4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
b'DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
2F1HA 5KPDA 4HEJA 4NMMA 2QEQA 1E2MA 4D0GA 4XWAA 3P1JA 3PITA 2CLSA 3EZ2A 2FFBA 1WMSA 2J46A 4NCKA 3M4YA 1J8MF 4P4UA 4V0OA 1PJRA 5DI3B 3HE4A 1Z0DA 2QQ0A 2QPTA 3LIDA 2CE2X 4KLZA 4N0DA 2ZSAA 4TL8A 1DAIA 1VKJA 3HU1A 4A1FA 4YMTA 1SQ5A 3ZRWA 4AD8A 1G8FA 1A2KC 2Z5IA 1KI9A 4HLUC 4DT1A 4Q1DA 4A0FA 3K09C 4W9MC 1T3LA 3AKYA 1SVSA 3KUCA 3B7GA 4IRUB 4FWTA 4DCTA 4QBGB 1XPRA 5KPJA 2D3WA 2GWHA 2MSDB 2IS6A 4Q9IA 3M06A 4B32A 1HUQA 4PAQA 5ELXA 4GOKA 1C4OA 4GBMA 4HAZA 4ITRC 5KU1A 1UDWA 1XTKA 2GJ9A 4HZUB 3B60A 3BFVA 2V3CC 1JXOA 1XFAA 1LFDB 4MKGA 2QAJA 4MH0R 4OHVA 4PC3A 3H0KA 1KY2A 1P6XA 1KMHB 1XJCA 2P67A 1R2QA 4PHGA 3SR0A 3GLIE 4DUGD 1FX0A 3UWOA 3TIFA 4IDHA 2D4HA 3IUYA 5JWRA 3BRWD 3L2OB 1NL3A 1OYYA 3HDTA 3JVVA 1N6PA 4TLDA 2CVHA 3SN6A 3BS4A 4C4PA 1NRJB 2OCYC 5FTMA 4BZQA 2ZPTX 5FBLB 2REBA 1GKUB 2GZAA 4GPTA 4E03A 4OHYA 3HE5B 1II8B 2BM1A 2ZI9A 2ZYWX 3OIYA 1ZRHA 3BH6A 4TL9A 2YWGA 5K8LA 3TAUA 3TR5A 1FNNA 1GTVA 1K5GA 1SVIA 1RC8A 1KO5A 3DGEA 1QG2A 1UBEA 3EC1A 2J87A 2ODBA 2GRJA 1SLQA 4BLPA 3PUZA 1U9IC 4TYNA 2VQSA 4Q1CA 3HYTA 1JR6A 2GVZC 3H4MA 1DG3A 1HT2E 1N5IA 1TQDA 4Q19A 4YQFA 3C7KA 2PZGA 4JAUA 2RGXA 3MWLA 1JEEA 1KI7A 1BS1A 2J7KA 4H9GA 1GL9B 3FE2A 3LX5A 3A7OA 4G0NA 2YJTD 4AI6A 4TT3D 3AP3A 3W5JA 5CDFE 4HZIA 1S9KD 3LFUA 5JWOA 2E87A 2MMCA 5A0FA 1NF3A 2FSHA 2NIPA 1BYUA 2XOKA 4LK2A 3HPQA 3WRXC 1P73A 1G4UR 2XB2A 3I4LA 4AWXA 2RGDA 5JI2E 2ASEA 4KFRA 5AUOB 4AUWA 3CIOA 1GM5A 2BCJQ 3ZDQA 1L4UA 2F1IA 3QOFA 2Z5FA 2ZRCA 3F5FA 1V5WA 1W0JA 1Z6AA 4HLQB 2F1JA 3W90A 1S4QA 1T8UA 2ZRDA 4DBLC 5A4JA 2PCLA 4XVQA 3MFYA 5H1YA 2EYQA 3VR2A 2F43A 1SXJD 3I61A 3A1SA 4WVFA 2O8FA 3W3AA 5B30A 1IN8A 4EQ6A 3RS5A 5GVRA 1FUUA 2OILA 4LYHA 3QKSB 2GJSA 1E9EA 3OE7A 4NE2A 5KSOA 4HAUA 3QKTA 4EJSB 3SJAA 3SJCA 3AH8A 4XH9B 1E4VA 4M1OA 4XE5B 3ZIAA 4MGIR 3AVYA 2A2ZA 2OE2A 4EPVA 2IYYA 1RIFA 2GVDC 4HAYA 3RSLA 4PSVA 3WNBA 1BMFA 2XSZA 1ZM4A 3W6PA 3THYA 2DCUA 2WJGA 3A1UA 3I73A 5GJCA 4QM6A 1HWTC 4EPYA 2Z5HA 1YRBA 4RVCA 5CIQA 5L3SA 1GTWA 1KDPA 3RC8A 1J90A 1RJ9B 2F6RA 1FQJA 3L0PA 2QP3A 1RE0A 5FL3A 1G64A 3CNOA 4TLCA 5B1NA 1YR9A 2OAQ1 5HCIA 3TUZC 4QGHA 3PEUA 3QXXA 2IYQA 4TWZA 4LHVA 2JLWA 4M1TA 3RRYA 3AF2A 2P7JA 1D2NA 4IKEA 5FL7D 2NZ8A 2WIAA 2ZE6A 3D6TB 4MTXA 2VYFA 4C0QC 2VTKA 4BRWA 2BKEA 2I1QA 2Q6TA 2XZRA 1BOFA 3M6AA 4JBXA 4LGMA 1KZ7B 2R5BA 3P26A 3Q72A 4C0KA 4B71A 1I4LD 1R0YA 3NC0C 5HZKA 2WSMA 4Q18A 4A6XA 2DHRA 5F3WB 3AGQA 4JAVA 2W6ID 2IF2A 3K9LA 3KFXA 4ARZA 3ZVNA 2PT5A 4L4UA 2R6DA 4DLYA 4DWJA 2CLDX 3TSZA 1Z0KA 2V8OA 4M1MA 4M53A 5EXXA 3EG5A 4V0NA 3W8NA 2V54A 3FYHA 4FN5A 1Z29A 2O8CA 1ZUNB 2C9CA 3U3MA 2WOJA 1Z6TA 3N5CA 1ZIOA 4HAVA 4B3XA 4DLTA 4JLDA 1W46A 2ZSFA 5EUQB 1XEFA 4P31A 3VMYA 1YZGA 1YKSA 2WV9A 4HYYA 2LKDA 4C7OB 1TUIA 5FBWB 2IW3A 2ZVPX 1PLJA 3B8EB 2FSFA 4NDZA 2N42A 5JS7A 2YINC 4BQSA 1D9ZA 1J70A 1X8JA 4M9ZA 3LQRA 4BWYA 2G6BA 4S2EA 4UNPA 2QBYA 2H8KA 4AIIA 2Z83A 4G1UC 2OLKA 4JLNA 4BEBA 4URXR 2HV8A 3IIMA 2KWIA 4QHSA 1GD2E 1CR2A 3LBIA 5CM8B 2FH5B 5KUTA 1XB2A 1DAHA 1LF0A 3CZQA 4DXAA 3HE4B 1NVXQ 1CR1A 5C4MA 1ZBDA 4Q48A 4AK9A 3ZRWB 1W47A 1L2TA 1X1RA 1PVOA 5L3QA 4C7NA 1KI3A 3BOSA 5KDLA 3UMSA 5GJBA 1MUUA 4DT1B 1RFLA 5B58C 3FHTA 5KSYA 721PA 1KI6A 2EFDB 2VHJA 3H1TA 4O25A 4B3CA 3T1VA 4TTPA 3SHFA 2Z43A 3VMFA 3A3YB 2P3SA 2WM9B 2FFAA 2XNSA 4BUJA 1I4DD 3GFOA 4FW9A 5DGXA 2DWPA 1QF9A 4LBVA 1IONA 1F2TA 1TEXA 2NO0A 2GBLC 3QPUA 3QVVA 1SP4A 1QHGA 2DPXA 5IT5A 2F55A 4EFLA 2N46A 3B13B 1DAGA 3OAAD 4C2UA 3Q7QA 3W6NA 1HH4A 1P2UA 4UXHA 2IC5A 2ZS7A 2Q5UA 2NPFA 1Q3HA 4KV9A 1ZD8A 4UQOA 1U8YA 1HY3A 2B92A 2ZJ2A 1A1VA 4OI0A 1FX0B 1TQ4A 3A8TA 3C5CA 4D4MA 5K8UA 3AQ4A 3FHOA 4FINA 5DHFA 1XRJA 3MWKA 1GRQA 4JZKA 4RZXA 3KQGA 3Q3JB 2QI9C 3G82C 3LBHA 4I1UA 2PT7A 2C9OA 1GITA 3QXSA 4URVR 3GLIB 1CXZA 4WBSA 1NBMD 4LHWA 1NVWQ 5AVTB 1ZNXA 4DCNA 2AFHE 4JSTA 4NCNA 1YZNA 3SE0A 4AURA 2YNYA 1T5IA 1GG2A 4KODA 4Q9JA 1KK0A 1GRNA 2J0QA 2BEKA 5FUXA 4MDFA 2VF8A 2ZUCA 1P9WA 4Q4JA 4DZZA 1GDDA 4DHEA 3LRPA 1LVGA 1NWQA 1QBKC 1P60A 2H1LA 3CF2A 3G5UA 3A1WA 5EE0A 3RS0A 2O8EA 1F3OA 4PZYA 2D62A 2VPPA 4US2R 1ZW6A 2Q21A 2Y8EA 4TLAA 1J2JA 2YC4C 4PFSA 5JI3E 1OH6A 1VECA 3I62A 3LLUA 3VNUA 1COWD 3MGNA 2WWGA 4IVQA 3WHLA 3AVQA 3X1YA 3NBFA 1GL6A 2VRSA 4CZ2A 1HJBA 1L4YA 2LCFA 4AYWA 1OHHA 1E2PA 2IEZA 5J40A 4OYHA 5DYGA 1NNEA 4CEHA 3Q9LA 4DSNA 3A1VA 2BJWA 3BXZA 2BIFA 3RYTC 4ZCIA 2EVWX 2WWHA 3FMIA 4B48A 4JVLA 4LV8B 4X8HA 5JLJA 2EFCB 5AW2B 2CJWA 2IA5A 2FTKA 4RCYA 2QAGC 2OO7A 4PHHA 4UNNA 4XSHA 5FUVA 3CONA 3LO5A 3W6OA 1AKYA 2W0SA 1UEJA 1J99A 2J9RA 3FMFA 4JT4A 3T34A 1HT1E 4RSGA 4XIGS 2WZQA 3E1SA 3ZS8A 4AYTA 4MRPA 1HV8A 2F43B 5TV2A 1JR3E 5HPYB 1NLFA 3BIFA 5HKKD 4EQ6B 5K8TA 2AXPA 1N25A 5EE5B 2FE4A 4KHZA 1R5OA 2A5DA 2OHFA 5AW6B 5M04A 3AVUA 3GJ6A 1N5JA 1NKTA 1JR3A 1SKQA 1KOFA 2REXB 2HEIA 1P5ZB 4B86A 1EFRA 2ZR7A 1M7BA 2HF9A 3K9HA 1H8ED 2VP4A 2CNWA 1ZAKA 1U2RA 2W2XA 1HA3A 2UVQA 3SYNA 3C15C 3ZQJA 2WJJA 2ZSEA 3MJRA 5H8WA 3MWJA 3G0HA 2CCJA 