4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
4ZCMA 3CX8A 4XH9B 3CX6A 5JSZA 5JWRA 4LYFA 2HCBA 3KXIA 1A2KC 4AYWA 2BASA 4Q5IA 4AY2A 4MKIA 5KU1A 3KFXA 2ZREA 4LPKA 4Q1EA 1KAOA 1OXTA 1S3SA 1OFTA 1G8YA 3AVQA 2NG1A 1XZPA 4YMTA 3RRYA 1OFIA 4EJSA 2QMEA 2BIFA 2ODNA 2F9LA 3P20A 2DFKB 2WM9B 4UQOA 3W5IA 4IVPA 1P5ZB 4ZIRA 1X86B 2VHQA 2OE2A 1G8GA 2OSBA 4N3NA 1KQLA 1XJCA 4TMVA 4D4LA 2D62A 2Q3MA 1Q0UA 5L3RA 2ODEA 4IDPA 4DWJA 2ZU0C 5H68A 3LO5A 1G20E 1HBWA 2OO7A 2IEZA 2OAQ1 1YZNA 3ZVRA 2GJ8A 2VSOA 3I73A 2YWEA 3NTUA 3K0AB 4MRNA 3H1TA 4R2IA 2AL7A 3T61A 1YZKA 3U3RA 2Q7CA 3O47A 3BB1A 4OI2A 3U3OA 4CEIB 4IDQA 5DISB 4Q7MB 4XSHA 1E9SA 5KUTA 1M74A 3NXSA 4IFBA 2AWOA 4A0GA 2YINC 3SN6A 2PX3A 3NH6A 1ANKA 4TZ6A 2JATA 3HYRA 4QKQA 2ZJYA 1A1VA 3RDPA 3UXMA 1MV8A 1AK2A 4OHWA 5FTNA 2H7VA 3U7HB 1DPFA 2ZI7A 1NKTA 3B1WA 3TK1A 2J9RA 4OQMA 4MT8A 1UDWA 2IYUA 1RYFA 2WT7A 5FOSA 3PVSA 1AS0A 1IN5A 1CLUA 3MLEA 2AKYA 2JCSA 1CRPA 1DAEA 4AYTA 3K0FA 2QROA 3QI2A 3BB3A 5EZ5A 1F2UB 1BYIA 2P67A 5LB4A 2IL1A 1G9XA 4DC9A 3GFPA 3KB2A 4KYUA 4W5JA 2AKAB 3W9YA 1ZD9A 1E9RA 1T6NA 2GTPA 1ZJ6A 2V7QD 2XNDD 1SKQA 3FHOA 4GP6A 1KY3A 1HJBA 1EX6A 2PBRA 3A1WA 3C41J 4E03A 1ZVQA 1PLLA 2QG6A 5JEDA 2QE7A 1U0LA 3V00A 4D26A 5KHOC 3AH8A 4CDGA 2XTNA 3B9QA 2V8OA 1FFHA 1LNZA 4GMXA 2JGNA 3SJAA 2ZJZA 5EE0A 3G82C 3L2OB 4L8GA 2KP8A 1E6CA 1LS1A 4A0RA 4WVFA 3ADKA 3I5CA 2BMDA 2JDIA 4XVRA 5FOUA 3MWYW 2VTKA 4M9SA 1PUIA 5HKKA 4Q01A 4URWR 3B8EB 3REGA 2O8CA 4TQ9A 4Q03A 4B71A 1E2GA 2O8EA 1CF4A 4FINA 1X8YA 1P60A 1P75A 1RE0A 2ZFCA 3OEEA 1XP8A 3SJCA 2ZANA 1P2VA 2IEYA 3CPHA 2V55B 4PAMA 4BEBA 4D0LB 2GBLC 2O8FB 2IYVA 4QNRA 1OFHA 2BCJQ 1SGWA 1G3MA 1WXQA 1Z0IA 5B64A 1YJ5A 3THXB 2G1JA 2RHMA 4D0NA 3PUXA 1NJFA 1Z07A 4CEHA 2QTFA 3DGEA 4QOSA 1H8ED 3CW2A 1XF9A 3NC1C 1S9KE 2GK7A 3C4JA 2QSYA 4DSTA 2J5XA 5AW2B 2N1BA 4LK2A 1SXJB 2W83A 4CT5A 4UJ5A 4M53A 1P6XA 1W44A 5AVZB 4NYIQ 3FWYA 1VCOA 3LVQE 4XVQA 1G7SA 1NBMA 5BYKA 3TAUA 4NPHA 3ND8A 4YDSA 2V3CC 3VR3A 1K5DA 4D6PA 2X77A 1QZXA 5G41A 4FWTA 1FX0B 4M21A 5EUQB 1YRBA 1RRFA 1X8LA 1E9DA 3X1DA 4OK3A 3R8CA 2FSFA 3JVUA 3K0EA 5AVUB 2P7JA 4ERNA 4GDFA 2YNMA 1VMAA 1ZAKA 3LD9A 1OH8A 1NNEA 4C4PA 1TEVA 2JJ8A 2B8WA 3E70C 5EUMA 2RGXA 1DAGA 3TSZA 1CTQA 4B74A 3KKQA 1F5NA 3IDQA 1DELA 1LW7A 2BKEA 2P2LA 5CYPA 6Q21A 2XTZA 3M91A 1NKSA 3ZJYA 2J3EA 1QG2A 2ODBA 2OT3B 3PENA 4DLXA 3EZ6A 1W4RA 2NMVA 3VR1A 4BZXA 4JT2A 1ZU4A 3NEJA 2BWJA 1WBDA 5JJIA 4NYMR 2DWOA 4BFUA 2IK8A 1EWRA 2D74A 1T91A 4DUGA 2P65A 4FWIB 2IS2A 1VG8A 4UNNA 2PEZA 3F3YA 1NIPA 3CZPA 4I1OA 3FOZA 3CLVA 3RYTC 5F9HA 1E0KA 1II8B 1GRNA 2WICA 1YRAA 2BKUA 1WDTA 2KE5A 3GEEA 4NTZA 4UJ3A 5BN5A 3MFYA 3K1JA 3LX5A 1G8FA 3TQCA 3TR0A 2JLRA 2XSZA 5DI3A 4JL5A 4B47A 1CBUA 1XTIA 1E99A 2C98A 1J2JB 2J7KA 2OBLA 4UNPA 2FH5B 2CJWA 5J4YA 3EARA 2ZRNA 2W6JA 5BN3A 1ZUNB 2CVFA 1DEKA 2R6DA 4URZR 2R5BA 3CKLA 1TQ4A 4UXJA 1N6KA 4MKGA 3T15A 1A82A 1FMLA 2A7QA 1Q20A 4O3MA 3SC3A 4D82A 1E2HA 1N0WA 1N6RA 2EWWA 2P6RA 1B23P 3NWJA 1IY0A 4RD4A 4IXMA 3TIFA 1WB9A 2ZYWX 2QP9X 3HPQA 4EJSB 2GEUA 2VHJA 1KO8A 4NYMQ 5C46F 4GOJA 3SFVA 2R3CA 2QM8A 4M0LA 1XPOA 4I6MC 2A5JA 3HTKA 2AK3A 1R5BA 5AVYB 3EW9A 4IJMA 2ZAMA 1DO0A 3NIBA 4ZIRB 1HURA 1KI8A 3OFND 3QQ5A 3D31A 2IXEA 4HLUA 4AYXA 4QM7A 4D0GA 5KPDA 2HLDD 3SYKA 1VG1A 3K53A 4TSFA 2PZGA 3SQWA 2C9LY 1QF9A 3K9NA 3WP0A 4QPJA 4RY2A 4YONB 1EFCA 3VTPC 2KB0A 3RS4A 4P4SB 3FHTA 1JXMA 1MRSA 4GZLA 3SWFA 1KJZA 1KI2A 4M2LA 1TUEA 5APVA 3V4QA 3CR8A 2C9CA 2F43A 3AKEA 1N0UA 1R8SA 2IBMA 3B1XA 4NHOA 4UXIA 4AKHA 4P33A 2F1IA 4A8JA 2CBZA 3WNCA 1MH1A 2Q9BA 4OQLA 2CE7A 3AV0B 1VKJA 4H9GA 2P5SA 2WIAA 5TB5A 2R6CA 2P2UA 3A36A 2FEOA 4R7ZA 3TVTA 3KTAA 3PR1A 3IQWA 1P62B 4TYPA 3T97A 1ZNZA 1S4QA 2C03A 2NZJA 4B2PA 5AVQB 1S1CA 2YO2A 1ZM7A 3H2YA 3X1WA 4DLVA 1FUUA 2UZ3A 4F4CA 4V0LA 3SR0A 5B58C 4I99A 1T4GA 2FZLA 1Z0JA 3HYTA 1CJVC 3EPKA 3EC2A 1ELOA 5DHAA 5EQTA 3W90A 2IYXA 2R65A 3T5DA 1TQ2A 3SOPA 2QGZA 3K0CC 3EX7C 1Z0AA 2WT7B 3BIFA 2RGDA 1N5KA 4CGZA 4ZCIA 2ANBA 4FPPA 3MMPA 1G4AE 2IYLD 3FMPB 3RANA 2MSEB 1W0JA 5JEEA 2O8DA 3AKDA 3K0FB 4BZQA 4DCTA 3A37A 1R0XA 1G7CA 1J8MF 1TNDA 1FOEB 1GITA 3D8BA 5JJLA 3TGPA 1D2NA 1W5SA 1YVDA 2W2XA 4LJ6A 1SKYB 2ZXEB 2NZ8A 2V6IA 3CF6R 1JR3D 4GOXA 4Y0VA 2BEJA 5GVRA 1QRAA 1CR4A 1JALA 1E0SA 1II9A 2PT5A 1XD9A 3KX2A 2IW3A 4GI7A 3B9PA 1G3QA 4JLVA 3X2SA 2VBCA 1ZNYA 2VA8A 3TAHA 1VYUA 4BFVA 5AW5B 4AKIA 3EXAA 1Z3IX 3AM1A 1IXRC 1U8ZA 1Z83A 1HE8B 1VG0B 4FMCF 4XTRA 3S1AA 4V02A 4OI1A 4CVNA 3MGCA 1LTQA 5G40A 1XTKA 5TMPA 4W9MC 1NVUQ 2CNWA 4Q21A 5FTLA 1U81A 3W34A 1MO6A 1Z6AA 2I4IA 2MSDB 4R2HA 1KI9A 2WV9A 5AJVB 4IDHA 5LD2C 1W36C 1ZINA 1N0VC 3PEVA 4FCWA 1KI1A 2O8CB 1GM5A 5FTMA 2O8EB 2IA5A 3VKWA 3LBIA 2R6FA 1S9HA 2WPDD 3CWZA 5IK2A 2SHKA 2JJ2A 4DDWA 4C2UA 5LB2A 1FTNA 4LHWA 4MYTA 4BRUA 1GP2A 3KUCA 4GZMA 2GXAA 3SHFA 3BOSA 2A5FA 3ZD6A 3E5HA 4D4KA 3RS5A 4ZI3A 2VRSA 2C96A 3V4WA 4Q47A 5TXGA 3W6OA 4CEHB 2A30A 2EFHB 1YU9A 1RZ3A 2WWYA 1SZPA 5JCZA 4PQFA 1SP4A 4F4JA 5LDDC 2JLUA 2BJWA 3M6AA 1GILA 2HYIC 5JLJA 4NCKA 3MWKA 1HH4A 3GEIA 1US8A 2J0UA 