4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
4PV1B 1VF5B 4H13B 1Q90D 2K9YA 4KT0J 2QSIA 2YIUC 2QJPC 2WPVB 3LW5J 4H44B 1ZRTE 2WSEJ 2E74B 2E75B 4I7ZB 5KKZC 4OGQB 2ZT9B 3C8VA 4RKUJ 2WSFJ 1S5LX 2QJKC 5KLIC 1JB0J 4IL6X 2E76B 4H0LB 2D2CB 2FYNC 5L8RJ 4Y28J 2QJYC 2WSCJ 2O01J 2QIWA
chains in the Genus database with same CATH superfamily
2ADPA 2Y4TA 3GVMA 2XAFA 1S4XA 4JI8B 4IHJB 2P7JA 1NT2B 1IBMO 2LGQA 3SYOA 4LLHA 1HDJA 4N78D 4GYCB 1M1KQ 4XBFA 2P06A 3ZX6A 3L71J 4H0LD 5D5QA 4TUYA 1Y4MA 4W4LA 4OX9B 3L71E 2RMZA 3ZHQA 3PTZA 5CCGD 2A06E 4H44C 4DR7B 1Q8IA 1XHXA 3G4SV 5IJ9B 1LTJC 3ZJZA 2Y0EA 3K9AA 3S3WA 2NZ2A 2K9JA 4LWSB 5AW9B 1RPRA 1NTZJ 3EVKA 3SJBC 3HD7C 1NTZE 3LDDA 5KTBA 3HKBB 3SYPA 1DD3A 2ETNA 1Y6XA 5KKZB 1BGYD 1KORA 5BVZA 5KA5A 5AW1B 1N33B 2FYUJ 3TNUA 4NXMO 2FYUE 1FJPA 1K9MW 1X0TA 4UCUA 2F66C 1ORQC 2ARHA 1KILA 3KDPB 4PV1D 5KAFH 1SQVH 3K58A 4BIOA 1BQ0A 1LGHB 4WFAV 2GDSA 3OAAG 1N0NA 1IBKB 4JI3B 1L0LH 4QPKA 2EIKC 1E1QG 1PPJD 3HKEB 2ADQB 2W0XA 1KYOF 3H1HG 2F43G 4KT0J 3Q2YA 2DWEC 2ZXXA 1SC5B 1PM9A 4N21A 3NXSA 5B5EZ 1IBLB 3FKSG 4DR3B 4XDKA 4K3AA 3DXRA 1ZN5A 2OQQA 1NTKJ 3SWKA 2KUBA 1BE3D 5LXTA 1NTKE 3IAYA 2CUGA 4EFBA 2RH0A 5KLVG 1RP3B 1SETA 3L37A 1EFRG 1AQTA 3PLNA 1Y67A 2K1EA 5LP6C 1P7GA 4DV4B 2ZKOA 3C9IA 4IGGA 1KD1Q 4WFHA 4ZKIA 3FXDA 1FZGA 3AEDC 3CCMV 1VQPP 1SA0A 3ETEA 4B3TB 4GKJO 2DYSB 5FNVA 3M8AA 1YVWA 1SQQD 3IF4A 2LXCB 3D8CA 3M9BA 2W6JH 4H13C 4C7NB 2ZE8A 3IFXA 2IJJA 3U1AA 4O2BA 5B1NA 3K08A 3DGEA 5HFLA 1RF0C 4PD4D 5BY1A 4IL6X 1FXKB 4JI1O 1X22A 2WSSH 1QLNA 3CL3D 4D6TG 5CA0B 4PV1B 4X20B 2E5LB 2WWWA 1M1JC 1USDA 1R3KC 2GV9A 3UO2A 1N7SD 1IJDB 1YCIA 5H6RA 1G1XB 2OCCC 2UUBO 1DX7A 1SRYA 4I50A 2WSCH 1KQFB 2PYJA 3MHSC 1N73A 1GL2C 5JH7B 3C3SA 3DC6A 1YZBA 2IZ1A 1NTZK 1SA0B 3SGIA 5GW7A 3JSVC 1IXMA 4TV9B 2W6AA 2ZVNB 1SQFA 2G38A 3AECC 1IO4A 5BR8O 2DWDC 5H6QA 2A79B 2O01N 3CXHD 1IC2A 1LTGC 3B5NA 1YJWP 1KZUB 2QDOA 2FYUK 4DO2A 2XZRA 2OIGA 1L8DA 1XMOB 1V54C 1CI6B 1MMMA 1OCRC 2OT5A 1YI2V 5KUKA 2KYVA 2DOSA 4UV8A 1IDSA 5GTHZ 2A9HA 3D36C 4MTOA 4DUYB 1XNRB 1NQTA 4JI0O 1LJ2A 1SQBJ 2KI7B 1IK7A 1KFMA 1SQBE 1R1BA 3RL0B 1KYOE 3AG4C 2ZNIA 3CWBJ 4UB6E 1ZR4A 3CWBE 2M7WA 3K79A 3OEHG 2AHZA 1N73B 5AVRB 2ODMA 3CEIA 4X1KB 2W6IG 3P8CD 3CC2P 4CS2A 4IYIA 1NTKK 1HNZB 4TQDA 2P6JA 4R7CA 3GLMA 1R6KA 2G8YA 1TUEB 3A2FA 4O4IA 1IFJA 2Y0CA 5GTIE 1ZUQA 1N7SB 2OTLP 1YJ9V 3FAVA 4LFBB 5KAIZ 5CCHA 4I4TA 2B87A 3RK2C 4I1LA 3L70G 3A0HZ 4HYOA 3FX7A 2Y69C 3B77A 1W5CE 1HGVA 1K5QA 1MZEA 3HB3B 4EB6B 2UUCO 3CRAA 3L35A 1K9MQ 1M8OB 2L35A 3I56V 3AK2A 4DV6B 3TGUJ 4X64B 3TGUE 1LP1A 3BCCG 5BZBA 4DV0B 1SQVD 2EIMB 4OPHA 3QF7A 3O8ZA 3V5BA 1D7MA 1CW5A 1XMQB 1L0LD 1SERA 2FB5A 2R72A 5CB4B 5LMUB 1GK6A 3CCRP 1TU3F 1FFXA 5H2FH 3M06A 3V6IA 5LOVA 4FLYA 4JTDB 3TYYA 3T1CA 4WFBV 1O9GA 3OTOB 3ABMC 3CD6P 5DN6G 5B1BC 1K92A 2JRIA 1ZV8A 2VQEB 3P3NA 3E7KA 3CCUP 4X65B 2QJPB 3L72J 4MVQA 3L72E 4PA7A 1R8EA 1EXIA 3G6BA 4FFKA 1NKDA 2JIZG 3OR6C 1Q81W 3JAWA 3Q4HB 1ZRTE 4FZ0A 4O4JB 3J80N 1J1DB 1J5EB 1H2NA 2BTOA 1QVFU 2O1JA 4R4MA 4QE7A 1FJGO 3G6EP 5JVDA 2OYHB 4KJMA 1KTMA 2DYRB 1B04A 3JYCA 4ASUG 3RN4A 1QLEB 1D2DA 1S5LZ 1V9PA 3H1HH 1H2SB 1H8HG 3FWNA 4FK5C 1XTGB 1AI6A 4WY4A 2H8PD 5APWA 1VQ8V 1SQBK 3BATA 3ZHUA 2JJLA 4ZBMA 2HG5D 3HKDB 4MTXA 1EZVH 1RF1B 2GBOA 2RJZA 5B1OA 2PAJA 1K05A 1JVMA 3ZBHA 3VMYA 3N2GA 2YUAA 2FFDA 4K0KO 1CEZA 3FB5C 5GTHH 1MOFA 1GDTA 5KHGA 4XDJA 1OVUA 2W0FC 2K1AA 1S2EA 2DW3A 1A02J 4YJ2A 1SQPJ 2P1JA 1AQ5A 1VF6C 1SQPE 2I1KA 3BPZA 5B5EE 4ZI7A 1QHTA 3ABUA 2HVKC 3IC7A 1EDLA 1K7DA 3WG7B 2UXCO 4LF6B 2H3OA 2A3QA 1FS0E 5EZYA 3PHLA 2QJYB 4G28B 5KKZC 3K5OA 1QR9A 4D6TH 1OW7A 4FLTA 4GDOA 1H8AA 2JDIH 3A0HH 4BXLA 4WFEA 3JCUH 3OEEG 3AE3C 2Q9IA 1VQKP 1VARA 1PPJG 1JQ0A 4BWNA 3ZN1A 2KLUA 1VPCA 3WMM0 3E89A 1K34A 1KUQA 1EDKA 4LC1A 3G71V 2QM8A 3II6A 1W59A 2J59M 2IFMA 3HE5A 1AROP 5CA1A 2FYNB 2QTSA 1OVRA 4ZIBA 1BE3G 4DR5O 5C8YA 1HUCA 3H1JJ 2B9BA 3S3XA 3H1JE 1TVKA 1MSWD 3BABA 3CP1A 3KQGA 1JY3P 1JCDA 3V2QA 4UUJC 2CTQA 2F95B 2YDEA 3FFQA 4NXMB 3AE6C 1QVFO 1MNGA 1VQNP 1FKAO 1EXJA 3S1KA 1UIXA 5LGNA 4FLXA 1SQQG 1F4NA 2M6YA 1FXHA 5AW2B 2X6BA 2JKVA 5CCGC 1FOSF 4MW8A 1G2CA 1JFFA 3CCSP 2E76D 1RM1B 1PNKA 3ZMTA 2DYSC 1JY3O 5CN0A 1NTMJ 3CC4V 1XNQO 1NTME 2IYPA 2QKAA 3NMDA 5FPRA 3UKMA 3WU2E 3E22B 5EYPB 2R9IA 1I0HA 3K59A 2WA3A 4WCEV 4DR3O 3K03A 4TT3H 2KSDA 2W8ZA 1ZSPA 1M7LA 4DV7O 4CS4A 3OMNB 1AB3A 5KA6A 3CC7V 2R3CA 4PV1C 1FU1A 1SS3A 2UXDO 3CCEP 5LBQA 2QWRB 4O2AA 1VIBA 4DUZB 1HH0A 1SQPK 2K3RA 2YKPA 2ITDC 1DEBA 2GTSA 2VRSA 4GKJB 1ZLLA 2ZAEB 2XAQA 1HWTC 1Y76B 1JM0A 4JPZB 1Q81Q 1HGZA 3CLQA 1S1CX 1ZL8A 4GUNA 4FM2A 1SZXA 1XL4A 4A7PA 2IJIA 3RYFB 3MAQA 1Q43A 4QE9A 3ASOC 2CGOA 3OW2U 2WLIB 2Q7GA 3UIAA 1GM9A 1R3JC 5KAIE 4JI1B 2P2UA 1Q6HA 2HJFC 4WWIA 4I0XA 1QU7A 4KXRA 1XREA 3TXQA 5JWPA 3RGBA 4NVPA 4EOTA 4RUFA 5AW7B 1AFOA 2E76B 3QNEA 1AP5A 4H33A 4ZHQA 1EZVD 2UUBB 5KX5A 3W67A 3MUDA 1R5LA 2OYIB 3BA8A 4QGPA 3KZIZ 3LDEA 5J2TA 4HB1A 4AQRD 1S76D 3E8BA 1ZWIC 4W80A 3RL0C 1L0NJ 2WSFH 3OFNG 4J9ZB 1L0NE 5BU5A 5BU8B 3AE7C 5C93A 5E79E 1JMBA 3U59A 5CA3A 1NKZB 2HKOA 1KP3A 1WP7A 1N73C 5BR8B 4ZKPA 5C39A 1Q82W 2XAHA 2YEVB 1AI4A 4GT1A 4MVSA 4JI4O 1YTFB 3RT3C 2ZD9A 3V4WA 2Y0IA 3JD2A 5L3GA 3H9VA 5CBFA 1W2BO 4RKUJ 2KZJA 1M93A 2A7WA 1XMOO 2KS1B 2WZ7A 2FXOA 2M3BA 1EQ7A 1FDIA 3H1LD 1BCCG 1FOSE 4KL1A 1Y74A 3F7YC 3R66A 1HP8A 2OCCB 4JBZA 4JI0B 3U0ZA 3RK2D 4UV9A 4DUYO 2AXTE 1KMIZ 5L3EA 1GTWA 1SQVG 3HUSB 1JJOA 1NTMK 1UFIA 3M99B 2DJVA 3IFMA 4HAMA 3AEGC 1L0LG 5B3SB 1DIPA 1BS3A 2WPDG 2W83C 4JZGA 4UVBA 3OGIB 1DTOA 4FM1A 3T4ZA 2EIMC 1NGMB 3RYCB 1S5LE 3B2EE 4YY3O 2H43A 2OTJV 2WT7B 1H38A 4FFBA 2C0WA 3K0GA 2XAJA 4O9BA 1KKDA 1K4CC 2HVJC 2Q73A 3FWLA 2ZDIC 1Q7YQ 1XDCA 2W27A 3USSA 2YIUC 1VQ4P 3ZN0A 2Q6AA 4J80A 1F4MA 2DN9A 4PDRA 2Q3EA 2QJPC 3M91A 1Y66A 2XU6A 3BCCJ 5KJ7D 1Y74B 2UUAO 4LF7O 2H7HA 3BCCE 1DGSA 2YSUB 1GTOA 3N2KB 1WP8A 1S0VA 1KB9E 2Q5ZA 4JYCA 5EBWC 2PRRA 1RH5B 5CHXA 2X7RB 3OW2O 1ZTEA 4IL6E 1IVSA 2JGUA 3JALA 3K06A 3UT5A 1J1DC 1X8YA 1AI7A 3A8TA 4DV0O 5CJ4A 4DXWA 3OE7G 5KUMA 1AJYA 2WSEH 1JCHA 3WUTA 3A0RA 2OYHC 1NI8A 3JATA 1AILA 3IR9A 2DYRC 1LUWA 1YTZI 1QLEC 1YYCA 2DW4A 2WSSG 1N32O 1URQD 2CH7B 4GZRB 4Z1VA 2QA4P 4EKWA 1OZ0A 1NS1A 1BDCA 4P2ZA 2JR8A 1N86A 4LF9O 4WBNA 1L0NK 1P84E 3RVYA 4BIZA 2BCCJ 2H88C 3CCVP 4DRXA 2BCCE 3CHXA 3NFQA 2UWJE 1GW4A 3CCLV 2PTMA 1CZQA 3L74J 1FYJA 3L74E 1P7BA 1SFCA 2Z5IA 4DYLA 2WLJA 5B66Z 1FJGB 4E4EA 5JQGB 4DV3O 3KZIH 5LGTA 5AVQB 5LHIA 4BAYA 3RYHB 4UFZA 4PD4F 1GO3F 2F1MA 1HBWA 3CSXA 1F23A 4UXNA 2RNBA 2YICA 4QPJA 1GN4A 3MHVA 1NTZH 3JD0A 3QH9A 5FL7G 4N78E 1SS1A 2Y0PA 3WG7C 1GN3A 2XKMA 1QCEA 3H32B 4Y28J 2FYUH 2KNCB 4ZKUA 2QJYC 2O01J 1J95A 