4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
4DJTA 4Q1DA 2WTUA 4XD7A 4Z1MD 5EP4A 1Q20A 3AB3A 4YXWA 2JDID 1AIPA 3IILA 1TX4B 5EP1A 3VKHA 3ZQ6A 3GFTA 5EXPA 1T0JB 1KAOA 2YOGA 5FOVA 4GT1A 1UF9A 3RRYA 2FNAA 3GLHB 2OO7A 2V3CC 3TH5A 2ZM5A 2X1VA 4ZDJA 3UK6A 4GKGA 3P4XA 4QOSA 4HYTB 4ACAA 2FGKA 3ZGXA 4MUAA 2BASA 2NOAA 4EKDA 3ZCCA 2BC9A 1DARA 2QMOA 2JJ1D 1KQLA 3TSOA 1M8PA 4TWZA 1MO6A 2PL3A 2WAXA 1OPXA 4LV6A 4F4JA 4FMTA 1N5JA 4B35A 1A5TA 5KPDA 4Q47A 2QE7A 4HB3A 1TQ2A 2V54A 4JVLA 4C0JA 1CLUA 5JHHB 3RWMB 5BYKA 3K9GA 1YR9A 3KDPB 1P7CA 2ECKA 2QTVB 2CCJA 2KP8A 1P3JA 2YWHA 3D31A 3EIEA 3OFNA 1Z6TA 3FB4A 3M0EA 2WICA 1GDDA 2C8VA 4PANA 1HT2E 1T2KC 4Q1EA 1GAJA 3CX7A 2QTFA 2ZYUX 1CR4A 2PT5A 3V00A 3U60B 5E3HA 2ZJAA 5BXQC 3WNCA 5AW9B 4GFDA 4IOJA 1KSGA 1U9IA 4D2IA 1X1SA 2HCBA 4U5XA 3B9QA 3RLFA 3THWA 2A78A 4TMXA 3N2EA 2VRWA 4B73A 4A15A 1Z6AA 4D80A 3ZIAA 2YNMA 4DLWA 1GK4A 3PCRB 5DLQC 5H8WA 1KYIA 2ODBA 5DE3A 2V7QA 3V4RA 2OT3B 2QEQA 4KVGA 3L8YA 2FX3A 3B1WA 4EQ6A 2XJ4A 5FFMA 2NMVA 1G3RA 3SJCA 1F60A 1Q0UA 1RIFA 2ZR7A 621PA 2DBYA 2Q21A 1Q44A 3P8MC 2ZVQX 2X8AA 3GD7A 3W6NA 6Q21A 2WPRA 2NZ8A 4D4KA 2WMOB 4TYQA 3KXLA 1W36B 2IS6A 2H57A 2WAYA 3TYYA 1XCMA 2YYZA 5B1OA 3WY9A 4NCKA 4HLQB 1RW4A 4QL3A 1E79D 4OQFA 1T3HA 4P4UA 1RJ9B 5AVYB 1JUNA 4HDCA 5EE5B 2ZJOA 5APVA 1G5TA 1YZLA 1KJZA 2R65A 3A8TA 2Q7CA 4I1SA 4YDSA 2F1RA 1JJVA 3LWNA 4L9SA 2PJRA 2IS1A 2WT7B 2REOA 3JVUA 4O0MA 4HAVA 4BLSA 1CJKC 1ZRHA 4Q03A 3W3ZB 1ZNXA 4AIIA 2MMCA 2R32A 2JDIA 4Q4AA 4JLVA 4D25A 1E98A 2W2VA 4HDOB 1NKTA 2RHMA 5A4JA 4R2IA 3RABA 2A5GA 4HEJA 5DNYB 1VCIA 3SI7A 3RC8A 3CM0A 1LY1A 2WPDD 3HTKA 2ZI3A 5FBRB 3CZQA 4QGFA 2WWYA 3AM1A 3AVTA 1AKYA 3AP3A 2LFRA 2BBSA 2JEOA 2GWHA 3AVXA 2FE4A 1BYUA 5LD2C 1KKLA 1G7RA 2QL6A 4A6XA 2QBYB 2YHSA 5BN4A 2ZJBA 2BMJA 3G5UA 4W5JA 4WXPA 5FTJA 1YR6A 4JLBA 3RRMA 2JJ1A 3RVBA 5EE0A 2P2UA 5AW3B 1NN1A 3NBZC 1YVDA 4KV9A 3EASA 3K1JA 4P33A 2DWQA 2WIBA 4JL6A 4LJYA 2OFXA 3E2IA 4HYYA 1R0YA 4P0TA 3K09A 4QJ3A 3PENA 2ZXEB 1C4OA 3NMDA 3K09C 1XTQA 2FFQA 2FSHA 1E2EA 4MKHA 4JIMA 4KP4A 1SKYB 5HZKA 3C14C 2QZ4A 2DWOA 2IF2A 2QQ0A 4B2PA 3IO5A 5J4HA 3OAAD 4MRVA 4DSUA 3IO3A 5HE8A 1FTSA 1CTQA 1M7GA 3CF0A 1G8FA 4Q9LA 3TSZA 1BIFA 1L4UA 1N0VC 2GCOB 2GESA 4OL0A 4PQYA 3TQFA 4D0LB 4UNRA 2XB2A 2ZJZA 4M1OA 3RANA 1LS1A 4LV5B 5LB2A 4D4LA 1GILA 3FVQA 4ARZA 2IYUA 2ZXUA 5L3QB 3NEJA 1EFUA 1KI8A 4XH9B 3A3YB 4XWKA 3SZRA 1DH3A 3EZ7A 5JS7A 2BEKA 3X1WA 4MITA 4M1MA 3T5GA 4XIGS 4Q4JB 2P5SA 1XFAA 4PC2A 5L3VA 4Y0AA 2XTMA 3W8NA 4J0QA 4MTXA 1NSFA 4EJSA 3PUZA 2AL7A 1LFDB 4EJSC 1OV4A 5JEEA 4KAXA 2ZFCA 1N5KA 4CEIB 4EOTA 1FFHA 3TNUB 2C04A 1XTSA 1FOSE 1FX0A 1E79A 4ZIRA 1XEWX 4TL7A 4M1TA 3ADBA 3F3YA 3FFBA 4LYAA 2HYDA 4BFWA 3SBEA 5D3MB 2QU8A 4TZ0A 1GSIA 2H16A 2ZSDA 2KB0A 5K8TA 3IIJA 3AKEA 1UBGA 3MGCA 5AK0A 3ZS9A 3AVVA 3LV8A 5FBWB 1NMYA 1L4YA 1XEWY 1ETUA 4GZMA 4L8GA 2NPFA 1CRQA 2R44A 2FFHA 1AA9A 3SHWA 3K70B 2ZYWX 4G5OA 1OXXK 1MR3F 3KQNA 1T6NA 1ZYUA 3EPKA 2DPXA 1P6XA 1AGPA 4JAVA 4HLUA 1IXRC 1P75A 5TV2A 1KJYA 1P9WA 2ZRMA 4TLEA 1I4DD 1K8RA 4PXAA 5IHPA 4Q01A 1ZU4A 2O0HA 2ZRHA 2I1QA 3FFAA 3PXGA 2F43B 3O8RA 5KSOA 2FMXA 2ZSFA 2WV9A 1N6RA 2RGNA 1AS0A 2A9KA 3U6KA 2IYQA 5EUMA 1X1RA 5F9HA 2QUZA 4B47A 1OH7A 2IS2A 4BEJA 4B32A 2HEIA 5L8VA 5M04A 2ZU0C 4A6PA 1XJQA 3NH9A 1EFCA 2EFHB 3EIHA 4LYHA 4ZPXA 3EC2A 5IDJA 3B8EB 3QF4B 4DHEA 4WIAA 1Q1EA 5JLJA 3AF2A 4HDQB 1IAQA 3L37A 1VDZA 2QAGB 4RZ2A 1ZM2A 2P65A 3K0SA 3B1XA 5AJZA 1WCV1 4WW0A 3OAAA 4R2HA 3BORA 2QSYA 5SZIA 1HJBA 3I61A 3T06B 2OXRA 1TADA 2YWFA 4OYHA 1GG2A 2CDNA 1DOAA 4RD6A 5B58C 3FMIA 3NBYC 1UKZA 1YZNA 2G3YA 4N1AA 2VLIA 2EWVA 4OHWA 4B34A 1IJFA 1UKYA 2NG1A 1D5CA 4B44A 1HUCA 1Z47A 5EXSA 3W9YA 1HV8A 4AD8A 4A2WA 4Q02A 3OEED 1KZ7B 2EFEB 2OSBA 1QHIA 3KTAA 2LKCA 4JZKA 1NLZA 2FA9A 2FZLA 4LHYA 2OCYC 4LOAA 5EQTA 1XF9A 4QKQA 2FSGA 2KBEA 1AZTA 1KAGA 4A8JA 1MT0A 4A8JC 4TL6A 3DM9B 1HTWA 4V0ME 4PFSA 1XTKA 2BM1A 3GPLA 1PLKA 1T8TA 3LIEA 3IIKA 3R7WB 5C1BA 4V0OA 5JHGB 1IN8A 5FPKA 2ZS8A 1G5RA 3FMPB 3PIRA 4O2RA 3NKVA 4ASUD 1VHLA 2AN9A 2GJAA 5ANRB 2Z5FA 3OIYA 2QBYA 1Q57A 2P6RA 2IHYA 3LRPA 1XXHB 3C5CA 4B71A 2XNDD 1T4GA 2RB4A 3LFUA 4Q1CA 4FMDF 4UNSA 5DI3A 2G9NA 1VYTA 3VU9A 2ZRJA 4IOLA 3KQGA 2XU6A 4I2LC 2B6HA 3AVOA 2IK8A 3T35A 4DZZA 4M9XA 4NMMA 2IXGA 4ZDIA 4DDWA 1E9CA 1GP2A 4IXMA 3GCGA 3UWKA 5JECA 2ANBA 4CT5A 1QZXA 3IBYA 1F51A 3QVUA 1NY5A 2ZRNA 1PZNA 3GFPA 2CCKA 4M22A 2W6AA 1XCGB 3ADCA 2VH5R 3A1SA 3HU2A 3V5BA 4MKIA 2EFGA 5DYIA 5J4LA 2ZPTX 1GK6A 3PR1A 4MKGA 4BFUA 4Q7MB 2ZI5A 1W49A 4HUQB 4OI4A 3AV0B 3QPWA 4UNPA 4OQMA 5AVRB 1R8QA 1EWRA 2WPQA 1ZM9A 4OQLA 3ZZ0A 3GP8A 3TLXA 1OIVA 4TMKA 4JLPA 2QSZA 5BQ5A 1GNPA 2O0JA 4XVUA 2E9SA 4B2LA 1OT3A 2ZS9A 4XWOA 2J5XA 1Z2CA 3KB1A 5CYOA 3A7OA 4Q4JA 2B8TA 2ATVA 1NMXA 3A37A 5FPYA 1R5OA 1Z08A 3QI2A 1A1VA 2CK3D 3U44A 1KO7A 4HB2A 2VHCA 4NYIQ 1E9RA 5IDVA 1P2UA 4CEIA 4BFVA 1CJUC 4NDZA 1II9A 1XD9A 4RFSA 4QG7A 4FD2A 4TTPA 1NN0A 3SJZA 4RJLA 2ZE8A 2IA5A 2EYUA 2Z83A 4DCVA 5AW0B 3RDPA 4PO8A 2QP4A 3TIFA 2IF0A 5JCPA 2GEVA 3K8YA 4M1KA 2P6UA 