3VX4A 1F5NA 4RZUA 1LNZA 1OW3B 2AN9A 1KZGB 2RHMA 4BE7B 3THYB 2ZM5A 2ZEJA 5AWFC 4I1SA 1JJVA 1W36D 2J41A 2ZRLA 3FMPB 5L3SB 2H18A 2Q3HA 1Q3TA 1UEIA 4Q4HA 2BEJA 3IPXA 1AIPA 2JJ1A 3REFA 1RRFA 3SYKA 3OEHD 1XJQA 1RRGA 2QTFA 1NY6A 1YZKA 5P21A 4OI1A 4DDVA 1S8FA 4DDUA 5AVSB 2P5SA 2XAUA 4DLVA 1KK3A 5E4FA 5FPHA 1JECA 1KMQA 1FOSF 5GVSA 3PR1A 3U6KA 1G7SA 3QI2A 2FN4A 4LY6A 4ZIRA 3KJGA 4LYAA 4OQNA 2VF7A 1DBSA 5AVZB 1FFHA 1IXSB 2ANCA 2AXNA 2IYTA 4B33A 4EPTA 4P33A 1W2GA 3B1WA 3U6BA 1LTQA 1HYQA 5JS8A 1EG7A 1UBFA 1ZM3A 2X2EA 2GXSA 2R44A 3NTNA 4U02A 4GZLA 1PZNA 3QPVA 2BBSA 1UF9A 2RGCA 2FA9A 3Q85A 3CNNA 2F7SA 1KI2A 2QM7A 4M4SA 5AK0A 4ZV4A 1E0KA 4L9WA 3OEEA 1IY0A 3EZFA 1Z3IX 1U98A 3I92A 4DLRA 3CX7A 1JQLB 4OK6A 5APSA 4TMXA 1VG8A 5C1BA 2O8CB 1UBGA 4NH0A 4QFMA 1MO4A 4HUTA 4DSTA 3AB3A 1NN0A 2O0HA 1E9SA 4G5QA 1E3MA 4O0MA 5GADl 2QN6A 3CX8A 4N3NA 4A6PA 3BB4A 1S1CA 4QGAA 1HURA 3QF7A 3ADBA 4AYXA 2OFWA 4DSOA 3CO5A 4B44A 1M7HA 5LD2B 2PJZA 2GCOB 1XCPA 1ZCBA 2IHBA 3WRYC 3L43A 4OQMA 1UM8A 4I2LC 2NGRA 3M1IA 4DDWA 3U44A 3THXA 1G8YA 2X1VA 3QEJA 1KJZA 2CE7A 1UAAA 3HJNA 2LFRA 1XTJA 1S0UA 2FFQA 3HPRA 3R20A 1GNQA 4RD0A 1Q1BA 2BWJA 4OQFA 4I5SA 4US1R 5FBVB 3GPLA 2WKPA 3KKPA 3MLEA 2YO3A 4KSCA 1T5LA 4B76A 2ZU0C 5L3QB 4C7NB 5AVXB 1KO7A 1OB2A 4DIEA 2GK6A 2CL6X 4QPJA 2J7PD 4HB2A 5F98A 4E5UA 1KI6B 3NBZC 5EZ6B 4G01B 3UKDA 4D4KA 4M8NE 4XWOA 3TH5A 2WPRA 2JLZA 4MT8A 2C04A 5J4LA 4CEIA 1MH1A 2FPKA 3ONWA 3EZ7A 2XZPA 2G77B 3VR1A 5EXTA 4HLCA 2LKCA 4OQLA 3IR9A 3BK7A 1Z63A 5CJPA 5APWA 5EE3A 621PA 1FOEB 1F2TB 3SOPA 2V9PA 4FI3C 5KOYA 2V1UA 2YOHA 1YZUA 5FUWA 4MYHA 3LV8A 3NH9A 3CPEA 4D81A 2B7BA 2FG5A 3KXKA 3ICQB 5HE8A 2YV5A 2HXSA 4Q7KA 5FI1B 1UFQA 3QXCA 3RS2A 5JJLA 2FV8A 5AW1B 1XX6A 2JLXA 2ONKA 4IDQA 1VCNA 4M9SA 1T2KC 1YZQA 4HDQB 2W00A 4YMSA 3PUYA 1RRCA 4C3ZA 2W6JA 5G3ZA 3T5GA 3TR0A 2ZE7A 2OUKA 4O2LA 4N1AA 2B8WA 3CW2A 2IPPA 1XCMA 3TYYA 1IXRC 4Q66C 4KSBA 1N5LA 1F2UA 1R4AA 2QAGB 5L3VA 821PA 5E7IA 1Z07A 3BJIC 3TW4A 4I1OA 4Q4JB 2GTPA 2FEMA 2ZRJA 2FNAA 4PSKA 4A92A 1RZ3A 1TQ6A 4IEEA 4FPPA 2VHTA 3GEHA 4D26A 4GP7A 4TMKA 3OESA 2W27A 2ZFCA 1GK4A 2O8EB 3TMKA 3QEOA 2YWHA 3E2IA 1EFCA 1X3SA 5TARA 5IK2D 3KTAA 1J2JB 3ICEA 4OI2A 2PL3A 3NXSA 5IDJA 3L35A 1Z2CA 2MSCB 3C5HA 4HDCA 5FOXA 4DRZA 1E9BA 4LHXA 1LW7A 4M9QA 3DKVA 4PQYA 1OXXK 3ZVRA 4TSFA 4GRAA 2FSIA 3OFNA 3BWDD 1X8LA 1FNMA 1AK2A 3SFZA 3EX7C 1ANKA 1E2LA 4IFEA 3NG1A 4Q7LA 4CEHB 2VBCA 2ZUDA 1GILA 1UKEA 4HLUA 3GFTA 5AVWB 4GFDA 3K09A 4LI0A 4JIMA 4B6FA 2QMOA 2ZITA 3Q7PA 4LJ9A 2CJWB 1CSBA 1JJ7A 4XOIA 4HUQB 4LJ8A 2SHKA 3DHWC 5JMTA 1VCOA 3UPUA 4LZZA 4B2LA 4B6EA 1NIJA 2ANBA 4XD7A 4QKQA 4ESVA 2HCJB 4PO1A 3PCRB 1OIVA 1WCV1 2ODWA 2P6NA 1TAGA 1F60A 3T97A 3FMOB 1YR7A 1CJKC 4E07A 1ESMA 3FB4A 4KYUA 4RD3A 2QM8A 1UPTA 2R32A 4EPWA 3TLXA 2P2LA 2BKUA 3V5BA 3FTQA 2Q3IA 1E2FA 1Z2AA 5L3RA 2QT1A 4Z1MD 1U99A 5EP1A 3B1VA 1SVWA 3P4YA 3SU8A 5IF9A 2O8BA 1EGAA 2PZFA 1E2IA 4KYIB 1NP6A 3CF6R 3ZZUA 4TL6A 2OEPA 1JNMA 1XMIA 4BFXA 1C1YA 1OV4A 4KO8A 4UXJA 3T1QA 3N70A 2FOLA 2XJ4A 4LJAA 1RVDA 3TVDA 5FTJA 4Z51A 4TZ6A 2RHDA 2Q9AA 3SJZA 3WYAA 5JBQA 3CUEF 1AS3A 2GAOA 4Q4HB 2AK3A 3AV0B 2D7DA 4PC2A 1HUCA 2VSFA 121PA 1KAGA 2VP9A 3EA5A 4QC2A 2R8RA 3ZGXA 2W2TA 2PCJA 1KSHA 3UWKA 5DH9A 3VR4A 1U9IA 5SZKB 1GIAA 1GSIA 1OH5A 1VHTA 5FTLA 4TQ9A 2YHSA 3U7EB 3ZZTA 4ZIRB 2HT1A 2GF9A 2WAXA 2IHYA 2ORWA 2D7CA 3LWNA 2GNOA 2J5XA 5JJKA 1PUJA 1ZD1A 2C77A 3KB2A 3L0IB 3M9HA 1SVMA 2DFKB 2RGAA 3LH5A 5LB4A 2ODEA 3X1XA 2P6UA 3GLIA 1EWRA 1S1MA 5EUMA 1CKEA 2GF0A 3MRSA 1E9CA 4YDHB 1KSFX 4B2IA 2C96A 4Q01A 1CP2A 1SKYE 1W5TA 3SBEA 1UBCA 2NOAA 3B78A 4MRVA 4PAOA 4Q1FA 3RANA 3FOZA 4DLUA 3CB4A 3TQFA 3EIEA 2QMHA 1Z6XA 3B9QA 1V43A 3PQCA 4JL8A 4A2WA 5KDOA 3TSWA 1DARA 3BORA 2EYUA 3CKLA 5JWHA 3U3KA 3X2SA 2HLDD 1Q1ZA 2R65A 1QVAA 3RABA 3AF1A 1VMAA 2VHCA 3GLHE 4R7ZA 1XD8A 3RSOA 2IF0A 3U4QB 3K70B 3TJZA 2DBYA 3U2QA 3SS8A 1A02J 3KQNA 3V4RA 1E9DA 3C16C 4ON9A 1X8YA 1KI4A 3IKJA 3GLHA 4OJQA 1Z06A 1NKSA 3EZ9A 4DSUA 4QM7A 3U44B 4KITB 3THXB 2ZIAA 2C9NY 2Z4RA 1IHUA 5APTA 3EIHA 1CBUA 4KFSA 2OZEA 1W48A 3V00A 1SXJE 3C41J 4YMWA 5F9FA 3I5YA 4BRUA 1NG9A 5H68A 4B2PA 5AJXA 2V6IA 4UKDA 4RESB 2RGBA 1T0JB 1IN6A 1R10A 2O52A 2FGKA 3VHLB 1IQPA 1VYTA 3DOFA 4WIAA 1Q22A 1DAMA 2K5UA 3FKSA 5CDFA 3AVPA 4M2LA 3NFQA 1I2MA 2XNDA 1NAFA 2UZIR 2WKRA 3CPJB 1A02F 4A0HA 4ZDWA 4HB4A 2JJ8A 2KI5A 3B6EA 1DEKA 1GZSA 2ZREA 1KSGA 2W0MA 1XXHE 1UDXA 4B35A 3DDCA 4NYIR 3TSOA 4CEIB 3BB3A 3THOA 3CWQA 1R7RA 4A2QA 1S3GA 1MO3A 1T91A 4NU0A 3VMZA 4K8OA 1XXHA 3QXJA 4GKGA 1MRSA 3IO5A 3FWYA 3IILA 5BYKA 2ZRMA 5GJVC 4A2PA 2JJ2D 2ZI6A 5KO2A 4MA4A 4W5WA 3A6PC 1CJTC 2FPLA 4KP4A 2IYZA 4IJMA 3RWOA 2ZRGA 3BGWA 1N6RA 2XOKD 1QDEA 1ZUHA 3FDIA 5SZJA 3AKCA 2D2EA 2XITA 4OKSA 1FMLA 2BDTA 2CEAA 3BH0A 4GMDA 4RCZA 3U3JA 1Z6GA 2OM2A 2ZJ5A 4LSGA 5APVA 421PA 3MCAA 2Z4SA 2QT0A 1SXJC 2ZRBA 5CM9C 5DNYB 3EPHA 1VYVA 1GRRA 3VR6A 1VG1A 3CH4B 1P3JA 3SQWA 4XSGA 4JMPA 4M22A 4PHTA 4MDEA 1CZQA 2YVUA 2A5FA 1F2UB 3HU2A 3TK1A 1YJ5A 3PEVA 2C9LY 2KJQA 5K8IA 4PPQA 3ZZ0A 2GEVA 4A82A 1HTWA 