3GG2A 4MVUA 1H0TA 2LO1A 1OWAA 1VQ7P 1YITV 2HLDG 3QO7A 5AVYB 1NHLA 2CDYA 1Q6IA 1VF7A 3BRCA 5BMVA 4PJ0E 5LHGA 3OD4A 4LFCO 1BGYJ 1BSNA 1BGYE 2CE4A 1ZP0C 3CXHF 1URQB 2D2CD 2N9YB 3CCQP 1JTHA 1FDMA 5AVWB 2WLLA 4LP8A 2ITAA 1ZOYC 1Q82Q 4ICGA 4X1IA 3BHPA 4GCZA 5AW0B 2HG5C 1S5JA 2FYNC 2WA4A 4C7UA 4XE5B 4OVNF 1Y8AA 1NTKH 1AJPA 2YKOA 2HODB 2KSJA 2X6CA 4JF3A 2E74D 2N05A 1U97A 2BASA 1LT9B 2R5DA 4U3FJ 2M5AB 4U3FE 5AG2A 2JWAA 2JS3A 3SPJA 3DC5A 5K5GB 3ZMSA 2ZVOB 3CRMA 5APVA 1BE3J 1B06A 2P7TC 1RM1C 3JARB 4LNUB 1BE3E 3SFDC 1H2MA 2OWOA 3KCXA 3JAKB 1URFA 1KILD 3MTUE 3TK1A 4DR5B 4JI7B 3ZHTA 3SPCA 1IFPA 4IIJA 4YTPC 3R65A 1AA0A 1T3UA 1S5HC 3JAMN 4DR4O 3TJTA 4D7SA 2Z0AA 5JJNB 2UU9B 1RE3C 3V2NA 1BCCH 3CMAV 5APSA 1B3QA 2NNUA 3P30A 3AG1B 1FZCA 1VQLP 3IJ4A 2XDJA 4DV2O 2D2CB 2QWNB 3EWKA 2JJ1G 3B40A 4PD4E 1OXZA 3VOPA 3DSQA 1GW3A 4JI6O 4TUYB 3L73J 1XNQB 2R32A 1WPBA 3L73E 1TUBA 1J1EB 5B66H 2EULA 2XAGA 1VF5C 3OAKA 4EI2A 4LR3A 5AW8B 1L4AA 1SF9A 3F5HA 2ATKC 5DM6V 2Z3YA 2E74B 2K9JB 1NZ6A 2Q1KA 1VQ5V 1T8ZA 3WB1A 4MSWC 4DV7B 1DLBA 1EZVG 1S5LX 2WLKA 4YXWH 1LTBC 1AVOA 3A2AA 2UXDB 1ZLZA 4KUMA 3TNUB 2Q7HA 3K3WA 1SQBH 1KP2A 4DUZO 1WN7A 1QEXA 2F93B 2E76C 3CXHE 1VDFA 3GW6A 4LH7A 3ITKA 1KN7A 1KILB 3CWBH 1VQMP 2OYIC 3TXSA 2I8DA 2JS5A 2I1JA 2KIKA 1T2KD 3L71D 1AJNA 1VP7A 3ZRWA 3CJHA 1EZVI 3E8HA 5H2FZ 3ABVC 3RL0D 2KK7A 1W0JG 1MV8A 1JMKC 3CCRV 2XNXA 2N1TA 3FXEA 2HEPA 3KKYA 1OFCX 1WRGA 4YXDC 1D5AA 5APQA 3H1LG 3KXDA 4TV8A 3MIWA 1JY3N 4HKZH 1NTZD 4J7ZA 3HKCA 4FLUA 2YXYA 3RYIA 4OH8B 2YO2A 3DXRB 3H1KJ 3ICXA 2ZJSE 3H1KE 3S9OA 3B5ND 2Q8VA 5LXTB 3D71A 2JDIG 2FYUD 3R4YA 2QM4A 4QMAA 2GUZA 3DTUB 3D6YA 4JZ2A 3RK3B 2BEZF 3HUSC 3I55V 1N36B 2H94A 1PNLA 3TGUH 4RQEA 3AG7A 2HP8A 1Q3EA 1SKVA 3M7MX 3MUDC 1QVGU 4MW3A 5B3SC 1AP6A 2P67A 5FNVB 3CMEP 5CJ0A 2PUSA 4PELA 3ASOB 2JEEA 1J2JB 1MFTA 4JI4B 3THOA 4O2BB 1N4CA 1QBZA 2KOGA 4GOFA 5A2QN 4FZ1A 4IFMA 5KAFE 1ZAUA 4TV8B 1SQVJ 3CRRA 3T4DA 5DJTB 3C90A 1SQVE 3ETQA 3G80A 1NTKD 1WT6A 3CX5I 2LW7A 3F89A 4L76A 1US6A 3U1CA 1Z2GA 4KFMA 2YKQA 2JJ2G 3G4SP 2E42A 4JASA 4H13D 1T6AA 1RE4A 1YIJV 5CCHD 3TSIA 2IW5A 4I50B 4Q6GA 2HPCA 1NR1A 1QNMA 1AR4A 5IE9A 3WB2A 3VOUA 1IXBA 3CYOA 2LP7A 4YY3B 5TISE 3SPGA 2KSEA 4CC5A 1YEWA 5AW4B 4YJ3A 2ZT9D 4R50A 4TT3G 3B5NB 4GKKO 1SQXG 2MKVA 2QWQB 1QLED 3ZHSA 1VQ6V 2B89A 1YJNV 1DF4A 2RCVA 1BSHA 3JCUZ 1EDJA 2JVDA 1BHAA 3P32A 4HH2A 2UUAB 1KU9A 1HW7A 3L75H 4FM0A 4LF7B 4TLFA 1Z5WA 4X8AA 2OTKE 3F5TA 1BCCD 2QE7G 1EN6A 3N27A 5B1AB 1N8RW 3E86A 4B3MO 1GM7A 2NPSA 2CPSA 2B1GA 2CPBA 3HPLC 1PP9G 1PV3A 2PYLA 2JP3A 1N32B 3H1IG 2DE0X 2YI9A 4B86A 4E2LA 3ZMZA 4JYYA 2WSCJ 4O4IB 3LSUA 4N3YB 4QJFB 4LF9B 2YIUB 5KJ7C 3FAVB 4H13B 2IFNA 5EFWB 4JGSA 2WVRA 3CCMP 1HWYA 2FBWC 4PA3A 1M4UA 4JTAB 5EIBD 4I4TB 4BRYA 3K5LA 2B87B 1QVGO 1AR1B 4R6ZA 5IYDO 2FMLA 1D5NA 1LUVA 3G67A 4WY4D 1DF5A 1KQLA 1SQBD 1WB7A 3O9OA 2RN9A 2ZIOA 3PRJA 4P9PA 5LL6Y 2IJKA 5APTA 1WAZA 1XILA 2ZT9B 4DV3B 1PZQA 4TSFG 3CWBD 3E2EA 1LP1B 2IBZE 4CH6A 1PKXA 1S9KD 1GRJA 1VQ9V 1URQC 1NKNA 1SQVK 3IC9A 1WMKA 5DECA 3K5BA 5L3DA 5IJ0A 3H1JH 4C46A 4AUWA 1FFXB 2BSKA 4KHXA 5LOVB 2YNYA 2QWOB 2CK3H 4JAAA 4L75A 1GH6A 2C9LY 5D5PA 3LIDA 3IAOA 1DH3A 3TETA 4I7ZB 1NVOA 5DEDA 1LT9C 4DV5O 4CS3A 1CXZB 4UCTA 4LFCB 2L91A 4I55A 4MT8A 3TCUA 4Z2WA 3JAWB 1JEKA 4GX0A 3TGUD 5KHHA 2RMKB 5J2UA 2KQXA 1K04A 1NTMH 5EBMC 3GHGA 2R9AA 3D3QA 4U7OA 2WPQA 1K33A 4Z1MH 3O6QA 5JVDB 1IFMA 3JASA 1SP4A 1YI2P 4Y99B 1WJZA 1JOCA 4R4LA 3IN6A 2EZPA 2XUMA 2FY8A 3BAAA 3H1LH 1GAXA 1YTZT 4WY4B 1H88A 3RBXA 3UO3A 3OMAB 4JI5O 1KBHA 3LW5H 2A45G 4PI0A 1H8EG 2YC0A 1M90W 3AG1C 3N2GB 1SQGA 3L9DA 2FFDB 2QEXV 1IK9A 2NLJC 2D2CC 5H2FE 3ETDA 4PDMA 4X66B 1NYHA 2JWDA 1FFTB 2M0BA 4YJ2B 2CTRA 3CX5H 1OJHA 1YJ9P 3ZS8C 3G9RA 1EZJA 1J1EC 4DR6O 5L3BA 3O6QB 2B1IA 4JYBA 4JI7O 1HVVA 2A45I 3PH0A 4LH6A 4ZI7B 1VF5D 3I5CA 2E74C 1OX3A 5LA6A 4IYHA 3SWFA 4DR4B 4UB8Z 1LTJA 5K1PA 2O3JA 3GMAA 3BY6A 3I56P 5EZYB 4AILC 1DEEG 1XL6A 2UU9O 3LNMB 4DV2B 3HD7A 1OCOB 3L71G 3L75D 1OCZB 4GOEA 3H1HJ 2EIJB 3H1HE 4NB5A 3OGCC 4X1YA 2Q7EA 4JI6B 1KILC 4HZ3A 1WA8A 3T1YO 3ASNB 3AE5C 1IX9A 4RO2A 1T5EA 1NOHA 1JNMA 5LHHA 3H25A 2JO1A 1NTZG 1QX8A 1MFZA 2ZE7A 4IT5A 4MVZA 1S72V 2YXRB 3HE5B 1WB8A 2EX3A 5KLVJ 5KLVE 1BL8A 2BTQA 1FPOA 2QM7A 5CA1B 4DR2O 2BE3A 3VQVA 2HHHO 4N23A 5C8YB 2N9BA 3E1IA 4W7ZA 2GSMB 1SQXH 2FYUG 1TVKB 5GTHE 4U3JA 4LFAO 1FDOA 3L36A 3T97A 1H89A 1YTFD 3OUFA 4NR1A 4IFFA 1KECA 1LTTC 5A9GA 2AXTH 2F4VO 1NU1H 3BASA 1GD2E 3RWRD 3A0BH 2N74A 2NN4A 3EHBB 4BWAA 3AE8C 1U7JA 4W4KA 1WLEA 2QE7H 5AW6B 3RK3C 2W90A 2OYOA 1G2CB 5LP6A 1JFFB 5KMGA 1VF5B 1BSMA 4NXNO 4JPRA 4HNAA 1VQ8P 4KHPB 1BT8A 2Q9LA 3OT7A 3CRQA 4D6TJ 4D6TE 4Q20A 3V2RA 1PP9H 2Z5HA 3ML0A 5CBNA 3A3YB 3H1IH 1NTKG 2UXXA 4J7JA 4UCOA 3H1JD 1I94B 3A0HE 5EC2C 2XNDH 4O4LA 4B08A 4OGQB 4U3JB 1I5YA 4DW0A 1ZX3A 3W7SA 1RF0A 3HTKA 4X9QA 3EFGA 1X4TA 1KB9H 1T2KC 4O2AB 4P9OA 3LDCA 2JK5C 4IL6H 2O57A 5FLXN 2KG7A 3BVHA 1CSBA 1N36O 1V55B 1BQZA 1M1JA 2WLHA 1VQOV 1M5IA 1GN2A 2DMXA 2P22C 3QVNA 1YQ3C 2MW2B 2JGDA 3MDSA 2NR5A 1QQCA 2V7QH 2QGNA 1ZL8B 3ETGA 1NTMD 1KC8W 2YXHA 2VQFO 3SJCC 1GL2A 1K5SA 3BRTB 4P30A 1PNMA 3B09A 1S77D 1N0JA 2Q3IA 2BOBC 5AVXB 1FZEA 3B5NC 3F5WC 4B7EA 5IYCO 4XDLA 4I0XB 1P84H 3H6PA 3D70A 1CP9A 5LGUA 3Q3DA 4UB8H 3G71P 2UXBO 3L74H 1G1JA 4ZHQB 5KX5B 5KLIB 2KB1A 3JD4A 4BIUA 2W6BA 4XFJA 1M90Q 5KLVK 3VN0A 4B7KA 5APXA 5J2TB 5B1AC 1GU5A 3EFFK 4DT0A 4AYCA 3D36A 3N4XA 3NTNA 5KHKA 4F4LA 3CX5D 4FPPA 5K1XA 5KHJA 3L70J 4GKKB 3L70E 3ABLC 4L8JA 5IYZA 3ABTA 2KLVA 2IPPA 4YXWG 2EBOA 3OTFA 5GONA 1IFNA 4LBEC 1JR9A 1KQGB 4J9YB 3W68A 2YMYA 4I9QA 1NBMG 3JCZA 1M57D 4CH5A 2Q0AA 1SQBG 2LJ2A 2XT9A 5CCHC 4F6EA 1GM8A 1HR0O 4LF5B 3CWBG 2ITCC 2A45H 4PJ0H 3CC4P 2O1KA 1K8AW 4L73A 1KQSU 1OV9A 2YIDA 3FB6C 2Q0OC 4YHHO 5CMZA 2HJDA 4B3MB 2ZT9C 3WUUA 1Q5OA 4WFFA 1Q90D 3CC7P 4YIPA 1RQVA 1SFCD 1KYOI 1LT1A 4W7YA 1JA8A 1W2EA 3AG3B 3ZIAG 4FFBB 1PL4A 2FYZA 1SQXD 4I9WA 1M9NA 3E8FA 1WPXA 2K9PA 4U7NA 1RSOA 3AEIA 1G1IA 1X79B 1TGOA 4FVMA 4I7ZC 1K73W 3TGUG 4NPDA 4B3RO 4ZOLA 1NU1D 3OJAB 2BEQD 3L71H 1VMGA 4GX2A 2N04A 2A06H 1H2GA 1H2LA 2IH1C 3LNNA 3AE4C 3B71A 3JALB 3UT5B 2OYQA 3G3ZA 1YXBA 2PI5A 3JD3A 1IFDA 3JATB 1YSCA 4F6RA 4Y99C 2EINB 1M57B 1PP9D 5EIBC 2SPZA 3H1ID 3APQA 4RUEA 3JSNA 4R8CA 3MP7B 4WY4C 1FAVA 5L3CA 1X59A 3ZCCA 2EILB 3AEFC 4WBNB 2QVAA 4DV5B 4JYAO 3M9HA 4DRXB 3LSQA 1VQPV 3UCSC 2OIEA 1HJ0A 1KB9D 2FFDC 2Y4UA 2X6AA 1G6UA 1ENVA 4ZNCA 1XHZA 1SFCB 1QL2A 3ZEDA 3L73H 3QG5A 4J41A 5JCOA 2AZ2A 2B9ZA 4IHJA 3STLC 2NRGA 1YF2A 3APOA 3GF3A 3GHGC 1KC8Q 1K4DC 1M56B 1BDDA 2YIBA 3RL0g 3SPIA 3VMZA 5IWAB 1VF6A 3K5MA 1LNQA 2YXLA 5IJ9A 4JI5B 4RQFA 3L75G 5AW5B 4GX1A 1PPJE 2QJKB 1P84D 3M0DA 