XKM A;  3LSQ A;  1N33 B;  2UWJ E;  1PGQ A;  2L91 A;  4GDO A;  1U7J A;  4NXN O;  1WRG A;  4NB5 A;  1TUE B;  1LWU A;  2PAJ A;  1IK7 A;  3AEB C;  3CXH E;  2YC0 A;  4PD4 E;  1P7B A;  2VS0 A;  1SQQ H;  1VDF A;  5H9C A;  4YJ2 A;  1RHZ B;  5LXT B;  1DEE G;  1PP9 H;  1J1E C;  1N7S A;  4ZHQ B;  4IL6 Z;  5GTH H;  2D2C B;  1GAX A;  2P2U A;  3R2P A;  4Y28 J;  3T97 B;  1KFN A;  2OYH C;  4LH6 A;  1XMO B;  3UM7 A;  3CWB E;  2OWO A;  2K1E A;  5LP6 A;  2WSE J;  3EHB B;  3H32 B;  4I4T B;  2ODM A;  4OX9 B;  1WJZ A;  1B6Q A;  2RKL A;  4GOD A;  1BDD A;  5KLV E;  1R6N A;  1GL2 B;  2WPS A;  2ZQM A;  1Y6X A;  4CZZ A;  5KHH A;  1RE3 C;  3BCC J;  2EZP A;  1PD3 A;  1T6A A;  2YIC A;  4GX1 A;  1FOS F;  1B3Q A;  2EIJ B;  4JV5 B;  4B3R O;  3TET A;  3GLM A;  4K8X A;  1GM9 A;  3JD1 A;  2IBZ E;  3OEE G;  3OR6 C;  4UCT A;  1XMQ B;  1KYO D;  1MZ9 A;  3CX5 H;  3GWO A;  2DW3 A;  4KHP O;  4LF4 B;  3SYQ A;  1CW5 A;  3IC9 A;  1PPJ G;  3K58 A;  4LFB O;  3JAT B;  1XI1 A;  1NOH A;  3HKE B;  1NH4 A;  1KQL A;  5C93 A;  3TSI A;  3QWO C;  5BMV B;  2NR5 A;  1M93 A;  4OH8 B;  4J41 A;  3OA7 A;  1D7M A;  1KB9 I;  5CBF A;  2QEX P;  5CB4 A;  3K06 A;  1EFR G;  1GU5 A;  5BU5 A;  1TVK B;  4KXR A;  4C46 A;  4GZR B;  4I7Z B;  2P7T C;  5LP6 C;  3QO7 A;  1IC2 A;  3LSS A;  3D71 A;  2WZ7 A;  2AEM A;  4XDJ A;  4A7P A;  1IJD B;  5H5N A;  1L0N E;  2GUV A;  2NZ2 A;  1WPX A;  1N33 O;  2E74 C;  3Q3D A;  2I1K A;  1RP3 B;  1LGH B;  4IHJ B;  4EYY Q;  1YI2 V;  4FIP C;  2PF4 E;  2QM7 A;  4D6T G;  3GHG A;  3SGI A;  5LMN B;  4AIL C;  3F5T A;  4JI5 O;  2FYN C;  1SQV K;  3JSN A;  4HNA B;  5EK0 A;  2V7Q H;  2WMM A;  1IBL B;  4EOT A;  5K1X A;  2BTO A;  1NTM H;  4ASV A;  2OGU A;  3QNE A;  1QR9 A;  4WFB V;  2CTQ A;  3E22 B;  4LF6 B;  2AXT H;  2ZXE B;  3Q4H B;  4JI1 B;  1MMM A;  1CEZ A;  2N9Y B;  3BY6 A;  1SQV D;  3G3Z A;  5CBH A;  3H1L J;  5B5E H;  2QJY C;  1J1D B;  3OE7 G;  4DR7 O;  3JD2 A;  1NR1 A;  4H13 D;  4JBZ A;  5CA0 A;  1H2G A;  1R3I C;  3SPC A;  1Q81 W;  2O1K A;  4X88 A;  5FPO A;  3O6Q A;  1X8Y A;  5FLX N;  4FM2 A;  2IZ0 A;  3TGU D;  5AW1 B;  1H2L A;  1DD4 A;  1G1I A;  4WFH A;  2DN9 A;  2DQ3 A;  4B7E A;  1XMQ O;  2OCC B;  2ZE6 A;  4U3F H;  1IFM A;  4D7S A;  1SLQ A;  3JAS A;  2QIW A;  1LR1 A;  3PLN A;  3V6I A;  1M57 C;  4MT8 A;  2E75 B;  4RJT A;  4FLZ A;  1FDO A;  4JGS A;  2A06 D;  2V1D A;  3IF4 A;  1VAR A;  3A2F A;  4WWI A;  2VWJ A;  1TUB A;  2O57 A;  4EEQ A;  