4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Hydrolase
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
2Q7CA 2FWRA 3B1WA 4FD2A 3I61A 2O0HA 1NP6A 3ICQB 4GSYA 4WZ6A 4JLVA 5DI3A 5LD2B 1VG0B 3CNLA 5AJXA 4TMKA 2YWHA 2C03A 3MMPA 3V4FA 1PUIA 3K9LA 4J0QA 5H70A 5AW0B 3Q7QA 1YRAA 1Z83A 4E5UA 1HV8A 3UG6A 2VLIA 1GL6A 1N5IA 2MSCB 2C96A 3K0CA 4NBSA 3RWMB 3ADCA 2FV8A 4B3XA 4JYBA 2BHRA 4BFXA 1DAKA 2QTVB 1DAHA 6Q21A 1OH6A 4QJ4A 1P5ZB 1SP4A 1XTSA 2ZAOA 4I1OA 4IOLA 4Q66C 3VTPC 4JLNA 4MRVA 1E79A 2G83A 1DS6A 221PA 3MGNA 1H65A 4I5SA 3P4XA 2ZJ8A 1IXRC 2ZVQX 3DGEA 1J8MF 2OUKA 3DPUA 5KNCA 5JLJA 3LV8A 2HLDD 1P75A 2HF9A 4UJ3A 4BLRA 1A2KC 2MMCA 3FGNA 2ZSEA 3PEUA 2L0XA 2WJVA 1SXJC 1OPXA 5HZKA 4B74A 2PLRA 3RC8A 4TSFA 3WP1B 1H89A 3HR7A 2X2EA 4GKGA 3BAFA 4BASA 1HJBA 2EWVA 2GXQA 3WRXC 1GAJA 4EAQA 3TAUA 1WBBA 4QM6A 2IYVA 4U7DA 4HUQA 3GD7A 5DI9A 1KK0A 2D2EA 4L4UA 3THOA 4URVR 2FH5B 4FCWA 4GNKA 4AIIA 2QROA 2VEDA 4CDGA 4RFSA 5GVRA 1F60A 2R65A 4W7SA 3UK6A 1I4TD 1WRBA 1AN0A 2QQ0A 3CLVA 3E70C 1NIPA 4IDOA 1ZNXA 5A0FA 4CF7A 5FUVA 1KAOA 1UKVY 2FFQA 3QJYA 4GMDA 5DYGA 5JS7A 3WHLA 4QPJA 2WOJA 5BW8A 3PQCA 2AN9A 4NYJQ 4NTZA 1K8RA 3K0AA 3BGWA 5AW8B 2C99A 2RCNA 4EPXA 3L35A 4XWKA 3CF6R 1KI9A 4S35A 2VIIA 1ZINA 2HXYA 2D74A 4X8OA 4B76A 1W1WA 3SJZA 2XGJA 2OCBA 5KOYA 1NY5A 2DWQA 1LVGA 3BS4A 1VECA 1E2PA 1G9XA 1O87A 1Z0JA 3REFA 2O5VA 3WP0A 3H4MA 3RS4A 1XCMA 4IVQA 1XMJA 2IXGA 2CNWD 4EPVA 1JPNA 3HE5B 1OFHA 2JIZD 4PSKA 3AKCA 3IO3A 3BORA 1RRPA 3BRWD 1TAGA 1QF9A 2IPPA 2OT3B 2WWIA 2G6BA 1XXHE 2KBFA 4XWOA 3L0SA 4LYFA 3N2IA 2KBEA 4DHEA 3RDPA 3M9BA 2W6AA 1E2JA 1ZM9A 3TNUB 4MGYR 1S9KE 4MKGA 2ZETA 1CTQA 4CW7A 3QPVA 2YZ2A 2XU6A 2WTYA 5J47A 1G6OA 1T4GA 2YYZA 5AK0A 3FFBA 3VX4A 2FSIA 