4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
2O01J 2QJPC 3LW5J 1VF5B 5KKZC 2WPVB 4IL6X 2WSFJ 2E76B 2QSIA 4I7ZB 2E74B 2QIWA 4H0LB 4Y28J 1JB0J 1Q90D 4H44B 4H13B 2D2CB 2E75B 1ZRTE 4KT0J 2ZT9B 2QJYC 4PV1B 2YIUC 3C8VA 4OGQB 2K9YA 2WSEJ 5L8RJ 4RKUJ 2WSCJ 2QJKC 2FYNC 1S5LX 5KLIC
chains in the Genus database with same CATH superfamily
4XDKA 3WB1A 5AVVB 3K04A 2KP8A 1BSNA 2CPSA 1LTGC 1J1DB 2PI4A 4TLFA 2WLIB 4LFAB 2E42A 2P22C 4JYAB 5EIBD 3T1YB 5AW1B 2HKOA 3BRVB 1Z5VA 3R2PA 2XZRA 4C7NA 1EDJA 1A02J 2Q9IA 3MHSC 1BGYH 3SFDC 4DR4B 2MKVA 1XOUA 1U96A 1KILE 1VF5D 3E1IA 1FJGO 5IYDO 3CPWO 5K5GB 4DR3B 1FXVA 4LF9O 1T6AA 2EZOA 3JCZA 1KFMA 3A0HZ 1IFMA 1S5LX 3RBZA 5KLIC 5DECA 5IE9A 4DR1B 4HYTB 3QO5A 1GL2D 2OGUA 2L6LA 2ZE8A 5FNVB 1S2EA 2K88A 3SJQC 1SQXJ 1F51A 1FFXB 3HKCB 4UVBA 2DE0X 3K06A 4NPDA 4H13B 3M9QA 5APQA 2Q69A 3RK3B 1I5XA 1N36B 1SF9A 1KN7A 3KXDA 1EZJA 1AP6A 3SYPA 1YJWP 3DTUB 1R8EA 1NTMH 1Q6UA 2D3OW 1URQA 2AW9A 5LP6A 3M9BA 3VMYA 1Q82W 3TGUJ 4J11A 2K1EA 4YIPA 4AHCA 2YIDA 1VQ4P 4KFMA 4ZOLA 2CE4A 4TV9B 2J59M 4ZI7B 2R3CA 4MS2A 4TV8A 1XEQA 2CGNA 3CE2A 4G2KA 4X65O 2FY8A 1M1KQ 4QE7A 5LHIA 1YIJP 4U3FH 1N7SB 1PP9E 2NZ2A 2P2UA 4JI7B 5IYZA 2KK7A 1WAZA 1IXBA 3OMIB 3BCCD 2JEEA 3A0RA 3L73H 2WMMA 2LQTA 2LFSA 5IDJA 1XNRB 5KHGA 2DN9A 1GK4A 4JI0O 5CB4B 1Z2GA 1FU1A 1PGPA 5JJEB 5L3BA 1GL2C 1IK9A 3ABUA 3AECC 1P84E 2M3EA 2BOCC 3D6ZA 3VMZA 2IJIA 5KMGA 4P30A 1OIPA 2JJ2G 2O1JA 3VOUA 1F7YA 3GHGA 5KJ7D 2R70A 4G27B 1S5LE 2E76C 4LNUA 1OVUA 3CCMV 4NXNO 1HNWB 1ZRTD 1GM7A 2GHYA 2H43A 1BL8A 3L70H 1M9NA 4IIJA 2XNDG 1TUEB 1R3KC 2QWNB 1EXIA 3AEDC 4IL6Z 1OMIA 3L73G 3G71P 3ZEDA 3K79A 5L3DA 4OX9O 2OYIA 3JARA 1NBMG 5KUMA 3C9IA 4ZKPA 3CCLP 1KILA 3D70A 4UFZA 1V9PA 4PA9A 3WG7C 4TV8B 2PGDA 1L4AD 3RK2B 3O9OA 5AVUB 5CBHA 3K57A 3OT7A 4HJGH 4NTWA 3V2PA 3OEHG 2B9BA 4NYKA 3IF4A 3WUUA 1JCHA 2YIBD 1NVOA 4PDLA 5E79Z 2CTWA 3CCEV 3SWKA 4JAUA 4IYHA 1YJWV 2QR4A 3RYIA 5CBOA 2IFNA 4J80A 4NKGB 1H38A 4U7JA 3T1CA 3TDKA 5CCGA 2EILC 3AE7C 2V7QH 1KP2A 5EBLC 1KILD 1HWTC 3B5NB 2N04A 1SETA 2PYLA 2Q1KA 4LBEC 2DWDC 3L73D 3ETEA 2QDOA 1M1JB 4TV9A 1QLED 4UCRA 1KQSO 2N1TB 4R4LA 1THZA 1WA8B 1LTJB 5AVRB 3C3TA 1GW3A 5LHGA 1KQLA 3RK3D 2GUVA 1GU5A 1IBLB 3CCQV 3BCCE 1G8MA 1R6KA 1SQVH 1FFXA 3B09A 3CS5A 3HKCA 5KAFE 4PI0A 2FYUD 4JV5O 3AE2C 2NNUA 3M0DC 2B5UA 1FXKC 5H5NA 4NXMB 2WLNA 1AQTA 2NLJC 2YXHA 1BE3D 2WSCJ 3L70D 3LIEA 1GKFA 3N2GB 1EXJA 4A7PA 2BCCE 1VF5B 3L75H 1YTZT 2O1KA 1JFFB 1NOHA 1M90W 1MUUA 4DR6B 3VBBA 2Q0AA 2BSKA 3APOA 1SQQD 2E75C 1RF1C 4P9PA 2J5UA 1A32A 1PZQA 4B3TB 3B2EE 4FIPC 2ADQB 3G3ZA 1JY2N 1NKDA 4OPAA 1ZR2A 1DF5A 2ITCC 1UIXA 1F23A 1VP7A 2HFED 4ASUG 2PAJA 1FD9A 3N7NA 1GRJA 1LGHB 4D6TD 2OTKE 1K7DA 4IL6X 3BATA 4ZHQB 3IN6A 2ILMA 2WLMA 1WPBA 2ZR3A 2E75D 2B87A 5KMGB 1NHLA 5JH7A 2YO2A 4LF8O 3GVMA 5GONA 4LF7O 3WB2A 2L5GB 3VQXA 3RGUA 5L3EA 5DJUB 1M4UA 1IFNA 1JJ2U 1XNRO 1AVMA 4IL6H 3CC2V 1R3LC 2IZ1A 4WBAA 4PA4A 1OWAA 3GHGC 1W2EA 4FFKA 1RQUA 1LNQA 1BE3G 1D7MA 1KUQA 2FXMA 2YXRB 1SQBJ 1FZGA 1M1JA 3L9DA 3F89A 2IH1C 2ETNA 1YITV 2W0XA 3S9OA 4MVMA 2IZ0A 3CCUP 3LDDA 1XMOB 3ZIAG 2P58A 3RL0B 3TNUB 2UUAO 1QL1A 5E79H 4GKKB 4UCVA 2HVKC 4DRXB 2V7QJ 3BA8A 5LL6Y 2QA4P 1NU1D 2Q9LA 2Y4UA 1VDFA 3K5NA 1M5IA 4X1IB 3ZHTA 1CP9A 1O9GA 1BGYG 3U0ZA 3UCSC 1BE3E 1IVSA 2YMKA 1IJDB 3OR6C 1NU1K 1I0HA 1P7BA 3L74G 4HNAA 2FYZA 2PP6A 1OHHG 2D2CD 3CRMA 4X64O 4UB6Z 3L73E 4UCUA 1H2MA 4FZ1A 4DUZB 1KV4A 1SQBG 2YO3A 2E76B 3HE4A 4KHXA 1JFFA 1T2KD 2B89A 1OCRC 1HR0O 2M0BA 4CS2A 2O3JA 3ZRXA 1PNKA 2EIKB 2WSSG 2K9PA 1XL6A 3AEFC 2N1TD 1QVGO 1SQVG 1QBZA 5CJ0A 3HUSA 1OJHA 2Y69C 2UUCB 3CCQP 1L4AC 5BR8B 4ZI7A 3P3NA 1S9KE 5GTHE 5B3SC 3H1JJ 1LUVA 3BPZA 1SQBD 4U3JB 4X20B 3II6A 1R6TA 3K5LA 2IM9A 3ZHQA 3P8MC 1JY2O 4X1YB 4JI2B 1M90Q 2FBWC 2OIEA 3CC7V 1FS0G 3TF5A 5KLVG 2GM4A 1JJOA 3OMNB 1WLEA 3I56P 3BA9A 4X89A 5E1AC 5A9GA 4DR7O 1M57B 3NXSA 3ABLB 1KKDA 2A06H 1J5EB 1AILA 2ZJSE 4RQEA 1RF0A 2CGOA 1URQD 3H32B 3JCUZ 3TJTA 4FK5C 1J95A 5AVTB 1GDTA 1LP1A 2N74A 1V54C 3AE6C 2ZQMA 2HHHO 4UB8E 2UXDB 4DV0B 2FYUK 3FAVB 4H0LC 3G6EP 2J58A 2P6JA 1NTZJ 3ZHUA 3JARB 2Q73A 4B3RB 4JPRA 2KXPB 4LF5O 3ABVC 1YTFB 2W6AA 4GOEA 4JTDB 2YKQA 2EX3A 2AXTH 4XFJA 2FB5A 1S72V 1X8YA 5LYJA 3FX7A 2I1KA 2O01H 3L72G 5KTBA 2KNCB 4P2ZA 2IX7C 3Q3DA 1YHQV 4UB8H 1WPXA 2ZIOA 1H0TA 3STLC 3CXCU 3CWBE 5BU5A 3VYIA 2XOKG 4FM0A 1KU9A 4KT0J 3L71G 4HKZH 2G8YA 1QHTA 2ZM6O 1YQ3C 1JVMA 1N33B 5JJNB 1XILA 1IFPA 3ZCCA 3KQGA 2Y9ZA 1CSBA 2R5BA 3B5NC 1V55C 3FB5C 4WBNA 4DR4O 1BDDA 2OTLV 1OZHA 1YEWA 3WMM0 3U1AA 3X2QC 3L75E 1K4CC 4I50B 2KB1A 2O57A 5J2TA 3CCEP 4XBFA 1NTMG 3ZMSA 1PPJH 2RKLA 1L0LK 1U97A 4XDJA 2VS0A 4JF7A 2A7WA 3MUDA 1XTGB 3V6IA 2CTPA 3OFNG 1NU1G 2VQFO 2BEZF 3VMAA 2HODB 1KC8Q 4OPHA 4CH5A 1KORA 2DOSA 3TGUG 3CCJP 5APSA 2LGQA 5CCHC 1MFTA 3VP9A 3BVHA 4JI3O 3K0DA 4FLZA 3SYCA 1LTJC 2QSIA 4C46A 3Q5SA 3W7XA 2AHYA 2QIWA 3HB3B 1FPOA 1TVKB 4J9ZB 1VQLV 1P84F 1VF5C 2ZE5A 3LSUA 3SJAC 1VQ5V 4Z1MH 5AVZB 3E1RA 1AROP 3W7UA 5LGUA 1AA0A 2EIJB 4HZ3A 3ZX6A 1SQQJ 2G3AA 1VQNV 1S72P 2UU9B 1FBMA 4RKUJ 1Q82Q 3BHPA 3MIWA 1SQXK 2KZIA 4EOTA 1DH3A 1YJNV 1PL4A 3ZBHA 1OX3A 1Y76B 4U7NA 1I5YA 4X9QA 5IJ9B 2Y0IA 3JCUH 3MP7B 1Z56A 4B7EA 2YXQB 2E3CA 2RN9A 4J7KA 1K04A 3L37A 2H7HA 3K9AA 2XAGA 1VMGA 2N05A 3P32A 2E75B 3MDSA 2F4VO 5IT9N 2ZT9D 3SSUA 1RF1B 1DEEG 4KHPB 5JWPA 1Q81Q 3HKEA 4NB5A 5IYBO 1Q7YQ 3OA7A 2F43G 3HD7A 1RM1B 4O2BA 2WLHA 4UXNA 2HHHB 1N34O 2V4DA 1FXHA 2QWPB 1J1DC 2PZSA 4H44D 4BRYB 2QM4A 2YUAA 2VQEO 1NKZB 5CA1B 1E79H 3FWNA 3N2KB 1NTKJ 4DOJA 5KAIE 3CC4P 1NTKK 1BCCG 1SC5B 3ASOB 3PN1A 1GMJA 3BRTB 2ZVOB 1DTOA 4YXWH 1CPYA 1RE4C 4J10A 3ZRSA 1HNZO 2W27A 2Q3IA 4JI8B 3VN0A 4GYCB 3I5CA 1K5QA 2FYUG 1ZL8A 4LH6A 5APYA 1XQ8A 4MVOA 4C7UA 2HLOA 5CB4A 2BCCG 4U3FE 4AUWA 3H1IH 2QJKC 4JGSA 1HR0B 2QSAA 3SYQA 4JASA 3RN4A 3CB2A 1WT6A 1WB8A 3TETA 3T4DA 4I0XA 2WZ7A 5HFMA 1AJPA 2R72A 1R3JC 2QJYB 3SJBC 2Y0EA 2IU0A 2ITAA 2QGNA 1U7MA 1Y9BA 3L72E 2KSDA 1J1EC 4Q6GA 1VQMV 1OCRB 1RH5B 1Y67A 5J2TB 5IWAB 4H44C 2ZINA 1KB9I 2KOGA 1AFOA 5B5EH 3H1IE 3V2NA 4ZHQA 3E22B 4GODA 2QM7A 2W0FC 2KIKA 2GUZB 1BDCA 1JX9A 1ZW0A 3ZN1A 1YBKA 4O4JA 5LOVA 3I5DA 3CPWU 3CXHF 2ZIMA 1QQCA 4B3MB 1RPOA 2IBZE 1KTMA 1HNXB 4X1YA 4WCEV 1K8AQ 3H1LE 4D7SA 4X66B 3SR2C 1SQQH 4R6ZA 2AZ2A 5E79E 3T97B 2Q0OC 3HUSC 5APVA 1QVFO 1NQTA 2OYIC 2YMYA 2BTOA 2Y9YA 2HG5C 5EBWC 4Y99C 2AXCA 3RK2D 3CCLV 1XBLA 1BGYE 1WRGA 3A7OA 1L0NJ 3B4SA 3ETQA 3G6BA 2AXTE 5AW0B 3L74E 5EIBC 3O6QA 2JEXA 1H0TB 2Q68A 4DCKA 3H1ID 4D6TH 5L3CA 4WVZA 3X2QB 4LF5B 1FZEA 1DF4A 4EFEA 1YJ9V 2RN0A 4JAAA 2WPDG 2IYPA 1RSOA 4W4KA 3HTKB 2ZDIC 2L35A 3BASA 3I56V 3C1LA 5AW6B 1K34A 5CA3A 2QWOB 1SQQG 2JO1A 4QNHB 3WG7B 3RYCA 3CI9A 