3U6KA 1AGRA 4LHZA 4JAVA 4KVAA 3BERA 4W7SA 2WJJA 1JUNA 1RRGA 5TVKA 3Q7QA 4FMCB 4KBGA 3L35A 3TR5A 4YXWA 4LC1A 1FTSA 1KI7A 4KJZA 4NH0A 1VIAA 2C2HA 2HCJB 3PUVA 4A0HA 3OIYA 1ESMA 3ADDA 3AVXA 5EE5B 2GJ9A 4BGDA 1G3UA 4TYNA 3ICEA 2ZSEA 2ZSFA 4URVR 2ERXA 3U5ZB 2GVZC 3B8HA 1SXJD 3GJXC 1XJQA 1ZM3A 4LHVA 1W36B 1Q22A 4HDCA 4QGAA 3GLIE 4KFTA 2Q5UA 4DLSA 2ZE6A 4Q1DA 3SDZA 4O0MA 2DR3A 1AS3A 4MRRA 2GJAA 3NBZC 5FUVA 3LBNA 4IOLA 3K09C 1Q1QA 1RC8A 5JRZA 1DAMA 3PQCA 5ANRB 3RLFA 2W2TA 3M0EA 2QAJA 1MT0A 3OZXA 1FOSF 1W48A 3GD7A 3W6PA 3OF5A 2YKGA 2EFCB 3TW8B 2IF2A 3TUZC 1OXZA 1XBTA 1WQ1R 4AUWA 3ZRVA 1X3SA 4H1UA 3KQUA 3LV8A 4GT1A 1AQYA 1W5TA 2ZRCA 1G4UR 4LJAA 4O25A 1NLZA 3L0SA 3OE7D 1XRJA 3EASA 2WBLC 5DI3B 1E79D 4V0ME 4P0TA 2JLWA 4BLTA 1DOAA 1KZ7B 2GZAA 4G01B 4A8JC 1GVNB 4PHHA 2G83A 1XXHE 3CH4B 1FP6A 1KNXA 2CJWB 2IUSA 3AUYA 4Q1AA 4YMSA 3T1QA 1G2CB 1OWAA 1U90A 4BE7B 1GSIA 1CR2A 1QHNA 2QGNA 4NYJQ 5M04A 3M1IA 2IX3A 2GK6A 2G1KA 1D2EA 4KSBA 1WF3A 3ECCA 2QEQA 4JKIA 1ZU5A 2DCUA 4KCGA 2D2EA 4C0BA 1VCIA 5APSA 1KDPA 4KSCA 3U2QA 3KJHA 4WBSA 4IW3B 4QM6A 2NO7A 1FUKA 4FXPA 1E1RD 4IDNA 3CNOA 3GLHE 4MGZR 3I72A 5JECA 1CEEA 3M06A 3WHKA 121PA 2ZQ5A 4HEJA 2ZUBA 4C7NA 2XOKD 4C2TA 5KDOA 4BUJA 3DZ8A 2Z4SA 4PQYA 4PHGA 2ZRHA 1SVLA 1CS4C 2NPIA 2Z0MA 1HEIA 3Q3JB 4LBZA 4QJ5A 3D3QA 3K70C 4MRSA 3DL0A 4IRUB 2I1VB 3PIRA 2C2AA 2FGJA 4BFXA 2ZUDA 1W46A 1N25A 5FUWA 3R9IA 4G5GA 3UMRA 4A8JB 4U5XA 2CK3A 4LJYA 4QBIA 4TLAA 4EPTA 4Z51A 2QRZA 2VLIA 1TF7A 3ZGXA 3A5TA 2VP4A 4DIDA 2ORIA 3KTAB 2P6UA 3N2EA 1CULC 3AF1A 1DAFA 4C0AC 2WTYA 4AD8A 4RFSA 2FFHA 2WMNB 4B6FA 5AW9B 2ZS9A 3N70A 1HUQA 5FH9A 2REXB 1VG9B 4XWAA 2XEXA 5G3YA 4DDUA 4JLPA 4PHTA 2NGRA 2WWHA 2E43A 2CEAA 4QNMA 4MRVA 2F1JA 1W4BA 4HZUA 4B2IA 3L0OA 1LY1A 1JR6A 2PLFA 4DXAA 2ZI9A 2W00A 3B82A 2O8DB 4US0R 1ZIOA 2P0EA 5DLQC 2KSQA 1A4RA 3RS0A 3CB4A 2JAQA 4EPVA 1M8PA 4PPGA 3CRRA 1K5GA 5D3MA 2HT6A 1IAQA 1VTKA 2OHFA 2GAAA 4OL0A 1XTSA 2QA5A 1LF0A 2AR7A 2RHDA 4UNRA 1Z2CA 2FE4A 4TMXA 4MUBA 3P7KA 5KNCA 1GD2E 1R0ZA 4A9AA 2VHUA 4OYHA 3S1AB 1KSGA 4X8HA 5JZVA 2WWWA 3TYYA 5CIQA 5HTKA 1B0UA 1NVVQ 2QAGA 3MRSA 1GL6A 2D7CA 3HU1A 3RS2A 2ERYA 4OHZA 3L43A 1E2LA 1NIJA 2BV3A 4Q9KA 4DIEA 2QE7D 4B3CA 3UK6A 4DB2A 1GKYA 2ATXA 3A6PC 1T3HA 2XU6A 1S96A 4I1UA 5DN6A 4XWOA 4PR0A 3BC1A 2OCAA 4BWYA 3O8BA 4C9BA 5J47A 5FUXA 2J0QA 2R9VA 2XNSA 2PL3A 4M3LA 2HXYA 1ESNA 3FMFA 3C14C 1UBFA 2J1LA 1HE1C 4LHXA 2W58A 1KOFA 1ZMXA 5KTYA 2A3RA 2YV5A 2TMKA 3QKUA 3WHLA 1US8B 2J0UB 1A5TA 2FA9A 4FCVA 4QXAA 5FR1A 3RVBA 3GLFA 1R2QA 5AW8B 221PA 5FPKA 5L3QA 2XV5A 1NG1A 4L4UA 4TQUS 2C77A 4A0FA 2GBLA 4G5QA 2BVNA 1Z6YA 2Z5HA 1UF9A 1NY6A 2OBNA 2GNOA 2VF8A 4MA4A 1L8QA 4HB4A 1AKYA 5JJKA 4PSAA 4DLUA 4QHYA 1EFHA 5DYIA 1UKEA 3V9PA 5AJYA 2PMKA 4WOPA 3SI7A 2ZSDA 4KLNA 3EZ7A 5CM9C 4B3GA 1NBMD 1IXZA 3IIKA 4BFYA 1XEWX 4AI6A 5FOXA 2MMCA 2ZSAA 3RRZA 3MUFA 4LZZA 4LX0A 2FDCA 1ZRHA 4Q1CA 1ZNWA 1KDTA 4FW9A 4EKDA 4HUTA 1OE0A 1PUJA 3HDTA 5L3SA 2OLKA 1JR3E 2IUTA 3DM5A 1HTWA 3F8TA 3ZS8A 1TADA 3QXXA 1G7RA 4IKEA 4IDOA 4DLRA 1P72A 3AEZA 4OJKA 4N0DA 1GWNA 1H8AA 1TF5A 2BBSA 5JI2E 2GDJA 4MGKR 1EG7A 5G3ZA 2FOLA 2C9OA 1U2RA 3CNNA 3P26A 3LXRA 2HYDA 4JL8A 2Y8EA 4JLKA 5EP3A 1IXMA 2C99A 1YZLA 4LDJA 5AR1A 3UPUA 4IHQA 4XWKA 4PSVA 4DUGD 4PC6A 5FPSA 3CRW1 4PX9A 4OI4A 2DHRA 3JZMA 5JI3E 3AGQA 4TL9A 4C3ZA 4QHTA 3VR4A 1HY3A 2CVHA 4QRHA 3KXKA 3H4MA 2ECKA 2GXSA 3KKOA 3N5CA 4URUR 1X8JA 1JPNA 1LV7A 1S3GA 2BBWA 4PC2A 1ZYUA 1LFDB 2XSZD 4KITB 2Z6VA 1DAKA 2JLSA 2P5TB 4DCUA 2O0HA 2D06A 4K81B 1DBSA 5FL7A 3P1JA 3L82B 3TW4A 3THWA 3Q8XB 3AGPA 1AZSC 2JJ1D 4TLBA 2AX4A 3A4MA 4C7NB 4X8OA 1F60A 1KIMA 3KKMA 5IT5A 2VRWA 1Z63A 1DE0A 4WW0A 5AUOB 2KI5A 3P8MC 1GIAA 1OKKA 3VMFA 4MDEA 4M1KA 4N1AA 4RD6A 5HR5A 5DI9A 1CR0A 2VP9A 2PMDA 3H84A 3WXMA 4ABYA 2WSSA 1G5TA 2CMKA 3I1FA 3IKJA 2JLXA 5EJEA 1TAGA 1ZBDA 4DRZA 1XPRA 3U61B 5BYJA 2GCNA 3NBFA 1CR1A 1SXJE 5J4HA 2WJVA 4TSFD 2LFRA 4X8MA 2EYUA 2QAGC 1DAHA 1Z8FA 3EWSA 4RFSB 4DVGA 821PA 4ASUA 4M1WA 3PUWA 3ZYCA 4Q1BA 5A5GA 3IILA 4FD2A 4GSYA 4PPQA 4FN5A 2FX3A 3CUEF 1R7RA 1BH2A 1N5IA 1GU4A 5E7JA 1CI6A 3D36A 1N5LA 1NI3A 2ZE5A 1WRBA 5P21A 1QHGA 4NMMA 3RS3A 4HZUB 3C8UA 3QSYA 5FBVB 5B1OA 1JB1A 5APTA 2CCGA 4NYIR 2G77B 4TMZA 5DHFA 2UKDA 4B3BA 5IF9A 2WAXA 4Q9LA 4KHXA 5C4MA 2ONKA 4QHSA 721PA 3PV0A 1OHHD 2XXAA 2Z4RA 2OAP1 4PC3A 3VMYA 2WIBA 2XITA 2ZRDA 1JI0A 3P4YA 1BMFD 2Q3FA 4Q18A 4CYMA 4G1UC 2WOOA 3G0HA 5D3MB 3QBTA 3R7WA 1YYCA 1I2DA 2X1VA 2H5EA 2HJVA 3BRWD 3THYA 3BJIC 1JNYA 3K0CA 2GKSA 4ZDJA 2FSHA 4ZV4A 1H8HD 1KI3A 4JS0A 1GK4A 1W0JD 3DKPA 2OZEA 5FBLB 2AN9A 4RESB 4QGGA 4HYYA 4PZLA 4E09A 3C15C 1XMSA 1E9AA 2G0NA 1MV5A 2QAGB 2WOJA 3IEUA 5KSPA 4DLWA 1O3YA 4L5BA 5KOYA 1KSFX 4B3FX 3B7GA 3KQNA 3EZ9A 4AURA 2KBFA 1GTWA 2XZRA 4OHVA 2GRJA 1T3LA 2HF8A 1QHHA 4TYYA 4NBSA 4LY6A 4RZXA 2ZEJA 4JJZA 3HR8A 1VYTA 3VTKA 3AUXA 3ZDQA 2GXQA 5K8TA 3U60B 2CHVA 3BE4A 4UXHA 5E7MA 3EIHA 1RVDA 3NEYA 5JS8A 3IR9A 3ZIAA 4A1FA 5BQ5A 1I2MA 4LUCA 3T1VA 2QTHA 2CNWD 5JMTA 2VF7A 3MJHA 5FPHA 3H86A 3O8CA 1HA3A 4M1SA 