3P26A 4BRWA 2QE7D 2ZM5A 1X8KA 1E9AA 4LJ4A 3UATA 1QZXA 5FOTA 2BIFA 1EX6A 5AW2B 3JZAA 3K9HA 2AD5A 5P21A 1E2IA 3W34A 2IEZA 3QXCA 4C7OA 2BEKA 1KZ7B 4YC7A 2CE2X 4B3BA 1Y63A 1YRBA 4EPTA 3PUZA 4HUQB 3GLHA 3EA0A 1KHTA 2WAXA 1J2JB 5SZIA 4BFZA 3EZFA 2ASEA 1IJFA 4MUBA 2NPIA 2XV5A 3AEZA 5CJ2A 3TRFA 3QOFA 2R6CA 1E2EA 3D8BA 1SHKA 1FOSE 5ELXA 1FW6A 1X1RA 4EJSC 1FAVA 4AUWA 5FL3A 2A5YB 3QF7A 1II8A 1GRQA 4G5QA 4B2LA 4P32A 4A2PA 1XMVA 1OJLA 2CCKA 4GDFA 2RKOA 3LIDA 2GF0A 2ZS9A 3IBGA 4KFUA 3HE4A 3FHOA 3ZD7A 2B7CA 2IYXA 2ZRIA 3RVBA 3SR0A 1ELOA 3GLFE 1SGWA 2QENA 1P2UA 3WYFA 4DLWA 5KSOA 4LBYA 4JBWA 2LFSA 1NL3A 1SZPA 4OI4A 2GRJA 2IS4A 2J87A 2CVHA 3BD9A 3OF5A 5FBWB 2QE7A 2C95A 4G3XA 4XD7D 1E2QA 1R5OA 3CW2A 1D8TA 2BBOA 2G1KA 3SI7A 3B1XA 3QENA 3RRZA 2ZYVX 2WWGA 3MWKA 4QBGB 3U61B 4XVQA 3W9YA 1XEFA 5C2JB 4H9GA 5L3VA 2Z5HA 2H16A 1T3LA 2NZ8A 4ZI2A 2EFDB 2YVUA 5C46F 1Z0AA 1J90A 1TQ2A 1KO8A 4IVPA 1X3SA 3AV0B 4B75A 3EZ6A 3EARA 3TUJC 5AVWB 1S3SA 2AWOA 2F43B 3U7FB 1S9KD 2O8FA 2IYQA 1X6VA 2H18A 5FI1B 2NG1A 1R0ZA 3C16C 3NHBA 4A2WA 4CZ2A 3V00A 3KB2A 1XCGB 4C3ZA 2H92A 3CUEF 5CITA 4M9SA 3OIWA 1ZJ6A 4I2LC 3V4QA 4C2TA 1AS2A 1SVOA 4FWTA 2MMGA 1CZQA 1GKUB 2J7PD 3VMFA 1YR7A 3NBZC 1G5PA 4KFRA 3GLFA 1ZCBA 5C4GB 5AR1A 5M04A 1G5RA 4E09A 1LTQA 1OHHD 1KMHA 1XD2B 5JZVA 3SJAA 1PJRA 1S9HA 1DE0A 1KZGB 2VHCA 2QGNA 4HYYA 5JI2E 1Z6GA 1PLJA 3CNOA 3PG5A 5F98A 1JUNA 1P61B 1KIMA 4DT1B 1S1CA 3BE4A 4HAXA 4MQBA 1P72A 5FUWA 5APXA 1OIVA 3QQ5A 3REGA 2H17A 2JLUA 1VG8A 4QL3A 1Z8FA 1LY1A 1Z0DA 2IYLD 3M0EA 1ZNYA 5DNYB 1II8B 2XB4A 3HTKA 4HDCA 3KQNA 1SQ5A 4FMCB 1P2SA 1F2TB 5CM9C 1DVRA 2B8TA 1QHNA 2F9LA 4JLJA 2GK6A 2PL3A 5DI3B 4EUNA 1VMAA 3R9XA 2JEOA 4EPWA 5HPYB 1MT0A 2V6IA 4JVMA 4Q7LA 1YZQA 3U3OA 