1VQ8P 4RAIA 4GX1A 2QTOA 1HUCA 1LTAC 2IPPA 3A0BH 4B08A 4W4LA 1VARA 4RESB 2AGAA 2FFDB 3IC7A 1L0NG 3SYAA 1QLNA 4UCOA 3ZMZA 5C93A 1NTME 3N27A 4UUJC 1KYOH 1N2DC 1NI8A 5H2FH 4O2BB 3GLMA 4BIUA 1FZCC 4EEQA 5APWA 4LR3A 5KKZB 3RYCB 3SPCA 2EILB 1YI2V 1ZV8A 1PV3A 3SWYA 4K0KO 1I08A 1K73Q 5JQGA 3JAMN 1BCCD 3J7AU 2C0WA 3QH9A 4N6JA 2P7TC 4DV7B 5CA0B 4JYAO 4ZNCA 3M0DA 4R50A 1H88A 3UO3A 4PA7A 2GV9A 3QTCA 3E86A 2E5TA 3CCRP 4ZOLB 4X66O 1L0LJ 4RJTA 2IJJA 1PD3A 3OW2U 1T2KC 5AVSB 5BMVB 5CCGD 5CBNA 4YTPC 4RUEA 4PJ0Z 2M6YA 1Y6XA 2JIZG 1IBMB 3ZS8C 4X1IA 2GTAA 3UM7A 2KLUA 1ZOYC 4BW5A 5CMZA 4BRYA 4KJMA 1I94B 3L70J 4W80A 3FGAD 3OAAG 1GL2B 3ZMUA 4ASVA 1OCCB 4GKGA 2DQ0A 2YS8A 1VQ9P 2YC0A 1NTZD 3L74D 3CC2P 4JI1O 3SPJA 2KQXA 3QNEA 1SLQA 2KB7P 1UPGA 1YJNP 1E79G 3CP1A 2XAHA 2H8PD 1S77D 2ZT9C 4EDFA 1JTHA 2HVJC 2UUCO 3KKYA 2WT7A 2ZNJA 1AR4A 1KFNA 3ITKA 5KAIH 4DV2B 2IFMA 1MV8A 2MJZA 3S3WA 2M8RA 3CXHD 1ENVA 4ZIBA 2UUAB 2OARA 4D6TJ 2Q67A 1HNWO 2KSJA 1JCDA 3WU2H 2RNBA 4FLXA 2ZE6A 4U7OA 2POHA 4UVAA 5KHJA 1KB9F 2A06D 2I8DA 1D2DA 3RL0g 4BW9A 2IDBA 2LXCB 1GMGA 1JMMA 3LIDA 3CRCA 1HWYA 2FL4A 5LGTA 3TGUE 1OCOB 1MMMA 2WSCH 1M56D 2VQEB 4O2AA 1YXBA 1RQVA 1MSDA 3W67A 4GX2A 4JTCB 2KKWA 3H1HJ 2IBZG 2ZKOA 2BTQA 4UCTA 1RE3A 1KB9E 1SQVE 4JI1B 1S9KD 3SGIA 1KMIZ 2RJZA 4LF4O 2R9IA 1NU1E 2ZDIA 2Q5UA 3PRJA 3JATB 1VQ4V 4PELA 2P67A 4U3FD 1IO4A 3H1IG 5LMUB 2WTYA 3CC4V 2HEPA 3JSNA 2KI7B 2ZXWB 2P7JA 4DV1O 2JKVA 5AVWB 3RK3E 2UXNA 3AE1C 4G28B 3ZHRA 4BAYA 1H2NA 5EC2C 2I1JA 1URQC 5B5EE 1QVGU 2UU9O 3V2RA 4WF9V 1D5NA 4PV1C 5CBFA 4JQ0D 3WB0A 2UUBB 3TK1A 3H1KJ 4OGQD 5JH7B 1US6A 2X0LA 1PGJA 2JR8A 2QJKB 3H01A 4I5SA 5CA0A 5BZBA 4FLUA 1K33A 2B9ZA 3TYYA 1BQZA 1RE4A 2DYRB 3UIAA 4P9OA 1NH2B 2XV5A 2CK3H 3VMXA 3D3QA 5LA6A 4I4TA 2QJYC 1JPXA 3FB8C 2EZPA 3CEIA 4U3JA 3SPGA 1PPJD 1L8DA 2KS1B 3RWRD 1SQVJ 1E5WA 1YCIA 2IU3A 3ZMTA 1MZEA 1NJIW 4WY4A 2YDEA 5B66E 4KUMA 3AEEC 1FZCB 5DN6G 5H9CA 4D7TA 4JI6B 4I0XB 2OTJV 2F95B 5HFLA 3RVZA 3UT5B 5C8YB 1JY2P 3OTOO 2ZYDA 3ABLC 1W0JG 3CD6V 2L91A 1VQ8V 3L73J 3TXQA 3C3SA 1SQQK 2N9BA 3AEIA 3ZN0A 4OGQC 2FYUE 5IJ9A 1BGYJ 3M9HA 5CCHD 2Q7HA 4DV2O 4PA3A 1NH2D 4LF6O 1AR5A 3IFXA 1V54B 4PD4I 1GO3F 2LP7A 3FYEB 4CBCA 1AVYA 3QF7A 4Y99B 1X4TA 5KJ7C 2E76D 1VEWA 2M7WA 5KAFH 4OH8B 1NT2B 4H0LB 4JI7O 4N78E 3H9VA 5EFWB 2W6BA 1P84D 3N2GA 2LO1A 3B77A 4WWIA 1EN5A 1KYOI 1NS1A 4DR2B 1SP4A 2B87B 1GM8A 2FYUH 3K5MA 4MW3A 4PD4D 4ICGA 3A0BZ 2RDCA 1PPJG 3HUSB 1ZX3A 1JMBA 2OYIB 2Z5UA 2PUSA 3AG1C 3JAWB 2OTJP 2NPSA 4ZKUA 2WVRA 4YXWG 4WY4B 3A5TA 4UB6E 3RYHA 4DV6O 1BCCH 1NTMK 2F93B 1N32O 3CX5D 1XREA 2GDSA 4PD4F 5LP6B 2XKMA 2Y48A 3E7KA 1SQPJ 2Y0PA 4I55A 4LLHA 1S5JA 1Y4MA 5K1PA 1Q86W 3G67A 3L71J 3HKDA 3OUFA 5AW2B 2Z4EA 2LXBA 2O01N 4TQDA 1RSOB 1FZBA 4NPEA 5GTHZ 2Y69B 1K73W 2JGDA 3KCYA 2OYQA 1DK1A 3V2QA 1GH6A 5LMUO 1N73C 3H32A 1RP3B 2JS3A 1M56B 3J81N 1ZXGA 4GIFA 2IYOA 4FMTA 1HGVA 2FFDC 1LT9B 1CW5A 3ZRWB 3OTOB 1Y74A 3CCJV 3GG2A 1T3JA 3DXRA 2WPVB 3L35A 2YKOA 1HDJA 3L72J 4PJ0H 1HH0A 4JI8O 4YJ3B 3J80N 1NTZH 3L74H 5DJTB 2P06A 4HBNA 4GT1A 4I1LA 1YF2A 1GZLA 5JCOC 4JYCA 4QPKA 4LFCB 3CX5I 5ITZA 4MW8A 4DV5O 3JATA 1HW7A 1K3EA 2OT5A 2W6IG 2WLLB 4F6RB 4AILC 1NVPB 4GX5A 3TXSA 1IZNB 2EINC 3AG2B 2B1GA 1PP9J 5BVZA 3I55P 1LTIC 3H1KG 5IYZB 4GOFA 2CH7B 2ZFCA 1IX9A 2V4HA 1VQMP 3GW6A 3A0BE 4CH3A 3GWOA 3E83A 2LFRA 2E74B 1XMOO 1COWG 1S5LZ 2GSMB 1H89A 3BVOA 1JMKC 5KLVK 1NU1H 5KJ7A 2ZT9B 2X7RB 1GN6A 5KAIZ 3T4ZA 3A3YB 4AQYB 2Z3YA 1URQB 5F2VO 1TAEA 4DK0A 2QEXP 1VQ6V 4WFGA 3R65A 5B1BC 3RYFB 1T3UA 3ZRWA 1GD2E 1H8AA 3PJSK 2OYOA 1VQNP 3P8CE 2QJPC 1K9MW 3EXAA 2JVDA 4YJ2B 2JDIH 1SZTA 4YJ3A 4B3MO 5APXA 1N34B 3H1JG 3ABMB 1K05A 3MGNA 2E5LO 3ETGA 2KNCA 1VQLP 1GN2A 4DR7B 4QPJA 1GK9A 1ZSPA 5AG2A 4UB8Z 1H2GA 2Q6QA 3HKDB 2A0LA 1CI6B 1SFCB 3H1HE 1S0VA 2HODA 1Y8AA 3H1JE 3BCCG 1AI4A 1VPCA 3A2AA 4O4IA 2NPSD 3CCSV 5BMVA 2OCCB 1RPRA 3KYQA 1XHZA 3KCXA 2E74D 1UFIA 3D36C 3FAVA 4LH7A 1OV9A 4JTAB 1VQPV 5TISH 2VWJA 2EIMB 4LFCO 2WAMA 5B1AB 1SQBH 3CJHB 1QVFU 4NVPA 1DGSA 4NR1A 4CC6A 4JPZB 1GM9A 3EHBB 2PFXA 2ZD9A 4H13C 1OCOC 2LW7A 3H1HH 2Q7GA 4DV4B 1L0NK 5KA5A 2DWEC 2EBOA 2LR2A 2N9YB 3OGIB 5IJ0B 1Q6HA 3P30A 2XUMA 4OGQB 2EIJC 1NVPD 2ADPA 2A45H 1G4YB 1PFIA 1VIBA 3JD1A 2KUBA 3IAYA 3P7KA 1R5LA 3FB6C 2XAJA 2C9LY 3WUVA 3OAKA 2GA1A 5KX5A 5IJ0A 1N73A 4DR6O 5JJJB 3JALB 5LA6B 1EC5A 1LR1A 1XNQB 1W5CE 3HTKA 1FC2C 5AW5B 2C9NY 1G1JA 3IFMA 4IFDK 5KHIA 2ZYGA 5A2QN 2QE7G 1DLBA 3QO7A 2IJHA 3AG1B 1IBKB 1LWUA 3OJAB 1R1BA 3JAKB 2QKCA 2QA4V 2QTSA 3FD9A 5BY1A 4I2LC 1JR9A 3U59A 4TT3H 4DV3O 1FDIA 4DXWA 1LP1B 1I94O 3F5WC 1UIIA 4FLWA 2FKXA 1V55B 1IBMO 1FXKA 1K4DC 2PTMA 2D2CC 1KECA 1EZVI 2WITA 3JAWA 3CRRA 4K35A 2XNDH 1Q7YW 3KPEA 1YI2P 3CXHE 4O4IB 3SPHA 3VTPC 1HNXO 2WWWA 3CXHH 2UXCB 1AJNA 4OXSA 2IW5A 4UVCA 1J5EO 2R44A 1JUNA 2R9AA 3T1HO 3L75G 2UXBB 3L72H 1FAVA 3JASB 2DYSB 5KX5B 2LJ2A 3LNMB 3K08A 2XASA 1FZCA 1R6NA 1G1IA 2F23A 2ZYAA 3OD4A 4MTGA 3H1IJ 3RT3C 3NMDA 5IY5C 3AE8C 5J9PC 2ARHA 2YKPA 3G4SP 5L3GA 4FLTA 1SQXD 2RCVA 3TCUA 1EN4A 3NR7A 1XMQO 1XMQB 4I9QA 4KP4A 2A06E 2W90A 3E8BA 4U3FG 4HH2A 4JBZA 3RYHB 2LKMA 1SQBK 1B06A 4DW0A 4GKJB 1DD4A 1N0NA 4YHHB 4HAMA 2E74C 3BAAA 1JA8A 1AI6A 1FE6A 3M0AA 3MTUE 1G2CA 1WB7A 1WNSA 2A06G 4AYCA 3CWBH 3KZIZ 3SPIA 2Z0AA 3CCMP 2PGGA 4H44B 5EZYB 3K0GA 1AVOA 3G6EV 1IFJA 1KP3A 4WFHA 3CRQA 3K3WA 1SQPK 1MSWD 3BCCJ 3HE4B 2UXCO 5L8RJ 1QLEB 4LFAO 3P3PA 3WFVA 3CMEV 1EM1A 5KLVE 2QJPB 3CXHI 3B5ND 4L76A 3AG7A 3LW5J 1W2BO 1SQFA 1X79B 1M56C 1MZFA 1M1KW 2KYVA 4DV1B 1JY3O 3AE9C 4YPCA 1SS1A 2R9RB 4MT8A 1W2BU 3L72D 1PV0A 3L4FA 1PGOA 2AEJA 2QKSA 1SA0A 4LF9B 2W6JH 5AW9B 3ZMVA 1NTKE 3KDPB 2OCCC 5B5EZ 2A9HA 1U7JA 2WSSH 1NAYA 1U57A 3H1LD 3JSVC 3CMEP 4JI2O 1CEZA 2UUBO 4GZRB 1FAFA 4HB1A 2JEUA 4L74A 4J41A 1JO5A 4CZZA 4LGDE 1R73A 1N86A 3AG3C 1QGKB 5AVYB 1PPJE 4UV9A 1YDXA 1VQ7P 2R3SA 1NR7A 5LYJB 5TISE 2ZNIA 1SQPD 3DGEA 5JCOA 1JNMA 2JWDA 4I50A 2XT9A 2ZVNB 3CWBD 3CRAA 4CH4A 3L71D 2KZJA 2W6JG 2GBOA 3KHUA 5FNVA 3KG2A 1RE3C 4YXDC 1K97A 4X8AA 1VQOP 3H1LG 4K3AA 1Q43A 1BHAA 2CTRA 5LBQA 5B1OA 5KKZC 4B3TO 2WLLA 4F6RA 2K3RA 1XTCC 2HG5D 4FZ0A 3OW2O 5BXZA 5FPRA 1SQBE 4ASWA 1WP8A 3T1YO 2HFEC 1Q90D 4MVRA 3CX5E 1UJWB 3AEBC 2QE7H 4JI5O 5AVQB 2FYNB 3N4XA 4FPPA 1FKAO 1VF7A 1NTKD 1TUBB 4FM1A 1TA8A 3H1HD 3CWBG 4FFBB 4KL1A 1HJ0A 3BEHA 1USDA 1SQPE 2M5AA 4LWSB 4E2LA 3H1LJ 3LUTB 1JTHB 3HKBB 2F4VB 4JYBA 4Z1VA 1PP9D 1NKNA 4KHPO 3H1LH 3RVYA 5H2FZ 3CX5H 2Q8VA 2XAQA 3ABMC 2JGDB 2A45G 3AG4C 3BY6A 1SRYA 2Q3EA 1BSHA 1Y47A 4O4LA 3TSIA 4C7NB 5JVDB 2UXDO 4CS3A 3QO8A 1G1XB 1KD1Q 4K8ZA 5H6QA 2OWOA 2WA4A 1TUBA 2EJ7A 3AK1A 3LSSA 3JD3A 1N36O 1M7LA 4LFBO 3WUTA 1PKXA 4AQYO 1RFYA 4FLYA 1SQPH 3OEEG 3H1KD 