4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
2J3EA 4ZI3A 4ZPXA 1WDTA 5KYKA 4HUQB 3QKSA 1Z0KA 2BC9A 4F4IA 1L4UA 2JJ2A 4W5HA 1KY2A 1UBGA 4BPBA 1AJEA 1AZSC 2J0QA 2RGAA 1KI3A 4MRRA 3THXA 2ZI6A 1CS4C 2DHRA 2IWHA 4JLKA 2WWGA 4OJKA 3K1JA 2XXAA 3GJXC 5CITA 3SS8A 1GIAA 2GA8A 3ASYA 5AVTB 1R6BX 4Q4AA 4F4JA 1PLKA 1KZ7B 4RZUA 2IYSA 4JKYA 2ZI4A 5FPYA 3EW9A 3TVTA 1N6NA 3FMIA 5JS8A 3EPHA 4C0JA 3FGNA 1WP9A 2GF0A 1GZSA 3FKQA 1T0JB 3H86A 2VP0A 5KDLA 4LHXA 3RYTC 1OB2A 3VTPC 3KDPB 3U4QB 2VH5R 4JBWA 1CU1A 3JVVA 1F6BA 4MYHA 1NP6A 2IYQA 1RW4A 5ANRB 5FR1A 2A9KA 3ASZA 3KXIA 1AM4D 1XPRA 3C5HA 3NIBA 4EJSB 2X8AA 3BFVA 2YYZA 4HDOB 1PLLA 4JMPA 4WA7A 4Q19A 1H8EA 3HE5B 4CEHB 2QI9C 4O2LA 5G41A 2I1VB 1R5OA 4DLXA 4ACAA 2R8RA 5E95A 2KSQA 1KJWA 4AC9A 1HEIA 1G3RA 2XB2A 1XJCA 2IEYA 2ZANA 4HAUA 3SOPA 4LJ9A 1E32A 3RRNA 2WWIA 3CRQA 2OLKA 5AW3B 1D6JA 2XU6A 4UNNA 1D2NA 3W34A 2QSZA 2ZRBA 3SC3A 2YO2A 4TN1A 3FPAA 1NI3A 1OHHA 1S9HA 1KTVA 5AJXA 2OAP1 4M8NE 2O8BB 1MOZA 1ZNWA 4Z54A 1EFTA 4P31A 4O0MA 2YOHA 1IXZA 1GWNA 4IFEA 2XAUA 4ILEA 5IK2D 1YVDA 2WWXA 3RABA 1OHHD 4FIDA 3T1VA 2JASA 2FG5A 5FOTA 1W5SA 3WP0A 4D82A 4LHYA 4LK2A 1KQLA 1Q21A 3Q72A 3IIMA 2EFEB 4C4PA 4DIDA 4RZ2A 1XPOA 1VYVA 2FOLA 3C5CA 1YZGA 3IBGA 1S4QA 3PG5A 3N70A 4IEEA 4OQNA 4MKHA 4C0SA 1N6RA 2R6CA 1N5IA 4P4UA 1XEWY 1SXJA 5L3SA 4N0EA 3U7FB 1G18A 1A02F 4GI7A 5JWHA 4DSOA 4RY2A 4LBVA 2GAOA 1W44A 3M9BA 2FFHA 3EXAA 1XF9A 3L43A 4N1AA 4OI1A 1OH7A 2D7DA 3D8BA 4DUGD 4H1UA 4BUJA 2W6JA 1UEIA 5GJWC 1CR0A 1R8SA 3LH5A 1H8AA 2NMVA 3I62A 3AGPA 5HE8A 3EIEA 5FI1B 3A1WA 1NN0A 2ZRKA 4CGZA 5FOVA 3VR2A 2GCOA 2O8CA 1G9XA 3M0AA 2GJKA 4MGIR 4PPFA 5AVSB 1E9DA 3WNBA 1KKMA 3CX8A 5H8WA 4OI2A 3QXSA 1HY3A 1XDBA 1JQLB 5IT5A 2IUUA 3PCRB 2Q6TA 4KHZA 4V0KA 1JECA 1N6PA 3KQGA 2F43A 3W8NA 2O5VA 4IVPA 1NMXA 1DELA 1T6NA 4B33A 5LPNA 1R0YA 2D06A 1NRJB 3R9WA 2PZFA 4LC0A 2W83A 4U7NA 1OWAA 2W6JD 1P5ZB 4U02A 3TW4A 1I4TD 1OH8A 3SEAA 4F93B 4OQFA 4QBHA 3U6KA 1G64A 1M74A 2RGDA 3L0SA 2W2XA 1F2UA 221PA 2HV8A 1N2CE 4V02A 2QP4A 3ZZ0A 4C7OB 1BH2A 3A7OA 1VCNA 5JSZA 1N5LA 2CLSA 1WCV1 3AEZA 4OHXA 2JDIA 3QUSA 2Q9AA 3BK7A 4B74A 4C2TA 2ZRHA 1U0LA 3QXXA 2JLXA 5C93A 1VECA 1FP6A 1UKEA 4QRHA 1XCPA 4TL7A 2RHMA 4URUR 3EPLA 4TL6A 4ZKIA 1OE0A 3ZS8A 4A0GA 1JR6A 1KSJA 1IXRC 1J2JA 4KCGA 3A58B 2CMKA 2Z4RA 4V0ME 1EFRA 1ZNXA 2ZETA 4BLSA 1NLYA 4BFVA 5C1BA 4QHTA 1J2JB 4LWZA 1UDXA 1MABB 2QN6A 4RZ3A 3FYHA 3SJZA 4Q00A 2PX3A 3O8ZA 2XSZA 4MKFA 5DN6D 2IS2A 4JJZA 2X2EA 5JEEA 1CR1A 2E87A 1RYFA 3QI2A 3QKUA 3ZRWB 3A4LA 4QGGA 1D2MA 2R44A 2FX3A 1E96A 4XSHA 1X3SA 1T5LA 4Q7MB 3A1SA 2V4ZA 5HZHA 1FP7A 1OYWA 2ZFCA 1X1RA 4V0LA 3DZDA 3P27A 5JJLA 1E94E 2HF9A 1ZM4A 4M4SA 3OEHD 4AG6A 3KJHA 5HKKA 1AGPA 4Q20A 2G1JA 5HKKD 3VKGA 1KI8A 2HF8A 3M0EA 1DAIA 3IO3A 3T34A 4YMSA 3ZIAD 1NLZA 3CF6R 1A82A 1N5KA 4L8GA 3QBVA 4LX0A 1Z6AA 1IY1A 5AW1B 1GL6A 4DSNA 1Q22A 1GK6A 3GPLA 2IW3A 3AVOA 3SU8A 2TMKA 1WQ1R 4UNSA 1SULA 5A0FA 1O87A 1NLFA 2DWOA 4QC2A 4HB0A 2CCKA 2NO6A 3B82A 3FE2A 4PC1A 5B30A 3ZLJA 2PMDA 4MGKR 3MGCA 3EA0A 1J99A 1XPUA 2NIPA 3ND9A 4RKEA 5B1NA 3O8DA 2QAGB 4I1VA 1E2JA 4HUTA 3TQFA 3X1XA 2ONKA 3PUVA 1VG1A 5DE3A 1GRQA 1SVIA 4TMXA 1R10A 4DC9A 1I2DA 3CH4B 4US0R 2BJVA 5BYJA 1XEXB 3G0HA 3IIKA 2ZXUA 2MMCA 4YMUA 2JLVA 2ZE5A 2PT7A 1AQYA 3CIOA 3W5IA 1GKUB 2YC4C 2BKUA 3EC1A 4ASUA 1R2QA 3PVSA 3D6TB 2ERYA 3Q7QA 4C0AC 4QXAA 1YE8A 2V3CC 2CBZA 3AGQA 4Q48A 3GLIA 1HV8A 2KJQA 1QHHA 1W2GA 2ZSBA 1C1YA 4RKFA 3SI7A 5KU1A 3SBDA 4B47A 4ZDWA 1ZUIA 5KDDA 1HURA 2FDCA 2R5DA 4GMDA 1CLUA 4G5OA 2Z4SA 2D4HA 5G53C 1IO4A 2F3RA 1XWIA 5AUNB 4URZR 1W36B 1MH1A 3B85A 4D6PA 1DO0A 2A5FA 4CIDA 3CRVA 2WICA 2FNAA 3BXZA 4NZYA 4PSVA 2HXYA 1YQTA 2W2VA 1VMAA 2NO9A 2QPOA 2ZRMA 2J0UA 2PBRA 2GEDA 1TL7C 2YVUA 3A1TA 4RD4A 3SJCA 3DOFA 4UNRA 4DLZA 1UEJA 5APQA 1KO5A 4OJQA 2F1HA 4P4TA 4DDWA 4EAQA 1KNXA 1OFIA 3K0CA 3W6OA 1A02J 2C78A 4NP6A 2IS4A 2HDNB 2WZQA 3FKSA 3CF0A 3W6NA 2ZYVX 1UKYA 1RVDA 2FV8A 4QJ4A 3ZH9B 3QBTA 2OSBA 2KE5A 1F3OA 2O0JA 4H1VA 2GXUA 1YKSA 4LJ8A 4G1UC 1ZP6A 1KZGB 3U4QA 3TSWA 5EQTA 4Q4HA 2ZR9A 4LDJA 4NYMR 2QMHA 2BCJQ 2W0SA 2FEOA 1H88A 4M1SA 1N5JA 1IAQA 4MA4A 4OQLA 4UNQA 4BFSA 3WMGA 3NHAA 2V1XA 4EPXA 2QBYB 1NKTA 3GLGB 1JXMA 1ZBDA 2FMXA 4EPVA 4DDUA 1KMHA 5AK0A 4DXAA 4E07A 1U9IA 5DSZA 4CT5A 4Q47A 3RWOA 1XD9A 1XEXA 3B8HA 1KI6B 3V4FA 1DEKA 4EQ6A 1W5TA 4ZDIA 4KP4A 5JCPA 2X19A 2OAQ1 1HUQA 3KDSE 1KI4A 4MUBA 4PXAA 1SXJB 1WA5A 3LLUA 2ZU0C 2RGBA 2YJTD 2DY1A 1FX0B 1NSFA 2V7QD 2VF7A 3F5FA 4JAVA 2ZJAA 3HR7A 2GEUA 3IPYA 1P61B 2VHQA 3TVDA 3EIHA 3ZRXA 5TVKA 1U94A 3T5DA 1M8PA 5DYIA 5FBVB 2HEIA 5EP3A 2O8EB 4LPSA 5IK2A 2IPPA 3SFZA 1UKZA 5APVA 1EXMA 1UBEA 4V0MA 4WAUA 5CYOA 4HUQA 4BLQA 2LWIA 2QUZA 4DLRA 2YZ2A 3THXB 2DFTA 5AVZB 4KU4A 1KSGA 4UNPA 2BMDA 3MFYA 3I1FA 2F43B 2R9VA 4GZMA 1VG8A 2KI5A 1YR9A 1CJMA 2R6GA 3JZAA 3KXKA 4X8HA 3BB4A 4MRVA 1G8PA 1G8YA 4C46A 2G6BA 5AUOB 2XTMA 3X1WA 3UATA 4RJLA 5EE0A 2QM8A 3ZQ6A 4A4DA 3HE4B 1EX7A 2CL0X 1N25A 1VDZA 1ZW6A 3Q9LA 5KNCA 3KB2A 2ONJA 1H8HA 5EUQB 5GJCA 4YONB 2FZLA 2GHIA 4DSUA 