4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
4I1OA 2AK3A 3OE7A 3I3SR 1UBFA 3QIAA 1OFTA 4UXIA 3U6BA 1WF3A 1EFRA 2NG1A 1QVAA 3D7MA 4Z8XA 2IF0A 4RFSA 3SU8A 2VIIA 4NL4H 3NH9A 1COWA 3CRVA 2XITA 1XTIA 4MRPA 3BBPA 1XWIA 2IS4A 3TNUA 1ZNWA 1CR4A 1X6VA 4TYNA 3EIHA 2QMEA 3GJ7A 3W6PA 1ZINA 4G01B 3WBJA 4DHEA 2WBLC 2GA8A 1KQLA 3A0RA 4TMZA 3C41J 5FL7A 4KYUA 4YQFA 3M1IA 2D3WA 4M1MA 2YC2C 3EASA 2WWHA 3CRW1 3CNOA 5FI0B 1PJRA 3N2EA 2YWFA 4FI3C 4LYFA 2JATA 2ZJBA 4M0LA 1KJWA 4ZDJA 1ZUIA 3NDBB 1KY2A 3EZ2A 4HZUA 4O2RA 2AK2A 1G8PA 4EPYA 3CX7A 3IEVA 4JIMA 2AX4A 2IYXA 4LV6A 4LJ7A 5SZKB 2ZSDA 3FGNA 4PAMA 5A0FA 3RLFA 1LY1A 3Q85A 1GD2E 2WM9B 1QHHB 3K0CA 5FOXA 2Q21A 1KK1A 1LV7A 3RC8A 4X8LA 1S1MA 4A0RA 2G1KA 3PUWA 2XGJA 1XEXB 1YRAA 3FPAA 1W4AA 4JVNA 1E1RA 3ZZ0A 1CEEA 1CJMA 1E9CA 1XJCA 1EX7A 1G1MA 2ZITA 1NIPA 3BS4A 3NG1A 4QBIA 4QGAA 4BIZA 2ZE8A 2O8FA 2HF8A 2I1VB 3ADBA 4D26A 2ODEA 1WBBA 1VCMA 3DMDA 1SXJD 3M0EA 5EP1A 1JEDA 2OAQ1 4ZCLA 1R4AA 2GF9A 2NZJA 3OESA 2WSMA 2CHVA 4UJ5A 3T5GA 2N42A 3K9HA 2R2AA 1N5KA 4HZUB 1IONA 4JBYA 3NHAA 3OE7D 1FOEB 4FCTA 3WHKA 2FE4A 2V7QA 4LZZA 2KE5A 4DXAA 2D7DA 1DE0A 3VR1A 3A4MA 3MCAA 3QKRA 4OL0A 2QAGC 1XDBA 3DPUA 4DEYA 3A1SA 5EP2A 1N0UA 4D80A 3OFND 1OYYA 4LJ4A 1MT0A 1M7GA 4KHXA 1W0KA 3CRRA 3B2EA 3FE2A 5G41A 4DWJA 5IK2D 4A15A 4XE5B 2GVZC 5AW8B 3O8DA 1NBME 4JLJA 2C9YA 1IY1A 2OM2A 1YZGA 4B3BA 3OEED 3ZRWB 5C4MA 4HI0E 4JSYA 3KKOA 3HTKA 2ZE5A 1JNMA 2F7SA 3I62A 2O8FB 1X8LA 1XXHB 4MRVA 3C14C 3U4QA 1ZUNB 2AFIE 5HPYB 4QHSA 1Z3IX 4BASA 2ZXUA 4I2LC 3LW7A 1EFCA 4V0LA 3TNFA 2D2EA 4Q7MB 1G41A 2VHQA 3EAQA 2VSXA 5JLJA 3ECCA 4M53A 3AVVA 4HEJA 2V9PA 1MOZA 4A9AA 2WWXA 3UMFA 3A1VA 3PG5A 4ZO4A 4QBGB 1E9AA 4PSKA 3H86A 3W5IA 3FMFA 5BN3A 5FBQB 1S9KD 4NMMA 4U7DA 1II8B 3A2AA 4KO8A 1M74A 1XD2A 4BFZA 2Q7CA 5KSYA 1KHTA 4H1UA 1HURA 3IIKA 1X8KA 1J7KA 2SHKA 2ORIA 3AF0A 3ZJYA 1UDWA 3L35A 4BFXA 1E1RD 4PX9A 2O8EA 2OFXA 5AVRB 2ODWA 2XAUA 4EPWA 1G6OA 1E2KA 4AY2A 1DO0A 2ZS8A 3P8MC 2QL6A 3RYTC 2CK3A 2QUZA 5BWMA 5E4FA 5FTLA 4HB3A 4MDFA 3H2YA 4D4LA 2J59A 4W7SA 2UKDA 2ZAOA 4B6FA 1E79A 2ZU6A 2ZUDA 4PQYA 3BGWA 4DC9A 4B3CA 4URYR 4PC3A 2EWVA 1NMYA 1XD2B 2QROA 1GK6A 3NTNA 2BV3A 3D6TB 3PUZA 5CJ2A 2H7HA 4Q7JB 3VR2A 3U44B 5KYKA 4P31A 1F6BA 3KQGA 4M9ZA 2ZSAA 3U7HB 2OT3B 1WCV1 2KJQA 5FL7D 4C0LA 1TF5A 2C9LY 3NDPA 4FCVA 4URZR 4F91B 5FTNA 2RGDA 2W58A 2OLKA 3D36A 1YYCA 1Q1ZA 2WAXA 2J45A 5HR5A 2W0SA 3L8ZA 2FU5C 1E9DA 2Q9BA 2JIZA 1QHIA 2HXSA 3TYYA 4I1UA 4RJLA 3P20A 5CIWA 4DJTA 5JECA 2ATVA 2YWEA 3AP1A 3KJGA 1Z6AA 2DWOA 1G7RA 2W2TA 3CW2A 2DFTA 3I32A 1G64A 3RSLA 3L36A 1Z0AA 2QG6A 2XTNA 2B21A 2ECKA 1T91A 4K8OA 4BQSA 1N6LA 1KSFX 1L7VC 4AYXA 3QSYA 3KXLA 4AYCA 2CMKA 2ZJZA 3LX5A 3OIWA 4JKYA 3R9IA 4DUGD 3U44A 1NL3A 5ELXA 1NKTA 2IYUA 3LXXA 4FMDF 5J4KA 4CEJB 1D2MA 1CTQA 1G3MA 2HJGA 4X8OA 4FIDA 4WVFA 2RGNC 4DZZA 1M6NA 4C0AC 3HYRA 2YV5A 4RCYA 1EK0A 5AVWB 2NQ2C 3PUYA 3SHWA 3WY9A 2GXAA 4AURA 2QP9X 3CONA 4BLPA 2XXAB 2CLSA 1KI8A 3BORA 3PV0A 5GVRA 2X2FA 2G88A 2VHCA 2PEYA 1N5LA 4UNRA 2QENA 3O47A 4GZLA 4CEIA 3K0FB 5DLQC 5EUMA 2Q5UA 2E87A 2AR7A 2OILA 3CPJB 3CM0A 3MUFA 2QMHA 4K81B 2OUKA 1K5DA 1XPUA 1G8GA 2QRNA 4JLAA 2QBYB 4Z54A 3W3AA 5G3YA 5L8VA 5DI3B 1RKBA 1WDTA 1YU9A 4N3NA 1VHLA 4MH0R 4PHFA 1EFHA 5M04A 1OXUA 4V0MA 1OT3A 1HUCA 4CEJA 3QQ5A 4Y0AA 4NP6A 1YR7A 4BEJA 1Z0KA 4TTQA 2J5XA 3EPHA 2PBRA 4LJ6A 1MH1A 3L43A 2BBWA 4IVPA 4B71A 4ZIRB 1HY3A 2C98A 4HLQB 4OI4A 5DE3A 2OSBA 3LQQA 4KV9A 1EFRD 3MG9A 1Z83A 3VR3A 3K0FA 3MMPA 3GLHE 2IUUA 2IK8A 1N6HA 1OLOA 1ZM2A 4MRSA 5FBVB 3LWNA 4DVGA 1G18A 4ESHA 1SLQA 3UKDA 1QG4A 5KDDA 1W7AA 4BFUA 5EE5B 3VFDA 1VTKA 1ZC3A 1G8HA 1S0UA 2XNSA 1E0SA 2VYFA 2ATXA 2W6JA 1GZLA 2ERXA 5AVTB 3UIEA 3BE4A 1KO8A 2F1JA 2OEPA 4TQAA 4DLSA 1N6PA 2IPPA 4IFBA 3UG6A 2QTFA 2WZQA 2CK3D 2H16A 5EXSA 4D82A 1T3SA 1KI3A 3TAUA 3LQRA 5KSPA 1FNMA 2W83A 3KZ1E 4EPRA 2FSIA 2KWIA 1YR8A 3MWYW 4ZIRA 1E9EA 1CLUA 2QNRA 3WP0A 3EA5A 5FBRB 1TADA 3AKCA 3T97A 2PCJA 3MFYA 3W34A 2W27A 2GJKA 4K46A 1KI6B 3K9LA 2EWWA 4F4IA 1YVDA 1CULC 2P2LA 5JHGB 3D31A 2JLZA 1PLJA 2QAGB 3SYLA 1FX0A 1E69A 4R2IA 3G0HA 1NSTA 3TE6A 1FFHA 3VMXA 3AKYA 1KZ7B 1F2TA 2DWPA 1XEWY 1KAGA 4YONB 5FFMA 3NVAA 1HH4A 3RC3A 2JLSA 1N3BA 3EW9A 4NDZA 1EWRA 3QPVA 1IHUA 5TXGA 2WJVA 3FTQA 3QKSB 2J1LA 3NBXX 4QNMA 2GJSA 2FFQA 3IQXA 4WW0A 4QKQA 3VX4A 4H1VA 4DIEA 4EFNA 1JAIA 1I4DD 1RYHA 1UBGA 2P65A 2KP8A 2HT6A 5CB6A 1TQDA 4HLCA 1NVVR 2BEKA 3SE0A 4Q1DA 1CP2A 2RGCA 4BLOA 5KPJA 1EESA 1VG8A 3CH5A 2WT7A 2W0MA 4I1VA 2JJ2A 2ZRPA 1NWQA 2OLJA 4M1OA 2FFHA 4FMBB 2Q3IA 4Z8YA 3WRYC 4Q9LA 2H7VA 1GL9B 4I4LA 2Q9CA 5DI9A 5JI3E 1B0UA 1GL7A 4LBYA 1YZLA 2VF8A 4P0TA 3F5FA 1KJYA 2ZVPX 2IA5A 1OW3B 3AVXA 2ZJYA 1KI4A 5GJWC 2VP0A 4C7NA 3HPQA 4Q4HB 4URWR 4DEXA 1NNEA 3Q5DA 5TVKA 1E94E 5AK0A 4JMPA 3U7GA 3B13B 1MV5A 2EFCB 4R7ZA 5EXTA 2QI9C 4HATA 1U8ZA 1X86B 3ZIAA 4DLWA 1N5JA 3KUCA 4TQ9A 4OHVA 2CCGA 5TV2A 1TQ4A 5DN6A 4A36A 3DGEA 5AVUB 1W36D 1CRQA 3SBEA 2QT0A 1XPOA 4WXPA 1O87A 2J0VA 2NOAA 1N6KA 3TLXA 1UEJA 5AVVB 1W0KD 4U7NA 1RIFA 5AUOB 4I81A 