4H44B

2.70 a cytochrome b6f complex structure from nostoc pcc 7120
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
160
structure length
160
Chain Sequence
MATHKKPDLSDPTLRAKLAKGMGHNYYGEPAWPNDLLYVFPIVIMGSFACIVALAVLDPAMTGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLAMASVPLGLILVPFIENVNKFQNPFRRPVATTVFLFGTLVTLWLGIGAALPLDKSLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 43
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h44B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h44B01
1VF5B 2E74B 2E75B 4H13B 2YIUC 4H44B 2FYNC 2QJPC 2K9YA 2ZT9B 1S5LX 5KLIC 1Q90D 2D2CB 2QSIA 4Y28J 2WPVB 5L8RJ 5KKZC 4IL6X 2E76B 4RKUJ 4OGQB 2O01J 3C8VA 4KT0J 4H0LB 2QJKC 2QIWA 2WSFJ 2WSCJ 3LW5J 2WSEJ 4I7ZB 4PV1B 1ZRTE 1JB0J 2QJYC
chains in the Genus database with same CATH superfamily
3TETA 3FXDA 1DTOA 3CX5I 2Y0EA 2EJ7A 4D6TJ 1AJNA 1VQ7V 1AVOA 2KG7A 1XNRB 5B3SC 1HVVA 3E83A 3BCCJ 1XTCC 5APWA 4L76A 4Z1MG 1HGZA 2ZXWC 2K1AA 4GYCB 1M1JB 1J95A 3MP7B 1NO4A 1THZA 1XREA 3HKCA 1FXKC 1H2NA 4UCUA 2VQEO 4X64O 1S0VA 1BGYJ 1WP7A 3RK2C 1SQBK 1JVMA 4P9OA 1PPJD 1WP8A 3M99B 2KKWA 3MAQA 4D7TA 1P84I 3TGUJ 1IURA 1FS0G 3OE7G 1GM8A 4JTCB 5FL7G 5KTBA 1VL2A 5AW9B 1SZTA 3G3ZA 1ZRTE 4N6JA 3K5OA 3TJTA 1EN6A 1NJIW 2XUMA 2UXCO 2DJVA 4JI4O 2ZVNB 1VF6A 2LP7A 1JJ2U 5ITZB 5LYJA 1DEBA 2E5TA 3UO2A 5LHIA 5APVA 1L4AD 5BY1A 3NTNA 1LTSC 2Q7GA 3S4RA 3HE4A 3BA9A 3RK3C 2GV9A 1SC5B 1W2BU 3OR7C 3T4ZA 3II6A 2IJKA 4I9WA 2JWDA 1Q82Q 3GWKC 4LF8B 1GU5A 1QU7A 4GKJO 1SFCC 4WBNB 5CCHC 1WNSA 4H44C 1DH3A 1QL2A 2AXTE 3KXDA 2LFSA 4KFMA 1GK6A 1WT6A 4JI0B 2HYNA 2FY8A 5JWPA 1YQ3C 4BRYA 1J1EC 3T1YB 2M5AA 3CD6P 1NTZH 2M3BA 3BABA 1U7MA 2L35A 1KB9D 1NYHA 3G6BA 1URQC 1BCCE 3BA8A 2Q3EA 1N33B 2JGUA 1W0JG 5EC2C 1JY3N 1BE3D 2K9JA 3A0BE 3CCJV 1K7DA 2AHYA 1QR8A 1E79H 1SQVH 1NU1E 3B8NA 2YMYA 2Y0IA 4U7NA 1VQNV 4B3SB 2KOGA 1NKDA 2R44A 5A9GA 1NKNA 5IWAB 2DYRC 1UIIA 5KJ7D 1X59A 5EC1C 2UXDO 2YXYA 3OMNB 1L0LE 4IIJB 2B89A 4EYYQ 2QKCA 3A0HH 1CZQA 3E89A 4EDFA 1USDA 1KECA 1LWUA 2V4DA 4KP4A 2ZQMA 3JALB 4YXWG 2ZKOA 2RH0A 2YXLA 4FZ0A 2WLMA 3H1HJ 3LNMB 3OFNG 1S9KD 3U10A 3QNEA 3WU2H 2Q8VA 2RN9A 1L8DA 4ICGA 5APQA 1KC8Q 1VQ7P 3CSXA 1ZAUA 3DTUB 2Q7EA 5B1AC 3ZMVA 2OTLV 2CTRA 2X7RB 1KU9A 2XOKG 1JQ0A 1SA0A 4DV0O 3LIDA 3IC7A 1LTJB 2RKLA 5H6RA 4PA9A 4UFZA 1OHHG 1E5WA 3L36A 3P30A 3FAVA 5GTIZ 1GN4A 2GHYA 2GTSA 2ZYDA 1IX9A 2QRXA 4OX9B 4LF4B 5KLVG 3L72G 4BR6A 3LSUA 2XAQA 3OEHG 1EXIA 2N9YB 4JI5O 2P2UA 5C93A 3N7NA 3R2PA 2PY5A 1Y74B 4J7JA 1BL8A 4LFCO 1Y4MA 3CPWU 2Q0OC 2EINB 4JZ2A 2X0LA 2EIMC 1WPXA 1XL6A 1FDOA 4JTAB 2BCCG 1M93A 3VQYA 4GLXA 1IZNB 1KILC 2G8YA 4RWUA 2QKAA 4RKUJ 2OYHC 5LGUA 4AI8A 1LTGC 2IDBA 1OIPA 4DR2B 1OCOC 2N74A 4YY3O 3GLMA 4J7KA 2EULA 1RF0A 1PL0A 1BT8A 3QO5A 3CXHH 1NVOA 2YXHA 5JQGB 4BIZA 1RE3A 2O1JA 4RO0A 4TT3G 3OGIB 1JFFB 4TV9B 4P9PA 1NU1K 4DV6O 1NTKJ 2ZXEB 2CPSA 3MIWA 4U3FE 1M57D 5AVWB 1RY3A 1M5IA 1AFOA 4CH6A 2O01J 1K73Q 4NPEA 1FKAO 2N9BA 2GBOA 2GDSA 2IPPA 4JI1O 2ODMA 1Q6IA 3R65A 1X0TA 4MVMA 1G2CB 2QE7H 3CCJP 4TQDA 2GUZB 3B40A 1L0LK 5EIBD 4BIUA 4NXMO 2SPZA 1VQNP 4XDJA 4ZNCA 4TOIA 1NTMJ 5GTIE 1JY2O 2FB5A 3MHVA 1IBKB 4DR1O 3E1IA 2WLHA 2WSSG 3SYPA 1SP4A 2IFMA 3L9DA 1QL1A 3VP8A 1SQQD 4MVOA 4WFHA 2WZ7A 3UKMA 1N73C 3D36A 2FKWB 4PD4I 4HYOA 3RK2D 3HKCB 3E86A 2PAJA 3K04A 2WSEJ 2ZVOB 2QM7A 5CA3A 3H1IH 1FZCA 4X1KA 5LOVA 5LHHA 1RQVA 5H9CA 4QE7A 3O8ZA 1BSMA 2CGOA 3G9RA 3FD9A 3BCCG 3SWYA 5LYJB 1GAXA 3SYQA 4X62O 5D5QA 4O2AA 1KYOH 2VQEB 2CE4A 4H0LC 2OYHA 3QVNA 1BGYG 4X20B 4O4HA 2W6JH 1MFTA 2BTOA 3FKSG 2IJJA 4WVZA 2P10A 3J7AU 3TGUG 3JSVC 2HPCA 3K08A 2W27A 2ZE5A 3GG2A 3WUUA 3KKYA 1SS1A 4I6MC 2Q69A 4QPJA 4FM2A 2EIJC 4H44D 2QKSA 3QWOC 5DM6V 4JI4B 4HNAA 4ZI7A 3L71E 3MUDA 4EEQA 5D5PA 4FLXA 2IBZI 2CTQA 3RBXA 3IC9A 4BRYB 1GL2B 4GKKO 2FYUE 1QLED 2YI8A 2BOCC 3H6PA 4LF9O 4PJ0H 4CS2A 1Q5OA 3JASA 4JZGA 5IYDO 4DUZO 2YEVA 1H2MA 1NT2B 3ABUA 2K9JB 2YO3A 5CCGA 3RYIB 4YIPA 1QGKB 2QJKB 3MZWB 4J41A 1VQ6P 1HNWO 1H2KA 3F5WC 4NTYA 4LNUA 1NHLA 1X8YA 2E43A 2WPVB 3RGUA 3ASOC 3VQWA 1DD4A 1M9NA 2F23A 1MSWD 4EFBA 5EBMC 3SGIA 3TK1A 3FB6C 2HLDG 2E74C 2GA1A 1LWUB 3F5TA 1QVGU 2CAZC 1EN4A 3NXSA 2I8DA 1K8AQ 3W7WA 2QTOA 2UUCO 1G4YB 1G1IA 1RF1C 1K4DC 3SJBC 1KQLA 1X9VA 1XBLA 4TLFA 2Z5UA 4XDLA 5CA1A 2XNDG 1YJ9V 3CRMA 3HD7A 2UXDB 1AJYA 1V54B 3AE9C 3L75G 5GONA 1SA0B 1VQ9V 2R32A 2R3CA 4B08A 1O9GA 4FJCC 1B3QA 3ICXA 3VMYA 5KAFH 5KKZB 4YIOA 1AR4A 2NPSC 4ASUG 2DYSB 3FAVB 3H1HG 3HTKA 4O4LA 1NAYA 2HJFC 3ZBHA 3OEEG 1SQBH 1XMQO 1S3JA 1SQXJ 2P6JA 5LGNA 4AILC 1P7GA 3MHHC 5LMUB 1L0NG 4OXSA 3OTOO 3O6QA 3L73E 4U7OA 5B66Z 1QLEB 1I94O 1Y76A 4Z2WA 3HE5B 1Y6XA 2XAGA 1PV0A 1TUEB 1EZVG 4X66O 2P4KA 5TJHA 3EVKA 3H1JE 1VQ8V 2Y0PA 1SQPE 2FYUK 2HODA 2C9NY 2YICA 1P84H 3M91A 2RMZA 4LCUC 1Q8IA 2DWDC 4JASA 3B8EB 2OT5A 3S3XA 2ZINA 4PJ0Z 4JI5B 3L74H 2JO1A 1NR1A 4LFCB 4JV5O 2F1MA 1YEWA 3R4YA 3SJQC 3CWBH 2Q0AA 4UCRA 3AG1B 1GM9A 2A06D 3CCVV 1W59A 1HJBA 1KB9I 2C2AA 3ABKB 3OAKA 4I55A 3AEGC 3QF7A 2IBZG 2WLIB 1S72V 3H1IE 3LW5H 5EFWB 3C3TA 1PP9D 1ZW0A 2XAHA 1TUBB 3RT3C 4WCEV 1ROPA 5CCGD 3L70H 3U59A 2KYVA 2A0LA 1VQKV 3H1KD 3AG2B 4UXNA 3W7UA 4O2BB 1JM0A 1JX9A 1KYOE 3V4QA 1FZEA 1JY2P 2G38A 2ZR3A 1FS0E 4WFEA 1HW7A 5K1XA 2EILC 2QTSA 4J9ZB 1IZ3A 4GKGA 4R4LA 2NPSA 5B66E 4LFAB 1EN5A 1MSDA 2BTQB 3P3PA 2ZT9B 1WAZA 4N78D 2ZDIA 1M90W 2KSJA 3H1LG 4JI0O 4NXMB 4OWFA 4UCOA 3CC4V 2FL4A 2L6LA 1FZCB 4X1KB 3VBBA 5LOVB 3T1YO 1NTMG 4DR1B 1RHZB 1TGOA 4N21A 1YJ9P 1G8MA 4E4EA 3H25A 3M0DC 5KAIZ 3DXRA 4Y28J 1ZLZA 4UVBA 1EDIA 2ZYAA 3HD7D 4PJ0E 2QM4A 1VQ9P 3E8FA 4H0LD 4O2AB 4FFKA 4DO2A 2ZXXA 2F93B 3K58A 4O4HB 2KZIA 1KUQA 3BPZA 2IH1C 2WAMA 1O9HA 4P2ZA 1HH0A 2ZE6A 3USSA 1BDDA 4D6TH 1BCCD 2KLUA 2HPCB 2JRIA 1A02F 2P67A 3APQA 1PPJG 2FFDC 4G27B 5IYZA 1GD2E 4ZKPA 1HDJA 2R9AA 4NXNB 2FXMA 1T3JA 4K0KB 1SS3A 1NU1D 2JKVA 4ZI7B 1SQPK 1QCEA 3PN1A 3CC2V 3Q5PA 1SQXK 1AJQA 5APTA 1Y67A 2NR5A 1SETA 1ZX3A 2ZE7A 4PI0A 1LT9C 1NZ6A 3CRQA 4W4LA 1MA1A 2HP8A 3A2FA 3BY6A 4KJMA 4WB4A 4FMTA 4LH7A 4Q6GA 3Q5RA 3L75D 1Q86Q 1VQ8P 3GMAA 3P7KA 2WLLA 1AR5A 2VRZA 2YEVB 1H0TA 3ZMUA 1WPBA 1KBHA 2AXTH 3S1KA 1EXJA 2ITDC 2R9IA 3R66A 3S3WA 2VWJA 4WY4C 3BVHA 3B71A 2CTWA 2D2CD 1PM9A 1AROP 3ABMB 3HUSC 4IL6Z 4GKKB 2ADQB 4GX5A 4WFGA 5CB4A 3KCYA 3ZN1A 3IJ4A 5KAFE 3CCVP 2V4HA 4G2KA 2Q67A 1R3KC 1NH2D 1LP1A 3HKEA 4LF9B 2W0XA 4PV1D 5KAIE 1T2KC 2IZ0A 5B1BC 5CN0A 2WSCJ 2AZ2A 2E74D 3L72J 1S72P 1U97A 4LF4O 5CBFA 1JTHA 3ETQA 4LWSA 3SPIA 2L91A 4JQ0D 2P1JA 2QJPC 1EDJA 1HNWB 3TCUA 1VQKP 3K57A 2PP6A 2BCCJ 3CX5E 1B04A 3TXSA 4DV1O 1BE3G 1J5EO 5CJ0A 1FZFA 1L0LH 3HPLC 1YJWV 2IH3C 1KN7A 3HD7B 3MTUE 4QGPA 4JYYA 1D7MA 2Z0AA 4IFMA 1Q7YW 1VQ4V 1CI6B 3ZRWA 5KLVE 1F51A 2KSEA 4W7YA 1YTZI 1FDIA 4K8XA 3AEFC 2KXPB 2VWKA 