3VMXA 2MSDB 4A0HA 4XWOA 3TUIC 1E0AA 4GBMA 3QKRB 4RSGA 1G7TA 3WRXC 1HQYE 1XZQA 2G3YA 3WHLA 1O3YA 4M0LA 4KVAA 4PO9A 2V6IA 3A8TA 1DAEA 2GXQA 3DZ8A 3M91A 1P2VA 3DO6A 3I72A 3ADCA 3TUZC 2NQ2C 4C9BA 4ZIRB 3NXSA 4QPJA 4LSGA 1PZNA 1P2TA 2XZOA 2C9LY 2QPTA 2W00A 4URVR 4M9XA 3WYGA 2EYQA 1GRRA 2WWFA 1G17A 4A2PA 4GP6A 4JASA 4Q5IA 2F1JA 2F1IA 5AVVB 1KK3A 1QHGA 1U8YA 3QKRA 3K09C 3T15A 3CM0A 4I2LC 4L9WA 2YHSA 5E7JA 2ZE7A 3CLVA 4NCHA 1NIJA 3ZQJA 1GM5A 1J70A 2IK8A 2JAQA 1TUEA 1LFDB 3EZ2A 2P0EA 4WZ6A 2ZI7A 5JECA 1LB1B 4OI0A 5SZJA 2O8BA 2IEZA 4TMTA 1E2FA 2WAXA 4R98A 1QVRA 2XNDA 4TLAA 3WYAA 2GILA 5HR5A 1F2UB 1QHIA 1QVAA 3HE4A 3WBJA 1YRAA 4TLBA 2V8OA 4JS0A 3NVAA 5E3HA 3OEEA 1G21E 4B75A 2ZYTX 4B76A 3C16C 4W5JA 2XZLA 4CEHA 3A37A 4OHYA 2VSFA 4FWTA 2VP4A 2F7SA 4C0HA 4O25A 3OAAA 2ZSDA 5F2EA 1UM8A 4NMMA 3FFBA 5BN4A 3OE7D 4Y0VA 4ZKDA 3L37A 4YXWD 5G3YA 2PZEA 4V03A 2HXSA 2ZQ5A 1XXHB 4ZCIA 3GQBA 1SKYB 2Y8EA 5CB6A 4KITB 4QHYA 2OESA 1F2TB 1T9HA 3KKPA 4Q4JA 4RFVA 4TLCA 2YKGA 1SZPA 5IF9A 4LHZA 4XH9B 2O0HA 3ETLA 3G5UA 4JLJA 3AVXA 3WHKA 3SHWA 3QSYA 4HAZA 4QNRA 1ETUA 1BKDR 5EZ6B 2QG6A 3L8ZA 3E70C 4IEIA 4XOIA 2J5XA 4KXFB 2QP9X 4OQMA 2CHQA 4HYYA 2VP9A 2WIBA 4QM7A 4YMVA 2ZRLA 2A78A 1X8KA 2CHVA 2F1RA 1P73A 2CJWB 3CZQA 4BRUA 2A5GA 4XE5B 3BOSA 2Z43A 5FPHA 4C0BA 5C18A 5C4GB 3T35A 4XVQA 2FSIA 2R6FA 3ZVMA 1U9IC 2IYRA 3EZ9A 1ZYUA 4WZAE 5C4MA 3CNLA 3CR7A 3W3AA 1N3BA 3HP1A 4G01B 4Q4HB 1E6CA 1F5NA 5FPSA 2WSSD 5AVXB 1XMIA 1AIPA 3KQHA 2WMNB 1PUIA 1GSIA 3VYIA 1Z83A 3QKSB 3REGA 4N3NA 4EIWA 2PLRA 2D3WA 3AF2A 5EP2A 3A4MA 4Q7JB 4EPRA 4CEJA 1HJBA 2OUKA 2QAGC 3LA6A 2OM2A 4WVFA 3OEHA 2P7JA 4Q9LA 1VKJA 3ADBA 2DPXA 2P3SA 5KUTA 2IA5A 1KO8A 1OPXA 2WWYA 1E2IA 2J7KA 5HCNA 3K0CC 3NBFA 1UAAA 1JAIA 2W6IA 4HLQB 1Q44A 3QJYA 4C0KA 1M34E 2AK3A 2FZ4A 1J90A 4R9UC 4PQFA 4QFMA 2N46A 3AM1A 2HJGA 4NCKA 3UPUA 1T3LA 1D9ZA 3OIYA 1A2BA 2JCSA 5DGXA 1QDEA 1T3SA 1R0XA 1A4RA 3MMPA 1JXOA 2XSZD 5FPTA 2HYDA 1Z08A 2OBMA 2H1LA 3E5HA 1OXVA 1FNNA 1I4LD 4C7NA 4DEYA 3M06A 1FNMA 3D31A 4PHGA 4TMZA 1Z07A 5JMTA 3TR0A 1W36D 3ADDA 5JEDA 4GKGA 2ZIAA 4IJMA 1NAFA 2WAYA 5CDFA 1Q1QA 1X86B 2B21A 3NKVA 4FMCF 1H65A 4G3XA 1MO3A 3FVQA 4FN5A 1A7JA 1YU9A 1ZCAA 3AVUA 3LO5A 2O8FB 1X8LA 5JSZB 2OEPA 1LNZA 4I1UA 1LW7A 3ZD7A 1DG1G 2W27A 1F51A 2Z5IA 1G291 2ZU6A 3AVQA 4JLOA 4GOXA 1KNQA 5SZHB 1RE0A 1P60A 4B2PA 1CF4A 1S1CA 4D4LA 4KBGA 4DCTA 1BOFA 4B3CA 5IDVA 4GDFA 3LY5A 2YWHA 1IXSB 4PHFA 2REXB 3TAUA 1VCIA 3PQCA 1KGDA 3SJAA 3KTAA 4NBSA 1XTIA 4LV6A 1C9KA 3GJ3A 3EIQA 3RS7A 4BRWA 1H89A 5TXGA 1EK0A 4DCVA 2VP2A 1VCMA 2E9SA 2VP6A 3AF4A 2NPFA 1KY3A 4JLAA 2OXRA 2R3CA 4TL9A 2GK7A 3MGNA 4TLDA 4AK9A 3QVVA 4HAWA 5J4HA 2WPRA 3MRSA 4PQYA 3RS5A 1ONBA 1KOFA 2FGJA 1FMJA 5BXQC 4ZDKA 1W4AA 3HU1A 5G40A 1LTQA 2VPPA 4M1MA 3I32A 4HLUC 2O8DB 5FUXA 1RFLA 4B3XA 4DEXA 1XCGB 4DB4A 4TTQA 1T0HB 5EE1A 2J45A 1GFIA 1DTSA 4B3DA 2KWIA 3TNUA 4GPTA 3OAKA 1R8QA 3L0PA 1E2PA 1W47A 1DADA 3LBNA 4DUGA 1TF2A 5FBLB 3LIEA 2QEQA 2CXXA 4M1WA 4YDSA 4MGZR 2BIFA 2B8TA 4JLDA 5EJEA 3R8CA 1NN5A 1SXJD 1XD8A 3Q8XB 2FGKA 2IXEA 2EFHB 3UXMA 3QG1A 5AVQB 1Y63A 3FMFA 1XJ0A 4MYCA 2NO0A 4Z51A 3CPHA 5HZKA 3FB4A 1Q3TA 4M1TA 5FOSA 1TNDA 4V0OA 3EC2A 2RGNA 4ASUD 1NN1A 4M1KA 3H4MA 4IXMA 1KYIA 3FMOB 3WP1B 2QAJA 5LDDC 4HAVA 1A1VA 3UIEA 4Q7LA 1MRNA 1W4BA 5AW9B 1NMZA 3ECCA 1U0HC 2ZRIA 2QE7D 2RGNC 1ZD9A 3PIRA 4LGMA 3FOZA 3IDQA 3HJNA 2IYLD 2P6NA 4Q9HA 2P65A 1X8YA 4NU0A 4C0QC 2C8VA 2R32A 3BAFA 2I4IA 3TH5A 1Z5ZA 5FTJA 4BFUA 4LC1A 4KFSA 3B78A 4NE2A 4DCUA 5D3MB 4KVGA 5TB5A 5JCZA 4ACBA 2ZROA 2E42A 2QQEA 2VHJA 5AW2B 4HB2A 4UXHA 3KQLA 2FTKA 1Z6GA 4XVRA 4PQRA 4OHWA 1KSHA 1UDWA 1TAGA 2KB0A 3VMYA 2CJWA 3CRW1 3LDAA 5KPJA 4IOMA 2Q21A 1OLOA 3ZRVA 2WPSA 4DCSA 1CR4A 1IXMA 3VKHA 5APXA 1SVMA 4IRUB 1G6OA 4RFSB 4MT8A 2D62A 3VNUA 1GD2E 4B35A 3A1VA 3RS0A 1QHNA 2GCOB 4UXIA 3MD0A 2B8WA 2FEMA 4TYWA 2FSFA 3DPUA 4OI4A 3WNCA 3NDBB 2WT7B 1ESNA 2CL7X 3GFTA 4AD8A 1T91A 1W0KA 1P75A 1G5RA 1GZLA 1ODFA 1YR6A 4N0DA 2J7PA 5FTNA 3TBKA 3N2EA 1S3GA 1XD2A 4PC6A 3KKMA 2B7CA 3IIJA 3NBYC 3RRMA 1P62B 2Q3MA 4OYHA 2WM9B 4M53A 1JNYA 4JVSB 1ZM7A 3AKCA 2XOKA 2AFIE 3T1TA 1ZUHA 3O8CA 5DN6A 2X1VA 2UZIR 2HT6A 2WKQA 1PVOA 2CNWD 3QPVA 2JJLA 2JIZD 2X2FA 1DG3A 3REFA 3TKLA 3BFKA 1S96A 4HI0E 1QRAA 3QF4B 3OIVA 3U44B 3W8RA 1S1MA 1NNEA 1UJ2A 3R7WA 4KSBA 1E79D 3K70D 4Q9KA 2BVNA 2CLCX 1L4YA 2JJ2D 4R71A 5KSZA 3A4NA 1ZM9A 1DAMA 5J47A 3L36A 2J0UB 2R6AA 1IOZA 3AKYA 4DIEA 3U60B 1P2SA 3LIDA 4QBGB 1RC8A 4LJ7A 3L2OB 3QEJA 4IKEA 5TV2A 1YZLA 2BCGY 3AVVA 1Q3HA 4TQUS 2JLYA 1LS6A 4XVUA 1XB2A 4D0GA 1Z0AA 3PR1A 2CCJA 2AD5A 2VQSA 4B6FA 2O8FA 1LS1A 1E0JA 2JDID 3RANA 1U90A 3DEFA 4KBFA 3U3OA 4UJ5A 2VA8A 2PH1A 5EE9A 4GZLA 3VR3A 2FE4A 1K5GA 2H5EA 3SN6A 3SR0A 4TTRA 4B43A 4FXPA 1RRGA 3LQQA 1OIVA 3KFXA 5A4JA 2A3RA 4B2LA 4KJZA 2QP3A 4URWR 1E2EA 1E1QA 4XTCS 4B32A 1AS2A 1IJEA 3W5JA 4B86A 5B1OA 2CL6X 1IN5A 1US8A 4GOJA 4LCBA 3AF1A 2QBYA 5AW6B 1S9KE 3F8TA 1YZNA 2PX0A 3RWMB 3KJGA 4CT4B 1NMYA 3THWA 3FHCB 1SHZA 2QMUA 1G3IA 3UWKA 1KAOA 3SZRA 2F55A 4L5BA 