4LJ9A 4BGDA 4II7A 2ZM5A 1D8TA 2Z83A 4TN1A 5FH9A 3I73A 2WMOB 1N6NA 2AN9A 2C2AA 1E4YA 4TT3A 3V5BA 2BMDA 5JSZB 2R3CA 2P5SA 4ZKEA 4G5SA 3U7EB 3A1UA 4ZCMA 1T3LA 4Q1BA 3CB4A 5L3SA 5TMPA 2O8DA 3B1WA 2VP6A 4OBEA 2IYRA 1DG3A 4HLUC 4LBZA 5FTKA 3LH5A 4MYHA 1I4LD 4RY2A 4A8JC 4DT1B 1UKEA 3KTAB 1KGDA 4US0R 2H57A 3N70A 1W44A 1JR6A 1BMFA 1GK4A 2AL7A 2X1VA 2ZRJA 3WNDA 3QXCA 2JJ2D 4QXAA 4BFYA 4URVR 1WA5A 2JLUA 3IR9A 2BASA 5AR1A 1MO3A 4C9BA 3NC1C 3CX8A 4QGGA 2ZS9A 1SKQA 4JAVA 1S3SA 4JSTA 2VP9A 3CKLA 3TK1A 1NG9A 3R8FA 4JBWA 5FBLB 3RRNA 4QGHA 4AI6A 1U98A 4RVCA 2OAP1 5A4JA 3LBNA 1NMZA 5AVQB 4Q20A 1QF9A 4B47A 5FTJA 2A2ZA 3TUJC 3UWOA 2ZR7A 4MUAA 4OI2A 4QBHA 2BMFA 2YYZA 1XEWX 1ZD8A 3CH4B 2CDNA 4ZKIA 2VHTA 4MA4A 4PHHA 1GDDA 1IN4A 1KMHA 2AKAB 1PLKA 3PCRB 4EPVA 4Z1MA 1SHKA 3A5TA 2A5DA 2HYIC 1TAGA 5E3HA 1MO4A 4Z1MD 2QORA 3ZS9A 2HCJB 1XF9A 3GJ0A 4RKFA 2IT1A 2FSGA 4LRWA 1XCMA 2GJ9A 2RGNA 3B85A 4GFDA 1WRBA 2VP2A 1AQUA 1HT1E 2VPPA 4O25A 3BFKA 3TQCA 2D62A 3RRYA 4M22A 4DZOA 1SXJB 2OXCA 2KBEA 1L4UA 3VU9B 3B9QA 3K1JA 3NC0C 1MO5A 2HXYA 3K09A 4P32A 5HZHA 5JI2E 1T8UA 2HEIA 3DOFA 3AV0B 1TU3A 4TQUS 3BB3A 2V8OA 4B3GA 2AWOA 3ZS8A 1MO6A 2VBCA 3OHMA 3WYFA 1KO4A 3B5JA 4Q03A 1GWNA 1ZU5A 2HF9A 1XEXA 2CLCX 3H1TA 4L4UA 4LK2A 4KVGA 4DUGA 1G5RA 2XB2A 4OHYA 2XSZD 3RNLA 2NGRA 4TYYA 4V0KA 2QMOA 3WHLA 2MSEB 2ORWA 4C7OB 1CR2A 4M1WA 3AVQA 2Q3FA 3TR5A 2AD5A 5DYGA 1E6CA 1JB1A 2ZUBA 4BEBA 3TMKA 3EARA 2GNOA 2ZI9A 1RC8A 2DCUA 3QVUA 4C2TA 4GMDA 1R5OA 4RFSB 5F3WB 4RD1A 3KDPB 3P4XA 5KUTA 3BB4A 2ERYA 5AUNB 5AW3B 4KFSA 4X8MA 1B23P 2Z5FA 421PA 4M9XA 1P4SA 1A2KC 3KFVA 1VG1A 3CZQA 4O2LA 3HJNA 1FAVA 3UG7A 2KB0A 1D9XA 3SJCA 3ZRWA 3AGPA 5KHOC 4C30A 3WYGA 2PT7A 1DG1G 4WZ6A 1GITA 3ASZA 3QPUA 4Q19A 2I3BA 3CF6R 1JXOA 4ZPXA 3HDTA 4HDCA 3ZGXA 5JS8A 1T5IA 4OKSA 4DDTA 3IHWA 3VQTA 4B6EA 5K8LA 2CBZA 3KKNA 4L9SA 5BYJA 4Q18A 4BE7B 2RB4A 2QN6A 2OCAA 1BOFA 5A5GA 2IUSA 3FHOA 1ZP6A 5DIFA 2IXFA 2O8CB 2IYZA 1Z6YA 3MGCA 5C4GB 1E9RA 2A5FA 3CPEA 1X8YA 3K70B 4IOMA 4PHGA 4TMVA 4NYMQ 2W6ID 2ZRIA 2QPTA 5KNDA 1II8A 5EE9A 3FOZA 4TL8A 5AW6B 1E2GA 2H8KA 2KI5A 5APVA 1AM4D 1G3IA 3B9PA 4EDHA 2O0HA 5APYA 3FKSD 1Z2AA 3AVTA 5FI1B 5CJPA 1VCOA 1G2CB 3H4MA 3SHFA 1G291 4KITB 1HQYE 3SQWA 2FJUA 3UATA 1QHYA 2G83A 4NYJQ 1E99A 1S3GA 4IRUB 3VTKA 1IM2A 4DRZA 1IXRC 2WPSA 2F9MA 3K8YA 1DOAA 1SVSA 2WKRA 2VRSA 4W5WA 4GBMA 4EJSA 5J40A 3MGNA 4LC0A 4UNQA 2ZRNA 1ZAKA 1J70A 4UXHA 2JLXA 3B1YA 4JZKA 4PC6A 1HUQA 2WSSD 3GJ5A 2NZ8A 3QKRB 2XEXA 4DLVA 3HE4A 3HP1A 3BB1A 1DVRA 1UKYA 2PX3A 3EPJA 4HDQB 4NCIA 2FWRA 3HU1A 2FG5A 4MYUA 2FSFA 2ONKA 1W4RA 1PLLA 3AP2A 3OEEA 2GJAA 4P4TA 4UNPA 3SJAA 2Q3HA 5AVXB 1E2HA 4E09A 1P9WA 2TMKA 5FBWB 4RCZA 1FPMA 4DCSA 1XX6A 1XU4A 5FUXA 3HE5B 4G5RA 4BZXA 2XSZA 4DSNA 4UJ3A 1SVLA 1Z6XA 2AFHE 3AEZA 3DZDA 2J7KA 3TVTA 1G17A 2GF0A 2F43A 4M21A 3KFXA 3T12A 3KB2A 1KI9A 4PHTA 1G6HA 1SGWA 3SZRA 5JBQA 1OH7A 4RZ2A 1OFUX 2ZAMA 3ZYCA 3F0TA 1G7SA 4G5OA 4PZLA 3V9PA 4W9MC 3ZVLA 3B1VA 1KKLA 1PV4A 5APSA 1RRGA 2HUPA 2GZHA 2NPFA 4N0DA 1UM8A 4Q1CA 4B33A 1YZQA 2ZS7A 3EIQA 3SYKA 4AG6A 3EZ9A 3KKPA 5L3RA 1GSIA 2QGNA 2IX3A 1P7CA 2O8EB 3HE5A 4CT4B 1SP4A 2P5TB 2ZRHA 1SKYE 2QPAA 4HAYA 3ZVMA 2V3CC 3TAHA 1CIPA 1FUUA 2NO1A 2ZYVX 3QENA 3DKPA 4KCGA 5FOTA 5B58C 2DBYA 2F1RA 1NJGA 3GEIA 5IDJA 1W36C 3BRWD 4C3ZA 1UBEA 3TQFA 4PPFA 4GL2A 1E2DA 1OKKD 4LV8B 4DCVA 8OHMA 3AKEA 2H1LA 1P2VA 1ZYUA 4MKIA 1NY5A 1JJ7A 4M4SA 2GXQA 1UKZA 3SN6A 5DI3A 1G7CA 2ORVA 4EIWA 3LLUA 2LWIA 4QGFA 4F38A 2Q9AA 4FWTA 2BOVA 1ZM7A 4ACBA 1MKYA 5L3QB 3HPRA 3BJIC 4V0NA 2O5VA 1LNZA 5KNCA 3U3JA 3DMNA 4IDQA 4XD7A 4JJKA 3SDZA 4BLTA 5B1NA 3EIEA 3L8YA 3K70D 2WKQA 1OB2A 1M8PA 1JPJA 1IBRA 4QOSA 2OG2A 3FMOB 4OJKA 3KKMA 5B1OA 1KSHA 3PQCA 1SXJE 1Z22A 3QF4A 5B2ZA 2ZSBA 4Q4JA 1C9KA 5K8TA 5H1YA 2IS6A 4FMDB 3GEHA 4LWZA 4EQ6B 2DFKB 1G9XA 4S2EA 3AUXA 3W3ZB 2OCBA 4IFEA 1R5NA 1GKIA 2RKOA 4QHTA 2Q6TA 1IN7A 4Q9KA 2GDJA 4B2IA 1OPXA 2YVUA 1VYTA 2FX3A 3EPKA 4JLDA 4B43A 4GDFA 2WOJA 1AIPA 4JASA 1E2JA 5JZVA 4RD3A 3AVUA 1W46A 4G1UC 3Q7QA 1Z2CA 5FPHA 5D3MB 1UDXA 2RMKA 1DTSA 5HCNA 3T1VA 4EAQA 4WA7A 4DLZA 1PUIA 1FNNA 3BC1A 1YZNA 5E95A 3RAPR 3LIDA 5JRZA 3PXGA 3ND8A 3OAKA 1D2EA 5APUA 1OKKA 1KI6A 1RRFA 4LUCA 3DHWC 5BN5A 4QM7A 3AVWA 3U3OA 3Q7PA 4WZBE 2QAGA 2W6IA 3BH0A 4Q4JB 3FYHA 3I61A 2RH5A 3BFXA 1CBUA 1UADA 1IXZA 4TTRA 4UNSA 4A6PA 3VKGA 4EQ6A 5IRCD 3L0OA 1HBWA 1KNQA 2C04A 2F3RA 1GOTA 1RW4A 4IDNA 1PUJA 3L2OB 1KDRA 3U3RA 2G0NA 4HUTA 3Q8XB 1NVUQ 3VR5A 2ZYTX 4IEEA 1J99A 1X1SA 3KXIA 2D74A 1QHNA 2A9KA 1RVDA 2IYQA 2IYSA 5JMTA 5FOUA 3U7FB 2G9NA 1T3HA 2C99A 1YQTA 2GZAA 5D3MA 3LNCA 3WBKA 4ACAA 4BLSA 1GTVA 4JVLA 3FHTA 5HKKA 1CF4A 4KAXA 3R7WB 1M7BA 3IDQA 4KFTA 4B86A 2VQSA 1E32A 1DADA 1P72A 4PPQA 5D3QA 3ZD7A 2PMKA 1XFAA 1T8TA 3NFQA 4C4PA 3W6NA 1I2DA 1H8HA 1SVWA 1TF2A 4TYQA 5C93A 1C4OA 3C7KA 3QEJA 4E5UA 3QXSA 4D4JA 3AUYA 1P60A 4CZ2A 5CK5A 4YMUA 1JNYA 2XZLA 1JR3A 2O8BB 4U02A 4RD2A 2IHBA 1ZC4A 1Q44A 1F60A 4IOJA 2F9LA 2IHYA 2NPIA 1MR3F 2BM1A 2NO6A 2QPOA 3EWSA 4RD0A 3B60A 4TSFD 3LO5A 5GJCA 