3I92A 3CO5A 4DCSA 1UFQA 2OV2A 2QM7A 1T2KC 4EQ6B 4KFRA 5EXTA 4WXPA 5AW3B 2BM1A 2PX0A 3ZH9B 4BLQA 1Z2AA 4Q20A 2JJ2D 4Q7LA 1Q1EA 5HE9A 3TNFA 5E4FA 4BLPA 2EQBA 5L3QB 3GLFB 2HV8A 2H18A 3L8YA 2BM0A 1XX6A 4RZ3A 3OEHD 4IEIA 2N9BA 5KSZA 2ZSBA 4ZCLA 3QXSA 2ZVPX 2WWIA 1SHZA 3QIAA 1WA5A 2Q21A 3M0AA 2IYZA 5LBIA 4JLJA 4LJ8A 2AWNA 2EWVA 2EYQA 1YZGA 2RGGA 4NCJA 1XD2A 1U99A 4WZAE 3U7FB 1NVXQ 4IOMA 4BECA 1LF5A 3QXCA 3GMTA 1EXMA 4D81A 3AP3A 1UKVY 3CPEA 3FE2A 2BOVA 4LGMA 4RKFA 3CM0A 4JBXA 4DT1A 1KI4A 3TNUA 4LYJA 2BCGY 5B57C 4MGYR 4BRWA 1D5CA 3NBXX 5L3VA 3U3KA 3GFTA 3RS7A 1NVWQ 1XCPA 3B1YA 1D6JA 3BFKA 5KPJA 1QG4A 2J41A 4QBFA 5L3SB 1I4LD 3LX8A 5DE3A 4ZI2A 2PJZA 5JSZB 3GJ3A 2PH1A 3UWKA 1DG1G 4M1OA 1ZD1A 5JCPA 2D3WA 3BXZA 1E98A 4PZZA 4QBHA 1ONBA 4KO8A 2IHBA 3LW7A 2ORWA 4LPSA 4NDZA 1G1MA 1QDEA 1OLOA 3B1VA 3BH6A 3QNUA 3EIEA 1XZQA 1TU4A 4QJ4A 4KLZA 1G6OA 4AKEA 1IOZA 4N0EA 4U7NA 3K09A 4V0OA 1SKYE 2R2AA 3BK7A 5ELXA 3CF2A 3GCGA 3QKRA 3QENA 3DHWC 4DLTA 1E0AA 4L15A 4TLCA 2G0TA 1AJEA 2O5VA 4HLDA 4OKSA 2QBYA 4B32A 1CJTC 1CJMA 3I5XA 4URYR 2QQEA 4DKXA 1GNQA 1U0HC 2DFNA 3K9HA 4TLEA 4D25A 1UJ2A 4JLAA 1MO5A 3GLIA 4ITRC 2YNYA 4C0SA 2GF9A 1GG2A 2VL7A 1IY1A 2ZI4A 1OB5A 2WSMA 3ZZUA 5C93A 1KHTA 1HQYE 4KI0A 5C4GB 3THWB 4C0LA 2N42A 4GNKA 3VQTA 1DS6A 4XD7D 3SJZA 3A58B 3NBYC 3EZFA 1XTRA 4GRAA 2HDNB 2H92A 2OLJA 2AXPA 4Q19A 5APXA 2NO0A 4ESVA 1PLJA 3GJ7A 3GJ0A 3NKVA 2ZUCA 2V7QA 2XNDA 1C9KA 2ZRKA 4A6XA 3ASZA 3I32A 3ZS9A 2WPRA 4MGIR 4A92A 3K9LA 4E5UA 3I8XA 1H65A 1I4DD 1II0A 2DPXA 2XX3A 1J7KA 1KMHA 3REFA 1FAVA 4EPRA 3KQGA 3A3YB 5TDHA 3DVLA 2WJGA 4V0MA 5AW0B 2XGJA 1XXHA 2JLYA 2QMHA 5CLLA 1NBME 1ZUHA 1YR8A 3K9GA 2YWFA 4NCHA 5AVTB 1SLQA 1J99A 5DSZA 1KO5A 5JBQA 1X6VA 2ZRBA 4YC7A 1CI6B 5D3QA 3R8FA 1T8TA 4DCVA 4DLZA 1R5OA 1MABA 2DY1A 3QF4A 2G88A 2FPKA 2IYSA 2Q3IA 3LBHA 5HCNA 5TARA 1Z28A 2QL6A 4P32A 2HJGA 5AW1B 2DFTA 2GCOA 421PA 2NO9A 3SYNA 3VKHA 2GETA 3FKSD 4MYHA 3FHCB 4TT3D 2BDTA 1E9EA 1BO6A 3A0RA 1JEDA 1JJ7A 1E9CA 1OV4A 1OT3A 4C0JA 1OIVA 4A4DA 1W0KD 3J81k 1C1YA 1ZC4A 3UIAA 1N6NA 2VP6A 1OXVA 3QVVA 3QVUA 5FBWB 3R7WB 3QOFA 4MUAA 3QPWA 3NC0C 4ARZA 3PEWA 3THYB 3GPLA 4QPKA 2XJ4A 4QGHA 4BFWA 4PSKA 4JJKA 5CK5A 5CDFE 4GPTA 3VHXA 2WTUA 4K8OA 1NF3A 3TVDA 1COWA 2NIPA 5UKDA 2B21A 1N6OA 1YR9A 4HAVA 4DCNA 2ZRIA 2FSGA 2PCLA 3UMSA 2NPFA 3TUJC 4B73A 1KI6A 4LYHA 1AS2A 4C7OA 3FPAA 4FIDA 3RSLA 3WYGA 1ETUA 5AVSB 4M9ZA 3U3MA 1EFRA 1ZM2A 2I3BA 2ANCA 1IBRA 1OYWA 1QHHB 4Q4AA 1PV4A 3DOFA 1AA9A 3RRMA 2OFWA 3T34A 3QG5A 1CJUC 4D4MA 4AKGA 2QY9A 3K0SA 4M8NE 4TTRA 4XE5B 1E0JA 1VCNA 3P27A 2EFGA 4B34A 2XJ9A 4I81A 5B2ZA 3MWLA 5KNDA 5A4JA 1R0WA 4QC2A 3CRQA 4BLRA 4R9UC 2C9NY 4LBWA 1TQDA 4R71A 2E42A 1KNQA 2OXCA 5LD2B 1A2BA 1F51A 1HUCA 2VP0A 2O0JA 3V4FA 4EFNA 3VU9A 1K8RA 1QHSA 1T9HA 2LFSA 2ZRGA 5B30A 5DN6D 4NYJR 2WWGA 3QY0A 4OHYA 5J4VA 2JLZA 3LWNA 3O8ZA 4A6PA 3VR5A 1G21E 1TF2A 4F93B 621PA 3KQKA 4RVCA 3A1UA 4AWXA 2ZJ5A 4RD2A 2YHSA 3UWOA 3T5GA 4IXNA 3I4LA 4S35A 5CIWA 1ZCBA 1P9RA 1T5LA 1KDRA 2VP2A 4M4SA 1ZM9A 1XFAA 2CL6X 1XD2B 3OAKA 2VP5A 3LY5A 2HXSA 2IXFA 1RKBA 2OUKA 1QHIA 2J87A 4C0QC 2EVWX 4G5OA 4HSEA 3RC8A 1JOYA 4Q02A 4LSGA 2IXGA 3IQXA 1OYYA 4JKYA 4BQSA 1P61B 2MMGA 4DT1B 4AG5A 2W6IA 2ZRJA 2QI9C 1GKIA 4UKDA 4JLBA 1TQ6A 4CT4B 1NY5A 1FMJA 1AKEA 3DEFA 2C5LA 4R98A 4I1SA 4FMTA 1MR3F 4WIAA 4MDFA 1T5IA 3FGNA 3OFNA 4TN1A 4HDOB 5J5CA 1R6BX 3UKDA 1FL9A 3A4NA 2IYWA 5J40A 1IXSB 2GXUA 3X1XA 4B43A 3L8ZA 1IN6A 1JEEA 2HLDA 1RRCA 1FQJA 1Z0DA 1JQLB 2QENA 3GP8A 3ZCCA 3T1TA 4ZKIA 5FOWA 1IQPA 1A02J 2NOAA 4RCZA 3ZVLA 2ZVQX 3DZDA 3TRFA 4B3DA 1U8YA 3OAAD 2FNAA 1RPZA 2GHIA 3FMIA 1G18A 3ZVNA 3QKRB 1QBKC 2IPPA 1D9ZA 4DDVA 4JZKA 4GMDA 4TLDA 2JASA 4YMUA 3LQRA 1VECA 2FU5C 3FFBA 3P4XA 2AD5A 4HAXA 2PZEA 2C8VA 2R6AA 5JWOA 2QBYB 2ZYVX 3ASYA 4B3XA 5GJBA 4Q7KA 3SFZA 3DO6A 1NN5A 3GEHA 1GTVA 1NRJB 5FTJA 2OILA 2KJQA 4FI3C 4JSYA 3VHLB 2A5DA 2F43B 1E9BA 4HB2A 4K46A 1XMIA 3C5CA 4OK6A 1HV8A 3PG5A 3GLGA 2JJLA 1MFZA 1NLFA 1G5RA 3AQ4A 1U9IA 2IYTA 1E2MA 1TEXA 4B86A 1EK0A 3GFOA 1NN0A 3NMDA 1AM4D 3BB4A 2AFHE 5TV2A 4US1R 4YDHB 3A7OA 2ZJBA 3F5FA 5BW8A 4YMVA 1R4AA 1NVVR 4RFVA 2QMOA 1GK6A 2FF7A 2WJYA 5DIFA 2IWHA 3EG5A 1OH6A 1Z0FA 2IC5A 3IPXA 3MCAA 1L7VC 4AIIA 1GOTA 4NZYA 2YC2C 5AVVB 2YOHA 4BLSA 2PT7A 5FL7D 2ONJA 1OIXA 1IJFA 5C2JB 4MTXA 2ZJ2A 4DEXA 4WAUA 1KK3A 1OXXK 5FBQB 1HYQA 2NQ2C 1S1MA 4ZDWA 2QPTA 2RB4A 3F0TA 5AUPB 4BIUA 2YVUA 4KV9A 2J0SA 1XNJA 1P9WA 3AKYA 3GJ4A 4HLCA 5J4LA 2XZLA 4I2LC 1OKKD 1ZCAA 1XXHB 2Z83A 3G5UA 3TMKA 5AJWA 5E95A 3W8RA 3K70B 5AW7B 1EWQA 2FN4A 3BFVA 4JYBA 2RCNA 1W2GA 1AGPA 1Q3HA 5SZHB 2FPLA 2GEVA 2WSSD 3AKCA 1F6BA 4HATA 5FL3A 1IO4A 2B6HA 1P73A 4D2IA 4LYAA 1W2HA 3LIDA 2QUZA 1MABB 2WPDA 3GJ5A 3QF4B 1UPTA 3DDCA 3QJYA 3VN0A 2A78A 2UVQA 2YZ2A 3JVVA 4NE2A 4OQFA 4C0KA 1CIPA 3LRPA 2DYKA 5K8LA 3U4QA 2NO6A 1T0HB 2GAOA 4TWZA 4BLOA 2ZU6A 3KDSE 4LI0A 4ASUD 4Q66C 1T8UA 2JIZA 1XD8A 1XWIA 2WPSA 5H8WA 1OSNA 3BAFA 5FPTA 4G3XA 3CF0A 2PZFA 1W1WA 2FPMA 2RGNC 4Q1FA 4UNQA 4F7WA 1F3OA 1G7TA 2FV8A 4ARZB 2ZJOA 2QP4A 