1NVUQ 3RDPA 2A2ZA 3AP3A 5DO9A 4BZXA 1WBBA 3AQ4A 1D8TA 4ZI2A 4JL6A 2QAGA 5D3QA 3AVPA 2C2AA 1OF1A 4D0NA 3Q5DA 1FTNA 5APUA 2OG2A 4Y0AA 5AJZA 4C7OA 4JL8A 2GETA 2ZYUX 3IKJA 1SXJE 2QMOA 4JKIA 1CIPA 1G7SA 1KK0A 1W4RA 2VRSA 2ZRDA 1ZU5A 2K5UA 3AVWA 1R5BA 5HPYB 2YO3A 4G5QA 3IR9A 2FJUA 1DO2A 1WMSA 2W58A 2DFNA 3K0AB 1KKLA 2ZS7A 1II8A 4A9AA 3THYB 4AKGA 4TQAA 3ADKA 1RZ3A 4A92A 3K0EA 3R7WB 1E1QD 1CI6B 2WVJA 1AS3A 4DHEA 1XTKA 1U8AA 3B9PA 4KLZA 4LJYA 4QM6A 2OHFA 1X1SA 5KPDA 4KYUA 3KXLA 4ON9A 1P9RA 4US1R 3BE4A 4OHZA 1N6KA 2DWQA 3VN0A 1ZC3A 1E2DA 4B6EA 4CF7A 1Z06A 1W46A 5FL7A 4G5SA 1KK2A 5KNDA 1PLJA 1E2MA 3ICQB 2P6UA 1J8MF 2G83A 4XD7D 4L4UA 4IFBA 2IYTA 5FR2A 1WXQA 5FBWB 2BJWA 2ZYWX 3HPQA 3M1IA 4NYJR 1G8FA 4PANA 4B73A 1OXSC 5BW8A 5BWMA 5AVUB 3VR5A 3RAPR 5GADl 2CLDX 4B3GA 2IYZA 5K8UA 3DL0A 421PA 3QENA 1MO5A 2YOFA 4QGHA 3GLFA 4KODA 4ESHA 3GEEA 5GVSA 2A7QA 3QXCA 1TQ2A 3JVUA 4MUAA 4UJ3A 3PEYA 3WY9A 1FTSA 3V4WA 1Z6XA 2XTNA 1CSBA 1MV5A 3M9HA 2JLQA 4FW9A 1OW3B 3P4XA 2P67A 1JOYA 1IONA 1H8ED 1BYIA 4PPNA 3E2IA 1B23P 1VYTA 1TU3A 4IOJA 2A5JA 2GJAA 3ND8A 5AJWA 1IHUA 1T2KC 4JSTA 2C5LA 1E1RA 3HPRA 3FMPB 2IS6A 3TRFA 1E9RA 2HLDD 3W9YA 1M6NA 4MQBA 1Z8FA 1MO4A 1XXHE 3LQRA 1CRPA 5APWA 5FH9A 2CHGA 4QGAA 1W7AA 2AXNA 2C98A 2YNYA 1SHKA 3D36A 2OBNA 1YRBA 3BFXA 3KB1A 5GJVC 1E1RD 2NG1A 5TMPA 3IBYA 2ZS9A 4D4JA 4IHQA 5CLLA 4DVGA 2J41A 721PA 4BWYA 1HA3A 2OCBA 4LBZA 3CNOA 3ZDQA 3KZ1E 1E2KA 4EPYA 4UQOA 2RKOA 3VX3A 4AKIA 2CE7A 2Q3IA 2XB4A 5L3VA 3VTKA 4HEJA 2QMEA 1RYHA 1ZIPA 3LLMA 1QHHB 3PJRA 3BH0A 4XSGA 2ZAMA 4YMWA 4XIGS 3ZYCA 2HCJB 4U00A 2ANCA 2NO1A 3CO5A 4X8MA 2PJRA 4HLCA 2GK6A 4QGFA 2G77B 4LHVA 2FPKA 2XZRA 4DCNA 3UKDA 3WXMA 2YWEA 3RC3A 2QTVB 3IILA 2QM7A 1AK2A 1NKSA 1CR2A 1JNMA 1DPFA 3D3QA 4FPPA 3DKPA 2MMGA 1ZRHA 1GG2A 4A2WA 4GL2A 1OT3A 3HDTA 1OXTA 1SKYE 2RB4A 4JZKA 5CDFE 2CK3D 1GOTA 3BWDD 4AURA 2V9PA 1G6HA 3VFDA 3K0SA 1XMJA 1W0JA 2ZM5A 4BEJA 3GP8A 1RIFA 1FL9A 3PEUA 5L3SB 3AVTA 2F9MA 1P72A 3NDPA 4FCTA 2WOJA 1E98A 1R4AA 3HYRA 3MCAA 3OHMA 4PZYA 4AYWA 2N42A 3B2EA 4I1SA 2Z83A 4A6PA 1XZPA 1Q20A 3L35A 1JQJC 4II7A 5JRJA 1TUIA 2BMEA 3TR5A 1G3MA 1G5PA 3MJHA 5AJYA 1QZXA 3PUWA 1JB1A 2GWHA 1VIYA 2B6HA 2CE2X 3DDCA 5CLQA 5JHHB 2Z0MA 2QNRA 2C2HA 4TT3D 1KO1A 3BRWD 4HZUB 2BOVA 4DJTA 1EFHA 3X2SA 2AWOA 3NEYA 3A0RA 5JFGA 4BQSA 3TSOA 4Q7KA 2CVHA 1NVWQ 5B64A 3LXXA 3UK6A 3X1DA 2DB3A 4P4SA 4RD1A 2WT7A 1G7RA 3FDIA 4EPWA 3O8RA 3TSZA 2VSOA 3OF5A 1FX0A 2ZJ2A 3K8YA 4A15A 5CK5A 3A1UA 3OZXA 4ZCLA 1Q1BA 2AKAB 2ZJ8A 5AR1A 3WNDA 4PPGA 4GNKA 4A82A 3VU9B 4CZ2A 3L8YA 4FCWA 3U7HB 2AFHE 2ZVPX 1QF9A 1N0UA 3LX5A 5KOYA 4EOTA 3GLGA 2PCLA 4DT1B 1JI0A 1MR3F 2VBCA 3KQKA 2ORWA 4LJAA 5FTLA 1XRJA 5JZVA 2IUSA 8OHMA 3SBEA 1S2MA 3P8MC 4AYTA 1CULC 1ZC4A 3W6PA 4ARZA 1E9SA 2XJ9A 2QL6A 3B5JA 2E1RA 3CWZA 3O47A 1DE0A 4TLEA 5DIFA 1YR7A 4DT1A 1G3UA 1UPTA 4P0TA 1R0ZA 2IYUA 1U98A 4NCJA 2Z5FA 1TPZA 4CW7A 5CMZA 2Q3FA 2JJ8A 4GOKA 4B3BA 1OXZA 4JVNA 5CIWA 1KDRA 1CZQA 4I1OA 4B3FX 2BBWA 1OB5A 1NJFA 2ZJ5A 4EFMA 2VF8A 4BFXA 4PZZA 4D81A 3AP2A 4DLWA 1E99A 1N6LA 4O2RA 2IF2A 2DFKB 2RGXA 3WRYC 1E2QA 3NEJA 4KYIB 4OK3A 5P21A 1XBTA 5EP1A 1W1WA 3FTQA 5KDOA 2A30A 3VAAA 4BFWA 4FINA 3CRMA 1GAJA 2WPQA 1Z28A 2I3BA 2PMKA 4KSCA 3CWQA 1XTSA 4QBFA 2XOKD 4W9MC 2QT0A 3KKNA 3DM9B 1TADA 1BMFD 3GLHA 3DHWC 3HR8A 4M9ZA 4MYUA 3V5BA 3LVQE 1T5IA 2WOOA 1JR3A 4HZIA 4WXRA 2AR7A 2JLZA 2EFCB 1XTQA 1CJUC 5UKDA 1OH5A 2HYIC 3LW8A 4HLUA 1QHYA 4OK6A 3UMRA 5LD2B 1DAHA 1CP2A 4P33A 4DLTA 2GZDA 1SVSA 4JVMA 2O8DA 1ZM2A 1UBCA 2ORVA 4HDQB 3GJ6A 4QJ3A 2GJ8A 2A5DA 1G8HA 2ZI9A 2GZAA 4M9SA 2O8CB 2Q5UA 2ZITA 5CK4A 3GCGA 3VU9A 4ERNA 1GILA 2WSSA 3K53A 4ZO4A 5EXTA 4D4KA 3KJEA 1DVRA 1KMHB 3GMTA 3CB4A 3K9LA 4QG7A 4MKIA 2Z5HA 1ELOA 3I5YA 4Z1MA 4EKDA 3LWNA 5H1YA 2XGJA 2FSHA 2XNSA 4E03A 1KHTA 3N2IA 5FUYA 2VTKA 4Z1MD 3TLXA 2V6JA 1WBDA 1NF3A 3ZZTA 2SHKA 2C9YA 2C9NY 2KBFA 2IXGA 2WJVA 2Z6VA 2W6AA 4BZQA 5SZIA 3SNHA 4TYNA 1TX4B 1DH3A 5JHGB 4A36A 3ICEA 1S3SA 2PEYA 1IN6A 1E4YA 5B2ZA 1VG0B 3C7KA 3AUYA 3RLFA 1YZKA 1EWRA 4PTLA 1R0WA 1R7RA 3ZJYA 4JJKA 5DLQC 1COWA 1FMLA 3ZVNA 3SJBA 1N0VC 1AN0A 2G1KA 2ZE8A 3LXRA 2J0VA 4TZ6A 3HU2A 2OV2A 4YXWA 1KK1A 1E2NA 3OE7A 1DOAA 5KTYA 1LF5A 4TSFD 3OAAD 1JPNA 4I4LA 1W36C 2YNMA 3W3ZB 3VMZA 1DAFA 1HTWA 4C7NB 3IGFA 4M22A 3L0IB 1G3QA 3K70C 4Q9JA 5JJIA 2R5BA 2GEVA 5DHAA 1W2HA 2IL1A 3VR4A 5LB4A 1GITA 1GP2A 1HE8B 1E4VA 1XMVA 3EZFA 4Q01A 4PO8A 2FA9A 3QY0A 1GNQA 4F92B 1VPLA 2FFAA 3I8SA 1TQ6A 2GBLC 3MG9A 3V4RA 2VHTA 2RGCA 3E1SA 2BM1A 2J87A 4IDPA 5TY0A 4BLOA 3FHTA 1GDDA 3TNFA 4OL0A 2Q0HA 2ODBA 2ZRAA 1PV4A 4QBIA 1IN8A 2ZE6A 2PZGA 4CEJB 1XTRA 2ZRNA 2EU8A 2VP5A 3T61A 4FMTA 5AW5B 3RRYA 3TAHA 1OH6A 1HBWA 4FMCB 4L9SA 2ZR0A 1NWQA 2V54A 2Q7CA 1LV7A 2FWRA 3TW8B 4PFSA 2L0XA 2QRNA 1AA9A 1NL3A 3PITA 4H9GA 4AG5A 4JLBA 5DI9A 5BQ5A 3I3SR 1W4CA 1FOSF 5J5CA 3V4QA 2NO7A 4KLNA 5FOWA 1RJ9A 2GZHA 3K9HA 4F7WA 3NMDA 2UZ3A 3UMSA 3TE6A 4C3ZA 5KO2A 2FPMA 1IN7A 2XXAB 3GLIB 2NGRA 3FWYA 5H70A 4LOAA 4HZUA 2RGEA 1M1YE 5EUMA 5HCIA 1S9KD 1Q57A 5KSOA 5JLJA 1P4SA 