1P84E 4JAUA 2NPSD 4MN4C 2WLKA 2HFEC 4FLUA 1FOSE 1FXHA 1JR9A 4KL1A 1ZMEC 2JDIH 2R5DA 2F66C 5LXTA 4O4LB 3HTKB 3CC4P 3L74E 3FWLA 2YIDA 1LT1A 3ITKA 5KLIC 2QWPB 3CWBE 2UXXA 3E2EA 1TU3F 1PD3A 2QSAA 4K8ZA 3CX5F 2KI7B 1D2DA 1JY3P 1Y8AA 5L3EA 1BSHA 1N34B 3O6QB 2XV5A 3K5NA 1Y76B 3WB1A 5KHHA 5DJTB 3AG3B 2UXBB 2CK3H 1UFIA 4PD4H 3VOUA 3IGAC 1WRGA 1LTAC 4ZOLB 5LA6A 2H3OA 3L70E 2YIUC 1AP6A 2J59M 1IBKO 2HODB 1P84F 4HBNA 1FOSF 4N23A 1R3IC 1XMQB 1I0HA 3CCEV 2VQFO 2D2CB 2KB1A 3NFQA 3OTOB 1F23A 3SSUA 4Z1VA 1USEA 4ASVA 3ETEA 3CC2P 4DT0A 1I94B 3ASNB 2RJZA 1AV1A 1NH2B 4BWNA 4JAAA 4L8JA 1EZJA 2Q7HA 4X66B 1CW5A 2ZM6B 1PGQA 4I55B 1KD1Q 2W83C 4GDOA 2BSKA 1K33A 4IHJA 3JAMN 1AB3A 1GL2C 4ZMDA 1N4CA 3Q4HA 3SWKA 1S76D 5KHKA 2Y0CA 3CC7V 3JSLA 3K5LA 1IXMA 1PP9J 1IFJA 4JV5B 5CBNA 1N32O 3AG4B 1MNGA 1NI8A 2CGNA 4U3FH 1S1CX 4DJGA 1M56D 3FB8C 4LF5O 1LTTC 1QBZA 2DW4A 3H1KJ 3V2QA 2OIGA 1OCZC 2FKXA 1R5LA 1NTZD 1ZOYC 3LUTB 5AVYB 1K5SA 4I7ZB 1OJHA 3WFVA 4D6TE 1Z56A 2WTYA 3BCCE 4KXRA 2XTAA 2H8PC 3U1CA 5GTIH 1JMMA 1YHQV 3VP9A 5KLVK 1DF4A 1YF2A 1SQVD 4BWAA 2JWAA 1BHAA 1NTKH 4YTPC 1IO4A 1VQLV 1HTLC 4RO2A 3F5HA 3I5DA 1YJWP 2O01H 5IJ0A 3A3YB 3CPWO 1VQ4P 3M8AA 3TNUA 3FXEA 1HNXO 2QJYC 1I5YA 2Q6AA 3ABLC 1SQQG 3CB2A 2AHZA 1YVWA 2KS1A 1FFTB 3STLC 3OAAG 4PHZA 1QQCA 5TISH 2XNXA 2GM4A 1KFNA 4R6ZA 3D6ZA 2CH7A 3ZHQA 2DQ3A 2HHHO 2LGWA 2YI9A 1H8EG 2YIBA 4Y99B 4GX0A 2A3QA 1RM1B 3GHGA 1I08A 3K06A 1SQGA 1PV3A 3MDSA 2OYIA 3I56V 2FMLA 2A45H 2WSFJ 5J2TA 4ABMA 5AVSB 1R6KA 4R50A 3E8HA 4B3RO 2WSEH 2I1KA 1SZXA 4PA6A 5APYA 4FFBA 4JPZB 1PFIA 1FFXB 2B9ZA 4J7ZA 2JEXA 3L75J 3CCEP 3E22A 4OGQC 3CRRA 5AVQB 3L71H 1FXKA 2E76D 4PA4A 4LF7O 2POHA 2QWOB 1EDLA 2FYUH 3E1RA 2Q68A 5J9PC 3BATA 4I4TA 1M56B 5IE9A 2HEPA 5CB4B 4BW9A 5KHJA 3VQVA 4H37A 4FM0A 2JGDB 1MMMA 4X1YA 1IJDB 5AVRB 1T2KD 1LP1B 4E2LA 1GU4A 3RL0C 4B86A 2E75D 2HJDA 5L3CA 3JATA 4RQEA 1N7LA 2QEXV 1YZBA 1R3LC 4DR6O 4DCKA 4UV9A 5LHGA 2Y69C 4LWSB 1L0NJ 3CS5A 3HKBB 5EK0A 5LMUO 1N8RW 3WG7B 1L4AB 2EIKB 4H33A 3CC7P 2KIKA 1MKMA 1GO3F 3CRCA 4DXWA 3SYAA 3CXHD 2IYPA 1WJZA 3STZC 1UPGA 3T1CA 3BAAA 1K3EA 1F7YA 1ZL8A 2OYOA 3MGNA 2UU9B 2R5BA 4PD4E 1VF5D 4UB6Z 4I0XB 1SFCA 5CCHA 4H13D 1KB9H 2HFED 2OTJV 1K9MQ 2BOBC 2YUAA 5FLXN 1RPRA 3LIEA 1ZTEA 1GN2A 4O4IA 3C90A 4X1IA 1YHQP 1Q90D 2XT9A 4F4LA 1MUUA 4DV1B 2ILMA 2W6AA 1VQLP 1WA8B 1YSCA 4Q20A 1N86A 3H9VA 2C9LY 1URQA 4TUYA 1J5EB 4BW5A 2ITAA 1XNQB 5IY5B 4A7PA 1U7JA 1BMFG 5KA6A 5TISZ 3ABVC 4BIOA 4YXDC 4GOFA 4D7SA 1LTIC 1DEEG 4PD4F 2KP8A 4J9YB 5AW8B 3D6YA 1SESA 3X2QC 2Q9LA 5LA6B 1ZWIC 4YJ3A 2KK7A 4MSWC 3AK2A 3SJCC 2HG5C 4X9QA 4MS2A 1H38A 3D70A 2AW9A 2Q7CA 1JNMA 2O01N 2E76B 4OPHA 3L73H 2YIBD 4F6RA 2IBZE 4B7EA 3RYCA 1H89A 2FYZA 2UUAO 3N4XA 3B8MA 4FLWA 4MVSA 4J80A 4LFAO 2YS8A 4EFEA 4U3JA 1KYOD 3H1LJ 3H1JH 1N7SC 4LR3A 2E75B 3P8CE 3TSIA 2WT7A 1SQPH 3ZX6A 1Q82W 3KYQA 2OCCC 3OTFA 4UB6E 1SQXH 4IHJB 1PNLA 1RFYA 1NTKE 1QVGO 2KG7B 4LFBB 3Q4HB 1WB8A 5LP6C 1RE4C 2GUVA 3IF4A 4HJGH 2VQFB 1OZHA 2WITA 2Z5HA 5CBOA 1Q81Q 4MTGA 5CA0A 2UWJE 4RUFA 5IT9N 1IFDA 3GF3A 1LGHB 3VN0A 2LXCB 1FXVA 1OW7A 3AE1C 3ML0A 2Q1KA 1M4UA 3LDCA 3ZJZA 1NTME 3T97A 4H13B 1AVYA 5FPRA 2YKQA 4CS3A 4I9QA 2QEXP 4LF6B 3MHSC 5CBGA 1BQZA 3BRTB 2WPQA 4DR5O 4Z1MH 1SF9A 4NXNO 2A06G 1EZVI 5TISE 1NTZJ 4K0KO 2OTLP 1CXZB 1IFIA 4DR4O 2QA4V 2N1TC 3F7YC 5DEDA 1KILA 2LJ2A 3AK3A 4MVRA 1PP9G 5A2QN 3RK3D 1G1XB 1OCCB 1N32B 3HE4B 1IBLO 4L87A 3CCLV 4LF5B 1SQVJ 3CCSV 4DW0A 5CBHA 3VTPC 3H1KG 2ZYGA 5IJ0B 1Q6HA 2ZAEB 5B66H 2CDYA 1SFCD 3OW2O 3ETGA 3JCZA 2QWRB 4DV7B 5CCHD 1OMIA 4LLHA 4UCVA 3V6IA 1J2JB 3SYOA 2KS1B 1S5HC 2LGQA 3M7MX 4YHHO 2W90A 1M57B 3E8BA 1KC8W 2M5AB 4NR1A 3HRNA 5IDJA 2B1GA 1URQD 5AVXB 5LBQA 4JBZA 3W7SA 3HB3B 4ZBMA 2OYIB 1FJGB 2EZOA 2AZ0A 1HNXB 1R73A 4WBAA 4NB5A 5AW3B 2KNCA 4ZHQA 1LUWA 5BMVA 5KHGA 2WVRA 2FYNC 2NLJC 3CCMV 1BE3J 3FX7A 1H2GA 2BEQD 4FFBB 2R72A 5B3SB 2J58A 3KHUA 1N73A 4TV8A 3VOPA 1NAFA 5GTHH 1SQBD 3E22B 2P7TC 2HHHB 2H7HA 2WLJA 1FXKB 2ZNJA 3RK2B 2B87A 3AEIA 3B5NC 2MW2B 1BCCG 1EFRG 1T6AA 4N3YB 1NTKK 3A8TA 1KB9E 4I50A 2XU6A 4JI8B 4DRXA 4B3RB 2JIZG 4X1YB 3RL0D 1NU1G 5H2FZ 1F4MA 1SLQA 1XTGB 4JGSA 1HGVA 3JATB 1CSBA 2NRGA 1M1KW 3AE3C 4CC5A 4IGGA 3DC6A 4PELA 4GZRB 4JI3B 2N05A 1P84D 3UT5A 1NTMK 2H94A 1QLNA 3EWKA 1B6QA 4YXWH 1S5LH 4OVNF 1N34O 4LF7B 5EYPA 3C8VA 3RK3B 2HVJC 3B09A 1TVKA 3L74D 1WMKA 1SERA 2UXBO 2AEFA 4XA4A 3RN4A 3D71A 3CWBD 1GDTA 3FFQA 5KAIH 3RL0g 5L3FA 1TAEA 4X89A 1IFPA 1K73W 2OWOA 2IZ1A 1M1JC 1SFCB 1VPCA 1Q2NA 5CHXA 3LNNA 1T5EA 1KB9F 2UXNA 4H44B 5JH7A 4DR6B 1JY3O 1ZXGA 2KUBA 4IFDK 1S9KE 4NYKA 4A5UB 3WMM0 3G71V 3JAWA 3CX5H 1J1EB 5L3BA 4O4IB 2QA4P 4X1IB 5KMGA 3OW2U 2JS3A 4I7ZC 3SPGA 2XAJA 1KILD 1LTBC 2AGAA 1URQB 3T1HB 3CCLP 2ZM6O 2WWWA 2JK5C 3JD2A 2WSCH 2OARA 3CCSP 2Q9IA 5KLVH 3L72H 1MZFA 4FLZA 1JCCA 4BAYA 1VARA 2QJ1A 1QEXA 3UIAA 5IJ9A 1SQXE 5AVZB 4CH4A 2IM9A 2V7QG 1QHTA 3EFGA 1R3JC 2BCCH 5H2FE 4XFJA 1GK4A 1JOYA 2LO1A 2MK3A 2EX3A 4MW3A 3W7TA 3HKDA 2ZIMA 1Z2GA 2YXQB 4NPDA 4DOJA 2OIEA 4FK5C 3BEHA 1S4XA 4F6RB 3ETDA 5B5EZ 2YDEA 3LSQA 1CEZA 2PFXA 5H5NA 4IL6H 4TSFG 3SYCA 2HVKC 1Q43A 4FLVA 1VQMV 4DV5B 5EZYA 2GUSA 3JAKA 5GTHZ 1RF1A 3H32A 1PKXA 3K5MA 4TT3H 2K9YA 1J1DB 1JOCA 1Q7YQ 3OR6C 3D8CA 3CCMP 5APUA 2OGUA 3CCUV 3UCSC 1BDCA 5B1AB 1ZRTD 2O1KA 3P8MC 4D6TD 3BFRA 2ATKC 5B1OA 1HR0O 4I5SA 4JTDB 2P58A 3OT7A 5CA0B 3CYOA 1AJPA 1AP5A 2UUAB 4JI7O 2A7WA 1SQQJ 2JR8A 2JS5A 1S77D 1KV4A 2HR3A 3CHXA 2YNYA 2WSSH 1E1RG 4JYBA 1GW4A 1S5LZ 3T97B 3KG2A 4GIFA 3IFXA 3G6EV 2B9BA 1ZUQA 1YQ4C 1WN7A 2EIMB 1KP3A 3CXHI 1KILB 4RJTA 2IW5A 2OYHB 5F2VO 1WLEA 3CI9A 3C1LA 1XILA 4UCTA 2N04A 1R6TA 3M9HA 1BS3A 1L4AC 2EIKC 1YJNV 2A9HA 1LTJC 4JPRA 1BHBA 3BCCH 3IAYA 4DR5B 1K8AW 4R7CA 2P90A 1CP9A 4AYCA 1MZEA 1PP9H 1NTZG 4F6EA 5GTHE 4HNAB 1BGYH 4DR4B 3P3NA 3ZHVA 3JSNA 4U7JA 5APXA 5FPOA 3O65A 5HFMA 4HZ3A 1H2LA 3TGUH 1IBLB 1E79G 1TA8A 1BZKA 1SQVG 3JASB 2LKMA 1L0LD 2EINC 2Q4PA 3N2KA 2O57A 3QH9A 3JYCA 1NR7A 4JI2B 3BRVB 5DJUB 5E79H 4KUMA 3N2GA 1N0JA 4B7KA 4RAIA 5BMVB 2K1EA 1UIXA 2LW7A 4HB1A 1S5LE 1NJIQ 4LNUB 5LMNO 4YHHB 1VQOV 1N73B 2LFRA 4TV8B 1T3UA 2UU9O 1GTOA 4JI6B 2ZNIA 3V5BA 1X79B 5DECA 2B87B 3ZDMA 4UVAA 5E1AC 2JEEA 1SQBJ 5KJ7C 3RVYA 5BR8B 1VQMP 4XDKA 4DRXB 2K9PA 4IIJA 2FXPA 4GUNA 4PD4D 1RSOA 3D3QA 4RQFA 5EBWC 3ZHRA 3GB7C 5LGTA 3CCUP 3M0DA 1N0NA 4UVCA 4B3MO 3CJHA 1PGPA 5CA1B 3FGAD 2F4VB 3UT5B 1XNQO 2IFNA 1OVUA 1GW3A 1PNMA 4H0LB 5GONB 4FPPA 5EYPB 3L72E 1TVKB 4DK0A 4HH2A 2AEJA 1ENVA 2B5UA 2XDJA 4PA7A 3BVOA 2XHBA 5KHIA 1LTJA 3L74J 2XNDH 1KKDA 2FFDA 1M8OB 4O4JA 2BCCE 1EQ7A 4UB8H 1SQQK 1QVFU 3W67A 3L75H 2RMKB 4LBEC 3G6EP 1V55B 1MV8A 1JY2N 3OA7A 1H2SB 3GF7A 5KMGB 3KCXA 2Z4EA 1LT9A 2K3RA 2YXRB 3UM7A 3H1HH 1IK7A 4IL6E 2EZPA 3QTCA 1KKCA 4LH6A 2M7WA 