5BR8 B;  2B87 A;  2P10 A;  3ML0 A;  2EIM C;  1OWA A;  1H8A A;  2FFD A;  1NBM G;  5L3C A;  3CC4 P;  4CH6 A;  4BAY A;  1G2C B;  2KB7 P;  1EDI A;  1KN7 A;  3A0B H;  2BTQ A;  4B86 A;  1BGY G;  3STZ C;  1TGO A;  5FPR A;  1IO4 A;  4HH2 A;  2LQT A;  1FZC A;  2NPS A;  5K5G B;  1W59 A;  1PL5 A;  3SWY A;  1K4C C;  4AI8 A;  2N1T B;  1DF4 A;  4JI6 B;  1SVF A;  1VQ8 P;  4NTW A;  5H2F Z;  1GW4 A;  2DYR B;  2ZYA A;  1J5E O;  3OUF A;  4CC6 A;  1VQ9 V;  1JTH A;  1V55 B;  3L70 J;  3L36 A;  2Y48 A;  3EVK A;  4O4H B;  5H6R A;  2EZO A;  5APX A;  4F6R A;  5GTI E;  1I7F A;  3VOU A;  5KX5 B;  3HKC B;  2YIB D;  4PI2 A;  5LMN O;  2E5Y A;  4TQD A;  3P7K A;  1TA8 A;  3JAL A;  3JC2 2;  4U3J B;  1AR4 A;  1BSM A;  1IBL O;  5DJU B;  1MFT A;  1VQN P;  4GX5 A;  3G4S P;  3TCU A;  2KK7 A;  4LF6 O;  3FD9 A;  5LA6 A;  3D36 C;  4JI1 O;  4JI2 B;  1HUC A;  1AQ5 A;  1OHH G;  3JAW B;  2Q0O C;  1SET A;  3ZX6 A;  2W6J G;  1VQO V;  5AW4 B;  1JCH A;  2IZ1 A;  4JTD B;  3M91 A;  4LNU A;  1J1E B;  1W0J G;  4N23 A;  5CN0 A;  5EFW B;  1R3L C;  3JCU Z;  3Q5P A;  2L5G B;  2QA4 V;  3APQ A;  2CPS A;  5DM6 V;  2OYH B;  1P4R A;  1GK6 A;  3RBX A;  3FB8 C;  3CCU P;  3HE5 B;  5KLI C;  2JS5 A;  1I5X A;  4L74 A;  2QWQ B;  2H8P D;  2RN0 A;  1MNG A;  1AI7 A;  5IJ9 A;  1GTW A;  5EBW C;  2WT7 B;  4YY3 B;  1MG1 A;  4AQY B;  3CCE V;  2FL4 A;  4I9Q A;  1KKC A;  1NTZ G;  3VTP C;  3E8G A;  3SFE C;  4TOI A;  4GX0 A;  4PA4 A;  4RKU J;  1KP2 A;  5L3G A;  1AIL A;  5BR8 O;  1KKD A;  1YYC A;  2AEF A;  1S4X A;  2QWR B;  4I50 A;  2XAS A;  4BR6 A;  1UFI A;  1YIJ V;  1JX9 A;  3CPW O;  1RSO B;  2YXL A;  5AVR B;  3L71 J;  1PPJ D;  3ABV C;  1SQQ G;  4N3Y B;  1BT8 A;  4R50 A;  4FMT A;  3F89 A;  5B1B C;  3SPI A;  3IN6 A;  2HPC A;  2XUM A;  2FKW B;  1FFT B;  1SQV H;  1VQ6 P;  3CRQ A;  4JI6 O;  1PP9 G;  3ZHV A;  2N05 A;  2Q7C A;  1FXK C;  2KLU A;  4UB6 Z;  1V54 C;  3SPH A;  4DV2 B;  4JYA B;  2YO2 A;  2FML A;  3QO5 A;  2WLL A;  1IUR A;  4O4L A;  5LP6 B;  4PDM A;  1FZG A;  4GOF A;  2PYL A;  2E3C A;  2Q8V A;  2QE7 H;  2OQQ A;  3WU2 H;  1IZ3 A;  1XTC C;  3TGU H;  2QG4 A;  3ABU A;  4LCU C;  2HR3 A;  5JQG A;  1N7L A;  4MN4 C;  1S1C X;  3R4Y A;  1FZB A;  4MW8 A;  3RYF B;  2KIK A;  5LL6 Y;  2E74 B;  1BQZ A;  2HG5 D;  3A7O A;  1NZ6 A;  1L0L J;  4RQF A;  3L72 E;  4JI2 O;  2ITA A;  1ORQ C;  3MDS A;  1N86 A;  2ZYD A;  3W68 A;  2A06 H;  1S77 D;  5EIB D;  2C9L Y;  2CGN A;  5KAI Z;  3CCR