5DHAA 4ZCIA 1PVOA 1II0A 1YZTA 3CB4A 3OEEA 2Q6TA 3BWDD 1ZJ6A 3UIAA 2VRSA 1JXMA 1FMLA 1HY3A 1WDTA 3TW4A 2IUTA 3B2EA 2E43A 2YVUA 4NYJR 2J1LA 1OIWA 4A0RA 3THXA 2XAUA 2GJKA 3KXIA 1XEXB 2VBCA 2W2TA 4QXAA 4BWYA 3MD0A 5K8IA 4LCBA 1U0JA 3FYHA 3PFIA 2QPTA 4ASUA 1JEDA 4PX9A 4DBLC 3U4QB 3GMTA 3U5ZB 4FI3C 4QJ4A 3BB3A 4QNRA 1F6BA 4UXJA 3T12A 2D7DA 2XZLA 2W6ID 2XITA 4CYMA 2F9LA 2XNDA 4V0MA 3MRSA 1VG8A 2G77B 3IQWA 3LQQA 1RYFA 2YINC 3TE6A 5TMPA 2WSMA 1Z5ZA 1SVIA 3IR9A 4EAQA 2XXAB 3KJGA 5B1NA 2DB3A 3EWSA 2J7PD 3REFA 4KVAA 4C0KA 3BBPA 2A2ZA 1XZQA 5FOWA 2WSSD 1KIMA 4NKRA 4LK2A 821PA 1YZUA 1R0ZA 1H88A 2HJVA 4LRWA 3VAAA 1H8HD 1JALA 3QKSB 4N3NA 3HR7A 1KY3A 4I5SA 2ZRPA 2ZE6A 5KU1A 1DBSA 3LX5A 1LTQA 5FBQB 4B43A 2WOJA 4DRZA 4C30A 5K8LA 3ECCA 2CXXA 3SS8A 2RGAA 4WAUA 4JSYA 2EFDB 2I4IA 3J81k 1HE8B 2KSQA 1LF5A 3LVQE 3BH7A 1OSNA 3AUXA 4HZUA 3RRZA 1H89A 4HATA 1W4AA 3WNDA 3GLIE 1OXSC 3KKPA 4KHXA 1G7SA 3CKLA 3T97A 5E4FA 2JLUA 2ZE5A 2VSFA 3R20A 2ZR9A 1Q21A 1LS6A 3QEOA 2AK2A 3I72A 1U2RA 1NVVQ 2CK3A 1MRSA 2BDTA 4DLYA 1ESNA 2J9RA 3DDCA 2C99A 1G19A 5AVZB 1QBKC 3LAWA 4HAZA 4C4PA 4MT8A 1C9KA 3EX7C 3R7WA 3TQCA 1T5LA 2PX3A 3NC0C 3C5HA 4RD0A 5J4KA 2ZI4A 2PEZA 1ZD1A 1QHHB 2XV5A 1G3IA 2YNYA 4UJ3A 1KOFA 3OHMA 4O2LA 3U7HB 2V9PA 3AEZA 1P60A 1Z0KA 2IUSA 1UPTA 1WMSA 3NIBA 3NHBA 3R9WA 1IXSB 2KE5A 4HI0E 1TQDA 1E4YA 3I73A 4BRUA 4TMZA 3C15C 4Z8YA 3NC1C 1HE1C 2WWXA 1GOTA 2GAOA 2P67A 1E2PA 1Z0FA 3HPQA 3FHTA 1K6MA 4OHXA 5GJWC 1GU4A 4QGAA 3MJHA 4AQRD 1M2OB 4JL8A 1QHXA 2VL7A 2ZYTX 4M9SA 4NL4H 3HU1A 3ZVRA 2QQEA 3SNHA 1N5IA 2QM7A 2HCJB 2XZRA 1ZBDA 2AWOA 4U02A 5KSPA 2YOHA 3Q7PA 1E9FA 1HUQA 1M7BA 2OBLA 3LO5A 2V6IA 5DGXA 4BGDA 5FPTA 3CX6A 1W4RA 2W6IA 1HBWA 1MKYA 2BMFA 4OK5A 2QI9C 1SVOA 5EUQB 1VG9B 4BFXA 1TL7C 1SVKA 2ZRCA 4A1FA 3QKUA 4O3MA 4YXWD 3LIDA 1JECA 1GTVA 1HEIA 1II8B 2D2EA 2ZUBA 3DL0A 1KI3A 5CK5A 2J7PA 1E0AA 4A82A 3OE7D 2F1IA 2HXSA 1SGWA 1F2TB 2WSSA 3ZVLA 2Q5UA 4HAUA 2HF9A 1J8YF 2GK7A 4KSCA 1N6OA 4GBMA 4EUNA 2QP9X 1H8HA 2ONKA 2VPPA 5KOYA 1NG9A 3O8ZA 2GTPA 5A5GA 2WWIA 3F0TA 2FG5A 1XRJA 2BVNA 3CUEF 3U7EB 1E1RA 3W5IA 3MAAC 4Q7KA 4QGHA 4DLXA 3CRVA 3FE2A 4QGGA 3P32A 3A58B 1EK0A 2PCJA 1I2DA 1XU4A 2JJ2D 4L15A 1B0UA 1OLOA 1SVSA 4QFMA 1SHKA 1VG1A 4MRSA 4C7OB 1R4AA 1ZM7A 2W27A 4KITB 4US1R 1CIPA 4LJ4A 1EXMA 1TAGA 2J0UB 3SJAA 1KGDA 2FH5B 2ZRGA 1BKDR 3OFND 3VHLB 1V43A 3U3JA 3TMKA 2R6FA 1NNEA 4EIWA 5AJXA 3IEVA 4ZI3A 3AVWA 1G8YA 2OBMA 4TZ6A 3BGWA 4KFSA 1KI7A 3CNOA 4WVFA 1XEXA 3GLIA 3VKWA 3A4MA 1OE0A 3T15A 2D2FA 3THOA 1RVDA 3EIQA 3D8BA 4C0AC 1CU1A 4OHVA 2G1KA 4MYHA 1LNZA 1G4UR 2OE2A 1DADA 2RGGA 3U4QA 5FBLB 2AD1A 2A30A 1NN5A 3TW8B 5HKKA 1EESA 1VIYA 2WMNB 3KKNA 3WYFA 4WA7A 4CEJB 4XE5B 2PLFA 4BLTA 4PO1A 4PQRA 5DSZA 3ZRWB 4JKYA 1E2JA 2MSEB 3WRYC 4BZXA 2O8EA 4IDQA 3JZAA 4MYCA 5CJPA 3QOFA 4NZYA 1WB9A 3AVUA 2GJSA 3K0AB 3LW8A 4M9ZA 3TBKA 3N70A 3MFYA 1J8MF 3KKMA 1E2FA 2WJJA 4B3DA 3H0KA 4UKDA 1ZCAA 4JLNA 3SDZA 1IN6A 2NGRA 3OIWA 4XSGA 5BWMA 1XPRA 2P2LA 2ODEA 2EW1A 2PZEA 3Q5EA 3AGQA 4DLVA 2OCBA 1PJRA 2F9MA 3V9PA 2G83A 1Q1ZA 4R98A 3LW7A 1ZIOA 3FTQA 3LH5A 4L4UA 2QA5A 5GJBA 1YJ5A 1UADA 3AH8A 2CBZA 4GOXA 3PV0A 4OQNA 2WTYA 2VP9A 4DT1A 3VMXA 2R6CA 1ZU5A 4HAYA 1E2DA 1WP9A 3VMFA 4EPVA 4EPTA 2VP2A 3PITA 3OE7A 1M74A 4HAXA 1FUKA 3FHOA 3D3QA 3A1TA 2VIIA 4URXR 2BJVA 3VX4A 3BOSA 1EFRD 3EC1A 3QXHA 1JXOA 1AJEA 3Q3JB 4G0NA 1ZP6A 4C7NB 4QBHA 2PZGA 2NQ2C 1NBME 3DMDA 1KI4A 2VP4A 5DIFA 2P7JA 2EFCB 3L0OA 2H5EA 4NH0A 1CI6B 4YLGA 2Q3HA 1U90A 2G1JA 2C9NY 3I5XA 2VF8A 3H86A 1F48A 1GUAA 1KI9A 3GJ5A 2JJ2A 1G21E 5FR1A 1HYQA 4FIDA 2UKDA 2Q9BA 4IEEA 1GKIA 1NBMD 4GPTA 4NU0A 4A0FA 3HPRA 4UXHA 2W58A 4OK3A 1OH6A 5BYJA 2QROA 3CBQA 3LLMA 721PA 2GXAA 1TNDA 3RS2A 4XVRA 4E09A 2IW3A 3TRFA 2OLJA 3MUFA 1S1CA 2N9BA 1T0HB 1GRNA 1NI3A 4HB4A 3GQBA 4U7OA 1U9IC 4NCNA 3TVDA 4JT2A 2V8OA 4DCTA 4E5UA 1KTVA 1IHUA 3GLHE 4PC3A 1HH4A 4I4LA 5C4GB 1KO8A 4PZZA 4CF7A 2QAJA 1E2QA 2C96A 4HLDA 2WM9B 1D9ZA 4BQSA 1E2KA 3Q85A 1OYWA 1P9RA 1Z29A 1FQJA 2QMEA 3L82B 4C0QC 2AFHE 1NSTA 2V1XA 4LHXA 1T9HA 4NYMR 1IY2A 2REXB 1MABA 5AJVB 3CF6R 1JNYA 3T61A 2R6GA 4QBGB 5TVKA 4Z51A 4KSBA 1P4SA 1X8YA 4MH0R 3KQHA 1E0KA 1I2MA 1XZPA 1KHTA 4BFZA 2FFAA 4DKXA 3HDTA 3CR7A 1M1YE 4NHOA 4B3BA 3BD9A 1UAAA 1W46A 2PLRA 2W6JD 3U6BA 1XMVA 4Q9IA 2QRNA 1P2TA 3A5TA 4JJKA 5LBIA 3B1YA 2OHFA 4QBIA 3U7GA 4C7OA 2CCGA 3QKRA 1HQCA 3KJHA 2ZRFA 3R8FA 2G6BA 3W3AA 2J0UA 1KI6B 2OAQ1 1EFRA 4ESHA 1JOYA 2X77A 5FI0B 4G5QA 5KHOC 4DB4A 1DAKA 5KTYA 4Q1BA 3H4MA 2NO9A 5DI9A 1OFIA 3RNLA 1SHZA 2OCAA 2VTKA 4M3LA 3K0FA 5JJKA 1XCPA 2VA8A 4O25A 3SYKA 1SULA 4DWJA 1AK2A 4OI1A 4US0R 4PC7A 4RD2A 1KY2A 4ZI2A 5AVSB 5JSZB 2BV3A 5EE3A 1SQ5A 3HE4B 2Z4RA 1G6OA 3BB1A 3IHLA 1Z6GA 4PPFA 2IYWA 3EPHA 3OEHD 3MG9A 1O3YA 1EG7A 1NBMA 3WXMA 3ZD6A 4M0LA 1N6NA 2ZRBA 2B92A 2O8BB 1U98A 4GNKA 3K0AA 2BEJA 1ZCBA 3TJZA 2RGXA 1I4TD 1G6HA 1S9KE 1W36D 4IKEA 3ZJYA 2BWJA 4GZLA 4LHVA 2PJZA 3T1TA 5APUA 1VYVA 3M6AA 3I5CA 3AGPA 1UFQA 2BHRA 2WJGA 3F8TA 5UKDA 4TQAA 2JLYA 4R9UC 2O0KA 3MWLA 1KNQA 1GNQA 1IQPA 