5IYCO 3SWFA 1NYHA 1USEA 4I4TB 3ML0A 2P10A 2YI9A 2YXYA 2QWQB 1JEKA 2CTQA 1WJZA 2DYRC 3VOPA 4N21A 3CC7P 1N7SA 3E8HA 1PGQA 3M06A 3OUSA 2A3QA 4GX0A 2IJKA 3H25A 4FJCC 1P7GA 4XA4A 1EDLA 1DX7A 1IXMA 4O2AB 4UCSA 1X9VA 3ZDMA 1IFIA 4LC1A 5IWAO 1NTMJ 4DT0A 3R4YA 4LP8A 4X1KB 2NRGA 1OXZA 1MZ9A 1MNGA 1EFRG 3ABKC 2JGUA 3E35A 4LWSA 4CS4A 1R5SA 1SA0B 2V1DA 2K1AA 2QVAA 4OVNF 2GUZA 3H1JH 1KB9D 1LTSC 5B66Z 3G9RA 3WU2Z 2PI5A 2NPSB 4TT3G 1JY3N 2UWJE 1BS3A 3HPLC 5LGNA 2WA3A 4DV7O 5AVXB 3S4RA 3NTNA 2AZ0A 1ZUQA 4NXNB 1BCCE 1QEXA 2YI8A 1PP9H 3EQ2A 2V7QG 3CL3D 3B71A 4EKWA 4TWKA 3RYFA 4XE5B 1BGYD 2JS5A 2HLDG 4B86A 3G71V 2UXBO 3C90A 1OCZC 1L0ND 2Q7CA 3CJHA 5GW7A 1AI5A 3LDCA 1WA8A 3O65A 1LTJA 1LWUC 3IJ4A 1YHQP 3BFRA 1EBOA 1OCCC 4WFFA 3VQVA 1B3QA 2PYJA 2PRRA 1ZP0C 1NTZE 4X64B 1SQXH 3OM3B 1MFZA 2AXTZ 2M3BA 2ITDC 5KHHA 2OIGA 3H1KH 1X0TA 3LW5H 1TU3F 2QEXV 1FOSF 3JD0A 3O8ZA 4LF6B 2ZAEB 2D2CB 3MZWB 3OE7G 1FJKA 1MABG 1YTFD 3FWLA 3B40A 5J2UB 1RHZB 3LSQA 2P4KA 1L1FA 3L70G 3K9SA 2DJVA 1NTZG 3N2KA 1SQVK 4IFMA 4I6MC 1IBKO 4F4LA 4DYLA 1YIJV 4DUZO 2O01J 3AE5C 4H0LD 2FFDA 3TGUD 5KA6A 1JM0A 1HVVA 4X20A 1H2LA 5EYPA 4BIZA 1VQOV 1LJ2A 3B8MA 2HP8A 3HKBA 1BCCJ 2Y0DA 3H1JD 3ASNC 5D5PA 2HR3A 5CN0A 3BCCH 2RQ6A 4MVUA 2YIUC 3OGCC 3CCVP 2BE3A 3HD7B 1SQGA 1KILC 2WLKA 3JD2A 5KLVJ 1L0LD 1QR8A 1VQ5P 1F4NA 1H8EG 1Q86Q 2WLJA 4JZ2A 2W8ZA 2JDIG 1QLEC 2K37A 3K03A 1Q2NA 3HRNA 2F66C 2BTQB 5FPOA 3FXDA 3Q2YA 5AW7B 1NO4A 3ETDA 4PV1D 3OR7C 4TSFG 2G38A 2KG7B 1ZRTE 3SFEC 4PI2A 2YIBA 3K5BA 1OVRA 3EFGA 1N7LA 1QR9A 4LFBB 3FX0A 2RH0A 3RGBA 3TNUA 4PDRA 3L75J 2BASA 1BE3J 4GDOA 1GTWA 4BIOA 4DK1A 1M93A 1BSMA 1NJIQ 3E8FA 4IT5A 4MTXA 1EDKA 2RMZA 3SJCC 3CLQA 1SFCD 4H33A 5KUKA 1S1CX 3C8VA 4PDMA 2YIAA 1RM1C 1SERA 3H1HG 3M8AA 2FMLA 3T2MA 1SKVA 4PJ0E 1YJ9P 4L8JA 5KLIB 5JQGB 2IH3C 1KZUB 1LT9C 1KKCA 4EYYQ 3JCUE 4NPFX 2HYNA 3UQ8A 1L0LH 3M99B 1N8RQ 5EYPB 1ZMEC 4O4HB 1SFCC 3NFQA 1NWQA 4Y28J 3DSQA 4RQFA 1Z5WA 1VQ7V 4O9BA 3CSXA 5LHHA 1DIPA 1SQVD 1N73B 1RF0C 1QX8A 3JSLA 4QIWF 1MOFA 1BQ0A 1KQFB 2C2AA 1FDMA 1IBLO 3HE5B 3U11A 3SDLA 2FYNC 5B1AC 2LW1A 1FZFA 2N1TC 4UV8A 1YYCA 2M5AB 1XNQO 3AG2C 2EINB 3HR0A 3M7MX 4RO0A 4GCZA 3L75D 1EZVE 4FVMA 2XDJA 1G6UA 2DW4A 2AEMA 3LNNA 2QG4A 1M8OB 4IIJB 1KBHA 2BEQD 4BR6A 2BOBC 4ZBMA 3UO2A 2BCCJ 1FXKB 1YZBA 1AJQA 3EFFK 5CJ4A 1H2KA 1YITP 3T97A 4PA6A 3D36A 3CWBJ 5TISZ 1N0JA 4JAVA 3W7TA 1N33O 2JP3A 4GKJO 4GUNA 4AQRD 4WY4C 3E8GA 3L70E 5CHXA 1L2PA 4DV5B 3ASOC 2ZM6B 1QCEA 3ZJZA 3U1CA 4HYOA 1P84H 2JRIA 1KB9H 2IBZH 3CYOA 3AE4C 2ZCEA 4B7KA 1WN7A 3B5NA 4PD4H 3A8TA 3IC9A 3K58A 2VWKA 2Q5ZA 5AW8B 1SVFA 1MG1A 4IFFA 5M1BA 2KG7A 4E4EA 2AEFA 5B66H 1P49A 3JALA 3QWOC 2WT7B 1K9MQ 4WFAV 4W7YA 3IGAC 1L0NH 3RFRA 4X62O 1L0NE 3AEAC 4J7JA 1DEBA 2JJLA 4D6TE 1P4RA 2YXLA 1EQ7A 4PHZA 1LT9A 2WPRA 1W59A 4OWFA 2ZXXA 2DQ3A 1TVKA 5H6RA 4CC5A 3BRCA 1SZXA 4LNUB 1NU1J 4OX9B 3AK3A 3PHLA 4WBNB 4LF8B 3D71A 1AR1B 2EIMC 1QL2A 2HJFC 4Q20A 3P8CD 5DM6V 5GTIH 1OW6A 4EIJA 5D5QA 1VF6C 2JK5C 1TGOA 3G4SV 1NZ6A 2X6CA 4JYYA 2X6AA 1PNMA 1KYOE 5H2FE 2W83C 1Y76A 2N1TA 1WP7A 4DR5B 2YEVA 2CAZC 3D6YA 4DV0O 1IZ3A 3Q4HB 4TQFA 5CMUA 5FL7G 4IYIA 3W7WA 4QE9A 1OFCX 3JYCA 3L74J 1GAXA 2QJ1A 4MN4C 3CMAV 4DO2A 4LF7B 5L3FA 3DXRB 1GL2A 3OTFA 5BR8O 1CI6A 1SFCA 1ZR4A 4RUFA 4YIOA 1KQGB 4BWNA 4J7ZA 1NTKH 5B1BB 4ABMA 4CH6A 1MKMA 4FM2A 1EZVD 5K1XA 1FFTB 4IGGA 1O9HA 4WB4A 2QKAA 2EJRA 1JOCA 1AQ5A 4DW1A 2C0XA 2OYHA 1AP5A 4EFBA 1OZ0A 4WFEA 2Z5IA 5J2UA 1IK7A 1E1RG 1VQ9V 3CMAP 2GTSA 4MSWC 4UB6H 2CH7A 2LGWA 1ORQC 5EZYA 1IURA 2WPQA 4EI2A 3KZIH 1PIXA 1NTKG 1GU4A 1GW4A 1VL2A 3UKMA 4I7ZB 2ATKC 4KXRA 1JCCA 3ICXA 1IFDA 2OYHB 1Q8IA 3RL0C 3Q4HA 3ASNB 3L36A 2FYUJ 1PM9A 2PF4E 5IY5B 4X65B 1EZVG 2ODMA 4HNAB 2HJDA 2YIUB 4MTFA 1FYJA 1AV1A 2CK3G 3K59A 3USSA 1HF9A 4L73A 4X88A 1GN3A 3AG3B 2P5OA 1FDOA 4U3FJ 3D3IA 1RY3A 5CBGA 4N3YB 4Z2WA 3RW0A 2JJ1G 1CZQA 1G2CB 1NGMB 3PH0A 3JASA 4I9WA 5DEDA 4QMAA 1S3JA 3F7YC 1XUQA 4FLVA 1Y66A 5JVDA 2YEVB 4JZGA 2WSEH 2HPCA 1J2JB 3HE5A 1EZVH 1FJPA 5AW3B 5EBMC 2R5DA 4ZMDA 2WSEJ 1LTBC 4DR3O 3MAQA 1GK6A 2CDYA 1QNMA 2XU6A 2OQQA 2H89C 5C39A 4C7RA 3CCSP 1ZAUA 3PTZA 3WU2E 2B88A 5KLVD 3Q5RA 1N8RW 2YSUB 3V4WA 1NR1A 3DC6A 3GF7A 3K5OA 1AI7A 4JI6O 2E5YA 4BXLA 5EK0A 1W0KG 1FS0E 2Q7EA 1RF1A 4DUYB 4B3SB 2KSEA 1Q81W 3SYOA 2A79B 4X1KA 3IR9A 1HJBA 3CHXA 2YICA 5APUA 4Z1MG 4EB6B 1A02F 2ZE7A 4GKKO 2FKWB 3F7VC 3FXEA 3FKSG 5KAFZ 3ABTA 1PL5A 2OCHA 2E5LB 2YNYA 1R3IC 3TGUH 4B3RO 2DYSC 4IHJA 1SS3A 4H13D 2XTAA 4JI4O 1S5HC 4IOIH 4QGPA 5BU8B 2BCCH 2P90A 1H2SB 3RK3C 1B04A 2CPBA 4FFBA 5C8YA 4NTXA 3JAKA 3UT5A 1ZN5A 1FOSE 4W7ZA 5LXTB 3APQA 1NH4A 1PL0A 3THOA 4PD4E 4K8XA 1HGZA 2R32A 4O4JB 5LOVB 4TUYA 3A0HE 2Y0CA 2KLVA 2B1IA 4PDVA 2DW3A 4L87A 4DV6B 4D6TG 4O4LB 3A0HH 3VQWA 5FLXN 3B8EB 4DZOA 1T5EA 3RBXA 3W7SA 1KD1W 4AI8A 3Q1MA 1IDSA 1OW8A 3G80A 1N7SD 3GWKC 4K0KB 4WFBV 1N4CA 1LTTC 5GTIE 3I55V 1S4XA 1SQXE 1B6QA 4TOIA 2ZXWC 5LMNO 2BSKB 1L0LE 4TUYB 4JI3B 4YY3B 2K9JB 2EIKC 3AEGC 2K9YA 1YSCA 3V5BA 1EDIA 3O6QB 3JD4A 3JC22 4PV1B 3RYIB 2QM8A 3QVNA 4DUYO 1GTOA 2DMXA 4B3SO 1L0LG 2WSFH 3PLNA 4IL6E 3W68A 1N7SC 4J42A 4R4MA 1L4AB 2WSFJ 1BZKA 3QG5A 3CCRV 2Q4PA 4CPGA 3V4QA 1VQ6P 5B3SB 2X6BA 1EN6A 2Y4TA 5GONB 5TJHA 4RWUA 3F5HA 2BCCD 1WMKA 1L4AA 4RO2A 4JF3A 1HNZB 1ZLLA 5GTIZ 3RK2C 1I7FA 3MD0A 4R8CA 3CCVV 4LCUC 2QRXA 4N78D 3R66A 1IC2A 1M57C 3OMAB 4J9YB 4I7ZC 3BABA 1SQXG 1S5LH 3AG4B 2P1JA 2MK3A 1P84I 1T8ZA 3HKEB 1JB0J 3AE3C 3U10A 2UXXA 1NAFA 2JWAA 2A45I 3STZC 3D8CA 3FFQA 1N32B 3CCUV 4XDLA 4BWAA 4DJGA 5CCGC 1FZAA 4M3LA 1PP9G 3A2FA 2WLIA 3L71E 5ITZB 1DD3A 1K92A 4L75A 3ZHSA 1M57D 4LF4B 3EVKA 2H94A 1VF6A 4DR2O 2IBZI 4YHHO 2PY5A 3GMAA 3MHHC 4O4HA 3RL0D 3F5TA 2ZR2A 1BMFG 1F4MA 3AK2A 3VQYA 3FYIB 2XAFA 1H8HG 1XHXA 1J1EB 1Y74B 2SPZA 1SESA 2RMKB 3IAOA 3CX5F 3L71H 4DRXA 2MW2B 3ABKB 4DR1O 3E2EA 4R7CA 1BHBA 1OCZB 4JI4B 5AW4B 1BT8A 3VP8A 4MVQA 3GF3A 1QU7A 4DR5O 1SQQE 2E43A 3HD7D 4MTOA 1AB3A 3FB7C 1MA1A 2AHZA 5LP6C 5LXTA 1KC8W 1NTZK 3KZIE 2WQYC 3LDEA 1SQPG 2HPCB 2WPSA 3M91A 2VQFB 3ZHVA 2NN4A 3DC5A 2OTLP 2XHBA 2H88C 3H1KE 1ZWIC 2OYHC 1HP8A 1LWUB 2FXPA 1GN4A 4JI5B 2IBZD 4JI0B 1HTLC 1X22A 5KHKA 1OVVA 4ZKIA 1Q5OA 2K9JA 1ROPA 3ZRVA 1Q6IA 2VRSA 4WY4D 1URFA 5LMNB 2QWRB 4H37A 1LT1A 2VRZA 5APTA 4YY3O 5EC1C 4N23A 3S3XA 1X59A 4DV3B 1XL4A 4MVZA 4I55B 4NXMO 1KYOD 4JV5B 1K8AW 1FJGB 1PNLA 1XI1A 1BE3H 2FTKA 2EULA 2H8PC 2Z5HA 2XNXA 4A5UB 3T1HB 4QJFB 5KLVH 1HBWA 3H6PA 1E1QG 1CXZB 4EB6A 1S76D 3E22A 1KYOF 3MUDC 3GHGB 1K5SA 3HD7C 1JQ0A 1ZTEA 2CUGA 1JOYA 1ZL8B 3Q5PA 3PP5A 1VQKP 5CCHA 1M1JC 1YQ4C 4IHJB 3CD6P 1D5AA 4X62B 5B1NA 1VQPP 2NPSC 2KS1A 3S1KA 1Q3EA 2NR5A 3GB7C 1NTMD 1KQSU 3E89A 5CA1A 2P4VA 4GLXA 3EWKA 3MHVA 1OW7A 1YVWA 2F1MA 1KILB 4NTYA 2FXOA 2Q6AA 1YTZI 1AJYA 4MVSA 1VQKV 1JY3P 5GTHH 1XDCA 1ZLZA 4YJ2A 1LUWA 2GUSA 4F6EA 2ZXEB 3B8NA 4DV4O 2H3OA