1CSBA 4A2WA 2ZRKA 3KQHA 3LVRE 4OJQA 1F3OA 1KO1A 5EP4A 1S8FA 2EFDB 1E2FA 3P4YA 1KK2A 3OZXA 1SVOA 1ZIOA 2MSDB 5J47A 5LB2A 4WOPA 3I4LA 5DN6D 1T0JB 2WKPA 2PZFA 4F93B 3U3MA 1ZMXA 3ICEA 1G19A 4CYMA 1IY0A 3OFNA 3QG5A 3EXAA 4XH9B 4ZI3A 3PJRA 3N5CA 2RAPA 5KO2A 3IBGA 1Z0IA 1BS1A 1LF0A 2O8BA 4CEHB 3L0IB 3QUSA 3W9YA 1N25A 1NKSA 1HA3A 4GNKA 5DYIA 4LHXA 4QBFA 2QGZA 4MGZR 2CJWA 1Y63A 3GEEA 1VCNA 3A1WA 3DO6A 2OCYC 3QKSA 1S1CA 4DLYA 2ONJA 3BERA 4XOIA 1AS0A 3TGPA 2OE2A 4PR0A 3ZDQA 3I92A 1XCGB 4QRHA 2EVWX 1AZSC 1KO5A 2QSYA 4LYHA 3KTAA 1YR6A 2LFSA 3QKTA 1WB9A 4LX0A 2WAYA 4QJ4A 1HJBA 1COWD 3HU3A 3HR7A 4HUQB 4IEIA 3DM5A 1E98A 1OH6A 4MUBA 2YNYA 3LXRA 1M1YE 1P9NA 4B2LA 5EXXA 1UAAA 4XWAA 2UZ3A 4B75A 2XV5A 5GADl 1SQ5A 3U61B 1TF7A 3PENA 2DFLA 4JLBA 2A5GA 4QPKA 5APWA 4CEHA 3WNCA 4BLQA 1RRCA 3IO3A 3SJBA 1P62B 4EUNA 4GT1A 2D2FA 3N2IA 4PAOA 2ZRBA 2CL6X 3SYNA 4IDHA 3HR8A 4OK3A 3A58B 3T1TA 5E7MA 4Q9IA 2JIZD 1AS2A 4HZIA 5DSZA 1Z8FA 4KODA 3THYB 5AUPB 4PAQA 3P26A 4Q47A 2ZEJA 2P6RA 2ZANA 4OHZA 1ODFA 1Z0DA 4JLOA 4C2UA 4DSTA 3MWKA 4KLZA 2WSSA 3DOEA 3KUDA 4D0GA 1T0HB 3BWDD 2OHFA 4ABYA 3A4LA 1OWAA 1U99A 4CGZA 2F6RA 4TLDA 4ON9A 3RS4A 1G3RA 1W47A 5IT5A 2NMVA 3G82C 1EXMA 4KVAA 4B32A 4F4CA 1NVXQ 2ZRCA 3DKVA 4LJ5A 1Q12A 3BFVA 2R8RA 3V4FA 4AYWA 2NO9A 4F4JA 2WTYA 4JS0A 5SZIA 4IXMA 3WMGA 2FZLA 3I8SA 4MGYR 1VIYA 1RZ3A 4PO1A 3MWLA 5GVSA 1N2CE 4ARZB 3THOA 1IN6A 5CM9C 2V1XA 3GLIA 1S9KE 3LX8A 4U00A 1P6XA 4F7WA 2YO3A 4GSYA 1E9BA 1YHNA 2W6AA 1G8FA 1TNDA 2WVJA 4YXWA 1ZIPA 3SEAA 4YXWD 721PA 5L3SB 1RPZA 4CF7A 2BMEA 3GCGA 3Q3JB 3VU9A 1KO7A 2FGKA 3MSXA 4DT1A 4TMXA 1ZD9A 2WJGA 3WP1B 1AA9A 1BMFD 4TMWA 1ANKA 3QNUA 3K0SA 3LDAA 3PEVA 4KBFA 4TLCA 4FMCB 1W0JD 5H68A 2CHGA 2IL1A 2RHDA 1G7TA 3B8EB 3NH6A 4L15A 2XB4A 4XIGS 2VHJA 2IYLD 2W6JD 4PC1A 2MMGA 2GILA 4TLBA 1ZNZA 2BCGY 5UKDA 1E3MA 2JDID 2JJ8A 4Q4AA 4ARZA 5B57C 1MUUA 4C7OA 2IS2A 3GLIB 1Z07A 1OXVA 1T9HA 2XTMA 4NYJR 3T1OA 4XWKA 3IGFA 4NKRA 2IC5A 4OHWA 3H84A 1P5ZB 1NLFA 1NF3A 2IF2A 4PANA 1GRRA 5KSOA 4XJXA 1DAGA 4M1KA 4KSCA 2I4IA 3NWJA 2B7CA 2REOA 1OIVA 4RSGA 5AUQA 3QEOA 2YC4C 3VKHA 3KB1A 1UKVY 4TLEA 4AKHA 2ZETA 1U90A 3Q9LA 4MKGA 5KOYA 1U0HC 1Z08A 1JAHA 2VH5R 3UK6A 1YE8A 1AJEA 4JLPA 5IK2A 4RZ3A 4FW9A 5DGXA 4NTZA 5AVSB 1DAEA 1M34E 3U3KA 2GWHA 1KJZA 5JWHA 2WJYA 3TIFA 3CR8A 1KK0A 5HE9A 2JLVA 4U5XA 4TL9A 3WYAA 1JR3D 3C5HA 3OIUA 2A3RA 1FW6A 1IOZA 3C5CA 3VTPC 3V4QA 4LGMA 4P4SB 1E1QA 1QHGA 2WWIA 4Q4AB 5CMZA 1NAFA 2QQ0A 2QM7A 2C2HA 1OXTA 2LCFA 2J87A 1ZU4A 1XZPA 1Q21A 4N0EA 2YO2A 1SXJA 3GLFE 2WOOA 3RS2A 2F55A 1Z63A 2ZTSA 5DHFA 1AN0A 5AVYB 3AB3A 1MRNA 4M9QA 3UPUA 1DPFA 2ZJAA 1GNRA 3FFBA 4A0HA 2R65A 4Z51A 1S2MA 3OIYA 1P9RA 3Q72A 5FPYA 5J5CA 3ZLJA 2A7QA 3LY5A 1KTVA 3UMSA 4QG7A 4CT5A 3TNUB 2GEUA 3T34A 1D6JA 1DAMA 1E96A 3I8XA 1W48A 4KLNA 4IOLA 2ZYWX 4CDGA 1P3JA 3LLMA 3X2SA 2ZRLA 4D6PA 3NEYA 4O0MA 2FPLA 4TLAA 3S1AA 3PVSA 5JWOA 2E43A 4V0ME 3GLGB 1M7HA 3P1JA 2FMXA 1FTNA 1G5PA 1XRJA 1ZJ6A 5KDLA 3MJHA 3SS8A 1M2OB 1JBKA 1US8B 4PC7A 4GCZA 1JECA 4XTCS 5IDVA 4MITA 1IN5A 3T1QA 3GJXC 1GVNB 5SZJA 1G8YA 2LKDA 2XOKA 4FCWA 1K6MA 4YMTA 4FD2A 5K8IA 3EX7C 2WIAA 4AWXA 4AYTA 1ESMA 2VO1A 3CLVA 1W36B 4EOTA 1AQYA 5AW4B 4BZQA 4M8NE 4IVQA 1JJVA 121PA 3QXJA 821PA 1W0JA 3IEUA 1OXZA 1F51A 4KP4A 1E9FA 4WXRA 2CL7X 2YJTD 4LY6A 3LIEA 1LS1A 2ZI7A 1ZVQA 4Q02A 1NLYA 2ZE7A 2ZIAA 1ZUHA 1AZTA 1OSNA 2GCNA 4KU4A 1LB1B 2H18A 4FN5A 2Y8EA 1GRNA 4B76A 5L3VA 4Q01A 1II9A 2EW1A 4U7OA 1DAFA 2ZREA 2ZYUX 3X1WA 1JPNA 4AKIA 2V4ZA 3FDIA 5TB5A 2VF7A 4C0KA 1E79D 5LD2C 1TQ2A 3JZAA 1R6BX 1SZPA 1A02J 2VRWA 5CITA 2JJ1D 1YKSA 1EFTA 1G4UR 4EFLA 3C8UA 4EKDA 3A8TA 3GLHB 5H8WA 1IXSB 4IKEA 5FOSA 2FOLA 1NN3A 1U0LA 1KMQA 4LC1A 2QE7A 4WZAE 1CI6B 3A37A 2C5LA 4UXJA 5EZ5A 4A0FA 5C2JB 4Q1EA 2OZEA 2BBSA 1TMKA 2HJVA 3UIAA 3KX2A 4IHQA 4NHOA 1AKYA 3RRZA 3ZQ6A 5KTYA 1E0AA 3IBYA 3I5YA 1IO4A 2IYYA 4P33A 3DEFA 3LA6A 3X1ZA 4EJSB 1TUIA 4UQOA 1H89A 5AJZA 3R20A 4NCJA 1U9IC 2A30A 3T06B 1SVKA 5JEEA 2CEAA 3EZ6A 3HE4B 1Z6TA 3QI2A 4TZ6A 2JEOA 2R44A 2FFAA 5AJXA 2N9BA 3K0EA 5BN4A 6Q21A 1QHXA 1D9ZA 3AF2A 1K8RA 1NY6A 2L0XA 1GM5A 2IYVA 1X3SA 3GLHA 1JOYA 3QY0A 1H8HD 3AVPA 1IXMA 2FTKA 1N5IA 1RE0A 3EWAA 2BBTA 2P6UA 3MLEA 5DO9A 1TX4B 3LBHA 3KQKA 4WAUA 2DR3A 1XTKA 3QBVA 2NIPA 2OFWA 4JL5A 2DWQA 4NE2A 3GQBA 4AG5A 1YRBA 4LBVA 2D4HA 2ZSEA 5CLLA 2XU6A 1XNJA 1N0VC 2VP4A 3F3YA 5GJVC 1XD8A 4US1R 1T2KC 4ZKDA 1U0JA 5F9HA 2HDNB 1N6OA 2N46A 3KDSE 4E07A 4NYMR 4M1SA 2AXNA 3EC2A 2R6FA 4S35A 4UKDA 4XWOA 2BIFA 2RGEA 3P27A 3EZ7A 4G3XA 3QF4B 1EX6A 4RESB 4QFMA 2C95A 5FR2A 4LDJA 1ZW6A 4B35A 3DL0A 2AD1A 2C96A 4CW7A 4LCBA 3VMFA 3CF0A 1KDPA 2VP5A 2GZDA 2OXRA 2Z6VA 1OJLA 2X19A 4JLMA 4LPSA 1NJFA 3PUVA 5CB8A 2C8VA 2PX0A 2CE7A 2OESA 4L16A 4BLRA 2F1HA 3B1ZA 4MDEA 3GFOA 4AK9A 4JLKA 4ZDIA 1U81A 3ICQB 4LBWA 1R5BA 4HLDA 1DELA 4PC2A 1TTTA 4FMCF 2QU8A 3RRMA 1XJ0A 5FPSA 1KI2A 1GFIA 1MFZA 1NBMA 1A82A 2R6CA 2WJIA 2UZIR 3BXZA 4F92B 3KQLA 2NO0A 5DHAA 4BRWA 1T5LA 4D4MA 3FB4A 2ZJ2A 1H88A 1XTSA 5FPTA 4Q9JA 3IKJA 1L4YA 3KXKA 3LVQE 4B74A 