4DW1A 4XE5B 1VEWA 1NH4A 4U3FD 3T2MA 5JJJB 2KZJA 1NS1A 3CRAA 1VQPV 2MJZA 1YJNP 4AHCA 3ZS8C 4WY4A 1L0NH 2F95B 4MW8A 3K9SA 3GWOA 2PI5A 1R1BA 4C7UA 1FD9A 4LFBO 3S9OA 3M0AA 4JYAO 5HFLA 3SPCA 2R3SA 2BE3A 4RESB 3PH0A 2C0WA 3SPJA 2Q6QA 3HUSA 3P8CD 2IJHA 1VP7A 4NVPA 1EZVH 3ASOB 5CJ4A 1JO5A 1NWQA 3CMEV 4HAMA 4WF9V 4DK1A 5E79Z 1NTKD 2QE7G 4PV1B 3WUTA 2E74B 2CUGA 3FB5C 4P30A 4X88A 4LF6O 4TV9A 1EM1A 1COWG 2QM8A 1H8HG 1NVPD 5EZYB 3JAKB 4LGDE 4TWKA 2QSIA 4PI2A 4ZKUA 4EOTA 2DN9A 5KUMA 4DV3B 2F43G 4L74A 1YCIA 2IBZH 2QJKC 1H88A 1UJWB 3M9QA 2EBOA 4DR7O 1KORA 1URFA 2YSUB 4X65O 1FJKA 2A06E 4DV7O 1IBMO 3H1IG 2NPSB 1IC2A 1Y47A 3TYYA 2W6IG 4CBCA 1YIJV 1FZGA 4FVMA 4W4KA 1Q86W 3ZCCA 2FTKA 3N27A 3RFRA 3MD0A 4CH5A 1YYCA 2ARHA 4UB6H 1PP9E 3VMAA 3V2PA 2QR4A 3A0BZ 1BGYE 4HYTB 1AILA 4IL6X 1LWUC 2PYLA 2P5OA 3H1KE 3DXRB 3NR7A 3OUFA 5AW1B 3TGUE 2W6JG 3OGCC 1DX7A 3H01A 5K5GB 1HR0B 4W80A 1JPXA 3IN6A 4IOIH 3L71D 3ZHUA 4UB8Z 1AI4A 1FJGO 1PIXA 4JI7B 2BASA 3H1LH 1X22A 2FYUD 5AW5B 5L3GA 4EIJA 1NTMH 4L75A 5E79E 3SJAC 2Y9YA 1ZSPA 1V54C 4KHPO 4CC6A 4X20A 3PP5A 4N78E 1AVMA 2E3CA 1YXBA 3WB2A 1SQFA 5IYZB 5KKZC 5BZBA 1BSNA 4K35A 3UQ8A 2PGGA 2DYSC 1BCCJ 1NKZB 1S2EA 5AW2B 4EI2A 1JEKA 5B1NA 1PNKA 3B4SA 3V2RA 5BVZA 4RUEA 3PJSK 4JI8O 1NU1J 3KZIZ 1OVRA 3SDLA 1FBMA 1PPJH 2H43A 1GZLA 1GL2A 2WLLB 1KMIZ 3F89A 1VQPP 1H0TB 2MKVA 4QIWF 1LNQA 3N2KB 1NVPB 1QLEC 4JI3O 1OX3A 4WY4D 3D3IA 3ZMTA 2WA4A 1L0LJ 3N2GB 3RVZA 3JARA 2YO2A 3CCRV 2PI4A 4KHXA 3V4WA 1VQ5V 3ZN0A 3RYIA 3GW6A 1OWAA 2PYJA 1HWYA 1ZLLA 4YPCA 3FYIB 1K34A 5AVUB 3CMEP 4CS4A 2EILB 3DSQA 1RF0C 5KUKA 3HKEB 3CE2A 1KQGB 1G6UA 2VS0A 1RE3C 4UB8E 3B2EE 1IDSA 5JCOC 1JTHB 1AI5A 2ETNA 3AG1C 3L75E 3ZEDA 3FX0A 3ABKC 4HKZH 2KLVA 1F4NA 1RSOB 4I2LC 2IYOA 1U96A 3QG5A 1OV9A 3EHBB 5LMNB 3CJHB 3T1HO 4LP8A 1KQFB 3H1HE 4FM1A 1SVFA 1FDMA 2JJLA 2XZRA 1J1DC 2CPBA 3ZRWB 2ADPA 4M3LA 3AG2C 2V1DA 3L73D 3F7VC 1FYJA 2V7QJ 1L0NE 1SQBG 1YIJP 3AECC 2Y9ZA 1BE3H 3KZIE 3AEDC 5LXTB 1KD1W 3H1JD 2FFDB 3D36C 4O4JB 1X4TA 1SQPD 2HKOA 3Q5SA 3W7XA 3AE8C 1EZVE 4AQRD 4B3MB 1SQXD 2OCHA 2ZT9C 1HJ0A 1BQ0A 3AK1A 1FJPA 3OUSA 1GTWA 1DLBA 1NGMB 4DV4O 2GSMB 1GK9A 2RQ6A 1LT9B 1R5SA 4PDRA 1FZCC 4DV5O 4GCZA 4WFFA 4IFFA 1HBWA 1SKVA 5JJEB 3DC5A 3HE5A 3L74G 1DIPA 3H1ID 4WY4B 2KQXA 4U3FJ 3CWBG 1XQ8A 4UCSA 2OTKE 1FAFA 3HUSB 4J42A 3GVMA 1OXZA 3RYFA 1M1KQ 4AQYO 1AA0A 3I56P 2DE0X 2K37A 4MTOA 1RP3B 2UUBB 2Z5IA 2R9RB 1VQ6V 2DQ0A 5FNVA 5B1BB 2W6BA 1GMJA 1NOHA 5DN6G 3A5TA 2IU0A 3G80A 5JCOA 3L70G 3MUDC 1GL2D 4WFBV 2BSKB 3W68A 1NBMG 2P06A 3P32A 1HNZO 2QJPB 1A32A 2FXOA 3ZRXA 2E5LO 2W8ZA 5H2FH 4JYAB 1GM7A 4ZIBA 4C46A 4DYLA 2WLIA 3CCRP 1Q3EA 2A79B 4WWIA 3FYEB 4NTWA 2QWQB 1VQ5P 1EDKA 1TUBA 4DR3B 2NZ2A 2G3AA 1XI1A 3H1LE 1AQTA 4ASWA 1JB0J 2FBWC 5CCGC 1VF5B 1KP2A 2W0FC 4PDMA 1D5NA 2IU3A 3U1AA 3A0HZ 3G67A 3L37A 4DV2O 1QNMA 4O2BA 1IFNA 3AE2C 1XUQA 3ABMC 1GKFA 2QWNB 1XHZA 3TXQA 2LQTA 1OFCX 2NNUA 2WPDG 3RW0A 2H8PD 3PHLA 5IYBO 2WLNA 3WU2Z 3CCQV 1MG1A 1QR9A 5KLIB 1ORQC 4J10A 3CL3D 5JJNB 3Q2YA 3ZHSA 2BTQA 2RNBA 5GW7A 1L0NK 3SFEC 3RYHA 4DUYO 4UV8A 3BRCA 4IYHA 1L2PA 4OH8B 4DR7B 5J2UA 1OCRB 2X6BA 1XMOB 1PGJA 4PDLA 4X65B 1PPJE 3TNUB 2JP3A 2YMKA 1HF9A 3JD4A 1IBMB 4GOEA 4JI2O 2JJ2G 2OTJP 4D6TG 1NTZE 2Q5UA 4X8AA 1V9PA 4R8CA 2YIUB 3FWNA 3L71J 3HD7C 4NTXA 2ZCEA 3A7OA 4X64B 2FYUJ 5BU5A 4FLTA 1DGSA 1VMGA 2CH7B 2X6AA 1D5AA 1K4CC 4JI6O 1SQVE 3A2AA 1MABG 4FIPC 3GHGB 1Z5VA 1R6NA 2CTPA 1FE6A 3AEBC 1I5XA 1SQQH 1JCDA 1N7SA 3WB0A 5BR8O 3FB7C 5J2TB 1W2EA 3ZMZA 2K88A 4MTFA 3BHPA 4PDVA 4ZKIA 2UXCB 4DZOA 1JUNA 1Z5WA 1V55C 1RPOA 1S5JA 5B5EH 2DW3A 3A0HE 2ZD9A 4KHPB 3Q1MA 1RE4A 5LP6A 1N2DC 1N36O 2ZE8A 2IJIA 2ZXWB 1K9MW 4OGQD 1M90Q 2F4VO 3AG3C 2IX7C 3JD1A 1LUVA 3HR0A 4FZ1A 3WU2E 2WPRA 3JARB 3CX5D 3U11A 1K04A 4I4TB 1DK1A 1YTFD 4GKJB 3SR2C 3BASA 4L73A 3IR9A 1OCZB 1AI6A 3K5BA 4B3TO 2D2CC 1FPOA 1XOUA 1BE3E 2Y4UA 1IVSA 5KLVD 3L72D 1HWTC 3QO8A 2LXBA 1KTMA 3ASNC 2N1TA 5L8RJ 1KQSO 1H8AA 1L1FA 1YTZT 3VMZA 4PV1C 1JMBA 2Y48A 1L0LG 3ZIAG 2B1IA 3JD0A 2BCCD 1RH5B 3EXAA 3I5CA 3K0GA 3UO3A 1ZR2A 1IFMA 1ZL8B 4CPGA 1IXBA 3L35A 4MVQA 2JDIG 2QJYB 3ABLB 3CP1A 2DMXA 1AQ5A 5CMUA 2LR2A 4J11A 2A45I 3AG4C 4GX2A 3JD3A 3T4DA 3OJAB 3E7KA 1CI6A 3AG7A 3CCQP 3L73J 3TDKA 2WA3A 2J5UA 3L70D 4MVUA 4C7NA 3VQXA 2H89C 1YITV 1I7FA 4PA3A 1NTZK 2ZT9D 1DD3A 4TUYB 3EFFK 5H6QA 3H1JJ 3IFMA 2CK3G 2JVDA 2ZDIC 4YJ2A 3CXHE 5L3DA 1Q81W 1SQPJ 4XBFA 3ZHTA 1YI2V 1DF5A 5AW7B 5JVDA 4W7ZA 4EB6A 2D3OW 1SQVK 3LSSA 1GRJA 4CH3A 2DYRB 1AI7A 1K5QA 2QDOA 3QO7A 3RGBA 4YJ3B 2XASA 5KX5A 4DV0B 4DV3O 1FZBA 1YDXA 2HG5D 3AEEC 4NPFX 2AEMA 1VDFA 3OD4A 2AXCA 4OGQB 1MZ9A 4AUWA 5KA5A 1ZP0C 2RCVA 3K79A 3CLQA 3PLNA 2KB7P 5LL6Y 3B5NA 4ZOLA 3K9AA 2XAFA 2M3EA 3RYCB 3H1IJ 3JCUH 1XDCA 3RYFB 2H88C 4DV4B 1YTFB 1XNRO 2Y4TA 2YKOA 4LC1A 1GH6A 5BXZA 3I55V 1N7SD 4U3JB 3RL0B 2KSDA 5FNVB 3RWRD 3CXHF 4Y99C 2WT7B 4JYCA 2WQYC 1RM1C 5CMZA 2PRRA 2YKPA 2Y69B 3OMAB 1GN3A 3VMXA 2ZR2A 4GODA 1OW6A 5C8YA 4U3FG 3BCCD 2QVAA 1VF7A 2ITCC 2P4VA 3K0DA 4YY3B 1NQTA 4AQYB 2WPSA 5C39A 3SWFA 1BGYD 1A02J 1KQSU 1M7LA 3WUVA 2PF4E 2VRSA 1M1JA 3U0ZA 2C0XA 3TGUD 4BXLA 3G4SV 4C7RA 4DV6B 1JMKC 1M56C 1XEQA 3KPEA 1NTKG 1HNZB 5AW4B 3VYIA 2JEUA 2E5LB 1FZAA 2N1TD 3B77A 4LF8O 1MFZA 2EJRA 2RDCA 1Q6UA 4JI1B 1EC5A 1MOFA 2Q73A 1SQQE 1QVFO 3AE5C 4MVZA 3K3WA 2OYQA 3RYHB 3M9BA 2Q5ZA 1LR1A 5ITZA 1OCOB 1K97A 1GMGA 4QPKA 5J2UB 2A06H 4DV2B 3WG7C 3SFDC 1E1QG 5B5EE 4R4MA 5KAFZ 4K3AA 3ABTA 1U57A 2QGNA 3CMAV 3X2QB 1PL4A 3G71P 1P49A 1SRYA 1KYOF 1N33O 3OM3B 3SPHA 1OVVA 4WBNA 1HUCA 1YITP 4EKWA 4TQFA 3H1KH 4B3SO 3KQGA 2A45G 4DUYB 1FAVA 3PRJA 5IWAO 1YBKA 3RK3E 1US6A 1KFMA 1YI2P 4CZZA 3ZRSA 1N7SB 5K1PA 3CEIA 2KNCB 4ZHQB 2OCCB 3K59A 3L71G 3JCUZ 4X62B 3LDDA 3PTZA 5IY5C 3O9OA 3CXCU 4QMAA 5LP6B 2ZIOA 4KT0J 1JCHA 2FYUG 3V2NA 2I1JA 4QJFB 3E35A 2QIWA 2M0BA 1ZV8A 1Y9BA 4QNHB 2ZFCA 3B5ND 1JA8A 3AE6C 2GTAA 1FFXA 2YC0A 1KYOI 2YIAA 4FLYA 2Y0DA 3AE4C 4I50B 3I55P 2P22C 5AW0B 3H1HD 4JF3A 2PZSA 3J80N 2JJ1G 2E76C 3THOA 1AR1B 3JALA 4MTXA 1PZQA 2JGDA 1N36B 2RN0A 1XL4A 2N1TB 1BCCH 3AEAC 1L0ND 3LDEA 2Q3IA 2E75C 1K92A 3K03A 1XHXA 5KLVJ 4OX9O 4DUZB 4GT1A 5AVTB 3A0BH 2B88A 5AG2A 2WSFH 4O9BA 1NU1H 4UUJC 2BEZF 1SQBE 2L5GB 2OQQA 3HKBA 1EZVD 2PTMA 1KZUB 1G1JA 3NMDA 3A0RA 1GN6A 1L4AA 1FC2C 4B3TB 3J81N 2EIJB 1RQUA 3G4SP 3CWBJ 3ZRVA 1PGOA 5JH7B 1EBOA 4JAVA 4OPAA 4I0XA 4DR2O 4WFAV 1OW8A 3JAWB 1ZN5A 1VF5C 3APOA 1Y66A 4H13C 3LW5J 3JCUE 2R70A 4C7NB 2Z3YA 2UUBO 4IYIA 2NN4A 3TF5A 1IK9A 1ZR4A 1W2BO 1Y74A 1QX8A 1VIBA 2LW1A 2DWEC 3KDPB 2DOSA 2UUCB 4YJ2B 3L70J 5APSA 3E8GA 1VF6C 2HLOA 4GX1A 2IBZD 2WMMA 1B06A 4QE9A 1WA8A 5M1BA 1S5LX 3CD6V 1FU1A 3OMIB 5JVDB 5IJ9B 4EB6B 2E42A 5EBLC 1OCCC 3RBZA 2FYNB 2P7JA 3CMAP 3KZIH 5BU8B 1CPYA 3M06A 5KX5B 3Q3DA 1OCRC 2QG4A 3L73G 4G28B 4DR3O 3HKDB 1WB7A 1K05A 1T8ZA 1W0KG 2O3JA 1N8RQ 3JC22 1OZ0A 2E5YA 3B5NB 5JQGA 4I1LA 3C3SA 4MT8A 3ZMSA 1W5CE 2ZJSE 3H1JG 1KILE 5KJ7A 1JFFA 1SQPG 1P7BA 2V7QH 3L4FA 2M8RA 1SQXG 1M57C 5AW6B 1HP8A 3H1LD 3H32B 5IYCO 1RF1B 3DGEA 1R8EA 4NKGB 2XKMA 2PUSA 3GHGC 5AVVB 1NTMD 3C9IA 1G2CA 2M6YA 3AE7C 2AXTZ 4IT5A 2OYIC 2GUZA 1P4RA 2X6CA 1JJOA 1VQOP 4JF7A 3IAOA 1PL5A 5C8YB 5EIBC 1LJ2A 2PGDA 1XMOO 3EQ2A