1XD2B 1Z07A 2Z43A 3NHAA 1WQ1R 4H9GA 4PAMA 3ZRXA 1JPNA 3EW9A 4PPNA 4QJ5A 5CIWA 5G53C 1CJVC 4ZKEA 3RAPR 3MWJA 4RCYA 2YO3A 1HWTC 3KZ1E 2FSFA 521PA 1S9KD 3WMEA 4BEBA 3QKTA 5HCIA 2J41A 1T3LA 4BUJA 1MO3A 1BO6A 3MWYW 4IVPA 3NH6A 4MGKR 1P2SA 1F5NA 2FWRA 1F3OA 1J2JB 4ACBA 1FPMA 3MSXA 4YONB 3DZ8A 2ZU6A 4C0BA 3GJ6A 3GLHA 3K0EA 4L16A 4AYXA 2NO0A 2OEPA 1KDOA 1VKJA 2ZROA 3QNUA 4GSYA 4Q9KA 4KBGA 5H1YA 4C7NA 2IXEA 4LSGA 3M9HA 1NG1A 4Q4LA 4I99A 1YR8A 4RZXA 1E32A 2WZQA 1G2CB 1BH2A 3IUYA 1RRFA 2E42A 1SKYE 1UM8A 1VHTA 4PR0A 4EFMA 1YE8A 3PEYA 4BE7B 2W6JA 4KI0A 5JCZA 3ADKA 2V55B 3DZDA 1S3GA 4LUCA 2W00A 5TY0A 2ZRDA 4PSVA 3ZZTA 2Q3MA 3N2IA 3RS4A 1ZINA 1IONA 3X1XA 2A5FA 3RWOA 4Q4HB 4HLUC 3GJ8A 2ORIA 4TYYA 1X6VA 2CLCX 3M91A 4V03A 4DZOA 2LCFA 4Q19A 3Q72A 3ETLA 4WZ6A 2DFKB 2R6AA 3UIEA 5JWOA 4MGIR 1NL3A 3ZRVA 2JIZD 5JRZA 3QPVA 2ZJ5A 4DLRA 1NAFA 2RGNC 3UPUA 4KCGA 3L2OB 4NBSA 2I3BA 4XJXA 3EZ2A 4NP6A 3DVLA 3UWOA 3AQ4A 3KDSE 2ZJ2A 3O8DA 5CB8A 3LVRE 4XWAA 4B75A 1MFZA 3OEHA 2AHOA 2NIPA 3QXSA 4Q21A 4EPRA 1Y3AA 4FMCF 4B3XA 1G3MA 2J7KA 2IYXA 1MUUA 3CO5A 4BZPA 5AW6B 1A7JA 2IHBA 2XOKD 1E1QD 1E4VA 1KDPA 2OM2A 2OLKA 2ZANA 3C41J 3L0PA 5C18A 2AFIE 2I1VB 4JAUA 4IDPA 4FCTA 3CH4B 3EZ9A 4JLMA 1W36C 1OW3B 4KO8A 1LB1B 1N2CE 4Q18A 5CLLA 4ILEA 4JLAA 4M1YA 1FOEB 2RGDA 2BKEA 4GP7A 4WZAE 3CZPA 1CJMA 3NXSA 3SYLA 3X1YA 2IBMA 5KDOA 4LHZA 1ZM3A 4DCUA 3EG5A 1RJ9A 3TSWA 1OWAA 3BB4A 1T3SA 4YMWA 4ABYA 1E3MA 2V4ZA 4QM6A 1R7RA 1US8B 1HQYE 1A82A 3K9LA 4W5WA 4F92B 2GILA 2WT7A 2FEOA 3AP1A 3PEUA 1H8AA 4NPHA 2ZRKA 5L3SB 4GMDA 2D4HA 1QHYA 1G1MA 4DSNA 4KU4A 2C95A 1CBUA 2QGNA 1A2KC 3HYRA 3K70D 2XB4A 1C1YA 3P26A 3PEVA 4S2EA 3QVVA 3UMRA 2WWWA 4D4JA 3A2AA 2IX3A 3ASZA 4LHWA 3BK7A 3CPHA 2H1LA 1W5SA 3KL4A 1H65A 1Z8FA 1AQYA 4Q9HA 3TK1A 4ZO4A 3KUDA 4RFVA 2PMKA 4B6EA 5F98A 1E6CA 3AF3A 2J87A 1KSJA 1OB2A 1UBCA 1XJCA 2GZAA 2W83A 5H70A 2VP6A 2FN4A 2IYTA 1Q12A 4MDFA 3RS0A 3D36A 5E7JA 3FHCB 1GITA 1A2BA 1S4QA 1R10A 3WNBA 1I4LD 4PSAA 3SFVA 1NMZA 2AR7A 4DDVA 3P20A 1Z0AA 2AK3A 4G5SA 5J40A 1SP4A 1ELOA 2H17A 1P5ZB 3QQ5A 4LJAA 5EZ5A 3NTUA 4A9AA 4P31A 2ERXA 1XMSA 4B3GA 2MSCB 1KSFX 2ASEA 4ZDWA 1OH8A 1NP6A 2GF0A 4V02A 1G20E 2ZSAA 5AW8B 2ZJYA 4LYFA 1WRBA 2IT1A 5G40A 3REGA 5HCNA 1TQ6A 1KO4A 3B13B 4BPBA 2J0QA 3AKDA 5IRCD 1TEXA 2JIZA 5CYPA 2GCOA 4C0HA 1OB5A 1CULC 3I8XA 5IT5A 5AJYA 1KO1A 1J99A 2QTHA 2ZAMA 1P2VA 4JLJA 1XD2A 3VMYA 5L3QA 3DGEA 5C93A 3BH0A 5G41A 2HT6A 1RRCA 4A36A 1PUJA 1KMQA 4PO9A 4BFSA 1IXZA 1VCNA 2GXQA 4Q20A 3QUSA 3V4QA 3P1JA 4DSTA 4LBWA 4HAWA 1B23P 4B33A 3VNVA 2XOKA 1E1QA 4II7A 3KB2A 4PPGA 2Z5IA 1NJGA 1XXHE 4AYTA 3UANA 1JAIA 2WBLC 4K46A 2RGBA 4G1UC 3SU8A 3MLEA 1CS4C 2F1HA 4D81A 2H8KA 2PZFA 5FTNA 1SKQA 3TNUA 3AVQA 5KNCA 4OHYA 3SR0A 2WVJA 4LWZA 2CE2X 2JASA 3BE4A 5CJ2A 2DCUA 1TEVA 5D3MA 2C2HA 3KX2A 3QENA 2VF7A 4A4DA 3WMGA 3CPJB 4XSHA 4QHSA 5FOXA 3ZQJA 1KMHB 1N25A 2HLDD 1N0WA 2Q0HA 5EE9A 4ZCMA 2REBA 4JMPA 2O8DB 1YKSA 3TKLA 3CH5A 3K70C 3TAHA 3VR2A 4IDNA 4TTRA 2UZIR 1L2TA 3VKGA 2JLSA 3THYB 4DCNA 2GDJA 4OBEA 4URWR 3SBDA 1XMJA 2QORA 4V0KA 1S2MA 1J7KA 1GL7A 4KFTA 4QBFA 1ZVQA 2F43A 1P9NA 2IS4A 1RKBA 2BBTA 2AXNA 5AW2B 2IYZA 4A0HA 4KJZA 4ZCLA 1G3QA 1QRAA 3EPJA 2YKGA 4I1VA 4Q7LA 1R5NA 4PC1A 2QT0A 2OFOA 1DE0A 1Z06A 4AUWA 4M2LA 4XTCS 1CSBA 1OXTA 1MV8A 5FL7D 3DKVA 2CVFA 3GJ7A 4XVQA 4YQFA 5FH9A 2H92A 1MOZA 4JYCA 3QF4A 1QDEA 1G17A 1E69A 4V0NA 4N0DA 1TMKA 1VG0B 2P6NA 3IKJA 4GMXA 4MUBA 3AVYA 1K5GA 1PUIA 2QAGA 4E22A 1AM4D 2QAGC 1W2GA 3L8ZA 3AF4A 1XP8A 1T8UA 4JVNA 3T1VA 2TMKA 4HUTA 4FMDB 2CMKA 4X8OA 1E1RD 3WHLA 4N0EA 3N5CA 3QEJA 4IFBA 5FL3A 2PCLA 2YV5A 3OIVA 4FCWA 1US8A 2ORWA 4B6FA 1QVAA 3FMOB 4PAQA 3IEUA 2D74A 2H18A 5C2JB 4X8MA 2PBRA 1XJ0A 3Q5DA 5AVQB 5HR5A 1NY6A 3ZZUA 1KK2A 1TUEA 1CRPA 4F91B 1HA3A 5DH9A 4I1OA 1YQTA 4RY2A 5G3YA 1SXJB 1UKVY 3IPXA 4Q1FA 4Y0VA 5KUTA 2IYRA 3SQXA 1ZW6A 1ZNWA 1QG2A 2LFSA 4OKSA 4JYBA 5FUWA 4ZKIA 1EGAA 2WPSA 1G8HA 3S1AB 5F3WB 1KK0A 2N42A 3NDBB 5CITA 1E9BA 2IYYA 5FBVB 3EPLA 4JVMA 5HE9A 4MYUA 1Z0JA 2AX4A 2D06A 3SFZA 4PZYA 3RS7A 1FP7A 2ZEJA 5HKKD 4PTLA 4RESB 5JJIA 2JLXA 4BASA 1XXHA 3HU3A 1SVLA 4ZV4A 3Q8XB 2JJLA 1RFLA 2C5LA 4CW7A 2P0EA 2HLDA 2OXCA 4AKGA 1S96A 2CLSA 4RCZA 1QHGA 5AVXB 3U3OA 5KDLA 2ZITA 4LJ8A 2XEXA 2VHTA 1E2LA 1CR2A 4CRWB 2W0MA 4BIZA 1GU5A 2CL0X 4YDHB 3L0IB 2ZI9A 5F2EA 3U7FB 2KJQA 1GKYA 2C98A 4B86A 1G4AE 4PAOA 5TXGA 2R5DA 3LDAA 4FMBB 4GL2A 1A02J 2CL7X 2J0SA 1Q22A 4OQXA 4BLPA 1WA5A 5ELXA 1CP2A 4IDOA 4OK6A 4HUQA 1GL9B 4B3FX 1RRPA 2VHUA 5TDHA 2DYKA 1Q1BA 5B30A 2GZDA 4POAA 1BYIA 4FWTA 1G8GA 1ZNYA 5FL7A 3RSLA 1FZQA 4Q1AA 3UATA 2IYLD 2O8FB 4B48A 3VNUA 4JBYA 4RSGA 1X8LA 1GRRA 4IHQA 4AYWA 1KDTA 1JAHA 1GZSA 4TMWA 4M53A 3M0AA 4D0NA 4LBYA 2R8RA 3B5JA 3CR8A 2BKUA 4LPSA 4M21A 1AQUA 3ICEA 1NN3A 1W4BA 1YZGA 3GLFB 2C9LY 3DM5A 5EJEA 5KNDA 1FQKA 3HR8A 3NTNA 4U7DA 2WHXA 4DLUA 4TSFA 4UJ5A 3PJRA 2ONJA 3BFVA 1IOZA 2J0VA 1ZNZA 1QG4A 1KMHA 1JI0A 4IFEA 1WXQA 3VN0A 1QF9A 1XX6A 5BN3A 3RHFA 1NLYA 3W6OA 1YHNA 3U3RA 5APWA 3EZ6A 1R6BX 4U7NA 1VTKA 3OIUA 3A1WA 3IPYA 