3LW7A 1NN3A 2GWHA 1IAQA 3PVSA 1E2HA 2FX3A 4YDHB 3OZXA 4DDTA 1W7AA 2XZRA 2GTPA 3CF2A 4V0KA 1KSFX 3B9QA 5F9FA 2QPAA 1Z2AA 4OQNA 1DTSA 1F2UB 1S1MA 3RANA 1YZTA 3IHLA 2R44A 3QKSB 1G8GA 1U0LA 1ZD9A 3GFTA 3QKRB 2KE5A 1LB1B 4KCGA 4PQFA 4XSHA 4PPQA 3FOZA 2F1HA 2WM9B 4C0JA 2WJIA 2GJ8A 1CKEA 4Q00A 5FUYA 5KSPA 2IWHA 5JRZA 3ZRWB 1N5JA 1W47A 1VCMA 621PA 821PA 4JBXA 3SFZA 3UIEA 2LKCA 1E4YA 5LD2C 3TBKA 2XSZA 3GCGA 2IT1A 3MFYA 4ERNA 1VYTA 3RSOA 3T5DA 2VP9A 4D0NA 1ZBDA 1OXZA 4QXAA 521PA 3ZVLA 4JS0A 2JLQA 3CR8A 5CJPA 4IOJA 3RSLA 5CB8A 4YXWD 2P67A 3RRYA 4OK5A 1NBMD 2W6JA 1UBEA 121PA 4NCKA 2BCGY 3SBEA 1XFAA 3AGQA 3BH6A 4TLAA 1GL9B 2FTKA 4B3GA 2Z6VA 2PZFA 3B7GA 3K70D 4ZCLA 4BIUA 2TMKA 4WW0A 2O8EB 4QJ3A 4C0QC 5AW3B 1EFUA 3MSXA 4DSUA 3P8MC 2ZI4A 2J7PA 2F6RA 2A5DA 2VH5R 4LC0A 4DVGA 1GZSA 4HAWA 4F4IA 2BMFA 1N6KA 1Q22A 4CEHB 3A36A 3FWYA 4NYMQ 3EPLA 4V0NA 2AXPA 3ZIAA 3ND9A 4JLDA 2NGRA 1LV7A 1ZU5A 3C41J 5JWRA 3K0AB 2ZS8A 1COWA 4BEJA 3WMFA 3KQKA 4MDFA 5G40A 4PC6A 4AG6A 1NG9A 1LF0A 2J46A 3W90A 2CHVA 5GVSA 3MUFA 1OB2A 1KK1A 3MG9A 3OIVA 4IVRA 3KJIA 4O25A 3A7OA 4O3MA 4LJ7A 4Q7JB 2DWOA 4A15A 2I4IA 2NO0A 3ASYA 3K09A 4HB2A 4PHFA 1Z29A 4PTLA 3HWSA 4IOKA 5TVKA 2GJSA 2WJGA 1CJMA 2GEUA 2CLDX 3A0RA 1E2GA 4Q4LA 2KI5A 1JEEA 1HURA 5FTKA 2A5JA 4AC9A 1FOEB 5CK5A 4KFSA 2E9SA 4BFVA 1KKLA 1DO2A 1C9KA 1HEIA 1J99A 5FBRB 1UDXA 1VHLA 1CU1A 3KFXA 4MRSA 2WPRA 3RC3A 4AURA 4C7NB 1F2UA 3VYIA 1C1YA 1MV5A 4JLKA 5G3ZA 2DFKB 2GNOA 2GETA 1MOZA 1Z5ZA 1NI3A 4V0MA 2GA8A 2QSZA 1XPRA 3TNUA 4IHQA 1EK0A 4WXPA 4DZZA 2WTUA 5CB6A 1ZAKA 2ATXA 2ZE6A 1JI0A 1D9XA 3IHWA 5KDLA 4EKDA 1NWQA 2GCOA 3WNCA 3VMXA 1E4VA 4AKIA 3I72A 3VN0A 1OFUX 2F3TA 2ZR7A 4Q1BA 4JASA 4R2HA 4U5XA 3T1VA 1N3BA 2NOAA 1ZD1A 1OFTA 