1MABA 2ZXEB 4YMSA 1BO6A 4MRNA 1G16A 1WXQA 1PVOA 4GZMA 3SFZA 2Z0MA 3A36A 1A02F 3W90A 1H65A 2BKEA 5HCIA 3EZFA 2GEVA 1FZQA 2Q0HA 4IW3B 4JKIA 4EJSC 2XZOA 4GKGA 2R6AA 3M06A 2WPDD 2XNDA 3IIJA 3CR7A 3KKQA 2ZRMA 5DNYB 4AUWA 5AW5B 5L3QA 5P21A 3CNLA 4A82A 4Q1FA 4BWYA 3OEHD 3PFIA 3B7GA 4XVQA 3ZVNA 2XXAA 2JA1A 1VHTA 2ZUCA 3NKVA 3AF4A 4BUJA 2PJRA 3THXA 1A4RA 1JQLB 2V6JA 4ITRC 3ZRVA 1AGRA 3F8TA 4IXNA 3W8NA 4PPGA 3X1YA 3ASYA 4LV5B 4CRWB 4DKXA 5LD2B 1HE8B 2FPKA 5AWFC 4PTLA 2GJ8A 2FPMA 1JI0A 5CYOA 4D0NA 4R71A 5FOVA 2C9NY 3H0KA 2F3TA 1FTSA 3ZQJA 2J0QA 4DDVA 2V6IA 4LYJA 2Z5HA 2XJ9A 3HWSA 5AW7B 4ILEA 2ZU0C 1EFUA 4XVRA 3UXMA 3MRSA 1VYVA 5B64A 1ZRHA 3CRQA 4Q66C 4G5GA 3W6OA 5F9FA 2FA9A 2QT1A 4JLNA 4MQBA 3REFA 2YKGA 1SHZA 1VPLA 1E2NA 5ANRB 3DDCA 4NZYA 2BBOA 2WJHA 4LHZA 1IQPA 2F1IA 3MD0A 1T6NA 1XTRA 4D81A 5HKKD 4LJ8A 5EJEA 4MKFA 2N1BA 1DBSA 3RS5A 4W5HA 4ZDWA 3K0AB 1HWTC 1KI7A 3TRFA 3PIRA 3FKSA 3GJ6A 3M9HA 4GP6A 3AP3A 3P7KA 1DAIA 2BJWA 2ODBA 3QVVA 1W5TA 1CZQA 3ZZTA 1AKEA 4HAZA 3TBKA 2BVNA 4MTXA 2CLDX 3EA0A 2JLYA 1G21E 2HLDD 3BH7A 3E70C 3OAAD 2ZI5A 4LHYA 1VIAA 2GXSA 4ASUD 2EYQA 2B7BA 2LKCA 1NG1A 1UPTA 3PUXA 4ESVA 4E03A 1J2JB 1H8EA 4D0LB 1NRJB 5JRJA 5JJIA 4JBXA 3CO5A 4B2PA 2VEDA 4LYAA 3X1XA 2WTUA 1FMJA 1U2RA 1KDTA 3MJRA 1GZSA 4HAXA 3KJIA 2R6GA 2EFGA 2IEYA 2REBA 3CZPA 5E7IA 4HUQA 3VYIA 5FTMA 1L2TA 3CPHA 3QXXA 3NIBA 1FQJA 4I99A 2QE7D 1GU4A 4BPBA 4OK5A 1CJKC 3A7OA 3REGA 5JJLA 1TU4A 4XSHA 1S96A 2ZSFA 3IHLA 4C46A 4FPPA 2GK7A 2J3EA 4JL6A 4TMTA 2GEDA 2GBLC 2ZQ5A 3SWFA 3RS7A 2WHXA 2J0SA 3BD9A 2AKYA 1DH3A 1W2GA 4OYHA 3U5ZB 4HB4A 2HCBA 5JSZA 1P2UA 2R6DA 4YC7A 4BECA 2PZEA 1MV8A 1J2JA 2J0UA 2J46A 2FSHA 5DH9A 5EP3A 3R8CA 1H8ED 1O3YA 3KL4A 3VX3A 1DAHA 3ZZUA 2DPXA 3UANA 1VCIA 2PJZA 2IW3A 5JEDA 2GXUA 2BEJA 2BKUA 1ZM3A 2KSQA 3TSWA 2WT7B 3FVQA 1GAJA 4B73A 4I1SA 2JJ1A 4PO9A 1LS6A 2I1QA 4LHWA 3NTUA 1NLZA 1CU1A 1OFIA 4RD4A 4HLUA 4DIDA 4PPNA 4HDOB 2Z5IA 2C9CA 4L9WA 3G5UA 3ND9A 2CXXA 1R0WA 1H8AA 1FOSE 3QJYA 3VKWA 3KQNA 1YZKA 1P61B 1QZXA 2ODNA 4EPXA 2P7JA 1IJEA 2H17A 2B6HA 2R5BA 1KSJA 1E2EA 3LV8A 3P32A 1BYUA 3TH5A 1FOSF 1KZGB 3TJZA 4A6XA 3VHXA 1BKDR 2J0UB 4I6MC 3WNBA 4OHXA 4JVSB 1NBMD 2JAQA 3B78A 4QM6A 2GKSA 4LI0A 2ANCA 3PEUA 3I5CA 1KMHB 1BIFA 2BDTA 3RSOA 2QEQA 2FN4A 4B34A 3PEYA 3Q5EA 3QPWA 3VHLB 2YINC 3AF1A 2DB3A 5EXPA 4A8JA 1N0WA 5G3ZA 3A1TA 3CRMA 5B30A 4WBSA 1E2LA 1W4CA 5FUWA 1OB5A 4IJMA 4D25A 3RS3A 1JR3E 4TTPA 2BJVA 3QF7A 4RZUA 5BYKA 2PLRA 2QAJA 4GMXA 4KSBA 2EYUA 3ZD6A 2FNAA 3GD7A 1I2MA 1XTJA 3VNUA 4GPTA 2VL7A 2IS1A 4KYIB 2P0EA 4C0BA 2QSZA 3OIVA 3THYA 4B48A 3AKDA 4V03A 5CDFE 3NEJA 1AGPA 3DM9B 3T61A 3RVBA 2WWYA 1VKJA 5F2EA 3CWQA 2YHSA 3ZIAD 4DCUA 3VR6A 4DLTA 2K5UA 3HYTA 1J90A 3IIMA 4OQFA 5AW0B 4NH0A 2DFNA 2HV8A 4XSGA 4IDPA 5CIQA 4CIDA 5BXQC 4GOJA 1CKEA 2ZI3A 2P6NA 5TDHA 1R7RA 621PA 1AS3A 1XP8A 3X1DA 5KU1A 2ZI6A 4HAUA 1K5GA 1NSFA 4ZV4A 2XZRA 1CS4C 1IAQA 3CF2A 2OO7A 4TYWA 1R0YA 4P4SA 3KJHA 4ASUA 2CL0X 1KOFA 1P2TA 1Z28A 2GK6A 3GJ3A 1OIWA 1NIJA 3CNNA 2QA5A 1ZCBA 2ZROA 3K9GA 4Q7LA 1CRPA 5IHPA 1TEVA 5JCZA 1CXZA 2WIBA 1OXSC 2YNMA 2RHMA 1GNQA 5JCPA 3SR0A 1JEEA 2ANBA 1UJ2A 4TZ0A 2D06A 2XZPA 3L37A 4KI0A 3K53A 2RGGA 5EE0A 2V1UA 1EG7A 5E7JA 4Q48A 3T5DA 3PR1A 2ZFCA 1NP6A 2RGBA 1Y3AA 2ASEA 4AC9A 4PQRA 4R2HA 4DDWA 3FFAA 4A0GA 2DYKA 2PL3A 1XD9A 4B3DA 1OF1A 5TY0A 1NN5A 1HV8A 1XTQA 3BK7A 2R32A 3DVLA 2ZI4A 1OHHD 3GP8A 2XJ4A 4JYBA 5AJYA 2CE2X 1GRQA 4QL3A 3B82A 4B3XA 3FHCB 2PLFA 1SVIA 1OV4A 2X8AA 3AVOA 4DCTA 3RHFA 3TR0A 3IO5A 1KKMA 2CNWA 2VSFA 4TYPA 2O8CA 2KBFA 5HZKA 4YDHB 2OBLA 2RGXA 3ADDA 1TQ6A 4NONA 1WMSA 4X8HA 3VMZA 1IN8A 1YR9A 4DLUA 5K8UA 3QG1A 3SNHA 3A3YB 221PA 4BFSA 3R9WA 1VYUA 1ELOA 2YOHA 4Q00A 1XJQA 4BFWA 4HYTB 1Z0FA 2Z4RA 3SOPA 2EFHB 1YJ5A 1IJFA 1DARA 3A6PC 1GTWA 4V0OA 1XXHA 2EU8A 3THWB 4P3YA 1QG2A 2Z43A 5G53C 1FP6A 1QVRA 1Z0JA 2A78A 3M9BA 4FXPA 2ZRAA 1DEKA 4URUR 4NCHA 5TARA 4M1TA 1OXXK 3CIOA 1QDEA 2IWHA 1XEFA 3UMRA 2J7PD 1QRAA 4KXFB 1R8SA 4A2PA 4Q5IA 1SULA 3SBDA 1QHHA 3BIFA 4TL7A 5AJWA 1ESNA 2ZJOA 3TW4A 1V43A 1OH5A 2ZVQX 5SZHB 3E2IA 1S9HA 4QJ3A 3FMPB 3O8CA 1VG0B 4KFRA 3S1AB 3I5XA 2P2UA 1LTQA 3B6EA 1EGAA 3HU2A 3WMEA 3THWA 4OI0A 2ZJ5A 3GLGA 2ZRGA 3ADCA 3PITA 3QBTA 1R2QA 3B8HA 1NVWQ 1J8YF 1HTWA 2F43B 4TSFA 3SFVA 4DDUA 1U8AA 4QNRA 3CX6A 1US8A 1EWQA 1GL6A 4JLVA 3OF5A 4RZXA 1J8MF 4IDOA 1OH8A 3LBIA 2P3SA 1HE1C 2MMCA 4BFTA 4DBLC 2IYTA 4AKGA 4XTRA 1KAOA 2ZPTX 3IQWA 4KHZA 1ZM4A 5DISB 5EZ6B 1U94A 2W00A 2WMNB 1GIAA 1N6IA 3ZH9B 4E22A 1HYQA 1D5CA 1W4BA 3NHBA 1LF5A 2FV8A 2G6BA 3T35A 5LB4A 4MRRA 3WRXC 3U4QB 3VNVA 521PA 3O8ZA 2CVHA 4YLGA 1XCPA 4M2LA 2C78A 1F48A 4J0QA 3M0DA 4RFVA 2E9SA 3MWJA 4Q21A 5BW8A 1Q1QA 3RDPA 4DLRA 4JT2A 1WP9A 3LFUA 1NN0A 2P67A 5LBIA 5C1BA 5KPDA 1E2PA 1E2IA 5J4LA 1RFLA 3K70C 2YWGA 1ZBDA 4DB4A 5JJKA 1F2UB 2FEOA 3GJ8A 1VG9B 1XMSA 4AKEA 2XTZA 5EQTA 2JLRA 1KSGA 4PZZA 2EFEB 3B1XA 3L0SA 2X2EA 5LPNA 4AD8A 5IF9A 4FWIB 3L82B 1VECA 2C77A 3M0AA 1CI6A 1R10A 1OE0A 4GP7A 2ZJ8A 4DSUA 3C15C 1E2MA 2ZR0A 5JWRA 1XZQA 4ZI2A 5AW9B 3M6AA 