V;  3OGI B;  1IZN B;  2RCV A;  3MP7 B;  2FYN B;  1ZUQ A;  3DC5 A;  2UXD B;  4EI2 A;  1VEW A;  2AZ0 A;  4X66 B;  3OTF A;  1HVV A;  1NGM B;  1K9M Q;  2BCC E;  2H3O A;  1EDK A;  1JY3 O;  3P8C D;  3ZHQ A;  3VOP A;  3E1R A;  1OX3 A;  3H1H J;  3ZHS A;  3ABT A;  1VQ4 V;  1XTG B;  4FM1 A;  1KYO E;  2QJY B;  4KT0 J;  1WNS A;  3CSX A;  1N73 A;  1EM1 A;  1Y8A A;  1ZL8 A;  1KOR A;  3MUD A;  2M8R A;  3N2G B;  2IJK A;  2RQ6 A;  3I56 V;  2QKC A;  3J7A U;  4GIF A;  1YJN P;  2Z5U A;  5AVY B;  1FJK A;  4NVP A;  3C9I A;  4LF9 B;  1PL0 A;  4GLX A;  3BCC D;  1QX8 A;  4GYC B;  1EZV E;  2JWA A;  5JVD A;  3CE2 A;  1JY2 O;  1M57 B;  1GM7 A;  3TNU B;  2G8Y A;  2YIA A;  4X62 B;  5IE9 A;  1NKZ B;  3L74 J;  1WPB A;  4JZ2 A;  3APO A;  1YBK A;  1URQ C;  2V7Q G;  2EIM B;  1KC8 Q;  4K0K B;  1JJO A;  1FFX B;  4WY4 C;  4NR1 A;  4JYA O;  1M5I A;  3QVN A;  4XBF A;  3PRJ A;  1L4A D;  2LW1 A;  1WB8 A;  2M5A B;  2G3A A;  1O9H A;  2ZIO A;  3QTC A;  4ZHQ A;  5J2T B;  1HNZ B;  1LTI C;  4L87 A;  1FXV A;  3MHH C;  2X6C A;  4UCU A;  1DK1 A;  4TLF A;  3T97 A;  2VRZ A;  1K92 A;  3ABK C;  1GU4 A;  3RWR D;  2ZKO A;  3ABM C;  4DR2 O;  4Z2W A;  1NVP D;  5KJ7 D;  5FL7 G;  5GW7 A;  2F4V B;  2ZYG A;  4DRX A;  4IFF A;  2IYP A;  3K5O A;  5TIS H;  1NH2 D;  3CME V;  2Y9Y A;  2FYU J;  3G71 P;  1RF1 C;  3CCJ P;  5AG2 A;  1K97 A;  3A0R A;  3JAS B;  1SF9 A;  3VQV A;  1S72 P;  3P32 A;  2UU9 B;  2ZR3 A;  1NU1 J;  1ZSP A;  2LO1 A;  1QR8 A;  1QGK B;  1BCC E;  4N78 D;  5H6Q A;  1TUB B;  1BE3 J;  5D5Q A;  4Z1V A;  4JAS A;  2K3R A;  3M9H A;  1JCC A;  3CRR A;  3HR0 A;  2OTL V;  1Q7Y W;  3HD7 C;  1HJ0 A;  2EBO A;  1JFF B;  2Q4P A;  4GKK B;  5GON A;  3QO8 A;  3WUT A;  5AW0 B;  5E79 E;  4J11 A;  3JAT A;  1SQB E;  3SR2 C;  3HKE A;  1K5Q A;  2BTQ B;  1PM9 A;  3BEH A;  3HKD B;  4LLH A;  5C39 A;  3RYI B;  4DV1 B;  5DEC A;  3H1L D;  1YTZ T;  3B77 A;  3UKM A;  2ZM6 B;  5ITZ A;  1DEB A;  2IJJ A;  2JO1 A;  3AE8 C;  3CXC U;  3JD3 A;  3DXR A;  3FFQ A;  3CI9 A;  5B66 Z;  2KP8 A;  1YIT P;  2QVA A;  5KLI B;  4UVC A;  3ZMU A;  2N04 A;  4B7K A;  1NJI Q;  4U7J A;  1I94 B;  3BA9 A;  2KS1 B;  1DLB A;  1N7S D;  2QRX A;  4X62 O;  1A02 F;  3VMA A;  1IVS A;  2QSI A;  1HP8 A;  5CJ0 A;  3OD4 A;  2P58 A;  1KB9 E;  3I5C A;  3A0H Z;  4K0K O;  2Q68 A;  4FLT A;  4UB8 E;  4MVZ A;  4W4L A;  2HOD B;  2A3Q A;  3AEI A;  2QR4 A;  4HNA A;  1M8O B;  3CP1 A;  1SS1 A;  3H1K E;  1HNZ O;  5KAF Z;  1AVO