1TAEA 1UPGA 2ZR3A 2BCCD 4LWSA 2EJRA 1H0TB 4LGDE 2OCHA 1MSDA 1XUQA 1OCOC 1COWG 4RWUA 4L87A 3L74D 1OCZC 3AG2B 2C0XA 1FZFA 4J7KA 5BMVB 2OTJP 2EIJC 3AE9C 2HR3A 4X66O 1K97A 2XOKG 3P3PA 3UM7A 3ASNC 4D7TA 5APYA 1HTLC 1YDXA 2Q5UA 1YJWV 2CAZC 2QKCA 4DR6B 1FBMA 3AEEC 3I5DA 1NWQA 1FS0G 3ABKB 5J9PC 3O65A 3U11A 1IZ3A 1JTHB 2HFED 2CGNA 1K3EA 2WLLB 4UVCA 4X1IB 1Q86W 1ZR2A 2WTYA 3SYQA 1SQQJ 4B3SO 3SWYA 1PFIA 1SQQE 3H1KH 2AHYA 1JCCA 3HKEA 3C8VA 1LWUA 3KHUA 1L4AD 4IFDK 3KZIE 3M0AA 2QR4A 3PP5A 2BOCC 4TWKA 2P4KA 4DR1O 1RY3A 4FLZA 2XHBA 3T1YB 1K8AQ 1MUUA 4GODA 3CC2V 3RK3D 4ABMA 3AEAC 2PF4E 3FX0A 3OM3B 3W7UA 2GA1A 3H1JG 1U7MA 4JI2O 5CCGA 4DR2B 1EDIA 3CCJP 2OTLV 1Z5VA 2HHHB 2CK3G 4C7RA 4LFAB 3CCLP 1FC2C 3E1RA 4C7NA 4IIJB 2KZIA 1YBKA 2N1TD 4PA6A 1GK4A 4OGQC 3VYIA 2F4VB 1W0KG 4IOIH 3FD9A 1LWUB 4U3FD 2R44A 1KYOH 3BRVB 1FZCB 2DQ0A 4UB6H 5AW3B 1FXKA 2WAMA 1K73Q 2E5TA 3VQYA 3W7WA 5CA0A 1NTMG 3HR0A 4Z1MG 4X20A 4NXNB 1V55C 2LR2A 2JEUA 3RGUA 2A06D 5TISH 2VS0A 3VP9A 1EC5A 3Q5PA 4KHPO 1TUBB 2EJ7A 4H0LB 5GTIH 2Z4EA 2A0LA 1OVVA 3CD6V 1L4AB 3SSUA 1YITP 5JH7A 2VWJA 1JUNA 1I94O 4BW9A 5CBOA 2E3CA 3CCUV 4TQFA 3VMAA 4TV9A 2C2AA 2XTAA 4OWFA 3P8CE 1YHQP 1EBOA 3GWOA 4FMTA 3AEBC 1I08A 1FE6A 4DCKA 3X2QB 3B8MA 3JD1A 5FPOA 2Q68A 4MTFA 4X88A 3KYQA 1HNWO 3GF7A 4DJGA 5CMUA 2UXNA 1CI6A 3G6EV 5KLIC 3ZRWB 3CJHB 3PJSK 3L73D 1SQQK 1OHHG 2VQFB 2B5UA 2R70A 1GMGA 4G27B 2N1TB 4EFEA 1ZXGA 1BCCJ 1BCCE 1N7LA 2QSIA 2ZM6O 4JF7A 3TF5A 1UIIA 4QIWF 4X1KA 1BHBA 3HKCB 3L72H 4HJGH 1OCCB 5AVSB 3CPWU 3RYIB 4BW5A 1LTSC 5F2VO 1ROPA 1L0LJ 1GMJA 1L0LE 2UXBB 2V4DA 5L8RJ 5B66E 1L0NG 1NJIW 1N34B 1HNXO 3E8GA 2GUZB 3T1HO 1N7SA 1JJ2U 1KKCA 4M3LA 2B88A 3WFVA 3RBZA 3JC22 2IBZH 3WU2Z 5AVUB 1AI5A 5H5NA 3A5TA 1MZFA 1WNSA 2ZYGA 3W7XA 4CH4A 1THZA 2X0LA 4EB6A 5EK0A 3U10A 3CMAP 2JEXA 1G8MA 5CBHA 1Q86Q 4UVAA 1OW8A 1XBLA 3AG3C 3KCYA 3AK1A 4MTGA 2NPSD 2ZE5A 3JSLA 1GK9A 3D3IA 1NU1G 2VWKA 3OA7A 2Q69A 1O9HA 3H1KD 2VRZA 2EZOA 1S9KE 1HR0B 4DV1B 5CB4A 1PIXA 2AEJA 1VQKV 4AHCA 4OPAA 2QWPB 4LF5O 1NVPD 4K8ZA 1A02F 2IDBA 2ZXWC 1OW6A 4YHHB 2ZDIA 2D3OW 3R2PA 1JO5A 1SQPH 2AW9A 1ZMEC 2LGWA 2HPCB 1VQ5P 5B5EH 1GKFA 1B6QA 2ZNJA 4A5UB 5LMNO 4JQ0D 3C3TA 2GUSA 3ABLB 4AQYO 1E1RG 4GKGA 4YIOA 2PGGA 1G4YB 2IZ0A 3D6ZA 1A32A 4YJ3B 2QKSA 2XNDG 3Q4HA 4O4JA 2P4VA 3SJAC 2WQYC 2EINC 1M57C 3S4RA 5HFMA 1AJQA 1KFNA 3VP8A 3FB8C 2Z5UA 1Q6UA 2V4HA 2YO3A 1E79G 2LW1A 1QR8A 2OYHA 1VQNV 2F23A 4NKGB 2ZR2A 3C1LA 3RFRA 2E75D 2DQ3A 2ZYAA 2R3SA 3FYIB 4X62O 3K5NA 1FAFA 1JY2P 2OGUA 1FXVA 4UCRA 1CPYA 5E79Z 2EILC 3ZMVA 3F7VC 4B3RB 1JOYA 2PGDA 4DK0A 3CCSV 1FJKA 4J42A 1KYOD 2Q67A 1P49A 3HKDA 1JB0J 3QO8A 2Q7CA 1L2PA 2V7QG 1RF1A 3BEHA 3BA9A 5L3FA 1SFCC 1JX9A 3CE2A 5APUA 2P90A 2QIWA 3CPWO 4NPFX 4NTXA 1KB9I 2NPSB 5CBGA 3B4SA 4GLXA 1JY2O 2C9NY 2CTPA 5EBLC 1R6NA 1RPOA 1L0LK 2HLOA 2K88A 3LUTB 2Y0DA 1M56C 2AXTZ 2R9RB 2BCCG 1NVPB 3I55P 3A0BZ 2LFSA 3CCEV 3SYAA 3L74G 4JYAB 4BRYB 1IFIA 2QJKC 2ZCEA 5AVTB 1EN4A 2GHYA 4WFGA 4X89A 3AG2C 5H9CA 1AV1A 1P84I 4LF8O 1I7FA 3STZC 3SR2C 2IYOA 2J5UA 1PL5A 5IY5B 3SYCA 2QG4A 1E5WA 4J10A 3WU2H 5KLVH 5JCOC 4LF4O 3L75J 3ABKC 3NR7A 4BR6A 3L75E 2E75B 5IJ0B 1FZAA 3ZHRA 2CTWA 2BSKB 5IWAO 1IURA 2P58A 3GWKC 1YIJP 1XOUA 1MG1A 2PFXA 4PI2A 3QO5A 3V4QA 3FGAD 2IM9A 3L72D 4IL6Z 3IGAC 2QTOA 4JV5O 2MJZA 3RW0A 4H44D 1BGYG 2J58A 3VMXA 1VL2A 3M0DC 2IU0A 1NJIQ 1PGPA 4GX5A 3RVZA 2Y48A 1DK1A 1ZRTD 3MZWB 4HYTB 1TA8A 4TOIA 4I55B 1PGQA 3CX5F 3KPEA 2P5OA 1XI1A 2LKMA 2WMMA 3HD7D 2IBZD 1YJNP 1VQ6P 3OMIB 5J2UB 2IX7C 1IBMB 4PHZA 1NAYA 3E35A 3GHGB 4JI8O 5KAIH 1LTIC 3JASB 2Y9ZA 3B8EB 3SFEC 2AGAA 4B3SB 2PP6A 4NPEA 4U3FG 4OX9O 4K35A 4WVZA 4DK1A 1OZHA 4NTWA 4RAIA 4DR7O 4FIPC 4CZZA 2FKWB 2XV5A 4AI8A 4OGQD 3E22A 4MVRA 5EYPA 5ITZA 4DR1B 3SPHA 1LWUC 3KG2A 2OARA 2A06G 4UCSA 1L0NH 2YMKA 3OUSA 1FZCC 2RQ6A 2PI4A 1GN6A 5E79H 3N7NA 4WBAA 3ZRVA 2ILMA 1Q7YW 1N8RQ 1RE3A 3GB7C 1R5SA 2HFEC 1SQPD 4RJTA 4JI2B 1EZVE 4CBCA 1N33O 2ZFCA 2ZE6A 4PDVA 2GTAA 4QNHB 4H0LC 1W2BU 1Y76A 1X9VA 2RDCA 1L4AC 1Y47A 1YQ4C 3BFRA 1NO4A 1VQ4V 5LA6B 4I5SA 4H44B 1AVMA 4PJ0Z 1LTJB 3RYFA 1IBKO 4JI3O 3ZHVA 1PV0A 1AR5A 2LQTA 2WLIA 4EDFA 3X2QC 1XEQA 3AK3A 5JJJB 1VQ9P 2YS8A 3HD7B 5IT9N 2H89C 5ITZB 3L73G 1IBLO 2ZIMA 1MKMA 1S5LH 4X1YB 3H1LJ 3WUVA 3OR7C 1FXKC 3H1LE 4ASWA 1WA8B 3HE4A 1JPXA 3FB7C 2QA4V 2L6LA 3L70H 1EM1A 1PD3A 4DV4O 1LTAC 3J81N 3LW5J 4PD4I 2OYIA 2N1TC 2FXMA 2BTQB 3L4FA 3JCUE 2KP8A 1XQ8A 2LFRA 1I5XA 2EIKB 3CCVV 4B3TO 3T97B 1E79H 4FLVA 3ZDMA 1OCCC 1GL2D 2YEVA 3BCCH 1SVFA 2IJHA 3ZRSA 2PY5A 4LCUC 1KB9F 5EC1C 4L74A 3CX5E 3MGNA 1HJBA 3EXAA 4UCVA 2FXPA 1HNWB 1UJWB 2L5GB 4HBNA 2KS1A 3H1HD 4MVMA 4G2KA 1T3JA 2ZYDA 5LP6B 5KMGB 3CXHI 4HNAB 2E5LO 2FL4A 3HUSA 3HE4B 4H37A 2KKWA 1RQUA 2GUVA 1OIPA 4PA4A 5KLVD 1R3LC 2ZM6B 3H1KG 3PN1A 2ZQMA 2YXQB 1P84F 2QRXA 2M3EA 2QEXP 1VEWA 1RHZB 3RYCA 2ZINA 1GU4A 4O4LB 1VQ7V 1Y9BA 1S3JA 2BCCH 3SJQC 2K9YA 5M1BA 2WPRA 2YI8A 1SESA 4J11A 1GZLA 3H01A 2WT7A 1HNXB 3HTKB 2WPVB 1F51A 3T1HB 1NH2D 1H2KA 4GIFA 4DOJA 3CB2A 1N34O 1Z56A 2P10A 4RESB 1RFYA 4N6JA 1FZBA 1U96A 1JMMA 2KG7B 3K04A 1RE4C 4MVOA 1MA1A 3CCQV 1SQXJ 3QWOC 1L1FA 1M1JB 1N7SC 1SQXE 4WB4A 2HYNA 2JGDB 4JTCB 2MK3A 2AEFA 2AXCA 4FJCC 4D6TD 3N2KA 5BXZA 1XNRO 1M1KW 4OXSA 1NU1J 2KXPB 1NU1E 1GL2B 3A7OA 3A0BE 4MN4C 3E83A 2E5YA 3UQ8A 1FD9A 2QJ1A 1NH4A 2O01H 3P8MC 1R73A 4KP4A 4DV1O 4CC6A 2Q4PA 3HRNA 3VTPC 3V2PA 3QTCA 1P4RA 2CH7A 1HNZO 1OMIA 1BZKA 4ZMDA 3MD0A 1V54B 1PP9J 3SDLA 3AE1C 5AVVB 1S72P 1BGYH 1PP9E 3H1IJ 4EEQA 1OCRB 3H1IE 2XASA 1L0ND 3EQ2A 3Q5SA 5JJEB 3ZMUA 4JAUA 5LMNB 4LFBO 3B8NA 1MZ9A 3MHHC 2WLNA 4AQYB 5IYBO 4XA4A 3Q1MA 3LSSA 3W7TA 3WB0A 1PGOA 2UUCB 2NPSC 2E43A 3CRCA 3AG4B 4RO0A 5IYZB 4PA9A 4FLWA 5KHIA 1PGJA 2Y9YA 2W6JG 5JQGA 5LYJA 2K37A 5GONB 4DV6O 2WSFJ 3CI9A 1NH2B 1PPJH 4X64O 3CXCU 5TJHA 3RYHA 2RKLA 1M56D 1SZTA 4U3FH 4X62B 1QL1A 1AVYA 1VQLV 1F7YA 2IU3A 3AE2C 1XMQO 2FKXA 2V7QJ 2G3AA 4NYKA 2ZXWB 2R5BA 3Q5RA 2IH3C 4YPCA 1LR1A 5LMUO 1Q2NA 4DW1A 5KJ7A 2PZSA 1U57A 1BE3H 1PL0A 3K0DA 1BMFG 3H32A 3RK2B 2V1DA 4O4HA 2KB7P 2KNCA 4I2LC 5IDJA 3OTOO 1NR7A 2Y69B 1NAFA 2VQEO 2YIAA 1KD1W 1USEA 5KAFZ 4X65O 3CCJV 5IY5C 1DD4A 4K8XA 1RF1C 1ZW0A 3VQWA 3ZRXA 4MS2A 1QGKB 3J7AU 4UB8E 3L70D 2M8RA 3K9SA 3VBBA 1XTCC 3L72G 2E75C 1SQQH 1EN5A 2WITA 1IZNB 3K57A 1URQA 1J5EO 4CPGA 2GM4A 1HF9A 4DZOA 5LYJB 4UB6Z 2AZ0A 4PDLA 1KILE 2WPSA 1VQOP 4CH3A 1RSOB 1SQXK 3BCCD 2AEMA 4PD4H 2WLMA 2YIBD 2ZXEB 1VQMV 5TISZ 3M9QA 4ZOLB 2IBZG 3CS5A 3ABMB 2HODA 3VQXA 5B1BB 4LF8B 4WF9V 5E1AC 1NU1K 2RN0A 5GTIZ 5DJUB 1R3IC 1LT9A 2M5AA 4O4HB 3LIEA 2LXBA 4LF4B 3T2MA 4K0KB 4JAVA 4F6RB 1KQSO 2IBZI 3JARA 4LNUA 1JY2N 1YHQV 2Q6QA 5AVZB 3JAKA 3BVOA 1SLQA 3RK3E 2QSAA 1N2DC 4JV5B 2WSEJ 4I6MC 3CXHH 4U7JA 1KV4A 3P7KA 1MABG 4EYYQ 4NTYA 2H8PC 3HKBA 1SQPG 3FYEB 3TDKA 2UXCB 4EIJA 4ASVA 2FTKA 1R6TA 3CMEV 2POHA 4LF6O