chains in the Genus database with same CATH topology
2O01J 3AE5C 4H0LD 1DD4A 3S9OA 3GMAA 1PL5A 2E74C 1MKMA 3GLMA 1GMJA 3Q3DA 2V7QJ 4H13D 1PV3A 2BEQD 4H13C 4H44B 4U7JA 4KT0J 3IAOA 3SFDC 2MKVA 3RK3E 2G8YA 3AE1C 1KILE 2YIUC 1VF5D 3AE7C 4OGQB 2YMKA 5L8RJ 1IK7A 1YQ3C 2QJKC 2D2CD 1NYHA 2JP3A 3GF3A 2P10A 4PV1C 1S5LX 5KLIC 3LW5J 4OGQD 4R4LA 2WPVB 1PIXA 2E76B 3Q1MA 1VL2A 3H25A 4I7ZB 1OW8A 4YTPC 2WQYC 3AE9C 3Q2YA 4PV1D 4H13B 1Y9BA 1ZOYC 3AEFC 1ZRTE 3AE4C 3SFEC 2H88C 2QJYC 4H44C 2FXPA 3FGAD 3AEGC 3R4YA 3AE2C 1R8EA 2K9YA 2BEZF 1HF9A 1U57A 2WSCJ 1KORA 5M1BA 4PV1B 1EXJA 4GDOA 1FDOA 3G9RA 4TT3H 4R4MA 1VF5B 1FDIA 3AEEC 2WSFJ 2QSIA 3Q5SA 2E74B 1NGMB 2QIWA 3AEAC 2ZT9C 4Z1MH 1VF5C 1KTMA 2NZ2A 2D2CC 2E75C 2FBWC 2J5UA 3B71A 2ZT9B 1S1CX 3T97B 3C8VA 2G3AA 2WSEJ 4OGQC 1WMKA 4RKUJ 3Q5PA 1UIXA 3D71A 2OQQA 2H89C 4YXDC 1ZP0C 3AECC 1OW6A 2QJPC 3Q5RA 3O6QA 1YQ4C 3D6ZA 5KKZC 3RL0g 4I7ZC 4IL6X 2E76D 3GF7A 2IDBA 3IN6A 2E76C 1K05A 1ZMEC 1TU3F 2E75D 4H0LB 3AE6C 4Y28J 1JB0J 1K04A 1Q90D 3AE3C 2D2CB 3D6YA 2ZT9D 3AE8C 2E75B 3AEBC 3EWKA 1OW7A 1RQVA 1DIPA 4H0LC 1EXIA 2JO1A 1OMIA 3AEDC 1KQFB 1AJYA 3ABVC 1DD3A 1RQUA 2E74D 3D70A 2FYNC 4XFJA 4H44D 1HJ0A 1KQGB 1KMIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 J;  2QJP C;  3LW5 J;  1VF5 B;  5KKZ C;  2WPV B;  4IL6 X;  2WSF J;  2E76 B;  2QSI A;  4I7Z B;  2E74 B;  2QIW A;  4H0L B;  4Y28 J;  1JB0 J;  1Q90 D;  4H44 B;  4H13 B;  2D2C B;  2E75 B;  1ZRT E;  4KT0 J;  2ZT9 B;  2QJY C;  4PV1 B;  2YIU C;  3C8V A;  4OGQ B;  2K9Y A;  2WSE J;  5L8R J;  4RKU J;  2WSC J;  2QJK C;  2FYN C;  1S5L X;  5KLI C; 
#chains in the Genus database with same CATH topology
 4XDK A;  3WB1 A;  5AVV B;  3K04 A;  2KP8 A;  1BSN A;  2CPS A;  1LTG C;  1J1D B;  2PI4 A;  4TLF A;  2WLI B;  4LFA B;  2E42 A;  2P22 C;  4JYA B;  5EIB D;  3T1Y B;  5AW1 B;  2HKO A;  3BRV B;  1Z5V A;  3R2P A;  2XZR A;  4C7N A;  1EDJ A;  1A02 J;  2Q9I A;  3MHS C;  1BGY H;  3SFD C;  4DR4 B;  2MKV A;  1XOU A;  1U96 A;  1KIL E;  1VF5 D;  3E1I A;  1FJG O;  5IYD O;  3CPW O;  5K5G B;  4DR3 B;  1FXV A;  4LF9 O;  1T6A A;  2EZO A;  3JCZ A;  1KFM A;  3A0H Z;  1IFM A;  1S5L X;  3RBZ A;  5KLI C;  5DEC A;  5IE9 A;  4DR1 B;  4HYT B;  3QO5 A;  1GL2 D;  2OGU A;  2L6L A;  2ZE8 A;  5FNV B;  1S2E A;  2K88 A;  3SJQ C;  1SQX J;  1F51 A;  1FFX B;  3HKC B;  4UVB A;  2DE0 X;  3K06 A;  4NPD A;  4H13 B;  3M9Q A;  5APQ A;  2Q69 A;  3RK3 B;  1I5X A;  1N36 B;  1SF9 A;  1KN7 A;  3KXD A;  1EZJ A;  1AP6 A;  3SYP A;  1YJW P;  3DTU B;  1R8E A;  1NTM H;  1Q6U A;  2D3O W;  1URQ A;  2AW9 A;  5LP6 A;  3M9B A;  3VMY A;  1Q82 W;  3TGU J;  4J11 A;  2K1E A;  4YIP A;  4AHC A;  2YID A;  1VQ4 P;  4KFM A;  4ZOL A;  2CE4 A;  4TV9 B;  2J59 M;  4ZI7 B;  2R3C A;  4MS2 A;  4TV8 A;  1XEQ A;  2CGN A;  3CE2 A;  4G2K A;  4X65 O;  2FY8 A;  1M1K Q;  4QE7 A;  5LHI A;  1YIJ P;  4U3F H;  1N7S B;  1PP9 E;  2NZ2 A;  2P2U A;  4JI7 B;  5IYZ A;  2KK7 A;  1WAZ A;  1IXB A;  3OMI B;  3BCC D;  2JEE A;  3A0R A;  3L73 H;  2WMM A;  2LQT A;  2LFS A;  5IDJ A;  1XNR B;  5KHG A;  2DN9 A;  1GK4 A;  4JI0 O;  5CB4 B;  1Z2G A;  1FU1 A;  1PGP A;  5JJE B;  5L3B A;  1GL2 C;  1IK9 A;  3ABU A;  3AEC C;  1P84 E;  2M3E A;  2BOC C;  3D6Z A;  3VMZ A;  2IJI A;  5KMG A;  4P30 A;  1OIP A;  2JJ2 G;  2O1J A;  3VOU A;  1F7Y A;  3GHG A;  5KJ7 D;  2R70 A;  4G27 B;  1S5L E;  2E76 C;  4LNU A;  1OVU A;  3CCM V;  4NXN O;  1HNW B;  1ZRT D;  1GM7 A;  2GHY A;  2H43 A;  1BL8 A;  3L70 H;  1M9N A;  4IIJ A;  2XND G;  1TUE B;  1R3K C;  2QWN B;  1EXI A;  3AED C;  4IL6 Z;  1OMI A;  3L73 G;  3G71 P;  3ZED A;  3K79 A;  5L3D A;  4OX9 O;  2OYI A;  3JAR A;  1NBM G;  5KUM A;  3C9I A;  4ZKP A;  3CCL P;  1KIL A;  3D70 A;  4UFZ A;  1V9P A;  4PA9 A;  3WG7 C;  4TV8 B;  2PGD A;  1L4A D;  3RK2 B;  3O9O A;  5AVU B;  5CBH A;  3K57 A;  3OT7 A;  4HJG H;  4NTW A;  3V2P A;  3OEH G;  2B9B A;  4NYK A;  3IF4 A;  3WUU A;  1JCH A;  2YIB D;  1NVO A;  4PDL A;  5E79 Z;  2CTW A;  3CCE V;  3SWK A;  4JAU A;  4IYH A;  1YJW V;  2QR4 A;  3RYI A;  5CBO A;  2IFN A;  4J80 A;  4NKG B;  1H38 A;  4U7J A;  3T1C A;  3TDK A;  5CCG A;  2EIL C;  3AE7 C;  2V7Q H;  1KP2 A;  5EBL C;  1KIL D;  1HWT C;  3B5N B;  2N04 A;  1SET A;  2PYL A;  2Q1K A;  4LBE C;  2DWD C;  3L73 D;  3ETE A;  2QDO A;  1M1J B;  4TV9 A;  1QLE D;  4UCR A;  1KQS O;  2N1T B;  4R4L A;  1THZ A;  1WA8 B;  1LTJ B;  5AVR B;  3C3T A;  1GW3 A;  5LHG A;  1KQL A;  3RK3 D;  2GUV A;  1GU5 A;  1IBL B;  3CCQ V;  3BCC E;  1G8M A;  1R6K A;  1SQV H;  1FFX A;  3B09 A;  3CS5 A;  3HKC A;  5KAF E;  4PI0 A;  2FYU D;  4JV5 O;  3AE2 C;  2NNU A;  3M0D C;  2B5U A;  1FXK C;  5H5N A;  4NXM B;  2WLN A;  1AQT A;  2NLJ C;  2YXH A;  1BE3 D;  2WSC J;  3L70 D;  3LIE A;  1GKF A;  3N2G B;  1EXJ A;  4A7P A;  2BCC E;  1VF5 B;  3L75 H;  1YTZ T;  2O1K A;  1JFF B;  1NOH A;  1M90 W;  1MUU A;  4DR6 B;  3VBB A;  2Q0A A;  2BSK A;  3APO A;  1SQQ D;  2E75 C;  1RF1 C;  4P9P A;  2J5U A;  1A32 A;  1PZQ A;  4B3T B;  3B2E E;  4FIP C;  2ADQ B;  3G3Z A;  1JY2 N;  1NKD A;  4OPA A;  1ZR2 A;  1DF5 A;  2ITC C;  1UIX A;  1F23 A;  1VP7 A;  2HFE D;  4ASU G;  2PAJ A;  1FD9 A;  3N7N A;  1GRJ A;  1LGH B;  4D6T D;  2OTK E;  1K7D A;  4IL6 X;  3BAT A;  4ZHQ B;  3IN6 A;  2ILM A;  2WLM A;  1WPB A;  2ZR3 A;  2E75 D;  2B87 A;  5KMG B;  1NHL A;  5JH7 A;  2YO2 A;  4LF8 O;  3GVM A;  5GON A;  4LF7 O;  3WB2 A;  2L5G B;  3VQX A;  3RGU A;  5L3E A;  5DJU B;  1M4U A;  1IFN A;  1JJ2 U;  1XNR O;  1AVM A;  4IL6 H;  3CC2 V;  1R3L C;  2IZ1 A;  4WBA A;  4PA4 A;  1OWA A;  3GHG C;  1W2E A;  4FFK A;  1RQU A;  1LNQ A;  1BE3 G;  1D7M A;  1KUQ A;  2FXM A;  2YXR B;  1SQB J;  1FZG A;  1M1J A;  3L9D A;  3F89 A;  2IH1 C;  2ETN A;  1YIT V;  2W0X A;  3S9O A;  4MVM A;  2IZ0 A;  3CCU P;  3LDD A;  1XMO B;  3ZIA G;  2P58 A;  3RL0 B;  3TNU B;  2UUA O;  1QL1 A;  5E79 H;  4GKK B;  4UCV A;  2HVK C;  4DRX B;  2V7Q J;  3BA8 A;  5LL6 Y;  2QA4 P;  1NU1 D;  2Q9L A;  2Y4U A;  1VDF A;  3K5N A;  1M5I A;  4X1I B;  3ZHT A;  1CP9 A;  1O9G A;  1BGY G;  3U0Z A;  3UCS C;  1BE3 E;  1IVS A;  2YMK A;  1IJD B;  3OR6 C;  1NU1 K;  1I0H A;  1P7B A;  3L74 G;  4HNA A;  2FYZ A;  2PP6 A;  1OHH G;  2D2C D;  3CRM A;  4X64 O;  4UB6 Z;  3L73 E;  4UCU A;  1H2M A;  4FZ1 A;  4DUZ B;  1KV4 A;  1SQB G;  2YO3 A;  2E76 B;  3HE4 A;  4KHX A;  1JFF A;  1T2K D;  2B89 A;  1OCR C;  1HR0 O;  2M0B A;  4CS2 A;  2O3J A;  3ZRX A;  1PNK A;  2EIK B;  2WSS G;  2K9P A;  1XL6 A;  3AEF C;  2N1T D;  1QVG O;  1SQV G;  1QBZ A;  5CJ0 A;  3HUS A;  