A;  2OIG A;  4IFD K;  5B1B B;  5TIS Z;  3E22 A;  1XHZ A;  3H6P A;  3Q4H A;  3HTK B;  3VMY A;  2IW5 A;  3IGA C;  4ABM A;  4X9Q A;  1FXK B;  4PI0 A;  1V54 B;  1K5S A;  4JI7 B;  4WVZ A;  1KIL D;  4JI8 B;  1ZP0 C;  2WSE H;  5CBO A;  1JA8 A;  1VP7 A;  5HFL A;  3CD6 V;  2OTJ P;  4DV6 B;  1PNL A;  3U11 A;  3CL3 D;  4PV1 D;  1VQL V;  3F7V C;  3L70 D;  3AE1 C;  3BAA A;  2FYU G;  1Y74 B;  1ZN5 A;  3T4D A;  4ZMD A;  3FB7 C;  3BCC H;  3RYH B;  3CCQ V;  2YIU C;  2JKV A;  2V4D A;  2CTP A;  1SQG A;  1MA1 A;  1OZH A;  2ZT9 D;  3WUU A;  4MS2 A;  2BOC C;  1PKX A;  2CAZ C;  2A45 G;  3RL0 D;  3ZHU A;  4I50 B;  4GKK O;  3IAO A;  4CH3 A;  2M6Y A;  1EDJ A;  1VMG A;  2K88 A;  1QQC A;  1PGO A;  3RGB A;  1G4Y B;  3VP9 A;  3KYQ A;  3ABL C;  1AJN A;  2ZM6 O;  1GH6 A;  1FS0 G;  4NXN B;  1S0V A;  1P84 F;  3I55 V;  1SQV G;  1AJP A;  4FZ0 A;  5EBL C;  3SJQ C;  1AV1 A;  2HYN A;  2E43 A;  2BAS A;  2QJP C;  4QIW F;  3B71 A;  1S5L E;  1WLE A;  3L73 J;  2WLL B;  5KHK A;  4ZI7 B;  2FBW C;  2QWN B;  1JPX A;  3AE5 C;  3F5H A;  4N21 A;  1SZX A;  2QE7 G;  2J59 M;  3OAA G;  1YXB A;  5JQG B;  3K9S A;  2UXB B;  3H1J E;  3LW5 J;  4NPD A;  1PPJ E;  1FPO A;  2P6J A;  3TGU G;  1OZ0 A;  4FZ1 A;  3DGE A;  5IJ0 A;  3P30 A;  4IL6 H;  4O4H A;  1K73 W;  2ZE8 A;  4CBC A;  4DR5 O;  1VQP P;  5KX5 A;  2XTA A;  3S1K A;  1S3J A;  4TWK A;  3K08 A;  1LT9 C;  1IBK O;  2A06 G;  4U3J A;  2KI7 B;  1NT2 B;  4NTY A;  2XT9 A;  1V9P A;  2HHH B;  2CPB A;  1URQ B;  4B3R B;  1R73 A;  2JEX A;  4OXS A;  2XZR A;  2W6J H;  3VQX A;  4QE7 A;  3L71 D;  3JAW A;  3SDL A;  2A79 B;  4WY4 B;  1Z2G A;  3STL C;  2WQY C;  3KZI E;  4NPE A;  3D6Y A;  1E1Q G;  2IU3 A;  1K8A W;  3H1L H;  4LFB B;  1N8R Q;  2M3B A;  2EIN C;  4LR3 A;  2E5L B;  4D6T E;  3C3T A;  1XL4 A;  5APW A;  1Y67 A;  3ICX A;  1Z5V A;  3WMM 0;  2OYH A;  1ZL8 B;  1IFD A;  2XHB A;  3ABK B;  1E5W A;  3PJS K;  1L0L K;  3TYY A;  2EIK C;  3HE5 A;  3ABM B;  3MGN A;  4JQ0 D;  2IU0 A;  3LIE A;  2VWK A;  1XHX A;  3ZHR A;  3ETQ A;  1ZXG A;  3RYC A;  1FJG B;  4DR6 B;  4WFE A;  3ZMT A;  2JDI H;  1S76 D;  1XQ8 A;  2ZCE A;  3O8Z A;  3K04 A;  1RF1 B;  1L0L D;  2A45 I;  1JUN A;  2ZNJ A;  1RE3 A;  3H1I J;  1FDM A;  3NTN A;  1Q6H A;  4LC1 A;  1I0H A;  3IFM A;  1KQS O;  4LGD E;  3HD7 B;  1A32 A;  4WF9 V;  2X7R B;  3E35 A;  1RSO A;  4FLY A;  1SQX E;  2YKO A;  5AVU B;  4JI5 B;  4OVN F;  4H0L D;  2WLI B;  4OGQ C;  3AEF C;  1WB7 A;  