chains in the Genus database with same CATH topology
4PV1B 3Q5SA 2BEQD 1MKMA 2E76C 1R8EA 1EXJA 1EXIA 1UIXA 2D2CC 1KMIZ 2J5UA 3Q1MA 1PL5A 3AEAC 3AE4C 3B71A 1NYHA 3AEGC 1YQ3C 3LW5J 1KQFB 1DIPA 1ZRTE 2E76D 1ZP0C 3ABVC 3G9RA 4R4MA 2D2CD 2E75B 4H0LD 1NGMB 1PV3A 2JP3A 2WSFJ 1VF5D 1KTMA 1OW8A 4H44C 1ZOYC 4YXDC 3AECC 3T97B 2FYNC 2E74C 3FGAD 3AE2C 2WSCJ 4OGQC 2NZ2A 2V7QJ 3GMAA 2G3AA 3D70A 1PIXA 3Q5RA 4H13B 2FXPA 3AEFC 2FBWC 3Q3DA 4TT3H 4H44D 3S9OA 1DD3A 3D71A 1VL2A 1U57A 2E74D 3R4YA 1KORA 2IDBA 1OW6A 1HJ0A 2YIUC 4H13C 4PV1C 2QJPC 3D6YA 1K05A 4XFJA 1ZMEC 2BEZF 1DD4A 1IK7A 2ZT9B 3AE5C 3Q5PA 4PV1D 1RQUA 4H0LB 3SFEC 2JO1A 3SFDC 3H25A 3D6ZA 1AJYA 2E75C 3GF3A 1S1CX 1WMKA 2WQYC 1HF9A 3RL0g 5M1BA 1Y9BA 2K9YA 1KQGB 1KILE 4KT0J 3Q2YA 4YTPC 1FDOA 2E75D 3GLMA 2G8YA 3AEBC 4OGQD 2WPVB 2P10A 3IAOA 4I7ZB 2YMKA 2OQQA 5KKZC 3GF7A 1OW7A 2H88C 5KLIC 1JB0J 3AE8C 2E76B 4GDOA 4H13D 2D2CB 3AE9C 3EWKA 2QIWA 2ZT9C 3AE3C 1VF5B 1Q90D 1K04A 3AEEC 3AEDC 4H0LC 4Z1MH 3AE7C 3O6QA 1RQVA 1VF5C 2QSIA 1YQ4C 2ZT9D 3RK3E 4R4LA 3IN6A 4H44B 2WSEJ 4U7JA 2E74B 2MKVA 1TU3F 4OGQB 3C8VA 1GMJA 4RKUJ 1S5LX 2QJKC 1OMIA 4IL6X 5L8RJ 3AE1C 4Y28J 2H89C 4I7ZC 1FDIA 2QJYC 2O01J 3AE6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV1 B;  1VF5 B;  4H13 B;  1Q90 D;  2K9Y A;  4KT0 J;  2QSI A;  2YIU C;  2QJP C;  2WPV B;  3LW5 J;  4H44 B;  1ZRT E;  2WSE J;  2E74 B;  2E75 B;  4I7Z B;  5KKZ C;  4OGQ B;  2ZT9 B;  3C8V A;  4RKU J;  2WSF J;  1S5L X;  2QJK C;  5KLI C;  1JB0 J;  4IL6 X;  2E76 B;  4H0L B;  2D2C B;  2FYN C;  5L8R J;  4Y28 J;  2QJY C;  2WSC J;  2O01 J;  2QIW A; 
#chains in the Genus database with same CATH topology
 2ADP A;  2Y4T A;  3GVM A;  2XAF A;  1S4X A;  4JI8 B;  4IHJ B;  2P7J A;  1NT2 B;  1IBM O;  2LGQ A;  3SYO A;  4LLH A;  1HDJ A;  4N78 D;  4GYC B;  1M1K Q;  4XBF A;  2P06 A;  3ZX6 A;  3L71 J;  4H0L D;  5D5Q A;  4TUY A;  1Y4M A;  4W4L A;  4OX9 B;  3L71 E;  2RMZ A;  3ZHQ A;  3PTZ A;  5CCG D;  2A06 E;  4H44 C;  4DR7 B;  1Q8I A;  1XHX A;  3G4S V;  5IJ9 B;  1LTJ C;  3ZJZ A;  2Y0E A;  3K9A A;  3S3W A;  2NZ2 A;  2K9J A;  4LWS B;  5AW9 B;  1RPR A;  1NTZ J;  3EVK A;  3SJB C;  3HD7 C;  1NTZ E;  3LDD A;  5KTB A;  3HKB B;  3SYP A;  1DD3 A;  2ETN A;  1Y6X A;  5KKZ B;  1BGY D;  1KOR A;  5BVZ A;  5KA5 A;  5AW1 B;  1N33 B;  2FYU J;  3TNU A;  4NXM O;  2FYU E;  1FJP A;  1K9M W;  1X0T A;  4UCU A;  2F66 C;  1ORQ C;  2ARH A;  1KIL A;  3KDP B;  4PV1 D;  5KAF H;  1SQV H;  3K58 A;  4BIO A;  1BQ0 A;  1LGH B;  4WFA V;  2GDS A;  3OAA G;  1N0N A;  1IBK B;  4JI3 B;  1L0L H;  4QPK A;  2EIK C;  1E1Q G;  1PPJ D;  3HKE B;  2ADQ B;  2W0X A;  1KYO F;  3H1H G;  2F43 G;  4KT0 J;  3Q2Y A;  2DWE C;  2ZXX A;  1SC5 B;  1PM9 A;  4N21 A;  3NXS A;  5B5E Z;  1IBL B;  3FKS G;  4DR3 B;  4XDK A;  4K3A A;  3DXR A;  1ZN5 A;  2OQQ A;  1NTK J;  3SWK A;  2KUB A;  1BE3 D;  5LXT A;  1NTK E;  3IAY A;  2CUG A;  4EFB A;  2RH0 A;  5KLV G;  1RP3 B;  1SET A;  3L37 A;  1EFR G;  1AQT A;  3PLN A;  1Y67 A;  2K1E A;  5LP6 C;  1P7G A;  4DV4 B;  2ZKO A;  3C9I A;  4IGG A;  1KD1 Q;  4WFH A;  4ZKI A;  3FXD A;  1FZG A;  3AED C;  3CCM V;  1VQP P;  1SA0 A;  3ETE A;  4B3T B;  4GKJ O;  2DYS B;  5FNV A;  3M8A A;  1YVW A;  1SQQ D;  3IF4 A;  2LXC B;  3D8C A;  3M9B A;  2W6J H;  4H13 C;  4C7N B;  2ZE8 A;  3IFX A;  2IJJ A;  3U1A A;  4O2B A;  5B1N A;  3K08 A;  3DGE A;  5HFL A;  1RF0 C;  4PD4 D;  5BY1 A;  4IL6 X;  1FXK B;  4JI1 O;  1X22 A;  2WSS H;  1QLN A;  3CL3 D;  4D6T G;  5CA0 B;  4PV1 B;  4X20 B;  2E5L B;  2WWW A;  1M1J C;  1USD A;  1R3K C;  2GV9 A;  3UO2 A;  1N7S D;  1IJD B;  1YCI A;  5H6R A;  1G1X B;  2OCC C;  2UUB O;  1DX7 A;  1SRY A;  4I50 A;  2WSC H;  1KQF B;  2PYJ A;  3MHS C;  1N73 A;  1GL2 C;  5JH7 B;  3C3S A;  3DC6 A;  1YZB A;  2IZ1 A;  1NTZ K;  1SA0 B;  3SGI A;  5GW7 A;  3JSV C;  1IXM A;  4TV9 B;  2W6A A;  2ZVN B;  1SQF A;  2G38 A;  3AEC C;  1IO4 A;  5BR8 O;  2DWD C;  5H6Q A;  2A79 B;  2O01 N;  3CXH D;  1IC2 A;  1LTG C;  3B5N A;  1YJW P;  1KZU B;  2QDO A;  2FYU K;  4DO2 A;  2XZR A;  2OIG A;  1L8D A;  1XMO B;  1V54 C;  1CI6 B;  1MMM A;  1OCR C;  2OT5 A;  1YI2 V;  5KUK A;  2KYV A;  2DOS A;  4UV8 A;  1IDS A;  5GTH Z;  2A9H A;  3D36 C;  4MTO A;  4DUY B;  1XNR B;  1NQT A;  4JI0 O;  1LJ2 A;  1SQB J;  2KI7 B;  1IK7 A;  1KFM A;  1SQB E;  1R1B A;  3RL0 B;  1KYO E;  3AG4 C;  2ZNI A;  3CWB J;  4UB6 E;  1ZR4 A;  3CWB E;  2M7W A;  3K79 A;  3OEH G;  2AHZ A;  1N73 B;  5AVR B;  2ODM A;  3CEI A;  4X1K B;  2W6I G;  3P8C D;  3CC2 P;  4CS2 A;  4IYI A;  1NTK K;  1HNZ B;  4TQD A;  2P6J A;  4R7C A;  3GLM A;  1R6K A;  2G8Y A;  1TUE B;  3A2F A;  4O4I A;  1IFJ A;  2Y0C A;  5GTI E;  1ZUQ A;  1N7S B;  2OTL P;  1YJ9 V;  3FAV A;  4LFB B;  5KAI Z;  5CCH A;  4I4T A;  2B87 A;  3RK2 C;  4I1L A;  3L70 G;  3A0H Z;  4HYO A;  3FX7 A;  2Y69 C;  3B77 A;  1W5C E;  1HGV A;  1K5Q A;  1MZE A;  3HB3 B;  4EB6 B;  2UUC O;  3CRA A;  3L35 A;  1K9M Q;  1M8O B;  2L35 A;  3I56 V;  3AK2 A;  4DV6 B;  3TGU J;  4X64 B;  3TGU E;  1LP1 A;  3BCC G;  5BZB A;  4DV0 B;  1SQV D;  2EIM B;  4OPH A;  3QF7 A;  3O8Z A;  3V5B A;  1D7M A;  1CW5 A;  1XMQ B;  1L0L D;  1SER A;  2FB5 A;  2R72 A;  5CB4 B;  5LMU B;  1GK6 A;  3CCR P;  1TU3 F;  1FFX A;  5H2F H;  3M06 A;  3V6I A;  5LOV A;  4FLY A;  4JTD B;  3TYY A;  3T1C A;  4WFB V;  1O9G A;  3OTO B;  3ABM C;  3CD6 P;  5DN6 G;  5B1B C;  1K92 A;  2JRI A;  1ZV8 A;  2VQE B;  3P3N A;  3E7K A;  3CCU P;  4X65 B;  2QJP B;  3L72 J;  4MVQ A;  3L72 E;  4PA7 A;  1R8E A;  1EXI A;  3G6B A;  4FFK A;  1NKD A;  2JIZ G;  3OR6 C;  1Q81 W;  3JAW A;  3Q4H B;  1ZRT E;  4FZ0 A;  4O4J B;  3J80 N;  1J1D B;  1J5E B;  1H2N A;  2BTO A;  1QVF U;  2O1J A;  4R4M A;  4QE7 A;  1FJG O;  3G6E P;  5JVD A;  2OYH B;  4KJM A;  1KTM A;  2DYR B;  1B04 A;  3JYC A;  4ASU G;  3RN4 A;  1QLE B;  1D2D A;  1S5L Z;  1V9P A;  3H1H H;  1H2S B;  1H8H G;  3FWN A;  4FK5 C;  1XTG B;  1AI6 A;  4WY4 A;  2H8P D;  5APW A;  1VQ8 V;  1SQB K;  3BAT A;  3ZHU A;  2JJL A;  4ZBM A;  2HG5 D;  3HKD B;  4MTX A;  1EZV H;  1RF1 B;  2GBO A;  2RJZ A;  5B1O A;  2PAJ A;  1K05 A;  1JVM A;  3ZBH A;  3VMY A;  3N2G A;  2YUA A;  2FFD A;  4K0K O;  1CEZ A;  3FB5 C;  5GTH H;  1MOF A;  1GDT A;  5KHG A;  4XDJ A;  1OVU A;  2W0F C;  2K1A A;  1S2E A;  2DW3 A;  1A02 J;  4YJ2 A;  1SQP J;  2P1J A;  1AQ5 A;  1VF6 C;  1SQP E;  2I1K A;  3BPZ A;  5B5E E;  4ZI7 A;  1QHT A;  3ABU A;  2HVK C;  3IC7 A;  1EDL A;  1K7D A;  3WG7 B;  2UXC O;  4LF6 B;  2H3O A;  2A3Q A;  1FS0 E;  5EZY A;  3PHL A;  