4A8JC 1XMSA 2ZRCA 1NBMA 1BMFA 2X77A 5E4FA 3LAWA 1DS6A 1Z0FA 2H7HA 4BLPA 1JBKA 3SDZA 4IDNA 3D7MA 4MKGA 2WV9A 4YLGA 4W7SA 3KKOA 4RCZA 1EGAA 1F2TA 3QXJA 1Z6TA 3P26A 1MKYA 3PUYA 3GLIE 5GJBA 4AYXA 4GCZA 2C03A 2ASEA 4EPTA 3TMKA 2VHCA 2JJ1D 4DSTA 3TGPA 2QTFA 1NG1A 2Q9BA 4AYCA 2G9NA 1TQDA 3THYA 4OKSA 4M1YA 3KX2A 2JLUA 5F9HA 2OBLA 5FI0B 4XWKA 4E09A 1P9NA 3VX4A 2WJHA 1VYUA 2WPDA 1E69A 2OT3B 3CRRA 4WZBE 5C46F 3GLHB 4Q21A 4JYCA 2IYXA 4K46A 3QOFA 2JLWA 521PA 1E9AA 4X8OA 2OFWA 1VHLA 4Q1AA 3AF0A 4AIIA 4IDHA 3H84A 4BLTA 4F38A 5FL7D 2N9BA 2PCJA 4PC7A 1RKBA 3NG1A 2BV3A 3QG5A 4DBLC 1J8YF 2BBOA 2BEJA 3MAAC 4CVNA 5E7IA 3K09A 2F3TA 3N5CA 4QL3A 3AKEA 3B1VA 3BD9A 3GJ7A 4JBYA 4DDTA 3GLHE 3K0AA 4HLDA 4TMKA 2FF7A 4KHXA 1ZJ6A 4IXNA 3WBKA 5FTMA 1Z0IA 4LPKA 1Q0UA 2QORA 4GT1A 1II0A 3P20A 2OFOA 4DLUA 4Z8XA 2WBLC 5EZ5A 5EE5B 4JLMA 5APTA 1ZMXA 5EE3A 5DHFA 4NL4H 3K0FA 1TF7A 1BS1A 4FMBB 4ARZB 5LD2C 1RRCA 5JI3E 2C77A 2YWGA 3X1ZA 4US2R 4MRSA 5FUVA 1JUNA 1IY2A 5AUPB 4JT4A 4Q18A 3GLFE 3F0TA 4KFTA 1CXZA 3R8FA 1HE1C 3FKSD 3DKVA 3GEHA 4RZXA 4XWAA 3BORA 3AF3A 3NTNA 3DVLA 4C30A 1FAVA 3QQ5A 6Q21A 5B57C 3OIUA 3SYLA 4BGDA 2WKRA 3U61B 3C15C 2HLDA 1Q1EA 2WJJA 3W90A 2OLJA 3LV8A 5FBRB 4A6XA 1D2EA 1XU4A 3B1YA 4OHVA 1NG9A 4OK5A 1XNJA 3A5TA 4NTZA 2QPAA 4M3LA 3GLFB 3BJIC 4YMTA 5G3ZA 3LNCA 2HUPA 4BIZA 1GUAA 4HATA 1DAGA 2FH5B 3BGWA 5J4KA 1K6MA 2KP8A 4Q4JB 1A2KC 1W0JD 2ZUDA 3RSLA 3H1TA 4U7OA 821PA 3DOEA 2IWRA 3QF4A 4BECA 2C9CA 1Y3AA 4URXR 1EFUA 2BEKA 2AL7A 3EWAA 2ZVQX 3NBZC 5D3MA 4AKEA 3R9XA 1FFHA 2IHYA 1NIPA 3H2YA 3P7KA 4TYPA 1RRFA 2BM0A 1E79A 3KTAB 2D7CA 4KFRA 2GF9A 4HAXA 2ZR7A 2ZRPA 1P9WA 3T12A 2WKPA 2IUTA 2IYYA 1RJ9B 4F91B 4BASA 2NPIA 4ITRC 5BN3A 5AUQA 3WMEA 5JWRA 1KI2A 1P2UA 3RSOA 4IVQA 3ZD6A 2CNWA 2NZ8A 3RS3A 1TEVA 3I4LA 4KV9A 2H8KA 4OQXA 3NC1C 1G7CA 2C95A 3SYNA 5EXPA 1XEWX 1KDTA 2H7VA 3CW2A 4Q66C 3I5CA 5JS7A 2ZXEB 2PLFA 1ZAKA 2B92A 2FFBA 1XX6A 3EZ7A 4MITA 3U7GA 2QZ4A 1DAKA 1IN4A 1VTKA 5JBQA 4IOLA 3FHOA 4EQ6B 4O3MA 4R7ZA 4R2IA 2A5YB 1M7HA 2F9LA 3U2QA 3VKWA 3QXHA 4CRWB 5EXSA 4MRPA 3X1YA 4P3YA 3NH9A 1GU4A 2XX3A 3OFND 2BMJA 1KI9A 1Z22A 1IM2A 4YC7A 2ECKA 3NFQA 1G19A 3S1AB 3SHFA 1TTTA 2GVZC 1V5WA 2H57A 2LKCA 1EX6A 4ZV4A 1E9BA 3K0FB 3U3KA 4K81B 4HB4A 2UKDA 3RRZA 3IHWA 1QHXA 3ONWA 3PEVA 1OFTA 3R9IA 4D2IA 4EUNA 1H8HD 1EESA 3BB1A 1K5DA 4NPHA 1JALA 2RHDA 1ZVQA 3B1ZA 4HYTB 4GFDA 5TARA 2IBMA 4HAYA 4Q4AB 3RHFA 5TDHA 4BFYA 5L3QB 2N1BA 3GJ4A 2R2AA 1W48A 1E0SA 4FI3C 4E5UA 1Z6YA 5K8IA 2QSYA 2ZJBA 4EFLA 4LHWA 3A6PC 3B9QA 2XTZA 5F98A 1NBME 2JATA 1OIWA 3K9GA 1JR3E 4GP7A 3ZVLA 2D2EA 4IDOA 4A8JB 2QGNA 3GJ5A 1KI7A 4OBEA 5AW8B 1G1MA 2FN4A 1U81A 4PHHA 1Z3IX 1GKYA 1LVGA 4FMDF 2GNOA 1FQKA 4I99A 4JLVA 1GTWA 3EASA 4LI0A 3ZS9A 4Q1BA 1WF3A 5J40A 5AVRB 1JJ7A 2ZJYA 4EFNA 3H0KA 4J0QA 3EPKA 4AY2A 1WB9A 4FMDB 2V7QA 4XTRA 3EAQA 4DZOA 2WWHA 1T4GA 4Q4LA 4U7DA 2IC5A 3WMFA 1G16A 4W5WA 2WPDD 3EX7C 3CH5A 4QPKA 1GKIA 2E43A 5IHPA 1NVVQ 1CRQA 5JWOA 1SVOA 3ZGXA 4Z8YA 3IO5A 2IX3A 4G5GA 1QG4A 2IHBA 1ANKA 1Z2AA 4A0RA 1FOEB 2VLIA 3NWJA 4X8LA 1PUJA 2WIAA 1QHSA 1G5TA 1ZINA 2J59A 3C41J 3MWYW 4RFSA 3U3MA 4B48A 2DBYA 3C8UA 3LBHA 4QHSA 4EDHA 2GXAA 1JEDA 2C96A 3T1QA 2IF0A 3QVUA 3T06B 1TU4A 2AX4A 4TMWA 1Z0JA 1FZQA 1UKVY 3OESA 4TWZA 1UF9A 2J1LA 3SFVA 3TK1A 2QY9A 2VRWA 2RMKA 4DKXA 1G2CB 1NY5A 3GJ8A 1SKQA 5FBQB 2D2FA 4B71A 1FW6A 1U8ZA 2ZI5A 4NDZA 3BC1A 4NCNA 4BIUA 5GVRA 3VR6A 5DI3B 1T8UA 3OIWA 1MO6A 4G5RA 621PA 2RAPA 4D0LB 3OFNA 5CYPA 2BBSA 1IJFA 3UG7A 5CJPA 2PJZA 2BDTA 2CEAA 2YV5A 4NYIR 4PAQA 4WBSA 4NYMQ 1II9A 1P6XA 2YC2C 3T97A 1YR8A 3V00A 1TEXA 4MDEA 2WSMA 3PV0A 2VIIA 3CF2A 2IS1A 3DMNA 2AXPA 4RD0A 2P2UA 1ZNYA 2O0KA 2BBTA 2ZUCA 5FOXA 1CJTC 3KKQA 1KMQA 1GL7A 5KNBA 1I2MA 3SYKA 3I61A 1M7BA 4MRNA 4S2EA 5DI3A 1SGWA 1SVKA 3ZCCA 3TIFA 3BIFA 1S0UA 2ZJZA 2ZTSA 2ODNA 5AVYB 4NHOA 1E2HA 1L8QA 1GU5A 3DGEA 4M9QA 3VR1A 4PO1A 3MSXA 5F3WB 5APSA 5FFMA 1N6IA 3IEUA 4M2LA 4RD2A 3IEVA 4PHTA 4DWJA 1I4DD 3SQWA 4A2QA 4JAUA 2G0TA 4EJSA 121PA 1UBFA 1EFCA 2QE7A 3BBPA 3RS4A 1E0KA 4CDGA 4D25A 2WTYA 3MWJA 1RPZA 5IDJA 2QRZA 1B0UA 2JIZA 3AVYA 3WYFA 4P32A 4XD7A 2OZEA 3CUEF 4I5SA 2EQBA 3IUYA 4TYQA 4KAXA 4TZ0A 1FUKA 3HTKA 1OFHA 2XITA 1C4OA 2NOAA 2VSXA 5KSPA 2EWVA 4TSFA 3DMDA 1E2LA 3KUCA 2QQ0A 2J7PD 3U44A 3RC8A 4DLVA 1W0KD 3MUFA 2B7BA 5AW4B 4IOKA 5AVWB 4P4SB 4IVRA 1F48A 1HT1E 5DNYB 3ZIAA 3QPWA 4ZKEA 1EWQA 2AK2A 4WOPA 1VIAA 2REOA 3NBXX 4JLNA 2CCGA 3LD9A 2ODEA 2FSGA 1XD2B 5A5GA 2GKSA 4I81A 5FOUA 3CPJB 4A8JA 5AWFC 1DARA 2HCBA 3NTUA 3PUZA 4PAOA 2ATXA 4ABYA 2MSCB 1ZU4A 2RGGA 3IHLA 4LY6A 1YZTA 2D74A 1UFQA 4WW0A 1T8TA 4LJ4A 5CB8A 3NHBA 5J4YA 2OCAA 3EZ6A 1KJYA 4DRZA 2G88A 3C14C 3B1XA 4GRAA 4C0LA 2DYKA 1ZIOA 3Q7PA 3JZMA 3M0DA 4HDCA 1SXJC 3ZRWA 3MWKA 4LV5B 4WIAA 5CM9C 3TQCA 4TL8A 1BYUA 4TYYA 2LKDA 3KJIA 4JVLA 4BEBA 1OYYA 3EG5A 3U3RA 3THWB 4FD2A 1PJRA 1NN3A 2RH5A 3L82B 4RVCA 3UG6A 2JEOA 1TMKA 2XV5A 1Q1ZA 1MABA 3A2AA 1RRPA 4LUCA 3I8XA 3KL4A 1SP4A 4POAA 1ZUNB 1GTVA 1EFRD 2QA5A 2OCYC 4U5XA 4C2UA 1CBUA 5SZKB 4JYBA 4UXJA 4Q1FA 