1OJH A;  2Y69 C;  2UUC B;  3CCQ P;  1L4A C;  5BR8 B;  4ZI7 A;  3P3N A;  1S9K E;  5GTH E;  5B3S C;  3H1J J;  1LUV A;  3BPZ A;  1SQB D;  4U3J B;  4X20 B;  3II6 A;  1R6T A;  3K5L A;  2IM9 A;  3ZHQ A;  3P8M C;  1JY2 O;  4X1Y B;  4JI2 B;  1M90 Q;  2FBW C;  2OIE A;  3CC7 V;  1FS0 G;  3TF5 A;  5KLV G;  2GM4 A;  1JJO A;  3OMN B;  1WLE A;  3I56 P;  3BA9 A;  4X89 A;  5E1A C;  5A9G A;  4DR7 O;  1M57 B;  3NXS A;  3ABL B;  1KKD A;  2A06 H;  1J5E B;  1AIL A;  2ZJS E;  4RQE A;  1RF0 A;  2CGO A;  1URQ D;  3H32 B;  3JCU Z;  3TJT A;  4FK5 C;  1J95 A;  5AVT B;  1GDT A;  1LP1 A;  2N74 A;  1V54 C;  3AE6 C;  2ZQM A;  2HHH O;  4UB8 E;  2UXD B;  4DV0 B;  2FYU K;  3FAV B;  4H0L C;  3G6E P;  2J58 A;  2P6J A;  1NTZ J;  3ZHU A;  3JAR B;  2Q73 A;  4B3R B;  4JPR A;  2KXP B;  4LF5 O;  3ABV C;  1YTF B;  2W6A A;  4GOE A;  4JTD B;  2YKQ A;  2EX3 A;  2AXT H;  4XFJ A;  2FB5 A;  1S72 V;  1X8Y A;  5LYJ A;  3FX7 A;  2I1K A;  2O01 H;  3L72 G;  5KTB A;  2KNC B;  4P2Z A;  2IX7 C;  3Q3D A;  1YHQ V;  4UB8 H;  1WPX A;  2ZIO A;  1H0T A;  3STL C;  3CXC U;  3CWB E;  5BU5 A;  3VYI A;  2XOK G;  4FM0 A;  1KU9 A;  4KT0 J;  3L71 G;  4HKZ H;  2G8Y A;  1QHT A;  2ZM6 O;  1YQ3 C;  1JVM A;  1N33 B;  5JJN B;  1XIL A;  1IFP A;  3ZCC A;  3KQG A;  2Y9Z A;  1CSB A;  2R5B A;  3B5N C;  1V55 C;  3FB5 C;  4WBN A;  4DR4 O;  1BDD A;  2OTL V;  1OZH A;  1YEW A;  3WMM 0;  3U1A A;  3X2Q C;  3L75 E;  1K4C C;  4I50 B;  2KB1 A;  2O57 A;  5J2T A;  3CCE P;  4XBF A;  1NTM G;  3ZMS A;  1PPJ H;  2RKL A;  1L0L K;  1U97 A;  4XDJ A;  2VS0 A;  4JF7 A;  2A7W A;  3MUD A;  1XTG B;  3V6I A;  2CTP A;  3OFN G;  1NU1 G;  2VQF O;  2BEZ F;  3VMA A;  2HOD B;  1KC8 Q;  4OPH A;  4CH5 A;  1KOR A;  2DOS A;  3TGU G;  3CCJ P;  5APS A;  2LGQ A;  5CCH C;  1MFT A;  3VP9 A;  3BVH A;  4JI3 O;  3K0D A;  4FLZ A;  3SYC A;  1LTJ C;  2QSI A;  4C46 A;  3Q5S A;  3W7X A;  2AHY A;  2QIW A;  3HB3 B;  1FPO A;  1TVK B;  4J9Z B;  1VQL V;  1P84 F;  1VF5 C;  2ZE5 A;  3LSU A;  3SJA C;  1VQ5 V;  4Z1M H;  5AVZ B;  3E1R A;  1ARO P;  3W7U A;  5LGU A;  1AA0 A;  2EIJ B;  4HZ3 A;  3ZX6 A;  1SQQ J;  2G3A A;  1VQN V;  1S72 P;  2UU9 B;  1FBM A;  4RKU J;  1Q82 Q;  3BHP A;  3MIW A;  1SQX K;  2KZI A;  4EOT A;  1DH3 A;  1YJN V;  1PL4 A;  3ZBH A;  1OX3 A;  1Y76 B;  4U7N A;  1I5Y A;  4X9Q A;  5IJ9 B;  2Y0I A;  3JCU H;  3MP7 B;  1Z56 A;  4B7E A;  2YXQ B;  2E3C A;  2RN9 A;  4J7K A;  1K04 A;  3L37 A;  2H7H A;  3K9A A;  2XAG A;  1VMG A;  2N05 A;  3P32 A;  2E75 B;  3MDS A;  2F4V O;  5IT9 N;  2ZT9 D;  3SSU A;  1RF1 B;  1DEE G;  4KHP B;  5JWP A;  1Q81 Q;  3HKE A;  4NB5 A;  5IYB O;  1Q7Y Q;  3OA7 A;  2F43 G;  3HD7 A;  1RM1 B;  4O2B A;  2WLH A;  4UXN A;  2HHH B;  1N34 O;  2V4D A;  1FXH A;  2QWP B;  1J1D C;  2PZS A;  4H44 D;  4BRY B;  2QM4 A;  2YUA A;  2VQE O;  1NKZ B;  5CA1 B;  1E79 H;  3FWN A;  3N2K B;  1NTK J;  4DOJ A;  5KAI E;  3CC4 P;  1NTK K;  1BCC G;  1SC5 B;  3ASO B;  3PN1 A;  1GMJ A;  3BRT B;  2ZVO B;  1DTO A;  4YXW H;  1CPY A;  1RE4 C;  4J10 A;  3ZRS A;  1HNZ O;  2W27 A;  2Q3I A;  4JI8 B;  3VN0 A;  4GYC B;  3I5C A;  1K5Q A;  2FYU G;  1ZL8 A;  4LH6 A;  5APY A;  1XQ8 A;  4MVO A;  4C7U A;  2HLO A;  5CB4 A;  2BCC G;  4U3F E;  4AUW A;  3H1I H;  2QJK C;  4JGS A;  1HR0 B;  2QSA A;  3SYQ A;  4JAS A;  3RN4 A;  3CB2 A;  1WT6 A;  1WB8 A;  3TET A;  3T4D A;  4I0X A;  2WZ7 A;  5HFM A;  1AJP A;  2R72 A;  1R3J C;  2QJY B;  3SJB C;  2Y0E A;  2IU0 A;  2ITA A;  2QGN A;  1U7M A;  1Y9B A;  3L72 E;  2KSD A;  1J1E C;  4Q6G A;  1VQM V;  1OCR B;  1RH5 B;  1Y67 A;  5J2T B;  5IWA B;  4H44 C;  2ZIN A;  1KB9 I;  2KOG A;  1AFO A;  5B5E H;  3H1I E;  3V2N A;  4ZHQ A;  3E22 B;  4GOD A;  2QM7 A;  2W0F C;  2KIK A;  2GUZ B;  1BDC A;  1JX9 A;  1ZW0 A;  3ZN1 A;  1YBK A;  4O4J A;  5LOV A;  3I5D A;  3CPW U;  3CXH F;  2ZIM A;  1QQC A;  4B3M B;  1RPO A;  2IBZ E;  1KTM A;  1HNX B;  4X1Y A;  4WCE V;  1K8A Q;  3H1L E;  4D7S A;  4X66 B;  3SR2 C;  1SQQ H;  4R6Z A;  2AZ2 A;  5E79 E;  3T97 B;  2Q0O C;  3HUS C;  5APV A;  1QVF O;  1NQT A;  2OYI C;  2YMY A;  2BTO A;  2Y9Y A;  2HG5 C;  5EBW C;  4Y99 C;  2AXC A;  3RK2 D;  3CCL V;  1XBL A;  1BGY E;  1WRG A;  3A7O A;  1L0N J;  3B4S A;  3ETQ A;  3G6B A;  2AXT E;  5AW0 B;  3L74 E;  5EIB C;  3O6Q A;  2JEX A;  1H0T B;  2Q68 A;  4DCK A;  3H1I D;  4D6T H;  5L3C A;  4WVZ A;  3X2Q B;  4LF5 B;  1FZE A;  1DF4 A;  4EFE A;  1YJ9 V;  2RN0 A;  4JAA A;  2WPD G;  2IYP A;  1RSO A;  4W4K A;  3HTK B;  2ZDI C;  2L35 A;  3BAS A;  3I56 V;  3C1L A;  5AW6 B;  1K34 A;  5CA3 A;  2QWO B;  1SQQ G;  2JO1 A;  4QNH B;  3WG7 B;  3RYC A;  3CI9 A;  1VQ8 P;  4RAI A;  4GX1 A;  2QTO A;  1HUC A;  1LTA C;  2IPP A;  3A0B H;  4B08 A;  4W4L A;  1VAR A;  4RES B;  2AGA A;  2FFD B;  3IC7 A;  1L0N G;  3SYA A;  1QLN A;  4UCO A;  3ZMZ A;  5C93 A;  1NTM E;  3N27 A;  4UUJ C;  1KYO H;  1N2D C;  1NI8 A;  5H2F H;  4O2B B;  3GLM A;  4BIU A;  1FZC C;  4EEQ A;  5APW A;  4LR3 A;  5KKZ B;  3RYC B;  3SPC A;  2EIL B;  1YI2 V;  1ZV8 A;  1PV3 A;  3SWY A;  4K0K O;  1I08 A;  1K73 Q;  5JQG A;  3JAM N;  1BCC D;  3J7A U;  2C0W A;  3QH9 A;  4N6J A;  2P7T C;  4DV7 B;  5CA0 B;  4JYA O;  4ZNC A;  3M0D A;  4R50 A;  1H88 A;  3UO3 A;  4PA7 A;  2GV9 A;  3QTC A;  3E86 A;  2E5T A;  3CCR P;  4ZOL B;  4X66 O;  1L0L J;  4RJT A;  2IJJ A;  1PD3 A;  3OW2 U;  1T2K C;  5AVS B;  5BMV B;  5CCG D;  5CBN A;  4YTP C;  4RUE A;  4PJ0 Z;  2M6Y A;  1Y6X A;  2JIZ G;  1IBM B;  3ZS8 C;  4X1I A;  2GTA A;  3UM7 A;  2KLU A;  1ZOY C;  4BW5 A;  5CMZ A;  4BRY A;  4KJM A;  1I94 B;  3L70 J;  4W80 A;  3FGA D;  3OAA G;  1GL2 B;  3ZMU A;  4ASV A;  1OCC B;  4GKG A;  2DQ0 A;  2YS8 A;  1VQ9 P;  2YC0 A;  1NTZ D;  3L74 D;  3CC2 P;  4JI1 O;  3SPJ A;  2KQX A;  3QNE A;  1SLQ A;  2KB7 P;  1UPG A;  1YJN P;  1E79 G;  3CP1 A;  2XAH A;  2H8P D;  1S77 D;  2ZT9 C;  4EDF A;  1JTH A;  2HVJ C;  2UUC O;  3KKY A;  2WT7 A;  2ZNJ A;  1AR4 A;  1KFN A;  3ITK A;  5KAI H;  4DV2 B;  2IFM A;  1MV8 A;  2MJZ A;  3S3W A;  2M8R A;  3CXH D;  1ENV A;  4ZIB A;  2UUA B;  2OAR A;  4D6T J;  2Q67 A;  1HNW O;  2KSJ A;  1JCD A;  3WU2 H;  2RNB A;  4FLX A;  2ZE6 A;  4U7O A;  2POH A;  4UVA A;  5KHJ A;  1KB9 F;  2A06 D;  2I8D A;  1D2D A;  3RL0 g;  4BW9 A;  2IDB A;  2LXC B;  1GMG A;  1JMM A;  3LID A;  3CRC A;  1HWY A;  2FL4 A;  5LGT A;  3TGU E;  1OCO B;  1MMM A;  2WSC H;  1M56 D;  2VQE B;  4O2A A;  1YXB A;  1RQV A;  1MSD A;  3W67 A;  4GX2 A;  4JTC B;  2KKW A;  3H1H J;  2IBZ G;  2ZKO A;  2BTQ A;  4UCT A;  1RE3 A;  1KB9 E;  1SQV E;  4JI1 B;  1S9K D;  3SGI A;  1KMI Z;  2RJZ A;  4LF4 O;  2R9I A;  1NU1 E;  2ZDI A;  2Q5U A;  3PRJ A;  3JAT B;  1VQ4 V;  4PEL A;  2P67 A;  4U3F D;  