5AUPB 1VCMA 1JB1A 4ZDKA 3EARA 4JBXA 2BMEA 3K0CA 4OI0A 1LW7A 1GRQA 3EA0A 1X3SA 4IEIA 4B76A 5AUNB 4DEYA 4AI6A 3GJ4A 3NVAA 4NYIR 3RRNA 1ZD8A 4EPXA 4Z54A 5C46F 3CRQA 1DPFA 4HSEA 1T2KD 3LA6A 1G9XA 2XXAA 3GLFE 4AWXA 5LD2B 2HT1A 221PA 1YU9A 5LDDC 5AR1A 3TR5A 3KQLA 1RPZA 2CE7A 2GF9A 4DLSA 5J47A 5SZHB 5F9FA 1E9EA 2B21A 1IN7A 3B1VA 4UXIA 2Z0MA 3HJNA 4TT3D 5CM8B 2YOFA 2GBLA 3BERA 3QKSA 3LX8A 5JMTA 2GBLC 3EXAA 3AKYA 4QHYA 5DYGA 1W0JD 1ANKA 1E0JA 1OIXA 2KBFA 4DIDA 3I92A 2GETA 4DLZA 4EFLA 2WKQA 4H1VA 2HJGA 5AVUB 5FPSA 3PUWA 4RKFA 5FR2A 3WP1B 1MH1A 1U8YA 3A0RA 1TU3A 3M0DA 3FPAA 5CDFA 3VR3A 3WBKA 4MGZR 4QRHA 3FMFA 1U8ZA 1E2GA 1OYYA 2C9OA 5FTKA 2VHQA 5GJVC 1W0KD 3ZVMA 1UJ2A 1G291 3FKQA 2AKAB 3KXKA 5HTKA 4ARZB 1N3BA 5DO9A 1KJWA 2JATA 2X2EA 4LPKA 2J46A 2RHDA 5AVWB 1D2NA 4GP6A 1R0XA 5CLQA 3X1ZA 3DPUA 2ZI6A 4S35A 4TMTA 1DG3A 4KFUA 1D6JA 3S1AA 1IN4A 2XX3A 3WYAA 1QHHA 1NWQA 1NVWQ 3DOEA 2XZPA 4LYJA 3WP0A 1E9DA 2Z6VA 3AP2A 3NBFA 3DMNA 4R71A 3PEWA 4OJKA 1P72A 2OV2A 1IY1A 1HURA 4MQBA 3C7KA 4EJSB 1VYUA 2OILA 4FN5A 2IWHA 4RD1A 3HYTA 2CHVA 1FOSF 3SC3A 2C78A 1LF0A 2GCNA 4JBWA 2WWHA 1Z3IX 4QHTA 5LPNA 1A4RA 1FX0B 3C8UA 4ZIRB 1D2EA 4URUR 3VQTA 1WBBA 4JLOA 5APYA 5EXTA 4AKHA 1YRBA 1XDBA 1GZLA 3DEFA 3PUVA 1K5DA 2ZETA 1TF7A 5FUYA 1PLJA 1G18A 3IDQA 4BRWA 1P73A 2QP3A 2DR3A 1E96A 2XTZA 3ADDA 2Z4SA 2QNRA 4CZ2A 2IEYA 1G3UA 4YMUA 1NVVR 2N46A 3I4LA 4AC9A 4BLQA 2CJWB 2CL6X 3T1QA 4C2TA 4QPJA 3T5DA 4W7SA 3A6PC 2ZE7A 5JWRA 3PVSA 3W5JA 2JCSA 3EA5A 1II8A 1AKEA 1FAVA 1ZC3A 4BLRA 4W9MC 1OF1A 1F2TA 3LD9A 2O8FA 1W47A 4TL9A 3QY0A 2ANCA 2KI5A 1CEEA 2V6JA 5E7MA 1E2NA 1V5WA 1W4CA 2H7VA 1W48A 4TT3A 1NRJB 2A5DA 2D62A 3FOZA 5B57C 1JEEA 2YC4C 3DKPA 1TTTA 4GCZA 3CLVA 4ON9A 3TVTA 3G0HA 1W0JA 4LZZA 3SJBA 2ODWA 1GIAA 3GLFA 4EPWA 1S1MA 3EZFA 4DLTA 4M1SA 2FPKA 1DTSA 1P61B 2BCJQ 4LBZA 4BFYA 1S3SA 1UKEA 3HP1A 1VIAA 4LJ7A 1KK1A 1E9AA 3CIOA 4U00A 2FTKA 3DHWC 5FOTA 3QPUA 3CONA 3L36A 5L3RA 2XZOA 4IOKA 2LKDA 2G88A 3LNCA 4QM7A 5HZHA 1VCOA 4AKIA 3SYNA 3ONWA 4TMVA 1W0KA 1DAHA 4MA4A 3QG1A 2GK6A 4TTQA 1SZPA 3CF2A 3R9IA 3I5YA 1GWNA 2OBNA 5CIQA 4YMSA 3I3SR 3X1DA 3C16C 4K81B 1IO4A 4Z1MA 2ZR0A 4F7WA 3KTAB 2OCPA 1YZQA 3V4FA 3H84A 5EP3A 3KKOA 1U81A 1XWIA 4QPKA 1W44A 2GVDC 3A1UA 5AVTB 1RRGA 2GEUA 3FWYA 4KLZA 2YC2C 5FI1B 4A8JB 5E7IA 4CEJA 4UNNA 3WMFA 5JI3E 1WF3A 3ZRWA 4FXPA 4I1UA 3VTPC 1M7HA 2RGEA 3QJYA 5JRJA 3QF7A 3QG5A 2D3WA 1FW6A 4LJ5A 1UEIA 1M34E 1R8SA 1YRAA 2ZSBA 2J3EA 4PC6A 5KSZA 4B3CA 1RE0A 1S8FA 3DOFA 4C0LA 4W5HA 3W90A 3GEIA 4L9WA 3ZS8A 4B2IA 2C9CA 4NCIA 4AK9A 3KQKA 4TL8A 3VMZA 5DI3B 3FGNA 4DUGD 1QHSA 3VU9B 4G5RA 2R5BA 2BMDA 2ZSEA 3UG6A 2ERYA 2FJUA 4NE2A 3KJIA 2BJWA 1W2HA 5FTLA 4GRAA 1GD2E 1TU4A 2E1RA 4XTRA 1G8PA 2HYIC 2ZI7A 3UMSA 1COWD 4RZ3A 1OFUX 3KUCA 1IY0A 5KO2A 1IN5A 1VPLA 1DVRA 2Q9AA 3HWSA 1W7AA 1TF5A 4KYIB 2EWWA 4JLDA 5FOSA 1JQJC 3BRWD 1ODFA 4QNMA 3TUJC 3ZYCA 2SHKA 4OHZA 5A0FA 3X2SA 5KNBA 1N6LA 1QHNA 2VQSA 4DIEA 3VX3A 2ZRIA 2BOVA 4NYJQ 1BMFD 2JJ8A 5JEDA 1XEFA 4F93B 1AS3A 1J90A 1SVWA 4OJQA 5AW5B 1XD8A 1UDXA 5KPJA 4P4SB 1FMJA 2HV8A 1XMIA 4KXFB 2ZS7A 1F2UB 1CI6A 2NO6A 4AYCA 4TN1A 2OZEA 3M1IA 4QC2A 1XPUA 2WOOA 2JLRA 1RC8A 4AG5A 2OUKA 4GI7A 3SEAA 4KYUA 3MCAA 3U44B 5KDDA 3SQWA 3G82C 2J59A 3T34A 1NVXQ 3VYIA 1Z83A 1U0HC 4P3YA 5IK2D 1S9DA 4RFSB 2QPAA 2ZIAA 3W34A 1U8AA 1X8KA 2ZUDA 4IOMA 4URZR 3KFVA 5GVSA 4RZUA 5CMZA 4I81A 2FZ4A 4JJZA 2O52A 3GJXC 1DAFA 4IDHA 1TQ4A 3TGPA 4WOPA 3V4WA 1OXVA 1R5BA 2EU8A 4BFTA 2GKSA 3O47A 4Q66C 4RD4A 3U3MA 2GAAA 2WJVA 2F55A 4YMVA 4RKEA 1Q3TA 3THXB 3O8BA 4EFNA 2A5JA 2CJWA 3H2YA 4IXNA 4Z8XA 5J4VA 2WPDA 1JJ7A 2WKPA 1AZSC 2J45A 3LBNA 1KI1A 4KLNA 3VTKA 5FOUA 2NO7A 3A1VA 3B7GA 1RYHA 2R9VA 3ZLJA 1IBRA 2QGZA 5K8UA 1G64A 1KKMA 2IYVA 3BC1A 1UEJA 3IGFA 2NTYC 4JKIA 1XNJA 4URYR 4UNQA 1ESMA 4FW9A 4K8OA 3SHFA 2F1JA 4G3XA 3NFQA 1T91A 2WJHA 4DUGA 1E94E 3RC3A 5SZJA 4PHTA 3RS5A 3LY5A 3GEHA 1PV4A 2HXYA 3TR0A 3MWKA 5APTA 3SWFA 1Z0IA 2DWPA 1YZKA 4LV8B 3SE0A 3ZDQA 5AUQA 3GJ0A 4X8HA 1QVRA 5J5CA 1COWA 3LXRA 1NIJA 4CGZA 1GL6A 3MGNA 1N0UA 3IQXA 4DDTA 4CEHB 2K5UA 5C4MA 1A02F 2VP0A 3Q9LA 2A5YB 2FV8A 4RD3A 5JBQA 1E2HA 4DCSA 1MO5A 2FFBA 2G0TA 3ICQB 1KI6A 2NZJA 2AKYA 3CX8A 2ZTSA 2WJIA 3L0SA 3MMPA 1BMFA 1CXZA 1JPJA 4JASA 1KO5A 4NTZA 4HZUB 2GA8A 4PPQA 1S0UA 1ZM4A 3AKCA 1L8QA 3TUZC 3NDPA 4WXRA 1NKSA 4BLOA 2GJ9A 5EP2A 2FF7A 2WKRA 2JLWA 3E1SA 421PA 2H7HA 1ZC4A 3IBGA 1OXUA 4ERNA 1OH5A 1Y63A 5JSZA 1EX7A 3GLGA 4JVSB 3HE4A 1IM2A 2N1BA 3D7MA 1JR6A 1JNMA 2VSXA 4Q5IA 4LI0A 2JLZA 3FDIA 2DY1A 3R9XA 1Q3HA 4LGMA 2BBWA 2W2XA 2X19A 4TLAA 3KFXA 121PA 1N6HA 4Q9JA 1JR3E 2BIFA 1DAEA 4HZIA 2GHIA 4TYNA 3EWAA 4BIUA 2QG6A 5IK2A 3RSOA 2HUPA 5CK4A 4AKEA 2O8BA 2CVHA 3K9NA 5FUXA 3B9PA 4KFRA 2HDNB 2ORVA 4JT4A 2A7QA 1ONBA 1R0WA 2MMGA 1LV7A 3C4JA 2PEYA 3Q7QA 4CT4B 2FEMA 1EX6A 4P32A 2B7CA 2IEZA 4HLCA 3VFDA 1UBEA 1DAIA 3LXXA 2XNSA 2B8WA 1JR3D 1WE2A 2GZHA 4MRRA 3GFOA 2CHGA 1OXZA 2ZRAA 2C9YA 5DHFA 1KK3A 3IIMA 5KSYA 4H1UA 4C3ZA 1DO0A 1OJLA 4ITRC 4LC0A 3GJ3A 1MRNA 4DEXA 5JS8A 1P62B 2JAQA 