2QJY B;  4G28 B;  5KKZ C;  3K5O A;  1QR9 A;  4D6T H;  1OW7 A;  4FLT A;  4GDO A;  1H8A A;  2JDI H;  3A0H H;  4BXL A;  4WFE A;  3JCU H;  3OEE G;  3AE3 C;  2Q9I A;  1VQK P;  1VAR A;  1PPJ G;  1JQ0 A;  4BWN A;  3ZN1 A;  2KLU A;  1VPC A;  3WMM 0;  3E89 A;  1K34 A;  1KUQ A;  1EDK A;  4LC1 A;  3G71 V;  2QM8 A;  3II6 A;  1W59 A;  2J59 M;  2IFM A;  3HE5 A;  1ARO P;  5CA1 A;  2FYN B;  2QTS A;  1OVR A;  4ZIB A;  1BE3 G;  4DR5 O;  5C8Y A;  1HUC A;  3H1J J;  2B9B A;  3S3X A;  3H1J E;  1TVK A;  1MSW D;  3BAB A;  3CP1 A;  3KQG A;  1JY3 P;  1JCD A;  3V2Q A;  4UUJ C;  2CTQ A;  2F95 B;  2YDE A;  3FFQ A;  4NXM B;  3AE6 C;  1QVF O;  1MNG A;  1VQN P;  1FKA O;  1EXJ A;  3S1K A;  1UIX A;  5LGN A;  4FLX A;  1SQQ G;  1F4N A;  2M6Y A;  1FXH A;  5AW2 B;  2X6B A;  2JKV A;  5CCG C;  1FOS F;  4MW8 A;  1G2C A;  1JFF A;  3CCS P;  2E76 D;  1RM1 B;  1PNK A;  3ZMT A;  2DYS C;  1JY3 O;  5CN0 A;  1NTM J;  3CC4 V;  1XNQ O;  1NTM E;  2IYP A;  2QKA A;  3NMD A;  5FPR A;  3UKM A;  3WU2 E;  3E22 B;  5EYP B;  2R9I A;  1I0H A;  3K59 A;  2WA3 A;  4WCE V;  4DR3 O;  3K03 A;  4TT3 H;  2KSD A;  2W8Z A;  1ZSP A;  1M7L A;  4DV7 O;  4CS4 A;  3OMN B;  1AB3 A;  5KA6 A;  3CC7 V;  2R3C A;  4PV1 C;  1FU1 A;  1SS3 A;  2UXD O;  3CCE P;  5LBQ A;  2QWR B;  4O2A A;  1VIB A;  4DUZ B;  1HH0 A;  1SQP K;  2K3R A;  2YKP A;  2ITD C;  1DEB A;  2GTS A;  2VRS A;  4GKJ B;  1ZLL A;  2ZAE B;  2XAQ A;  1HWT C;  1Y76 B;  1JM0 A;  4JPZ B;  1Q81 Q;  1HGZ A;  3CLQ A;  1S1C X;  1ZL8 A;  4GUN A;  4FM2 A;  1SZX A;  1XL4 A;  4A7P A;  2IJI A;  3RYF B;  3MAQ A;  1Q43 A;  4QE9 A;  3ASO C;  2CGO A;  3OW2 U;  2WLI B;  2Q7G A;  3UIA A;  1GM9 A;  1R3J C;  5KAI E;  4JI1 B;  2P2U A;  1Q6H A;  2HJF C;  4WWI A;  4I0X A;  1QU7 A;  4KXR A;  1XRE A;  3TXQ A;  5JWP A;  3RGB A;  4NVP A;  4EOT A;  4RUF A;  5AW7 B;  1AFO A;  2E76 B;  3QNE A;  1AP5 A;  4H33 A;  4ZHQ A;  1EZV D;  2UUB B;  5KX5 A;  3W67 A;  3MUD A;  1R5L A;  2OYI B;  3BA8 A;  4QGP A;  3KZI Z;  3LDE A;  5J2T A;  4HB1 A;  4AQR D;  1S76 D;  3E8B A;  1ZWI C;  4W80 A;  3RL0 C;  1L0N J;  2WSF H;  3OFN G;  4J9Z B;  1L0N E;  5BU5 A;  5BU8 B;  3AE7 C;  5C93 A;  5E79 E;  1JMB A;  3U59 A;  5CA3 A;  1NKZ B;  2HKO A;  1KP3 A;  1WP7 A;  1N73 C;  5BR8 B;  4ZKP A;  5C39 A;  1Q82 W;  2XAH A;  2YEV B;  1AI4 A;  4GT1 A;  4MVS A;  4JI4 O;  1YTF B;  3RT3 C;  2ZD9 A;  3V4W A;  2Y0I A;  3JD2 A;  5L3G A;  3H9V A;  5CBF A;  1W2B O;  4RKU J;  2KZJ A;  1M93 A;  2A7W A;  1XMO O;  2KS1 B;  2WZ7 A;  2FXO A;  2M3B A;  1EQ7 A;  1FDI A;  3H1L D;  1BCC G;  1FOS E;  4KL1 A;  1Y74 A;  3F7Y C;  3R66 A;  1HP8 A;  2OCC B;  4JBZ A;  4JI0 B;  3U0Z A;  3RK2 D;  4UV9 A;  4DUY O;  2AXT E;  1KMI Z;  5L3E A;  1GTW A;  1SQV G;  3HUS B;  1JJO A;  1NTM K;  1UFI A;  3M99 B;  2DJV A;  3IFM A;  4HAM A;  3AEG C;  1L0L G;  5B3S B;  1DIP A;  1BS3 A;  2WPD G;  2W83 C;  4JZG A;  4UVB A;  3OGI B;  1DTO A;  4FM1 A;  3T4Z A;  2EIM C;  1NGM B;  3RYC B;  1S5L E;  3B2E E;  4YY3 O;  2H43 A;  2OTJ V;  2WT7 B;  1H38 A;  4FFB A;  2C0W A;  3K0G A;  2XAJ A;  4O9B A;  1KKD A;  1K4C C;  2HVJ C;  2Q73 A;  3FWL A;  2ZDI C;  1Q7Y Q;  1XDC A;  2W27 A;  3USS A;  2YIU C;  1VQ4 P;  3ZN0 A;  2Q6A A;  4J80 A;  1F4M A;  2DN9 A;  4PDR A;  2Q3E A;  2QJP C;  3M91 A;  1Y66 A;  2XU6 A;  3BCC J;  5KJ7 D;  1Y74 B;  2UUA O;  4LF7 O;  2H7H A;  3BCC E;  1DGS A;  2YSU B;  1GTO A;  3N2K B;  1WP8 A;  1S0V A;  1KB9 E;  2Q5Z A;  4JYC A;  5EBW C;  2PRR A;  1RH5 B;  5CHX A;  2X7R B;  3OW2 O;  1ZTE A;  4IL6 E;  1IVS A;  2JGU A;  3JAL A;  3K06 A;  3UT5 A;  1J1D C;  1X8Y A;  1AI7 A;  3A8T A;  4DV0 O;  5CJ4 A;  4DXW A;  3OE7 G;  5KUM A;  1AJY A;  2WSE H;  1JCH A;  3WUT A;  3A0R A;  2OYH C;  1NI8 A;  3JAT A;  1AIL A;  3IR9 A;  2DYR C;  1LUW A;  1YTZ I;  1QLE C;  1YYC A;  2DW4 A;  2WSS G;  1N32 O;  1URQ D;  2CH7 B;  4GZR B;  4Z1V A;  2QA4 P;  4EKW A;  1OZ0 A;  1NS1 A;  1BDC A;  4P2Z A;  2JR8 A;  1N86 A;  4LF9 O;  4WBN A;  1L0N K;  1P84 E;  3RVY A;  4BIZ A;  2BCC J;  2H88 C;  3CCV P;  4DRX A;  2BCC E;  3CHX A;  3NFQ A;  2UWJ E;  1GW4 A;  3CCL V;  2PTM A;  1CZQ A;  3L74 J;  1FYJ A;  3L74 E;  1P7B A;  1SFC A;  2Z5I A;  4DYL A;  2WLJ A;  5B66 Z;  1FJG B;  4E4E A;  5JQG B;  4DV3 O;  3KZI H;  5LGT A;  5AVQ B;  5LHI A;  4BAY A;  3RYH B;  4UFZ A;  4PD4 F;  1GO3 F;  2F1M A;  1HBW A;  3CSX A;  1F23 A;  4UXN A;  2RNB A;  2YIC A;  4QPJ A;  1GN4 A;  3MHV A;  1NTZ H;  3JD0 A;  3QH9 A;  5FL7 G;  4N78 E;  1SS1 A;  2Y0P A;  3WG7 C;  1GN3 A;  2XKM A;  1QCE A;  3H32 B;  4Y28 J;  2FYU H;  2KNC B;  4ZKU A;  2QJY C;  2O01 J;  1J95 A;  3GG2 A;  4MVU A;  1H0T A;  2LO1 A;  1OWA A;  1VQ7 P;  1YIT V;  2HLD G;  3QO7 A;  5AVY B;  1NHL A;  2CDY A;  1Q6I A;  1VF7 A;  3BRC A;  5BMV A;  4PJ0 E;  5LHG A;  3OD4 A;  4LFC O;  1BGY J;  1BSN A;  1BGY E;  2CE4 A;  1ZP0 C;  3CXH F;  1URQ B;  2D2C D;  2N9Y B;  3CCQ P;  1JTH A;  1FDM A;  5AVW B;  2WLL A;  4LP8 A;  2ITA A;  1ZOY C;  1Q82 Q;  4ICG A;  4X1I A;  3BHP A;  4GCZ A;  5AW0 B;  2HG5 C;  1S5J A;  2FYN C;  2WA4 A;  4C7U A;  4XE5 B;  4OVN F;  1Y8A A;  1NTK H;  1AJP A;  2YKO A;  2HOD B;  2KSJ A;  2X6C A;  4JF3 A;  2E74 D;  2N05 A;  1U97 A;  2BAS A;  1LT9 B;  2R5D A;  4U3F J;  2M5A B;  4U3F E;  5AG2 A;  2JWA A;  2JS3 A;  3SPJ A;  3DC5 A;  5K5G B;  3ZMS A;  2ZVO B;  3CRM A;  5APV A;  1BE3 J;  1B06 A;  2P7T C;  1RM1 C;  3JAR B;  4LNU B;  1BE3 E;  3SFD C;  1H2M A;  2OWO A;  3KCX A;  3JAK B;  1URF A;  1KIL D;  3MTU E;  3TK1 A;  4DR5 B;  4JI7 B;  3ZHT A;  3SPC A;  1IFP A;  4IIJ A;  4YTP C;  3R65 A;  1AA0 A;  1T3U A;  1S5H C;  3JAM N;  4DR4 O;  3TJT A;  4D7S A;  2Z0A A;  5JJN B;  2UU9 B;  1RE3 C;  3V2N A;  1BCC H;  3CMA V;  5APS A;  1B3Q A;  2NNU A;  3P30 A;  3AG1 B;  1FZC A;  1VQL P;  3IJ4 A;  2XDJ A;  4DV2 O;  2D2C B;  2QWN B;  3EWK A;  2JJ1 G;  3B40 A;  4PD4 E;  1OXZ A;  3VOP A;  3DSQ A;  1GW3 A;  4JI6 O;  4TUY B;  3L73 J;  1XNQ B;  2R32 A;  1WPB A;  3L73 E;  1TUB A;  1J1E B;  5B66 H;  2EUL A;  2XAG A;  1VF5 C;  3OAK A;  4EI2 A;  4LR3 A;  5AW8 B;  1L4A A;  1SF9 A;  3F5H A;  2ATK C;  5DM6 V;  2Z3Y A;  2E74 B;  2K9J B;  1NZ6 A;  2Q1K A;  1VQ5 V;  1T8Z A;  3WB1 A;  4MSW C;  4DV7 B;  1DLB A;  1EZV G;  1S5L X;  2WLK A;  4YXW H;  1LTB C;  1AVO A;  3A2A A;  2UXD B;  1ZLZ A;  4KUM A;  3TNU B;  2Q7H A;  3K3W A;  1SQB H;  1KP2 A;  4DUZ O;  1WN7 A;  1QEX A;  2F93 B;  2E76 C;  3CXH E;  1VDF A;  3GW6 A;  4LH7 A;  3ITK A;  1KN7 A;  1KIL B;  3CWB H;  1VQM P;  2OYI C;  3TXS A;  2I8D A;  2JS5 A;  2I1J A;  2KIK A;  1T2K D;  3L71 D;  1AJN A;  1VP7 A;  3ZRW A;  3CJH A;  1EZV I;  3E8H A;  5H2F Z;  3ABV C;  3RL0 D;  2KK7 A;  1W0J G;  