5ELXA 4M1OA 1X6VA 3AH8A 2XZPA 1P7CA 4K8OA 1KDPA 2ZAOA 2LFRA 4F4CA 4BE7B 4EJSC 2V1UA 2GBLA 1JR3D 3MJRA 3SWFA 1M2OB 4MGYR 4LBYA 1P3JA 2ODWA 4LYHA 3K70B 2I1QA 2JGNA 2GJ9A 3Q3JB 2WJGA 4PX9A 3AV0B 3B1WA 4L16A 2GCNA 1LF0A 2JLSA 3Q5EA 1AKYA 2EFGA 1ESMA 3OEED 4DZZA 4PAMA 4L15A 1MRSA 2JJ1A 1GRNA 2GVDC 2VYFA 4LJ6A 1G8GA 4IDQA 2GRJA 4FCVA 1E9EA 4Q1CA 4PC3A 4QKQA 2GTPA 2ZJOA 2IYWA 4I6MC 2OCPA 1CEEA 5L3RA 4G0NA 3CR8A 3IQWA 1L2TA 1W49A 4MH0R 2QROA 3G82C 5FTKA 1NBMD 1KO7A 1ZD8A 2DWPA 3U5ZB 5JI2E 3ZVRA 2OILA 3HYTA 5F9FA 1GNRA 2W6ID 5DH9A 5CJ2A 4CEIB 5HE9A 1ZD1A 2P2LA 1K8RA 4D26A 1GVNB 1SQ5A 3R20A 3QEOA 4S35A 5CIQA 3VHXA 4B2IA 5AW7B 3UWOA 2AD1A 1QBKC 1Z47A 4AKHA 1HQCA 3CX6A 2BASA 1NVXQ 2ZREA 1SVWA 4KFUA 2AHOA 3V9PA 4JSYA 2R62A 2UVQA 3IQXA 5DYGA 3TJZA 1J7KA 4TTPA 3I5XA 4LRWA 2REBA 2R65A 3LRPA 1HUCA 1X8JA 2EW1A 4MYTA 2OXCA 3P1JA 4NKRA 1AGRA 4DLSA 4LBWA 4RD3A 3ZZUA 2GCPA 2ZRFA 5KSYA 4GMXA 2HJVA 1JEEA 1N6HA 4D4MA 3KFVA 1YHNA 2QT1A 3F3YA 2RCNA 5K8TA 4RCYA 1E9FA 2ANBA 1SVLA 4LYJA 2YOGA 4QNMA 4E22A 2CDNA 1OIXA 1AQUA 4LV8B 4A0FA 2BKEA 5EXXA 2C04A 5AJVB 1OSNA 2WJIA 3QPUA 1VHTA 4LZZA 5DISB 3T1OA 4KI0A 2H92A 2O8EA 4DLYA 5JJKA 1Z2CA 5E7MA 2XEXA 1IY0A 1D5CA 1HWTC 2P5TB 3QE0A 4ZDJA 2ZPTX 2LCFA 3GFPA 1FOSE 2DFLA 3EA5A 4YDHB 1FQJA 5L8VA 3PEWA 3AUXA 1YJ5A 5B58C 4JBXA 1KDOA 2J9RA 4URYR 3KQNA 2QGZA 1CKEA 2CK3A 1COWD 2IYVA 1OKKA 3P4YA 2ATVA 1AKEA 2H16A 3O8BA 1G20E 4JL5A 3AP1A 3LFUA 3J81k 2J0SA 2W2TA 1NJGA 2OO7A 3S1AA 2FU5C 1OXUA 1NVVR 4A1FA 2G0NA 2GESA 2EFDB 3VMFA 4PC2A 3KQUA 3A3YB 4Q1DA 1US8B 3BERA 3K9NA 4PSAA 3B7GA 2R6DA 4RD6A 2VHUA 3RVBA 4BLRA 2PL3A 3VQTA 3TYYA 3B13B 3EARA 3PFIA 4R2HA 5BYKA 1S8FA 4NCIA 3HWSA 3IPXA 3TNUB 4AUWA 1OV4A 3BH7A 4XJXA 5LB2A 1BIFA 2ZEJA 4QOSA 1DBSA 2EVWX 1V43A 1XEFA 1KSFX 2PEZA 2EYUA 4CYMA 5KHOC 3RNLA 5K8LA 3QKTA 2KBEA 3CKLA 2XJ4A 1UADA 1IBRA 3PENA 2DCUA 3SQXA 4PSKA 2J46A 4IW3B 2V55B 5J4LA 1N6OA 2GXSA 1U2RA 2FPLA 2WTUA 2HT1A 3CBQA 1Z63A 4LJ5A 3PUXA 4HB3A 1EG7A 4Q02A 3DM5A 5LBIA 5EP4A 2W0MA 4BFTA 4Q1EA 3B8EB 3LVRE 2AN9A 1R5NA 1FPMA 2BMFA 4NYIQ 2NZJA 2ZUBA 4FWIB 1OKKD 2PT5A 2FFQA 3U6BA 1S9DA 4RESB 2O52A 4JIMA 2ZSFA 4AWXA 1CJKC 3I92A 2NTYC 2IXFA 3P32A 3KUDA 5BN5A 3T5GA 1JPJA 1KIMA 4QJ5A 2QU8A 3U3JA 2IT1A 4PPQA 4BZPA 2P5SA 5J4VA 3B60A 1G4UR 5AW0B 1AZTA 4WXPA 3NH6A 3VNVA 2VL7A 2ZRGA 2JLRA 3B6EA 3M4YA 4GSYA 1KI6A 3BB3A 2ZSEA 3BH6A 4Q03A 2WJYA 1ZNZA 2Q9CA 5FUWA 2XNDD 5IRCD 2P6RA 1IQPA 4B44A 1G4AE 1YZQA 1T2KD 1XJQA 3AB3A 1MV8A 1GK4A 4DB2A 2ZRJA 1E3MA 1WRBA 3A36A 1N0WA 5M04A 2YINC 4JT2A 1Z29A 5CM8B 5HTKA 1D9XA 1FUUA 2ZI3A 4NH0A 4CEIA 2OE2A 4NYJQ 3GFOA 1II8B 1CJVC 1HH4A 2LFSA 1YYCA 4MTXA 3M6AA 3NC0C 4PR0A 4TMVA 2GDJA 1JJVA 1ZM3A 2Q3HA 4PZLA 4DDVA 3THOA 5APYA 1QG2A 3EPJA 1CI6A 4AQRD 3BS4A 4JLPA 4BFZA 2GJSA 3HU3A 4M21A 3GLGE 3FFAA 1VCOA 2H18A 1KI1A 3MLEA 1AS0A 3QIAA 5L3QA 1YZUA 2C9OA 2ERXA 2ZSAA 3MWLA 1TF5A 1G41A 3AKDA 4ESVA 3EWSA 2WMOB 1KO4A 1E9CA 2BHRA 2GAAA 1GNPA 1XCMA 3CZPA 5FPKA 4AI6A 3QF7A 1T3HA 1MUUA 4YQFA 1MFZA 1TQ4A 1HT2E 1E2GA 1MT0A 1U0JA 4Q9IA 3SE0A 2WWWA 2CVFA 3UANA 4ZCMA 2ORIA 3U7EB 2C99A 2OFXA 1Q12A 4KO8A 3L0OA 2DR3A 5JRZA 3LX8A 4HSEA 3I73A 3HE5A 2AWNA 1OFUX 3CONA 1KAGA 5C2JB 4ZIRA 5H68A 3UMFA 3VHLB 1L7VC 4NONA 2EWWA 1LY1A 1GL9B 4MDFA 1BO6A 2QTHA 1NSTA 1CTQA 2ZS8A 4TT3A 3TUJC 1U99A 2JA1A 1XTJA 1ZCBA 4UKDA 2AKYA 3GEIA 1SLQA 2WHXA 2H17A 3Q85A 2YWFA 2VO1A 4LYAA 4B34A 3UIAA 1XFAA 2VEDA 4LYFA 5FL3A 2QENA 2F6RA 4V0NA 1HYQA 3CNNA 3RS2A 3LBIA 1VG9B 2BWJA 1NY6A 1OJLA 1OXXK 3GJ0A 1F60A 1XP8A 3CPEA 4TQ9A 3PXGA 2MSEB 3C4JA 3LW7A 3GD7A 1KJZA 1A5TA 1XXHA 1WE2A 4D80A 1JAHA 3QNUA 1M7GA 1Z0DA 3CX7A
chains in the Genus database with same CATH superfamily
4D0RA 2H1WA 5E6UB 1Y9DA 2XIQA 2ZTVA 3HVKA 4UM5A 4ZI3A 1OV6A 2X4DA 5TEWA 2WE8A 1WDTA 2YVKA 4QICA 2I8CA 2YIAA 3MLAA 4HUQB 3WJ2A 1Y8AA 2H8GA 3OI7A 4JTDB 1L4UA 3BQ9A 3SR4A 4F4IA 4QFBA 1SQBG 1QR8A 4A16A 5I7VA 4DV4O 2MSNA 2IOFA 4ETIA 4EUHA 2DX7A 4KSYA 5E79Z 3MOGA 4EYEA 3THXA 1MW9X 4I6JA 1PNVA 3WLIA 5B7QA 1QSGA 3NC4A 1MQAA 3GJZA 2ILMA 3GJXC 4JYYA 3WFVA 5LYJB 5B6IA 2EJWA 1HI9A 2V4MA 1T1IA 5CITA 3SS8A 4EZEA 1WZIA 3EEYA 2Z2KA 4EJ2A 1NLUA 2EIXA 3WK9A 1JCHA 3O0DA 4QQFA 5DK6A 4F4JA 4NCAA 5L3ZA 1PDVA 2ZI4A 5FPYA 3TVTA 1HETA 1M0TA 3HUTA 1N6NA 3FMIA 3W5HA 4ND8B 2VDJA 1DSSG 4B6SA 1VEWA 4UHJA 4C5CA 2BFEA 3EPHA 1DXYA 2XYPA 4GPD1 3CT6A 4CM9A 3AI1A 4PYQA 2VP0A 1F8XA 1MB4A 2H2IA 4CG3A 3R3SA 4ZYZA 2C5HA 4AXBA 2DWDC 2ZWIA 1F6BA 1BU8A 4MYHA 5LDGA 2D00A 4C3OB 2AR0A 4IYRA 4POOA 3QELA 3O65A 5EJ2A 1QANA 2PXAA 2ODQA 3RCBA 4PBSA 1AKQA 5DTEA 5F78A 5DASA 3UJ6A 4E6EA 1S2OA 1ZH8A 2YMQA 2YR0A 3LG2A 1AJYA 1PLLA 2BAGA 4WT7A 3RG8A 1K7CA 3RQIA 2CMGA 4WA7A 1P1CA 5CH5A 4IM7A 4EY3A 3LNMB 4FFNA 5G41A 7ADHA 2I1VB 2VZ8A 4NTYA 1LNQA 1VC2A 2B34A 4RO0A 2AR9A 5E95A 1PL4A 4DJEC 5LD2B 3DEZA 3RFUA 5AKIA 3SYCA 2ZANA 4M8SA 5KYXA 1P0CA 2XB2A 1WUKS 2F4VO 1P4HA 1E32A 2WWIA 1MF7A 1E18A 1D6JA 1MX9A 1X94A 4UNNA 3PQ6A 3VISA 4B79A 1YJXA 2YNMC 3WK8A 2AC2A 4WY2A 2VCHA 5JNVA 1V11B 2IQ5A 3FZYA 4JEHA 