chains in the Genus database with same CATH topology
2H88C 3AE6C 2E75B 1RQVA 2YIUC 3AE4C 3T97B 3AE3C 2WQYC 3G9RA 2E76C 4OGQC 2D2CB 3Q1MA 1DIPA 3O6QA 5KKZC 2E76D 3EWKA 4H0LC 4OGQD 3Q5PA 1YQ4C 3C8VA 3GF3A 1OW6A 3GF7A 3AEAC 1WMKA 2E75C 3D71A 1VL2A 1OW7A 2P10A 3Q5RA 1IK7A 3AE1C 1K04A 1ZRTE 3GMAA 3RL0g 2E75D 2BEZF 4H13B 2OQQA 4GDOA 4H44D 1GMJA 1EXIA 1EXJA 4Z1MH 2D2CC 4H44B 1KMIZ 2MKVA 2JO1A 3B71A 2D2CD 1RQUA 3S9OA 3R4YA 1FDOA 1KTMA 1MKMA 5L8RJ 2G8YA 1S1CX 4RKUJ 4I7ZC 4PV1C 4U7JA 1OW8A 2IDBA 1VF5C 4PV1D 2NZ2A 3AEGC 2G3AA 1ZOYC 4H13C 3LW5J 1VF5D 2WSCJ 3GLMA 2E74D 4I7ZB 4PV1B 3AE5C 1JB0J 2FBWC 1VF5B 4H13D 2E74B 4H44C 1KQGB 1OMIA 3AE2C 1YQ3C 3SFDC 2QJPC 4R4MA 5M1BA 1S5LX 1U57A 1Q90D 4XFJA 1UIXA 4YTPC 2QSIA 2WPVB 1DD4A 1NYHA 2O01J 3Q2YA 2J5UA 3Q3DA 2H89C 4R4LA 3SFEC 1KQFB 2E74C 2QJKC 2ZT9D 1DD3A 1KORA 1K05A 1FDIA 3AEFC 2ZT9B 3ABVC 2QJYC 4YXDC 1ZMEC 3RK3E 1KILE 2JP3A 2YMKA 1HF9A 3D6YA 2V7QJ 4TT3H 2FYNC 2K9YA 3AECC 2FXPA 5KLIC 2BEQD 3AEDC 1TU3F 3D6ZA 3H25A 3D70A 4Y28J 1R8EA 1AJYA 3AEEC 3AE9C 3Q5SA 3FGAD 3AE8C 4IL6X 2E76B 4OGQB 1PV3A 3AE7C 4H0LD 4KT0J 1ZP0C 2ZT9C 1HJ0A 4H0LB 2QIWA 2WSFJ 1PL5A 3IAOA 3IN6A 1NGMB 2WSEJ 3AEBC 1Y9BA 1PIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF5 B;  2E74 B;  2E75 B;  4H13 B;  2YIU C;  4H44 B;  2FYN C;  2QJP C;  2K9Y A;  2ZT9 B;  1S5L X;  5KLI C;  1Q90 D;  2D2C B;  2QSI A;  4Y28 J;  2WPV B;  5L8R J;  5KKZ C;  4IL6 X;  2E76 B;  4RKU J;  4OGQ B;  2O01 J;  3C8V A;  4KT0 J;  4H0L B;  2QJK C;  2QIW A;  2WSF J;  2WSC J;  3LW5 J;  2WSE J;  4I7Z B;  4PV1 B;  1ZRT E;  1JB0 J;  2QJY C; 
#chains in the Genus database with same CATH topology
 3TET A;  3FXD A;  1DTO A;  3CX5 I;  2Y0E A;  2EJ7 A;  4D6T J;  1AJN A;  1VQ7 V;  1AVO A;  2KG7 A;  1XNR B;  5B3S C;  1HVV A;  3E83 A;  3BCC J;  1XTC C;  5APW A;  4L76 A;  4Z1M G;  1HGZ A;  2ZXW C;  2K1A A;  4GYC B;  1M1J B;  1J95 A;  3MP7 B;  1NO4 A;  1THZ A;  1XRE A;  3HKC A;  1FXK C;  1H2N A;  4UCU A;  2VQE O;  4X64 O;  1S0V A;  1BGY J;  1WP7 A;  3RK2 C;  1SQB K;  1JVM A;  4P9O A;  1PPJ D;  1WP8 A;  3M99 B;  2KKW A;  3MAQ A;  4D7T A;  1P84 I;  3TGU J;  1IUR A;  1FS0 G;  3OE7 G;  1GM8 A;  4JTC B;  5FL7 G;  5KTB A;  1VL2 A;  5AW9 B;  1SZT A;  3G3Z A;  1ZRT E;  4N6J A;  3K5O A;  3TJT A;  1EN6 A;  1NJI W;  2XUM A;  2UXC O;  2DJV A;  4JI4 O;  2ZVN B;  1VF6 A;  2LP7 A;  1JJ2 U;  5ITZ B;  5LYJ A;  1DEB A;  2E5T A;  3UO2 A;  5LHI A;  5APV A;  1L4A D;  5BY1 A;  3NTN A;  1LTS C;  2Q7G A;  3S4R A;  3HE4 A;  3BA9 A;  3RK3 C;  2GV9 A;  1SC5 B;  1W2B U;  3OR7 C;  3T4Z A;  3II6 A;  2IJK A;  4I9W A;  2JWD A;  1Q82 Q;  3GWK C;  4LF8 B;  1GU5 A;  1QU7 A;  4GKJ O;  1SFC C;  4WBN B;  5CCH C;  1WNS A;  4H44 C;  1DH3 A;  1QL2 A;  2AXT E;  3KXD A;  2LFS A;  4KFM A;  1GK6 A;  1WT6 A;  4JI0 B;  2HYN A;  2FY8 A;  5JWP A;  1YQ3 C;  4BRY A;  1J1E C;  3T1Y B;  2M5A A;  3CD6 P;  1NTZ H;  2M3B A;  3BAB A;  1U7M A;  2L35 A;  1KB9 D;  1NYH A;  3G6B A;  1URQ C;  1BCC E;  3BA8 A;  2Q3E A;  1N33 B;  2JGU A;  1W0J G;  5EC2 C;  1JY3 N;  1BE3 D;  2K9J A;  3A0B E;  3CCJ V;  1K7D A;  2AHY A;  1QR8 A;  1E79 H;  1SQV H;  1NU1 E;  3B8N A;  2YMY A;  2Y0I A;  4U7N A;  1VQN V;  4B3S B;  2KOG A;  1NKD A;  2R44 A;  5A9G A;  1NKN A;  5IWA B;  2DYR C;  1UII A;  5KJ7 D;  1X59 A;  5EC1 C;  2UXD O;  2YXY A;  3OMN B;  1L0L E;  4IIJ B;  2B89 A;  4EYY Q;  2QKC A;  3A0H H;  1CZQ A;  3E89 A;  4EDF A;  1USD A;  1KEC A;  1LWU A;  2V4D A;  4KP4 A;  2ZQM A;  3JAL B;  4YXW G;  2ZKO A;  2RH0 A;  2YXL A;  4FZ0 A;  2WLM A;  3H1H J;  3LNM B;  3OFN G;  1S9K D;  3U10 A;  3QNE A;  3WU2 H;  2Q8V A;  2RN9 A;  1L8D A;  4ICG A;  5APQ A;  1KC8 Q;  1VQ7 P;  3CSX A;  1ZAU A;  3DTU B;  2Q7E A;  5B1A C;  3ZMV A;  2OTL V;  2CTR A;  2X7R B;  1KU9 A;  2XOK G;  1JQ0 A;  1SA0 A;  4DV0 O;  3LID A;  3IC7 A;  1LTJ B;  2RKL A;  5H6R A;  4PA9 A;  4UFZ A;  1OHH G;  1E5W A;  3L36 A;  3P30 A;  3FAV A;  5GTI Z;  1GN4 A;  2GHY A;  2GTS A;  2ZYD A;  1IX9 A;  2QRX A;  4OX9 B;  4LF4 B;  5KLV G;  3L72 G;  4BR6 A;  3LSU A;  2XAQ A;  3OEH G;  1EXI A;  2N9Y B;  4JI5 O;  2P2U A;  5C93 A;  3N7N A;  3R2P A;  2PY5 A;  1Y74 B;  4J7J A;  1BL8 A;  4LFC O;  1Y4M A;  3CPW U;  2Q0O C;  2EIN B;  4JZ2 A;  2X0L A;  2EIM C;  1WPX A;  1XL6 A;  1FDO A;  4JTA B;  2BCC G;  1M93 A;  3VQY A;  4GLX A;  1IZN B;  1KIL C;  2G8Y A;  4RWU A;  2QKA A;  4RKU J;  2OYH C;  5LGU A;  4AI8 A;  1LTG C;  2IDB A;  1OIP A;  4DR2 B;  1OCO C;  2N74 A;  4YY3 O;  3GLM A;  4J7K A;  2EUL A;  1RF0 A;  1PL0 A;  1BT8 A;  3QO5 A;  3CXH H;  1NVO A;  2YXH A;  5JQG B;  4BIZ A;  1RE3 A;  2O1J A;  4RO0 A;  4TT3 G;  3OGI B;  1JFF B;  4TV9 B;  4P9P A;  1NU1 K;  4DV6 O;  1NTK J;  2ZXE B;  2CPS A;  3MIW A;  4U3F E;  1M57 D;  5AVW B;  1RY3 A;  1M5I A;  1AFO A;  4CH6 A;  2O01 J;  1K73 Q;  4NPE A;  1FKA O;  2N9B A;  2GBO A;  2GDS A;  2IPP A;  4JI1 O;  2ODM A;  1Q6I A;  3R65 A;  1X0T A;  4MVM A;  1G2C B;  2QE7 H;  3CCJ P;  4TQD A;  2GUZ B;  3B40 A;  1L0L K;  5EIB D;  4BIU A;  4NXM O;  2SPZ A;  1VQN P;  4XDJ A;  4ZNC A;  4TOI A;  1NTM J;  5GTI E;  1JY2 O;  2FB5 A;  3MHV A;  1IBK B;  4DR1 O;  3E1I A;  2WLH A;  2WSS G;  3SYP A;  1SP4 A;  2IFM A;  3L9D A;  1QL1 A;  3VP8 A;  1SQQ D;  4MVO A;  4WFH A;  2WZ7 A;  3UKM A;  1N73 C;  3D36 A;  2FKW B;  4PD4 I;  4HYO A;  3RK2 D;  3HKC B;  3E86 A;  2PAJ A;  3K04 A;  2WSE J;  2ZVO B;  2QM7 A;  5CA3 A;  3H1I H;  1FZC A;  4X1K A;  5LOV A;  5LHH A;  1RQV A;  5H9C A;  4QE7 A;  3O8Z A;  1BSM A;  2CGO A;  3G9R A;  3FD9 A;  3BCC G;  3SWY A;  5LYJ B;  1GAX A;  3SYQ A;  4X62 O;  5D5Q A;  4O2A A;  1KYO H;  2VQE B;  2CE4 A;  4H0L C;  2OYH A;  3QVN A;  1BGY G;  4X20 B;  4O4H A;  2W6J H;  1MFT A;  2BTO A;  3FKS G;  2IJJ A;  4WVZ A;  2P10 A;  3J7A U;  3TGU G;  3JSV C;  2HPC A;  3K08 A;  2W27 A;  2ZE5 A;  3GG2 A;  3WUU A;  3KKY A;  1SS1 A;  4I6M C;  2Q69 A;  4QPJ A;  4FM2 A;  2EIJ C;  4H44 D;  2QKS A;  3QWO C;  5DM6 V;  4JI4 B;  4HNA A;  4ZI7 A;  3L71 E;  3MUD A;  4EEQ A;  5D5P A;  4FLX A;  2IBZ I;  2CTQ A;  3RBX A;  3IC9 A;  4BRY B;  1GL2 B;  4GKK O;  2FYU E;  1QLE D;  2YI8 A;  2BOC C;  3H6P A;  4LF9 O;  4PJ0 H;  4CS2 A;  1Q5O A;  3JAS A;  4JZG A;  5IYD O;  4DUZ O;  2YEV A;  1H2M A;  1NT2 B;  3ABU A;  2K9J