1MV8 A;  1JMK C;  3CCR V;  2XNX A;  2N1T A;  3FXE A;  2HEP A;  3KKY A;  1OFC X;  1WRG A;  4YXD C;  1D5A A;  5APQ A;  3H1L G;  3KXD A;  4TV8 A;  3MIW A;  1JY3 N;  4HKZ H;  1NTZ D;  4J7Z A;  3HKC A;  4FLU A;  2YXY A;  3RYI A;  4OH8 B;  2YO2 A;  3DXR B;  3H1K J;  3ICX A;  2ZJS E;  3H1K E;  3S9O A;  3B5N D;  2Q8V A;  5LXT B;  3D71 A;  2JDI G;  2FYU D;  3R4Y A;  2QM4 A;  4QMA A;  2GUZ A;  3DTU B;  3D6Y A;  4JZ2 A;  3RK3 B;  2BEZ F;  3HUS C;  3I55 V;  1N36 B;  2H94 A;  1PNL A;  3TGU H;  4RQE A;  3AG7 A;  2HP8 A;  1Q3E A;  1SKV A;  3M7M X;  3MUD C;  1QVG U;  4MW3 A;  5B3S C;  1AP6 A;  2P67 A;  5FNV B;  3CME P;  5CJ0 A;  2PUS A;  4PEL A;  3ASO B;  2JEE A;  1J2J B;  1MFT A;  4JI4 B;  3THO A;  4O2B B;  1N4C A;  1QBZ A;  2KOG A;  4GOF A;  5A2Q N;  4FZ1 A;  4IFM A;  5KAF E;  1ZAU A;  4TV8 B;  1SQV J;  3CRR A;  3T4D A;  5DJT B;  3C90 A;  1SQV E;  3ETQ A;  3G80 A;  1NTK D;  1WT6 A;  3CX5 I;  2LW7 A;  3F89 A;  4L76 A;  1US6 A;  3U1C A;  1Z2G A;  4KFM A;  2YKQ A;  2JJ2 G;  3G4S P;  2E42 A;  4JAS A;  4H13 D;  1T6A A;  1RE4 A;  1YIJ V;  5CCH D;  3TSI A;  2IW5 A;  4I50 B;  4Q6G A;  2HPC A;  1NR1 A;  1QNM A;  1AR4 A;  5IE9 A;  3WB2 A;  3VOU A;  1IXB A;  3CYO A;  2LP7 A;  4YY3 B;  5TIS E;  3SPG A;  2KSE A;  4CC5 A;  1YEW A;  5AW4 B;  4YJ3 A;  2ZT9 D;  4R50 A;  4TT3 G;  3B5N B;  4GKK O;  1SQX G;  2MKV A;  2QWQ B;  1QLE D;  3ZHS A;  1VQ6 V;  2B89 A;  1YJN V;  1DF4 A;  2RCV A;  1BSH A;  3JCU Z;  1EDJ A;  2JVD A;  1BHA A;  3P32 A;  4HH2 A;  2UUA B;  1KU9 A;  1HW7 A;  3L75 H;  4FM0 A;  4LF7 B;  4TLF A;  1Z5W A;  4X8A A;  2OTK E;  3F5T A;  1BCC D;  2QE7 G;  1EN6 A;  3N27 A;  5B1A B;  1N8R W;  3E86 A;  4B3M O;  1GM7 A;  2NPS A;  2CPS A;  2B1G A;  2CPB A;  3HPL C;  1PP9 G;  1PV3 A;  2PYL A;  2JP3 A;  1N32 B;  3H1I G;  2DE0 X;  2YI9 A;  4B86 A;  4E2L A;  3ZMZ A;  4JYY A;  2WSC J;  4O4I B;  3LSU A;  4N3Y B;  4QJF B;  4LF9 B;  2YIU B;  5KJ7 C;  3FAV B;  4H13 B;  2IFN A;  5EFW B;  4JGS A;  2WVR A;  3CCM P;  1HWY A;  2FBW C;  4PA3 A;  1M4U A;  4JTA B;  5EIB D;  4I4T B;  4BRY A;  3K5L A;  2B87 B;  1QVG O;  1AR1 B;  4R6Z A;  5IYD O;  2FML A;  1D5N A;  1LUV A;  3G67 A;  4WY4 D;  1DF5 A;  1KQL A;  1SQB D;  1WB7 A;  3O9O A;  2RN9 A;  2ZIO A;  3PRJ A;  4P9P A;  5LL6 Y;  2IJK A;  5APT A;  1WAZ A;  1XIL A;  2ZT9 B;  4DV3 B;  1PZQ A;  4TSF G;  3CWB D;  3E2E A;  1LP1 B;  2IBZ E;  4CH6 A;  1PKX A;  1S9K D;  1GRJ A;  1VQ9 V;  1URQ C;  1NKN A;  1SQV K;  3IC9 A;  1WMK A;  5DEC A;  3K5B A;  5L3D A;  5IJ0 A;  3H1J H;  4C46 A;  4AUW A;  1FFX B;  2BSK A;  4KHX A;  5LOV B;  2YNY A;  2QWO B;  2CK3 H;  4JAA A;  4L75 A;  1GH6 A;  2C9L Y;  5D5P A;  3LID A;  3IAO A;  1DH3 A;  3TET A;  4I7Z B;  1NVO A;  5DED A;  1LT9 C;  4DV5 O;  4CS3 A;  1CXZ B;  4UCT A;  4LFC B;  2L91 A;  4I55 A;  4MT8 A;  3TCU A;  4Z2W A;  3JAW B;  1JEK A;  4GX0 A;  3TGU D;  5KHH A;  2RMK B;  5J2U A;  2KQX A;  1K04 A;  1NTM H;  5EBM C;  3GHG A;  2R9A A;  3D3Q A;  4U7O A;  2WPQ A;  1K33 A;  4Z1M H;  3O6Q A;  5JVD B;  1IFM A;  3JAS A;  1SP4 A;  1YI2 P;  4Y99 B;  1WJZ A;  1JOC A;  4R4L A;  3IN6 A;  2EZP A;  2XUM A;  2FY8 A;  3BAA A;  3H1L H;  1GAX A;  1YTZ T;  4WY4 B;  1H88 A;  3RBX A;  3UO3 A;  3OMA B;  4JI5 O;  1KBH A;  3LW5 H;  2A45 G;  4PI0 A;  1H8E G;  2YC0 A;  1M90 W;  3AG1 C;  3N2G B;  1SQG A;  3L9D A;  2FFD B;  2QEX V;  1IK9 A;  2NLJ C;  2D2C C;  5H2F E;  3ETD A;  4PDM A;  4X66 B;  1NYH A;  2JWD A;  1FFT B;  2M0B A;  4YJ2 B;  2CTR A;  3CX5 H;  1OJH A;  1YJ9 P;  3ZS8 C;  3G9R A;  1EZJ A;  1J1E C;  4DR6 O;  5L3B A;  3O6Q B;  2B1I A;  4JYB A;  4JI7 O;  1HVV A;  2A45 I;  3PH0 A;  4LH6 A;  4ZI7 B;  1VF5 D;  3I5C A;  2E74 C;  1OX3 A;  5LA6 A;  4IYH A;  3SWF A;  4DR4 B;  4UB8 Z;  1LTJ A;  5K1P A;  2O3J A;  3GMA A;  3BY6 A;  3I56 P;  5EZY B;  4AIL C;  1DEE G;  1XL6 A;  2UU9 O;  3LNM B;  4DV2 B;  3HD7 A;  1OCO B;  3L71 G;  3L75 D;  1OCZ B;  4GOE A;  3H1H J;  2EIJ B;  3H1H E;  4NB5 A;  3OGC C;  4X1Y A;  2Q7E A;  4JI6 B;  1KIL C;  4HZ3 A;  1WA8 A;  3T1Y O;  3ASN B;  3AE5 C;  1IX9 A;  4RO2 A;  1T5E A;  1NOH A;  1JNM A;  5LHH A;  3H25 A;  2JO1 A;  1NTZ G;  1QX8 A;  1MFZ A;  2ZE7 A;  4IT5 A;  4MVZ A;  1S72 V;  2YXR B;  3HE5 B;  1WB8 A;  2EX3 A;  5KLV J;  5KLV E;  1BL8 A;  2BTQ A;  1FPO A;  2QM7 A;  5CA1 B;  4DR2 O;  2BE3 A;  3VQV A;  2HHH O;  4N23 A;  5C8Y B;  2N9B A;  3E1I A;  4W7Z A;  2GSM B;  1SQX H;  2FYU G;  1TVK B;  5GTH E;  4U3J A;  4LFA O;  1FDO A;  3L36 A;  3T97 A;  1H89 A;  1YTF D;  3OUF A;  4NR1 A;  4IFF A;  1KEC A;  1LTT C;  5A9G A;  2AXT H;  2F4V O;  1NU1 H;  3BAS A;  1GD2 E;  3RWR D;  3A0B H;  2N74 A;  2NN4 A;  3EHB B;  4BWA A;  3AE8 C;  1U7J A;  4W4K A;  1WLE A;  2QE7 H;  5AW6 B;  3RK3 C;  2W90 A;  2OYO A;  1G2C B;  5LP6 A;  1JFF B;  5KMG A;  1VF5 B;  1BSM A;  4NXN O;  4JPR A;  4HNA A;  1VQ8 P;  4KHP B;  1BT8 A;  2Q9L A;  3OT7 A;  3CRQ A;  4D6T J;  4D6T E;  4Q20 A;  3V2R A;  1PP9 H;  2Z5H A;  3ML0 A;  5CBN A;  3A3Y B;  3H1I H;  1NTK G;  2UXX A;  4J7J A;  4UCO A;  3H1J D;  1I94 B;  3A0H E;  5EC2 C;  2XND H;  4O4L A;  4B08 A;  4OGQ B;  4U3J B;  1I5Y A;  4DW0 A;  1ZX3 A;  3W7S A;  1RF0 A;  3HTK A;  4X9Q A;  3EFG A;  1X4T A;  1KB9 H;  1T2K C;  4O2A B;  4P9O A;  3LDC A;  2JK5 C;  4IL6 H;  2O57 A;  5FLX N;  2KG7 A;  3BVH A;  1CSB A;  1N36 O;  1V55 B;  1BQZ A;  1M1J A;  2WLH A;  1VQO V;  1M5I A;  1GN2 A;  2DMX A;  2P22 C;  3QVN A;  1YQ3 C;  2MW2 B;  2JGD A;  3MDS A;  2NR5 A;  1QQC A;  2V7Q H;  2QGN A;  1ZL8 B;  3ETG A;  1NTM D;  1KC8 W;  2YXH A;  2VQF O;  3SJC C;  1GL2 A;  1K5S A;  3BRT B;  4P30 A;  1PNM A;  3B09 A;  1S77 D;  1N0J A;  2Q3I A;  2BOB C;  5AVX B;  1FZE A;  3B5N C;  3F5W C;  4B7E A;  5IYC O;  4XDL A;  4I0X B;  1P84 H;  3H6P A;  3D70 A;  1CP9 A;  5LGU A;  3Q3D A;  4UB8 H;  3G71 P;  2UXB O;  3L74 H;  1G1J A;  4ZHQ B;  5KX5 B;  5KLI B;  2KB1 A;  3JD4 A;  4BIU A;  2W6B A;  4XFJ A;  1M90 Q;  5KLV K;  3VN0 A;  4B7K A;  5APX A;  5J2T B;  5B1A C;  1GU5 A;  3EFF K;  4DT0 A;  4AYC A;  3D36 A;  3N4X A;  3NTN A;  5KHK A;  4F4L A;  3CX5 D;  4FPP A;  5K1X A;  5KHJ A;  3L70 J;  4GKK B;  3L70 E;  3ABL C;  4L8J A;  5IYZ A;  3ABT A;  2KLV A;  2IPP A;  4YXW G;  2EBO A;  3OTF A;  5GON A;  1IFN A;  4LBE C;  1JR9 A;  1KQG B;  4J9Y B;  3W68 A;  2YMY A;  4I9Q A;  1NBM G;  3JCZ A;  1M57 D;  4CH5 A;  2Q0A A;  1SQB G;  2LJ2 A;  2XT9 A;  5CCH C;  4F6E A;  1GM8 A;  1HR0 O;  4LF5 B;  3CWB G;  2ITC C;  2A45 H;  4PJ0 H;  3CC4 P;  2O1K A;  1K8A W;  4L73 A;  1KQS U;  1OV9 A;  2YID A;  3FB6 C;  2Q0O C;  4YHH O;  5CMZ A;  2HJD A;  4B3M B;  2ZT9 C;  3WUU A;  1Q5O A;  4WFF A;  1Q90 D;  3CC7 P;  