2REXB 4C0QC 4LHVA 1Z6GA 1XXHE 4JYCA 1P2SA 4NCKA 4DB2A 2OBMA 1Q3TA 2GESA 2GVDC 4CVNA 4L5BA 1GKUB 3LAWA 4ERNA 4Q9HA 1V5WA 2Q3MA 2BHRA 2DHRA 4B44A 3CUEF 1P75A 3ETLA 2J7PA 1JALA 2PMDA 4KJZA 1F2UA 4HAWA 2QP3A 4M9SA 1A2BA 2FGJA 5CYPA 4OQLA 2CNWD 3O8RA 1MABB 1Q22A 4DLXA 2DY1A 3IUYA 3J81k 4B3FX 5CK4A 1XB2A 1S9DA 1GILA 3ADKA 2QBYA 2IBMA 3GLFA 5EE1A 2VTKA 2GCOA 4OQMA 3BH6A 1MRSA 1II0A 3GLGE 1Z5ZA 4IVRA 2OFOA 2VSOA 3VN0A 2A5JA 2IXEA 1N6RA 3GJ4A 5APXA 2G3YA 4LJYA 1SKYB 2BM0A 2QZ4A 3NMDA 1GU5A 5JFGA 3V4WA 5BQ5A 3KQUA 3IPYA 1KK3A 2JJLA 3W5JA 3C16C 1CR1A 2AXPA 4GI7A 3AVYA 3AF3A 2HYDA 4Q7KA 1KNXA 1JQJC 2OBNA 4R98A 3RABA 4O3MA 1U9IA 2ZRDA 2H92A 1S4QA 4LSGA 1XMVA 2IEZA 3C4JA 1Q57A 2G1JA 1SXJC 2H5EA 4JL8A 2QM8A 3K09C 4ZDKA 2G77B 3GLFB 1DS6A 1KY3A 2GCOB 4A1FA 1FP7A 1ZNXA 4EFMA 5C18A 1Q3HA 1G20E 1Z06A 5AVZB 1E9SA 3WMFA 4IOKA 2GTPA 2EQBA 3OEHA 4HAVA 4A4DA 1A1VA 2QQEA 5J4YA 3L0PA 1F5NA 4D2IA 4EPTA 2JLWA 4JJZA 5AJVB 4MGKR 4H9GA 1UFQA 2QTVB 2VLIA 1YZTA 5FOWA 3TSOA 2QTHA 2J41A 3AGQA 1WBDA 5AW1B 1C1YA 1RRPA 4CEIB 2ZE6A 3FMIA 4TL6A 4MGIR 2WICA 4NPHA 2BC9A 1NI3A 4YMWA 2D7CA 1A5TA 4N1AA 1G5TA 3CBQA 1FX0B 1G4AE 2B8TA 2QMUA 3ONWA 3PEWA 2OV2A 3JZMA 5APTA 1UF9A 5CDFA 4GRAA 4C0SA 2J9RA 2O0JA 4OI1A 3SI7A 1LW7A 2G0TA 2R9VA 3GPLA 3GMTA 1ETUA 4TWZA 3TVDA 3GFPA 3AM1A 2LFRA 1P73A 4NYIQ 2FEMA 4QC2A 3EC1A 4UNNA 4W5JA 3BAFA 4D4KA 1A7JA 2CHQA 1SVMA 1GKYA 1U8YA 1NMXA 2WJJA 2YOFA 4Y0VA 3D3QA 4OQXA 1CJTC 4US2R 4DCNA 1TUEA 1WQ1R 1X1RA 5CM8B 4Q4LA 2XX3A 2X77A 2O52A 4JT4A 1OFHA 3THXB 3KJEA 3LD9A 3LW8A 2V54A 1FMLA 4WIAA 2XOKD 2IYWA 4GOXA 1DAKA 4PO8A 4Q1AA 3GFTA 3SQXA 1LVGA 2OCPA 1GP2A 2PZGA 2W2VA 3QOFA 3FWYA 4PZYA 3E5HA 3T15A 2A5YB 2QY9A 4LPKA 4YDSA 3JVUA 4HSEA 4NU0A 4AIIA 3U60B 2R62A 4M3LA 3OAAA 2PT5A 3MAAC 3TW8B 2JDIA 4R9UC 3U2QA 2CJWB 2C9OA 1E4VA 4A2QA 3O8BA 4V02A 1IY2A 4Q4HA 3W8RA 3NXSA 4MT8A 3K0CC 3R7WA 1XMIA 2NTYC 2YWHA 5FUVA 4L8GA 1Z47A 1BYIA 1Z29A 2VA8A 4QJ5A 2FFBA 3TKLA 1I4TD 4JAUA 1PZNA 1R8QA 1G3QA 4AQRD 2CCJA 1KIMA 2PH1A 2FF7A 1QHSA 1QBKC 2WWGA 3K0AA 2JASA 2WWFA 4NBSA 3SC3A 5F98A 4PQFA 4C0HA 2RCNA 1RJ9B 1HQCA 2QP4A 1BH2A 1F2TB 4FINA 2NO7A 5H70A 1UBCA 2CCKA 3A4NA 3AH8A 3FKQA 4HB0A 4M1YA 5GJBA 3K9NA 5JHHB 1E2QA 1ONBA 4OK6A 5FUYA 3GLIE 5APQA 4KFUA 2JLQA 5HTKA 1Q20A 3RWMB 1LFDB 4FMTA 1E1QD 1FUKA 4PFSA 3VR4A 2V55B 4PXAA 4BFVA 3AQ4A 5AW2B 5FPKA 3RWOA 2O8DB 4BZPA 3U6KA 1DO2A 5G40A 3R9XA 3NBFA 1Q1EA 2CVFA 4POAA 2BWJA 2PEZA 1W49A 1VMAA 4MYCA 1VDZA 4YMVA 4MYTA 5HE8A 2R5DA 1XBTA 1FL9A 1NVVQ 3E1SA 1R0ZA 5J4HA 1KI1A 3QKUA 5KNBA 3UWKA 2WPQA 1RJ9A 3WXMA 3JVVA 1E0JA 2GRJA 1OIXA 3RANA 4RKEA 4BRUA 2ZRFA 1D2NA 1R0XA 3DZ8A 3VAAA 1L8QA 4PSAA 4ZCIA 2XNDD 3IILA 2BCJQ 5C46F 4URXR 1CJUC 4LOAA 2HLDA 2PCLA 2W2XA 4NYIR 4LJAA 2AHOA 4GOKA 3TUZC 3D8BA 1ZD1A 4I5SA 4C7NB 3TUIC 1X8JA 2C03A 2V7QD 4XD7D 5JS7A 4MKHA 2O0KA 4HYYA 1Q1BA 1KDOA 4OQNA 1W2HA 1HT2E 3QXHA 2GAOA 5EUQB 1XPRA 1KYIA 2VHUA 2JGNA 1JUNA 5FR1A 1AK2A 4QPJA 1G3UA 1W5SA 2WWWA 2GCPA 2IXGA 1ZNYA 3IPXA 3VMYA 1GNPA 4KBGA 3M91A 1GG2A 5EE3A 5J4VA 1FQKA 2UVQA 3CWZA 1UEIA 2GETA 4G5QA 4RD6A 2IUTA 1JXMA 1Q0UA 4A92A 2GHIA 1TL7C 1XMJA 3TSZA 4G0NA 1OHHA 5LDDC 1E0KA 1CJVC 1NN1A 1ZCAA 2YOGA 4TMKA 2RGAA 1T4GA 5CLQA 5KSZA 2E1RA 2B8WA 3I72A 4TT3D 4HB2A 2GBLA 1TPZA 1OYWA 2ZR9A 3RS0A 3EPLA 3M4YA 3LRPA 4BIUA 3ZVRA 2BMJA 4QHYA 2QRZA 2FH5B 3ZCCA 2GAAA 3NBYC 4P4UA 3V4RA 1YZUA 1HEIA 2E42A 5KDOA 3BOSA 5FL3A 3QE0A 2JCSA 4JVMA 2FZ4A 2IWRA 3SJZA 4A8JB 2WPRA 1CR0A 2MSCB 3NBZC 4PSVA 2B92A 1TEXA 1T2KD 2AWNA 2YZ2A 4NCNA 2Z4SA 1GUAA 1ZM9A 1WE2A 3V00A 4DSOA 3EG5A 4XVUA 2WPDA 2WV9A 1RYFA 3I1FA 4C0JA 3ZRXA 1W1WA 2HT1A 2FDCA
chains in the Genus database with same CATH superfamily
4RKYA 2IVFA 4CTKA 4OM7A 1H2NA 2UZ0A 2ZPUA 3SR3A 4KMOA 1S8AA 2EC5A 2AK3A 1PNMA 1TK9A 2ZT9C 3I3SR 3OE7A 2ZBRA 3PWKA 1ZL8B 3QIAA 3H1LH 2PVCA 1Y89A 4G63A 4QT0A 1ABBA 2HQ1A 1M7LA 2PU7A 4GIFA 1A9PA 3D7MA 2I2FA 5IAKA 3SJ7A 1M5TA 2VIIA 2OGUA 3NH9A 1B4DA 3GJYA 1COWA 3H04A 2E5LB 2ZWAA 2AN3A 1XTIA 3AIIA 3R4VA 1UFVA 1ZUD1 1YOBA 3HKBA 1OCZC 1U1EA 1TA8A 1AXEA 2PMWB 3DNFA 2YRFA 3QU7A 5CB4A 4DV4O 4JUCA 1SQPD 3PKZA 2AG0A 1V5FA 1EM6A 3V5NA 3NPMA 2HQOA 2VQEB 4I55B 2WZ7A 3TSAA 2A0XA 2POQX 2PWPA 4DHEA 1DDOA 1KQLA 3A0RA 3EFEA 4TMZA 5FL7A 3DW1X 4KYUA 4S3MA 4YQFA 2J9XB 2ZIXA 3H7AA 3N2GB 1M2KA 4BQEA 4F96A 1H5NA 1D1TA 2D3WA 4LQCA 1JZSA 4AQDA 5BVHB 5EFZA 1HGZA 4YQEA 3TTWA 4ZXPA 1Y5RA 2JIOA 3UJ6A 3CMAP 5TQVA 4FI3C 4LYFA 4BBJA 1V8BA 3OU2A 2ZJBA 4ZDJA 1R3IC 2JP3A 1KJWA 1FB5A 3SWWA 1QH1B 1ZUIA 2C4MA 2J07A 3V4VB 1JEYB 3QQPA 4Q1VA 4O2RA 3TMAA 4DLLA 4FFLA 2JBAA 2JGUA 4LXIA 4WY5A 4QTYA 3OT1A 3K35A 3TKAA 1G8PA 5B1YA 2Q1XA 4JIMA 4WOBA 2O07A 4LV6A 4JIGA 3OOYA 2W7TA 2Y0BA 4HBNA 2JZOA 3RL0D 2I1WA 2X5JO 2ZSDA 4PAMA 3RS8A 2RQ6A 3TNLA 1NRWA 3Q85A 1GD2E 5CCXA 2BFEA 4E5KA 2Q21A 3INGA 1KK1A 3T5BA 2AA3A 5AW6A 4PYKA 3RC8A 1EGMB 3FZEA 1SF9A 2R6HA 1GTZA 2G1KA 3CCUP 3PUWA 4W7IA 1XKLA 2XGJA 2K7FA 1JKIA 3OP4A 4JI1B 1YRAA 3TCNA 1W4AA 4KIFA 3ZZ0A 1VMKA 4R9NA 1QKKA 1T2VA 1XJCA 1EX7A 1G1MA 