2FU5C 2UVQA 2RCNA 3M4YA 4CDGA 1DAGA 2IC5A 2G0NA 4ZKDA 4LC1A 3SN6A 1IXMA 5AWFC 4PZLA 3AVPA 1J2JA 2F3RA 1ZAKA 4RVCA 2GCPA 4TYWA 1Q1QA 1YYCA 3KQUA 2A3RA 3AF1A 3LBHA 3NEYA 3B82A 2R62A 3KJEA 4EDHA 1EFHA 4DXAA 5KYKA 2DFLA 3IHWA 2Z5HA 1S9HA 1D9XA 1JQLB 3QXCA 2QN6A 4YC7A 2NO1A 2NPIA 4P4SA 3U61B 4FMCB 1FUUA 3UG7A 3CNLA 5AUOB 1EWQA 4AURA 1Z28A 5G3ZA 2JLVA 1F2UA 4LX0A 1CZQA 3TAUA 1XB2A 2DFTA 1U0LA 3E70C 2ZQ5A 3U2QA 1Z0DA 4TYPA 4DVGA 5JFGA 2Q3IA 1VECA 1E0SA 2VYFA 3FKSD 3SOPA 2PMDA 5EZ6B 4MRNA 4CVNA 3VR6A 1KNXA 4Q4HA 5TARA 2FDCA 4C2UA 2JLQA 1IJEA 1KSHA 1GVNB 3GEEA 1MV5A 3CPEA 2F7SA 4M9QA 3GLGB 4NCHA 2VHJA 3B8HA 1NVUQ 1UDWA 2IWRA 1AS2A 1OFTA 2XTNA 3BXZA 1N6IA 4JLKA 1G5PA 1O87A 1R2QA 2CNWD 5APXA 1OKKD 4TLBA 4LDJA 1U94A 1OHHD 3BJIC 4TLCA 3GLIB 4DC9A 4E07A 2O8CB 2ZUCA 2ZAOA 4V0LA 1YR7A 5APQA 2JGNA 2YZ2A 2ZRLA 3T1OA 3QSYA 2GXSA 3HE5B 3QBVA 4F38A 2IPPA 1PLLA 4M1WA 3BH6A 3CRW1 4MGYR 1G41A 1XBTA 4M4SA 1J70A 1GFIA 2JA1A 1Z2AA 3AF0A 3P27A 3UKDA 5HPYB 1ZMXA 2ZVPX 1XTIA 3EAQA 2C2AA 4US2R 2O8EB 1JR3A 4TQUS 1WBDA 2CLDX 1RZ3A 1XTJA 5AW1B 3MJRA 4OI2A 2Y8EA 1UBFA 4TSFD 1AGRA 5GADl 4GOJA 3ZH9B 5AVVB 1E2IA 3JVVA 4JL5A 2XSZD 5DN6D 3ZVNA 4BECA 1GKUB 3QIAA 3M9BA 1ZD9A 2P5TB 3VR1A 2AXPA 4JSTA 5L3SA 4CEHA 2GVZC 1DEKA 3GLGE 4G01B 3PUXA 1ZIPA 2FPLA 4JS0A 3RYTC 3AUYA 1U99A 2OESA 3OF5A 4IVRA 2Q9CA 2CHQA 3UXMA 5FPHA 2B7BA 3VHXA 2UZ3A 4TQ9A 4D0GA 5B64A 2L0XA 5AJWA 1KDRA 5B2ZA 4AY2A 4DT1B 1H8ED 1TF2A 2BM0A 2OAP1 4KODA 2QENA 5TB5A 2P3SA 3P4YA 1D2MA 1X8JA 2WIAA 2XJ9A 2YWEA 4IRUB 4PHGA 2VSOA 2R6DA 2C77A 2ZREA 3QBTA 3L35A 3I8SA 3K53A 1FP6A 2ATXA 3BFKA 4YMTA 4FPPA 5D3QA 2PH1A 3VR5A 4I6MC 2Q3FA 2FSIA 2OG2A 4LJ6A 2IL1A 2ZYVX 3FKSA 2F6RA 4URVR 1M6NA 3OESA 3VR4A 1L7VC 2EVWX 2V1UA 4LY6A 2VP5A 3BFXA 4L5BA 1N6PA 4TLDA 3I62A 3B78A 1GTWA 3PG5A 4PSKA 5CDFE 3BAFA 1BS1A 2WWGA 3ND9A 5P21A 2OFWA 4Q00A 4F4IA 1TUIA 3QXJA 4NYMQ 4C0SA 3RS3A 3BIFA 5E95A 1BOFA 1XTRA 2RH5A 4A2QA 4A0GA 1SXJE 2QRZA 1NLFA 2LWIA 4UQOA 4D26A 1DAMA 4Q7JB 5J4YA 2D7CA 2CNWA 3U3KA 1FNMA 1E99A 1OKKA 3CNNA 3D6TB 5DISB 5SZKB 3W6PA 2E87A 4G5GA 1OHHA 1X86B 4LBVA 3CWZA 4KHZA 3A36A 3LLUA 1JBKA 3O8CA 4NONA 1W5TA 1Z22A 4WZBE 4DB2A 2PX0A 3THWB 1HT1E 4EPYA 2X2FA 1SXJD 3A4LA 2ZJ8A 3P7KA 1CF4A 2QMUA 4IW3B 5H68A 3ZD7A 1CJTC 1FTNA 1TPZA 2PT7A 1SVMA 3E5HA 4KBFA 2EQBA 5GJCA 2O5VA 1Z6YA 3LBIA 2FPMA 3A4NA 3B60A 3L43A 3B85A 4XD7D 3TNFA 4EQ6B 5JWHA 2IYSA 3CW2A 4NCJA 8OHMA 1Z63A 1DS6A 4GDFA 5LB4A 4P4TA 3DO6A 2DHRA 1MO4A 5DN6A 2XSZA 2YJTD 3LQRA 3B1ZA 4MYTA 4ESVA 3WHKA 4F4CA 1MABB 1Z6XA 4Q48A 3OAKA 2KWIA 1G16A 2AWNA 2VEDA 4GOKA 1G7TA 4FCVA 4E03A 2EYQA 1G7CA 1CR1A 2QM8A 5BN5A 4XOIA 2RGCA 1DG1G 2O8DA 2GEDA 2R2AA 3ND8A 2WWFA 3M06A 4WBSA 4A92A 3THYA 2QPOA 1H8EA 5BW8A 3QE0A 4D6PA 3R8CA 4Q4AB 2FGJA 2GXUA 3KKQA 3W8RA 3K0CC 4DDUA 2RKOA 5AW7B 1GNRA 1T5IA 3I1FA 3QKRB 2QE7D 1OFHA 1AN0A 3UMFA 3CWQA 4PHHA 4MRPA 2XGJA 1LVGA 2FOLA 4CIDA 1EFTA 2IXFA 2QT1A 1N5LA 4FWIB 1KZGB 3H1TA 1E2MA 4IJMA 2GJ8A 4D4MA 2YO2A 2GNOA 2QMHA 5CM9C 1CR0A 1NJFA 2HF8A 3QXXA 1NF3A 2DFNA 2VO1A 2W0SA 3PQCA 4LJ9A 5JZVA 2O8CA 5AW4B 5APSA 3K0FB 5EE1A 1E9SA 3PUYA 4DSOA 3CRMA 2QY9A 2BBOA 3HE5A 5JJLA 3JZMA 5EXXA 2WJYA 4MKFA 1VMAA 4R7ZA 3ZIAD 4M8NE 5JI2E 1XPOA 4B74A 3WRXC 1KI2A 2V7QD 4C46A 3F5FA 2C03A 2ODNA 1N6KA 1DELA 2IUUA 5IF9A 4AG6A 1SLQA 3WBJA 2RMKA 2YWGA 1ZUHA 2CEAA 4HB0A 5GVRA 3NG1A 2BCGY 3NWJA 4D82A 1GM5A 5CB6A 3K9HA 1W1WA 2GRJA 4PQFA 2RAPA 5FTMA 4IVQA 3WYGA 3ASYA 3B6EA 1FL9A 3I32A 4FINA 4X8LA 4PHFA 1D8TA 4BZQA 4MDEA 1ZUIA 1SXJA 2MSDB 3CRRA 3NBXX 1NIPA 1SXJC 3OZXA 3TUIC 1FNNA 2AD5A 4C9BA 2R3CA 1DO2A 1CKEA 4A2PA 2F3TA 5FUVA 1ZUNB 3BS4A
chains in the Genus database with same CATH superfamily
3WU2H 3AR7A 3WAKA 4Z1MD 4UXNA 3CURA 3IILA 3L4FA 3ROGA 2WTBA 3GLHB 5I7AA 2ESRA 2B98A 2BC9A 2Y9PB 2E18A 2JJ1D 3KZOA 2NPSB 5CDGA 2QE7A 4HXFB 4N9QA 4H0LB 3VZRA 4UVHA 4F7DA 2J67A 3SQNA 5BYKA 1ORDA 3OFNA 1P3JA 3PPWA 1Z6TA 2WT9A 3PH0A 2VT6A 3ANXA 3BFJA 3QFCA 2VUSA 4IOJA 1EWKA 1U9IA 4BO7A 3O2QB 4U5XA 5JNWA 1V7PC 2AW5A 4PBSA 3SXUB 1VQMV 3JYHA 4MHTA 1G42A 5I9IA 3OPXA 2DBYA 2ACVA 2ZVQX 4KGDA 1RJFA 2WPRA 2ISCA 1L3BA 1IM5A 2P79A 3PC7A 3U4GA 3T38A 4F6RB 1RR6A 4HLQB 1G5TA 2O2HA 2F1RA 2YY5A 2F43G 3KOXA 1L1EA 3G49A 1IJKA 1O6ZA 1SXHA 2EZUA 3TPZA 1Q5PA 2QX7A 3ZD8A 2ZJ1A 2O5EA 3STLC 4XGQA 1PPJH 2F66C 4Z0HO 2QL6A 3WWDA 5DHQA 5HOEA 4KV9A 4EVIA 3PQ3A 3K1JA 3KR2A 1JIXA 3ELBA 3FTDA 4NZNA 3MELA 3IO5A 4BVGA 3R5FA 3BPZA 1U1FA 3KPEA 3MJFA 3F4LA 3JSLA 4BNTA 3RANA 1L8AA 4RNDB 3P8CE 4X20B 2ZXUA 4J2TA 5AVWA 5JIBA 3DQPA 2VF5X 4UCVA 5K3FA 3X1WA 1P44A 4M7PA 3CPSA 4EJSA 3PUZA 1ABEA 3NATA 1U7DA 3FAVB 2XYHA 2PL9A 4MQFB 1V1MB 3HCDA 1K4CC 1PJAA 4M1TA 4Q39A 5TJ9A 3EN0A 4U7GA 4YCBA 1MSWD 1EDJA 3LOUA 5BOVA 4WUTA 2UWJE 2BYTA 3I1IA 1CRQA 2VJAA 3SYOA 2HMSA 1ZYUA 3A6JA 5TV2A 1XVUA 1A8QA 3VPSA 1NAIA 1A0OA 4ZOBA 5IVHA 4M9CA 5DBEX 3QUAA 4MVSA 2IHJA 1QHEA 4BEJA 3OECA 3DG9A 2WD8A 3W7VA 3UMJA 3I61A 4WY4B 3T06B 2VOEA 5JVDA 1V39A 4AVYA 3A6KA 3TQSA 1IPHA 3RYHA 3BIWA 3ETEA 2C4NA 2OSBA 3PK0A 