4YIP A;  1RQV A;  1SFC D;  1KYO I;  1LT1 A;  4W7Y A;  1JA8 A;  1W2E A;  3AG3 B;  3ZIA G;  4FFB B;  1PL4 A;  2FYZ A;  1SQX D;  4I9W A;  1M9N A;  3E8F A;  1WPX A;  2K9P A;  4U7N A;  1RSO A;  3AEI A;  1G1I A;  1X79 B;  1TGO A;  4FVM A;  4I7Z C;  1K73 W;  3TGU G;  4NPD A;  4B3R O;  4ZOL A;  1NU1 D;  3OJA B;  2BEQ D;  3L71 H;  1VMG A;  4GX2 A;  2N04 A;  2A06 H;  1H2G A;  1H2L A;  2IH1 C;  3LNN A;  3AE4 C;  3B71 A;  3JAL B;  3UT5 B;  2OYQ A;  3G3Z A;  1YXB A;  2PI5 A;  3JD3 A;  1IFD A;  3JAT B;  1YSC A;  4F6R A;  4Y99 C;  2EIN B;  1M57 B;  1PP9 D;  5EIB C;  2SPZ A;  3H1I D;  3APQ A;  4RUE A;  3JSN A;  4R8C A;  3MP7 B;  4WY4 C;  1FAV A;  5L3C A;  1X59 A;  3ZCC A;  2EIL B;  3AEF C;  4WBN B;  2QVA A;  4DV5 B;  4JYA O;  3M9H A;  4DRX B;  3LSQ A;  1VQP V;  3UCS C;  2OIE A;  1HJ0 A;  1KB9 D;  2FFD C;  2Y4U A;  2X6A A;  1G6U A;  1ENV A;  4ZNC A;  1XHZ A;  1SFC B;  1QL2 A;  3ZED A;  3L73 H;  3QG5 A;  4J41 A;  5JCO A;  2AZ2 A;  2B9Z A;  4IHJ A;  3STL C;  2NRG A;  1YF2 A;  3APO A;  3GF3 A;  3GHG C;  1KC8 Q;  1K4D C;  1M56 B;  1BDD A;  2YIB A;  3RL0 g;  3SPI A;  3VMZ A;  5IWA B;  1VF6 A;  3K5M A;  1LNQ A;  2YXL A;  5IJ9 A;  4JI5 B;  4RQF A;  3L75 G;  5AW5 B;  4GX1 A;  1PPJ E;  2QJK B;  1P84 D;  3M0D A;  1TAE A;  1UPG A;  2ZR3 A;  2BCC D;  4LWS A;  2EJR A;  1H0T B;  4LGD E;  2OCH A;  1MSD A;  1XUQ A;  1OCO C;  1COW G;  4RWU A;  4L87 A;  3L74 D;  1OCZ C;  3AG2 B;  2C0X A;  1FZF A;  4J7K A;  5BMV B;  2OTJ P;  2EIJ C;  3AE9 C;  2HR3 A;  4X66 O;  1K97 A;  2XOK G;  3P3P A;  3UM7 A;  3ASN C;  4D7T A;  5APY A;  1HTL C;  1YDX A;  2Q5U A;  1YJW V;  2CAZ C;  2QKC A;  4DR6 B;  1FBM A;  3AEE C;  3I5D A;  1NWQ A;  1FS0 G;  3ABK B;  5J9P C;  3O65 A;  3U11 A;  1IZ3 A;  1JTH B;  2HFE D;  2CGN A;  1K3E A;  2WLL B;  4UVC A;  4X1I B;  1Q86 W;  1ZR2 A;  2WTY A;  3SYQ A;  1SQQ J;  4B3S O;  3SWY A;  1PFI A;  1SQQ E;  3H1K H;  2AHY A;  1JCC A;  3HKE A;  3C8V A;  1LWU A;  3KHU A;  1L4A D;  4IFD K;  3KZI E;  3M0A A;  2QR4 A;  3PP5 A;  2BOC C;  4TWK A;  2P4K A;  4DR1 O;  1RY3 A;  4FLZ A;  2XHB A;  3T1Y B;  1K8A Q;  1MUU A;  4GOD A;  3CC2 V;  3RK3 D;  4ABM A;  3AEA C;  2PF4 E;  3FX0 A;  3OM3 B;  3W7U A;  2GA1 A;  3H1J G;  1U7M A;  4JI2 O;  5CCG A;  4DR2 B;  1EDI A;  3CCJ P;  2OTL V;  1Z5V A;  2HHH B;  2CK3 G;  4C7R A;  4LFA B;  3CCL P;  1FC2 C;  3E1R A;  4C7N A;  4IIJ B;  2KZI A;  1YBK A;  2N1T D;  4PA6 A;  1GK4 A;  4OGQ C;  3VYI A;  2F4V B;  1W0K G;  4IOI H;  3FD9 A;  1LWU B;  4U3F D;  2R44 A;  1KYO H;  3BRV B;  1FZC B;  2DQ0 A;  4UB6 H;  5AW3 B;  1FXK A;  2WAM A;  1K73 Q;  2E5T A;  3VQY A;  3W7W A;  5CA0 A;  1NTM G;  3HR0 A;  4Z1M G;  4X20 A;  4NXN B;  1V55 C;  2LR2 A;  2JEU A;  3RGU A;  2A06 D;  5TIS H;  2VS0 A;  3VP9 A;  1EC5 A;  3Q5P A;  4KHP O;  1TUB B;  2EJ7 A;  4H0L B;  5GTI H;  2Z4E A;  2A0L A;  1OVV A;  3CD6 V;  1L4A B;  3SSU A;  1YIT P;  5JH7 A;  2VWJ A;  1JUN A;  1I94 O;  4BW9 A;  5CBO A;  2E3C A;  3CCU V;  4TQF A;  3VMA A;  4TV9 A;  2C2A A;  2XTA A;  4OWF A;  3P8C E;  1YHQ P;  1EBO A;  3GWO A;  4FMT A;  3AEB C;  1I08 A;  1FE6 A;  4DCK A;  3X2Q B;  3B8M A;  3JD1 A;  5FPO A;  2Q68 A;  4MTF A;  4X88 A;  3KYQ A;  1HNW O;  3GF7 A;  4DJG A;  5CMU A;  2UXN A;  1CI6 A;  3G6E V;  5KLI C;  3ZRW B;  3CJH B;  3PJS K;  3L73 D;  1SQQ K;  1OHH G;  2VQF B;  2B5U A;  2R70 A;  1GMG A;  4G27 B;  2N1T B;  4EFE A;  1ZXG A;  1BCC J;  1BCC E;  1N7L A;  2QSI A;  2ZM6 O;  4JF7 A;  3TF5 A;  1UII A;  4QIW F;  4X1K A;  1BHB A;  3HKC B;  3L72 H;  4HJG H;  1OCC B;  5AVS B;  3CPW U;  3RYI B;  4BW5 A;  1LTS C;  5F2V O;  1ROP A;  1L0L J;  1GMJ A;  1L0L E;  2UXB B;  2V4D A;  5L8R J;  5B66 E;  1L0N G;  1NJI W;  1N34 B;  1HNX O;  3E8G A;  2GUZ B;  3T1H O;  1N7S A;  1JJ2 U;  1KKC A;  4M3L A;  2B88 A;  3WFV A;  3RBZ A;  3JC2 2;  2IBZ H;  3WU2 Z;  5AVU B;  1AI5 A;  5H5N A;  3A5T A;  1MZF A;  1WNS A;  2ZYG A;  3W7X A;  4CH4 A;  1THZ A;  2X0L A;  4EB6 A;  5EK0 A;  3U10 A;  3CMA P;  2JEX A;  1G8M A;  5CBH A;  1Q86 Q;  4UVA A;  1OW8 A;  1XBL A;  3AG3 C;  3KCY A;  3AK1 A;  4MTG A;  2NPS D;  2ZE5 A;  3JSL A;  1GK9 A;  3D3I A;  1NU1 G;  2VWK A;  3OA7 A;  2Q69 A;  1O9H A;  3H1K D;  2VRZ A;  2EZO A;  1S9K E;  1HR0 B;  4DV1 B;  5CB4 A;  1PIX A;  2AEJ A;  1VQK V;  4AHC A;  4OPA A;  2QWP B;  4LF5 O;  1NVP D;  4K8Z A;  1A02 F;  2IDB A;  2ZXW C;  1OW6 A;  4YHH B;  2ZDI A;  2D3O W;  3R2P A;  1JO5 A;  1SQP H;  2AW9 A;  1ZME C;  2LGW A;  2HPC B;  1VQ5 P;  5B5E H;  1GKF A;  1B6Q A;  2ZNJ A;  4A5U B;  5LMN O;  4JQ0 D;  3C3T A;  2GUS A;  3ABL B;  4AQY O;  1E1R G;  4GKG A;  4YIO A;  2PGG A;  1G4Y B;  2IZ0 A;  3D6Z A;  1A32 A;  4YJ3 B;  2QKS A;  2XND G;  3Q4H A;  4O4J A;  2P4V A;  3SJA C;  2WQY C;  2EIN C;  1M57 C;  3S4R A;  5HFM A;  1AJQ A;  1KFN A;  3VP8 A;  3FB8 C;  2Z5U A;  1Q6U A;  2V4H A;  2YO3 A;  1E79 G;  2LW1 A;  1QR8 A;  2OYH A;  1VQN V;  2F23 A;  4NKG B;  2ZR2 A;  3C1L A;  3RFR A;  2E75 D;  2DQ3 A;  2ZYA A;  2R3S A;  3FYI B;  4X62 O;  3K5N A;  1FAF A;  1JY2 P;  2OGU A;  1FXV A;  4UCR A;  1CPY A;  5E79 Z;  2EIL C;  3ZMV A;  3F7V C;  4B3R B;  1JOY A;  2PGD A;  4DK0 A;  3CCS V;  1FJK A;  4J42 A;  1KYO D;  2Q67 A;  1P49 A;  3HKD A;  1JB0 J;  3QO8 A;  2Q7C A;  1L2P A;  2V7Q G;  1RF1 A;  3BEH A;  3BA9 A;  5L3F A;  1SFC C;  1JX9 A;  3CE2 A;  5APU A;  2P90 A;  2QIW A;  3CPW O;  4NPF X;  4NTX A;  1KB9 I;  2NPS B;  5CBG A;  3B4S A;  4GLX A;  1JY2 O;  2C9N Y;  2CTP A;  5EBL C;  1R6N A;  1RPO A;  1L0L K;  2HLO A;  2K88 A;  3LUT B;  2Y0D A;  1M56 C;  2AXT Z;  2R9R B;  2BCC G;  1NVP B;  3I55 P;  3A0B Z;  2LFS A;  3CCE V;  3SYA A;  3L74 G;  4JYA B;  4BRY B;  1IFI A;  2QJK C;  2ZCE A;  5AVT B;  1EN4 A;  2GHY A;  4WFG A;  4X89 A;  3AG2 C;  5H9C A;  1AV1 A;  1P84 I;  4LF8 O;  1I7F A;  3STZ C;  3SR2 C;  2IYO A;  2J5U A;  1PL5 A;  5IY5 B;  3SYC A;  2QG4 A;  1E5W A;  4J10 A;  3WU2 H;  5KLV H;  5JCO C;  4LF4 O;  3L75 J;  3ABK C;  3NR7 A;  4BR6 A;  3L75 E;  2E75 B;  5IJ0 B;  1FZA A;  3ZHR A;  2CTW A;  2BSK B;  5IWA O;  1IUR A;  2P58 A;  3GWK C;  1YIJ P;  1XOU A;  1MG1 A;  2PFX A;  4PI2 A;  3QO5 A;  3V4Q A;  3FGA D;  2IM9 A;  3L72 D;  4IL6 Z;  3IGA C;  2QTO A;  4JV5 O;  2MJZ A;  3RW0 A;  4H44 D;  1BGY G;  2J58 A;  3VMX A;  1VL2 A;  3M0D C;  2IU0 A;  1NJI Q;  1PGP A;  4GX5 A;  3RVZ A;  2Y48 A;  1DK1 A;  1ZRT D;  3MZW B;  4HYT B;  1TA8 A;  4TOI A;  4I55 B;  1PGQ A;  3CX5 F;  3KPE A;  2P5O A;  1XI1 A;  2LKM A;  2WMM A;  3HD7 D;  2IBZ D;  1YJN P;  1VQ6 P;  3OMI B;  5J2U B;  2IX7 C;  1IBM B;  4PHZ A;  1NAY A;  3E35 A;  3GHG B;  4JI8 O;  5KAI H;  1LTI C;  3JAS B;  2Y9Z A;  3B8E B;  3SFE C;  