3BS4A 3QKWA 4FLXA 1YK0A 2WUGA 3AR5A 4L9AA 4LDQA 5DZSA 2HF8A 2I1VB 5KX5F 3P52A 2BFPA 1ISSA 4H2DA 3LFHA 2BEWA 3VPBA 3ZWWA 4TRRA 1JEDA 1RJDA 3VDMA 3W5CA 3J80A 2GF9A 2YZNA 4PF1A 1LZLA 1TC2A 2CHVA 2B4AA 4EGAA 5K6TA 2JCBA 5L51A 1MABG 3K9HA 3Q5SA 1N5KA 1UBNA 1VCHA 1IK9A 1VM6A 1ZITA 3FPKA 3PL5A 4HZUB 2EXXA 4TQFA 1JY3P 4KUEA 2V7QA 1DWQA 1HT3A 2PTHA 2EBWA 1V45E 1PL4A 3MGKA 4ITVA 4MK4A 1BFKA 1GLNA 1C3LA 2PTGA 3IMFA 2FYUE 3KYCB 1ECLA 3DBLA 1FFGA 1QK5A 2SKCA 3DPUA 1UPFA 4IZIA 3OKCA 2ECOA 4RHEA 1GU7A 2FFJA 1OYYA 3TZ6A 1N33O 4EI9A 4DR2O 1TUBA 1OCOB 4DWJA 3D6JA 3O8DA 1OCCB 1DXYA 3CNQS 1NBME 1XAHA 3HCCA 3P7MA 3QVSA 4JLJA 2C9YA 4PZCA 2E21A 4C89A 4F12A 5J2TF 1IZ9A 2B5VA 1VLMA 2V9ZA 2VJPA 1CIVA 1GGJA 3PTLA 1EWYA 2ZE5A 1CC1S 3P9PA 2F7SA 3R5TA 4JSYA 5CT8A 5DBIA 1PX2A 5DHPA 3V4PB 1NVTA 1XXHB 1Z4JA 1A5AB 3G71P 4MRVA 3LF2A 2AFIE 2UXCB 3QEMA 4I1RA 1GU0A 3PD7A 4RF3A 3S44A 2OP1A 4CKZA 3C3YA 2O3TA 3FH0A 4RVNA 4HC4A 4UB8Z 4IQFA 1S8NA 3NRJA 3TNFA 2A58A 1VL6A 4AJKA 2B20A 1P49A 3V2PA 3Q3IA 2ZVJA 4JUAA 1FS0E 4DR3O 3EWIA 3U7IA 1QE5A 4PDVA 3ECCA 4AZWA 1NX6A 4B7CA 4HEJA 1SQBH 4QQNA 4ZANA 8AT1A 3AVVA 4P3OA 4R0VA 3TJTA 4XEUA 3RT3C 5IEJA 3ZN2A 2EJBA 5D87A 3PG5A 1E9AA 1VHDA 5IBPA 2PWYA 4N3CA 3H1JE 3LBAA 2PD6A 5TF0A 4C05A 3SXJA 3U16A 1II8B 1N1GA 1AR5A 2PUFA 2OV3A 1XD2A 2KOGA 3ZG6A 2C0XA 3R3UA 3IIKA 1J7KA 4IF4A 4EGQA 4FM2A 3SG0A 2ORIA 3PFGA 2YHBA 3P8ZA 4WFAV 1U7PA 3NMUF 3PTAA 1O5IA 4LMBA 3MXOA 4BFXA 4PX9A 3OWHA 2O8EA 1ZSPA 1J00A 2LD4A 3U1CA 1CK4A 1LUWA 2ODWA 2OFXA 2VZ8A 3WHPA 1E2KA 1U9ZA 2ZS8A 3W9SA 1QYXA 2JBWA 5FPPA 5IUNC 1KC1A 1RHQA 2FLVA 3R7LA 5BWMA 1TIBA 2QUZA 2QVZX 2ZYHA 5K9ZA 1OCCC 3SWKA 1OJ7A 5LQUA 4O4IA 2V7UA 2A9QA 4D4LA 5LHIA 1KZ9A 1UFOA 4LF8B 2J59A 2Q3JA 1B6SA 1D07A 2P9CA 2XIQA 3BN3A 3KVVA 4J0EA 4JBLA 1S0VA 4M6WA 4B6FA 4BV8A 4D9GA 1PV2A 4YRQA 4PQYA 2B5WA 3CLKA 2WWTA 1U57A 3BGWA 3IE2A 4AJHA 2R1TB 3QMWA 3RBXA 2BH2A 1L4AC 4ZGBA 4KREA 1RR6A 2M9MA 4KSYA 1U7MA 5KWIA 4PC3A 1BEZA 1WJGA 3KUKA 4R1NA 4X1OA 3JQ8A 2J5UA 3RTDA 3SGLA 1J33A 2EWVA 4B81A 3PUZA 1A7UA 1MXHA 2BR5A 2VDQB 2H1SA 3AFMA 3EULA 4GMHA 2H7HA 1SC1A 3FX2A 1K4DC 4MQ4A 1Q6ZA 4WL0A 3TZCA 3ZV5A 1OBVA 4DIOA 3U44B 1F6BA 1JO5A 4W7ZA 4W6QA 2PRSA 2B0JA 4E3WA 4ALNA 3SQDA 1QZUA 1HYEA 2P2DA 1OFCX 1KFJB 3B7WA 4U7FA 2Q5OA 2WLLA 3NDPA 1XQ9A 2IGBA 2IH1C 2ZIUB 5FTNA 4E4TA 4F91B 2W58A 2WAXA 1DKOA 2OLKA 3KKEA 3KPYA 3O91A 3PQEA 1IVSA 4GI2A 4QU5A 4L5JA 3UA3A 4ZYYA 1M2WA 5HR5A 1BVRA 3G2HA 1N0JA 1V1JA 1XXLA 4WLVA 1UPAA 4FOPA 3F6RA 1F4MA 1RWPA 2A1UA 2DWUA 4LCJA 5CIWA 3L71D 2Y1EA 3KEMA 4YJ3A 2B83A 3TL3A 4MUKA 1YB5A 3WK6A 2X8WA 4CT0A 1JLKA 2FUNB 2QLJA 3AP1A 3NNSA 4MUIA 2DWOA 2HG5C 1G7RA 4F21A 4E5PA 3NT4A 3K6SA 3ELYA 4GR5A 3JWJA 1EFDN 5F23A 3L36A 5BV7A 2XTNA 3CCEP 3BRWA 4EG3A 2WFMA 3AF5A 3RASA 5GIOE 2BMAA 1TDJA 2BGJA 3QSYA 2ADQB 1NUHA 3H9QA 2JGEA 5IWAO 2VQ6A 3LQYA 4UW9A 1QFSA 4FYYA 3R9IA 3C43A 3ZU5A 1IDOA 2W2LA 1ZI6A 2GN9A 1QCYA 5AJUA 4MOWA 4XI9A 3KVYA 4Q3NA 3RODA 1NKTA 4K9MA 4ZZ3A 1O0SA 4FMDF 4K9QA 4LQ4A 4CL8A 3TB6A 2ZCJA 1CTQA 2HJGA 3TOVA 2H1WA 5IZCA 4WVFA 2H0QA 2JJ2G 1L0LJ 2OYIC 3SC2B 3HYRA 3JQAB 4OXQA 4W99A 3K79A 2WHYA 2G1PA 2WLHA 2XAQA 1OI3A 3CMCO 2W8BA 3CTMA 3OLCX 1UZLA 3Q7EA 4TWRA 2GXAA 3PXCX 4ZQHA 1PJAA 2PUVA 1S5PA 3GEDA 3V1YA 2QTVA 1EQAA 1JLSA 2FOIA 2HA7A 2G88A 3LC7O 4UPEA 1OASA 4GL4A 3W7WA 3LC2O 5DLYA 1J5EO 3O47A 4ARSA 4UNRA 2AMJA 2UYQA 2WEKA 1PWEA 4I50B 3K0FB 4MQ5A 1VPDA 1MZPA 2E87A 1G2IA 3Q2KA 4GUAA 4Z4HA 1LLUA 3CSXA 1LA2A 2Q2NA 1BMTA 4Y6QA 3ROTA 2QMQA 1O94D 1R27A 1YOVB 3W8DA 1XPUA 4DV7O 4EKYA 1T36A 3DNPA 4JB3A 4WV3A 4Y2RA 3WZ2A 4AMZA 5A9TA 2R72A 5JTUA 4ZARA 3LSTA 4KP7A 1EQUA 5C3UA 5M04A 2FRVA 4G67A 1OT3A 2OYOA 3ESRA 4IIDA 1K3EA 2CLKB 3IS3A 4CEJA 1UWVA 4K6GA 3SJCC 2H9IA 1CUZA 3I58A 2DETA 1JU3A 1E5QA 1M54A 1U02A 3HS3A 2NU6B 1CY7A 3M1YA 3RIXA 5ENVA 2J5XA 1W0JG 3DOCA 2R66A 1AHPA 3E27A 1V1MB 1MH1A 3X2QB 4K5QA 4ZIRB 5JH7A 2YC0A 1QKJA 3VKFA 2MSKA 3HUSC 1ISRA 2XTAA 2PLWA 3LQQA 1SOWA 4DLVA 4MPRA 5A5VA 4MP6A 5EG5A 2IJIA 3LDFA 1L5MA 2GBPA 4HDSB 2WYWA 5KYWB 3GLHE 1VMGA 3H16A 1N2HA 3MQ2A 2FR1A 2IK8A 1Y67A 3ZWOA 4CL0A 1JEQB 4MRSA 3V55A 2EINC 1BDDA 3QWFA 3T7RA 4CLOB 4QDXA 1G18A 2G8NA 1SLQA 4YJHB 1YULA 1BE3J 5U9CA 1W7AA 2Z6UA 3VFDA 1PQWA 1G8HA 2XNSA 1AUQA 3QO5A 1Y1LA 1Q6IA 2ERXA 5AVTB 1W5FA 4X92A 3UIEA 1E64A 3VDXA 3ZTYA 4XBFA 5A9GA 1GG9A 2VXCA 2AW9A 4DLSA 4LF6O 5F9MA 3O0TA 4FFDA 3DAYA 2Y05A 4EMTA 5IF3A 1WRGA 2EKLA 2QTFA 2VDRB 2WZQA 3JR3A 4K05A 5JATA 1T3SA 5LZ4A 3TAUA 3LQRA 2F90A 3KZ1E 2AFIB 3CVJA 1Y9AA 1M57D 3COYA 1YR8A 1EEXB 2GZSA 3CEPB 4MV4A 4OB8A 3UJ9A 1UJ5A 4NX2A 3HDHA 2QTGA 4OBWA 1B2LA 4G9GA 5DASA 4KR9A 5DHQA 1YMVA 4C01A 1F8FA 5K0BA 2PAJA 5DCLA 1XDGA 2PCJA 3E23A 4I36A 1G5IA 4N9WA 3W34A 4YT8A 2W27A 1ZGCA 5B3SB 1P29A 3ZOZA 3K9LA 3NC4A 2EWWA 4KACA 3WYEA 2N1TC 4F4IA 2P2LA 4ER5A 3AMVA 5EWMA 1WXWA 4DUPA 1XZGA 5DJ5A 3T3NA 1RWNA 3FLMA 3RVSA 6ADHA 3DEIA 1FMTA 3AKYA 5CG2A 3NVMB 3CLTD 1O94A 1CERA 2H1VA 1XEWY 1EJ0A 4EP1A 5ALVA 1FIUA 2NTVA 1VQ4V 4OFBA 2Z09A 3G0HA 4QJFB 2QX6A 3OY7A 