4V24A 4EUKA 1GA4A 2GPAA 3AE5C 1OHHA 1SD2A 4K1LA 1CY4A 4NX2A 5C34B 4D98A 2D4AA 5THXA 1EH5A 1ZNWA 2HM7A 4B6QA 3UJNA 1W581 1VLJA 2I54A 4QEZA 4P31A 1Y47A 1IXZA 5C8VA 2MSWA 2XAUA 3UHAA 2X1MA 3FTEA 1YVDA 3OM1A 1GG5A 4FIDA 1T25A 2JFWA 1TIBA 4KJXA 2OFFA 1NTMH 2Q45A 1W5SA 4D82A 5KX5A 3BQMB 1P7GA 4OB6A 4G2KA 4XUCA 2WEKA 3VH4A 4RZ2A 1XPOA 3DFMA 2FOLA 1KR2A 4MJ7A 1UBUS 3R7DA 4XCVA 5JY1A 4KITB 3N70A 4IEEA 1MXHA 4JC8A 4C0SA 4CMJA 1BCCD 3L7OA 3V2IA 2W70A 5ITVA 4RTOA 1XEWY 2DM6A 3R6TA 4RZHA 3WFZA 2FMKA 2CFIA 3PNLA 4N0EA 3PD7A 2FG6C 5FHRA 3U7FB 3G0DA 1S1CX 3PXXA 4GI7A 3H1HD 4MULA 1AGXA 3DG9A 3O6QA 2AH5A 3PFNA 3U48A 4E14A 2XNJA 1I3OA 1W44A 3HFGA 1X9VA 3EXAA 1OC2A 1XF9A 2AYXA 2B98A 1Z8DA 3L43A 4FE3A 4C76A 3EUWA 4H1UA 2W6JA 3EVKA 4RC9A 4YUYA 4L72A 1CR0A 3LH5A 3EVNA 3K9BA 2IH2A 2K87A 3AGPA 1OVMA 1IUOA 5HE8A 1IFDA 2V5AA 3B3JA 5FI5A 5K2MA 1W4ZA 3EZNA 3JQ7B 4DNQA 2ZRKA 3CVYA 1V71A 2IP1A 4R5HA 5FOVA 2O8CA 1KYXA 1M57C 3M0AA 1G9XA 5K3FB 4P93A 1DIRA 1E9DA 4GECA 4TTSA 3WL8A 4MCIA 3MS7A 1DC4A 1ONOA 1KMMA 3CX8A 5H8WA 1M0EA 3QXSA 4X20A 1ARZA 1MA0A 4B8ZA 1O57A 2HNBA 1XDBA 3O83A 4OXXA 3PCRB 3IAAA 4WZZA 1NUPA 1X3LA 4CJXA 3PQ2A 1TA4A 2NSDA 4BAUA 4V0KA 5DYWA 4EG1A 3SGLA 1UMCB 3ASOB 2JFUA 2RBKA 4Y30A 2CFRA 3V2UA 3Q4HA 2F43A 4DAEA 3L74H 3VR5H 1YONA 1T6NA 2ZB4A 1R0YA 2CN1A 2MTBA 2J67A 1NRJB 4BE9A 1QBGA 1X0VA 4LC0A 1Q0LA 3N8GA 4BN5A 4U7NA 3MT9A 3RV3A 4COKA 4EEZA 3VUFA 3ZJ4A 4B7CA 2W6JD 1P5ZB 3TW4A 7YASA 2RNBA 5KJ7C 3IUEA 3JASB 1C0EA 1NTZG 1HG0A 4KPEC 4RLHA 1PFQA 3QE3A 1M74A 2RGDA 5AJUA 1WPXA 1K08A 2W2XA 2H2WA 1F2UA 221PA 1Y66A 3BIJA 1N2CE 4AM8A 4EF5A 1XE3A 4Y2UA 5KVVA 3A7OA 3AEFC 4R4LA 1P0FA 1RHKA 2I3ZA 3QBDA 3G6EV 1WCV1 2CLSA 5BV0A 2Q5CA 5JSZA 3AEZA 1F9AA 1FXKA 2R8PA 3CCUV 1CUYA 3FETA 3H6KA 1UP6A 3BK7A 5CCGC 2VH1A 2HSDA 1WP4A 3D0QA 3QXXA 4NK5A 3TLYA 5AW3A 3UT5B 3NUGA 4B7XA 2JLXA 1RM0A 2GFQA 4TL7A 4QRHA 1IUKA 1V55C 1UKEA 2EZUA 2NADA 4IZHA 2O5CA 3FWNA 4URUR 4IQGA 2KG7A 1NU1E 4B83A 4C1NA 2DHEA 4TL6A 5DXJA 5MN4A 2A3QA 1URQC 2CWWA 3OC6A 2JEUA 4EW1A 4F9GA 1JR6A 2ZBFA 4ND1A 3CVXA 4JZ2A 2H2HA 5JASA 5KYWA 1J2JA 4WLOA 4WV3A 2Z4RA 1TM3E 1JIXA 2ADPA 4LE2A 3T94A 3ZWKA 4E21A 4QE7A 3PD1A 2FR1A 3WR5A 3PH0A 2JKVA 2XMZA 4QHTA 1F51E 3GVXA 2BI8A 2FSUA 2R60A 3JWEA 1P91A 4LWZA 4YP1A 4LXTA 1XZBA 4RZ3A 1A71A 3TM5A 4F5ZA 5DBEX 4B40A 2AFRA 4Q00A 2PX3A 3O8ZA 1VI6A 5DN6D 5FWXA 2CYBA 2PKQP 2YJ5A 2E87A 2O2SA 4PG7A 1DIPA 1RYFA 1QIFA 4X85A 5E1DA 4RQUA 3PD0A 4C6HA 4DGQA 1D2MA 3WA7A 2HPCB 4PXSA 3USZA 3WG9A 1ORQC 5KTKA 4MIEA 1E96A 4I5IA 3NEAA 1CDEA 5ADVA 1L0LJ 3U39A 1J0EA 1KRWA 3DLBA 3HYCA 3MBKA 2ONCA 4WOKA 3T7SA 2DOKA 3EDRA 4V2IA 2LW7A 2KLVA 1SEPA 3SYOA 1YS9A 3R3VA 4OWFA 1CDOA 3T99A 1APBA 2IJKA 3H1IH 1RHUA 4B7UA 3FCEA 1K04A 3RUAA 2OC4A 3IUBA 3V4OA 1SQPK 4DY4A 4LZWA 4Y7DA 1VSVA 3OEHD 1JDVA 1E3TA 1E6MA 4DIKA 1BDIA 3G2QA 5HKKA 1AGPA 2V59A 4XDLA 2EEZA 3IELA 1DX4A 3NUQA 1KI8A 3I42A 3QY9A 4ZMRA 2G3AA 1G20B 4G4GA 1KJJA 4RAIA 3T1HO 2GRAA 1QLEB 1H1LA 3ZIAD 4BNJA 1ZGAA 1MIOA 1N5KA 4PIPA 4ER6A 4L8GA 1H6AA 1ND6A 1UFOA 4G0XA 3AEEC 4WBXC 4LX0A 1O08A 1IY1A 4Y99C 1GL6A 1Z6AA 3CUTA 4S24A 4JJ4A 1NVAA 4B45A 5HJ5A 4D57A 3NPAA 4BU1A 1H9BA 2PSDA 4YRBA 1WNFA 1VBNA 1W2WB 3KLMX 3GLRA 2NV2B 2CHUA 1N73A 2EULA 1NLFA 2Y0EA 2YW9A 4NPEA 1OXBB 3MJCA 4CV0A 5JO0A 2M5AB 4I5GA 3ZLJA 3A31A 1DPGA 4BWAA 2G25A 2Q8PA 3RKUA 3GT4A 3I9V1 2NT4A 3AB7A 5L3FA 1N34B 2NIPA 3O8DA 4OATA 1OVGA 3F6CA 3SJAC 1TYCA 4CS4A 3OE1A 5AHWA 3CW9A 2ONKA 1YQEA 3PUVA 3VPXA 2ADOA 2H48A 4OM7A 5DE3A 3S4RA 1EK5A 2HF2A 3NONA 1R10A 4PZUA 3RHTA 4I55B 3V4PB 3NHRA 2VPQA 1EFAA 1XEXB 3G0HA 5EMKA 3IIKA 4KQ6A 3N2ZB 4MVCA 3IDOA 2MMCA 2OYQA 1HDRA 4NJMB 4IIEA 5HF5A 3AB8A 5K05A 5EN4A 2XNDG 5HQ3B 2OYHC 2IOYA 4I55F 1SBQA 3T6KA 4HEA6 2QTNA 3TFWA 4BNTA 2REQB 1SO8A 5BN4B 3N7TA 5KYUA 3H5WA 3JRWA 4UDOA 4QYIA 5J3JA 1Z56A 1I4OA 3E9NA 2OXEA 1U7XA 2GN2A 1Q7BA 2R6R1 1ZOIA 2YWBA 4HGZA 1F0KA 4M36A 3I2FA 5EGNA 1TCCA 2WYOA 3W5DA 1K73W 3L72J 2V7EA 2JZOA 4ZDWA 1KPIA 1ZUIA 2GFIA 1T2NA 3T3HA 3WWOA 4K9NA 1D4ZA 5JARA 4GMDA 3HUSA 4G5OA 1I94O 2Z4SA 4TT8A 3JYOA 1IO4A 1H6BA 3KCQA 5AUNB 2WIKA 3HBNA 1OWOA 1D1TA 4H35A 4URZR 3FF1A 3IF4A 2A5FA 1RWKA 3CRVA 1K86A 1SC5B 3F6PA 4M98A 4MV9A 1KC8Q 1WM1A 2FNAA 4CQLA 2E76B 3DJYA 4CKCB 2JLZA 3LF2A 1CRZA 2CMFA 3CE6A 1H6DA 3L72H 2QUJA 4H08A 1U3VA 3P0JA 4J6EA 4Q3OA 3VU8A 1XUQA 3ABUA 1AP6A 1KO5A 3ZDXB 2X4GA 4P4TA 1NU6A 3IQZA 1I32A 4PNPA 2Q5IA 1WKBA 1LTSC 3E7KA 3ACDA 3W6OA 3O38A 4ZTUB 2R9AA 1BN6A 3L70J 2WZQA 4Q3NA 1DEXA 1U9YA 3W6NA 2YHIA 2Z6AA 3L73J 3PDJA 3HUSB 2R87A 3OZCA 4XB6B 2KSEA 1JDSA 5DM0A 2WFLA 3QBTA 2ZWOA 2OSBA 4JI6B 2NSLA 5DGTA 3S4YA 3B1FA 1SQQE 5A04A 1ZW1A 1F3OA 2HPVA 4H1VA 1ID8A 4LYDA 3SC4A 1IWBB 1GTG1 4NG5A 1YKSA 3H2IA 4BCBA 4YT4A 1ZP6A 3TSWA 4LS3A 4Q4HA 3L72E 4X63A 3N0RA 4NYMR 2QMHA 1DQZA 8ADHA 3LCJA 2DU8A 3JQPA 4XFJA 1E64A 4BW5A 3G6KA 5KNCH 2J32A 3VZRA 1N7SC 1F4LA 2VSQA 4OQLA 4UNQA 1SIBE 4BNVA 3NHAA 2ISCA 5ALYA 1M73E 1ORRA 8ABPA 1JXMA 3VYWA 2POQX 5TQVA 4LDAA 5A71A 2OT5A 2OXIA 3UAVA 4GNRA 3UKJA 4L74A 