B;  2YO3 A;  5CCG A;  3RYI B;  4YIP A;  1QGK B;  2QJK B;  3MZW B;  4J41 A;  1VQ6 P;  1HNW O;  1H2K A;  3F5W C;  4NTY A;  4LNU A;  1NHL A;  1X8Y A;  2E43 A;  2WPV B;  3RGU A;  3ASO C;  3VQW A;  1DD4 A;  1M9N A;  2F23 A;  1MSW D;  4EFB A;  5EBM C;  3SGI A;  3TK1 A;  3FB6 C;  2HLD G;  2E74 C;  2GA1 A;  1LWU B;  3F5T A;  1QVG U;  2CAZ C;  1EN4 A;  3NXS A;  2I8D A;  1K8A Q;  3W7W A;  2QTO A;  2UUC O;  1G4Y B;  1G1I A;  1RF1 C;  1K4D C;  3SJB C;  1KQL A;  1X9V A;  1XBL A;  4TLF A;  2Z5U A;  4XDL A;  5CA1 A;  2XND G;  1YJ9 V;  3CRM A;  3HD7 A;  2UXD B;  1AJY A;  1V54 B;  3AE9 C;  3L75 G;  5GON A;  1SA0 B;  1VQ9 V;  2R32 A;  2R3C A;  4B08 A;  1O9G A;  4FJC C;  1B3Q A;  3ICX A;  3VMY A;  5KAF H;  5KKZ B;  4YIO A;  1AR4 A;  2NPS C;  4ASU G;  2DYS B;  3FAV B;  3H1H G;  3HTK A;  4O4L A;  1NAY A;  2HJF C;  3ZBH A;  3OEE G;  1SQB H;  1XMQ O;  1S3J A;  1SQX J;  2P6J A;  5LGN A;  4AIL C;  1P7G A;  3MHH C;  5LMU B;  1L0N G;  4OXS A;  3OTO O;  3O6Q A;  3L73 E;  4U7O A;  5B66 Z;  1QLE B;  1I94 O;  1Y76 A;  4Z2W A;  3HE5 B;  1Y6X A;  2XAG A;  1PV0 A;  1TUE B;  1EZV G;  4X66 O;  2P4K A;  5TJH A;  3EVK A;  3H1J E;  1VQ8 V;  2Y0P A;  1SQP E;  2FYU K;  2HOD A;  2C9N Y;  2YIC A;  1P84 H;  3M91 A;  2RMZ A;  4LCU C;  1Q8I A;  2DWD C;  4JAS A;  3B8E B;  2OT5 A;  3S3X A;  2ZIN A;  4PJ0 Z;  4JI5 B;  3L74 H;  2JO1 A;  1NR1 A;  4LFC B;  4JV5 O;  2F1M A;  1YEW A;  3R4Y A;  3SJQ C;  3CWB H;  2Q0A A;  4UCR A;  3AG1 B;  1GM9 A;  2A06 D;  3CCV V;  1W59 A;  1HJB A;  1KB9 I;  2C2A A;  3ABK B;  3OAK A;  4I55 A;  3AEG C;  3QF7 A;  2IBZ G;  2WLI B;  1S72 V;  3H1I E;  3LW5 H;  5EFW B;  3C3T A;  1PP9 D;  1ZW0 A;  2XAH A;  1TUB B;  3RT3 C;  4WCE V;  1ROP A;  5CCG D;  3L70 H;  3U59 A;  2KYV A;  2A0L A;  1VQK V;  3H1K D;  3AG2 B;  4UXN A;  3W7U A;  4O2B B;  1JM0 A;  1JX9 A;  1KYO E;  3V4Q A;  1FZE A;  1JY2 P;  2G38 A;  2ZR3 A;  1FS0 E;  4WFE A;  1HW7 A;  5K1X A;  2EIL C;  2QTS A;  4J9Z B;  1IZ3 A;  4GKG A;  4R4L A;  2NPS A;  5B66 E;  4LFA B;  1EN5 A;  1MSD A;  2BTQ B;  3P3P A;  2ZT9 B;  1WAZ A;  4N78 D;  2ZDI A;  1M90 W;  2KSJ A;  3H1L G;  4JI0 O;  4NXM B;  4OWF A;  4UCO A;  3CC4 V;  2FL4 A;  2L6L A;  1FZC B;  4X1K B;  3VBB A;  5LOV B;  3T1Y O;  1NTM G;  4DR1 B;  1RHZ B;  1TGO A;  4N21 A;  1YJ9 P;  1G8M A;  4E4E A;  3H25 A;  3M0D C;  5KAI Z;  3DXR A;  4Y28 J;  1ZLZ A;  4UVB A;  1EDI A;  2ZYA A;  3HD7 D;  4PJ0 E;  2QM4 A;  1VQ9 P;  3E8F A;  4H0L D;  4O2A B;  4FFK A;  4DO2 A;  2ZXX A;  2F93 B;  3K58 A;  4O4H B;  2KZI A;  1KUQ A;  3BPZ A;  2IH1 C;  2WAM A;  1O9H A;  4P2Z A;  1HH0 A;  2ZE6 A;  3USS A;  1BDD A;  4D6T H;  1BCC D;  2KLU A;  2HPC B;  2JRI A;  1A02 F;  2P67 A;  3APQ A;  1PPJ G;  2FFD C;  4G27 B;  5IYZ A;  1GD2 E;  4ZKP A;  1HDJ A;  2R9A A;  4NXN B;  2FXM A;  1T3J A;  4K0K B;  1SS3 A;  1NU1 D;  2JKV A;  4ZI7 B;  1SQP K;  1QCE A;  3PN1 A;  3CC2 V;  3Q5P A;  1SQX K;  1AJQ A;  5APT A;  1Y67 A;  2NR5 A;  1SET A;  1ZX3 A;  2ZE7 A;  4PI0 A;  1LT9 C;  1NZ6 A;  3CRQ A;  4W4L A;  1MA1 A;  2HP8 A;  3A2F A;  3BY6 A;  4KJM A;  4WB4 A;  4FMT A;  4LH7 A;  4Q6G A;  3Q5R A;  3L75 D;  1Q86 Q;  1VQ8 P;  3GMA A;  3P7K A;  2WLL A;  1AR5 A;  2VRZ A;  2YEV B;  1H0T A;  3ZMU A;  1WPB A;  1KBH A;  2AXT H;  3S1K A;  1EXJ A;  2ITD C;  2R9I A;  3R66 A;  3S3W A;  2VWJ A;  4WY4 C;  3BVH A;  3B71 A;  2CTW A;  2D2C D;  1PM9 A;  1ARO P;  3ABM B;  3HUS C;  4IL6 Z;  4GKK B;  2ADQ B;  4GX5 A;  4WFG A;  5CB4 A;  3KCY A;  3ZN1 A;  3IJ4 A;  5KAF E;  3CCV P;  2V4H A;  4G2K A;  2Q67 A;  1R3K C;  1NH2 D;  1LP1 A;  3HKE A;  4LF9 B;  2W0X A;  4PV1 D;  5KAI E;  1T2K C;  2IZ0 A;  5B1B C;  5CN0 A;  2WSC J;  2AZ2 A;  2E74 D;  3L72 J;  1S72 P;  1U97 A;  4LF4 O;  5CBF A;  1JTH A;  3ETQ A;  4LWS A;  3SPI A;  2L91 A;  4JQ0 D;  2P1J A;  2QJP C;  1EDJ A;  1HNW B;  3TCU A;  1VQK P;  3K57 A;  2PP6 A;  2BCC J;  3CX5 E;  1B04 A;  3TXS A;  4DV1 O;  1BE3 G;  1J5E O;  5CJ0 A;  1FZF A;  1L0L H;  3HPL C;  1YJW V;  2IH3 C;  1KN7 A;  3HD7 B;  3MTU E;  4QGP A;  4JYY A;  1D7M A;  2Z0A A;  4IFM A;  1Q7Y W;  1VQ4 V;  1CI6 B;  3ZRW A;  5KLV E;  1F51 A;  2KSE A;  4W7Y A;  1YTZ I;  1FDI A;  4K8X A;  3AEF C;  2KXP B;  2VWK A;  1P84 E;  4JAU A;  2NPS D;  4MN4 C;  2WLK A;  2HFE C;  4FLU A;  1FOS E;  1FXH A;  1JR9 A;  4KL1 A;  1ZME C;  2JDI H;  2R5D A;  2F66 C;  5LXT A;  4O4L B;  3HTK B;  3CC4 P;  3L74 E;  3FWL A;  2YID A;  1LT1 A;  3ITK A;  5KLI C;  2QWP B;  3CWB E;  2UXX A;  3E2E A;  1TU3 F;  1PD3 A;  2QSA A;  4K8Z A;  3CX5 F;  2KI7 B;  1D2D A;  1JY3 P;  1Y8A A;  5L3E A;  1BSH A;  1N34 B;  3O6Q B;  2XV5 A;  3K5N A;  1Y76 B;  3WB1 A;  5KHH A;  5DJT B;  3AG3 B;  2UXB B;  2CK3 H;  1UFI A;  4PD4 H;  3VOU A;  3IGA C;  1WRG A;  1LTA C;  4ZOL B;  5LA6 A;  2H3O A;  3L70 E;  2YIU C;  1AP6 A;  2J59 M;  1IBK O;  2HOD B;  1P84 F;  4HBN A;  1FOS F;  4N23 A;  1R3I C;  1XMQ B;  1I0H A;  3CCE V;  2VQF O;  2D2C B;  2KB1 A;  3NFQ A;  3OTO B;  1F23 A;  3SSU A;  4Z1V A;  1USE A;  4ASV A;  3ETE A;  3CC2 P;  4DT0 A;  1I94 B;  3ASN B;  2RJZ A;  1AV1 A;  1NH2 B;  4BWN A;  4JAA A;  4L8J A;  1EZJ A;  2Q7H A;  4X66 B;  1CW5 A;  2ZM6 B;  1PGQ A;  4I55 B;  1KD1 Q;  2W83 C;  4GDO A;  2BSK A;  1K33 A;  4IHJ A;  3JAM N;  1AB3 A;  1GL2 C;  4ZMD A;  1N4C A;  3Q4H A;  3SWK A;  1S76 D;  5KHK A;  2Y0C A;  3CC7 V;  3JSL A;  3K5L A;  1IXM A;  1PP9 J;  1IFJ A;  4JV5 B;  5CBN A;  1N32 O;  3AG4 B;  1MNG A;  1NI8 A;  2CGN A;  4U3F H;  1S1C X;  4DJG A;  1M56 D;  3FB8 C;  4LF5 O;  1LTT C;  1QBZ A;  2DW4 A;  3H1K J;  3V2Q A;  2OIG A;  1OCZ C;  2FKX A;  1R5L A;  1NTZ D;  1ZOY C;  3LUT B;  5AVY B;  1K5S A;  4I7Z B;  1OJH A;  3WFV A;  4D6T E;  1Z56 A;  2WTY A;  3BCC E;  4KXR A;  2XTA A;  2H8P C;  3U1C A;  5GTI H;  1JMM A;  1YHQ V;  3VP9 A;  5KLV K;  1DF4 A;  1YF2 A;  1SQV D;  4BWA A;  2JWA A;  1BHA A;  1NTK H;  4YTP C;  1IO4 A;  1VQL V;  1HTL C;  4RO2 A;  3F5H A;  3I5D A;  1YJW P;  2O01 H;  5IJ0 A;  3A3Y B;  3CPW O;  1VQ4 P;  3M8A A;  3TNU A;  3FXE A;  1HNX O;  2QJY C;  1I5Y A;  2Q6A A;  3ABL C;  1SQQ G;  3CB2 A;  2AHZ A;  1YVW A;  2KS1 A;  1FFT B;  3STL C;  3OAA G;  4PHZ A;  1QQC A;  5TIS H;  2XNX A;  2GM4 A;  1KFN A;  4R6Z A;  3D6Z A;  2CH7 A;  3ZHQ A;  2DQ3 A;  2HHH O;  2LGW A;  2YI9 A;  1H8E G;  2YIB A;  4Y99 B;  4GX0 A;  2A3Q A;  1RM1 B;  3GHG A;  1I08 A;  3K06 A;  1SQG A;  1PV3 A;  3MDS A;  2OYI A;  3I56 V;  2FML A;  2A45 H;  2WSF J;  5J2T A;  4ABM A;  5AVS B;  1R6K A;  4R50 A;  3E8H A;  4B3R O;  2WSE H;  2I1K A;  1SZX A;  4PA6 A;  5APY A;  4FFB A;  4JPZ B;  1PFI A;  1FFX B;  2B9Z A;  4J7Z A;  2JEX A;  3L75 J;  3CCE P;  3E22 A;  4OGQ C;  3CRR A;  5AVQ B;  3L71 H;  1FXK A;  2E76 D;  4PA4 A;  