3ZS9A 2QENA 1AN0A 4A8JC 3A37A 3L0OA 4GP6A 2DY1A 3UG6A 3NHAA 5F2EA 8OHMA 2JLRA 3OE7D 1G8PA 2J45A 4KVAA 5EQTA 2FWRA 4EPRA 1D2MA 1OH7A 2Q3MA 2V4ZA 4ZDIA 1WXQA 2PX0A 3ZIAD 3WBKA 5E7JA 2C2HA 4GNKA 5KSZA 3A0RA 3KTAB 221PA 1UKYA 2BJVA 1RYHA 2GZDA 3ZRXA 2WT7A 1U8ZA 3IHWA 4GI7A 2XSZD 1G3QA 1NN3A 3BBPA 2OFXA 1G16A 1Y3AA 2ZI5A 3KKMA 2V7QA 3TVTA 2VP6A 3K0EA 1ZD9A 4ABYA 1Z08A 2OBLA 1T4GA 4X8LA 4OK3A 1OXUA 1YE8A 2GESA 4QNRA 3NWJA 1G20E 5CK4A 1G6OA 3OF5A 2WTUA 3NVAA 4BASA 3ND8A 3QG5A 3PJRA 3IQWA 5HCNA 3CZPA 3KKNA 4QHYA 3B1ZA 1LF5A 3TNUA 1DOAA 2NQ2C 4MRNA 1TL7C 1Q12A 4DIDA 1G7TA 1II9A 1OIWA 1VCIA 1XZQA 2RGEA 2ZANA 1E98A 5FOSA 5AW4B 2ZSDA 1HQYE 1GVNB 1TX4B 2Z6VA 3LQQA 4IW3B 4URWR 5G41A 3MAAC 2QNRA 4CW7A 4E09A 3EPLA 2ZVQX 4KVGA 4QJ4A 1SHKA 1W0KA 2GBLA 2PLFA 2VH5R 2VEDA 1QHHA 2JLVA 2GCOA 4DLXA 1ZVQA 2QMEA 3VFDA 1O87A 2G0NA 2IBMA 4PSAA 5FPKA 4ZCMA 4Y0AA 1JNYA 1W1WA 1CLUA 2WBLC 4JLPA 1TTTA 2KE5A 3TAHA 2RMKA 2XU6A 2QGZA 1IOZA 1N6HA 2R6AA 2DWQA 1XMJA 3PENA 1SULA 2JDIA 5D3MA 2O0KA 2R6FA 4CIDA 4TYWA 5FBQB 2O8BB 1GNPA 1ETUA 2CHVA 4BFYA 2QROA 2Z0MA 4WA7A 5JFGA 4M0LA 5JHHB 3VN0A 1XEXA 2J3EA 2PX3A 4PC7A 4RZ2A 2IS4A 4NZYA 4PQFA 2VL7A 2BCGY 1G5PA 3UK6A 2IYRA 4Q02A 1ZM7A 2CK3A 4BFSA 1E69A 2D74A 2G1KA 3IHLA 1OFTA 3DO6A 5DSZA 5BQ5A 2QGNA 4BFTA 4JLJA 4Z54A 2ZQ5A 3CLVA 4LBYA 1E9FA 3OAAA 2GA8A 2ZE8A 1MRNA 4OJKA 3C8UA 2LFSA 5FUYA 5SZIA 1XD2B 1NBME 1G7CA 3QENA 1R5NA 1ZM9A 2A5YB 1S2MA 1MFZA 3GJ7A 1XNJA 3TNFA 3ND9A 3GLFE 1Z0FA 1IXMA 4KJZA 4JBWA 4ACBA 4JYBA 1F48A 4AKIA 2MMGA 3DOEA 2NO1A 4QJ3A 3X1ZA 5J4YA 4US0R 3A58B 3GLFA 2VHUA 1YR8A 1Z28A 1R0XA 2AFIE 3PUWA 1G1MA 5DI9A 1Z5ZA 2XB4A 4O3MA 4NBSA 4PANA 2FU5C 4QGFA 3QPWA 3X1DA 3H2YA 2BOVA 3LBNA 2Q7CA 4B3FX 2A30A 4FXPA 1TU4A 1R8SA 2EQBA 3AUYA 4C0HA 4B47A 4EPXA 3HYRA 3IIKA 1ZYUA 2EU8A 2RGNC 2ZAOA 4NCIA 1CJMA 1GZLA 1JI0A 4Q5IA 3FFBA 3B85A 1VTKA 4A0GA 2QAGA 1AS2A 4JJZA 3KQHA 1CS4C 1E79D 3W5IA 1KK2A 5DLQC 3QKRA 4Q4LA 5G3YA 5EP4A 3VQTA 2C03A 1U81A 4JSYA 4EAQA 5D3QA 4I6MC 1SKYB 3KXIA 4R98A 2ORIA 4U5XA 5CIWA 3KZ1E 1AQUA 1BKDR 1TADA 4EOTA 4KCGA 4CT5A 1L7VC 1GU5A 1M2OB 1XJ0A 4TLBA 1XTIA 1LS6A 1T3SA 2CXXA 2ZYUX 3UXMA 2YYZA 1Z8FA 1H8HD 1T8TA 2QE7A 3WHKA 4B73A 3GLHB 4LJ4A 1AA9A 2BM0A 2P6RA 1VG9B 2GJAA 3KQKA 2RGGA 4CDGA 2VRWA 3QBTA 5SZHB 3VMXA 5FR1A 4NKRA 4ZDJA 1MT0A 3CRRA 4RKEA 1ODFA 1N3BA 1VG0B 2O8DA 2WWFA 4C9BA 4BGDA 1SXJB 1NSFA 3CH5A 3F3YA 2XZOA 1NVVR 4HUQA 5HKKA 3EAQA 4BFVA 2AD5A 1NMYA 3DVLA 4PPNA 2FPMA 5B2ZA 1NI3A 1Q21A 3EZ6A 1S9DA 4DEYA 1E2EA 1TUEA 1OKKD 3VU9A 4JS0A 4YLGA 1DO2A 1M8PA 3TGPA 4LOAA 3J81k 3R8CA 4DLSA 4NCHA 1VCMA 3GFPA 1H8EA 1Z0JA 1DE0A 1OIXA 2WICA 1H88A 1WA5A 3VHXA 1EK0A 2IYXA 1XXHB 4MGYR 2WKQA 1G3UA 1E2DA 1NVUQ 2WMOB 2O5VA 2OCAA 3HR8A 2XV5A 1C9KA 3B82A 2CL0X 1OHHD 2DWOA 2ZETA 3F8TA 4J0QA 4QJ5A 1A5TA 5FPSA 2VHQA 4D80A 3U5ZB 5KNDA 1JAHA 1P4SA 2WPDA 3KX2A 4EUNA 5AJWA 2OSBA 1G3MA 4Y0VA 1E4YA 1U8AA 2GJ8A 1NY5A 1N6IA 2OT3B 4PC6A 1NG1A 3DPUA 1SVKA 1IY1A 2DYKA 4KFUA 2VO1A 2RAPA 1D8TA 2HYDA 3KB1A 3NH6A 4FD2A 4LC0A 4Q1AA 4F4CA 4AYCA 1OPXA 5KNCA 1OXZA 1VPLA 1UKZA 1IO4A 2PEYA 3RVBA 1E1QA 2VP2A 4ASUA 1ZCAA 2BMEA 5KNBA 2WWYA 4DB4A 1WBBA 4PPGA 3A4MA 5EE9A 1AZTA 4Q00A 4QBHA 1JPJA 1BIFA 3K9GA 3T5DA 2WPQA 2JAQA 3ASYA 3CBQA 1OFUX 1IAQA 4MGZR 3TUIC 5AVVB 4NHOA 3RRMA 5J4HA 4GDFA 1KKMA 4K46A 3O8ZA 1EFRD 4K81B 1KNQA 2CNWD 4OL0A 2ZRAA 4KBFA 3WMGA 3B1XA 5FPTA 1GOTA 1EESA 2QSYA 3LDAA 3NIBA 3M0DA 2WT7B 2ZR9A 4B3DA 2OAP1 1W36C 4IXNA 4TN1A 2JCSA 3K1JA 1TQ2A 2JIZA 3GCGA 3LNCA 5JEDA 1M34E 4KAXA 4A4DA 2XTNA 3D8BA 5DN6D 2JLUA 3HP1A 4ZCLA 2WSSA 4G5GA 5FOWA 4D4JA 2H92A 3N2IA 1KDOA 3NBYC 2I3BA 2GCPA 4MYTA 4TMZA 1VHLA 1FMJA 2CCKA 1FPMA 2QMUA 1GUAA 3T35A 4V0KA 3EPKA 4WW0A 2JJ1D 1OB5A 3LA6A 4AKHA 4BIZA 4YXWA 1EFTA 1OH8A 3LIEA 2GDJA 4DC9A 4IVPA 3GJXC 3TNUB 4LWZA 4TTRA 3R9XA 3KDPB 2BMJA 2ZJBA 1GKIA 1XTRA 1G41A 1PUIA 4GOJA 3WBJA 3U4QA 1QG4A 2R2AA 5CMZA 4Q21A 3B2EA 2CL7X 5BWMA 1KDRA 2WTYA 1KNXA 5AVUB 1QHHB 4X8MA 4XVUA 3EXAA 4R2IA 2XEXA 3R9IA 3UIEA 2H57A 1W7AA 2B21A 1S9HA 4KU4A 5JZVA 1PV4A 1WB9A 1HE1C 2J7PA 1ZM2A 4JL5A 1XWIA 1AM4D 2BBTA 4PZZA 4ZKDA 5AVRB 2IXEA 1WQ1R 2C99A 5AW0B 2IYWA 3EPJA 1OSNA 2VP5A 1R8QA 4NTZA 5D3MB 4Q1EA 1YQTA 3GJ4A 2VSOA 1E1RD 2G88A 4KFTA 4BIUA 2Q9CA 4BLQA 4QHTA 2L0XA 1XEXB 2D2FA 4G3XA 5FI0B 3UMFA 1KO4A 4D2IA 5H70A 1IBRA 5CYOA 2GEDA 3VX3A 3PUVA 2OXRA 3AM1A 2VIIA 1FP6A 1U90A 1E94E 2A78A 3MG9A 2GJKA 2A9KA 4D82A 3K70D 3LD9A 5DO9A 5FH9A 2XXAA 3KJHA 3LY5A 1MABA 3TQCA 2UZ3A 4ZDKA 1FTNA 3B1YA 4WZBE 2KSQA 2WHXA 1U94A 5F9HA 2A5JA 2E9SA 4A15A 2CHGA 4QGGA 2JLSA 4W5HA 5C93A 2HDNB 1E2HA 1GL7A 1XEWY 2EFEB 5IRCD 4WXRA 1AQYA 1QHIA 4B74A 5TMPA 2GAAA 1AGRA 4LYJA 1OYWA 5KTYA 2ZJAA 2NO6A 4IOLA 1G5RA 4LYFA 3ADDA 4B3GA 1N6KA 4RFVA 1P2VA 5AVYB 1KK1A 1E32A 2B8TA 4LC1A 2Q0HA 4I99A 3GLFB 2OESA 3U3OA 1JAIA 3RLFA 2C5LA 1IY2A 1GAJA 1KY3A 3ZH9B 3ZRVA 4KXFB 1LS1A 1GFIA 3DKPA 5TB5A 4G5OA 3Q8XB 4R71A 1II0A 5IDVA 5AW3B 2GXQA 1KI8A 4FMCF 4DLZA 2R3CA 4KBGA 4DEXA 4QOSA 4NYJR 4FCWA 1R5BA 2GK7A 3NTUA 2ZAMA 1J8YF 1OXSC 