3WB1 A;  5AVS B;  4J9Z B;  1JOC A;  3H1H D;  2UUA B;  2IDB A;  2K37 A;  2VQF B;  2PYJ A;  2KOG A;  1JMB A;  1GD2 E;  2X0L A;  2UXB O;  2K9P A;  3CC7 P;  5APQ A;  4B3M B;  3K03 A;  1YSC A;  5AW2 B;  1MOF A;  1OW8 A;  2JR8 A;  3M0A A;  4GCZ A;  2FXO A;  2ZVN B;  4DRX B;  3L70 H;  4ZNC A;  4PJ0 E;  3A5T A;  4WBN B;  3AE3 C;  4DR7 B;  1E1R G;  1EC5 A;  4HYO A;  2YXR B;  4TSF G;  1BSH A;  1BMF G;  1H2N A;  4MTX A;  1YHQ V;  2JGU A;  2KUB A;  2DOS A;  2B5U A;  3L75 J;  1N32 B;  3RYF A;  1BGY E;  1YZB A;  2WIT A;  2HHH O;  2QKS A;  1N34 B;  4X8A A;  1TAE A;  2B89 A;  3L74 D;  5KA6 A;  1PL4 A;  1VQM P;  5AW6 B;  2KZJ A;  1JY2 N;  3ZMS A;  2P67 A;  3ZN0 A;  5GON B;  2W6B A;  3H01 A;  2W83 C;  2QM8 A;  2Z4E A;  4QMA A;  1FDI A;  3B8E B;  1H0T B;  3AEE C;  4X64 O;  2E5L O;  3B40 A;  3KQG A;  3JSV C;  3OR7 C;  2FXM A;  3BRC A;  2JRI A;  2F43 G;  3E86 A;  4G28 B;  3U59 A;  2JIZ G;  4CH4 A;  5ITZ B;  1K05 A;  1X9V A;  4B3S O;  3DXR B;  3GB7 C;  2FYU K;  2OIE A;  3MD0 A;  3CC7 V;  3RFR A;  1NI8 A;  3B8N A;  1FJG O;  1S9K D;  4RWU A;  4DR6 O;  2Q3I A;  3CWB J;  1Q6I A;  2XOK G;  1NU1 K;  1KP3 A;  2ZDI A;  1FXH A;  2ZE7 A;  4OWF A;  3RK2 C;  2GM4 A;  5K1P A;  1GN3 A;  3N2G A;  1N0J A;  1ZRT D;  1WT6 A;  2FYU D;  3L35 A;  4YXW H;  5KLV J;  1NWQ A;  5CCH A;  1J5E B;  5AVW B;  4XDL A;  1FAF A;  2FKX A;  2P22 C;  2YIU B;  2X6B A;  1HDJ A;  1LJ2 A;  1XL6 A;  1NTK E;  4BXL A;  1NU1 D;  5BXZ A;  1PFI A;  3JSL A;  1IFJ A;  2YDE A;  3N4X A;  4TQF A;  2WAM A;  3C90 A;  2LR2 A;  5H2F H;  3CCL P;  1BE3 D;  3TNU A;  2R32 A;  4EKW A;  2ZE5 A;  3Q5R A;  2QGN A;  3AK1 A;  1URF A;  3L71 H;  1YTZ I;  2BE3 A;  1BZK A;  2UUA O;  2VQF O;  2MJZ A;  1FFX A;  3ABL B;  3KDP B;  5AVV B;  2A9H A;  1NTZ E;  2CH7 B;  5LYJ B;  4B3M O;  5APY A;  3N2K A;  4H37 A;  3RN4 A;  2PZS A;  2QEX V;  3SFD C;  2ZXW C;  3SPJ A;  1SER A;  2M5A A;  2QJP B;  5CCG D;  5J2T A;  3OFN G;  2F93 B;  4NYK A;  1R6T A;  5B1N A;  1DGS A;  2ZDI C;  3CXH F;  5KUK A;  1M56 D;  3OUS A;  4PD4 F;  3AE7 C;  1N32 O;  1XOU A;  4J7Z A;  2ZIM A;  2JS3 A;  5CCH C;  3E89 A;  4IGG A;  1SQQ E;  1N34 O;  3AK2 A;  3L75 G;  1AVM A;  3BCC G;  2XNX A;  1L0L H;  1JOY A;  3R65 A;  3JAK B;  1UJW B;  1L0N J;  1PP9 E;  3JCU H;  1G1X B;  3RL0 C;  5GTH E;  4H44 D;  5TJH A;  4PA6 A;  1BL8 A;  2GUS A;  1LT9 B;  3CS5 A;  2H94 A;  1LP1 B;  3A3Y B;  4DK0 A;  1PGP A;  1SC5 B;  2HFE D;  2O01 N;  