4LF7 O;  2POH A;  2QWO B;  1EDL A;  2FYU H;  3E1R A;  2Q68 A;  5J9P C;  3BAT A;  4I4T A;  1M56 B;  5IE9 A;  2HEP A;  5CB4 B;  4BW9 A;  5KHJ A;  3VQV A;  4H37 A;  4FM0 A;  2JGD B;  1MMM A;  4X1Y A;  1IJD B;  5AVR B;  1T2K D;  1LP1 B;  4E2L A;  1GU4 A;  3RL0 C;  4B86 A;  2E75 D;  2HJD A;  5L3C A;  3JAT A;  4RQE A;  1N7L A;  2QEX V;  1YZB A;  1R3L C;  4DR6 O;  4DCK A;  4UV9 A;  5LHG A;  2Y69 C;  4LWS B;  1L0N J;  3CS5 A;  3HKB B;  5EK0 A;  5LMU O;  1N8R W;  3WG7 B;  1L4A B;  2EIK B;  4H33 A;  3CC7 P;  2KIK A;  1MKM A;  1GO3 F;  3CRC A;  4DXW A;  3SYA A;  3CXH D;  2IYP A;  1WJZ A;  3STZ C;  1UPG A;  3T1C A;  3BAA A;  1K3E A;  1F7Y A;  1ZL8 A;  2OYO A;  3MGN A;  2UU9 B;  2R5B A;  4PD4 E;  1VF5 D;  4UB6 Z;  4I0X B;  1SFC A;  5CCH A;  4H13 D;  1KB9 H;  2HFE D;  2OTJ V;  1K9M Q;  2BOB C;  2YUA A;  5FLX N;  1RPR A;  3LIE A;  1ZTE A;  1GN2 A;  4O4I A;  3C90 A;  4X1I A;  1YHQ P;  1Q90 D;  2XT9 A;  4F4L A;  1MUU A;  4DV1 B;  2ILM A;  2W6A A;  1VQL P;  1WA8 B;  1YSC A;  4Q20 A;  1N86 A;  3H9V A;  2C9L Y;  1URQ A;  4TUY A;  1J5E B;  4BW5 A;  2ITA A;  1XNQ B;  5IY5 B;  4A7P A;  1U7J A;  1BMF G;  5KA6 A;  5TIS Z;  3ABV C;  4BIO A;  4YXD C;  4GOF A;  4D7S A;  1LTI C;  1DEE G;  4PD4 F;  2KP8 A;  4J9Y B;  5AW8 B;  3D6Y A;  1SES A;  3X2Q C;  2Q9L A;  5LA6 B;  1ZWI C;  4YJ3 A;  2KK7 A;  4MSW C;  3AK2 A;  3SJC C;  2HG5 C;  4X9Q A;  4MS2 A;  1H38 A;  3D70 A;  2AW9 A;  2Q7C A;  1JNM A;  2O01 N;  2E76 B;  4OPH A;  3L73 H;  2YIB D;  4F6R A;  2IBZ E;  4B7E A;  3RYC A;  1H89 A;  2FYZ A;  2UUA O;  3N4X A;  3B8M A;  4FLW A;  4MVS A;  4J80 A;  4LFA O;  2YS8 A;  4EFE A;  4U3J A;  1KYO D;  3H1L J;  3H1J H;  1N7S C;  4LR3 A;  2E75 B;  3P8C E;  3TSI A;  2WT7 A;  1SQP H;  3ZX6 A;  1Q82 W;  3KYQ A;  2OCC C;  3OTF A;  4UB6 E;  1SQX H;  4IHJ B;  1PNL A;  1RFY A;  1NTK E;  1QVG O;  2KG7 B;  4LFB B;  3Q4H B;  1WB8 A;  5LP6 C;  1RE4 C;  2GUV A;  3IF4 A;  4HJG H;  2VQF B;  1OZH A;  2WIT A;  2Z5H A;  5CBO A;  1Q81 Q;  4MTG A;  5CA0 A;  2UWJ E;  4RUF A;  5IT9 N;  1IFD A;  3GF3 A;  1LGH B;  3VN0 A;  2LXC B;  1FXV A;  1OW7 A;  3AE1 C;  3ML0 A;  2Q1K A;  1M4U A;  3LDC A;  3ZJZ A;  1NTM E;  3T97 A;  4H13 B;  1AVY A;  5FPR A;  2YKQ A;  4CS3 A;  4I9Q A;  2QEX P;  4LF6 B;  3MHS C;  5CBG A;  1BQZ A;  3BRT B;  2WPQ A;  4DR5 O;  4Z1M H;  1SF9 A;  4NXN O;  2A06 G;  1EZV I;  5TIS E;  1NTZ J;  4K0K O;  2OTL P;  1CXZ B;  1IFI A;  4DR4 O;  2QA4 V;  2N1T C;  3F7Y C;  5DED A;  1KIL A;  2LJ2 A;  3AK3 A;  4MVR A;  1PP9 G;  5A2Q N;  3RK3 D;  1G1X B;  1OCC B;  1N32 B;  3HE4 B;  1IBL O;  4L87 A;  3CCL V;  4LF5 B;  1SQV J;  3CCS V;  4DW0 A;  5CBH A;  3VTP C;  3H1K G;  2ZYG A;  5IJ0 B;  1Q6H A;  2ZAE B;  5B66 H;  2CDY A;  1SFC D;  3OW2 O;  3ETG A;  3JCZ A;  2QWR B;  4DV7 B;  5CCH D;  1OMI A;  4LLH A;  4UCV A;  3V6I A;  1J2J B;  3SYO A;  2KS1 B;  1S5H C;  2LGQ A;  3M7M X;  4YHH O;  2W90 A;  1M57 B;  3E8B A;  1KC8 W;  2M5A B;  4NR1 A;  3HRN A;  5IDJ A;  2B1G A;  1URQ D;  5AVX B;  5LBQ A;  4JBZ A;  3W7S A;  3HB3 B;  4ZBM A;  2OYI B;  1FJG B;  2EZO A;  2AZ0 A;  1HNX B;  1R73 A;  4WBA A;  4NB5 A;  5AW3 B;  2KNC A;  4ZHQ A;  1LUW A;  5BMV A;  5KHG A;  2WVR A;  2FYN C;  2NLJ C;  3CCM V;  1BE3 J;  3FX7 A;  1H2G A;  2BEQ D;  4FFB B;  2R72 A;  5B3S B;  2J58 A;  3KHU A;  1N73 A;  4TV8 A;  3VOP A;  1NAF A;  5GTH H;  1SQB D;  3E22 B;  2P7T C;  2HHH B;  2H7H A;  2WLJ A;  1FXK B;  2ZNJ A;  3RK2 B;  2B87 A;  3AEI A;  3B5N C;  2MW2 B;  1BCC G;  1EFR G;  1T6A A;  4N3Y B;  1NTK K;  3A8T A;  1KB9 E;  4I50 A;  2XU6 A;  4JI8 B;  4DRX A;  4B3R B;  2JIZ G;  4X1Y B;  3RL0 D;  1NU1 G;  5H2F Z;  1F4M A;  1SLQ A;  1XTG B;  4JGS A;  1HGV A;  3JAT B;  1CSB A;  2NRG A;  1M1K W;  3AE3 C;  4CC5 A;  4IGG A;  3DC6 A;  4PEL A;  4GZR B;  4JI3 B;  2N05 A;  1P84 D;  3UT5 A;  1NTM K;  2H94 A;  1QLN A;  3EWK A;  1B6Q A;  4YXW H;  1S5L H;  4OVN F;  1N34 O;  4LF7 B;  5EYP A;  3C8V A;  3RK3 B;  2HVJ C;  3B09 A;  1TVK A;  3L74 D;  1WMK A;  1SER A;  2UXB O;  2AEF A;  4XA4 A;  3RN4 A;  3D71 A;  3CWB D;  1GDT A;  3FFQ A;  5KAI H;  3RL0 g;  5L3F A;  1TAE A;  4X89 A;  1IFP A;  1K73 W;  2OWO A;  2IZ1 A;  1M1J C;  1SFC B;  1VPC A;  1Q2N A;  5CHX A;  3LNN A;  1T5E A;  1KB9 F;  2UXN A;  4H44 B;  5JH7 A;  4DR6 B;  1JY3 O;  1ZXG A;  2KUB A;  4IFD K;  1S9K E;  4NYK A;  4A5U B;  3WMM 0;  3G71 V;  3JAW A;  3CX5 H;  1J1E B;  5L3B A;  4O4I B;  2QA4 P;  4X1I B;  5KMG A;  3OW2 U;  2JS3 A;  4I7Z C;  3SPG A;  2XAJ A;  1KIL D;  1LTB C;  2AGA A;  1URQ B;  3T1H B;  3CCL P;  2ZM6 O;  2WWW A;  2JK5 C;  3JD2 A;  2WSC H;  2OAR A;  3CCS P;  2Q9I A;  5KLV H;  3L72 H;  1MZF A;  4FLZ A;  1JCC A;  4BAY A;  1VAR A;  2QJ1 A;  1QEX A;  3UIA A;  5IJ9 A;  1SQX E;  5AVZ B;  4CH4 A;  2IM9 A;  2V7Q G;  1QHT A;  3EFG A;  1R3J C;  2BCC H;  5H2F E;  4XFJ A;  1GK4 A;  1JOY A;  2LO1 A;  2MK3 A;  2EX3 A;  4MW3 A;  3W7T A;  3HKD A;  2ZIM A;  1Z2G A;  2YXQ B;  4NPD A;  4DOJ A;  2OIE A;  4FK5 C;  3BEH A;  1S4X A;  4F6R B;  3ETD A;  5B5E Z;  2YDE A;  3LSQ A;  1CEZ A;  2PFX A;  5H5N A;  4IL6 H;  4TSF G;  3SYC A;  2HVK C;  1Q43 A;  4FLV A;  1VQM V;  4DV5 B;  5EZY A;  2GUS A;  3JAK A;  5GTH Z;  1RF1 A;  3H32 A;  1PKX A;  3K5M A;  4TT3 H;  2K9Y A;  1J1D B;  1JOC A;  1Q7Y Q;  3OR6 C;  3D8C A;  3CCM P;  5APU A;  2OGU A;  3CCU V;  3UCS C;  1BDC A;  5B1A B;  1ZRT D;  2O1K A;  3P8M C;  4D6T D;  3BFR A;  2ATK C;  5B1O A;  1HR0 O;  4I5S A;  4JTD B;  2P58 A;  3OT7 A;  5CA0 B;  3CYO A;  1AJP A;  1AP5 A;  2UUA B;  4JI7 O;  2A7W A;  1SQQ J;  2JR8 A;  2JS5 A;  1S77 D;  1KV4 A;  2HR3 A;  3CHX A;  2YNY A;  2WSS H;  1E1R G;  4JYB A;  1GW4 A;  1S5L Z;  3T97 B;  3KG2 A;  4GIF A;  3IFX A;  3G6E V;  2B9B A;  1ZUQ A;  1YQ4 C;  1WN7 A;  2EIM B;  1KP3 A;  3CXH I;  1KIL B;  4RJT A;  2IW5 A;  2OYH B;  5F2V O;  1WLE A;  3CI9 A;  3C1L A;  1XIL A;  4UCT A;  2N04 A;  1R6T A;  3M9H A;  1BS3 A;  1L4A C;  2EIK C;  1YJN V;  2A9H A;  1LTJ C;  4JPR A;  1BHB A;  3BCC H;  3IAY A;  4DR5 B;  1K8A W;  4R7C A;  2P90 A;  1CP9 A;  4AYC A;  1MZE A;  1PP9 H;  1NTZ G;  4F6E A;  5GTH E;  4HNA B;  1BGY H;  4DR4 B;  3P3N A;  3ZHV A;  3JSN A;  4U7J A;  5APX A;  5FPO A;  3O65 A;  5HFM A;  4HZ3 A;  1H2L A;  3TGU H;  1IBL B;  1E79 G;  1TA8 A;  1BZK A;  1SQV G;  3JAS B;  2LKM A;  1L0L D;  2EIN C;  2Q4P A;  3N2K A;  2O57 A;  3QH9 A;  3JYC A;  1NR7 A;  4JI2 B;  3BRV B;  5DJU B;  5E79 H;  4KUM A;  3N2G A;  1N0J A;  4B7K A;  4RAI A;  5BMV B;  2K1E A;  1UIX A;  2LW7 A;  4HB1 A;  1S5L E;  1NJI Q;  4LNU B;  5LMN O;  4YHH B;  1VQO V;  1N73 B;  2LFR A;  4TV8 B;  1T3U A;  2UU9 O;  1GTO A;  4JI6 B;  2ZNI A;  3V5B A;  1X79 B;  5DEC A;  2B87 B;  3ZDM A;  4UVA A;  