2VPPA 5KDDA 4MH0R 2GVDC 4MYCA 5CJPA 1S0UA 2QPAA 1RRPA 3L0IB 1N6LA 3AP1A 3IGFA 4M22A 5CK4A 3NDBB 5EZ6B 1WE2A 3NHBA 1IY2A 2VHCA 4EFMA 3MSXA 4X8LA 3KL4A 4FMDF 4HYTB 2JDID 4Z8XA 2F9MA 3AP2A 4AYCA 4II7A 4RKEA 2W6AA 2DBYA 3L37A 1RYHA 1KI6B 2ZTSA 3UMFA 5HKKD 3U6BA 4C7OB 2XAUA 3DMDA 1JBKA 4Q4AB 1KO1A 1NMZA 2CXXA 4P3YA 4V03A 4LV6A 3WMFA 2ZE7A 2IF0A 3V5BA 3OEED 1Z6GA 2LCFA 2ZXUA 5EP2A 2YOGA 1F48A 4LWZA 2OCBA 5KSOA 2N46A 4BFZA 1N2CE 2GA8A 2JLVA 2A9KA 1W47A 1Z22A 3OIWA 2FEMA 1L4UA 1G5PA 1Q1ZA 3H0KA 5DGXA 4US2R 1JAHA 5FR2A 3U7GA 3KJIA 2YYZA 5EE9A 4Q4JA 2FTKA 2LKDA 1P9NA 1HT2E 4GKGA 2NTYC 3IIJA 3DM9B 3KJGA 2ZR7A 2ZRFA 3VU9B 3NHAA 1ZIPA 2EFDB 2ZETA 4Z54A 5J4KA 3KUDA 2BJVA 4M9XA 1I4TD 1OF1A 8OHMA 1XEWY 5HZKA 3ZRWA 3L36A 1N5JA 4JL6A 5GJWC 3AF4A 4FMDB 4LV8B 2QP3A 4RZ2A 2ZRLA 1OFUX 1E79A 1Z47A 5HE8A 4PAOA 3A8TA 5EXSA 4GCZA 3KXLA 3HJNA 4KFSA 1DTSA 4ZO4A 1W36D 1JNMA 2GZDA 3LDAA 2O8BA 1D8TA 3QKSA 2ZITA 4I5SA 3LVRE 1MRNA 2W27A 4YMWA 1UEJA 1XEXA 5KYKA 3CPJB 2IWRA 1Y3AA 5KSYA 2F1RA 1KDOA 4KYIB 3TBKA 4TYWA 3AB3A 3ZZTA 4G0NA 2J45A 3HE4A 4DSOA 1IONA 1J2JA 3EWAA 4HZIA 3LIEA 1E1RA 2RGEA 1IN8A 3LFUA 3QG1A 3SS8A 1U9IC 4HUQA 4S2EA 2YWGA 1G8HA 4PHFA 1SULA 3IUYA 2XOKA 1UDXA 4JSTA 5FTKA 3QXJA 1DVRA 2KBEA 3PXGA 2F55A 2BC9A 2Z43A 3RRNA 4TTPA 5H70A 4A2WA 1KSJA 1S8FA 2ZRPA 4P4TA 4B6EA 4IEEA 3OHMA 3RHFA 1E2IA 5F3WB 1JPJA 5K8IA 3ADCA 1M2OB 4JVMA 4EAQA 1NSTA 3HPRA 2DB3A 3VNVA 3ZRXA 3KQLA 3CR7A 1G3RA 1Z06A 4MITA 1OJLA 1NL3A 2R6GA 1JXOA 4A82A 1XCMA 2CL7X 3KKPA 4BFTA 2YC4C 2ASEA 4O2LA 2W6JD 2C78A 1V5WA 2FZ4A 2PEYA 3C7KA 5F9FA 2QT0A 3HE5A 1QHXA 3O8DA 5CJ2A 2F3TA 3B1ZA 2BEKA 4LHYA 3DOEA 4LRWA 1X1RA 2QPOA 1E1QA 2B7BA 3AVVA 2ZI6A 5FOVA 3EIQA 3M4YA 3CRVA 4P4SA 5BN4A 1KJWA 3ND9A 3NFQA 4OQXA 2ZJAA 3QEOA 4OQNA 1CKEA 2QU8A 2ZM5A 1NMYA 2QRNA 1KZGB 3VMXA 2O0KA 2VHTA 2X8AA 4HB0A 3GLGB 2IS4A 1MUUA 4HAUA 1E2JA 1P2TA 3SZRA 4ACAA 2J7PA 2GF0A 3OIVA 2WZQA 2REOA 4PAQA 4TL7A 5FFMA 3LLUA 1E9FA 3QPUA 3BD9A 3BH0A 4D80A 3Q85A 3RABA 4XTCS 2BBTA 3U44A 2G6BA 4RSGA 2VH5R 1Q44A 1YHNA 1VPLA 4HLQB 5IDJA 1XJ0A 5KO2A 2Q6TA 3D7MA 4URXR 3WRYC 2YWHA 5DH9A 4JLOA 3FB4A 3CNLA 4Q4LA 4F38A 2RAPA 3T06B 3VKGA 2Z5FA 2HUPA 3AF3A 3UANA 1E2DA 1CRQA 3E1SA 1P4SA 1XEFA 2YJTD 4Q48A 3VNUA 1WP9A 3L0PA 5DNYB 1GRRA 4Z8YA 5SZIA 4B48A 1UADA 3FMOB 2AXNA 4KAXA 3M9HA 1ODFA 3GLFE 3ICQB 2ZYUX 1SXJC 1ZUIA 3ONWA 1SVKA 5JHGB 1E2QA 4RD1A 1SHKA 3R9XA 1MKYA 4PTLA 3A4LA 4POAA 3KFVA 4PXAA 4KHZA 3AF2A 2C9YA 3MJRA 4BFSA 3C16C 2GESA 4A36A 4PO9A 1KK0A 2ZROA 2X2FA 4P31A 3WMEA 3U4QB 4C0HA 2G9NA 2I1QA 1E96A 4F4IA 3K70D 4B76A 2FFAA 3EA5A 1P2UA 4A2PA 2XZPA 2WPQA 2OXRA 1JECA 4TMTA 5L8VA 2QN6A 1GNRA 1ZC3A 1XMJA 1FP7A 3LW8A 4JBWA 1OH7A 4BZPA 1H88A 1XDBA 1Z6XA 1NSFA 2AD1A 4MRPA 5AVRB 1FPMA 1XTQA 1EFUA 1KAGA 3OIUA 4FMBB 3PUYA 2ZI3A 2V6JA 2OEPA 1PLKA 3AVPA 3QUSA 1KO7A 1W49A 1TUIA 3BWDD 4Q9HA 3Q5EA 1HQCA 1NWQA 5EE1A 4U00A 2YO3A 2LKCA 4CW7A 2C95A 4Z1MA 1KMQA 4JVNA 5IK2D 2CHQA 3LQQA 3BFXA 1MO3A 5JS7A 3QEJA 2R62A 3QKTA 3TQFA 1J90A 521PA 4B44A 5CYOA 1COWD 5K8UA 1KY2A 5GVSA 2P3SA 3UG6A 5KNBA 4AK9A 2QNRA 1Z5ZA 3NH9A 4I1VA 4E07A 1TU3A 3EC1A 2OFOA 1P2SA 3IHWA 1YR7A 2VO1A 4QL3A 3RWMB 5CM8B 1EESA 2IYRA 4TQAA 1ZD8A 2J46A 1EFRD 3AF0A 4Q4JB 3LAWA 2OFXA 4JIMA 3V4RA 4HAYA 4ON9A 1E2NA 5EXPA 5GJVC 4E22A 4B35A 4ZKDA 5CMZA 1LS6A 2XB4A 3TSOA 1R8QA 2ATVA 1Z0KA 4M1MA 4AQRD 2PJRA 5A0FA 4YXWD 1FZQA 4EJSC 2CCKA 3ZRWB 3WNBA 4EFLA 1K6MA 1UM8A 3Q72A 3SEAA 1GNPA 3NVAA 3WYFA 2F6RA 4UNSA 3AVYA 1M7GA 1OXUA 3IIMA 1Q3TA 4JBYA 1BYUA 5CDFA 3X1YA 3CZQA 3HR7A 1BOFA 3I3SR 4L16A 5B1NA 2R8RA 2O8BB 3LLMA 2AFIE 1U8AA 3QKSB 5G53C 4KP4A 4PPFA 1VYVA 2CE2X 1WCV1 2BMFA 2PCJA 1XEXB 5DO9A 3HU3A 3CX7A 1KTVA 1U94A 5H1YA 3BS4A 2WJHA 1PVOA 3WBJA 2EU8A 1NAFA 1ZNXA 2ZR0A 2V4ZA 3A1VA 3HE4B 3QXHA 1VIYA 4DDTA 5APWA 4H1VA 4HUQB 2ZIAA 3X1ZA 4EDHA 2B7CA 2CLCX 2JJ1A 3WRXC 1QVAA 4M9QA 4IOJA 3CWQA 2OM2A 2FGKA 3RNLA 4NKRA 2J0VA 1R0YA 1F2TA 3MWJA 5SZKB 5CB6A 1GRQA 2GEDA 2OG2A 5CITA 5HPYB 4PC7A 4LJ9A 3M9BA 1OXSC 3TSWA 1KKLA 4A2QA 2W6ID 2D2FA 4ACBA 1O87A 1WMSA 3GJ8A 2ZI5A 4MYUA 1OPXA 3MG9A 5EP4A 4Q9IA 1M7BA 4U7DA 3IO5A 1FNMA 2FG5A 1OIWA 4CIDA 4ILEA 3MGNA 3BBPA 1NMXA 5C18A 1PZNA 2CDNA 2CL0X 2FJUA 2DWQA 3R20A 3GJ6A 4ZDIA 5BXQC 2HT1A 2AK2A 2VYFA 3HE5B 3A2AA 1C4OA 4G5RA 4KFUA 5JWHA 1YE8A 3Q9LA 4HB3A 4RJLA 3PCRB 1YQTA 2VEDA 4GOKA 3U7EB 4QBGB 2RKOA 3P32A 4MQBA 1NN3A 2RGCA 5KDLA 3FDIA 1KYIA 4TMKA 2VSXA 4B75A 3KKNA 3W5JA 3PEUA 1H89A 2OESA 1UBCA 2J59A 3W3ZB 4M1TA 3SU8A 4XVUA 4DSNA 2D4HA 2W0SA 3LXXA 4OJQA 5FI0B 1YZQA 3WMGA 1R10A 5AJZA 3TLXA 2GWHA 3ZQJA 1OHHA 3TH5A 4F92B 5CLQA 3U3JA 3U44B 4ESHA 1GZLA 4GP7A 2GCPA 4LBYA 1BMFA 2WMOB 4IOKA 5JFGA 4TYQA 1E2PA 5JHHB 1JJVA 5FPYA 1G8PA 4PO1A 2QT1A 4QJ3A 2A5YB 2WKPA 4G5SA 2CK3D 4BASA 1G291 2C04A 1DARA 2OCYC 2Q3HA 3W3AA 3GQBA 4KXFB 2RGBA 3VR2A 1H8HA 4Q7JB 1LB1B 1FW6A 1E3MA 5SZJA 1AZTA 2BMEA 2OCPA 3CH5A 4JYCA 4BEJA 2WKQA 1Q12A 4M1YA 2XXAB 5AWFC 3GLHA 2E1RA 2CLDX 2IS6A 3E2IA 4Q4HA 1H8EA 1JAIA 3AVOA 3ZVMA 3B60A 5EE3A 3IHLA 4PANA 4OK5A 