2AGA A;  4B3S B;  2PP6 A;  4NPE A;  4U3F G;  4OX9 O;  4K35 A;  4WVZ A;  4DK1 A;  1OZH A;  4NTW A;  4RAI A;  4DR7 O;  4FIP C;  4CZZ A;  2FKW B;  2XV5 A;  4AI8 A;  4OGQ D;  3E22 A;  4MVR A;  5EYP A;  5ITZ A;  4DR1 B;  3SPH A;  1LWU C;  3KG2 A;  2OAR A;  2A06 G;  4UCS A;  1L0N H;  2YMK A;  3OUS A;  1FZC C;  2RQ6 A;  2PI4 A;  1GN6 A;  5E79 H;  3N7N A;  4WBA A;  3ZRV A;  2ILM A;  1Q7Y W;  1N8R Q;  1RE3 A;  3GB7 C;  1R5S A;  2HFE C;  1SQP D;  4RJT A;  4JI2 B;  1EZV E;  4CBC A;  1N33 O;  2ZFC A;  2ZE6 A;  4PDV A;  2GTA A;  4QNH B;  4H0L C;  1W2B U;  1Y76 A;  1X9V A;  2RDC A;  1L4A C;  1Y47 A;  1YQ4 C;  3BFR A;  1NO4 A;  1VQ4 V;  5LA6 B;  4I5S A;  4H44 B;  1AVM A;  4PJ0 Z;  1LTJ B;  3RYF A;  1IBK O;  4JI3 O;  3ZHV A;  1PV0 A;  1AR5 A;  2LQT A;  2WLI A;  4EDF A;  3X2Q C;  1XEQ A;  3AK3 A;  5JJJ B;  1VQ9 P;  2YS8 A;  3HD7 B;  5IT9 N;  2H89 C;  5ITZ B;  3L73 G;  1IBL O;  2ZIM A;  1MKM A;  1S5L H;  4X1Y B;  3H1L J;  3WUV A;  3OR7 C;  1FXK C;  3H1L E;  4ASW A;  1WA8 B;  3HE4 A;  1JPX A;  3FB7 C;  2QA4 V;  2L6L A;  3L70 H;  1EM1 A;  1PD3 A;  4DV4 O;  1LTA C;  3J81 N;  3LW5 J;  4PD4 I;  2OYI A;  2N1T C;  2FXM A;  2BTQ B;  3L4F A;  3JCU E;  2KP8 A;  1XQ8 A;  2LFR A;  1I5X A;  2EIK B;  3CCV V;  4B3T O;  3T97 B;  1E79 H;  4FLV A;  3ZDM A;  1OCC C;  1GL2 D;  2YEV A;  3BCC H;  1SVF A;  2IJH A;  3ZRS A;  2PY5 A;  4LCU C;  1KB9 F;  5EC1 C;  4L74 A;  3CX5 E;  3MGN A;  1HJB A;  3EXA A;  4UCV A;  2FXP A;  1HNW B;  1UJW B;  2L5G B;  4HBN A;  2KS1 A;  3H1H D;  4MVM A;  4G2K A;  1T3J A;  2ZYD A;  5LP6 B;  5KMG B;  3CXH I;  4HNA B;  2E5L O;  2FL4 A;  3HUS A;  3HE4 B;  4H37 A;  2KKW A;  1RQU A;  2GUV A;  1OIP A;  4PA4 A;  5KLV D;  1R3L C;  2ZM6 B;  3H1K G;  3PN1 A;  2ZQM A;  2YXQ B;  1P84 F;  2QRX A;  2M3E A;  2QEX P;  1VEW A;  1RHZ B;  3RYC A;  2ZIN A;  1GU4 A;  4O4L B;  1VQ7 V;  1Y9B A;  1S3J A;  2BCC H;  3SJQ C;  2K9Y A;  5M1B A;  2WPR A;  2YI8 A;  1SES A;  4J11 A;  1GZL A;  3H01 A;  2WT7 A;  1HNX B;  3HTK B;  2WPV B;  1F51 A;  3T1H B;  1NH2 D;  1H2K A;  4GIF A;  4DOJ A;  3CB2 A;  1N34 O;  1Z56 A;  2P10 A;  4RES B;  1RFY A;  4N6J A;  1FZB A;  1U96 A;  1JMM A;  2KG7 B;  3K04 A;  1RE4 C;  4MVO A;  1MA1 A;  3CCQ V;  1SQX J;  3QWO C;  1L1F A;  1M1J B;  1N7S C;  1SQX E;  4WB4 A;  2HYN A;  2JGD B;  4JTC B;  2MK3 A;  2AEF A;  2AXC A;  4FJC C;  4D6T D;  3N2K A;  5BXZ A;  1XNR O;  1M1K W;  4OXS A;  1NU1 J;  2KXP B;  1NU1 E;  1GL2 B;  3A7O A;  3A0B E;  4MN4 C;  3E83 A;  2E5Y A;  3UQ8 A;  1FD9 A;  2QJ1 A;  1NH4 A;  2O01 H;  3P8M C;  1R73 A;  4KP4 A;  4DV1 O;  4CC6 A;  2Q4P A;  3HRN A;  3VTP C;  3V2P A;  3QTC A;  1P4R A;  2CH7 A;  1HNZ O;  1OMI A;  1BZK A;  4ZMD A;  3MD0 A;  1V54 B;  1PP9 J;  3SDL A;  3AE1 C;  5AVV B;  1S72 P;  1BGY H;  1PP9 E;  3H1I J;  4EEQ A;  1OCR B;  3H1I E;  2XAS A;  1L0N D;  3EQ2 A;  3Q5S A;  5JJE B;  3ZMU A;  4JAU A;  5LMN B;  4LFB O;  3B8N A;  1MZ9 A;  3MHH C;  2WLN A;  4AQY B;  5IYB O;  4XA4 A;  3Q1M A;  3LSS A;  3W7T A;  3WB0 A;  1PGO A;  2UUC B;  2NPS C;  2E43 A;  3CRC A;  3AG4 B;  4RO0 A;  5IYZ B;  4PA9 A;  4FLW A;  5KHI A;  1PGJ A;  2Y9Y A;  2W6J G;  5JQG A;  5LYJ A;  2K37 A;  5GON B;  4DV6 O;  2WSF J;  3CI9 A;  1NH2 B;  1PPJ H;  4X64 O;  3CXC U;  5TJH A;  3RYH A;  2RKL A;  1M56 D;  1SZT A;  4U3F H;  4X62 B;  1QL1 A;  1AVY A;  1VQL V;  1F7Y A;  2IU3 A;  3AE2 C;  1XMQ O;  2FKX A;  2V7Q J;  2G3A A;  4NYK A;  2ZXW B;  2R5B A;  3Q5R A;  2IH3 C;  4YPC A;  1LR1 A;  5LMU O;  1Q2N A;  4DW1 A;  5KJ7 A;  2PZS A;  1U57 A;  1BE3 H;  1PL0 A;  3K0D A;  1BMF G;  3H32 A;  3RK2 B;  2V1D A;  4O4H A;  2KB7 P;  2KNC A;  4I2L C;  5IDJ A;  3OTO O;  1NR7 A;  2Y69 B;  1NAF A;  2VQE O;  2YIA A;  1KD1 W;  1USE A;  5KAF Z;  4X65 O;  3CCJ V;  5IY5 C;  1DD4 A;  4K8X A;  1RF1 C;  1ZW0 A;  3VQW A;  3ZRX A;  4MS2 A;  1QGK B;  3J7A U;  4UB8 E;  3L70 D;  2M8R A;  3K9S A;  3VBB A;  1XTC C;  3L72 G;  2E75 C;  1SQQ H;  1EN5 A;  2WIT A;  1IZN B;  3K57 A;  1URQ A;  1J5E O;  4CPG A;  2GM4 A;  1HF9 A;  4DZO A;  5LYJ B;  4UB6 Z;  2AZ0 A;  4PDL A;  1KIL E;  2WPS A;  1VQO P;  4CH3 A;  1RSO B;  1SQX K;  3BCC D;  2AEM A;  4PD4 H;  2WLM A;  2YIB D;  2ZXE B;  1VQM V;  5TIS Z;  3M9Q A;  4ZOL B;  2IBZ G;  3CS5 A;  3ABM B;  2HOD A;  3VQX A;  5B1B B;  4LF8 B;  4WF9 V;  5E1A C;  1NU1 K;  2RN0 A;  5GTI Z;  5DJU B;  1R3I C;  1LT9 A;  2M5A A;  4O4H B;  3LIE A;  2LXB A;  4LF4 B;  3T2M A;  4K0K B;  4JAV A;  4F6R B;  1KQS O;  2IBZ I;  3JAR A;  4LNU A;  1JY2 N;  1YHQ V;  2Q6Q A;  5AVZ B;  3JAK A;  3BVO A;  1SLQ A;  3RK3 E;  2QSA A;  1N2D C;  4JV5 B;  2WSE J;  4I6M C;  3CXH H;  4U7J A;  1KV4 A;  3P7K A;  1MAB G;  4EYY Q;  4NTY A;  2H8P C;  3HKB A;  1SQP G;  3FYE B;  3TDK A;  2UXC B;  4EIJ A;  4ASV A;  2FTK A;  1R6T A;  3CME V;  2POH A;  4LF6 O; 
#chains in the Genus database with same CATH homology
 4PV1 B;  3Q5S A;  2BEQ D;  1MKM A;  2E76 C;  1R8E A;  1EXJ A;  1EXI A;  1UIX A;  2D2C C;  1KMI Z;  2J5U A;  3Q1M A;  1PL5 A;  3AEA C;  3AE4 C;  3B71 A;  1NYH A;  3AEG C;  1YQ3 C;  3LW5 J;  1KQF B;  1DIP A;  1ZRT E;  2E76 D;  1ZP0 C;  3ABV C;  3G9R A;  4R4M A;  2D2C D;  2E75 B;  4H0L D;  1NGM B;  1PV3 A;  2JP3 A;  2WSF J;  1VF5 D;  1KTM A;  1OW8 A;  4H44 C;  1ZOY C;  4YXD C;  3AEC C;  3T97 B;  2FYN C;  2E74 C;  3FGA D;  3AE2 C;  2WSC J;  4OGQ C;  2NZ2 A;  2V7Q J;  3GMA A;  2G3A A;  3D70 A;  1PIX A;  3Q5R A;  4H13 B;  2FXP A;  3AEF C;  2FBW C;  3Q3D A;  4TT3 H;  4H44 D;  3S9O A;  1DD3 A;  3D71 A;  1VL2 A;  1U57 A;  2E74 D;  3R4Y A;  1KOR A;  2IDB A;  1OW6 A;  1HJ0 A;  2YIU C;  4H13 C;  4PV1 C;  2QJP C;  3D6Y A;  1K05 A;  4XFJ A;  1ZME C;  2BEZ F;  1DD4 A;  1IK7 A;  2ZT9 B;  3AE5 C;  3Q5P A;  4PV1 D;  1RQU A;  4H0L B;  3SFE C;  2JO1 A;  3SFD C;  3H25 A;  3D6Z A;  1AJY A;  2E75 C;  3GF3 A;  1S1C X;  1WMK A;  2WQY C;  1HF9 A;  3RL0 g;  5M1B A;  1Y9B A;  2K9Y A;  1KQG B;  1KIL E;  4KT0 J;  3Q2Y A;  4YTP C;  1FDO A;  2E75 D;  3GLM A;  2G8Y A;  3AEB C;  4OGQ D;  2WPV B;  2P10 A;  3IAO A;  4I7Z B;  2YMK A;  2OQQ A;  5KKZ C;  3GF7 A;  1OW7 A;  2H88 C;  5KLI C;  1JB0 J;  3AE8 C;  2E76 B;  4GDO A;  4H13 D;  2D2C B;  3AE9 C;  3EWK A;  2QIW A;  2ZT9 C;  3AE3 C;  1VF5 B;  1Q90 D;  1K04 A;  3AEE C;  3AED C;  4H0L C;  4Z1M H;  3AE7 C;  3O6Q A;  1RQV A;  1VF5 C;  2QSI A;  1YQ4 C;  2ZT9 D;  3RK3 E;  4R4L A;  3IN6 A;  4H44 B;  2WSE J;  4U7J A;  2E74 B;  2MKV A;  1TU3 F;  4OGQ B;  3C8V A;  1GMJ A;  4RKU J;  1S5L X;  2QJK C;  1OMI A;  4IL6 X;  5L8R J;  3AE1 C;  4Y28 J;  2H89 C;  4I7Z C;  1FDI A;  2QJY C;  2O01 J;  3AE6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...