3A0HH 3G2OA 1K7YA 3QVJA 1NXQA 1M33A 3I9NA 1ONPA 3R4VA 1XZDA 4KHPB 4V0OA 5FPKA 3TTSA 2AN9A 4DLNA 3ICWA 4FLZA 4OQ4A 2X23A 2Y0PA 2Q2OA 1T4GA 2ATEA 1YIOA 2RK4A 2HIMA 3TIVA 3OGCC 2B6HA 1F4MA 5SY4A 2A0YA 3CZ4A 4AS1A 4HG2A 3E83A 1W5BA 2X13A 3DE5X 5DHRA 3ADCA 5HYVA 5H9VA 2EBOA 4FBGA 3LW5H 3GP8A 3DULA 1D6SA 3IV6A 5CYOA 3O0TA 2G3AA 1R5OA 3DEAA 1NJ1A 1Z08A 1IK7A 5LZ7A 4C7JA 1T9DA 4P83A 4CEIA 4BFVA 1WNTA 2A0WA 1IBLO 4UCSA 2ZZKA 3CLUC 5FYDA 3R7LA 4EYSA 1Y3FE 5E8RA 1SKBA 1Y9AA 1YUBA 3TIFA 1XNHA 5KREA 2P9CA 3LHDA 5TS3A 4PWYA 1V11B 1JQ3A 3F74A 4IQ0A 1XEXB 2W2TA 2W2NA 1BE0A 1BSMA 1WVMA 4CMEA 4QJ4A 3H2ZA 1DWOA 2W6ID 4TT3G 1WWKA 5H59A 5K8VA 5EN4A 3RS9A 3MHHC 1H8HD 3ECAA 3ZV5A 3OCCA 3ZQ4A 3E9CA 2HXGA 1OSNA 3WJ2A 3EVTA 2O5RA 3CVUA 3DTVA 1LS6A 1V5GA 4E2YA 4PRYA 3I04A 3I72A 1ZXLA 1SQQJ 3L73J 2QWNB 2AJBA 4RD0A 4ETWA 2B99A 2QN1A 5F7XA 2XQIA 3NIBA 5D51S 1EE9A 3FF1A 3FXDA 3ENQA 1URPA 2QR5A 1NPYA 3PNMA 1V8ZA 1XTUA 4JQ0D 2C31A 5FLXN 5JTTA 4C7UA 5JY1A 1H4VB 4R7CA 1DKLA 2DYRC 2O2JA 4U02A 3SKXA 3TLKA 5DGXA 3G9XA 1Z18A 1ZGZA 1V2HE 1SVKA 2D2EA 3HSSA 2W4QA 3SC6A 3K3WA 4UMDA 4FQ5A 3RVMA 3OQ1A 5ITZA 1YCFA 3PVCA 4JJ6A 2HHHO 3TZLA 3HDJA 7GPBA 1Y4SA 2C29D 2K9JA 2B87A 1ULTA 4QGGA 1G98A 1XNRB 1WXFA 2APJA 2W27A 2KB7P 1BKDR 2P4VA 3L70G 5AJXA 4AQDA 1NX6A 4TZ6A 4QO7A 2NV0A 1N2GA 4XDYA 3V4VB 3NYRA 1EB9A 1OE0A 3AWIA 4C0AC 3EIQA 3LA8A 4UD2A 2OPHA 2M9MA 2Z0AA 3NGLA 3ZV7A 2BDUA 3FWHA 2I66A 4X7PA 3R6LA 3BVPA 4XSGA 4TMFA 3ZE8A 2PRJA 4GXNA 4FYPA 4K9QA 2YWJA 4R98A 2WYHA 3ZBQA 3A9WA 3AR8A 3K9WA 2Z6QA 4MP8A 4KDEA 2WQYC 4E15A 3VMMA 4LE1A 4PY2A 4JPZB 3BOSA 5EWMA 1EFRD 1PR6A 3OR7C 4ZALA 4QBHA 2ZYRA 2WP0A 3DE4X 4ARVA 4I50B 2C9NY 1ZV8A 4CIXA 3WGIA 3BVHA 2QLFA 2H2WA 3ABMC 2OXEA 4G4GA 4MYSA 1EMDA 1EZ4A 1IZ3A 4OFWA 1O08A 2ICAA 1E8NA 4DQKA 2OLJA 3PHBE 1IVYA 4ID9A 3GQBA 4RDHA 4JT2A 2IZ1A 1DZ3A 1JG4A 3D7LA 2XLBA 1Z29A 2AG6A 4EGJA 3ESRA 1SQVG 4WVZA 1QG6A 5DLYA 2ILVA 4YRDA 3M6MD 1JOCA 3BQ9A 2JDIH 4DKXA 2HPZA 3VTFA 4TSRA 4B6RA 4C6HA 2QN2A 1W8IA 3U6BA 1P2TA 3HUTA 2JD2A 2AMVA 1XMQB 2ZRFA 1R37A 4Z9FA 3IERA 6LDHA 1USEA 4BWAA 4CH3A 1V71A 5F78A 4CR8A 4EX7A 4DWJA 4M7WA 5JSZB 5EE3A 3PDIA 5DV9A 3VNSA 3EPHA 2CWDA 2P7TC 1NBMA 2PYIA 5PNTA 4WTOA 2ZRBA 4G26A 2O3TA 3DYBA 1PZQA 1ZCBA 2H1SA 1ZR2A 2DPGA 4Y6OA 2J3MA 4CMKA 4OOFA 1MOSA 4MA0A 1CJCA 2V7WA 2Z43A 3L9XA 4TRNA 1JPNA 1UXGA 1UJCA 1M57B 1E5XA 1P2SA 5IHXA 4YONB 1Q92A 4FNGA 1OYOA 1L3CA 4MPDA 4Q4LA 1KH1A 3EAFA 3ZYZA 1E32A 4EFMA 3CUTA 4BE7B 2W6JA 2R7AA 3DE2X 5JCZA 2AGAA 3ADKA 5HP4A 3DZDA 4D02A 2DY0A 2W00A 2PS0A 3VH2A 1NVMB 1D2HA 1LSSA 3RS4A 4DC1A 1MVNA 4TYYA 3FJ1A 2YZMA 1YL6A 2ECQA 2HK7A 4B75A 2FMKA 1MFPA 2J7KA 3G3EA 3NPAA 2X0NA 4EO9A 2QLJA 5EQJB 3KJXA 1LVHA 1CJMA 3X1YA 1T2NA 4LHZA 1AV6A 1Y1RA 4BKPA 1M1ZA 4R2LA 1ZI8A 1CC1S 2Y6UA 3CCVP 3PD0A 1P6QA 5H6RA 1I0ZA 1CBUA 2MYUA 2V97A 3GT7A 5LQNA 2Y1DA 5TEWA 3BK7A 3DNMA 3K5NA 1H65A 3OJAB 5F98A 3AF3A 3VP9A 2C4MA 3L6CA 2AH5A 2DMRA 4QVGA 4UPVA 2AR7A 3N2GB 4OBXA 1QPBA 4BN0A 2ASEA 4OUDA 2GF0A 2HUNA 3LPAA 3BT7A 2ZJYA 2VK1A 1C3VA 5BXZA 4DCJA 3H05A 2JIZA 4C0HA 2QW0X 1ZWLA 3I8XA 3G2IA 1I10A 1J99A 4LSMA 1SQVH 2TYSB 5JMOA 3G4SV 1BHQ1 3WYDA 1VCNA 3GWZA 5BV7A 1P7ZA 3WMWA 1E1QA 1UBHS 2YHBA 3BFRA 3AY0A 1Z12A 2H6EA 3ZCXA 1N33B 4WF9V 1JAIA 4A0QA 4G1UC 3B6ZA 5BSKA 3AK4A 1IBKB 3O2SB 1KEZA 3PYMA 3T3GA 1ZTEA 2H5IA 4NR1A 1DC4A 2WT4A 3OT7A 1U4SA 3TKLA 1LW6E 2ZLBA 3VU0A 2V9ZA 3SBDA 3WLLA 1T9KA 1BXRB 2BTQA 1RKBA 4ZCLA 4KLCA 1Y4ZA 4RAQA 2Y69C 3S81A 5DNCA 1X77A 2LKMA 1T3JA 4EHHA 2H0RA 1G4YB 4UREA 4GLXA 3AF4A 1LLDA 3SYCA 1HDXA 2INGX 4KC0A 2OB2A 4Q6BA 2QAIA 4O33A 2I2WA 2ORWA 4UV8A 3ZHRA 4G4SP 4X8MA 2H1WA 2OGWA 1TUEA 1CRPA 1RP1A 3ET5A 1EFPA 2SICE 4Q1FA 2IU0A 1GW4A 4DTIA 4EB6A 5ENVA 4GR5A 1VPTA 4L0QA 3JU3A 4ZVUA 5HE9A 4CMBA 3UXHA 1FP7A 2E4ZA 3MMXA 4L51A 1U9YA 2ZKLA 3R6WA 1VEWA 3E8SA 1BU5A 1BW9A 4N7BA 4RCZA 2I6TA 3K9AA 2WPVB 2XEXA 4ODIA 1PL5A 2E21A 4QG3A 1Y89A 1ZCFA 4NBTA 2QSUA 3FLMA 1HDCA 3MJVA 4Z7JA 3K71B 3E58A 2QR2A 1F7UA 4GL2A 2IFNA 1GN9A 1GCAA 1RIIA 4ZVVA 5CA3A 3AEQA 2NXJA 4KXLA 1ZWKA 4FT2A 9LDBA 5AVRA 4D8WA 3DFMA 1LSOA 2W6ZA 4F71A 2HEGA 3GT0A 2Q45A 4GQBA 2VBGA 1RWQA 2PQ6A 3IUPA 2R8RA 3X2QC 1W4BA 4L5IA 1QFJA 1L0NE 3QVTA 3ZW9A 4K9RA 3F67A 1FQKA 3A6ZA 4UJ5A 3N6XA 4P4GA 1B4DA 3E1GA 1AUOA 5ICCA 1M2GA 1WUIS 3QOXA 1V3VA 1WXXA 3K0CA 5A0TA 1F2VA 4IEIA 1UK7A 4L8LA 2DUNA 1OBFO 3ENZA 1NQAO 3RK3E 4LF7O 4KAAA 2HT1A 221PA 3T9BA 1RI4A 3LWBA 2QTCA 1INLA 1AC5A 2WKQA 3QLVC 3K5OA 2ZTHA 3V80A 5B7GA 1U8YA 5DECA 5H16A 2CYCA 1TC2A 5GJVC 2OBYA 5M29A 4FM2A 3WADA 5IJXA 2X2EA 1R0XA 2ZI6A 1WPGA 1YHQP 4RSRA 4WJKB 5BN1A 3TXQA 2QL9A 3CL3D 2OV2A 4LTDA 4QPZA 2OILA 4YWJA 4LX8A 3I56V 1A4RA 3L75E 1PHRA 3KTOA 1FU7A 2VRCD 4HCJA 4JYAO 1HNXB 1L5LA 2VJMB 2PGJA 1PFWA 4I3GA 5ALVA 3GZTB 2D1TA 4C2TA 2ZAIA 4OYYA 4F3KA 3PVSA 2NSDA 1P74A 3QKIA 1Z5WA 1T2EA 4GMHA 3O3CA 5B57C 1TRHA 1TJPB 3SJBC 1PL0A 3R0VA 1DTSA 4FOSA 1KK1A 1M8KA 1QU2A 2CKDA 1HZZA 3AQIA 1WW8A 3ABSB 1D0IA 1KMMA 4LF6B 1DAHA 5TQ0B 5I7FA 4FLFA 1R0CA 4XI9A 1LX6A 4GKBA 3M1YA 