1IO4 A;  3H1I G;  5LMU B;  2WTY A;  3CC4 V;  2HEP A;  3JSN A;  2KI7 B;  2ZXW B;  2P7J A;  4DV1 O;  2JKV A;  5AVW B;  3RK3 E;  2UXN A;  3AE1 C;  4G28 B;  3ZHR A;  4BAY A;  1H2N A;  5EC2 C;  2I1J A;  1URQ C;  5B5E E;  1QVG U;  2UU9 O;  3V2R A;  4WF9 V;  1D5N A;  4PV1 C;  5CBF A;  4JQ0 D;  3WB0 A;  2UUB B;  3TK1 A;  3H1K J;  4OGQ D;  5JH7 B;  1US6 A;  2X0L A;  1PGJ A;  2JR8 A;  2QJK B;  3H01 A;  4I5S A;  5CA0 A;  5BZB A;  4FLU A;  1K33 A;  2B9Z A;  3TYY A;  1BQZ A;  1RE4 A;  2DYR B;  3UIA A;  4P9O A;  1NH2 B;  2XV5 A;  2CK3 H;  3VMX A;  3D3Q A;  5LA6 A;  4I4T A;  2QJY C;  1JPX A;  3FB8 C;  2EZP A;  3CEI A;  4U3J A;  3SPG A;  1PPJ D;  1L8D A;  2KS1 B;  3RWR D;  1SQV J;  1E5W A;  1YCI A;  2IU3 A;  3ZMT A;  1MZE A;  1NJI W;  4WY4 A;  2YDE A;  5B66 E;  4KUM A;  3AEE C;  1FZC B;  5DN6 G;  5H9C A;  4D7T A;  4JI6 B;  4I0X B;  2OTJ V;  2F95 B;  5HFL A;  3RVZ A;  3UT5 B;  5C8Y B;  1JY2 P;  3OTO O;  2ZYD A;  3ABL C;  1W0J G;  3CD6 V;  2L91 A;  1VQ8 V;  3L73 J;  3TXQ A;  3C3S A;  1SQQ K;  2N9B A;  3AEI A;  3ZN0 A;  4OGQ C;  2FYU E;  5IJ9 A;  1BGY J;  3M9H A;  5CCH D;  2Q7H A;  4DV2 O;  4PA3 A;  1NH2 D;  4LF6 O;  1AR5 A;  3IFX A;  1V54 B;  4PD4 I;  1GO3 F;  2LP7 A;  3FYE B;  4CBC A;  1AVY A;  3QF7 A;  4Y99 B;  1X4T A;  5KJ7 C;  2E76 D;  1VEW A;  2M7W A;  5KAF H;  4OH8 B;  1NT2 B;  4H0L B;  4JI7 O;  4N78 E;  3H9V A;  5EFW B;  2W6B A;  1P84 D;  3N2G A;  2LO1 A;  3B77 A;  4WWI A;  1EN5 A;  1KYO I;  1NS1 A;  4DR2 B;  1SP4 A;  2B87 B;  1GM8 A;  2FYU H;  3K5M A;  4MW3 A;  4PD4 D;  4ICG A;  3A0B Z;  2RDC A;  1PPJ G;  3HUS B;  1ZX3 A;  1JMB A;  2OYI B;  2Z5U A;  2PUS A;  3AG1 C;  3JAW B;  2OTJ P;  2NPS A;  4ZKU A;  2WVR A;  4YXW G;  4WY4 B;  3A5T A;  4UB6 E;  3RYH A;  4DV6 O;  1BCC H;  1NTM K;  2F93 B;  1N32 O;  3CX5 D;  1XRE A;  2GDS A;  4PD4 F;  5LP6 B;  2XKM A;  2Y48 A;  3E7K A;  1SQP J;  2Y0P A;  4I55 A;  4LLH A;  1S5J A;  1Y4M A;  5K1P A;  1Q86 W;  3G67 A;  3L71 J;  3HKD A;  3OUF A;  5AW2 B;  2Z4E A;  2LXB A;  2O01 N;  4TQD A;  1RSO B;  1FZB A;  4NPE A;  5GTH Z;  2Y69 B;  1K73 W;  2JGD A;  3KCY A;  2OYQ A;  1DK1 A;  3V2Q A;  1GH6 A;  5LMU O;  1N73 C;  3H32 A;  1RP3 B;  2JS3 A;  1M56 B;  3J81 N;  1ZXG A;  4GIF A;  2IYO A;  4FMT A;  1HGV A;  2FFD C;  1LT9 B;  1CW5 A;  3ZRW B;  3OTO B;  1Y74 A;  3CCJ V;  3GG2 A;  1T3J A;  3DXR A;  2WPV B;  3L35 A;  2YKO A;  1HDJ A;  3L72 J;  4PJ0 H;  1HH0 A;  4JI8 O;  4YJ3 B;  3J80 N;  1NTZ H;  3L74 H;  5DJT B;  2P06 A;  4HBN A;  4GT1 A;  4I1L A;  1YF2 A;  1GZL A;  5JCO C;  4JYC A;  4QPK A;  4LFC B;  3CX5 I;  5ITZ A;  4MW8 A;  4DV5 O;  3JAT A;  1HW7 A;  1K3E A;  2OT5 A;  2W6I G;  2WLL B;  4F6R B;  4AIL C;  1NVP B;  4GX5 A;  3TXS A;  1IZN B;  2EIN C;  3AG2 B;  2B1G A;  1PP9 J;  5BVZ A;  3I55 P;  1LTI C;  3H1K G;  5IYZ B;  4GOF A;  2CH7 B;  2ZFC A;  1IX9 A;  2V4H A;  1VQM P;  3GW6 A;  3A0B E;  4CH3 A;  3GWO A;  3E83 A;  2LFR A;  2E74 B;  1XMO O;  1COW G;  1S5L Z;  2GSM B;  1H89 A;  3BVO A;  1JMK C;  5KLV K;  1NU1 H;  5KJ7 A;  2ZT9 B;  2X7R B;  1GN6 A;  5KAI Z;  3T4Z A;  3A3Y B;  4AQY B;  2Z3Y A;  1URQ B;  5F2V O;  1TAE A;  4DK0 A;  2QEX P;  1VQ6 V;  4WFG A;  3R65 A;  5B1B C;  3RYF B;  1T3U A;  3ZRW A;  1GD2 E;  1H8A A;  3PJS K;  2OYO A;  1VQN P;  3P8C E;  2QJP C;  1K9M W;  3EXA A;  2JVD A;  4YJ2 B;  2JDI H;  1SZT A;  4YJ3 A;  4B3M O;  5APX A;  1N34 B;  3H1J G;  3ABM B;  1K05 A;  3MGN A;  2E5L O;  3ETG A;  2KNC A;  1VQL P;  1GN2 A;  4DR7 B;  4QPJ A;  1GK9 A;  1ZSP A;  5AG2 A;  4UB8 Z;  1H2G A;  2Q6Q A;  3HKD B;  2A0L A;  1CI6 B;  1SFC B;  3H1H E;  1S0V A;  2HOD A;  1Y8A A;  3H1J E;  3BCC G;  1AI4 A;  1VPC A;  3A2A A;  4O4I A;  2NPS D;  3CCS V;  5BMV A;  2OCC B;  1RPR A;  3KYQ A;  1XHZ A;  3KCX A;  2E74 D;  1UFI A;  3D36 C;  3FAV A;  4LH7 A;  1OV9 A;  4JTA B;  1VQP V;  5TIS H;  2VWJ A;  2EIM B;  4LFC O;  2WAM A;  5B1A B;  1SQB H;  3CJH B;  1QVF U;  4NVP A;  1DGS A;  4NR1 A;  4CC6 A;  4JPZ B;  1GM9 A;  3EHB B;  2PFX A;  2ZD9 A;  4H13 C;  1OCO C;  2LW7 A;  3H1H H;  2Q7G A;  4DV4 B;  1L0N K;  5KA5 A;  2DWE C;  2EBO A;  2LR2 A;  2N9Y B;  3OGI B;  5IJ0 B;  1Q6H A;  3P30 A;  2XUM A;  4OGQ B;  2EIJ C;  1NVP D;  2ADP A;  2A45 H;  1G4Y B;  1PFI A;  1VIB A;  3JD1 A;  2KUB A;  3IAY A;  3P7K A;  1R5L A;  3FB6 C;  2XAJ A;  2C9L Y;  3WUV A;  3OAK A;  2GA1 A;  5KX5 A;  5IJ0 A;  1N73 A;  4DR6 O;  5JJJ B;  3JAL B;  5LA6 B;  1EC5 A;  1LR1 A;  1XNQ B;  1W5C E;  3HTK A;  1FC2 C;  5AW5 B;  2C9N Y;  1G1J A;  3IFM A;  4IFD K;  5KHI A;  2ZYG A;  5A2Q N;  2QE7 G;  1DLB A;  3QO7 A;  2IJH A;  3AG1 B;  1IBK B;  1LWU A;  3OJA B;  1R1B A;  3JAK B;  2QKC A;  2QA4 V;  2QTS A;  3FD9 A;  5BY1 A;  4I2L C;  1JR9 A;  3U59 A;  4TT3 H;  4DV3 O;  1FDI A;  4DXW A;  1LP1 B;  1I94 O;  3F5W C;  1UII A;  4FLW A;  2FKX A;  1V55 B;  1IBM O;  1FXK A;  1K4D C;  2PTM A;  2D2C C;  1KEC A;  1EZV I;  2WIT A;  3JAW A;  3CRR A;  4K35 A;  2XND H;  1Q7Y W;  3KPE A;  1YI2 P;  3CXH E;  4O4I B;  3SPH A;  3VTP C;  1HNX O;  2WWW A;  3CXH H;  2UXC B;  1AJN A;  4OXS A;  2IW5 A;  4UVC A;  1J5E O;  2R44 A;  1JUN A;  2R9A A;  3T1H O;  3L75 G;  2UXB B;  3L72 H;  1FAV A;  3JAS B;  2DYS B;  5KX5 B;  2LJ2 A;  3LNM B;  3K08 A;  2XAS A;  1FZC A;  1R6N A;  1G1I A;  2F23 A;  2ZYA A;  3OD4 A;  4MTG A;  3H1I J;  3RT3 C;  3NMD A;  5IY5 C;  3AE8 C;  5J9P C;  2ARH A;  2YKP A;  3G4S P;  5L3G A;  4FLT A;  1SQX D;  2RCV A;  3TCU A;  1EN4 A;  3NR7 A;  1XMQ O;  1XMQ B;  4I9Q A;  4KP4 A;  2A06 E;  2W90 A;  3E8B A;  4U3F G;  4HH2 A;  4JBZ A;  3RYH B;  2LKM A;  1SQB K;  1B06 A;  4DW0 A;  4GKJ B;  1DD4 A;  1N0N A;  4YHH B;  4HAM A;  2E74 C;  3BAA A;  1JA8 A;  1AI6 A;  1FE6 A;  3M0A A;  3MTU E;  1G2C A;  1WB7 A;  1WNS A;  2A06 G;  4AYC A;  3CWB H;  3KZI Z;  3SPI A;  2Z0A A;  3CCM P;  2PGG A;  4H44 B;  5EZY B;  3K0G A;  1AVO A;  3G6E V;  1IFJ A;  1KP3 A;  4WFH A;  3CRQ A;  3K3W A;  1SQP K;  1MSW D;  3BCC J;  3HE4 B;  2UXC O;  5L8R J;  1QLE B;  4LFA O;  3P3P A;  3WFV A;  3CME V;  1EM1 A;  5KLV E;  2QJP B;  3CXH I;  3B5N D;  4L76 A;  3AG7 A;  3LW5 J;  1W2B O;  1SQF A;  1X79 B;  1M56 C;  1MZF A;  1M1K W;  2KYV A;  4DV1 B;  1JY3 O;  3AE9 C;  4YPC A;  1SS1 A;  2R9R B;  4MT8 A;  1W2B U;  3L72 D;  1PV0 A;  3L4F A;  1PGO A;  2AEJ A;  2QKS A;  1SA0 A;  4LF9 B;  2W6J H;  5AW9 B;  3ZMV A;  1NTK E;  3KDP B;  2OCC C;  5B5E Z;  2A9H A;  1U7J A;  2WSS H;  1NAY A;  1U57 A;  3H1L D;  3JSV C;  3CME P;  4JI2 O;  1CEZ A;  2UUB O;  4GZR B;  1FAF A;  4HB1 A;  2JEU A;  4L74 A;  4J41 A;  1JO5 A;  4CZZ A;  4LGD E;  1R73 A;  1N86 A;  3AG3 C;  1QGK B;  5AVY B;  1PPJ E;  4UV9 A;  1YDX A;  