2ZS8A 1E32A 2JA1A 2V9PA 4L9SA 4QG7A 4LOAA 1ZM4A 1QVRA 4JLDA 3EPJA 3WYAA 4W5WA 1XB2A 4KODA 1AQUA 2FFQA 1IN4A 4OBEA 1W4AA 2JEOA 4XJXA 5E7IA 2WAYA 2IYQA 3IPYA 2D7DA 2QZ4A 3PUZA 2A5GA 1GAJA 2WWXA 3VFDA 4WZBE 3PITA 4I4LA 2H8KA 4LC0A 1XTJA 1W4CA 2FSIA 3ETLA 5FI1B 1FNNA 4YQFA 5CB8A 1IJEA 1VHTA 1DH3A 2REBA 3IEVA 1G41A 4YLGA 4QGFA 3KQHA 1SVIA 3B2EA 2MSCB 1RJ9A 4PC1A 1GU5A 3CRMA 1M1YE 4JT4A 1E2EA 2ZYTX 3RSOA 3VR6A 4JASA 2UZIR 1N3BA 3PJRA 2H1LA 2JIZD 3OEHA 5AJXA 2EFEB 1U98A 3WY9A 1CU1A 3SHWA 2H7HA 1VHLA 2RGNA 4CEJA 4LBVA 4DB4A 1BKDR 2Z5IA 3QF7A 2ZE8A 3T35A 3BH7A 3DPUA 4EUNA 1IM2A 5FOTA 4NONA 2A2ZA 4EIWA 1FOSE 4NCNA 3KDPB 3DKVA 3KJEA 3EPLA 3IO3A 5JRJA 2PLRA 1BS1A 2ODWA 2F1HA 1JQJC 1KK2A 4DZOA 1BIFA 1SQ5A 3Q5DA 4LJ7A 1KO4A 4B2LA 4J0QA 3WNDA 2R32A 3A1TA 2CLSA 1S9DA 4JLNA 4XIGS 5APYA 3TNUB 4WXRA 3UIEA 1T3SA 2WKRA 1SVOA 4Y0AA 1WBBA 5FBRB 1HT1E 3CBQA 5HZHA 4GL2A 1OB2A 4OHXA 4TMWA 1HWTC 1LVGA 2FFBA 1EFTA 2H17A 1GFIA 5AUQA 3EPHA 4HAZA 3AVUA 3FKQA 1PJRA 1X8KA 2R44A 4HLUC 4LJ5A 5F2EA 4NP6A 4DSUA 1TX4B 3ZD7A 4WA7A 4W5HA 5FUYA 4EOTA 3B85A 3BORA 5APQA 2FMXA 1RW4A 2ZRMA 4XOIA 3I62A 1L4YA 2B92A 5AW4B 1AN0A 1VDZA 2WJIA 1Q57A 2W2VA 5GADl 3DMNA 3T1OA 3ZQ6A 3PFIA 2E9SA 5E3HA 4JMPA 4D4JA 3ZZ0A 3SYLA 4ZKEA 2ZR9A 1UBEA 1Z6TA 4PFSA 1GL7A 2KWIA 3JZAA 2DWPA 3A1SA 3HP1A 3NTNA 1MOZA 2QTVB 1CSBA 1E94E 1Q21A 3SBEA 1T2KD 2VIIA 1J70A 2BBOA 3EA0A 2EW1A 4HI0E 4XD7A 3RC3A 4DBLC 1F2TB 3M0DA 1S9KD 3B13B 4JAUA 1M7HA 2IT1A 4HDQB 5C1BA 2G3YA 1G64A 1Y63A 2ORVA 3CONA 3K0AA 2LWIA 1NJGA 1ZP6A 4GFDA 1D2MA 1UAAA 2XB2A 4KBFA 3HWSA 3GLIB 2BHRA 2WVJA 4OI0A 3SE0A 3R9WA 4CEIA 1NG9A 1J8YF 4LV5B 4PO8A 2Q9AA 4AC9A 3FFAA 2V1XA 2ZJ8A 4QFMA 5TY0A 3B78A 4CRWB 1CXZA 3KB1A 1N6HA 1E4VA 4XSGA 5IDVA 4WZ6A 4NCIA 4RCYA 3TKLA 1G3IA 2X19A 1A7JA 1CP2A 1JR3A 2BMJA 1G17A 2WWFA 1D9XA 1E69A 2VQSA 3LA6A 3ADBA 1KK1A 2ZRAA 1DO2A 2QQ0A 1CJKC 1R5NA 2K5UA 1VCMA 1G19A 3MAAC 4TL8A 5AUNB 3VAAA 2CHGA 1YKSA 1KMHB 3QE0A 4IFEA 5EXXA 2H16A 4ZPXA 3SQXA 1YZTA 2H57A 2IHYA 4AG6A 1F2UA 1TMKA 1U0JA 3NG1A 3K8YA 1E1QD 3FKSA 4TT3A 4PZYA 2B8TA 2WHXA 3RAPR 3B6EA 4TL6A 1YZUA 2XZOA 2Q9CA 2L0XA 2QORA 1G6HA 1W0KA 3FTQA 2YOFA 4RZUA 4DJTA 2W0MA 2QMUA 1M6NA 2IYYA 4V0KA 2HF9A 3TUIC 2J7PD 5AVWB 2XTMA 1TPZA 2GCOB 5GJCA 1G16A 2IUUA 3T12A 4CZ2A 4NU0A 4JVLA 1YR6A 1XMVA 3GLHB 3Q7PA 4C46A 1NN1A 3FVQA 3I61A 1M34E 4Q4HB 2QSZA 4BPBA 1OW3B 1GL9B 3AVTA 3WBKA 1DAIA 3UATA 4BIZA 2RH5A 2ZS7A 3VMZA 4LCBA 1IHUA 1AIPA 1CZQA 5DYGA 1KSHA 4A15A 3CIOA 1UEIA 3ZLJA 2O8FA 1GDDA 2R5DA 2CCJA 1TTTA 4U7OA 1T0JB 3THXA 1XPUA 2RMKA 4LJ4A 3HU2A 3W6NA 1E2FA 5LPNA 3MD0A 5BWMA 3VYIA 1E2KA 1UBGA 1IN7A 1RIFA 4TZ0A 1SXJA 1GKUB 1NLYA 1TL7C 2HEIA 3IBGA 1DG3A 1GUAA 4NL4H 3UG7A 2JLQA 3O8RA 5AK0A 4P4UA 2ZAOA 5IRCD 1UKYA 2IS1A 1RJ9B 4HAWA 1SVMA 4ZDKA 5AVXB 3I5YA 1SVWA 4CF7A 1FX0A 1QHYA 1UKZA 1ZW6A 1Z29A 2RGAA 2V1UA 3OESA 2GILA 2AHOA 4GBMA 4EPWA 2E87A 4DLYA 3N2IA 2NO1A 3LH5A 3TE6A 1KJYA 1N6IA 4PQRA 2DFLA 4DEYA 2O52A 1FQKA 2ZPTX 1P7CA 1XU4A 5EP1A 3BGWA 4DHEA 4KU4A 4EQ6A 4CEJB 1NP6A 3EAQA 2GJKA 2X2EA 1DADA 3THOA 2OBMA 4U02A 4O2RA 1W7AA 5AW6B 5HCIA 3IBYA 3ZIAD 4IVRA 4FCTA 1GZSA 4MKHA 3I8SA 3RWOA 2FWRA 1EGAA 3OE7A 4KVGA 4JVSB 5IHPA 4EPXA 4IVQA 3SJBA 3AVWA 4Q9JA 3VX4A 4Q00A 3LNCA 3EZ2A 1SVSA 3QPVA 1OH5A 5F98A 3WP1B 4MKFA 4Z1MD 3D6TB 4TTQA 4PPNA 1Z08A 3FYHA 3TJZA 3VX3A 4C30A 3W8NA 3C5HA 1L2TA 1EX7A 1II8A 3KZ1E 2V54A 3GLGE 4L9WA 4JLMA 4RD3A 1P3JA 1MO4A 1E4YA 4DZZA 4RD0A 3SBDA 2F7SA 2Q0HA 1RFLA 4V0NA 3SNHA 2GZHA 4B33A 1KGDA 1V43A 5APUA 1S2MA 1Q1BA 2F3RA 2GJSA 2VSFA 3QBVA 4EPYA 4F91B 3B5JA 3OAAA 3PEYA 1KKMA 1X1SA 2P6NA 3NDPA 1XCGB 1A02F 1N6PA
chains in the Genus database with same CATH superfamily
3ENQA 3EFOB 1PNLA 3EZLA 1T3UA 5BW6B 1GGFA 3ESAA 4K6GA 4DDKA 4H3VA 1LW6E 5BSVA 2AKEA 4BGVA 2D62A 1RHRA 1N75A 1C8VB 1SUEA 1Z45A 3A9VA 3P9SA 1PGNA 2Q7CA 3B2NA 4XSHA 3HKBA 4DWVA 1PQUA 4J0KA 5AVQA 3OLWA 3ICOA 2OT5A 3Q4GA 1DC6A 3ZHTA 3NRBA 3V97A 1AILA 2WT7A 3H83A 5F7XA 3CGWA 3ZV6A 1PT5A 3L74H 2QYHA 1LTHR 4E2WA 2XF8A 2XNDD 4GOOD 5DPMA 1S8AA 5LA6A 3NHSA 3V00A 2XTNA 3L7OA 1LSJA 3U3DA 4URWR 4IKPA 3SJCA 2ZANA 1P2VA 3CPHA 3E7PA 5AVOA 4LISA 2OP1A 1WXQA 3C5EA 3KUXA 4EDFA 3MT7A 1H8ED 1ONSA 3R44A 4L57A 3R6WA 1KZ1A 1NPTO 4LMBA 3UJDA 3RVYA 3RW0A 4AY3A 4Y1RB 4XE5A 5FA8A 3V7FA 1XAIA 2JGJA 1KJ9A 4RY0A 3OFSA 4C4PA 4I7ZC 2GM4A 1O95A 1DAGA 3H1HJ 3B7WA 1LW7A 3C9IA 2AN1A 2D1TA 1TAUA 3VR1A 5LGTA 3HA3A 3K20A 4YCLA 2QTRA 3WYDA 3CRNA 3FZEA 3GEEA 2P2SA 3BWVA 4QG3A 4B47A 2GWRA 1OJHA 1J1IA 2FH5B 1E1MA 2ZRNA 1XHEA 5BN3A 4YXFA 4J8PA 4URZR 2I7XA 4LJKA 2A9HA 1Q20A 1H1LA 1S1CX 2PUTA 4IXMA 1WB9A 2QP9X 2GEUA 2R3CA 5H4GA 1R5BA 4ZCRA 4JQYA 1L5RA 4MV8A 1DF5A 3ENKA 3HRKA 3SQWA 4CUKA 5BY1A 5CVUA 3M8AA 1BS3A 1EFCA 2H1WA 2P4UA 2YIUB 2M1XA 3PPVA 1ND5A 1DMRA 1KI2A 2F43A 4AQDA 1JW9B 1B6SA 4J1TC 4V39A 2V7QH 2WIAA 4R7ZA 3KR1A 2PMFA 1Y8ZA 3RWRD 4LXYA 1ZM7A 3KAQA 4X3CA 2LGQA 4GZ3A 5BSUA 2FZLA 1Z0JA 2IY8A 2WYIA 2G08A 3GW6A 3W7BA 3SOPA 1DRVA 1DJNA 3WYEA 4GKKO 1I1NA 3CCLV 2JF0A 3VYVA 3A6JA 