2DFNA 3ADKA 3QKRB 4EDHA 3T12A 2P5TB 4DCSA 4EIWA 2ZRIA 1X86B 4H1UA 3RS7A 1QHYA 3SBDA 2H7VA 5BN4A 1W49A 3O8CA 2QORA 1DPFA 2WJIA 4POAA 4DKXA 4IDNA 3UG7A 4JVNA 1R6BX 4DZOA 1P61B 1U0LA 5CK5A 4C0AC 1S96A 1QHNA 2J0UA 4Q03A 3MD0A 1ESNA 3T06B 1N0UA 4JLKA 1KSJA 4FMDB 1QHXA 2X2FA 4LCBA 1M74A 2AR7A 2HYIC 2F9MA 3I1FA 1GU4A 2WPSA 2FX3A 2GHIA 3RRZA 5DYIA 3PEWA 1HBWA 1OWAA 4A36A 3BFKA 4RFSA 2QP9X 2W6JD 2FZLA 4U00A 2FZ4A 3VKGA 2IWHA 2FDCA 3DMDA 4KLNA 4JVMA 1DH3A 2ZI3A 5J4KA 2J0SA 4WZ6A 1TPZA 1AZSC 2C98A 3I5CA 1VIYA 3D31A 2IX3A 3IDQA 2O8DB 1G3RA 1FQKA 4MGKR 4V0ME 5FTNA 4V03A 4EJSC 1NLZA 2FFHA 2NMVA 2ATXA 3PVSA 2ERYA 4YC7A 1KIMA 3I32A 3A4LA 4LV5B 3NBXX 2R6GA 1ZU5A 4C46A 1E0JA 1T3HA 2F9LA 3VU9B 4GMXA 3WMEA 3AEZA 4EFMA 1HEIA 5HZHA 1W44A 3CRW1 3SJBA 1EWQA 3QF4A 5C18A 1ZNZA 2AKAB 4P32A 4LDJA 4RKFA 3RS4A 2QU8A 2P2UA 2KBFA 4FWIB 4NCJA 1BYIA 4IOMA 4Z8YA 3DL0A 3WXMA 3Q5DA 4II7A 3SDZA 1A4RA 4GOXA 3KQLA 3OFND 1QHSA 4O2RA 3DEFA 1JALA 3M9BA 5APXA 1D5CA 3EC2A 3RNLA 2XGJA 1W36B 2PMKA 5DISB 1VYUA 3REGA 3NDBB 2VP0A 2P65A 2ERXA 3SWFA 4IXMA 4JYCA 2ZU6A 1XF9A 1FTSA 1GWNA 1P7CA 3NC1C 4M1YA 4TL7A 4D25A 2ORVA 2R62A 4DCUA 1GP2A 5DE3A 3EW9A 5E95A 3AF0A 2N9BA 1FAVA 1KGDA 4RD4A 4XD7D 1NN5A 1FZQA 1BO6A 2H16A 4IEIA 1TF7A 2HUPA 1E2JA 3SYLA 2J1LA 2WMNB 2YWEA 2IWRA 3ASZA 2W83A 3AVVA 4DUGA 1XD2A 3L82B 1QVRA 4URUR 5FR2A 2ZS8A 3DM5A 1EXMA 1ZIPA 2OBNA 1Q20A 4LJYA 4OHXA 1TEVA 5KDDA 1CRPA 1X1SA 5CLQA 1H8AA 3CWZA 4KHXA 1YRAA 2GZHA 3BERA 3EIQA 3VTKA 3HTKA 5G53C 4ZPXA 3AKEA 1KJYA 4F91B 2AWNA 4LBZA 1JUNA 1DAEA 4GT1A 1W4RA 3QIAA 3QUSA 4ILEA 2IYUA 3W9YA 4U7OA 1W4CA 2WVJA 3FHCB 4F7WA 2YKGA 4Q4AA 4V0LA 4URYR 3JZAA 5AUPB 3GQBA 3ETLA 521PA 3SFVA 2F3TA 1NLYA 2DR3A 5AW9B 3TUJC 3L37A 2HLDA 4DDTA 3VKWA 4QBIA 4PO9A 1Y63A 4TMVA 3RHFA 3AP2A 2ZRKA 2XJ9A 3RRNA 2CDNA 2B6HA 4P0TA 4C2TA 3SZRA 1F51A 1S9KE 2NZJA 2PBRA 4KI0A 2CMKA 3PEYA 5JCZA 1ZUIA 2FJUA 2OCBA 3KXLA 1KDTA 3DZ8A 2JLQA 3B5JA 3SC3A 5DHAA 4TT3A 5AJVB 3LVQE 5E7MA 4DVGA 1EFUA 2PMDA 5TDHA 3S1AB 1N0VC 6Q21A 1NVVQ 4TMTA 2BV3A 2FGJA 3GJ5A 5EZ5A 3QE0A 3X1WA 3M0AA 4TZ0A 3LXXA 1DAKA 3ZLJA 2X8AA 4X8OA 4QL3A 1AGPA 2H17A 1G5TA 5JCPA 1K5DA 3R8FA 1N2CE 4F38A 1SVLA 3P8MC 3A1TA 1WBDA 3DMNA 5EP2A 2AX4A 3IIJA 3K53A 3A4NA 3SQXA 2YWFA 3AUXA 3PUXA 4WAUA 2OCPA 2ZI4A 1SXJA 4HDOB 1DO0A 3V4QA 4HYTB 2QPOA 1CF4A 3K8YA 4R2HA 4JKIA 3AVTA 1M7GA 1IJFA 3MJHA 1D9XA 3U3RA 4AQRD 3JVUA 3NEJA 2VA8A 1UKVY 2O0JA 2ZJZA 4C0LA 1W4AA 4HATA 2JJ2A 4PXAA 1S3SA 5EXSA 5HE9A 2W58A 2WWWA 4CEJA 2HF8A 1I2DA 2XXAB 4M3LA 1FOSE 1MKYA 2IUUA 4A8JA 1MABB 2YZ2A 5E3HA 5FFMA 3AVWA 4Q20A 1UJ2A 4DB2A 1G6HA 2ZYVX 4S35A 3R7WA 5AUNB 2ZXUA 1CJVC 1NJFA 2GKSA 2G1JA 1TU3A 1YHNA 3D3QA 4L16A 4NYMR 4TLEA 5AJZA 1KYIA 2ZROA 2JEOA 3FVQA 1OFHA 4M1KA 2ZYTX 3O8RA 3CX6A 1E2KA 1ZNWA 4MITA 5GJWC 4JVSB 2BMDA 2IXGA 3D36A 3FKSD 2QZ4A 3C14C 1IXZA 3QVUA 1QRAA 5CJ2A 2A5GA 2FF7A 2DFLA 2XNDD 1B0UA 4MRSA 5CB8A 1W2HA 2IS1A 4ESHA 1W0JD 2XTZA 1LV7A 4ZKEA 2VSXA 3K0FA 4HB3A 4LPKA 5FL7A 3U7FB 3IO3A 4JKYA 4GL2A 5UKDA 3PG5A 1A82A 1AS0A 4AG5A 2ZRHA 1G21E 2V55B 2QSZA 4ZKIA 3D7MA 3K0CA 2ZR0A 3LX8A 1KHTA 4D4LA 2C9YA 4D6PA 2LWIA 4L9SA 5BYJA 1T0HB 4PO8A 4OHWA 4JLOA 4HAXA 1PLKA 1FW6A 4LRWA 2F1RA 5JJIA 2IK8A 4LJ5A 2W6AA 5JRJA 4BLTA 5C4GB 2C8VA 4Q7JB 2YOFA 2W6IA 4I1VA 2NG1A 4MYCA 1CR4A 2J0UB 4M21A 1JB1A 2YOGA 1BMFD 4WXPA 1DAFA 2X77A 1NIPA 2OXCA 2IYSA 2A7QA 3ZVLA 2H7HA 2ZJOA 4HSEA 2AHOA 3CM0A 4IHQA 1Z22A 4TYQA 3IEVA 4RFSB 2Q3FA 3TRFA 1OXVA 1VDZA 3NEYA 5FBRB 1Q1QA 1EFHA 1CR0A 1SZPA 1ELOA 1ZINA 1E2NA 4MUAA 4Z8XA 1ZC3A 1P9NA 4Q9KA 3W34A 3QKUA 4GCZA 1SGWA 1KKLA 5J47A 4HB0A 4IDPA 4I4LA 4QNMA 1G19A 3F0TA 1E9AA 2X19A 1Z47A 4DCVA 2DB3A 4PTLA 3VR3A 4FIDA 3K0CC 4HLDA 2HJGA 1B23P 3BE4A 1CTQA 1VIAA 3ZJYA 4ACAA 5BN3A 2E1RA 4QG7A 1CI6A 3QJYA 3LLMA 1Z83A 3KKOA 1MV8A 2IUSA 3WYFA 4MKHA 3IBYA 1XD9A 3QF4B 2ZRNA 4CYMA 4ERNA 2G83A 2AL7A 5AR1A 1TF2A 1W5SA 1RKBA 2BHRA 3K9NA 1CJUC 1JEDA 4JL6A 2KBEA 1E6CA 1EX6A 2PEZA 5C46F 4B75A 5J4VA 4P4TA 4YONB 2UKDA 3GP8A 2QY9A 2V7QD 2ZS9A 3AGPA 1YYCA 5TVKA 1WDTA 2YNMA 2C95A 3CR7A 3E70C 5FOVA 3M91A 2BBWA 4UNRA 2JGNA 3KFVA 3QNUA 2NO7A 1T9HA 4CRWB 3C4JA 2IS2A 5AJYA 5KHOC 4QRHA 4FMBB 2ZRPA 2J59A 4HI0E 2DFTA 1N6OA 1G4AE 1IJEA 4HAWA 4LX0A 3UANA 2CHQA 1RPZA 3EWAA 2RGNA 3GJ8A 3ZVMA 1NMZA 3AVXA 3ZD6A 1N6NA 4UNSA 1XMVA 2RCNA 1E96A 1DTSA 4GSYA 3SEAA 5KYKA 2XX3A 1W0KD 1IN4A 2OV2A 1ZC4A 2I4IA 1P2TA 3RDPA 3V9PA 2NO9A 5C2JB 1N6LA 1XP8A 4LBWA 3WP1B 2MSEB 1TNDA 3M0EA 5LBIA 3OIUA 4C0SA 1JOYA 1UADA 3WNDA 2W2VA 2NTYC 3VTPC 4JLVA 4NYJQ 1WP9A 1OJLA 1KQLA 1NBMA 3QG1A 2HCBA 4PX9A 2JDID 3GLGE 4P4SA 3K0AA 4UXIA 1F6BA 3H86A 2G9NA 2YC2C 3MUFA 2QG6A 3CR8A 3U61B 4TYYA 4Q4AB 1E79A 3GLGA 3K0SA 4M1WA 2CK3D 1A2BA 2R6CA 2IEYA 5LD2C 4MUBA 4UJ5A 3V4FA 1MO5A 1G291 3QY0A 1OT3A 4LJ7A 3LW7A 3NKVA 1H8HA 4OQXA 3L0SA 1OF1A 1WE2A 2HJVA 1R0WA 3PIRA 1COWA 1Z6YA 2GILA 4BZXA 3EASA 1FP7A 3T1OA 1K6MA 4EKDA 1NJGA 2IXFA 1N5KA 2IYVA 2OLJA 2QA5A 2IT1A 4BLRA 1E9RA 3WY9A 5APUA 2AWOA 4D0LB 5AVQB 5AW8B 4W7SA 1X8KA 1L8QA 1TMKA 1CEEA 1DELA 