1AQT A;  1RH5 B;  3CCM P;  5LGN A;  2XAG A;  4FJC C;  5KHJ A;  5AW7 B;  4WBA A;  3D36 A;  2GTS A;  1JFF A;  1R5L A;  1Q5O A;  3RK3 C;  4HYT B;  4BW5 A;  1HNW B;  3H1H H;  1EXI A;  5GTI Z;  1GK4 A;  1HWT C;  3HKD A;  2D3O W;  3B4S A;  3EFG A;  3RYI A;  1EDL A;  4WFA V;  2EIN B;  1H8E G;  1LTG C;  3ZCC A;  1R5S A;  3K9A A;  4LP8 A;  3CWB G;  3CX5 E;  1Y47 A;  1ENV A;  4BIO A;  5CA1 A;  2EIK B;  1SFC A;  1KBH A;  2B1I A;  3T1Y O;  2K1A A;  5IJ0 B;  3RK3 E;  5KLV G;  3L37 A;  1E79 G;  4UB6 H;  3RBZ A;  2KS1 A;  4K35 A;  4LWS B;  4DK1 A;  4KJM A;  2D2C D;  1AI6 A;  4W80 A;  5APV A;  2K9J B;  3L74 H;  3IAY A;  2R3S A;  1M90 Q;  4TV8 B;  1KD1 W;  3EQ2 A;  2WLM A;  4DR1 O;  2WPD G;  5L3F A;  2HOD A;  2EX3 A;  4PEL A;  3RGU A;  1M1K W;  1KV4 A;  1FBM A;  5L3D A;  3CC4 V;  1ZLL A;  4BRY A;  2QTS A;  2XND H;  1SZT A;  3UCS C;  3UO2 A;  1GL2 D;  1HH0 A;  3B5N C;  2DQ0 A;  4OGQ B;  3H1L G;  2LFR A;  2ZVO B;  1W5C E;  1AJY A;  2IH1 C;  4RUE A;  4JAV A;  5DED A;  3HTK A;  5KAI H;  5KUM A;  1YJ9 P;  2RMK B;  3L73 D;  1FXK A;  4O2A B;  3W7T A;  2FXP A;  3E7K A;  1I08 A;  2P90 A;  4FPP A;  1VQ8 V;  1UII A;  1VF5 C;  3CMA P;  2O01 J;  1SFC C;  4RUF A;  1LUW A;  3CB2 A;  2KZI A;  1SKV A;  4P9P A;  1NVP B;  1RM1 C;  1F23 A;  3RYC B;  3K79 A;  4Z1M H;  2GA1 A;  2FYU H;  3GWK C;  1NTM E;  4ZKU A;  2JDI G;  1Y74 A;  2AXT E;  2HJF C;  1NU1 H;  4AYC A;  4JPZ B;  4I5S A;  3RYH A;  1T2K D;  3CRA A;  2G38 A;  2A45 H;  5B5E E;  1FKA O;  1BE3 H;  4DXW A;  1XDC A;  5CHX A;  1VQN V;  4DV7 B;  5KKZ C;  3AG7 A;  3G4S V;  4LFC O;  1L8D A;  2EIL C;  1HNW O;  3H9V A;  1SQP K;  3U1C A;  2HP8 A;  1XIL A;  2OT5 A;  5M1B A;  3ITK A;  2DWE C;  1H2K A;  3JD0 A;  1YTF B;  1WAZ A;  2N74 A;  4U3F E;  3SSU A;  2YS8 A;  3WG7 C;  5APU A;  1RF0 C;  2B88 A;  4X65 B;  1P7G A;  3CCU V;  4ZI7 A;  2W27 A;  2GUZ A;  2IM9 A;  2H89 C;  5IY5 C;  1OW6 A;  2RMZ A;  5JH7 A;  3L70 G;  2R3C A;  3RK2 B;  4K3A A;  2ZNI A;  3Q1M A;  2OYQ A;  2Y9Z A;  3FYI B;  2HEP A;  5LHH A;  4DR2 B;  1X0T A;  3A0B E;  2AHY A;  3ZRW A;  1GKF A;  1KU9 A;  2E5T A;  4DZO A;  3AG4 C;  3H1I D;  1BHB A;  5L8R J;  2Y69 C;  4IOI H;  1BDC A;  1CI6 B;  2POH A;  3LDC A;  3GW6 A;  3BFR A;  4IIJ A;  1URQ A;  1OJH A;  1KQS U;  3FX7 A;  4U7O A;  3RT3 C;  1GW3 A;  1KTM A;  1EZJ A;  4WY4 A;  3AG3 C;  1VQ6 V;  4CS3 A;  3MZW B;  1AFO A;  3ZDM A;  2WPR A;  2K9Y A;  1IBM B;  2Z5I A;  2ZFC