2ATCA 2YZ7A 4LF9B 3B8HA 3C6BA 1EC5A 3LDUA 4P34A 4DV6B 1DEKA 3RS8A 4YCCA 3E23A 1EEHA 4MVJM 4YUZA 4ALNA 1LPNA 5CEEA 2OAQ1 4J1TA 4BVJA 4MUBA 4IHJB 3ILHA 1SXJB 4NECA 2ZU0C 2DY1A 5B36A 2D2CD 4C1BA 3B71A 1NSFA 1XZLA 1W52X 1FS4A 3F5FA 1DBIA 3IPYA 4S1VA 4DTIA 2VHQA 4IIYA 2Q9LA 3KJFA 3G2HA 1OI2A 3ZRXA 3EIHA 4X5OA 5TVKA 2V8BA 3OD5A 4ENUA 2XKJE 3ER6A 1BW9A 2ZOSA 1XZNA 3IUYA 1M8PA 3AEYA 3LQKA 1R3LC 1EZZA 1RZVA 2O6LA 4KI7A 5DYIA 2O8EB 4NTXA 1HLDA 1E1NA 4I9UA 3Q6IA 4LPSA 5IK2A 3SFZA 1UKZA 5APVA 1EXMA 4RMGA 3U9TA 4E70A 3ZN1A 5F1PA 3CEIA 1N7GA 1RR6A 2QUZA 2YZ2A 3BCRA 4TSRA 5DP1A 3V80A 5IWAB 4KU4A 3RB8A 3WZ2A 2FETA 2JJMA 4PDVA 3JQCA 2WVRA 2DBRA 2DYSC 4BGVA 4NWIA 2R9VA 1SFCB 1H5QA 2FP3A 4NOKA 1VG8A 2JO1A 3WG7C 4LC9A 1DTOA 3EXHB 2J3HA 3QX7A 3GRZA 4NATA 2DHQA 3KJXA 1G8PA 1G8YA 3HGTA 1TC2A 4C46A 2JJYA 5BRAA 2AMYA 3X1WA 1AVYA 1QK3A 4BKOA 4YUXA 3WG7B 3SF8B 3MUOA 4FDAA 4G5YA 3ZQ6A 4A4DA 1NQWA 2ZKOA 1J1DC 4HH0A 4RPJA 4CV3A 2B30A 4MRVA 2E3CA 2HRDA 3ZV7A 3OJCA 1TOAA 2AC7A 4BY9E 3T2MA 3KQQA 3RVJA 2PL1A 2ZR2A 1VQKP 1T24A 2XUPA 1SXIA 1ZEMA 1VQNP 1DD3A 4IKOA 5EUQB 1DLJA 3VMXA 4NIMA 4CMIA 1DWUA 3QKRB 4RSGA 1G7TA 3WRXC 3JSAA 4D1YA 3L04A 4ODIA 2HWUA 3DMYA 3OKPA 5K3DA 3DFFA 4KVAA 3V2QA 2CLOB 4PO9A 2V6IA 4UTOA 2R96A 3DZ8A 3M91A 3HN7A 3HB9A 4I5EA 2IODA 2PIDA 1KYOE 3DE0X 3I1IA 4FGKA 1T29A 3L1HA 4N7MA 4ZIRB 3NXSA 1GUFA 4GI1A 4DQUA 1P2TA 3PTZA 1FF9A 1TW2A 1QYRA 2CLLB 3ANTA 2QPTA 3U7QA 5KJ6A 4URVR 1V9PA 4N7JA 3LY7A 4R6ZA 4FEGA 1BDMA 5IUJC 4CLRB 1GRRA 2WWFA 4U63A 5F2KA 2Z9CA 5HEKA 2QUAA 1JTEA 1ZDMA 4Q5IA 6CHYA 4WFIA 2BFNA 1NW7A 1CP9A 4OYLA 4MWDA 2IBSA 3A6FA 3ET5A 5A6VA 3QKRA 1M72A 3K09C 5J58A 2M3EA 1VMIA 3CM0A 4L95C 2YHSA 4BNKA 1ZY2A 2ZE7A 4G27B 1VIVA 5BQFA 2FHPA 5JJBA 2IK8A 3FCSB 3L18A 4GLBA 5K20A 1BHO1 4PSDA 4WZ6A 4DV7O 6NULA 4OI0A 5TPWA 1HYBA 2VUIB 4K05A 1GFZA 1KP3A 1RWMA 2FP4B 3JW8A 1PJTA 1HNXB 3OKAA 2BKAA 4R98A 4RK6A 5H3LA 4O2AA 4EITA 2D2IA 1VGQA 2GILA 4S0ZA 1EVIA 4CMEA 1F2UB 4KXRA 2HAEA 1QVAA 2CLFB 4A5OA 3HE4A 2WVAA 4FZJA 1PKEA 4XVCA 2GLXA 4WLEA 4ZQHA 4BNUA 1E61A 3F78A 3RG2A 4RO2A 3N3AC 5BZBA 4N3CA 1YZFA 3OEEA 1X77A 2HSGA 3VNBA 4IJWA 2I78A 1YBAA 3QE4A 2IEBA 4DR2B 3FUXA 3HEBA 4FYMA 2NVOA 2ZYTX 3WLKX 3SWWA 4J3NA 3C16C 4WESB 5CLJA 1VA5A 1ACMA 1BJRE 1ZRTD 3WRWA 4CEHA 2IIVA 2PKQO 3A37A 3LCUA 1S6YA 3FFQA 2VF4X 2V6MA 2VP4A 2YRXA 2F7SA 1QNLA 2YV3A 4O25A 5AVWA 2ZSDA 4AJ2A 1UM8A 4RA9B 5BN4A 3A9WA 4Y0VA 2WTXA 5EJ4A 1SFCC 4C78A 1IJDB 5G3YA 3R7LA 3BZBA 5LYYA 2UYOA 1ABEA 1XXHB 3UAGA 3AJ8A 1SKYB 2Y8EA 4ZCIA 1UANA 5K0EA 2OESA 1T9HA 3CVVA 4TYMA 5BR8O 2RH4A 4L3WA 3L70E 4LDNA 4U7TB 1H42A 2HD4A 4MW6A 1Z12A 1WW3A 1K9SA 2O0HA 2KZIA 4H31A 2PRZA 4JLJA 1DRUA 2WTNA 1RM4A 4WFGA 1EVJA 1Q16A 5KA5A 1VL2A 1Y4UA 3MNFA 3MWEB 1XZJA 4IFTA 3ZY2A 1EQ7A 2QWXA 4Y2HA 5B5SA 5YASA 4QNRA 3DFIA 2C9DA 1EFRG 3HC7A 1BKDR 3NFYA 3ZE7A 3LYLA 1AV6A 2QG6A 2GD6A 1Z4NA 4IL6H 5IC5A 2CHQA 4HYYA 2WIBA 1UDCA 4LTMA 4QM7A 3AMVA 1NXPA 2Q8QA 3LPNA 4B4UA 4XGRA 3BXOA 3GGPA 1P73A 4JUCA 1R88A 3CZQA 4ABTA 1EZVE 4X3CA 1VJGA 3LW5H 3GRAA 1YDXA 1J97A 4GF5A 1W8IA 3HLYA 1KILB 1C0LA 2FSIA 2ZRQA 3CZ4A 3NZEA 4XVQA 3T35A 3AZPA 2JHGA 2IYRA 3LKZA 1DHTA 3EZ9A 3AEQB 3PN1A 2JJ2G 1NJ6A 1YZBA 1SQPE 1O8BA 3EZYA 1N3BA 2W6JG 4RPGA 4WKPA 4AXXA 1Y9AA 4G4SO 5IDQA 3ZDBA 1P2DA 3EVZA 2J6BA 4J49A 1YZ3A 3FWLA 1VQ6V 2VHEA 5AVXB 1XMIA 2Q4EA 4JQ0D 2W8BA 4NBKA 3WNZA 1G20A 1PUIA 1WXEA 5CCBA 3W9UA 1Z83A 2HPHA 4K35A 2C2BA 1AV7A 1AUXA 3WKEA 3KETA 3ZE0B 3OCCA 3QWBA 2D3WA 3AF2A 3R9KA 4EPRA 1YDGA 3ILSA 5L4LA 2QAGC 5C52B 2OM2A 2H9YA 4OQDA 2CJFA 2DTEA 2DPXA 2G8LA 2LTAA 4IH4A 2IA5A 3IFXA 1KO8A 2O48X 2JEEA 1F6WA 5ALUA 4C4OA 2WWYA 2O7SA 4YASA 1LRJA 2HRQA 2J7KA 2P4EA 3NBFA 5ELLA 1WXWA 4HLQB 3O82A 2IIBA 4YIHA 1Q44A 2C5FA 2QLTA 1J90A 1FFSA 3R6DA 2P9GA 4O4JF 1HMYA 4PQFA 1S3FA 4R9UC 4LXGA 2HJGA 4JBHA 4RWZA 1VKRA 3U49A 1Q8IA 4G23A 4E5KA 1D9ZA 3H9JA 9LDBA 4NEQA 3UPUA 3OD4A 4Y1RA 3KUXA 1T3SA 1G6KA 1VF7A 1A4RA 2REQA 3IUPA 4G1CA 3U1TA 4Y2YA 2SPZA 5JPDA 3TGUD 1VXRA 3CMAP 3LSTA 4J8PA 2OBMA 3HXOA 1FXHA 2H1LA 3E5HA 4MEJA 1Z2OX 1BEEA 4C7NA 4F71A 4TUYB 3QRWA 1L7NA 5GOZA 8ATCA 5ARBA 1SU4A 2H4FA 2Z9BA 3D31A 5AK4A 4BKRA 3A2FA 1NUUA 3DLPX 3K8ZA 4NBWA 2ES4A 5M5BA 5LSAA 4INJA 3SLRA 2WAYA 4N3AA 4EKYA 3LOUA 2PFSA 5KJ1A 5FPOA 4G3XA 1MO3A 3GW6A 4GX1A 2EBFX 1MB0A 2QL5A 1FDVA 2HU8A 2Q7GA 4EVRA 3K9FC 3JYQA 4EYGA 5A3RA 5JJ5A 1OCRC 3JQ8A 1DMRA 5BOSA 1DG1G 2ZU6A 3DXXA 1IM5A 2H4WA 4PRKA 4DIBA 3V46A 4DMKA 2TSYB 1KB9D 3E35A 1RE0A 1U1GA 1U0GA 2CFTA 2A0XA 2G08A 2PJUA 2FPGB 3EMKA 2JRLA 3W2EA 1L0LE 2R97A 4B3CA 1L0ND 4GDFA 3LY5A 2LP7A 4EYKA 1NTKH 1YQXA 4Y8VA 5AKYA 2EIJC 2Q69A 4MTCA 1VCIA 3TAUA 3RYFA 1KGDA 3UHJA 2G1PA 1N2GA 1MNQA 4OXSA 4X1IA 5JQGB 1LT1A 4HH2A 1G5FA 3GJ3A 1QPGA 2XGSA 3H9QA 4LV6A 4BRWA 4F5WA 5B7PA 5JJCA 3JYPA 5KLIB 3QO5A 1Z5GA 3BMCB 3O0TA 2VP2A 4EA6A 2KYVA 2DQ4A 4GBED 3CEPB 3CJQA 1HKUA 1XVTA 1T9KA 3H0CA 1UKBA 3IMGA 1U3TA 2FSSA 1Y6RA 4JLAA 5DULA 3GPDG 3WQRA 2NXJA 1J2RA 2GK7A 3BJZA 4E4EA 5AVSA 5J4HA 1TIKA 2BI4A 2PMFA 2WPRA 1L2PA 2XPCA 