1VQ7 P;  2R3S A;  1NR7 A;  5LYJ B;  5TIS E;  2ZNI A;  1SQP D;  3DGE A;  5JCO A;  1JNM A;  2JWD A;  4I50 A;  2XT9 A;  2ZVN B;  3CWB D;  3CRA A;  4CH4 A;  3L71 D;  2KZJ A;  2W6J G;  2GBO A;  3KHU A;  5FNV A;  3KG2 A;  1RE3 C;  4YXD C;  1K97 A;  4X8A A;  1VQO P;  3H1L G;  4K3A A;  1Q43 A;  1BHA A;  2CTR A;  5LBQ A;  5B1O A;  5KKZ C;  4B3T O;  2WLL A;  4F6R A;  2K3R A;  1XTC C;  2HG5 D;  4FZ0 A;  3OW2 O;  5BXZ A;  5FPR A;  1SQB E;  4ASW A;  1WP8 A;  3T1Y O;  2HFE C;  1Q90 D;  4MVR A;  3CX5 E;  1UJW B;  3AEB C;  2QE7 H;  4JI5 O;  5AVQ B;  2FYN B;  3N4X A;  4FPP A;  1FKA O;  1VF7 A;  1NTK D;  1TUB B;  4FM1 A;  1TA8 A;  3H1H D;  3CWB G;  4FFB B;  4KL1 A;  1HJ0 A;  3BEH A;  1USD A;  1SQP E;  2M5A A;  4LWS B;  4E2L A;  3H1L J;  3LUT B;  1JTH B;  3HKB B;  2F4V B;  4JYB A;  4Z1V A;  1PP9 D;  1NKN A;  4KHP O;  3H1L H;  3RVY A;  5H2F Z;  3CX5 H;  2Q8V A;  2XAQ A;  3ABM C;  2JGD B;  2A45 G;  3AG4 C;  3BY6 A;  1SRY A;  2Q3E A;  1BSH A;  1Y47 A;  4O4L A;  3TSI A;  4C7N B;  5JVD B;  2UXD O;  4CS3 A;  3QO8 A;  1G1X B;  1KD1 Q;  4K8Z A;  5H6Q A;  2OWO A;  2WA4 A;  1TUB A;  2EJ7 A;  3AK1 A;  3LSS A;  3JD3 A;  1N36 O;  1M7L A;  4LFB O;  3WUT A;  1PKX A;  4AQY O;  1RFY A;  4FLY A;  1SQP H;  3OEE G;  3H1K D;  5IYC O;  3SWF A;  1NYH A;  1USE A;  4I4T B;  3ML0 A;  2P10 A;  2YI9 A;  2YXY A;  2QWQ B;  1JEK A;  2CTQ A;  1WJZ A;  2DYR C;  3VOP A;  4N21 A;  3CC7 P;  1N7S A;  3E8H A;  1PGQ A;  3M06 A;  3OUS A;  2A3Q A;  4GX0 A;  2IJK A;  3H25 A;  4FJC C;  1P7G A;  4XA4 A;  1EDL A;  1DX7 A;  1IXM A;  4O2A B;  4UCS A;  1X9V A;  3ZDM A;  1IFI A;  4LC1 A;  5IWA O;  1NTM J;  4DT0 A;  3R4Y A;  4LP8 A;  4X1K B;  2NRG A;  1OXZ A;  1MZ9 A;  1MNG A;  1EFR G;  3ABK C;  2JGU A;  3E35 A;  4LWS A;  4CS4 A;  1R5S A;  1SA0 B;  2V1D A;  2K1A A;  2QVA A;  4OVN F;  2GUZ A;  3H1J H;  1KB9 D;  1LTS C;  5B66 Z;  3G9R A;  3WU2 Z;  2PI5 A;  2NPS B;  4TT3 G;  1JY3 N;  2UWJ E;  1BS3 A;  3HPL C;  5LGN A;  2WA3 A;  4DV7 O;  5AVX B;  3S4R A;  3NTN A;  2AZ0 A;  1ZUQ A;  4NXN B;  1BCC E;  1QEX A;  2YI8 A;  1PP9 H;  3EQ2 A;  2V7Q G;  3CL3 D;  3B71 A;  4EKW A;  4TWK A;  3RYF A;  4XE5 B;  1BGY D;  2JS5 A;  2HLD G;  4B86 A;  3G71 V;  2UXB O;  3C90 A;  1OCZ C;  1L0N D;  2Q7C A;  3CJH A;  5GW7 A;  1AI5 A;  3LDC A;  1WA8 A;  3O65 A;  1LTJ A;  1LWU C;  3IJ4 A;  1YHQ P;  3BFR A;  1EBO A;  1OCC C;  4WFF A;  3VQV A;  1B3Q A;  2PYJ A;  2PRR A;  1ZP0 C;  1NTZ E;  4X64 B;  1SQX H;  3OM3 B;  1MFZ A;  2AXT Z;  2M3B A;  2ITD C;  5KHH A;  2OIG A;  3H1K H;  1X0T A;  3LW5 H;  1TU3 F;  2QEX V;  1FOS F;  3JD0 A;  3O8Z A;  4LF6 B;  2ZAE B;  2D2C B;  3MZW B;  3OE7 G;  1FJK A;  1MAB G;  1YTF D;  3FWL A;  3B40 A;  5J2U B;  1RHZ B;  3LSQ A;  2P4K A;  1L1F A;  3L70 G;  3K9S A;  2DJV A;  1NTZ G;  3N2K A;  1SQV K;  4IFM A;  4I6M C;  1IBK O;  4F4L A;  4DYL A;  1YIJ V;  4DUZ O;  2O01 J;  3AE5 C;  4H0L D;  2FFD A;  3TGU D;  5KA6 A;  1JM0 A;  1HVV A;  4X20 A;  1H2L A;  5EYP A;  4BIZ A;  1VQO V;  1LJ2 A;  3B8M A;  2HP8 A;  3HKB A;  1BCC J;  2Y0D A;  3H1J D;  3ASN C;  5D5P A;  2HR3 A;  5CN0 A;  3BCC H;  2RQ6 A;  4MVU A;  2YIU C;  3OGC C;  3CCV P;  2BE3 A;  3HD7 B;  1SQG A;  1KIL C;  2WLK A;  3JD2 A;  5KLV J;  1L0L D;  1QR8 A;  1VQ5 P;  1F4N A;  1H8E G;  1Q86 Q;  2WLJ A;  4JZ2 A;  2W8Z A;  2JDI G;  1QLE C;  2K37 A;  3K03 A;  1Q2N A;  3HRN A;  2F66 C;  2BTQ B;  5FPO A;  3FXD A;  3Q2Y A;  5AW7 B;  1NO4 A;  3ETD A;  4PV1 D;  3OR7 C;  4TSF G;  2G38 A;  2KG7 B;  1ZRT E;  3SFE C;  4PI2 A;  2YIB A;  3K5B A;  1OVR A;  3EFG A;  1N7L A;  1QR9 A;  4LFB B;  3FX0 A;  2RH0 A;  3RGB A;  3TNU A;  4PDR A;  3L75 J;  2BAS A;  1BE3 J;  4GDO A;  1GTW A;  4BIO A;  4DK1 A;  1M93 A;  1BSM A;  1NJI Q;  3E8F A;  4IT5 A;  4MTX A;  1EDK A;  2RMZ A;  3SJC C;  3CLQ A;  1SFC D;  4H33 A;  5KUK A;  1S1C X;  3C8V A;  4PDM A;  2YIA A;  1RM1 C;  1SER A;  3H1H G;  3M8A A;  2FML A;  3T2M A;  1SKV A;  4PJ0 E;  1YJ9 P;  4L8J A;  5KLI B;  5JQG B;  2IH3 C;  1KZU B;  1LT9 C;  1KKC A;  4EYY Q;  3JCU E;  4NPF X;  2HYN A;  3UQ8 A;  1L0L H;  3M99 B;  1N8R Q;  5EYP B;  1ZME C;  4O4H B;  1SFC C;  3NFQ A;  1NWQ A;  4Y28 J;  3DSQ A;  4RQF A;  1Z5W A;  1VQ7 V;  4O9B A;  3CSX A;  5LHH A;  1DIP A;  1SQV D;  1N73 B;  1RF0 C;  1QX8 A;  3JSL A;  4QIW F;  1MOF A;  1BQ0 A;  1KQF B;  2C2A A;  1FDM A;  1IBL O;  3HE5 B;  3U11 A;  3SDL A;  2FYN C;  5B1A C;  2LW1 A;  1FZF A;  2N1T C;  4UV8 A;  1YYC A;  2M5A B;  1XNQ O;  3AG2 C;  2EIN B;  3HR0 A;  3M7M X;  4RO0 A;  4GCZ A;  3L75 D;  1EZV E;  4FVM A;  2XDJ A;  1G6U A;  2DW4 A;  2AEM A;  3LNN A;  2QG4 A;  1M8O B;  4IIJ B;  1KBH A;  2BEQ D;  4BR6 A;  2BOB C;  4ZBM A;  3UO2 A;  2BCC J;  1FXK B;  1YZB A;  1AJQ A;  3EFF K;  5CJ4 A;  1H2K A;  1YIT P;  3T97 A;  4PA6 A;  3D36 A;  3CWB J;  5TIS Z;  1N0J A;  4JAV A;  3W7T A;  1N33 O;  2JP3 A;  4GKJ O;  4GUN A;  4AQR D;  4WY4 C;  3E8G A;  3L70 E;  5CHX A;  1L2P A;  4DV5 B;  3ASO C;  2ZM6 B;  1QCE A;  3ZJZ A;  3U1C A;  4HYO A;  1P84 H;  2JRI A;  1KB9 H;  2IBZ H;  3CYO A;  3AE4 C;  2ZCE A;  4B7K A;  1WN7 A;  3B5N A;  4PD4 H;  3A8T A;  3IC9 A;  3K58 A;  2VWK A;  2Q5Z A;  5AW8 B;  1SVF A;  1MG1 A;  4IFF A;  5M1B A;  2KG7 A;  4E4E A;  2AEF A;  5B66 H;  1P49 A;  3JAL A;  3QWO C;  2WT7 B;  1K9M Q;  4WFA V;  4W7Y A;  3IGA C;  1L0N H;  3RFR A;  4X62 O;  1L0N E;  3AEA C;  4J7J A;  1DEB A;  2JJL A;  4D6T E;  1P4R A;  2YXL A;  1EQ7 A;  4PHZ A;  1LT9 A;  2WPR A;  1W59 A;  4OWF A;  2ZXX A;  2DQ3 A;  1TVK A;  5H6R A;  4CC5 A;  3BRC A;  1SZX A;  4LNU B;  1NU1 J;  4OX9 B;  3AK3 A;  3PHL A;  4WBN B;  4LF8 B;  3D71 A;  1AR1 B;  2EIM C;  1QL2 A;  2HJF C;  4Q20 A;  3P8C D;  5DM6 V;  5GTI H;  1OW6 A;  4EIJ A;  5D5Q A;  1VF6 C;  2JK5 C;  1TGO A;  3G4S V;  1NZ6 A;  2X6C A;  4JYY A;  2X6A A;  1PNM A;  1KYO E;  5H2F E;  2W83 C;  1Y76 A;  2N1T A;  1WP7 A;  4DR5 B;  2YEV A;  2CAZ C;  3D6Y A;  4DV0 O;  1IZ3 A;  3Q4H B;  4TQF A;  5CMU A;  5FL7 G;  4IYI A;  3W7W A;  4QE9 A;  1OFC X;  3JYC A;  3L74 J;  1GAX A;  2QJ1 A;  4MN4 C;  3CMA V;  4DO2 A;  4LF7 B;  5L3F A;  3DXR B;  1GL2 A;  3OTF A;  5BR8 O;  1CI6 A;  1SFC A;  1ZR4 A;  4RUF A;  4YIO A;  1KQG B;  4BWN A;  4J7Z A;  1NTK H;  5B1B B;  4ABM A;  4CH6 A;  1MKM A;  4FM2 A;  1EZV D;  5K1X A;  1FFT B;  4IGG A;  1O9H A;  4WB4 A;  2QKA A;  2EJR A;  1JOC A;  1AQ5 A;  4DW1 A;  2C0X A;  2OYH A;  1AP5 A;  4EFB A;  1OZ0 A;  4WFE A;  2Z5I A;  5J2U A;  1IK7 A;  1E1R G;  1VQ9 V;  3CMA P;  2GTS A;  4MSW C;  4UB6 H;  2CH7 A;  2LGW A;  1ORQ C;  5EZY A;  1IUR A;  2WPQ A;  4EI2 A;  3KZI H;  1PIX A;  1NTK G;  1GU4 A;  1GW4 A;  1VL2 A;  3UKM A;  4I7Z B;  