A;  4RO0 A;  2ZR2 A;  1CPY A;  2ZXW B;  5B3S C;  1BS3 A;  4FK5 C;  3TK1 A;  1FZE A;  3MHS C;  3KG2 A;  2QWO B;  2JGD B;  1OW7 A;  2WSS H;  3P3N A;  1HW7 A;  1FC2 C;  3LDE A;  1KQG B;  4JI0 O;  4H33 A;  4YXW G;  4DV7 O;  3RVZ A;  1DTO A;  4O4J B;  3L75 D;  1YJW P;  5EYP B;  1GZL A;  3G80 A;  1RF1 A;  3HRN A;  3M0D A;  3D70 A;  1NAF A;  4TUY B;  4W4K A;  2HKO A;  3RL0 B;  2E76 D;  1HTL C;  3AE9 C;  5B66 H;  3AED C;  4RO2 A;  3L72 J;  3D3Q A;  3CCV P;  1K04 A;  1S9K E;  2N1T D;  2QJK C;  3OJA B;  2XAH A;  2OCH A;  2H43 A;  3QF7 A;  5C8Y B;  4WFF A;  4BW9 A;  1ZLZ A;  3BRV B;  1J95 A;  3L71 G;  2E42 A;  1R3J C;  3LDD A;  2R9A A;  2AGA A;  4J7K A;  2Y0E A;  3CXH D;  3HD7 A;  2J5U A;  4PD4 D;  2C9N Y;  2LGQ A;  1QL2 A;  1X4T A;  3RK3 B;  1YVW A;  4HAM A;  4W7Z A;  3LID A;  1JO5 A;  4X65 O;  1CP9 A;  3N2K B;  1PGJ A;  1US6 A;  2BCC J;  2WLI A;  1M1J C;  3A0H H;  2Q6A A;  3S3X A;  2H88 C;  3L73 H;  2W6A A;  1H8H G;  1A02 J;  2L35 A;  3P3P A;  5CCG C;  4CPG A;  1QLE D;  3O9O A;  5KLV K;  4H13 C;  4FLW A;  5LOV A;  1D5N A;  3LW5 H;  4W7Y A;  3WUV A;  4Y99 B;  3K5N A;  3CWB D;  1VQK P;  2X6A A;  5KAF H;  5IYC O;  5AVX B;  4WBN A;  1N0N A;  4I6M C;  2VQE B;  1FS0 E;  4MTO A;  5KLV D;  4DYL A;  1YJN V;  1LTJ A;  5E79 Z;  3M0D C;  1L0L G;  5JCO C;  2C0X A;  1SQV E;  2JP3 A;  3MIW A;  4LF7 B;  4IYI A;  4BIU A;  4DW0 A;  4I55 A;  3SYA A;  4H44 C;  2YO3 A;  4UV9 A;  1MKM A;  3CCV V;  3T1C A;  1QL1 A;  2ILM A;  3WFV A;  5A9G A;  4B08 A;  2RJZ A;  5J2U A;  4BWN A;  5CBN A;  3WU2 E;  4DUZ B;  1B04 A;  1MFZ A;  3ZN1 A;  1IBM O;  3TGU E;  3KXD A;  4JTC B;  3ASN C;  3V4Q A;  1VQ7 P;  5BZB A;  4EIJ A;  2XDJ A;  2YI9 A;  3ZRX A;  5JWP A;  3CRC A;  1GDT A;  3B5N B;  4DT0 A;  1OVR A;  3T4Z A;  1H0T A;  3H1H G;  1T5E A;  1Q43 A;  1JMM A;  1S5J A;  1ROP A;  1SQP H;  3PTZ A;  3JYC A;  4UCV A;  1FD9 A;  3G6E P;  2A06 E;  3CYO A;  4JZG A;  4JYY A;  1L0N K;  2YKP A;  2EUL A;  1LTA C;  5CA1 B;  1VF5 B;  4UB8 Z;  1SFC B;  3SYC A;  1QLN A;  2CDY A;  1RM1 B;  2DE0 X;  1LTJ C;  3W67 A;  1XNR B;  5AW3 B;  3EWK A;  1K33 A;  3G71 V;  4HZ3 A;  4I2L C;  3CCJ V;  4B3T O;  1L0N D;  2M3E A;  3K5B A;  3H1I H;  1S72 V;  1SP4 A;  1H88 A;  1KYO F;  3OGC C;  2ZD9 A;  3F7Y C;  3V2Q A;  4LF5 B;  2WSC J;  1LTS C;  3L74 G;  2Q9L A;  4DR5 B;  1SES A;  1BCC J;  2QTO A;  5KKZ B;  2Z0A A;  2DW4 A;  1Y9B A;  2AW9 A;  2P5O A;  2KYV A;  3U1A A;  