2QW1A 1N3BA 3ESDA 2KSDA 2ZIWB 4P83A 3QP9A 4HYOA 3ZDYB 5TXGA 3FTQA 3GLMA 5D1NA 16PKA 2KIKA 2J1LA 3NBXX 2X3YA 4LYGA 2I4RA 4K0KO 2N04A 1W8DA 4G4IA 3E1RA 1W34A 1R00A 5F21A 1DL5A 3OCCA 4A16A 1ULTA 4H1VA 4BMNA 5K4HA 4FGZA 5B5SA 2NV0A 3KYJB 5JXWA 2P65A 3GC6A 3HCPA 1WP7A 2KP8A 1Q2UA 2HT6A 3C3PA 4ASUG 1YR1A 4L8LA 3G13A 4HLCA 5AP9A 4ISCA 3T7CA 3SE0A 5C8XA 1SJ9A 3OM8A 5DH9A 1EM1A 3K4PA 2XUDA 3FUTA 3C48A 2EP8A 2RGCA 3LO8A 4BLOA 2PGLA 3HO6A 4ZZ2A 2I8DA 5AM1A 2WT7A 2W0MA 3GFBA 4RVSA 2ZRPA 1Y1KE 3R3YA 4X00A 5B3JA 3FIJA 2P77A 5E9QA 3K94A 2C97A 2Q3IA 4YT2A 1FVOA 1D1QA 4H6WA 4IHJB 1EXWA 1Q5PA 4OPHA 2P1DA 1OGIA 4R1QA 1ADGA 1CUEA 4UPDA 4MLDA 2HA2A 2O1KA 1GL9B 1AKWA 1VJCA 2HRZA 3CC8A 3T1HB 1GL7A 3HMQA 5DI9A 5EKXA 5B1IA 4U2GA 5B1BC 3DV0B 3F5FA 5AMXA 3URMA 2J9GA 2RBGA 3WG9A 2PGGA 1S72P 2ZJYA 3NALA 4R6WA 4YXDC 5TPZA 2A14A 2VAPA 3GGJA 4B0OA 5BOSB 3HPQA 5TISE 1PUXA 2CLEB 2ZBUA 4DEXA 2YH2A 5E6SB 1GAXA 4Z4EA 3JQFC 5HOQA 1KMIZ 1JMVA 2C83A 3B13B 3FPBA 5EXTA 5A7FA 1MJGA 3E7XA 2O54A 4Z49A 4HATA 1IEWA 1KARA 5EY5B 3G0GA 1X86B 3PL1A 4M0FA 5LBUA 2QW8A 1N5JA 2RHLA 2XRYA 3PCXA 3VBCA 4D9MA 3IMEA 2HG5D 4HN9A 5JARA 1B93A 5AVUB 3PQ5A 1ABEA 3I9FA 4E13A 3CHYA 1ILEA 1AGXA 2QT0A 1LT9A 2MYPA 2Y0DA 3M9WA 1VA4A 2QV7A 3AUFA 2OO5A 4DPMA 1JWLA 2N05A 3TLXA 4KXRA 1ZHHA 2ZB7A 1RIFA 4BCCA 1NQUA 1FDWA 3EZNA 3G8CA 3TW0A 4CM1A 4RLHA 4TN1A 3KQMA 1YVWA 3I73A 3O4FA 4K6OA 4XGKA 4LWSA 2NQTA 1D09A 2RN0A 4UEOA 4FE7A 2KQXA 4QUDA 1JVSA 1LNSA 2OCIA 4MZXA 4IZOA 2FWAA 4FIPC 5JSZB 1A7AA 2P5SA 4ZKEA 4G5SA 3HPLC 3WMM0 1PR2A 1ENVA 3EH2A 4ZVPA 3CB4A 4A8PA 4ZCMA 5C7IO 5TMPA 5JO0A 2PTMA 1AUPA 3E82A 4OBEA 5E1DA 1YU6A 3B8NA 3DWEX 1RFGE 2OGZA 4H4CA 1QV7A 2QGFA 4A8JC 3TLAA 1G8KA 4US0R 5JXJA 1RI1A 1W44A 1UM9B 2AL7A 4QUHA 5KJ7A 3WNDA 4ZZ0A 3QXCA 3ZZ1A 2FMTA 1FKAO 4HWKA 1J8FA 2EIXA 3VR4H 3UUGA 5LL6Y 3ESBA 1QORA 3ELBA 3UPDA 1KZ4A 3QBDA 1SKQA 2DTXA 2QXTA 1KEVA 3DMTA 4KPGA 3TRJA 4MVJF 4RH1A 4N6GA 2JNWA 4LZWA 6GPBA 5FBLB 4AI6A 1UOOA 3M2TA 2K1EA 2PUWA 3FF1A 3FPJA 1B3RA 4F3YA 3ABSB 3DDOA 5LU8A 1NMZA 4JDUA 5AVQB 5D5PA 3DTYA 1L5OA 5EFOA 3I8OA 2H59A 5LHHA 2MK3A 3VO2A 4B47A 4F9EA 5B4UA 1MAVA 1RF0A 2LGQA 2PWBA 1D5WA 1J8QA 1K9MW 4FBMA 1COZA 4MNTA 1ZGGA 4BOYA 1E5WA 1HQKA 2YYZA 5H6RA 1IFNA 3H13A 3T3PB 5E0OA 4B6GA 4W4TA 4GXRA 4BUCA 4CM9A 1IN4A 1I08A 1JT9A 1W581 3II6X 1C9DB 2Y99A 1PLKA 4INPA 4MGEA 4EG4A 3O93A 1YTLA 2P0YA 5KHHA 2FSPA 5KHLB 3A5TA 5KLVH 4K03A 5E3HA 4GKAA 4R2WA 1GQ2A 1JKJA 2PY6A 2W11A 2YV1A 1AX9A 3WDLA 4CMHA 4Z1MD 1NTZJ 4ZYLA 5BUZA 1F7VA 4RKFA 1P4JA 4J0GA 3GRYA 4GX5A 4YAFA 1W75A 2NXJA 1ZSYA 2Y3IA 3T95A 1J21A 1QLEB 4WFHA 3L70G 2FG7C 4P9NA 4JUDX 1YONA 1KZUB 3NHMA 3MHPA 3BFKA 3Q0EA 2Q29A 3TQCA 2FPIA 4QDUA 1FBNA 4GLLA 2RCVA 1SXJB 3PHCA 2PH3A 4XPIB 1C81A 2WD7A 2P06A 3VU9B 4AJ1A 4OPAA 3CNHA 1D2RA 1NUTA 5C5EA 3NC0C 2HXYA 4QIHA 5TSDA 3EY9A 5HZHA 5JI2E 3ZWAA 4FZ0A 5LWHA 4HG2A 5LMUB 1TU3A 4EMSA 3RRFA 3FETA 2V8OA 4B3GA 5GM2A 1L7PA 1NF2A 3HD7A 2VBCA 3FCYA 2Q28A 3NDIA 2WDPA 4LXTA 4RZIA 5JAUA 5G4KA 2PBLA 3OVMA 4C7JA 2FHSA 1DG9A 4CM3A 5KAIE 3A6GA 3DJFA 4C0XA 2W2KA 2BT4A 3H1TA 4L4UA 6YASA 4AKTA 1VC2A 1MVNA 1A72A 3Q3EA 5IUKC 2WU0A 3B5NC 1V9CA 3GDOA 5ABPA 2XB2A 1R8XA 2XSZD 4OHYA 3I01A 4TYYA 4P98A 3WHLA 3W7XA 4CODB 1EDZA 1BHBA 1GLGA 1G21B 3OFVA 3I1YA 3KS9A 3L7AA 4NRDA 2AD5A 3H1HH 3PQ2A 4QXMA 4WBNA 5CN0A 1UMBA 1F4NA 4MDHA 4CG0A 2WSEH 2BEVA 3H2BA 1GM7A 1J20A 2CNKA 3DE1X 4I2VA 3RGBA 2V7QJ 2ZI9A 3EARA 3TMKA 4EOGA 5A9SB 5BSKA 4C2TA 4JEHA 3LT2A 4M86A 1MZVA 2B8JA 1RXIA 4ZK2A 4RFSB 1XZDA 4RD1A 5ITZA 3MWFA 5CBPB 1FNCA 3SVZA 1BE1A 3L8HA 4P30A 3L9XA 2WWVD 4KIWA 4EB6A 1O54A 1Q0TA 1E3TA 1L0NH 3KFVA 2QLLA 3CZQA 1DF4A 1NXXA 4PS1A 3SD7A 4N21A 3L75D 1K8QA 1SQBD 4UBOA 3JAWA 3RIHA 4MZDA 3D7NA 2JS5A 1LKZA 2UZ1A 2WJ4A 2XMGA 4D0RA 4S04A 5BW6B 2C2OA 5AOCA 2AYYA 3WYGA 4EBBA 3BT7A 1X7WA 2C4NA 1DG1G 5IE9A 1GITA 3H1IH 1Y1RA 1IQRA 1GT91 3FGZA 3MTQA 3ORQA 3RVPA 4Q24A 2I3BA 3CF6R 4GVLA 5DJUB 1BN7A 1PT5A 2GYUA 4I55F 3RU7A 3UC9A 4LXUA 3ZW7A 3IHWA 2O2GA 1YA4A 4B6EA 3PWZA 2CBZA 3KKNA 3KLBA 3C5WP 2I1KA 2FWMX 3CIFA 4L9SA 4M98A 1BL8A 3DUFB 2FP3A 3N0TA 4O5OA 5K51A 5KKZC 1LNQA 4ARIA 4YJDA 2IUSA 4EG5A 1EDBA 2FWBA 2MIIA 4IX1A 3AEUA 3M5DA 1MG1A 2IXFA 3Q3VA 2MDTA 2IYZA 2ZYIA 1Z6YA 1Z82A 1BFUA 3CPEA 5C4GB 4U6SA 3EOAI 4PWYA 4R0MA 5CH5A 5JSFA 1U8UA 4EYKA 1BC5A 4D74A 1RF1B 3Q4HB 1Z8DA 3H9JA 1EFVA 1GG8A 2H8KA 3UWPA 5CVDA 2WTBA 4EDHA 3CKKA 2C61A 2FK8A 1A7KA 2VN8A 3GRZA 4HBZA 3RSQA 2GPAA 2EZ9A 2WD9A 3OCYA 4GM4A 5CJPA 5CTJA 1S5LH 4UAGA 4IIJB 3LLCA 4OUDB 1TTHA 2GM3A 4QXOA 4BB5A 1FRVA 1GCIA 2SCUA 4EB0A 1E60A 5ILGA 3CRNA 1C3EA 3W79A 3A0HZ 4IRUB 5FB3A 3BSFA 2F9MA 3K8YA 4L3VA 1VQMP 4FWBA 1YQXA 3D7KA 4GBMA 3QUAA 5J40A 1YT5A 1E18A 2ZRNA 2ZWIA 5BVZA 5J5AA 2JLXA 4NPEA 2YHIA 3AEXA 4CFYA 4JGGA 5F7OA 4PC6A 1HUQA 3KZXA 1J95A 4YPVA 1QPBA 4MUJA 4B7KA 2XEXA 3QKRB 4X1YB 6CHYA 3HE4A 3MMXA 3P9XA 3BB1A 3O21A 4Z4CA 4HDQB 3CE6A 5B58T 1WHTB 3P0HA 4XOUA 3UAOA 3V32A 2JJYA 3K06A 2ZVDA 4MYUA 2X15A 1LFAA 5EQDA 3F6BX 1W4RA 4RQBA 3L71H 1PLLA 5FIUA 