3TGPA 4DS3A 1M0SA 5FV4A 5E79Z 1CR4A 2PT5A 1I1QB 5JTUA 2NU8B 2PLAA 3NO4A 4KDFA 1WUIS 4HL6A 1HE8B 1CERA 2O1KA 1L4NA 4YJGB 1KI9A 4IDHA 3B9BA 4R01A 5B3SC 5DRYA 1O95C 1NYLA 1L7XA 2ADQB 3HBAA 3BOSA 3FPFA 3SGLA 4D4KA 1BDHA 2M6LA 5CRIA 4IIYA 4CF3A 4DABA 1WXEA 4R6XA 5FA5A 1Y76B 2DTDA 4JAVA 5BRAA 2XT6A 5JAPA 3PN1A 5WRFA 1ZOLA 3ADDA 4BGDA 5COQA 1YITV 4A8PA 4TX1A 4LHVA 2F2TA 4L72A 5B1EA 4QBTA 1YHYA 1BGYH 2BR4A 4IILA 4G65A 1SVFA 3RC2A 5K6RA 2GJAA 3PGXA 1XL6A 4C7XA 3MYYA 4I2VA 5ANRB 3ETQA 5JS6A 3C5VA 2CYCA 2J3LA 4EI7A 3Q5GA 4QDTA 3ZY4A 1FP6A 1UBNA 4E2XA 1Y4SA 2CVQA 1YRLA 4DIBA 5M04A 1C5KA 4CHGA 2HY7A 3IAAA 2QRVB 2X4LA 2Y0PA 4AUMA 4KQ6A 3NIFB 3D5QA 4B3RO 4QDOA 1DCMA 4DO2A 1PRYA 3LUTB 2YHIA 5APSA 4ER6A 2QYTA 3K6SB 5AQEA 5ALHA 5CJ4A 4XJSA 1AHPA 2HX1A 1H5NA 4PQYA 1GN2A 1VIMA 4MYDA 1A88A 1CS4C 1QGYA 1JVBA 3C3WA 4JQZA 5HX7A 4Z4HA 1W46A 4LJYA 5K4HA 4NZ9A 1IU9A 2A7XA 4EY5A 3Q0EA 2JI7A 3B38A 3EWKA 1K6JA 4AD8A 2LGJA 2WMNB 3C3XA 4TRNA 4OA8A 3FF4A 1VQ1A 3I64A 1B42A 3D4BA 1M8GA 4J07A 1BGVA 5A6SA 3DQQA 3NBMA 4R8LA 2XKJE 1ZWIC 2C07A 2GFHA 1JA8A 3TQTA 1FS5A 2ILTA 4XYGA 2OHFA 2PT6A 1QE0A 2AR7A 4JAVC 4MB0A 3AG1B 1B0ZA 2JGAA 3QYAA 4DFDA 2WWWA 1B0UA 1NVVQ 3VZQA 5A0TA 1SS3A 3CEHA 4MNTA 2GPSA 2Q6KA 1E2LA 3JC22 1HG0A 3OJOA 4L28A 1NZJA 1Q11A 3H9UA 3SCZA 1DG9A 4IICA 2FKAA 1QMGA 5ADHA 4D44A 4RZIA 1DJOA 3LLSA 2GKOA 2YL2A 4B0PA 2QDXA 1AA6A 3C3SA 5HGJA 3T52A 2HI0A 4QQKA 4B2YA 3L7LA 3FMFA 4KWTA 3CNQS 4B5KA 3C14C 3WLFA 3BIOA 4HBZA 2HH9A 4KWHA 4L4UA 3L41A 4X66B 1NGMB 4ER0A 1H3NA 2W2LA 3QU5A 5A3JA 2ISSD 3CE9A 3G8DA 3V9PA 1QGED 3DAPA 1R6KA 1RR6A 4UEQA 1CC1S 4JR1A 4DV7B 2ZYGA 3G23A 1S8NA 4LDPA 2R8EA 4UUBA 3O9OA 4LX0A 5DX1A 3OHPA 1PTJA 1PEKE 5G3ZA 4DJFC 5BWCA 4OX9Y 4OXRA 4QVIA 2EGHA 1IM8A 4UD6A 1IG0A 1YZLA 1LTAC 4FZJA 3GEGA 4CMHA 1GJRA 3CRW1 3O9MA 4PX9A 2ICAA 2WJ3A 2J9ZB 3DYBA 1X8JA 1BRTA 5BSTA 3AM5A 2WQZA 3JPYA 1QIHA 2CMFA 3VQYA 1VSVA 2ZYHA 3V4LA 1K05A 1PIWA 5AUOB 4MP8A 3SWKA 3P8MC 3STHA 1X9GA 1OX4B 4WBNB 1CQXA 3I04A 2Z5UA 3BWCA 2CDCA 2GR9A 2JLXA 1SPXA 4Z9AA 2L5GB 2NV2B 1A9PA 2OA0A 3DVAB 3ZYCA 3IILA 2XYPA 5E7JA 4F2HA 2HBZA 4BO3A 1W4LA 4F3RA 3SXUB 1PL6A 3VDXA 5TQ0A 5LUAA 1DKMA 2OAP1 2XITA 2DLCX 3CLTC 1NTKJ 1JWAB 5T64A 3GC6A 3W1VA 2HJVA 3PYLA 2GKSA 5ERGB 3VR2D 4JS0A 4YEDA 4YAWA 5KLIC 2ZJFA 2P22C 5U9CA 5IARA 5IULC 1L5SA 3OH8A 2F23A 5T41A 1J8DA 2QV0A 5A62A 3AEKB 2QD1A 4OYRA 3ND5A 3EIHA 1RVDA 5FPHA 3G71V 3I92A 4H13C 3ZGOA 3WNVA 3BD8A 1PTJC 1M56D 4Q7LA 5HE9A 4IEIA 1CEYA 2ZSBA 4CF6A 1WXGA 1SZTA 1TEHA 3M0AA 5KKZC 2L82A 1LJ2A 4N21A 1Y9ZA 1XLWA 2CNBA 3F4KA 1UKVY 3E9DA 5LGUA 2P2NA 4ZTZB 3R0ZA 4TXLA 4REOA 4ZOQI 1JY3O 1XA4A 1FDUA 4GECA 3Q1MA 2JK0A 2H94A 4KQCA 4UHEA 3BXZA 3H5IA 4QBHA 4NDZA 3G7UA 2P9BA 3RC1A 2W2QA 1IN1A 3FYDA 2JFGA 4L15A 2G0TA 1NVKA 1XN4A 4H1HA 1Z7YA 1CJMA 2EHDA 3L75E 3ST7A 5FLXN 3OTHA 3WLKX 2WHEA 2YNYA 3S40A 5DNVA 3E8GA 3OPYI 4BQEA 3VQTA 3A58B 1P7WA 5BVGA 1M66A 3B3QA 2MWMA 5T3UA 2VAMA 2ZZKA 3FFXA 4YTPC 5K0BA 3OOHA 2AG1A 3ZE6A 3DCJA 3OMAB 4U3FJ 4ZVUA 5KTOA 3DWIA 2A94A 1BC5A 3AG3B 1XYGA 2J5RA 2LV8A 3WL6A 5KBYA 1FTQA 5B7QA 5C5CA 1R5OA 2FI1A 3HKCA 3MINA 1NE2A 2B34A 1KQFB 3EZGA 5GP1A 3A0RA 1KYZA 1C1YA 1XDCA 1OXVA 2EZ9A 2K37A 3GARA 5FP0A 2QE6A 4JJKA 2QLFA 2NUPB 3SFEC 3CC7V 5FUBA 2HZBA 1X9IA 2M3EA 4EX7A 3KOYA 3U3MA 5ECGC 3GA7A 2XMGA 4WY5A 4XJTA 1Y98A 3IOCA 1M5IA 2V0GA 2P75A 2C9NY 1QE3A 3LT1A 2FRVA 3OA2A 5B30A 1LT9A 4AUKA 3F9IA 3HE3A 1VQLP 4DQUA 1BHSA 2O50A 3P0EA 4QBKA 2QWRB 1Q90D 1UPFA 1N32O 2GH1A 1ZJ5A 2JNWA 4INAA 3BUSA 2EVWX 3NWBA 2VZLA 1E6MA 1B93A 1FC0A 3I2YX 4ZXFA 2JH9A 1NY5A 3G4SV 2C5LA 1Q43A 3CF4G 4WIAA 4KQJA 4MDFA 1M1YB 1QQTA 3K31A 1IN6A 3LNMB 1LPAB 5HIMA 2ZVQX 4EQZA 3PF8A 4CM4A 1T43A 4TZTA 3FZQA 4IHJB 4OUKX 1CVLA 2ZYVX 3DE6X 1X77A 2UYYA 1RYYA 1ECGA 1V1MA 4HB2A 1M6YA 4GPZA 3TWOA 1BE6A 4Z7OB 2I6FA 2H4XA 1NN0A 1DCFA 1AHHA 2ZJBA 6ADHA 2ECQA 2IWHA 2VSNA 5AVVB 3ZRSA 4DEXA 4MWOA 3KPUA 1EX1A 4LX8A 3F0TA 4RLHA 3TCNA 4E4YA 3ZU6A 4I6EA 3AECC 5ELLA 4OXKA 4GXTA 4QTUB 4WJZA 4JI5O 2HDHA 4LYAA 4B79A 1H5QA 2N05A 5DNDA 2A78A 2AJDA 1QBGA 3NCTA 1QLEC 3KDSE 2OQQA 4Q1FA 5FRDA 2ZJOA 5KDDA 3S3TA 3L1HA 1LT9C 2ZR8A 1VJ5A 4Q3LA 4D8YA 2Y68A 1IY2A 3JSAA 3AEAC 1U31A 2CSUA 3KHKA 4P7FA 1FDTA 4ZTUB 3AY0A 1GPWB 2HK7A 3WAKA 2Q7EA 3CKMA 5L9AA 2L19A 1BA3A 3E2MA 2XYVA 3BGVA 1Q1ZA 1LR1A 1JAHA 1RQNA 3HNOA 3U7GA 3KJIA 1WZ2A 4S24A 3PIIA 2O2XA 5J4KA 1Q7GA 1YQXA 2X6QA 4Z4FA 3KZVA 4BB0A 3ZDAA 1WV1A 5HE8A 4BQFA 4F21A 3VPSA 2XGMA 5JALA 4GS5A 1ZMRA 3P96A 5LGNA 3LLCA 5KSYA 5EBWC 3HI4A 4RVSA 3ZZTA 4IQGA 2J45A 2DE0X 2PBZA 5DYYA 4RVGA 1UMBA 4RXMA 2ZW9A 3FZNA 4G0VA 4RUKA 2XAGA 2E89A 2FYUK 2C78A 3AY7A 5CW2A 5CEFA 3BQ9A 3GO4A 2UV8A 1X1RA 3AVVA 5KYWB 1KJWA 3VC1A 4HB0A 1DGSA 4DN6A 4HYEA 4II3A 4HAUA 3WR5A 2J7PA 4RXUA 3WRXA 2WZBA 4FGKA 3O8OA 1RLJA 1NAIA 4CC5A 5K0NA 4FLXA 4B09A 1E5DA 3FB4A 4PHCA 4HB1A 1XEFA 5DNYB 3FMOB 1LI7A 1KGSA 1ZUIA 5JHGB 2Y4NA 3R9XA 5E79H 4CQMA 2X2FA 2Y1DA 1O97D 3LQYA 2BTQB 1E96A 1L8XA 5HUQA 3JD3A 2FFAA 3ESXA 1Z5WA 3IMCA 2A33A 4CLRA 4JITA 2QVGA 