5E1A C;  2JEE A;  1SQB J;  5KJ7 C;  3RVY A;  5BR8 B;  1VQM P;  4XDK A;  4DRX B;  2K9P A;  4IIJ A;  2FXP A;  4GUN A;  4PD4 D;  1RSO A;  3D3Q A;  4RQF A;  5EBW C;  3ZHR A;  3GB7 C;  5LGT A;  3CCU P;  3M0D A;  1N0N A;  4UVC A;  4B3M O;  3CJH A;  1PGP A;  5CA1 B;  3FGA D;  2F4V B;  3UT5 B;  1XNQ O;  2IFN A;  1OVU A;  1GW3 A;  1PNM A;  4H0L B;  5GON B;  4FPP A;  5EYP B;  3L72 E;  1TVK B;  4DK0 A;  4HH2 A;  2AEJ A;  1ENV A;  2B5U A;  2XDJ A;  4PA7 A;  3BVO A;  2XHB A;  5KHI A;  1LTJ A;  3L74 J;  2XND H;  1KKD A;  2FFD A;  1M8O B;  4O4J A;  2BCC E;  1EQ7 A;  4UB8 H;  1SQQ K;  1QVF U;  3W67 A;  3L75 H;  2RMK B;  4LBE C;  3G6E P;  1V55 B;  1MV8 A;  1JY2 N;  3OA7 A;  1H2S B;  3GF7 A;  5KMG B;  3KCX A;  2Z4E A;  1LT9 A;  2K3R A;  2YXR B;  3UM7 A;  3H1H H;  1IK7 A;  4IL6 E;  2EZP A;  3QTC A;  1KKC A;  4LH6 A;  2M7W A;  4DW1 A;  4XE5 B;  1VEW A;  1NH4 A;  4U3F D;  3T2M A;  5JJJ B;  2KZJ A;  1NS1 A;  3CRA A;  1VQP V;  2MJZ A;  1YJN P;  4AHC A;  3ZS8 C;  4WY4 A;  1L0N H;  2F95 B;  4MW8 A;  3K9S A;  3GWO A;  2PI5 A;  1R1B A;  4C7U A;  1FD9 A;  4LFB O;  3S9O A;  3M0A A;  4JYA O;  5HFL A;  3SPC A;  2R3S A;  2BE3 A;  4RES B;  3PH0 A;  2C0W A;  3SPJ A;  2Q6Q A;  3HUS A;  3P8C D;  2IJH A;  1VP7 A;  4NVP A;  1EZV H;  3ASO B;  5CJ4 A;  1JO5 A;  1NWQ A;  3CME V;  4HAM A;  4WF9 V;  4DK1 A;  5E79 Z;  1NTK D;  2QE7 G;  4PV1 B;  3WUT A;  2E74 B;  2CUG A;  3FB5 C;  4P30 A;  4X88 A;  4LF6 O;  4TV9 A;  1EM1 A;  1COW G;  2QM8 A;  1H8H G;  1NVP D;  5EZY B;  3JAK B;  4LGD E;  4TWK A;  2QSI A;  4PI2 A;  4ZKU A;  4EOT A;  2DN9 A;  5KUM A;  4DV3 B;  2F43 G;  4L74 A;  1YCI A;  2IBZ H;  2QJK C;  1H88 A;  1UJW B;  3M9Q A;  2EBO A;  4DR7 O;  1KOR A;  1URF A;  2YSU B;  4X65 O;  1FJK A;  2A06 E;  4DV7 O;  1IBM O;  3H1I G;  2NPS B;  1IC2 A;  1Y47 A;  3TYY A;  2W6I G;  4CBC A;  1YIJ V;  1FZG A;  4FVM A;  4W4K A;  1Q86 W;  3ZCC A;  2FTK A;  3N27 A;  3RFR A;  3MD0 A;  4CH5 A;  1YYC A;  2ARH A;  4UB6 H;  1PP9 E;  3VMA A;  3V2P A;  2QR4 A;  3A0B Z;  1BGY E;  4HYT B;  1AIL A;  4IL6 X;  1LWU C;  2PYL A;  2P5O A;  3H1K E;  3DXR B;  3NR7 A;  3OUF A;  5AW1 B;  3TGU E;  2W6J G;  3OGC C;  1DX7 A;  3H01 A;  5K5G B;  1HR0 B;  4W80 A;  1JPX A;  3IN6 A;  4IOI H;  3L71 D;  3ZHU A;  4UB8 Z;  1AI4 A;  1FJG O;  1PIX A;  4JI7 B;  2BAS A;  3H1L H;  1X22 A;  2FYU D;  5AW5 B;  5L3G A;  4EIJ A;  1NTM H;  4L75 A;  5E79 E;  3SJA C;  2Y9Y A;  1ZSP A;  1V54 C;  4KHP O;  4CC6 A;  4X20 A;  3PP5 A;  4N78 E;  1AVM A;  2E3C A;  1YXB A;  3WB2 A;  1SQF A;  5IYZ B;  5KKZ C;  5BZB A;  1BSN A;  4K35 A;  3UQ8 A;  2PGG A;  2DYS C;  1BCC J;  1NKZ B;  1S2E A;  5AW2 B;  4EI2 A;  1JEK A;  5B1N A;  1PNK A;  3B4S A;  3V2R A;  5BVZ A;  4RUE A;  3PJS K;  4JI8 O;  1NU1 J;  3KZI Z;  1OVR A;  3SDL A;  1FBM A;  1PPJ H;  2H43 A;  1GZL A;  1GL2 A;  2WLL B;  1KMI Z;  3F89 A;  1VQP P;  1H0T B;  2MKV A;  4QIW F;  1LNQ A;  3N2K B;  1NVP B;  1QLE C;  4JI3 O;  1OX3 A;  4WY4 D;  3D3I A;  3ZMT A;  2WA4 A;  1L0L J;  3N2G B;  3RVZ A;  3JAR A;  2YO2 A;  3CCR V;  2PI4 A;  4KHX A;  3V4W A;  1VQ5 V;  3ZN0 A;  3RYI A;  3GW6 A;  1OWA A;  2PYJ A;  1HWY A;  1ZLL A;  4YPC A;  3FYI B;  1K34 A;  5AVU B;  3CME P;  4CS4 A;  2EIL B;  3DSQ A;  1RF0 C;  5KUK A;  3HKE B;  3CE2 A;  1KQG B;  1G6U A;  2VS0 A;  1RE3 C;  4UB8 E;  3B2E E;  1IDS A;  5JCO C;  1JTH B;  1AI5 A;  2ETN A;  3AG1 C;  3L75 E;  3ZED A;  3FX0 A;  3ABK C;  4HKZ H;  2KLV A;  1F4N A;  1RSO B;  4I2L C;  2IYO A;  1U96 A;  3QG5 A;  1OV9 A;  3EHB B;  5LMN B;  3CJH B;  3T1H O;  4LP8 A;  1KQF B;  3H1H E;  4FM1 A;  1SVF A;  1FDM A;  2JJL A;  2XZR A;  1J1D C;  2CPB A;  3ZRW B;  2ADP A;  4M3L A;  3AG2 C;  2V1D A;  3L73 D;  3F7V C;  1FYJ A;  2V7Q J;  1L0N E;  1SQB G;  1YIJ P;  3AEC C;  2Y9Z A;  1BE3 H;  3KZI E;  3AED C;  5LXT B;  1KD1 W;  3H1J D;  2FFD B;  3D36 C;  4O4J B;  1X4T A;  1SQP D;  2HKO A;  3Q5S A;  3W7X A;  3AE8 C;  1EZV E;  4AQR D;  4B3M B;  1SQX D;  2OCH A;  2ZT9 C;  1HJ0 A;  1BQ0 A;  3AK1 A;  1FJP A;  3OUS A;  1GTW A;  1DLB A;  1NGM B;  4DV4 O;  2GSM B;  1GK9 A;  2RQ6 A;  1LT9 B;  1R5S A;  4PDR A;  1FZC C;  4DV5 O;  4GCZ A;  4WFF A;  4IFF A;  1HBW A;  1SKV A;  5JJE B;  3DC5 A;  3HE5 A;  3L74 G;  1DIP A;  3H1I D;  4WY4 B;  2KQX A;  4U3F J;  3CWB G;  1XQ8 A;  4UCS A;  2OTK E;  1FAF A;  3HUS B;  4J42 A;  3GVM A;  1OXZ A;  3RYF A;  1M1K Q;  4AQY O;  1AA0 A;  3I56 P;  2DE0 X;  2K37 A;  4MTO A;  1RP3 B;  2UUB B;  2Z5I A;  2R9R B;  1VQ6 V;  2DQ0 A;  5FNV A;  5B1B B;  2W6B A;  1GMJ A;  1NOH A;  5DN6 G;  3A5T A;  2IU0 A;  3G80 A;  5JCO A;  3L70 G;  3MUD C;  1GL2 D;  4WFB V;  2BSK B;  3W68 A;  1NBM G;  2P06 A;  3P32 A;  1HNZ O;  2QJP B;  1A32 A;  2FXO A;  3ZRX A;  2E5L O;  2W8Z A;  5H2F H;  4JYA B;  1GM7 A;  4ZIB A;  4C46 A;  4DYL A;  2WLI A;  3CCR P;  1Q3E A;  2A79 B;  4WWI A;  3FYE B;  4NTW A;  2QWQ B;  1VQ5 P;  1EDK A;  1TUB A;  4DR3 B;  2NZ2 A;  2G3A A;  1XI1 A;  3H1L E;  1AQT A;  4ASW A;  1JB0 J;  2FBW C;  5CCG C;  1VF5 B;  1KP2 A;  2W0F C;  4PDM A;  1D5N A;  2IU3 A;  3U1A A;  3A0H Z;  3G67 A;  3L37 A;  4DV2 O;  1QNM A;  4O2B A;  1IFN A;  3AE2 C;  1XUQ A;  3ABM C;  1GKF A;  2QWN B;  1XHZ A;  3TXQ A;  2LQT A;  1OFC X;  2NNU A;  2WPD G;  3RW0 A;  2H8P D;  3PHL A;  5IYB O;  2WLN A;  3WU2 Z;  3CCQ V;  1MG1 A;  1QR9 A;  5KLI B;  1ORQ C;  4J10 A;  3CL3 D;  5JJN B;  3Q2Y A;  3ZHS A;  2BTQ A;  2RNB A;  5GW7 A;  1L0N K;  3SFE C;  3RYH A;  4DUY O;  4UV8 A;  3BRC A;  4IYH A;  1L2P A;  4OH8 B;  4DR7 B;  5J2U A;  1OCR B;  2X6B A;  1XMO B;  1PGJ A;  4PDL A;  4X65 B;  1PPJ E;  3TNU B;  2JP3 A;  2YMK A;  1HF9 A;  3JD4 A;  1IBM B;  4GOE A;  4JI2 O;  2JJ2 G;  2OTJ P;  4D6T G;  1NTZ E;  2Q5U A;  4X8A A;  1V9P A;  4R8C A;  2YIU B;  3FWN A;  3L71 J;  3HD7 C;  4NTX A;  2ZCE A;  3A7O A;  4X64 B;  2FYU J;  5BU5 A;  4FLT A;  1DGS A;  1VMG A;  2CH7 B;  2X6A A;  1D5A A;  1K4C C;  4JI6 O;  1SQV E;  3A2A A;  1MAB G;  4FIP C;  3GHG B;  1Z5V A;  1R6N A;  2CTP A;  1FE6 A;  3AEB C;  1I5X A;  1SQQ H;  1JCD A;  1N7S A;  3WB0 A;  5BR8 O;  3FB7 C;  5J2T B;  1W2E A;  3ZMZ A;  2K88 A;  4MTF A;  3BHP A;  4PDV A;  4ZKI A;  2UXC B;  4DZO A;  1JUN A;  1Z5W A;  1V55 C;  1RPO A;  1S5J A;  5B5E H;  2DW3 A;  3A0H E;  2ZD9 A;  4KHP B;  3Q1M A;  1RE4 A;  5LP6 A;  1N2D C;  1N36 O;  2ZE8 A;  2IJI A;  2ZXW B;  1K9M W;  4OGQ D;  1M90 Q;  2F4V O;  3AG3 C;  2IX7 C;  3JD1 A;  1LUV A;  3HR0 A;  4FZ1 A;  3WU2 E;  2WPR A;  3JAR B;  3CX5 D;  3U11 A;  1K04 A;  4I4T B;  1DK1 A;  1YTF D;  4GKJ B;  3SR2 C;  3BAS A;  4L73 A;  3IR9 A;  1OCZ B;  1AI6 A;  3K5B A;  4B3T O;  2D2C C;  1FPO A;  1XOU A;  1BE3 E;  2Y4U A;  1IVS A;  5KLV D;  3L72 D;  1HWT C;  3QO8 A;  2LXB