1E2GA 1E0SA 4TYPA 2GCNA 4PAMA 3ZD7A 5APQA 4QXAA 3CRMA 3VAAA 3AP1A 4FCVA 2ZXEB 5G40A 4B34A 5A5GA 4N0EA 3PFIA 4Q9LA 1OKKA 2PLRA 2JA1A 2TMKA 3MSXA 1IN7A 2R9VA 4V02A 1I4TD 4C0JA 1SHZA 1US8A 4UJ3A 4L5BA 4IOJA 2QP4A 3RWMB 5CB6A 4AC9A 3WMFA 4MRRA 4P3YA 2BC9A 2N1BA 3THWA 1Z0AA 5ANRB 1FUKA 4YDSA 3FKQA 2OFOA 2VLIA 1ZNYA 2C2AA 5EXPA 3BH7A 3KL4A 2JATA 4JASA 4RY2A 4W5JA 1OLOA 4AKEA 4CEJB 2ZTSA 4A8JB 4I81A 3AVOA 2WAYA 3SNHA 2QE7D 5AW7B 4MKIA 4XTCS 4LJ6A 1R0ZA 4PPFA 3R9WA 2QTHA 3IEUA 2IUTA 3A5TA 3L36A 2ATVA 3R7WB 5LPNA 3GEEA 4G5RA 4L8GA 1Q57A 4MQBA 3O47A 5JSZA 4QPKA 2NPIA 4BFZA 4F93B 4CT4B 4U7NA 3U60B 1DVRA 4JT2A 4B43A 1MR3F 2QRZA 2V6JA 3NHBA 3T61A 1HE8B 1U0HC 3OIWA 1P62B 4U7DA 3EARA 3PV0A 3OEHA 2O8FB 1XBTA 3CPHA 3WYGA 1OFIA 3BB1A 3TE6A 2GEUA 3I8SA 3E5HA 2CCGA 3OIVA 4H1VA 3K0FB 3U7GA 4FCTA 2WWIA 1U0JA 3FPAA 3GJ3A 3IPYA 4GZMA 5CLLA 4C30A 3GEIA 4TQAA 5DI3A 1E0AA 1BH2A 3LW8A 4F4JA 1JPNA 5EP3A 4D0NA 3SHWA 3KKQA 4EFNA 4XJXA 3GJ0A 4LV6A 4YMUA 3RS3A 3OAKA 4LUCA 3AKDA 3KUDA 4LHZA 2IYLD 1JR3D 4IVRA 2QQEA 3P32A 2RH5A 5CITA 5DN6A 1P75A 5JHGB 1D2EA 5B57C 1LY1A 1J7KA 5TXGA 4RD2A 1YZLA 1ZP6A 4BFUA 5IHPA 2WPDD 2BBOA 2I1VB 2WOOA 3GD7A 1XPUA 4L15A 3WP0A 4AY2A 2P0EA 1LB1B 1H65A 2HT6A 2QTVB 4HZUA 3W3ZB 3A2AA 3IQXA 1WF3A 2XZLA 2ZJ8A 1DADA 3I72A 3LXRA 3EWSA 5HTKA 2E43A 2BMFA 3A36A 3ZCCA 3DZDA 1KMHA 2EWWA 1XU4A 2AD1A 2CLCX 1E1QD 4ASUD 3VYIA 3P27A 3DM9B 4BZPA 2ECKA 1G9XA 3P20A 2B7CA 1M6NA 3LAWA 4IOKA 2EW1A 1E2QA 4BEJA 3B8HA 1IN5A 2AK2A 1G8GA 2WJYA 2EFHB 4PC1A 4PR0A 4CF7A 1CI6B 5L8VA 2KP8A 1G18A 3V4WA 4BECA 2ZJYA 1MOZA 3S1AA 4ARZB 1CRQA 3UMRA 3HE5A 1II8A 3PXGA 2BVNA 4RJLA 4FMTA 1AKEA 1OXTA 3JZMA 3KJEA 1E1RA 1RYFA 2JIZD 1RW4A 3BAFA 4NYIQ 2XTMA 1NMXA 1YR6A 4URZR 5LDDC 1G7RA 1XZPA 1KO1A 2WSSD 4JJKA 3O8DA 1KAOA 2J0VA 1P2SA 2QUZA 4Q7MB 2PZEA 4F92B 1FL9A 3OEED 5FPYA 1XEWX 3HR7A 4TMWA 3HWSA 1X6VA 3SI7A 2WJHA 4BPBA 2JJLA 1QZXA 1RRPA 4G5SA 4B3BA 4NL4H 4YXWD 4NYMQ 1NSTA 2ZE5A 3U7HB 2G0TA 1JXMA 3GMTA 4AG6A 4MYUA 4BLOA 3IBGA 2QBYB 3BD9A 5AUQA 4A9AA 5BN5A 1ONBA 5KSPA 2GXAA 2ZI7A 4OHZA 1XCGB 4WZAE 3RAPR 4FMCB 3AF3A 1GKYA 1W4BA 3QQ5A 3VR5A 2RKOA 1Q44A 1WRBA 1H89A 1NN1A 2IL1A 3CRVA 4LHYA 3N2EA 3CNLA 3QBVA 2ODNA 2ZSBA 3RC3A 5EJEA 3Q5EA 1IM2A 1KJWA 4WOPA 4A0RA 4UNQA 2FSGA 2WIBA 1YVDA 3K0AB 3KDSE 1Q1EA 4P4SB 3UIAA 1T2KD 2FEOA 3MWYW 4XWKA 4DJTA 1TF5A 3ZYCA 2C78A 2R5DA 3TKLA 1G17A 3K70C 4TTQA 2WJVA 3TW8B 5FOTA 3GLGB 3OHMA 3FGNA 3AF4A 4MKFA 3TBKA 3QKSA 1ZJ6A 2A3RA 2G3YA 1HQCA 1P9RA 4EJSA 4JLAA 3KJIA 4NP6A 1XDBA 2OBMA 2Q9BA 2F3RA 2QL6A 3EA0A 1G2CB 3P4XA 5TY0A 3BC1A 2KB0A 1JBKA 5B64A 2CBZA 5IK2A 1XMSA 3ECCA 2E42A 3NDPA 3KQUA 3I3SR 2ZRFA 3CRQA 4ZO4A 3P7KA 2D06A 4PQRA 4YMVA 1MV5A 1G8HA 1DS6A 4M9XA 3T1TA 1XTQA 1N0WA 1Z0IA 4RD1A 4Q9HA 5CYPA 1K8RA 2FMXA 5DIFA 5FOUA 3LVRE 2HXYA 2AKYA 3HU3A 1YU9A 1D6JA 1RJ9A 1T6NA 4NONA 1CU1A 2YO2A 1YZTA 4ZI3A 2GXUA 4DLWA 3B9PA 1O3YA 1GK6A 3BFXA 4XVRA 3ADCA 3QSYA 2BASA 3NMDA 4ZI2A 2OG2A 1DG1G 1MO6A 4Q47A 1M1YE 1ZMXA 1OE0A 3MGCA 2ONJA 1CULC 1US8B 3W8RA 2GETA 1JQJC 1CIPA 5B1OA 3OZXA 3I8XA 1ZU4A 5JRZA 5J5CA 1A7JA 3THWB 4PZLA 2PJRA 4OK5A 1XPOA 4CVNA 1E99A 2H5EA 4V0MA 4LPSA 2JASA 4CGZA 3T15A 5BW8A 2EFGA 2QRNA 2QPAA 4NPHA 4Z1MA 4AKGA 1G3IA 1GNRA 4RZ3A 4QBFA 5JEEA 1KTVA 3H84A 5BXQC 4OBEA 5JECA 2CVFA 2EWVA 4E22A 4Q1BA 2JLYA 4XTRA 5AW5B 5FTKA 2ZUBA 3I5XA 4JLMA 5EE1A 3MMPA 3IGFA 3O8BA 4JBYA 4TSFD 4JLBA 5JSZB 3VKHA 4PHFA 1EX7A 3VNVA 1KO8A 1Q0UA 1SVOA 3WNCA 4BFWA 4BLSA 4F4IA 3L8ZA 5HR5A 2V1XA 4C0BA 3L8YA 4TQUS 1KI1A 2REOA 3UATA 4C7OA 2WWXA 1P72A 2PH1A 4M1SA 3QXHA 5APYA 4IDOA 3ZQ6A 1XTSA 4FMDF 1PLLA 4R9UC 1AJEA 5LB2A 4IFBA 3FFAA 2RB4A 3CF0A 4OI4A 4RD6A
chains in the Genus database with same CATH superfamily
2FFDB 2RN0A 5DYWA 4JYPA 1NQVA 2J46A 1DC6A 3M4YA 1T24A 1ZKMA 2R8BA 5JAZA 3ZBQA 1Z5VA 5CXSA 3H65A 4D3YA 3M5PA 3GFGA 5E6UA 1SVSA 3B8MA 1XZIA 4GOKA 4ITRC 1PUXA 5EK0A 1Y1QA 2VC2B 1XFAA 3BFJA 2JAUA 4WCFA 3PUJA 1LZKA 3G9ZA 3TNJA 1TK2A 5GZ3A 4CMAA 1Y1PA 1Y8RA 2A9OA 1RWPA 1ZVJA 5FTMA 3AFOA 3L70E 2VXBA 1VQ4V 1DBRA 1AVOA 2ZYWX 1TJ4A 3PJFA 2V5AA 1MOFA 2YWGA 3QE2A 2RDCA 2O3SA 4X1IA 2A14A 4HEQA 1HPLA 4I6GA 4PGGA 5EJ4A 3G8AA 3FI9A 5I4BA 2GVZC 1N5IA 3NPMA 5JS1A 1Y9DA 3C24A 2NSHA 1MJFA 3FE2A 3V6LA 5JJBA 1G8AA 3O38A 4URFA 2O01H 4E6PA 4B6GA 4YAGA 3QOFA 2H4ZA 3BIWA 5DGTA 5EJAA 1DIHA 3RVZA 3MFYA 4WLOA 4HK4A 4TM7A 4NHEA 1RQNA 5BOSB 2AZ0A 1VLVA 1S5HC 1ODSA 4YWJA 1RIFA 1RWXA 1XO1A 1E3SA 1BX0A 3VC2A 2VUSA 1ZVKA 2L35A 2RK4A 2VWGA 3PFKA 1JYEA 2YFQA 3I73A 4QM6A 4ES6A 1UQTA 1YRBA 1NZ6A 4BN0A 4HQRA 1I3LA 3L0PA 4E2WA 2P9GA 2NTNA 1G64A 5HFJA 1NUQA 5I7UA 2OWOA 4HUJA 2JA2A 2FXOA 1PNTA 4JDPA 4AI8A 1JY2P 1K8ZB 1YOVB 4RPLA 2O2CA 2G0AA 2CXPA 1FNSA 4JYMA 2M32A 3BGVA 4L4UA 2CLDX 1QIGA 5EHNA 1PPJH 1H5QA 4CUJA 3W8NA 1EDDA 3G59A 2NXJA 2WKSA 3WK7A 3V46A 3R9KA 3B51X 1Z6TA 1E77A 1ZIOA 2FUEA 4HAVA 3RBXA 4HYYA 1Y3IA 1GRCA 3PL1A 3PFCA 1HGZA 2FSFA 4A8TA 4EABA 4G1FA 4UNPA 1WZ2A 2DERA 3LXUX 3RF7A 4POOA 3SICE 5C4MA 1C3OA 2BZSA 5LQAA 1L2TA 1D2GA 1SBYA 3O84A 4IQGA 3QVLA 