4L9RA 4PQYA 5EIFA 1N2JA 1AO3A 2WSEH 3Q6MA 4L4ZA 1RXCA 1YA4A 2BFBB 1KOFA 2PL5A 4YRLA 3RK1A 2OO3A 1HW7A 4H44D 3BL5A 3ZOKA 2IY9A 3HU1A 4EL0A 4FHCA 4ZDKA 5MF6A 2J59M 4LQDA 2YWRA 1EGMB 2VEOA 1TUEB 3QV2A 3ANYB 4AL4A 2JVKA 3I32A 4P83A 2P58A 1T9ZA 1X15A 2BONA 2GS9A 4M1MA 5FUXA 1NXXA 1RFLA 4DEXA 5IC4A 3Q5RA 1Q14A 1XCGB 3Q7TA 1O95C 4JP8A 1AJNA 3E15A 2HR1A 4TTQA 5ERYA 5AFSA 3VJMA 1PI3A 2K9JB 3QW4B 1RXSA 1Q6UA 1RMQA 1GFIA 2J45A 1E59A 1PUXA 2J0EA 4G4IA 1XELA 3FHLA 4R7GA 5BSRA 4BV8A 2PPVA 1PN3A 1NATA 2J9FA 1VSBA 4FOTA 5F73A 4D6TD 1XGKA 2ZIGA 2XGOA 4OX9O 1E7SA 1XZFA 5FBLB 1NHLA 4AZVA 5IVHA 3Q6NA 2UUAB 5AIAA 2WQYC 4CG1A 4MWOA 9ATCA 4RUEA 4RZSA 4IXDA 3ET4A 3HI4A 3MCWA 2CJPA 3QVLA 4C20A 5EJEA 1SVFA 2IVFA 2ENUA 3F5QA 4EENA 4IV0A 1SXJD 1XD8A 3BIXA 2FGKA 1XAIA 3Q8XB 3UXMA 1XZKA 2AC4A 3QG1A 1IH8A 1L7XA 3FMFA 1GPAA 2EHDA 4OLFA 5CJ4A 3CPHA 4FSHA 3UCFA 1BL8A 4QOHA 3Q8LA 4ZMDA 3FCYA 2HA7A 1VF6A 2C82A 4UDNA 2C92A 4P58A 5T67A 4YHHB 4M1KA 1QQBA 2XAHA 1NUHA 3H4MA 4QUJA 1KYIA 1JOCA 1UPXA 4Z1VA 2ZB2A 2DMRA 3FMOB 3ZEDA 3OD1A 5J2TF 3WP1B 2QAJA 1USUA 3W06A 1WAMA 4HAVA 4N78E 4Q9AA 4Q7LA 1MRNA 1W4BA 1KEKA 4HWGA 1P2GA 1J8VA 1URQA 1P77A 3KPYA 4NXMB 5J2TB 1NOJA 2J30A 5EE3A 1P7ZA 2HMVA 2JLAA 4KR7A 2EIHA 1H38A 2C3OA 3PIRA 2OYCA 1A7AA 2IYLD 1T10A 4CLDA 4Q9HA 4G63A 2O54A 2P65A 3NORA 3GB7C 3F7MA 4CQMB 4ND4A 3K04A 3BAFA 2FYUH 3OZTA 4O2AF 1PVDA 1SOWA 3AM4A 4N5LA 1QMPA 4B4DA 4CM4A 1XL4A 1SU6A 4LC1A 1RKXA 2HGSA 5FADA 3HB5X 2FSVA 4NE2A 5D3MB 1NU1G 1RU3A 2AN3A 3WAKA 3EMVA 1GLGA 3AHGA 2VBFA 4ACBA 2E42A 3WB2A 2VHJA 1ZTEA 4Z0NA 1YIDA 1RM1B 5L40A 4PQRA 1Y6ZA 1IQRA 1KSHA 1T35A 1UDWA 4CH6A 4AKTA 4ENRA 5LQCA 3VMYA 4WASA 3LDAA 2ZATA 4IOMA 3U0VA 2Q21A 1B76A 2VHXA 3ZRVA 4GQAA 3ICPA 2VAPA 3WISA 4B6OA 1KEWA 1NTKE 1CR4A 4CFZA 5BV2P 2VZ0A 3LT5A 3UN1A 1GADO 3D3EA 4LAFA 3WIUA 1AKWA 1JWLA 3VKHA 1V96A 3HDYA 1M1JB 2O1WA 3E2PA 4B35A 1K3FA 2I6UA 3VNUA 2ZJFA 2V45A 2UVDA 3KOUA 3CXCU 4UXIA 1LQUA 2Z5VA 4MOWA 3RTCA 7MDHA 4I4IA 4L73A 2GEBA 1AD2A 3ANMA 3F6YA 3WNCA 3PJDA 4BO2A 4KGVA 4X41A 5C5CA 3OX2A 1RHRA 3GRUA 4G0MA 5I8WA 2EBUA 3G8CA 4N54A 1G5RA 2KLHA 1YR6A 3BN3A 4FSDA 2I7DA 4BX3A 1C2TA 1EVLA 5JDCC 3WIEA 1XA3A 3N2EA 3ASNB 3KKMA 3SDLA 2B7CA 3NBYC 4LY9A 2DWUA 2WTMA 3Q5PA 4ZRNA 3FOBA 4P7FA 3FXDA 4L7QA 1VQ7V 4OYHA 1YJQA 4UE3S 1JNYA 3RRMA 1ZM7A 2QLJA 2XOKA 3AKCA 1IG0A 4ML3A 3W67A 5CGZA 1WPGA 2Z4TA 3A6KA 4LEIA 5A2QN 5LU8A 1JIUA 1SFCA 4RLSA 4CMKA 3O8NA 2HT6A 2ZUSA 4S0XA 5JALA 3Q2OA 2HKIA 1UBMS 2VWHA 3M1AA 4HXGA 4DZTA 2JIZD 4MWTA 2A45G 2YIBA 3TB4A 1GPJA 3B48A 4M6WB 1PFIA 3F67A 3A1FA 4TWRA 1V25A 4PX3A 3OIVA 4ZOEA 4M60A 4QSMA 3U44B 1S1MA 4WUVA 3AUUA 3B7WA 5K03A 3SSOA 4OH1A 2JCXA 4CDRA 1R0SA 3H04A 3ZBHA 4QEDA 2C00A 4QOIA 4DW1A 3G13A 3WFJA 1ZM9A 5J47A 4HBZA 2R6AA 5KTPA 1FYEA 4R9RA 3HGMA 3PFHA 2BSXA 4XLTA 2UZ1B 4QBGB 3T95A 7MHTA 3FPCA 4LJ7A 4LFBB 3QEJA 4IKEA 1GZ5A 4U0JA 2RD2A 4OB7A 1WCXA 3JR7A 1Q3HA 1UDAA 2LZ0A 2ZG6A 3BMQB 1SELA 3I5UA 4OPMA 4UEWA 4YJKA 1Z0AA 5LXTA 1I7NA 4NFHA 4B6JA 4EOGA 4K8ZA 1LS1A 1QOQB 2EV9A 3RANA 4YS6A 3ROXA 2ACWA 1X7WB 1TT5B 4KPUA 3CLTD 4LVUA 5HCUA 4FDUA 3P4UA 4X6XA 1K5GA 2ZKIA 4B43A 4TTRA 3VSBA 5BNZA 2VQFB 1MENA 1UZAA 4FXPA 3C6ZA 1RRGA 1FZEA 1JHOA 3PF9A 3QVNA 3FNIA 3KFXA 3MF4A 2MW2B 1DRKA 2HEGA 3UPTA 4W6ZA 4B2LA 4URWR 4BBPA 4QFCA 1E1QA 4XTCS 4B32A 1IJEA 4J7JA 2BN4A 3DFZA 3W5JA 2WU3A 5CM2Z 4ZT7A 5B1OA 4EHFA 5CA0B 4OFWA 4HRYA 4LCBA 4ZAXA 1BE3E 2DGDA 2EJCA 3AF1A 4P7BA 4AX4A 1ULAA 1S9KE 3NBQA 3F8TA 4YCSA 1XZAA 4KQHA 1QOZA 3H1LG 2P10A 3KJGA 2M6KA 3THWA 2WDPA 1NM5A 4R1LA 3FHCB 1NT2B 3D8CA 5IY5B 4RQFA 1VQ1A 1KC3A 5DLYA 4N48A 2XOKG 4L5BA 4BZXA 1WBBA 4KQJA 4B7KA 1IMOA 1HZZC 4RH3A 3HCBA 3OCZA 4ZFNA 3ST7A 1PFVA 3F74A 2BDUA 4D0NA 1OF1A 3Q5DA 1XMXA 2G4LA 3U26A 1OXMA 4QDUA 1VKOA 2E75B 2Q0OC 1J9GA 4FOOA 3IKJA 5SY9A 1M2NA 3V4SA 5T4BA 2PYLA 3ADDA 2YV1A 4Z3DA 1O5OA 3U09A 1BE6A 5CBFA 1LQTA 4ABMA 1T6YA 3R77A 4Q3LA 2VRSA 1N5DA 2K5UA 3DHVA 3AK1A 2HG5D 3G5TA 4WCFB 3AVWA 4J0CA 2YO3A 4ZAZA 4RIEA 3IR9A 2FJUA 2W58A 4L8YA 4ALLA 3PNMA 2FXMA 2QX7A 3VV3A 1KKLA 1NRWA 2ENWA 2QUIA 4AIRA 1OWLA 3FBTA 3VVLA 5E79E 3AETB 2ACEA 4TQAA 1KWKA 3R7WB 3PR3A 1P6QA 1E1QD 1CI6B 1ML4A 1Z5VA 4B5LA 3NHMA 1XZCA 2AHZA 1F1JA 1TTQB 1QX8A 2IU6A 5G1OA 2JEXA 3UMBA 4BZWA 2JHAA 3ZJTA 1W93A 4KYUA 4ON9A 1P9RA 2WMDA 5JIBA 1AGYA 4EX7A 2DWQA 3H01A 3VN0A 3P2KA 4O6VA 5B1DA 4B6EA 1NW4A 4CF7A 1JXQA 3TW6A 4GKKB 1G59A 2PO7A 3ZK9A 5BY1A 1PLJA 4PLTA 4RXTA 4XKJA 4ZVQA 3K58A 1QG6A 3INNA 4B3RB 1SPXA 3ENNA 2Y05A 4J0GA 1KORA 1JSRA 1F4MA 4AZWA 3H1JG 2X2OA 5FF9A 5FBWB 3M1IA 5A5VA 2OGSA 1HWYA 3TEMA 4B73A 1NVFA 1BXKA 4LZNA 1Z75A 5AVUB 5BWMA 4IJQA 4MW8A 2A9QA 4NJMA 4E2LA 1QVZA 2P2GA 1SEVA 4JI8B 1H2EA 3K4QA 2I0FA 421PA 4UB6E 5DKFA 2XWBF 1U5BA 1CS0A 2BHLA 2DFVA 3ERCA 2H5IA 4IZ6A 2VPTA 5CVJA 2HNAA 3H18A 1TJ3A 2FUKA 2Z3ZA 3DDOA 3IMCA 3EH2A 3L6CA 2CLIB 2A9HA 3IBFA 3LPAA 4HAMA 4OGQC 1BFKA 3OT1B 3SG0A 1BQZA 2DJ5A 5HKLA 3NOXA 1P5JA 1K8XB 2Z0AA 3BFPA 3IT1A 3UMGA 1TUGA 2B89A 3V4WA 1CERA 1SQQH 2XTNA 2P69A 1CSBA 1PD0A 1GPLA