1SHTX 1GRCA 4RVOA 4BZPA 2AI2A 1XDBA 1V37A 2DU8A 1V7CA 2RJOA 2H85A 3INGA 1TUIA 4Q9HA 4XIYA 4EJ0A 1N5MA 3EY4A 1EH5A 2D1SA 3OA7A 3G5MA 4S3MA 4U7PB 3O7MA 4I1VA 1LBQA 4E07A 2OFOA 3IHWA 4MQUA 1I6MA 2HMYB 5JFTA 4PU0A 2YWDA 2JAUA 3KR9A 4X1YA 4HAYA 3Q98A 3L72G 2XB4A 2HLPA 4YQZA 5A0FA 3DWGA 4WFGA 3ZRWB 1K6MA 3CFYA 3WYFA 4Q9DA 2WC1A 4AY4A 4CQLA 5B5EH 1BYUA 2BPOA 1JB0J 2C7RA 4FR2A 1NNUA 3MT9A 3HU3A 5DO9A 1U94A 1QLWA 1SCJA 3UFBA 4RENA 1VOTA 3L18A 3L7AA 1TGOA 3BGIA 4QUIA 3WRXC 3CWQA 5E1OA 1T6ZA 5KHGA 4L87A 3TSWA 4WEOA 4AZ0B 3PI6A 4E3WA 4L27A 5EP4A 1Z38A 3FPCA 3QFRA 3IO5A 1KMNA 2VNJA 4CIDA 5ALJA 4ILEA 2ENUA 5KZMB 2D8AA 1XQWA 1KEUA 3U7EB 1KYIA 2PX4A 4B75A 5ENDA 3MHSC 2G09A 2W0SA 4OJQA 1Q1AA 4U6NA 1RY3A 1NKZB 3PUJA 1QX4A 1IUPA 3WBFA 1L1EA 3SIPA 2DBQA 2YIJA 4BASA 1BEEA 3WISA 3OZUA 2XQVA 5AVWA 1AZTA 3KYIB 5BQ3A 2FYUH 2IFTA 3KAJA 2AE2A 4Q4HA 4KXVA 5EE3A 1HX7A 3KVRA 2CUZA 3N2LA 5CDSA 3DLCA 3IPYA 3V32A 4RSMA 1SEVA 2PGLA 3NRCA 3ZY5A 4YQFA 1DH3A 2DUUA 4EKYA 1YE5A 5A5VA 1CU1A 2RJZA 4RY8A 3BG5A 1CVIA 4PG7A 3AFGA 1NBIA 2XRMA 4E33A 3TIIA 4D6TD 3L71D 5FOTA 5JBNA 1KILE 3HBMA 4WLNA 2BFBA 4C89A 3WMM0 3PRJA 3NPAA 1SQ5A 4BE9A 4DMUB 1SQVJ 3U4IA 3GJQA 3I4FA 4B2LA 3M6LA 2YZMA 3UJ3X 3CI9A 2GPBA 3P9NA 4GL2A 5AUQA 1GFIA 1X8KA 1XNQO 1WV0A 3R6LA 3SYQA 4ZEVA 1I8TA 4QOGA 1Y8QB 1EFVB 1NR1A 3SYLA 1VCHA 5DBEX 2AA3A 3KPVA 1F2TB 1CF9A 3VU8A 5C1BA 2FJ0A 1Y63A 2LWIA 5CA0F 3JCZA 3U7IA 1NG9A 4PO8A 1TUBA 1MMMA 1BVUA 4PAGA 3LC7O 4OHOA 2ZJ8A 1H3EA 3HCNA 3MCUA 1DEEG 2FR1A 4DDHA 1WLYA 5BT8A 3LA6A 3ADBA 1E69A 1DTOA 3RC9A 4KXRA 1D0SA 1K8ZB 1VDMA 1BEZA 2DT5A 2VS0A 2E48A 2CWDA 1IWPB 4AG6A 2OHGA 1FXUA 2IY9A 2RHRA 4BC1A 1YZUA 2XZOA 2Q9CA 1EUDA 4XASA 4W82A 1T2CA 4ZI5A 3T9AA 1B8UA 3LRTA 4UREA 3DV2A 2KS6A 2V5UA 3FPLA 3O3OB 2J7PD 5ARDA 1M2NA 1GA1A 1F51E 4X1OA 3FVQA 4FQ7A 4R9NA 2H4JA 4DV2B 4F6RB 2WLHA 1FVFA 5IAAA 1UEIA 2UUAB 2CCJA 3BFRA 1E2FA 3JAWA 2WJPA 1SRYA 5AW2A 2JCXA 1U8XX 4D4HA 2Q5LA 1XZMA 2VFAA 5ECWA 3BAZA 4R2MA 2SCUA 3I5YA 1SVWA 2CLOB 2IBTA 3DS8A 4D0SA 5KHIA 1YMUA 2E0IA 4DLYA 5A7FA 1JY2N 5FEUA 4JI3O 2VSYA 2IV7A 3G17A 3OP4A 5EFOA 4IPTA 3QU7A 1WUKS 2PSDA 1CIVA 1ZUWA 5EJMA 3WP1B 1ZXXA 3CX5D 3C5HA 1C7IA 1NAYA 4JXXA 3HCFA 5J59A 1ECBA 1UJCA 5FLKA 1XKTA 2G9RA 2EFYA 1V43A 4KP7A 3B5JA 1XYYA 3CX8A 4A16A 4QQRA 1NWHA 4RS3A 5EIXA 1MG5A 1N9GA 3UPDA 3KTDA 3OJWA 1EM8A 3VZBA 1FXWF 3P20A 5ESRA 3W5IA 4IVPA 4MR8A 4ZP1A 5CTAA 4I50B 2Q3MA 2CPBA 5CCEA 5JAMA 5ADUS 2IJJA 2WPDG 1SWVA 1EEHA 4H31A 1CD5A 4IDQA 4MS4A 4YJHA 4ECAA 3NXSA 3H25A 2QVAA 4CMCA 5DM60 2RN0A 3O0TA 3L9WA 2IDZA 1NUTA 1U1EA 2ETNA 1UR5A 2YW2A 3INTA 1ZX3A 4AZ3B 1VHDA 2Z08A 1AS0A 1PK8A 5E1AC 2AS0A 4E03A 1ZVQA 3FTDA 3HO8A 1JUDA 1U0LA 2I34A 3O75A 3AH8A 3E27A 3WAJA 2JGNA 3GFSA 4JA0A 4Z9XA 5C3MA 5JZOA 3HHPA 4D42A 2IITA 4YRCA 4Q01A 1HNXO 2KPOA 4Q03A 3GGOA 1OD6A 2E5LB 4G1BA 1CUUA 4Y6SA 3NWEA 5B64A 4REQA 2HZ7A 3CW2A 4IGEA 4EHNA 2N1BA 4IO0A 5A4DA 3HNRA 2HSEA 2B5WA 3LW5J 4V2UA 2UZ4A 2H4HA 3FYUB 5G41A 1GUYA 5LZ7A 2FP4B 1ENZA 3OOEA 2XGSA 4UDXX 4WV3A 5C8YF 1VMAA 1WPBA 3HB0A 1TXGA 3TEJA 2DQSA 1D0VA 3KKQA 1F5NA 2WR8A 2IOFK 3M91A 1KTIA 3R24A 4WCFB 5DGCA 4LF7B 5LIPA 2C00A 5JJIA 4NYMR 3B53X 3C3MA 2IS2A 4MX8A 5F7JA 1V54B 1CJBA 3RYTC 1D4FA 1R3DA 2OK7A 1XQ9A 1TFUA 1H0TA 1KJ8A 2D0OB 1G2CA 3L74E 1CR6A 3D1VA 3CKLA 3SC3A 2EWWA 4HH4A 2NSLA 1EN4A 3CGGA 2HU8A 1IY0A 1JIKA 1NPYA 2DOSA 3KPYA 2JGUA 1AI6A 3NIBA 4IMRA 1A9XB 2HLDD 3R0IA 2HDOA 4JQOA 3K9NA 1QF9A 3O3NB 3DXFA 4I0XB 4WY8A 4WZAB 3CR8A 4P33A 3NGMA 5EZYA 2JDIG 4L73A 1MH1A 3EHDA 3PR2B 5TB5A 2P5SA 2P2UA 13PKA 4PYRA 1B0PA 3NIGB 1VQPP 1U5CA 3QU4A 5AW9A 3OEEG 3SLGA 4LA4A 1GGKA 1ZIXA 2O59A 4DSAA 3D6ZA 1UT6A 1DF4A 1SKYB 3R3UA 2ZXEB 1RJFA 5T4BA 4UVDA 4CLXA 4UQPA 1NBMG 1II9A 1Y0BA 4FNOA 2VA8A 4OGQC 4EH1A 4K8XA 4CVNA 4V02A 4OI1A 1XAHA 2Y4TA 3W34A 4R2HA 3H1LJ 2XDAA 4J9VA 1EUZA 3GDFA 5BUCA 2YJ3A 1IY9A 3ZN0A 2FUNB 2NUAA 3HZRA 1SUAA 3SR2C 3GU3A 2OKCA 3N2NA 3DAOA 4MW4A 1LTSC 1UT5A 2W48A 3F4BA 3MS7A 2NXWA 3OMWA 4B6QA 1OC4A 1N2ZA 4TYNA 1WY7A 4GR9A 4KXQA 2E75D 3JCUZ 2VN8A 2ID9A 5BSKA 3LBNA 4UU8A 4YAFA 1T0UA 2JEYA 5EMJA 4EYEA 3TW8B 3LQ1A 4ZI7A 2PKQO 2V45A 3W2FA 1G4UR 4NARA 3AZOA 2YWJA 4LJAA 5EC2C 5IAOA 4TM8A 4V0ME 4G01B 2C7BA 3HPLC 4YMSA 1C3VA 2OHJA 4NJOA 1PP9H 4NYJQ 4JH0A 1VBFA 3HMKA 4OHPA 1E20A 2KMLA 5ILQA 3R77A 2IBZI 3THSA 1Y5MA 2I1JA 2GSMB 1Z62A 1YDHA 2XOKD 4KO3S 4C07A 3E7WA 4J42A 2NPIA 3VYRB 4KRGA 2EXXA 2WA3A 2NZVG 2QRMA 1FYEA 5T67A 2CK3A 3Q1LA 1L0NG 2M7WA 1Z37A 1XO1A 4RK1A 5G3YA 4JLPA 4JHLA 3CBGA 3GEPA 1R8JA 3QLUA 3CXHH 3M4NA 5CD1A 3RS0A 4CLOB 2JAQA 1DPGA 4I14A 3OJCA 5MF6A 1HRKA 3UOGA 2QUBA 5EKDA 3A1NA 4BL5A 2QA5A 4FLZA 4XWTA 4TMXA 3WDKA 1BGYE 4A9AA 5F76A 1KSGA 2BEQD 3TYYA 2UUOA 1SH7A 4DBZA 3TZEA 1V6SA 5HKBA 4MV4A 2DW3A 2VPZA 3QTCA 1DX7A 3HJHA 3Q12A 2XU6A 4I1UA 1L0LG 5DN6A 4K9OA 4WKCA 2GZ1A 4ARBA 1X39A 1KECA 1YJQA 1QH1A 2H08A 3SSAA 3F78A 2BMWA 1LVHA 4HNRA 2GBLA 5KLVH 1YDMA 2GYYA 2LNDA 3CEMA 2EILB 3P2EA 2A79B 3UZUA 1EFHA 4FGLA 3CCJV 3NV7A 3TOCA 1DIRA 4OH1A 1E79H 1YJ9P 5T57A 