4CIVA 2E82A 3A3YB 4LDAA 1VXOA 2H1IA 1UXGA 1IONA 1DIAA 1U0EA 4M46A 1ZS9A 3W6NA 2NPFA 3LDFA 2NM0A 3EEFA 1U96A 5K8UA 4EX7A 2O19A 3HB5X 3LBHA 4FLWA 4KIGA 4MK4A 5BR8O 1FAFA 1N86A 1UPFA 3T0FA 1YZNA 1K5SA 2J0QA 3TQQA 4H4DA 2O8NA 2JF0A 2ZUCA 4BZZA 4HRYA 4LEIA 3D2CA 4BEWA 1NJ1A 4PWYA 4R2XA 1F3OA 4J7ZA 5THKA 5ILOA 4PFSA 3KM0A 1UPXA 4C4OA 3ZBUA 4C2AA 1COWD 3L18A 1HJBA 3C0KA 4NSNA 1J2RA 5LBQA 5J40A 4WKGA 1WPRA 3V7NA 4ZCIA 3ZWDA 4DCMA 4HL6A 1RRVA 3NZEA 5EQJB 4KMOA 3LO5A 4KREA 1QH8B 2GERA 5CA3A 4AYTA 5FJJA 1SIUA 3T94A 1E1KA 1UQUA 3BF8A 3PQEA 3FTEA 1HDIA 4RPIA 1VQ8P 5M04A 4B7EA 2H4WA 5JROA 1KOFA 1UBKS 4EI7A 5CG1A 1L2PA 2JS5A 5ITZA 3CV3A 3NLLA 4ENPA 1F5NA 4P36A 2AN9A 5PNTA 4HAMA 5I9SA 1J1DC 1NVTA 4FX5A 3MWDA 4BB9A 5MHTA 1GL2B 2XAUA 5GVSA 1WMDA 2XLBA 1DDOA 1NJ5A 3BIOA 4X45A 3U7JA 1DKQA 4EKNB 2IYTA 2L19A 2OO3A 2K1AA 2V7BA 1E6WA 3EG9B 1J24A 1UF9A 3PSHA 4M4SA 2W4QA 1YJXA 4GW3A 3UMGA 4HUTA 2GRAA 2VTVA 1XHXA 3LC7O 4QUAA 3MCVA 4DSOA 4IL6Z 4GGPA 2J3LA 3RF6A 1Q43A 3M33A 3N7AA 2CE4A 2NGRA 2COKA 1BXKA 3O4GA 4J3FA 4R0MA 2LFRA 1VP3A 4H6PA 4OQFA 1TJYA 1ZUWA 4US1R 1T5LA 4BIIA 2GK6A 2PZAA 3IR6A 3UKDA 2WPRA 1DKPA 5J4LA 2NTVA 1BCCE 5KJ6A 1NLUA 3KUUA 2H2DA 2PRYA 4WFFA 1RM5A 621PA 2WK1A 1P49A 3NH9A 4AULA 2VZ8A 5A1TA 5HE8A 2ZXWB 2HXSA 1ZLZA 1KXJA 4BKUA 4W5RA 1IFNA 3PUYA 3GRKA 2AFRA 3O6QA 2DY0A 3T5GA 4QZVA 3CW2A 2CWDA 2R8OA 2HR1A 3A9WA 1FS0G 2MSLA 3H18A 2IIPA 3OESA 5J58A 3AE2C 5IK2D 4MTLA 3B6KA 1Q8IA 5IDJA 3ZVRA 1NHWA 3E86A 5I7FA 1HR0B 2AMJA 1RSZA 2XXJA 2CJWB 3QLVC 4CKYA 2NU9B 3CRZA 5LJIA 4GOOD 4ZU3A 1HQKA 3NNSA 4GLFA 1T15A 1KIAA 4MX8A 3BHMA 5CVUA 4O63O 2P2LA 5FORA 1L7OA 3CJQA 3TZHA 3WZ2A 1YTUA 1C1YA 4X1KA 2OD9A 1JAXA 4GZRB 3VA7A 4XB2A 4H60A 5TNXA 3UWKA 5AKZA 4EL0A 3QU9A 1CUVA 3SDBA 3ZZTA 2GF9A 2WAXA 1JU9A 2REQB 3FPFA 2GZ1A 1I6WA 1NTKG 4TXLA 3PGLA 3T99A 3WKDA 1OASA 1UBCA 4Q1FA 4QEKA 2V7XA 3B9QA 2K6GA 2R65A 3IBSA 2P3LA 2VP3A 1Z2GA 1Q6IA 4GICA 2ZYSA 1ZI6A 3HKDB 1O89A 5DJTB 1A9YA 4R1SA 1NTKJ 2EKDA 4B2PA 4F2WA 1CUFA 3IJ5A 2NPSB 4G0MA 2K5UA 4M2LA 1NAFA 3G0OA 2Y1FA 4ZDWA 1GXSA 4LXTA 3EVTA 1GKLA 3HXMA 3CVUA 4DCJA 2OK7A 3DFKA 3FWYA 4RY8A 1ZITA 2BFBA 4M0FA 4KXLA 1H5NA 4IJMA 3BGWA 1QYWA 4AS1A 2D2EA 4UW9A 2XITA 2Y1KA 4WOCA 2B1JA 4G0VA 1EGMB 1Z6GA 4LSGA 2N0SA 2Z4SA 1YB6A 1SXJC 2YKOA 2CJPA 3U19A 1VG1A 3NB0A 3QXGA 4JB3A 4TSRA 5B5EE 3VR2D 3PEVA 5JVDB 5COAA 2OYCA 1ZONA 1YUBA 4A8JC 3UG6A 3N5KA 1WXDA 1G8PA 3OPMA 4RV4A 3CY6A 2RHJA 3CJHB 4LWQA 4Z4GA 1UKYA 3ZRXA 4GX2A 2QTBA 2I99A 2QX6A 1JG6A 3GMIA 1CPYA 3KKKA 4X8LA 2JIQA 1WNSA 1LI7A 4ZQBA 4A3SA 3L7YA 3B1ZA 2VNIA 2O7QA 2F4NA 5AVKA 2ZSDA 4WMLA 1Y3HA 2Z6VA 2XTJA 5G41A 4QJ4A 3ED5A 3PNOA 4RL6A 2R1ZA 1AI4A 3KCQA 3ZKAA 4NX2A 5B6JA 2JBWA 1M10A 1KQSO 3I2YX 2PNJA 1ROPA 3O4FA 2CFRA 4JYZA 2GFQA 3RIMA 5KTMA 1I33A 1HI9A 2PGNA 4AJJA 3IP9A 1OGIA 3RREA 3F90A 3WWCA 1MRNA 1P1RA 4ZJUA 1WHSA 1QORA 3A2KA 4EO7A 3I5DA 4NV1A 1DJQA 1H2BA 1IHPA 3U5TA 1U80A 1ZJJA 4WADA 4UTZA 4O3MA 1N7JA 4NBSA 3GL9A 2YXEA 1G8MA 1ZYUA 3OU6A 3JAWA 3N87A 2R72A 4LSWA 2EIHA 3HI6A 3FIUA 4WCDA 3GVHA 1PIWA 1XJ0A 2YYZA 2XGSA 5GM1A 4LRTB 4RGVA 4Y2QA 2OD7A 2BAGA 3QBTA 3I9V6 4JA2A 3BICA 4DNOA 3WQRA 1W0JG 2X15A 3OTWA 2M6YA 4BGDA 1C3JA 1C4WA 2GPBA 5FNVA 3WX0A 1FP4B 3OI7A 1Z33A 1DJMA 3HLKA 5A6VA 4XDLA 5LXTB 2PS0A 4JI7B 2F95B 4UD6A 4J0QA 5HQ3A 1P4SA 3RVMA 3JV7A 3VTZA 5CN0A 1K0UA 1VLJA 4UARA 3GY0A 4K26A 1SVKA 1X7ZB 2UVPA 3WJ7A 4E12A 1VF7A 3OMIB 4QBHA 3DF9A 2EJCA 1BIFA 2YL2A 3OZBA 1V8BA 2IY8A 3ZLUA 1PT7A 5J4HA 1Q0SA 4UVBA 1QGUA 2GHTA 1CVLA 1NW6A 4OL0A 3ROMA 1SKBA 3NIBA 2WT7B 1NVPB 3LGXA 4TN1A 1WTCA 3PC6A 3LNCA 4B3MB 4MS4B 3CXHD 5JNSA 2WSSA 3PXUA 4MYTA 3GF7A 3NHPA 1VPCA 1GUAA 3RU9A 2Q67A 4ZODA 1OB5A 4LWZA 1KQPA 2BISA 1BD4A 3U4QA 1KMIZ 3V2QA 1JLMA 5PGMA 3FNIA 3DV9A 1R4MB 4NS4A 3QE4A 3C48A 3ELWA 2ZUWA 4NLLA 1K8AW 3AE6C 3C6ZA 3H2ZA 5AW0B 4CF3A 3T1NA 4Q1EA 2BOBC 1N8NA 3JZIA 1E1RD 1I0IA 2C4VA 5B7NA 2VHYA 1U90A 3ONFA 3KJHA 1PG5A 4MUIA 4YT4A 4RIHA 1Q2XA 2GZRA 3A0BZ 2HDNB 2AGAA 3RSFA 1XHLA 2GAAA 3L71E 3FCOA 5K3SA 3KJQA 2NO6A 2WHPA 1Z3CA 2QM4A 1BE3G 2OXFA 3K05A 1TJ5A 4LVUA 1KK1A 4B3GA 1E32A 1ITZA 4YCAA 5KTPA 1HDOA 3NBMA 4F96A 4Z4EA 1L7AA 4XB6B 3AIKA 1KEEB 1D07A 5ELMA 2OQIA 2R7MA 1F6DA 1QP4A 3RS7A 3FM9A 4KR0A 1U7WA 3AYZB 2AJDA 1NU8A 4B4WA 1HDXA 1U5AA 2XI4A 1KSJA 1BE3J 4F5DA 4FJ0A 1DD3A 2GHIA 4E70A 4GUNA 3R0QA 4RADA 4A36A 3FSGA 2ZDIC 4ZGWA 4J91A 2IWHA 1TM7E 4DA6A 1GTRA 2WILA 4Q3AA 4QOEA 1J1DB 4JYYA 3KYBA 3DCYA 2Y69C 2EJUA 1HEIA 1F4NA 4BO9A 3EDOA 1BFKA 4C4SA 3C3TA 3HMQA 2FYNB 5EFZA 1E2BA 4ETMA 3HEAA 3RNLA 2XGJA 2G5GX 2PMKA 2A0WA 1WD7A 4DV7B 4IXMA 3S2FA 1ZV8A 4WZZA 1GP2A 5DE3A 3U0VA 3WLJA 4NESA 3PNBA 1HG0A 1SK9A 3I83A 2J6BA 3KYIB 3DM5A 1Y34E 1XL1A 3M6UA 4LJYA 3DA8A 3VTKA 4IHKA 5G1OA 4S04A 2IEDA 4KIWA 2ZIXB 3FTFA 2WVJA 4Q4AA 4V0LA 3JZAA 4RKUJ 2DR3A 1NPTO 2E76C 3GK3A 2XJ9A 4OG2A 2D1SA 2X5KO 4P0TA 5KA6A 4QD3A 5KX5A 3ROPA 1L5SA 3IXLA 2GN0A 5EJ9A 2AG8A 3R3YA 2VJCA 6Q21A 5AVQA 1S77D 3P0HA 4IIHA 4CTJA 2X1HA 2H17A 4TUYA 1XN1A 1NGSA 2PGOA 4K8ZA 3A1TA 3KCYA 4W7ZA 