3D3KA 1IZYA 3IXMA 2I7XA 3WK5A 5E7IA 2J4CA 4KQCA 3ZRWA 3VTPC 3QF7A 3GYBA 4UCOA 3DOFA 3W90A 4MAFA 2PZJA 2PRSA 4DMGA 4MVMA 1UPCA 1B76A 5CH8A 5E79H 4FIPC 2E1RA 3LBFA 4NBUA 5TISZ 3HWSA 3F7YC 3ZYCA 1MF7A 5EUBA 4U7WA 1GKKA 2XGGA 2QJOA 3IT1A 1SNYA 1KJ8A 1XD8A 1SB9A 3DSQA 4HQ6A 1L2PA 3IP1A 2C7QA 2YS8A 5D6OA 3RVKA 3ABRB 2XWPA 2W48A 5HJ7A 4MB2A 4J10A 2ZUVA 3FTFA 1JYFA 3EG9B 4TRMA 4HOYA 4YRSA 1R6KA 3LHIA 4YCMA 3WG7C 5TNXA 2GAAA 1XVTA 2A5JA 4MW1A 1TT7A 3KEGA 2BZ0A 2PSSA 5AQEA 1RYHA 2ZGVA 4JKIA 1YBAA 3DNPA 4JAAA 5IPFA 3LHSA 1R4ZA 2AC7A 2A9VA 4MUGA 2GYUA 4OXIA 5B12A 3MWKA 4LV8B 4GYYA 2ZCVA 3TTUA 1VC2A 1PWYE 4D9NA 5AKLA 3FFTA 3TZQA 1S5JA 4DAOA 1NE7A 2CSUA 2G0TA 1L6RA 1QNFA 4YJHB 4I0XA 4NTZA 4W4KA 4WXRA 3T7DA 2HMAA 1ZX1A 4EOGA 3TXSA 4DQUA 3W5UA 5CCGD 2VSXA 5NLLA 4Y18A 1NM5A 2PI5A 1MX1A 3EXG1 3QU9A 3NX4A 5HXAA 5JAMA 2MMGA 1LV7A 5BUQA 3SZOA 3MCWA 1BN7A 3DZFA 3E53A 4GPZA 1NNLA 1X9GA 3ZDBA 5CFPA 2GNAA 2DYRB 2AHRA 2IJGX 4PZLA 4PONA 1GAXA 3LUKA 3P0JA 2Q0SA 1VQOV 2A3RA 1HSZA 4A8HA 2A33A 2IPAB 4EY3A 4AM8A 2FN8A 2NO1A 3U61B 3P4UA 4RHEA 1XB2A 1Z0DA 1LBEA 4BX0A 1XI1A 5GM2A 4CM1A 5DPMA 3QVKA 4HUJA 4H7KA 1GVNB 4ZVTA 2UYGA 3PNPA 1UIMA 2AXQA 1D04A 1N3YA 2ZUCA 1XHXA 4C6TA 3ZJTA 2NTNA 1L4BA 1SQQD 3EOBI 3L73D 1HNWO 5CBGA 3OCWA 4ZVRA 5K0CA 1OZ0A 4TTJA 5AW1B 4Z86A 1EBOA 1SEPA 4LXXA 5GADl 3FYDA 2YI9A 2XSZD 2HPCB 3ZVNA 3M9BA 4V24A 3VSCA 1ADYA 3O8NA 1XNGA 2B7BA 1RZRD 3INYA 1N1DA 4OYLA 3DT6A 3AUTA 1H8ED 4MVJF 2FMIA 3ROTA 2XJ9A 3FCEA 5CB4B 1DO8A 1FRNA 2ATXA 5D3QA 5MDHA 4Y2XA 4MSUA 5HIJA 5AHXA 1J21A 4TLLB 1RBZA 1R8EA 3ND9A 3ABMB 1S77D 3ABVC 2WHQA 5IYZB 2E5LB 3ZTTA 3NTLA 4NV0A 1OMIA 3P9XA 1JG1A 1M90W 2KMLA 4IW3B 4RIFA 1TVMA 1FTNA 1O77A 4K87A 1P5FA 1UP6A 1M5UA 4MQ5A 1KOLA 5AOVA 3C3CA 1KAMA 4QE9A 4YGXB 2W93A 3H9EO 3T94A 3CZ9A 3EQZA 2AWNA 4Y9TA 5DFAA 3LDDA 4OP3A 1HORA 5EPOA 1MJGA 3KNZA 5DCYA 3FRJA 4QQKA 4Q3DA 4JI8B 5GWXA 2JS7A 2RHHA 1Z4PX 4AKSA 3W7UA 1EFTA 1IHXA 4IZ6A 1ZD4A 2G1AA 3PE4A 1WZIA 4DGQA 1OC2A 5HKOA 1QOQB 2HF8A 3VNQA 2YX1A 4FFWA 2YKOA 1XV5A 3PQCA 4JP2A 1GNTA 2AZ2A 3LOPA 1JEOA 1YCHA 5A4KA 5EJAA 4QDKA 5CX4A 3PC8C 3WRXC 4IIYA 2QWXA 1QH1A 5ALPA 2R8EA 3N3AC 2CEAA 4HB0A 3NG1A 2BCGY 3MAJA 1K7XB 4F2DA 4S1OA 2D59A 3B6EA 3I32A 4X8LA 1L5OA 1SXJC 2YW2A 3SDBA 3A25A 1C0KA 1SIWA 1YZBA 2DEUA 2MINA 4Q1DA 1JVMA 3VKHA 1KAOA 1PGOA 2FNAA 2OO7A 4HRXA 1R4MB 4J90A 4MVJP 4QOSA 4ER0A 2C9BA 3DQZA 1PBNA 4EKDA 2AFHB 3F2VA 3RC9A 1HGZA 3DLIA 4I4TA 3IVMA 4H17A 3KDPB 2BW0A 2ZSKA 3M0EA 4EB0A 2I62A 3H5AA 4Q1EA 2QTFA 4FFBA 5BQ3A 4GFDA 4CNQA 3WGJA 5LVAA 4A15A 4DLWA 3PCRB 5P8WA 4GS5A 5L7YA 3HDQA 3W1WA 3VYTB 4R05A 1FZEA 1RLTA 3N76A 1SC1A 2X8AA 4AZVA 2IS6A 2Y2VA 4KWCA 4QL3A 2HZ7A 2A9PA 3GGGA 1E1YA 4I1SA 1PSZA 4OU4A 1PT5A 2P06A 5JQGA 4NENB 1U0SY 1JWAB 1DIOB 2W2VA 5ALJA 4R2IA 5ETJA 3RABA 5L7TA 3RC8A 4LWQA 1XJWA 3BCCG 1U7WA 3IS3A 2EJBA 3I5UA 1ONNA 3ELWA 5FORA 2BMJA 1YQGA 5LU8A 3ZS8C 5KJEA 2P2UA 1W34A 1R9NA 4YQEA 4MWGA 1U1DA 1L5YA 1XTQA 3KPWA 1PK8A 4KP4A 5HZKA 1RABA 1RXSA 1DD4A 2GESA 2F1KA 4KDFA 1GILA 5KTOA 1QCEA 1ZO8A 1A4XA 3H1PA 3NTQA 4JBLA 1MTZA 3G85A 1NW8A 2C7GA 4XIGS 5CMLA 2O1WA 1MGPA 1TK2A 3V8BA 4J0QA 1CVLA 1SBIA 1UPGA 1VE6A 4DW1A 2XMQA 1EXJA 4MUMA 1XTSA 1FOSE 1FX0A 5TEVA 1FQOA 3SVLA 3CE6A 3RUIA 3ADBA 2NSJA 2C9ZA 2Y1OA 5D3MB 4PG6A 4B2YA 2QJKC 3C3BA 4RY8A 4X66O 3FPSA 4HD8A 1UCFA 5FQOA 3IEIA 3KQNA 5SY6A 5IT0A 4HLUA 1IXRC 2IBZE 1V3QE 5FAXA 1QCZA 5J1SB 1JDJA 1BT8A 2F9FA 3B7WA 5DTIA 4M8IA 2DQYA 3X44A 2Y69B 1SZDA 4J0GA 2IU3A 1WCIB 3LC7O 4NBRA 2FR8C 3IODA 3AF2A 4RZ2A 1KB9I 4G65A 4LDAA 2QTMA 2ZZNA 2CDNA 2AN5A 4F72A 4N1AA 4WCVA 1D5CA 4OWFA 1IK6A 1WP4A 1RMTA 3ER6A 1NLZA 2FZLA 1GPNA 2RGYA 2OCYC 2KBEA 1EU1A 1PL8A 1UM9B 3UFBA 5BSMA 1Z2EA 4JELA 3ZDMA 3LIEA 3BDVA 1CERA 4O2RA 3DDSA 5G0UA 2GJAA 2Z5FA 2OV4A 2MJZA 4QYSA 2HG5D 1K3FA 2G9NA 4DADA 3OPYI 2DBZA 4C5BA 2E75C 2OFFA 3WBFA 3Q5GA 3FJOA 1Y3IA 4RWUA 5IBCA 1SQBG 5JAZA 2IP4A 4L6IA 1VGRA 4M9XA 4PZ9A 3K9CA 1QZXA 3E3LA 4WECA 1L5HB 2FYNC 4ZZ1A 2WF6A 3ORQA 2EL9A 3CSUA 1U9ZA 4G84A 2Z8YA 1EWRA 2YS6A 2Q46A 3QPAA 2IP2A 3K05A 3X2QB 4JBIA 4NDZA 4BWNA 4RFSA 4MCJA 3WK7A 2L18A 2HY7A 2NRGA 3BWDD 3UIAA 1O0SA 4OXSA 1HY3A 1NW3A 1WW3A 2TSYB 5HHTA 5BWLA 4KP7A 1LPMA 4JOBA 2H88C 3QU4A 4IUCS 4UXJA 4QNRA 3IB3A 1NGSA 2Q6LA 4ZYTA 1JKFA 2QJRA 5SYNA 3NTXA 2FJPA 2J7PD 3DSRA 3MIIA 1EHCA 1OJHA 3MCVA 2EGGA 2F48A 2AF3C 4C30A 3SS8A 2I4IA 2G9UA 1U8EA 4TKUA 4JP5A 4LZNA 1G7SA 2PZBA 5MGNA 3F97A 1L7PA 1DDIA 4RA6B 3ZI7A 3QEOA 3UOGA 3JQAD 4D6TJ 2BDTA 1ZGJA 3F3SA 4C4PA 3EX7C 3BZUA 3HABA 4ZRDA 2OC4A 2X22A 4UJ3A 3KL2A 1SURA 3ZGVA 4MWSA 1H93A 4DS3A 4WNCA 4IUDS 1YFJA 1ULSA 2UU9O 3MJHA 1M2OB 5ES3A 5B6PA 3LUFA 4ZHQF 1CUHA 1HUQA 1JI3A 1DZIA 3Q40A 4F9GA 2ZRCA 4TM8A 1KTMA 1II8B 4YAKA 1YKGA 1SGWA 3E7KA 4YRLA 2Q5UA 3R9KA 1YJQA 5GM1A 3TJRA 5KOYA 3H65A 5A9SA 4NAVA 3O6QA 2BVNA 3U7EB 4DDKA 2WQ6A 4IR7A 3EMBA 2QVXX 1I7SB 1YQUA 1ZM7A 1UWKA 4WOKA 2VF2A 1V43A 2BZGA 4N5MA 4EIWA 1G8YA 4DIBA 2V5UA 2BEWB 5K3SA 4AUMA 1SQBH 2HA5A 3DC6A 4R8CA 4R9NA 1VBMA 3LECA 3U40A 5DSZA 