4O6VA 3IELA 2MMCA 3T95A 4LZZA 4W4KA 2ZZMA 1OE0A 3HDTA 3X2QC 2H9IA 4UQLA 4DLRA 4R8MA 2MK3A 2C9OA 4JL8A 4RBNA 4FLVA 1BXGA 4XWKA 5TNXA 3O4FA 3VKUA 3BDIA 3RYHB 3NYQA 3B5NB 4QRHA 3H4MA 1FJHA 4URUR 1AMOA 1ZYUA 4IL5A 3VNBA 2P5TB 3OUUA 4K81B 1YR2A 1DBSA 4JJ6A 4F5WA 2VXCA 3QLUC 3LLVA 4CODB 1L0BA 2AX4A 1RCFA 2VRWA 5ALGA 5JPCA 1HGZA 1CUHA 1Z4PX 5THKA 5HR5A 5CLHA 2HO5A 3DSRA 1KKCA 3T7AA 4BX3A 4OXNA 1NHWA 3PX7A 2FF5A 4ASUA 2H2GA 3PUWA 3T3DA 3EB9A 1VQNP 3U4AA 2HREA 5LU9A 5E9WA 1D5AA 4YGXB 1C1DA 4RGVA 1JB1A 2B8JA 5APTA 2QUHA 4KHXA 2YXPX 3WLJA 1N33O 1KIFA 4R1SA 3VMYA 2XBMA 3BJIC 2FSHA 3IJRA 1BXRB 5JNVA 2BT4A 3OJ0A 2ZWIA 5FBLB 2Y99A 3O6QB 2AN9A 5DTEA 5I01A 2VTEA 1USUA 2ZTLA 2AZTA 3IDSA 4MPTA 1VQMP 1OOEA 2NU7A 3VZCA 4RZSA 2YVQA 4LUCA 3HN2A 4H0NA 3ABKB 3IALA 4IV0A 1YTLA 4A0SA 4EQ6B 2Q68A 3R5SA 3IEMA 2HA4A 3N05A 4F1KA 4LWSB 1KYOI 3OEHD 2FUKA 1UZNA 2ISQA 5TGTA 3Q87B 4CV3A 3MAQA 1P77A 2QTBA 1ZGBA 3IAM6 4FQ5A 4PFKA 3NM4A 2ZIXA 5K3BA 3VSDA 1GD1O 3KPJA 3WYBA 4E5MA 4G89A 4EGQA 2H1HA 5L3SB 5DE3A 2PJZA 1IH8A 3QMPA 3UWKA 3AE1C 2R8XA 4XUDA 4DCOA 2W6NA 3LW7A 4JYZA 1G1MA 1NUUA 4QJ4A 2FR0A 3GN2A 1G98A 4PSUA 4Y99C 1Y82A 1GNQA 4FYYA 4G1EB 1U97A 5I3CA 3Q9UA 4EAAA 4AMUA 1Y5NA 1YVUA 3LYHA 3D1LA 5HF6A 5CLGA 4N7BA 4CUJA 4GRAA 4QYMA 3WK6A 3DMHA 1D1QA 1SQXG 3GJ7A 3MCWA 1UT8A 1TZKA 2XNDA 4N8EA 5CFQA 1JTEA 3ZS9A 1RI4A 2PA0A 2IZ7A 4AY6A 2YZGA 2JLYA 2P91A 3J7TA 4PYKA 1VEWA 2Q2NA 2XMCA 3E1RA 2VDQB 2HJGA 3ITNA 4GSKA 2NO9A 1Y9JA 1EQ7A 3HSSA 1V45E 3CLKA 3DV0A 2D3TA 2FW7A 1E7YA 2W8BB 4ZEMA 3LZ6A 3SM9A 5CDFE 4GPTA 3VHXA 3WIUA 3GF4A 3V9AA 4UCUA 4GD3Q 2CXPA 1E8MA 1S5LZ 4LYHA 4JI2B 1RWXA 4EMTA 3HWRA 2XCUA 3HVHA 1AA9A 5KYYA 3W06A 4C14A 3VM6A 5KNDA 2Q5QA 5E1BA 2ORYA 2OTJP 3AR5A 4IZHA 1HUCA 4MARA 1EDEA 2ZRGA 3O7WA 5DN6D 4DNQA 5LLTA 2V7TA 4TQGA 3UQZA 5KREA 4R8VA 1RABA 3JASB 2E4ZA 1YDEA 2V58A 2X8LA 4E15A 4G4JA 2CL6X 3WOHA 1MNGA 4P7KA 2JC3A 1I4WA 4LCEA 3KBOA 3MTIA 2C5EA 2E6KA 4XQGA 2H2WA 2W6IA 3HV2A 5ALLA 1IMOA 5B1SA 3S5UA 2XOXA 2GSWA 1GGEA 1QEXA 4B43A 5BPHA 2UUCO 2QENA 1GV0A 2C97A 2XPCA 4JGSA 5CJ0A 4FC6A 4AJ2A 2WD7A 2CTQA 1G18A 3EVCA 3PE4A 3IAOA 2I76A 1QHEA 3NWOA 1U7OA 1BGWA 5LJLA 4FI3F 5HG0A 3SF0A 2GZMA 2YJZA 1G5RA 1OGYA 1YAJA 5HKLA 1L5WA 1M76A 2QMOA 5JJNB 2Z1MA 2BKLA 4E1AA 3BHIA 4I9WA 4HGNA 4FOSA 3V1MA 3HCWA 3BFJA 3AKYA 4QEKA 4QARA 4ER3A 1DXYA 3SPIA 2PKRA 3G2JA 3KM0A 1AGPA 4L74A 2ODMA 1TVKA 2CDAA 2CVZA 2IVZA 2UVQA 4FYVA 2AXQA 1F8XA 4ASUD 2O2EA 3TPFA 3RYFB 3FSRA 1SKVA 4RTQA 2FPMA 1XZBA 1NXQA 3NVDA 2XYGA 4L5CA 5CK4A 1XT6A 4EFMA 4LY0A 2SICE 3IOBA 1TW2A 3OBIA 1AJPA 3N3BC 1ISPA 2EZOA 1CYDA 1EDBA 1WUHS 1Y1LA 3UB4A 3SG0A 2GA8A 4FX2A 2JLVA 2BI8A 4ZQCB 1N1GA 4DR6O 3L49A 1WU8A 2YYZA 3K5NA 1HT2E 4CFSA 1Y7TA 2QQFA 3H04A 1J6UA 1LJUA 1QMPA 3P9KA 1Z8NA 1XK6A 3ZXSA 4MUGA 3UUEA 4J7ZA 1F0NA 4RSRA 3LDAA 2XODA 1OQAA 2J5BA 3R4CA 3I2KA 3BQNB 2Q9LA 1Z4KA 1EUYA 2IBZH 1AFOA 3COZA 2QTCA 4WLUA 4MV9A 4F86A 5LL6Y 3IUYA 4B8WA 3E2EA 1JS1X 2IRWA 2ILVA 4B6EA 4TKUB 2PS0A 4CE6A 3LTNC 1FFSA 2KG7A 1MC5A 3RAGA 1NSTA 3FETA 5EINA 3KKPA 3AEEC 2DUNA 4IS2A 3N0VA 4EK9A 1J0AA 3DOEA 3CRVA 4KXLA 3D7KA 3A9UA 1FW8A 4OQNA 2C9DA 4ZAGA 1KZGB 1XUQA 4LSZA 3W7SA 1T4CB 4UD2A 1MH9A 4CR7A 4U7FA 3PWTA 1EXVA 2VP3A 3LLUA 2VHZA 3Q85A 1SBNE 4J76A 2A0WA 2CAZC 5INTA 3MIIA 4GSLA 4QUDA 2Q1UA 2JFZA 4QT0A 3HYCA 4Z53A 3EXIA 1L7NA 5ITWA 3REOA 2UYOA 1SCUB 2A86A 3A6EA 1V4BA 4PRYA 2ZJ4A 3FUUA 4Y6GB 3N59A 3UGQA 4POAA 2HUNA 1CPYA 4OHUA 1DINA 4X9XA 3DKIA 3OPVA 5CW1A 1FTWA 2IGBA 2XUFA 2FSPA 2GPWA 2KB1A 2UXDB 1DEXA 3H2GA 3CMEP 3LW8A 3EC7A 1WVGA 5T6MA 1Z2OX 5EIOA 1G4HA 2V6JA 2OEPA 3EVDA 2Q1XA 3I4CA 5EE1A 1OYOA 1WA8A 4DLNA 3HM9A 3KP1A 4EYSA 1MO3A 2NTNA 1AMNA 1J90A 3FTFA 3NONA 1FFCA 1AZWA 2Z6AA 3BDAA 2X22A 4EKWA 2FWPA 1GSHA 3IUMA 1R74A 4IH9A 2P79A 1K7XB 1L4MA 2OXIA 1LS6A 4HDRA 3QW4B 2DBRA 3JCUH 1LNQA 2QJPB 1LBIA 1LGHB 5KNDD 4Z9FA 1GNPA 4D1YA 3IQZA 1KVTA 5GZ3A 1RKVA 1PJBA 4ETNA 2N04A 1YDFA 5HFNA 1BE3G 2W6JH 1QK5A 4UHCA 3W1WA 3UYLA 4ND4A 1VIYA 4IJUA 3ZHXA 3KT0A 5HFMA 4X61A 1JSLA 2W6ID 3I28A 5C1OA 3FH0A 3MOGA 2A45H 1I7LA 1MW8X 5E79E 2G38A 4WACA 4CL0A 1JZTA 2C0QA 3RCBA 3V1NA 4EG0A 4XIFA 1PGPA 1EVKA 1YQTA 3LUAA 3PXAA 1CX9B 3CD6P 2ZOSA 3DV9A 4XVUA 3MD9A 4U39A 3DD1A 3RVQA 1AB5A 2I3DA 5DLYA 3HCBA 4O1HA 4BYMA 1TCAA 4PYOA 3V8QA 1NTMJ 2F8TA 5EIHA 4JY7A 1FAFA 1THGA 5I9TA 2J3QA 2A5YB 1GGJA 4G5SA 3L5OA 1KBZA 2OCYC 3SJCC 3VR2A 2D5IA 1JCHA 1IBKO 1Q12A 4BTEA 1UAGA 5BWOA 2PHZA 3AVOA 1XZHA 1KP9A 1Y8AA 4YGYA 4V1CI 1PS8A 2JCVA 3W7XA 1DEBA 1XB2A 4X7BA 2JEOA 3THRA 2QNBA 1XCOA 4X3OA 3WGKA 4E2ZA 5B5EE 3IUQA 1VHTA 1P9LA 3WZLA 4KPGA 3L6CA 4KE9A 2DP4E 1EVQA 4JT4A 2Y1LA 2RHJA 3R3WA 4G2TA 1MJ5A 2J3KA 1UIXA 3SPHA 2RB5A 1V1RB 1J2RA 2EIHA 1AXEA 2XCOA 1NLMA 2I7CA 4TLFA 3JZIA 5D5HA 4Z7QB 1WNFA 2B25A 3JRWA 4I4NA 2R32A 3ZKAA 5FUQA 4JQ0D 2Y3IA 5B5EZ 3UIEA 2KSEA 3ZQKA 5LQAA 2JFYA 5GM2A 4OXQA 5A1JA 1M5RA 3K5PA 1Y1RA 2D1YA 2QL5A 3DB1A 5AW4B 1QIGA 3T1OA 2E9SA 4G41A 2ONYA 3ZZ0A 4ARUA 3SICE 1IOVA 5IANA 5EESA 3H11A 4FFBA 1SC3A 1T2KD 3EA0A 2FYUE