2ATK C;  4KXR A;  1JCC A;  3ICX A;  1IFD A;  2OYH B;  1Q8I A;  3RL0 C;  3Q4H A;  3ASN B;  3L36 A;  2FYU J;  1PM9 A;  2PF4 E;  5IY5 B;  4X65 B;  1EZV G;  2ODM A;  4HNA B;  2HJD A;  2YIU B;  4MTF A;  1FYJ A;  1AV1 A;  2CK3 G;  3K59 A;  3USS A;  1HF9 A;  4L73 A;  4X88 A;  1GN3 A;  3AG3 B;  2P5O A;  1FDO A;  4U3F J;  3D3I A;  1RY3 A;  5CBG A;  4N3Y B;  4Z2W A;  3RW0 A;  2JJ1 G;  1CZQ A;  1G2C B;  1NGM B;  3PH0 A;  3JAS A;  4I9W A;  5DED A;  4QMA A;  1S3J A;  3F7Y C;  1XUQ A;  4FLV A;  1Y66 A;  5JVD A;  2YEV B;  4JZG A;  2WSE H;  2HPC A;  1J2J B;  3HE5 A;  1EZV H;  1FJP A;  5AW3 B;  5EBM C;  2R5D A;  4ZMD A;  2WSE J;  1LTB C;  4DR3 O;  3MAQ A;  1GK6 A;  2CDY A;  1QNM A;  2XU6 A;  2OQQ A;  2H89 C;  5C39 A;  4C7R A;  3CCS P;  1ZAU A;  3PTZ A;  3WU2 E;  2B88 A;  5KLV D;  3Q5R A;  1N8R W;  2YSU B;  3V4W A;  1NR1 A;  3DC6 A;  3GF7 A;  3K5O A;  1AI7 A;  4JI6 O;  2E5Y A;  4BXL A;  5EK0 A;  1W0K G;  1FS0 E;  2Q7E A;  1RF1 A;  4DUY B;  4B3S B;  2KSE A;  1Q81 W;  3SYO A;  2A79 B;  4X1K A;  3IR9 A;  1HJB A;  3CHX A;  2YIC A;  5APU A;  4Z1M G;  4EB6 B;  1A02 F;  2ZE7 A;  4GKK O;  2FKW B;  3F7V C;  3FXE A;  3FKS G;  5KAF Z;  3ABT A;  1PL5 A;  2OCH A;  2E5L B;  2YNY A;  1R3I C;  3TGU H;  4B3R O;  2DYS C;  4IHJ A;  1SS3 A;  4H13 D;  2XTA A;  4JI4 O;  1S5H C;  4IOI H;  4QGP A;  5BU8 B;  2BCC H;  2P90 A;  1H2S B;  3RK3 C;  1B04 A;  2CPB A;  4FFB A;  5C8Y A;  4NTX A;  3JAK A;  3UT5 A;  1ZN5 A;  1FOS E;  4W7Z A;  5LXT B;  3APQ A;  1NH4 A;  1PL0 A;  3THO A;  4PD4 E;  4K8X A;  1HGZ A;  2R32 A;  4O4J B;  5LOV B;  4TUY A;  3A0H E;  2Y0C A;  2KLV A;  2B1I A;  4PDV A;  2DW3 A;  4L87 A;  4DV6 B;  4D6T G;  4O4L B;  3A0H H;  3VQW A;  5FLX N;  3B8E B;  4DZO A;  1T5E A;  3RBX A;  3W7S A;  1KD1 W;  4AI8 A;  3Q1M A;  1IDS A;  1OW8 A;  3G80 A;  1N7S D;  3GWK C;  4K0K B;  4WFB V;  1N4C A;  1LTT C;  5GTI E;  3I55 V;  1S4X A;  1SQX E;  1B6Q A;  4TOI A;  2ZXW C;  5LMN O;  2BSK B;  1L0L E;  4TUY B;  4JI3 B;  4YY3 B;  2K9J B;  2EIK C;  3AEG C;  2K9Y A;  1YSC A;  3V5B A;  1EDI A;  3O6Q B;  3JD4 A;  3JC2 2;  4PV1 B;  3RYI B;  2QM8 A;  3QVN A;  4DUY O;  1GTO A;  2DMX A;  4B3S O;  1L0L G;  2WSF H;  3PLN A;  4IL6 E;  3W68 A;  1N7S C;  4J42 A;  4R4M A;  1L4A B;  2WSF J;  1BZK A;  3QG5 A;  3CCR V;  2Q4P A;  4CPG A;  3V4Q A;  1VQ6 P;  5B3S B;  2X6B A;  1EN6 A;  2Y4T A;  5GON B;  5TJH A;  4RWU A;  3F5H A;  2BCC D;  1WMK A;  1L4A A;  4RO2 A;  4JF3 A;  1HNZ B;  1ZLL A;  5GTI Z;  3RK2 C;  1I7F A;  3MD0 A;  4R8C A;  3CCV V;  4LCU C;  2QRX A;  4N78 D;  3R66 A;  1IC2 A;  1M57 C;  3OMA B;  4J9Y B;  4I7Z C;  3BAB A;  1SQX G;  1S5L H;  3AG4 B;  2P1J A;  2MK3 A;  1P84 I;  1T8Z A;  3HKE B;  1JB0 J;  3AE3 C;  3U10 A;  2UXX A;  1NAF A;  2JWA A;  2A45 I;  3STZ C;  3D8C A;  3FFQ A;  1N32 B;  3CCU V;  4XDL A;  4BWA A;  4DJG A;  5CCG C;  1FZA A;  4M3L A;  1PP9 G;  3A2F A;  2WLI A;  3L71 E;  5ITZ B;  1DD3 A;  1K92 A;  4L75 A;  3ZHS A;  1M57 D;  4LF4 B;  3EVK A;  2H94 A;  1VF6 A;  4DR2 O;  2IBZ I;  4YHH O;  2PY5 A;  3GMA A;  3MHH C;  4O4H A;  3RL0 D;  3F5T A;  2ZR2 A;  1BMF G;  1F4M A;  3AK2 A;  3VQY A;  3FYI B;  2XAF A;  1H8H G;  1XHX A;  1J1E B;  1Y74 B;  2SPZ A;  1SES A;  2RMK B;  3IAO A;  3CX5 F;  3L71 H;  4DRX A;  2MW2 B;  3ABK B;  4DR1 O;  3E2E A;  4R7C A;  1BHB A;  1OCZ B;  4JI4 B;  5AW4 B;  1BT8 A;  3VP8 A;  4MVQ A;  3GF3 A;  1QU7 A;  4DR5 O;  1SQQ E;  2E43 A;  3HD7 D;  4MTO A;  1AB3 A;  3FB7 C;  1MA1 A;  2AHZ A;  5LP6 C;  5LXT A;  1KC8 W;  1NTZ K;  3KZI E;  2WQY C;  3LDE A;  1SQP G;  2HPC B;  2WPS A;  3M91 A;  2VQF B;  3ZHV A;  2NN4 A;  3DC5 A;  2OTL P;  2XHB A;  2H88 C;  3H1K E;  1ZWI C;  2OYH C;  1HP8 A;  1LWU B;  2FXP A;  1GN4 A;  4JI5 B;  2IBZ D;  4JI0 B;  1HTL C;  1X22 A;  5KHK A;  1OVV A;  4ZKI A;  1Q5O A;  2K9J A;  1ROP A;  3ZRV A;  1Q6I A;  2VRS A;  4WY4 D;  1URF A;  5LMN B;  2QWR B;  4H37 A;  1LT1 A;  2VRZ A;  5APT A;  4YY3 O;  5EC1 C;  4N23 A;  3S3X A;  1X59 A;  4DV3 B;  1XL4 A;  4MVZ A;  4I55 B;  4NXM O;  1KYO D;  4JV5 B;  1K8A W;  1FJG B;  1PNL A;  1XI1 A;  1BE3 H;  2FTK A;  2EUL A;  2H8P C;  2Z5H A;  2XNX A;  4A5U B;  3T1H B;  4QJF B;  5KLV H;  1HBW A;  3H6P A;  1E1Q G;  1CXZ B;  4EB6 A;  1S76 D;  3E22 A;  1KYO F;  3MUD C;  3GHG B;  1K5S A;  3HD7 C;  1JQ0 A;  1ZTE A;  2CUG A;  1JOY A;  1ZL8 B;  3Q5P A;  3PP5 A;  1VQK P;  5CCH A;  1M1J C;  1YQ4 C;  4IHJ B;  3CD6 P;  1D5A A;  4X62 B;  5B1N A;  1VQP P;  2NPS C;  2KS1 A;  3S1K A;  1Q3E A;  2NR5 A;  3GB7 C;  1NTM D;  1KQS U;  3E89 A;  5CA1 A;  2P4V A;  4GLX A;  3EWK A;  3MHV A;  1OW7 A;  1YVW A;  2F1M A;  1KIL B;  4NTY A;  2FXO A;  2Q6A A;  1YTZ I;  1AJY A;  4MVS A;  1VQK V;  1JY3 P;  5GTH H;  1XDC A;  1ZLZ A;  4YJ2 A;  1LUW A;  2GUS A;  4F6E A;  2ZXE B;  3B8N A;  4DV4 O;  2H3O A; 
#chains in the Genus database with same CATH homology
 2O01 J;  3AE5 C;  4H0L D;  1DD4 A;  3S9O A;  3GMA A;  1PL5 A;  2E74 C;  1MKM A;  3GLM A;  1GMJ A;  3Q3D A;  2V7Q J;  4H13 D;  1PV3 A;  2BEQ D;  4H13 C;  4H44 B;  4U7J A;  4KT0 J;  3IAO A;  3SFD C;  2MKV A;  3RK3 E;  2G8Y A;  3AE1 C;  1KIL E;  2YIU C;  1VF5 D;  3AE7 C;  4OGQ B;  2YMK A;  5L8R J;  1IK7 A;  1YQ3 C;  2QJK C;  2D2C D;  1NYH A;  2JP3 A;  3GF3 A;  2P10 A;  4PV1 C;  1S5L X;  5KLI C;  3LW5 J;  4OGQ D;  4R4L A;  2WPV B;  1PIX A;  2E76 B;  3Q1M A;  1VL2 A;  3H25 A;  4I7Z B;  1OW8 A;  4YTP C;  2WQY C;  3AE9 C;  3Q2Y A;  4PV1 D;  4H13 B;  1Y9B A;  1ZOY C;  3AEF C;  1ZRT E;  3AE4 C;  3SFE C;  2H88 C;  2QJY C;  4H44 C;  2FXP A;  3FGA D;  3AEG C;  3R4Y A;  3AE2 C;  1R8E A;  2K9Y A;  2BEZ F;  1HF9 A;  1U57 A;  2WSC J;  1KOR A;  5M1B A;  4PV1 B;  1EXJ A;  4GDO A;  1FDO A;  3G9R A;  4TT3 H;  4R4M A;  1VF5 B;  1FDI A;  3AEE C;  2WSF J;  2QSI A;  3Q5S A;  2E74 B;  1NGM B;  2QIW A;  3AEA C;  2ZT9 C;  4Z1M H;  1VF5 C;  1KTM A;  2NZ2 A;  2D2C C;  2E75 C;  2FBW C;  2J5U A;  3B71 A;  2ZT9 B;  1S1C X;  3T97 B;  3C8V A;  2G3A A;  2WSE J;  4OGQ C;  1WMK A;  4RKU J;  3Q5P A;  1UIX A;  3D71 A;  2OQQ A;  2H89 C;  4YXD C;  1ZP0 C;  3AEC C;  1OW6 A;  2QJP C;  3Q5R A;  3O6Q A;  1YQ4 C;  3D6Z A;  5KKZ C;  3RL0 g;  4I7Z C;  4IL6 X;  2E76 D;  3GF7 A;  2IDB A;  3IN6 A;  2E76 C;  1K05 A;  1ZME C;  1TU3 F;  2E75 D;  4H0L B;  3AE6 C;  4Y28 J;  1JB0 J;  1K04 A;  1Q90 D;  3AE3 C;  2D2C B;  3D6Y A;  2ZT9 D;  3AE8 C;  2E75 B;  3AEB C;  3EWK A;  1OW7 A;  1RQV A;  1DIP A;  4H0L C;  1EXI A;  2JO1 A;  1OMI A;  3AED C;  1KQF B;  1AJY A;  3ABV C;  1DD3 A;  1RQU A;  2E74 D;  3D70 A;  2FYN C;  4XFJ A;  4H44 D;  1HJ0 A;  1KQG B;  1KMI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...