1SC5B 2NU9B 4B85A 3UOAB 1XRRA 5LN1A 3O4JA 4BXOB 1E2FA 2ZPAA 1QF7A 4B3DA 4UKDA 4GUNA 3I2KA 1JB9A 2FQXA 4KE7A 2Q99A 2DJVA 1P0CA 3AL0C 1HPLA 4IUBS 1E5VA 3L8CA 3PV0A 5LZ8A 3RV4A 3ZGOA 4X1KB 2ACEA 3PXAA 5FI5A 1A76A 3D3QA 1SCUB 1NMEA 4RDCA 4UMFA 3HNOA 3KE9A 4LP8A 2V7QJ 1ZP6A 5HK9A 3BMNB 5JSQA 3I5XA 1U8XX 1KJJA 3O92A 1KI9A 1G21E 1N34O 1SQQK 4OATA 5LNK6 4IGGA 4AS3A 4V2IA 2CLOB 1NURA 5BWBA 1EX9A 3TE7A 3WG7B 1NV8A 1UMDA 2P5OA 1MA0A 1KO8A 2L19A 2QAJA 2QA4P 2DKNA 4PIVA 2UZ0A 4C0QC 5HJ5A 1Z2GA 2PG3A 2V1XA 5KTSA 3ZU5A 2LZ0A 5F33A 4QX6A 1XOUA 3ROEA 3OM3B 1D3AA 1KHTA 4NHOA 3AO0B 3C70A 1U8UA 1KECA 2P9HA 3VRHA 1XQ1A 3RJMA 1P84F 3COJA 5LA6A 2AV6A 3KT0A 4ESHA 1DCMA 1OW8A 1NVAA 4M7OA 2NV6A 3OP4A 3ZCUA 4XDGA 5K6AA 2JIPA 3TW8A 2I3DA 3BB1A 5JR3A 1NXPA 1O3YA 1VZ2A 3U7RA 4X97A 5E3IA 1BX1A 3RFFA 2XYGA 2WY2D 3P3PA 1M67A 1SIBE 2M6LA 1G2OA 4E5DA 2JLYA 1RVV1 5BW5A 3CI9A 5EEGA 1KDZA 4K8ZA 4DRYA 3QEKA 3B12A 2YO3A 1X59A 2J41A 2Q4OA 3CWBJ 4KUMA 3NH6A 2FWRA 1F3OA 3F8SA 3QVXA 2O2XA 1S72V 3GJ6A 4YLEA 1VKJA 3MC1A 4PLFA 4KVZA 3MIWA 2Q7OE 2OO5C 3CX5E 3A1NA 3SZGA 3IUYA 3K2IA 2HVKC 4D3ZA 3PEYA 2CZQA 1T6YA 4YPFA 5KVCA 5BP7A 4G36A 1QRDA 1ECGA 5CH5A 1SESA 4JAVC 3BA1A 2P9QA 4QPCA 1H0RA 1GK9A 3UMGA 1X0TA 1SCQA 1T8PA 1BOOA 3EZ2A 2ZW9A 1THGA 3L6BA 1Q15A 1BSHA 1QVFU 2XOKD 1W2EA 4TSFG 4Q0MA 4JAUA 3KSDO 1W36C 3ANSA 3NQ41 4FUQA 4EA9A 1P1FA 4Y2GA 5FPOA 3V4OA 4DF3A 3VUFA 1E3JA 1T3SA 4IIEA 4U2CA 3DWGA 4MQEB 2C8KA 4XR9A 1ZVMA 1ICEA 1HDJA 1HFKA 2IZ5A 3GPCA 4D4JA 3OX4A 3KUKA 1HTLC 1F1JA 2QX6A 3CPHA 1P2BA 3I30X 1KSJA 1ZGAA 2PH7A 4MWCA 1S4QA 5M2QA 1LGYA 3N8NA 4G5SA 5J40A 1I80A 4O4HF 1E7RA 4Q93A 4B3GA 1CZNA 2GCIA 3W7SA 4JQSA 3PGJA 3HRIA 1VE1A 5CG1A 2Q6QA 1GT6A 1DP4A 5I9BA 3B77A 3QWOC 5IT5A 1Q81W 5JU6A 2QTHA 2QX4A 4YUVA 1SERA 2R6JA 3T3OA 1H9AA 5CVCA 4BKQA 3UJ8A 4XYMA 3V4QA 4ZVQA 1KY4A 2Q4PA 1QGDA 2PO5A 1V4NA 3WYEA 4YT8A 2RGBA 1QCDA 2WTMA 4HWSA 3AHHA 5GOTA 4I9HA 4PDVA 2VF7A 4QHSA 5KOHA 1PSWA 3OJEA 2QE7G 4C0XA 2VUUA 3DQQA 1FSFA 1W59A 3VR2A 4Q6WA 5EWJB 2CZCA 1JMVA 4QBFA 2UXDB 4LYEA 4DBZA 3EPJA 3UKJA 1WTAA 5KAFH 5L3ZA 5I45A 1DE0A 1ENYA 4AUWA 5DBHX 3U0VA 3HBNA 4INOA 4LNHA 2Z4EA 5CP8A 4QLBA 3DKVA 1CVRA 2VZ8A 1QDEA 2FQ1A 4BV9A 3T9DA 4Y6QA 2VYCA 4JI6B 4B3SB 3F49S 1NYHA 3S5JA 4ZRMA 4LZJA 2RIRA 3IX7A 5JZSA 3U16A 1XJ0A 3Q5DA 1NY6A 1W73A 2UUCB 4I1OA 1SXJB 4AJKA 4EIJA 3NMUF 2RBKA 1I3NA 1WA8A 1KK0A 1E9BA 1MTOA 3RS7A 2ZEJA 4EFKA 4RE5A 4F11A 4AKGA 2VJDA 4LYDA 3U3OA 1CUUA 4YDHB 2KPOA 1EE1A 3AKZA 4PAOA 3QJ5A 1BWQA 5ELXA 4TXMA 2BEUA 1CP2A 4IDOA 4OK6A 3C2QA 1RRPA 3E1IA 1IWOA 4HGRA 4POAA 5B30A 3SMVA 4BVFA 3VVBA 5JNVA 1WCYA 3VNUA 1JAHA 5CGQB 2BKUA 2FP4A 1NN3A 4AIRA 1B04A 5EJEA 1GPBA 2DERA 3PJRA 4TSFA 4D5GA 5IJ0B 2HCRA 3VN0A 3RHFA 5HOQA 3U3RA 3RM3A 4FLVA 1YZ3A 3L71G 2BMEA 1C4KA 4R7GA 2HOQA 1YJ9P 2X42A 3EA0A 1CUBA 3NHWA 4EYEA 2WYWA 4N78D 1ROPA 1T0UA 4NYIR 3MWFA 4XFKA 1DPFA 3JPWA 3RTBA 5FO1A 1JH8A 2B21A 2O7VA 4I5EA 3BERA 3FSGA 9LDTA 4K3VA 2ZJSE 1MLDA 5H0IA 4PCAA 4AQYB 1VKNA 2Y9YA 2JK5C 5K8JB 4H7PA 1BJKA 5FR2A 3WP1B 4KXYA 4UHKA 3IB6A 2R8OA 5IFKA 5FTKA 4G0YA 4D4HA 3OPYA 5CLQA 1DBPA 4JWKA 2HF7A 2QE7H 5B3JA 4CM7A 3GA5A 2P9FA 3KHTA 1L6IA 5D86A 2MIIA 4IYHA 4FCCA 3GELA 1VYUA 2CHVA 1PV0A 2W8ZA 3I1YA 2WWHA 1Z3IX 5BY2A 1D2EA 2GKGA 1V8BA 5IKPA 1Y6FA 2QJKB 2ZETA 2O3SA 2RMZA 1SWVA 2H1IA 3U59A 4HNAB 2JG3A 5EIEA 1VBFA 3WWZA 1D7MA 3ABTA 5GOZA 1Y8QB 3CWCA 3SIRA 3OLZA 3H1LE 3HL4A 1AP5A 1V5WA 3Q3GE 1BSVA 3FCAA 2W42A 3D4OA 4J1QA 3CLVA 4MV4A 3CTMA 1WPQA 4ZEOA 5JPCA 5FOTA 2EZ9A 4BMCA 1CCWA 2NVUB 5A4DA 4EM6A 3R4YA 4EUHA 3IEXA 1XMPA 3JQQA 3V6LA 1ZRTD 3JWGA 1XXLA 2P1ZA 2YXYA 2AMFA 1B43A 1DIPA 1IEWA 1C9YA 4V3BA 1W44A 3M49A 4XE5A 5EYPA 1M6WA 1N7JA 2M6YA 5AYVA 3QJYA 1ZJZA 1RE0A 4OREX 1TEZA 5DU2A 2OB1A 2Q5QA 3CHXA 1V7ZA 2H63A 4RSHA 4DUGD 2E75B 3ANYB 2J6BA 2ZIVB 1FSZA 3KJIA 5THXA 5KYWA 3JR7A 2QYHA 1G8PA 1COWD 4I9NA 2H2FA 3AJEA 4QIWF 1ZSNA 2GEJA 2FYNB 4UBMA 2VRBA 3KETA 1GM7A 1AS3A 1RQ2A 4EO4A 3B6KA 3AE3C 4RLQA 1XMIA 3ZWOA 4FEGA 4AYCA 2OZEA 2ZYSA 1Z82A 1QYVA 4WJZA 3ICCA 4LXTA 1S89A 3JQBA 5IK2D 3TB6A 4UU0A 3GA7A 2X41A 1JP7A 3R75A 4JJZA 2H94A 3LT0A 4BFTA 2GKSA 4G1VA 4DY4A 1HDRA 3THXB 4K3AA 3O8BA 3SSAA 3NU1A 3OU2A 1NJIQ 1JW9B 3MD9A 4DV7B 2PA0A 1EBUA 1ZOYC 3ENKA 1R6TA 1PFUA 3AOGA 1HE3A 4FW9A 5J23A 2HM7A 3PQ8A 5A7GA 4PHTA 2EKQA 1WUTA 2V03A 2R85A 4WH0A 3SM3A 9ATCA 3OBBA 1CIJA 1F4LA 1KXJA 1IURA 3U48A 1EFAA 1KD1W 2ADFA 3VR6D 1CXZA 3QPCA 3A2KA 4PAGA 3L1VA 2OYHC 3JVDA 3U4HA 3CRNA 4WX2B 4OH1A 2QWQB 3E1RA 3D8RA 4RK5A 4LI0A 3U1CA 5I7OA 1EJBA 2QW8A 4WSOA 2QR3A 4MWZA 3EB9A 1WABA 4D46A 4TYNA 3EQ2A 5FUXA 1H6BA 1VQ4V 2IJHA 2BZSA 2WTXA 4DA9A 2JGEA 1ZH0A 4MRRA 5BORA 2G8NA 4ITRC 4ZK6A 1R5JA 2FU5C 1MA3A 2IC5A 2G0NA 4OHPA 1JHMA 1J2JA 2Z6AA 4FFLA 1QU3A 4LN1A 3AEUA 3HD7C 1SC3A 1SUPA 3GLQA 2QUBA 3UG7A 5G3ZA 2LW1A 5AJTA 3FKSD 2JAPA 3EGVA 1NS1A 3U4CA 4LRYA 1K6EA 1MQ9A 4UAUA 1QAQA 2DULA 5JYBA 1LTBC 1Z4KA 2CVQA 3DMTC 3N0TA 2H3HA 1G5PA 4BP3A 4DC9A 3L5OA 3FB6C 1GFIA 3OWOA 1AV7A 4D6TD 4JXXA 4MVRA 1LC3A 1PT9A 2Y8EA