3ROPA 4P4TA 4JELA 1SQBJ 2O7RA 2Y1DA 4NY1A 5AVXB 2OYIB 3KTDA 1P9WA 2GN8A 1SM4A 2TMKA 5FBWB 1FPMA 4MP3A 3VVMA 5C7YA 1KQFB 3SF0A 4BO0A 2RHJA 3NAGA 1UQRA 2PGNA 1O6FA 1P2GA 4BZXA 2UU9B 3F1LA 1DIHA 1QK4A 2XSZA 4J9ZB 3TSCA 5J1TB 1G8MA 3AEZA 1XC7A 1XZAA 2J7KA 1L5FA 1NF8A 2MU1A 2YS7A 3EXHB 3F49S 3TVTA 5HQ3B 4BE9A 1U63A 1MEOA 4V38A 4C7BA 2P9FA 4UPVA 2X6QA 5HQJA 3W2IA 4PHTA 5FYDA 4RNCA 2CZGA 1G6HA 1SB9A 1G20B 2Z56A 3CLUD 3ZYCA 2FB9A 2FMHA 3W1VA 2GM5A 3OR6C 1KKLA 3H9VA 3R74A 1AILA 5F7JA 1PS8A 2Z5VA 4MWSA 4E2FA 4ND5A 3H6GA 3N0WA 3CC2V 1U2EA 4OAOA 3BICA 4N0DA 3PP5A 3F2VA 4TT3H 3PZBA 3AHFA 3JQ7A 1VPEA 2I3GA 3IPRA 3DV9A 3WU2H 3R8CA 5HG0A 3RSCA 1YZQA 4HJGH 1PVDA 1PWXA 3EIQA 1FUIA 3L8DA 3NTXA 3TGUG 2GDZA 5EJ2A 3IIEA 4AG6A 3KKPA 1KH1A 2UXCO 4JBNA 3AUKA 5GTHE 5I4KA 1NTZK 3HE5A 3AK2A 2VRCD 3EN0A 1QIDA 1HE5A 2XDYA 3RM3A 3MXTA 3IUEA 4EF5A 1SKYE 1Y66A 2V3CC 1PL6A 3DB2A 1GTMA 1KRWA 3AR2A 2ZYVX 1B26A 5JSKA 4KFMA 1N33B 2AJBA 3VC3A 4J1QA 1JJOA 1GDHA 5IKOA 3M33A 3HADA 3TLGA 4C3ZA 2FEWB 2W6JG 4GPBA 2X5OA 2Q2QA 1USDA 8OHMA 4H4DA 2H1LA 3SC4A 4JA2A 2C0WA 3MTIA 2Y27A 5FV4A 1ZYUA 5LP6B 3FIUA 5FO1A 5FTLA 1NP7A 3H2SA 3SYQA 3WOVA 4XWWA 2GXQA 3DC2A 3WU2E 5IAJA 3OQHA 5HF5A 2ORVA 4NPFX 3GRRA 3KSRA 5AKHA 5DDIP 3COJA 2VXOA 1TYDE 4FWTA 4L87A 2IBZE 2FW0A 1ZM7A 3WICA 2YYYA 1L9KA 4U7HA 4UHCA 5JIBA 2BDUA 1AB3A 2Q6IA 3BJIC 4V0NA 4JI1O 3RFUA 3EDOA 3IPAA 5K4AA 1BVHA 5EIXA 3NJRA 2O5VA 3GUZA 4C87A 5BQ3A 3RYHA 1VQ7P 2BFWA 4BLTA 2UV8A 2IDJA 2QJOA 5AXBA 5KYUB 1QTQA 1USVA 1XZEA 1M8PA 1IBRA 1ZXXA 5F12A 5BN5B 3QGMA 2OG2A 3ETHA 3FMOB 1SKMA 3WFIA 2X3UA 1N7HA 4B4DA 5J63A 3ER8A 4ZVVA 2I4LA 1DMRA 3F97A 3NHKA 3UCFA 5HRAA 1UIIA 1M5RA 1OT5A 4HP8A 2XAFA 4JI6B 1TJ3A 4GZRB 1YB7A 4KE9A 1KQPA 5CCHC 2FFDB 2J08A 4MR9B 3O0DA 4FMDB 1JIUA 4K26A 3SZMA 8MHTA 4EEQA 2DFKB 4S2EA 3AUXA 2WQZA 1RAFA 1R5NA 4IFEA 2RE8A 4JTAB 2FUG1 3VKUA 9MHTA 4ND7A 2B99A 3QOWA 4JGBA 1KMIY 2BFDA 3F9RA 3IR7A 3PYLA 4DGQA 3H5VA 4NQRA 2G9RA 3AW8A 4KI7A 1LD3A 1HYBA 3C5VA 1ZAYA 4K3AA 3AG5A 1SQPG 2BCCG 5HCNA 1DTSA 1JS1X 1YDXA 1ZCZA 2QD4A 2YFKA 4WA7A 2BHLA 3V1NA 1PUIA 4CLDA 3EW7A 5FO0A 1OI2A 1TGYA 2IEDA 5E9WA 3TJMA 3WGQA 4MS1B 2V58A 1N7SD 3OIDA 4RY8A 4W8OA 3ZWNA 2BSXA 1OKKA 5APUA 4M3NA 2LGWA 1FZBA 3L8MA 4AM8A 4YROA 1IH8A 3I56P 3Q7PA 2QAGA 1ACMA 3BH0A 4J9YB 4ZAZA 5KAPA 4Z9XA 1ZQ1A 4YI3A 1P1IA 3E18A 4TTRA 1PX0A 3VKGA 1K7YA 2QN1A 4HYQA 5FWYB 4F3NA 2XKKA 5JR3A 1NLMA 2Q46A 1KNQA 1PR6A 3L0OA 2WW8A 1GOTA 4EUKA 2OR3A 5JDIC 4IDNA 4MXDA 1JH9A 2YN2A 4WY8A 4GXQA 1A69A 3L7JA 3K4QA 3ROMA 1NVUQ 1WA8A 2ZYTX 5E1MA 4YRZA 1J99A 3A9RA 3SX0A 2PF4E 1I94B 2A9KA 5DN6G 1XIVA 2D74A 1Y4SA 2GCIA 2IYSA 3F5SA 3INYA 3PUHA 4R2JA 5T41A 1UKBA 1F3LA 1SUBA 3HB4X 1XQVA 3RVDA 3ST7A 3L72G 3WBKA 4BLSA 4UEKA 4KAXA 1W5EA 2FZCA 3IDQA 2TSYB 1O97C 4KFTA 2QRKA 3OWXA 5B2FA 1I6KA 3NW9A 1YI8A 2B1RA 2HN9A 4OEHA 4OG2A 3KVOA 4EHIA 1GNVA 1TA0A 3D4BA 1ISPA 2QWRB 5I51A 1TW3A 2MYUA 3RL0B 1Q43A 1DWOA 3BXPA 4LS3A 4Q15A 4LDPA 2PMKA 2G1AA 2ADOA 3T1NA 3ZD7A 1EX9A 3RYCA 1XP5A 2FN8A 2OHXA 4XKJA 4DJJA 1Z17A 1OGJA 1TF2A 1H8HA 2H3OA 4TYQA 2HLHA 5EPOA 3UJBA 3RK1A 2D0DA 4FLEA 4JFRA 5CPBA 2ZUFA 4FX2A 1HDIA 3GP3A 4CZ2A 3A0BH 4FFMA 3FJOA 1NT2A 3FF4A 4FFOA 2FQ1A 5HFNA 2ZTUA 1F60A 5IXYA 2FEXA 1HQDA 2F9LA 1Q0ZA 1C9JA 1AN9A 2ZJ1A 1JAZA 3OJ0A 3TMYA 4MS2A 4ZOLB 1KJNA 2JI4A 3LO5A 5KHJA 1FRNA 2OYHA 4P2GA 4RVGA 3T5CA 1CSBA 1EQ7A 1N57A 3VYSB 3Q2YA 5CX1A 1A9TA 1F3OA 1KO1A 5EP4A 3X3HA 4HQ6A 1E2FA 1N2DC 4IIUA 5LQMA 4H1WA 3W7SA 2AT1A 3OZXA 4GGPA 4NV3A 4WKPA 1ZIOA 4UCFA 3ZX5A 3LX4A 3VKVA 4J7ZA 2JHPA 3HJUA 5J47A 3HXQA 3GT7A 1M33A 3QV1A 1L3CA 4KQ9A 4L02A 5BYBA 1LH0A 3B3FA 4RHFA 3UGQA 4QUJA 3QLUA 4ESEA 5DM70 4IWYA 3U3MA 1ZMXA 2Q7EA 1DD4A 3L3BA 4EX7A 3ICEA 4QDZA 4YMLA 1IY0A 2E5TA 5ICGA 1JVNA 4HDRA 1H22A 2XPCA 1IEXA 4ZI3A 3IPLA 2G3AA 2FWJA 3N5CA 3CVVA 1YA6A 4UUQA 3OQBA 1RPAA 2O8BA 4YJFB 1YI2V 3X2EA 4AWBA 1N25A 2QVLA 4F45A 3ZMSA 3FNEA 3ND7A 2FYUH 2XKAA 2CJPA 3BD8A 4LHXA 4QBFA 1YS6A 1XMQB 3AG2C 1PWYE 1ZI9A 2VK4A 3BXFA 4LJSA 3QKSA 4GPIB 3NVKI 3FPEA 3KR2A 1S1CA 2F4VB 1RYEA 2VDJA 4FNMA 3EQZA 2QXUA 4RTJA 1QLNA 3X1MA 4CWAA 4PR0A 3UT5A 2C4HA 1WMAA 2AE1A 4NBVA 4YRRA 1ORDA 1U2GA 2XCIA 2UUBO 3HUDA 4CR8A 1OWNA 3GJTA 3H5OA 1AZSC 2GEKA 2QSYA 3OC0A 3CMMA 3OU6A 1FSGA 1MGOA 4KN9S 2GKOA 4NBNA 3MINB 4R9SA 4ZYUA 1A9YA 3FCXA 3D1LA 4ZCTA 4IEIA 3A2KA 4V0RA 4GEKA 1K5QA 1OH6A 4FDUA 2YKPA 1FK8A 1AQ5A 1NOKA 2APJA 3R3VA 4P36A 4XQGA 1P9NA 2C07A 3EZYA 5DXJA 4L0CA 3PRKE 5EMLA 4B2LA 2E6UX 2UZ3A 3I6BA 4BKQA 4C43A 4G1CA 2OORC 4GKVA 2FAXA 1FFTB 4QPKA 2HRCA 2VJLA 4BLQA 4JI0B 3SJBA 3FZGA 3I0ZA 3E8BA 3L73G 3QYPA 4DJDC 4GT1A 3DL2A 3FG9A 4MI9A 4H6XA 4R8SA 5B55A 1FAFA 2A6PA 2ZRBA 2CL6X 2CXQA 4MS3B 4IDHA 3AFOA 3FLBA 1EVQA 2HGZA 3IDSA 1QC5A 1RQGA 1NAYA 1DUVG 2PZSA 1Z8FA 2ZJ3A 3ONEA 3P26A 2GEBA 2V7WA 2Y93A 1PV1A 3LL7A 3KSMA 3VC7A 1ZRTD 3CYFA 2P6RA 2VUIB 1C30B 3O74A 4MB2A 2DLNA 3QWBA 4DV3B 4AILC 1MJFA 3QVXA 3NV7A 2F9FA 3QUQA 1T0HB 5J5VA 1KC8W 1DQRA 2KG7A 1U7HA 1PG5A 3H1IE 5GM1A 2QU7A 3TD6A 4OD0A 5KTKA 1S3IA