A;  1KTM A;  3ASN C;  2N1T A;  5L8R J;  1KQS O;  1H8A A;  1L1F A;  1YTZ T;  3VMZ A;  4PV1 C;  1JMB A;  2Y48 A;  1L0L G;  3ZIA G;  2B1I A;  3JD0 A;  2BCC D;  1RH5 B;  3EXA A;  3I5C A;  3K0G A;  3UO3 A;  1ZR2 A;  1IFM A;  1ZL8 B;  4CPG A;  1IXB A;  3L35 A;  4MVQ A;  2JDI G;  2QJY B;  3ABL B;  3CP1 A;  2DMX A;  1AQ5 A;  5CMU A;  2LR2 A;  4J11 A;  2A45 I;  3AG4 C;  4GX2 A;  3JD3 A;  3T4D A;  3OJA B;  3E7K A;  1CI6 A;  3AG7 A;  3CCQ P;  3L73 J;  3TDK A;  2WA3 A;  2J5U A;  3L70 D;  4MVU A;  4C7N A;  3VQX A;  2H89 C;  1YIT V;  1I7F A;  4PA3 A;  1NTZ K;  2ZT9 D;  1DD3 A;  4TUY B;  3EFF K;  5H6Q A;  3H1J J;  3IFM A;  2CK3 G;  2JVD A;  2ZDI C;  4YJ2 A;  3CXH E;  5L3D A;  1Q81 W;  1SQP J;  4XBF A;  3ZHT A;  1YI2 V;  1DF5 A;  5AW7 B;  5JVD A;  4W7Z A;  4EB6 A;  2D3O W;  1SQV K;  3LSS A;  1GRJ A;  4CH3 A;  2DYR B;  1AI7 A;  1K5Q A;  2QDO A;  3QO7 A;  3RGB A;  4YJ3 B;  2XAS A;  5KX5 A;  4DV0 B;  4DV3 O;  1FZB A;  1YDX A;  2HG5 D;  3AEE C;  4NPF X;  2AEM A;  1VDF A;  3OD4 A;  2AXC A;  4OGQ B;  1MZ9 A;  4AUW A;  5KA5 A;  1ZP0 C;  2RCV A;  3K79 A;  3CLQ A;  3PLN A;  2KB7 P;  5LL6 Y;  3B5N A;  4ZOL A;  3K9A A;  2XAF A;  2M3E A;  3RYC B;  3H1I J;  3JCU H;  1XDC A;  3RYF B;  2H88 C;  4DV4 B;  1YTF B;  1XNR O;  2Y4T A;  2YKO A;  4LC1 A;  1GH6 A;  5BXZ A;  3I55 V;  1N7S D;  4U3J B;  3RL0 B;  2KSD A;  5FNV B;  3RWR D;  3CXH F;  4Y99 C;  2WT7 B;  4JYC A;  2WQY C;  1RM1 C;  5CMZ A;  2PRR A;  2YKP A;  2Y69 B;  3OMA B;  1GN3 A;  3VMX A;  2ZR2 A;  4GOD A;  1OW6 A;  5C8Y A;  4U3F G;  3BCC D;  2QVA A;  1VF7 A;  2ITC C;  2P4V A;  3K0D A;  4YY3 B;  1NQT A;  4AQY B;  2WPS A;  5C39 A;  3SWF A;  1BGY D;  1A02 J;  1KQS U;  1M7L A;  3WUV A;  2PF4 E;  2VRS A;  1M1J A;  3U0Z A;  2C0X A;  3TGU D;  4BXL A;  3G4S V;  4C7R A;  4DV6 B;  1JMK C;  1M56 C;  1XEQ A;  3KPE A;  1NTK G;  1HNZ B;  5AW4 B;  3VYI A;  2JEU A;  2E5L B;  1FZA A;  2N1T D;  3B77 A;  4LF8 O;  1MFZ A;  2EJR A;  2RDC A;  1Q6U A;  4JI1 B;  1EC5 A;  1MOF A;  2Q73 A;  1SQQ E;  1QVF O;  3AE5 C;  4MVZ A;  3K3W A;  2OYQ A;  3RYH B;  3M9B A;  2Q5Z A;  1LR1 A;  5ITZ A;  1OCO B;  1K97 A;  1GMG A;  4QPK A;  5J2U B;  2A06 H;  4DV2 B;  3WG7 C;  3SFD C;  1E1Q G;  5B5E E;  4R4M A;  5KAF Z;  4K3A A;  3ABT A;  1U57 A;  2QGN A;  3CMA V;  3X2Q B;  1PL4 A;  3G71 P;  1P49 A;  1SRY A;  1KYO F;  1N33 O;  3OM3 B;  3SPH A;  1OVV A;  4WBN A;  1HUC A;  1YIT P;  4EKW A;  4TQF A;  3H1K H;  4B3S O;  3KQG A;  2A45 G;  4DUY B;  1FAV A;  3PRJ A;  5IWA O;  1YBK A;  3RK3 E;  1US6 A;  1KFM A;  1YI2 P;  4CZZ A;  3ZRS A;  1N7S B;  5K1P A;  3CEI A;  2KNC B;  4ZHQ B;  2OCC B;  3K59 A;  3L71 G;  3JCU Z;  4X62 B;  3LDD A;  3PTZ A;  5IY5 C;  3O9O A;  3CXC U;  4QMA A;  5LP6 B;  2ZIO A;  4KT0 J;  1JCH A;  2FYU G;  3V2N A;  2I1J A;  4QJF B;  3E35 A;  2QIW A;  2M0B A;  1ZV8 A;  1Y9B A;  4QNH B;  2ZFC A;  3B5N D;  1JA8 A;  3AE6 C;  2GTA A;  1FFX A;  2YC0 A;  1KYO I;  2YIA A;  4FLY A;  2Y0D A;  3AE4 C;  4I50 B;  3I55 P;  2P22 C;  5AW0 B;  3H1H D;  4JF3 A;  2PZS A;  3J80 N;  2JJ1 G;  2E76 C;  3THO A;  1AR1 B;  3JAL A;  4MTX A;  1PZQ A;  2JGD A;  1N36 B;  2RN0 A;  1XL4 A;  2N1T B;  1BCC H;  3AEA C;  1L0N D;  3LDE A;  2Q3I A;  2E75 C;  1K92 A;  3K03 A;  1XHX A;  5KLV J;  4OX9 O;  4DUZ B;  4GT1 A;  5AVT B;  3A0B H;  2B88 A;  5AG2 A;  2WSF H;  4O9B A;  1NU1 H;  4UUJ C;  2BEZ F;  1SQB E;  2L5G B;  2OQQ A;  3HKB A;  1EZV D;  2PTM A;  1KZU B;  1G1J A;  3NMD A;  3A0R A;  1GN6 A;  1L4A A;  1FC2 C;  4B3T B;  3J81 N;  2EIJ B;  1RQU A;  3G4S P;  3CWB J;  3ZRV A;  1PGO A;  5JH7 B;  1EBO A;  4JAV A;  4OPA A;  4I0X A;  4DR2 O;  4WFA V;  1OW8 A;  3JAW B;  1ZN5 A;  1VF5 C;  3APO A;  1Y66 A;  4H13 C;  3LW5 J;  3JCU E;  2R70 A;  4C7N B;  2Z3Y A;  2UUB O;  4IYI A;  2NN4 A;  3TF5 A;  1IK9 A;  1ZR4 A;  1W2B O;  1Y74 A;  1QX8 A;  1VIB A;  2LW1 A;  2DWE C;  3KDP B;  2DOS A;  2UUC B;  4YJ2 B;  3L70 J;  5APS A;  3E8G A;  1VF6 C;  2HLO A;  4GX1 A;  2IBZ D;  2WMM A;  1B06 A;  4QE9 A;  1WA8 A;  5M1B A;  1S5L X;  3CD6 V;  1FU1 A;  3OMI B;  5JVD B;  5IJ9 B;  4EB6 B;  2E42 A;  5EBL C;  1OCC C;  3RBZ A;  2FYN B;  2P7J A;  3CMA P;  3KZI H;  5BU8 B;  1CPY A;  3M06 A;  5KX5 B;  3Q3D A;  1OCR C;  2QG4 A;  3L73 G;  4G28 B;  4DR3 O;  3HKD B;  1WB7 A;  1K05 A;  1T8Z A;  1W0K G;  2O3J A;  1N8R Q;  3JC2 2;  1OZ0 A;  2E5Y A;  3B5N B;  5JQG A;  4I1L A;  3C3S A;  4MT8 A;  3ZMS A;  1W5C E;  2ZJS E;  3H1J G;  1KIL E;  5KJ7 A;  1JFF A;  1SQP G;  1P7B A;  2V7Q H;  3L4F A;  2M8R A;  1SQX G;  1M57 C;  5AW6 B;  1HP8 A;  3H1L D;  3H32 B;  5IYC O;  1RF1 B;  3DGE A;  1R8E A;  4NKG B;  2XKM A;  2PUS A;  3GHG C;  5AVV B;  1NTM D;  3C9I A;  1G2C A;  2M6Y A;  3AE7 C;  2AXT Z;  4IT5 A;  2OYI C;  2GUZ A;  1P4R A;  2X6C A;  1JJO A;  1VQO P;  4JF7 A;  3IAO A;  1PL5 A;  5C8Y B;  5EIB C;  1LJ2 A;  2PGD A;  1XMO O;  3EQ2 A; 
#chains in the Genus database with same CATH homology
 2H88 C;  3AE6 C;  2E75 B;  1RQV A;  2YIU C;  3AE4 C;  3T97 B;  3AE3 C;  2WQY C;  3G9R A;  2E76 C;  4OGQ C;  2D2C B;  3Q1M A;  1DIP A;  3O6Q A;  5KKZ C;  2E76 D;  3EWK A;  4H0L C;  4OGQ D;  3Q5P A;  1YQ4 C;  3C8V A;  3GF3 A;  1OW6 A;  3GF7 A;  3AEA C;  1WMK A;  2E75 C;  3D71 A;  1VL2 A;  1OW7 A;  2P10 A;  3Q5R A;  1IK7 A;  3AE1 C;  1K04 A;  1ZRT E;  3GMA A;  3RL0 g;  2E75 D;  2BEZ F;  4H13 B;  2OQQ A;  4GDO A;  4H44 D;  1GMJ A;  1EXI A;  1EXJ A;  4Z1M H;  2D2C C;  4H44 B;  1KMI Z;  2MKV A;  2JO1 A;  3B71 A;  2D2C D;  1RQU A;  3S9O A;  3R4Y A;  1FDO A;  1KTM A;  1MKM A;  5L8R J;  2G8Y A;  1S1C X;  4RKU J;  4I7Z C;  4PV1 C;  4U7J A;  1OW8 A;  2IDB A;  1VF5 C;  4PV1 D;  2NZ2 A;  3AEG C;  2G3A A;  1ZOY C;  4H13 C;  3LW5 J;  1VF5 D;  2WSC J;  3GLM A;  2E74 D;  4I7Z B;  4PV1 B;  3AE5 C;  1JB0 J;  2FBW C;  1VF5 B;  4H13 D;  2E74 B;  4H44 C;  1KQG B;  1OMI A;  3AE2 C;  1YQ3 C;  3SFD C;  2QJP C;  4R4M A;  5M1B A;  1S5L X;  1U57 A;  1Q90 D;  4XFJ A;  1UIX A;  4YTP C;  2QSI A;  2WPV B;  1DD4 A;  1NYH A;  2O01 J;  3Q2Y A;  2J5U A;  3Q3D A;  2H89 C;  4R4L A;  3SFE C;  1KQF B;  2E74 C;  2QJK C;  2ZT9 D;  1DD3 A;  1KOR A;  1K05 A;  1FDI A;  3AEF C;  2ZT9 B;  3ABV C;  2QJY C;  4YXD C;  1ZME C;  3RK3 E;  1KIL E;  2JP3 A;  2YMK A;  1HF9 A;  3D6Y A;  2V7Q J;  4TT3 H;  2FYN C;  2K9Y A;  3AEC C;  2FXP A;  5KLI C;  2BEQ D;  3AED C;  1TU3 F;  3D6Z A;  3H25 A;  3D70 A;  4Y28 J;  1R8E A;  1AJY A;  3AEE C;  3AE9 C;  3Q5S A;  3FGA D;  3AE8 C;  4IL6 X;  2E76 B;  4OGQ B;  1PV3 A;  3AE7 C;  4H0L D;  4KT0 J;  1ZP0 C;  2ZT9 C;  1HJ0 A;  4H0L B;  2QIW A;  2WSF J;  1PL5 A;  3IAO A;  3IN6 A;  1NGM B;  2WSE J;  3AEB C;  1Y9B A;  1PIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...