4ZOEA 3FB6C 1CY1A 5IBCA 1N2CA 4RH0A 2KM1A 1RE3A 3BL6A 5IHXA 1GZVA 3NEJA 4Y0NA 4ZVLA 1J9EA 5EXSA 4PXAA 3WQQA 1FZTA 4RV9A 1RKUA 1CQJB 2OV3A 3A6KA 2XIQA 3E8XA 1MQSA 3DHVA 4RAIA 1Z38A 2BFNA 3DGEC 2Z8XA 4BDSA 3QVUA 4LRYA 2DFLA 4P08A 3F7TA 1F7UA 3BD7A 1VRCA 2FMFA 1JIIA 3HSKA 3OH8A 3K96A 1AG9A 3O65A 4DPLA 5AICA 3R3SA 3KKLA 1RZRA 1ZVVA 2PL1A 2NNWB 2GAIA 2VSQA 1DTEA 4TV9A 5B1YA 1EZ1A 1EFHA 3COJA 3QBEA 4UE2A 1VSQA 3D0RA 5K03A 5KJFA 2DB3A 3WDLA 3DOJA 4PTLA 2P2CA 2HJGA 1B23P 5CPBA 3AECC 3K0BA 3IP8A 3Q88A 4UPVA 5IKMA 4CYMA 4ERNA 4MUFA 1T4BA 5DBEX 3AWIA 1RKBA 3CW9A 1EX6A 4NNOA 1G1JA 4IF4A 3AGPA 3AY0A 2O6LA 2DP4E 5FOVA 3A0UA 2NO7A 1KDZA 5TT0A 5LHIA 3TRJA 4AZVA 2CLKB 2ZWAA 4IMPA 1Z5NA 2ST1A 3HR0A 2FP4B 1NASA 4HQ0A 5H7XA 4LBWA 4R8VA 5KHJA 4J7CA 1IBMO 4XWWA 1SPBS 3E84A 4L4ZA 3W79A 3GLGE 4P4SA 2Q49A 5B7PA 1SCAA 3CR8A 3HRKA 4LZJA 3TW8A 2UVDA 5CA0F 4GPEA 1A2BA 2PTMA 3GRAA 4FDVA 1FFAA 1YE5A 1SF9A 1NYTA 3KKZA 3NKVA 1AY0A 4OQXA 1JG2A 3Q0TA 4BUCA 3LWBA 3E05A 1STOA 4Y2GA 3QVSA 1Z62A 4TYPA 5ALJA 3EGCA 3K5LA 4H0LD 2ZXEB 3FKSG 4ESOA 1MOQA 3WNQA 4FK5C 4CCWA 4ASWA 3NC4A 1N2EA 4DS3A 1P4RA 4GKJB 1Y8CA 2WSYB 1G1AA 5ALLA 2DKFA 3RLIA 4ZV9A 2ZTSA 4A8JB 1U7HA 3CX5H 1UIMA 2P9YA 3P9XA 1DMRA 1OCRB 1YITP 3R9WA 3W2IA 1N2DC 1WKVA 5IKXA 4DAEA 4BNYA 3N2ZB 1Q57A 5JAPA 4U7NA 4K9DA 2XMGA 5IEJA 1N5OX 1XBTA 2UXXA 5FLEX 1DRUA 3GNLA 2EDCA 5ERYA 4IY1A 4RKWA 2OSVA 4Q7EA 3W9SA 4D44A 3CXHE 4ZTUB 1KQFB 4F72A 2JJQA 3GGOA 2OQQA 2HBZA 4OHFA 4BFUA 1T3TA 3PFBA 3TI9A 4J1TA 1RQUA 1DADA 3ERCA 2FUG1 4LRXA 1KMHA 3PD1A 2X58A 1Q0PA 5KHAA 5C53B 1KEPA 5AKYA 3E9DA 4ISCA 1M54A 2GD2A 2EFHB 5C80A 4LF7O 2RBEA 3EXIA 2BEWB 1F8YA 1FRFS 1V35A 1LBHA 2JWDA 3KEQA 4JJKA 3HR7A 1NVOA 5CBPA 4LF4O 3RWRD 3OA0A 3KK0A 2C0WA 1T9ZA 1J1IA 5CA1B 1TCVA 4XA4A 1POWA 1QZTA 2IFMA 4PDRA 1SQXD 3CZ5A 3H6KA 3HFSA 4Z1OA 3FVVA 1LLQA 1SC4A 5U4XA 4XLLA 3I0ZA 4LHYA 3CNLA 2VT3A 3U0ZA 3ILHA 3PPWA 3NASA 1KYOD 5K6AC 1WNFA 1ZD2P 1MJ5A 2NUTA 2HY7A 4YCJA 2C61A 1P2GA 3DCJA 5FOTA 1O95D 4IDDA 2G3YA 3AEQA 4BX2A 3CVOA 3RVPA 3DJFA 4K40A 3VPCA 3KSAC 4Y67A 3T4UA 3R7LA 5E0OA 3CPSA 2XAJA 4L6IA 3WB2A 1Z5UA 2GVNA 1OZFA 4Q9HA 5DIFA 4QPJC 3AI7A 4YRLA 1CU1A 2AXTH 1NI4B 3N07A 2ECQA 3PNMA 2GETA 3TDMA 2ACWA 5E79E 3HJAA 5G1NA 2C9MA 4BVGA 4JOCA 4OK5A 1AROP 5AI8A 3OX1A 3JWGA 3T15A 3LKBA 1Z15A 1WUYA 4QOGA 1GNRA 4RZ3A 3MLAA 3IVAA 4JB8A 2R9IA 3CCLV 1BE1A 1Q16A 3OUSA 2WD8A 2YS8A 2BHSA 4DARA 2E85A 4Z49A 3RV4A 3D0QA 4M86A 3GPCA 1OTXA 2BGLA 2PH1A 3KBBA 3OM8A 4M1SA 3QXHA 4D6YA 4R9UC 5JS6A 1YSCA 1SFCA 4BP3A 4RD6A 4LWSA 4CC5A 4FFOA 2QLTA 4NCKA 4JQOA 2FZGA 4V0OA 5DI3B 4KLZA 4TL8A 3QEKA 1G8FA 3PQ2A 4LZNA 5H59A 3EMVA 3K09C 1U3CA 3AKYA 4P38A 1C9MA 1KPHA 1P1CA 5ELXA 4PZCA 4JUBA 4F2DA 3D1VA 3B60A 1C80A 3VO9A 4GMKA 3JALA 1IZ7A 2ZBPA 1LR1A 4TZTA 3CUTA 2KQUA 2Q4OA 3UM9A 4BO5A 1YBHA 5AKGA 4MVCA 1UDAA 2V6MA 1DTOA 3G6EV 4ODIA 2BM1A 1RXYA 4NEHB 4EX6A 2QQGA 3CC4P 3TIIA 2H3HA 2FPOA 4I50B 1AK1A 3PQ6A 3U4HA 4YQFA 1U3UA 2J7KA 4H9GA 1GL9B 3KOWA 3G68A 2YJTD 3PEEA 3DLPX 3LFUA 1JWAB 3D6MA 2Z1DA 3TTXA 2CYAA 1GSOA 4WVLA 2D8MA 1ZZEA 1GM5A 3A6JA 3TTVA 1P7ZA 4F71A 3S2IA 4BVBA 1Q1NA 4L3WA 2A3NA 1T2DA 5K8VA 4DBLC 3BASA 1QHFA 2XF8A 1TLTA 3NAQA 1NNLA 1NTOA 1NP7A 2OILA 4DV6B 3G2QA 3QKTA 2AXTZ 1Z6ZA 2CNBA 4RABA 1ECFA 2GVDC 3WU2Z 3ZX4A 3WVNA 3HACA 1ST2A 4LIPD 3L7OA 5CCGA 1GTWA 2QRVB 1XV5A 1CQIA 3UK2A 2A35A 3G8CA 3Q11A 3ELUA 4JWTA 1YDGA 1J8VA 1NONA 3CMAP 4I4NA 2DW3A 2PV7A 1JDZA 3MK31 2I1QA 3H7AA 1M1YB 4RTLA 2EILC 4LGMA 4C89A 2Y1OA 5BNFA 5DGDA 1NXQA 3I5AA 3AJRA 3K9LA 4M1MA 3CCEP 2WOJA 4YJ3F 4NTWA 3D5EA 3CLKA 4C7OB 2B69A 3SXJA 1RBZA 4L5JA 4JZGA 3UJHA 1ML4A 3G0GA 3ZVKA 2VQFO 3B8EB 1UOQA 3UB3A 3CMMA 2E76B 2YINC 3VR3D 3ZHVA 2MK3A 4Y2HA 2VKQA 5KUTA 3QX9A 2D7JA 4AY3A 4IAOA 5AVXA 2IOQA 3PICA 3VR5H 3H1TA 3C8MA 1OLXB 3T4EA 5CCHD 3IE0A 1F06A 3N3AC 3KZOA 1HT3A 2VPYA 3B52X 1XA3A 1ZMTA 4OXKA 4P2BA 2DWPA 4UOEA 1EEHA 4QFDA 3DLTA 3JCZA 2GAJA 4LDPA 2Z8YM 3FOCA 2B92A 3FHOA 3VH4A 2VBIA 3MWKA 1GRQA 4EVIA 4BRSA 2VPIA 10MHA 4MQMA 1Z6PA 5FUXA 4M0EA 4Q4JA 3OA7A 1INLA 3CCUP 4ZV7A 3HVUA 1VL5A 4ZI7B 3NIFB 4HN4B 4PRYA 1J2JA 5K05A 3RODA 3B1KA 3KVOA 5JT1A 1C0EA 2C2ZA 1L4YA 2V7PA 5DYGA 5AOBA 1ZGJA 1NW3A 2OCIA 5AVWA 3Q5PA 2Q2WA 5I3ZA 1AGXA 2IA5A 1HGVA 2ZNIA 4TV8F 4RCYA 4UNNA 4LDNA 4EJMA 4DCCA 3DMHA 5HPYB 2JD2A 1ZJ5A 1DINA 5LQJA 2LPMA 4QXRA 1FYFA 5EHXA 5I01A 2W2XA 5IWAB 4RY9A 4KDFA 4GZ5A 1XMXA 1CRWG 4JXKA 5TGTA 3IPXA 7ADHA 1Q92A 4OI1A 1X8XA 2GD1O 4DLVA 3IKLA 3O91A 1EZVH 3PR1A 3P97A 1JSZA 1G7SA 3QI2A 2ROQA 3KJGA 4QT0A 4MHOA 5JXGA 3AIIA 1XRQA 4Y1GA 1UBFA 3ZYZA 4JBLA 3WOHA 4U02A 3T7SA 1H2GA 1VE3A 3WFZA 4KTVE 1THTA 1Z3IX 1KVRA 2Z6QA 3SPGA 1RADA 5H2FE 5D00A 3VRHA 4GVXA 4MNTA 3EFFK 1DOHA 4Z9BA 1GPH1 1ZH4A 5TLSA 3OBBA 3SXUB 4L76A 4IV8A 4KQJA 4OQMA 3TPCA 3M0DC 3AONB 4MEBA 3ROZA 3AERA 1ZEJA 2NYRA 5CX1A 1RD4A 3MLEA 2H9YA 2BFFA 1J2UA 4DIEA 5F98A 4G01B 1VCHA 2GWRA 3PU6A 1E79G 5AKLA 5IP5A 1FXKB 3ZWOA 2GUGA 2RAUA 4D99A 4NI5A 3C5WP 3UXEA 3BF7A 1I5YA 3K30A 3ODGA 3UHJA 2XDJA 1MQAA 1EM8B 1T2KC 3BEDA 