5CA3 A;  4DO2 A;  2EIL B;  1JM0 A;  3FYE B;  4BRY B;  1IBK B;  3SJC C;  3B2E E;  2XND G;  3CHX A;  1MSD A;  5AVZ B;  5LHI A;  1SQB J;  2E74 D;  1X59 A;  1W0K G;  2CH7 A;  3ZBH A;  5LYJ A;  1JY2 P;  4YIP A;  3WG7 B;  1ZTE A;  2IFM A;  1O9G A;  2Y0I A;  4C7U A;  3A2A A;  5KMG B;  2VQE O;  1YIT V;  1Y4M A;  1AI5 A;  3AEG C;  2H8P C;  1MV8 A;  4LF7 O;  2PUS A;  5IY5 B;  3TJT A;  2Y4T A;  4Z1M G;  1OMI A;  1VF6 A;  1Z5W A;  3X2Q C;  2MW2 B;  3L75 H;  1F51 A;  1GMJ A;  5APT A;  1IK9 A;  3U0Z A;  1B06 A;  2OYO A;  1AR1 B;  1VQ5 P;  1EZV G;  1NU1 G;  3QG5 A;  1JR9 A;  3JAK A;  3N27 A;  3S9O A; 
#chains in the Genus database with same CATH homology
 3H25 A;  1PIX A;  2BEQ D;  4I7Z B;  3LW5 J;  3AE2 C;  4PV1 C;  1ZRT E;  1HF9 A;  3D71 A;  1YQ3 C;  2JP3 A;  2H89 C;  4YTP C;  2JO1 A;  1EXI A;  3AE8 C;  1OW6 A;  4H44 C;  4TT3 H;  1NGM B;  3GF3 A;  3AE4 C;  1MKM A;  3Q1M A;  2ZT9 C;  2NZ2 A;  2E74 C;  3Q3D A;  1FDI A;  1KIL E;  3FGA D;  1VF5 D;  3AEE C;  4U7J A;  4H0L C;  1ZME C;  4XFJ A;  3D6Z A;  4KT0 J;  4IL6 X;  1KMI Z;  1K05 A;  3AEA C;  3GMA A;  5L8R J;  2QSI A;  4I7Z C;  1KOR A;  3RK3 E;  2FYN C;  2WQY C;  4OGQ D;  3Q5P A;  3D6Y A;  3GF7 A;  1RQU A;  1ZOY C;  2D2C D;  4R4L A;  1NYH A;  2WSF J;  5KLI C;  1TU3 F;  4GDO A;  1KTM A;  2V7Q J;  1VF5 B;  1DD3 A;  2K9Y A;  1IK7 A;  2G8Y A;  3AEB C;  2QJY C;  1Q90 D;  3EWK A;  2MKV A;  3SFE C;  1UIX A;  4H13 D;  4RKU J;  1VL2 A;  4OGQ B;  1U57 A;  1ZP0 C;  3O6Q A;  1EXJ A;  1OW7 A;  1AJY A;  2D2C B;  3T97 B;  4Y28 J;  3Q5R A;  2WSC J;  1KQG B;  4PV1 D;  1DD4 A;  1PV3 A;  2G3A A;  2FXP A;  1Y9B A;  2E76 B;  2WSE J;  3AE1 C;  1VF5 C;  2O01 J;  1DIP A;  2WPV B;  3D70 A;  1YQ4 C;  2QIW A;  3ABV C;  2E75 B;  1R8E A;  2E76 D;  3AE9 C;  3IN6 A;  3AED C;  1KQF B;  4Z1M H;  2YIU C;  1FDO A;  1K04 A;  3SFD C;  4H13 B;  2QJK C;  2ZT9 D;  2E75 D;  2E74 D;  2P10 A;  3AEC C;  4H0L D;  3AE6 C;  3C8V A;  3AEF C;  4OGQ C;  3RL0 g;  3IAO A;  3AE7 C;  1RQV A;  2D2C C;  2J5U A;  3GLM A;  4YXD C;  4PV1 B;  2IDB A;  3AEG C;  5KKZ C;  2YMK A;  2OQQ A;  3Q5S A;  2E76 C;  4H44 B;  2H88 C;  1OW8 A;  1OMI A;  1PL5 A;  1S1C X;  3R4Y A;  2E75 C;  1WMK A;  3Q2Y A;  1GMJ A;  4H44 D;  2ZT9 B;  3G9R A;  3AE3 C;  1JB0 J;  2E74 B;  1HJ0 A;  2QJP C;  4H13 C;  3B71 A;  5M1B A;  2BEZ F;  4H0L B;  4R4M A;  3S9O A;  2FBW C;  3AE5 C;  1S5L X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...