1F2DA 4N1AA 3R3HA 3HJFA 2YHBA 1ZX3A 1GW3A 5CVEA 4M8SA 821PA 1AQJA 2FNAA 4TOIA 1XZKA 4C05A 1Q86Q 2HF2A 1U3DA 2XUKA 3ZN1A 3EWKA 1AD2A 3NXSA 3F5QA 1Z2CA 4F4DA 4GRAA 3BMNA 3UYKA 2HK9A 7ABPA 5JSYA 3SFZA 5GY7A 5JE8A 4CM9A 4RLSA 4HDSB 3JX9A 2DTDA 4OPHA 3HKEB 1K6IA 2PSFA 1Z4NA 1VCOA 4CMEA 3L73G 3FYTA 3D6VA 4XD7A 2HA4A 4HWTA 4GYCB 4YUZA 1Y8AA 4CQJA 3P9YA 3FMOB 4HFNA 3AZOA 2GYVA 2F2TA 5IH3A 5L3RA 1E2FA 2QN7A 2H4XA 1P4JA 5L53A 3NXKA 1VRWA 3ZBHA 3R0ZA 4A6EA 3SIPA 2YKQA 3BA9A 5D8DA 3L73J 2OC9A 2A0YA 4C6TA 1FP1D 4PC2A 2FKWB 3EA5A 1VMIA 1X0XA 2BTEA 4ZIRB 4QG3A 2RJ3A 3CE9A 3T3MB 4AJHA 4RVFA 1XVVA 5ENDA 2IYEA 2PLNA 2RGAA 5LB4A 4QXMA 3JASA 1EWRA 2GS9A 3H1HE 1EUZA 1J0AA 2VQ6A 1SCDA 2IFNA 1U7OA 2PYJA 4HH4A 2XE6A 3TJZA 1DQNA 3R5FA 2IEIA 3HXPA 5F2OA 2GM9A 1KI4A 2WR8A 2C1EA 1J2TA 2AOUB 2EKLA 2Z4RA 4OMDA 1US6A 3B2NA 1CBUA 3MS7A 1H22A 3MB8A 2V6IA 3ET5A 1RAGA 2KX7A 4ZEMA 1DG9A 1LWNA 1OBVA 3GNQA 4GLBA 1SG6A 4PTYA 1QLEC 1KORA 4LFBB 1FRQA 1T91A 3DT8A 2KLVA 2OGTA 3QUCA 4D4IA 4JTDB 4MA4A 4W6ZA 4UVAA 1LTTC 3B70A 2HK7A 3STUA 3BH0A 1XZAA 2HWWA 2ZJ5A 3RKSA 3FUCA 1Z2PX 4CG3A 1K3TA 1GARA 3E82A 3O2NA 4F86A 1VYVA 4G89A 1OCOB 4DY6A 2CJFA 3SQWA 4D79A 3P71T 4GODA 3HU2A 4DR4B 1W85A 3GGJA 1YUNA 1ID1A 3L4SO 3WBKA 4GNKA 4IP0A 2Y05A 5DTIA 2O1XA 3NNNA 4X95A 1UMBB 1KKCA 4O1IA 3KKMA 2VP6A 1V6AA 2NV6A 5CK4A 3EH1A 3CZPA 1CNMA 2EJ7A 1OIWA 3EXG1 3OZFA 1XZQA 1CERA 5HBGA 3SPIA 4EY7A 1S6YA 4LP8A 2XNCA 3SQOA 4CW7A 1SHKA 4NBWA 1SC5B 3TB4A 1KYTA 2R7LA 1HOXA 2W2LD 5E1OA 1F1BA 4UBOA 4Y6LA 2JHAA 2ZTHA 2WSEH 2X0KA 5FBQB 3ZHZA 4EUHA 4M0LA 3UK6A 1VJDA 2J30A 2IYRA 4INPA 4FZVA 4GR9A 3M1AA 4HEA6 4LBYA 5FP0A 2OCGA 3IBFA 2LFSA 3QENA 4V1CB 1VQNV 1ZM9A 4BNNA 3H42B 1Z0FA 4KJZA 1JFFA 1BWPA 1DC7A 4US0R 2YNMC 1Z28A 4DJFC 4YALA 3WGZA 2HODB 3PUKA 2BP7A 3ELBA 4L0MA 1NW5A 3FFBA 1VTKA 4XRRA 3KQHA 2VAWA 3QKRA 3WYNA 4GQIA 3VQTA 4DIKA 1U81A 2FZEA 1H1LB 2PRJA 3CR3C 1T8ZA 4KQIA 4P82A 3QO7A 1T8WA 1LDEA 5A0VA 1DX9A 4HJXA 4HXFB 4FT4A 4CBCA 2JFWA 3DO8A 1RPTA 2V7TA 1Q2UA 1VG9B 2BL4A 2EW2A 2XWJI 1VE7A 1IVSA 4EAAA 3RJTA 1IXKA 4WDRA 3DL4A 5HKKA 4IINA 1NMYA 4PXYA 1NI3A 2F43G 3D5TA 2AEMA 1QM5A 2JI8A 1OIXA 1KZ1A 4YN3A 2DWOA 3TGUE 2EILB 2C2MA 4EUNA 2Q2NA 3Q15C 3S70A 5TVGA 4ER5A 2FWIA 1Y6FA 2VNKA 4KFUA 4YP7A 1QPZA 2PEYA 1PN3A 2BMEA 5KNBA 5EJFA 1N36B 4G28B 2ATEA 2XGGA 1JPJA 1FZCC 1HOTA 1T1IA 1FRZA 2B9ZA 3RYHB 4GDFA 3ABIA 1EFRD 1XP5A 3J7AU 1MC8A 3H4VA 4JITA 3DEYX 1BL8A 2PFXA 4IXNA 1SUCA 1V8OA 3X2QC 2H92A 4RTJA 3DNMA 3GJZA 2RJZA 3LY9A 3ACCA 3B2EE 4X65B 1G20B 4OTZA 4CKEB 1XTRA 2I2WA 4IRXA 3DR3A 1TZKA 1TO2E 3GI1A 1YJ9P 1A32A 1X7GA 1S9HA 1PV4A 2A45I 3HVKA 2J7PA 4KAAA 4E3WA 3V33A 4ZKDA 2NTEA 2C99A 2C2XA 4L4XA 3HBLA 1CG6A 4R83A 2UYYA 4TS1A 2NXEA 1V2HE 4AFNA 5H70A 3SR4A 3ZGVA 2A78A 4X7PA 4GE0A 4RELA 2A9KA 4X63A 2XNDH 2W42A 3B1YA 3OCVA 2NACA 3KYDB 5AK5A 2CHGA 3DDHA 1EUYA 1KB9F 3CTPA 2EFEB 5TMPA 2LDBA 3ZXSA 1E5WA 3LLSA 4RZIA 2PKXA 1C3VA 4I99A 3F8SA 1NU1G 3RLFA 5EQDA 4C3OB 3L6RA 3HLTA 5D86A 4Z7JA 3TD9A 2WA1A 2QUIA 3E3AA 3K5BA 3ZJZA 4EIWA 1BCCD 4BMYA 3O8CA 2QORA 4DKXA 4EMTA 2OQRA 2F9MA 3WWYA 1NU1J 2QP9X 2R25B 1I7DA 1PP9H 1E60A 5IXJA 4AP9A 2BKLA 1IJDB 1J21A 3H1KG 5FTNA 1NLZA 2JIBA 1WTAA 3A14A 5CFNA 3AEZA 4AS3A 5K0CA 4AZ0A 4WXMA 3HXLA 5AOAA 1JZSA 4MIOA 3IPLA 3ESRA 1SZTA 3D81A 1YF2A 4DR2B 4Y6GB 3JQEA 1CHDA 3AI2A 1TZJA 2ZBQA 3H1KJ 3M6LA 1GWNA 1H0TB 4MV9A 4Q37A 1C81A 5E95A 3MJFA 4MQEA 1SURA 4KUEA 1ZGHA 1XA4A 3DAFA 4QDOA 2VJYA 4DUGA 3C85A 1ESZA 1SKMA 5CMUA 2WU8A 4UB8Z 1E7RA 4KBYA 3OO1A 4LBZA 4JI2O 2JH3A 1FJ2A 2H2HA 2IPOA 2BHTA 4L72A 1NLYA 3AY3A 3AP2A 1VHJA 3CA8A 1ODIA 1WUJS 3KTFA 1YBMA 2MTBA 2XBLA 3WA7A 4RPJA 3KXLA 2ACEA 3SC3A 5EZYF 2DE0X 1PX2A 2DMRA 3J7TA 3WL4A 3WFIA 4P54A 2QE7H 2D2CD 4A73A 3BWCA 3TL3A 2F00A 4JHXA 4OHRA 3W1EA 5CGQB 1AQ6A 4K9OA 4GE3A 3V4VB 1S2NA 4CEJA 4C3VA 5EIOA 3JWEA 5HRUA 3FPGA 4HDAA 5AUNB 1IDSA 5I7EA 3CX6A 4MITA 4EKYA 1UMCB 5HSGA 1JQEA 3VGJA 4YIHA 4K0KO 2XUZA 2AV6A 2A7XA 4R69A 2GUZB 3ICXA 4LJ5A 2YOFA 2UU9O 4HS9A 3P0EA 1NIPA 2UYHA 5ETJA 4HSGA 4D6TE 3KS9A 1ZEMA 4MUYA 3BJMA 4RS4A 1CVIA 4TS9A 1K4MA 3K0CC 1EUDA 4HLDA 1Y8QB 4ACAA 4INJA 3M2PA 4U3FG 4B40A 3PX7A 1P84I 1XD9A 2EZ8A 1V3UA 3P9KA 1WDWB 3K9NA 1CJUC 1E6CA 2PEZA 1SRRA 1QC5B 3BRTB 3E70C 1XRSB 5JTTA 2QTOA 1IJEA 3G6BA 2FG6C 2FB9A 4YYEA 3EEIA 1E96A 3WI7A 4U3FJ 5KYKA 4AZWA 4XD2A 1LTHR 4RKQA 4FOPA 4ROTA 2J9ZB 5JS2A 2JDID 3ENNA 2VK4A 3PDJA 1SMKA 2HA2A 2F8MA 2V98A 3ORRA 1BGYG 2W8ZA 3ZHQA 4RK4A 1MO5A 2H3OA 3CC2V 3HM9A 1F14A 3TDNA 1Z2EA 3CRNA 4QE7A 1PAUA 1VQ5P 3PT9A 1QLEB 2Q1UA 3Q7EA 3ETNA 3PIRA 1OV9A 3WIEA 1U0TA 4FLYA 4WL0A 1SG9A 1X8KA 1TMKA 2H4HA 4AN4A 3ZD7A 1OI2A 4A03A 2FPXA 3BE5A 1OKKA 4MP8A 3MSXA 3VNBA 1SHZA 1WDLA 1QRDA 2M8RA 3L74H 3SLKA 3RYCA 3K16A 1ONNA 2WAYA 5F3DA 1PJZA 2DVMA 2ABWA 3WIOA 4DNXA 1JLKA 3OPXA 4NMXB 3MJTA 5JSZA 4P4LA 1B3RA 2FWAA 3MUDC 1FFDA 3CPWU 3L92A 3QVWA 3DHEA 4ER6A 2B4TO 4Z4CA 2WLHA 3P96A 3D8CA 2A9RA 1X9GA 4F4JA 3KZNA 2QRPA 2JPDA 5DN6A 1JIQA 4IL5A 5TXGA 4UMEA 2W6MA 3F6BX 3GD7A 3VZPA 2QTVB 2WJPA 3BWYA