3GJ7A 2YOHA 2Z83A 5CIQA 5J40A 1R4AA 2JJ1A 4NKRA 4QGGA 3T61A 2JLRA 1H8HD 1VHTA 2W58A 3LVQE 1B23P 1DG1G 2GBLC 4BIZA 5C93A 2GHIA 3DKVA 1IBRA 3RS3A 1G8PA 2CCGA 4DUGD 2MSDB 1KDTA 3QVUA 5EJEA 4HI0E 1IONA 4DLXA 1FX0B 3GLHB 1ANKA 2JLSA 1NBMA 2W6JD 3BOSA 3OAKA 1S8FA 1Z0FA 3AUXA 3EC1A 4GRAA 3L0PA 3L36A 2WSSD 4ACAA 5JCPA 3LNCA 3ASZA 4NYMR 2O8EA 1MFZA 2R2AA 4KHZA 3U7EB 1U8YA 1CR2A 1A2BA 1L8QA 2Q9AA 4BGDA 1KO7A 1UKZA 4LHZA 1TEVA 4KHXA 3GEIA 2C9YA 4Q4JB 2IX3A 4W9MC 3L37A 4OI0A 5JRJA 1ZW6A 4YDSA 1E2NA 1JQLB 5E3HA 3KQGA 4Q7KA 4XVUA 2ZU6A 2E87A 3AF2A 3CZPA 3LFUA 4V0ME 5GJVC 1IHUA 3ZS8A 2Q5UA 1A82A 3EA5A 2C9CA 2PT5A 1JXMA 1ZCAA 3I73A 3CX8A 1BKDR 2JLZA 1A02F 1RC8A 1TTTA 1W36D 4YMUA 5AVTB 2F1IA 4NZYA 3J81k 2ZXEB 1IQPA 2FJUA 1QHIA 4WBSA 3EPJA 3WNBA 4YMVA 5BWMA 3IGFA 2AKAB 3LXRA 2AKYA 3SE0A 5EZ6B 1G4AE 3AVPA 4ZKIA 4G5RA 4MRNA 3D36A 3TNFA 2CL6X 1AZSC 3OAAD 1II0A 2Q3FA 3R7WA 1JAHA 1IN6A 5FOVA 3M6AA 4I1UA 4C7NA 1G5TA 2WWHA 1E9CA 2IUTA 4C0HA 2H57A 3B13B 4KVGA 4A6PA 4GZLA 2F43A 3IPYA 3NDPA 1KDRA 2CL7X 3K1JA 4KYIB 4MUAA 2XTNA 3ECCA 4YLGA 3WBJA 4EPRA 2QA5A 2O8FB 4LC1A 2HT6A 4QOSA 1NG1A 2HJVA 1L2TA 4LHVA 3K9GA 3E2IA 2B7BA 2IYRA 3T1QA 1GKYA 4M1WA 3H2YA 3OEED 4OJQA 2NO6A 5B2ZA 5B1NA 2CNWA 2VSFA 2WMNB 1T3HA 1ZUHA 3P4YA 5FPHA 4E07A 1WP9A 3NDBB 2QGZA 3L8YA 1NF3A 2GZHA 4HZIA 3OEHD 5KNDA 1NSTA 2FSHA 1XTKA 4D2IA 3U7HB 3HPRA 3DM5A 2WVJA 3NKVA 4OKSA 1FP6A 1TUEA 4TZ6A 5AVYB 1XBTA 3BH0A 3RS7A 4G5OA 2ZSFA 5D3MA 2BM0A 2GF9A 2NQ2C 1NSFA 4IXMA 4P0TA 1U94A 1CI6B 1ZC3A 2CEAA 4DJTA 1T2KD 1FUKA 2PCJA 3BFXA 4TTQA 3SHWA 4IFEA 1JR3A 1G19A 1KJYA 5JSZB 3OHMA 3VR3A 3U4QB 1MO4A 2A9KA 2IXEA 5H68A 3BC1A 3FKSA 3TIFA 3A3YB 1HBWA 1F2TA 3CRQA 2GXSA 3MWJA 4JAVA 1KO1A 3FTQA 3SJBA 2KJQA 4AI6A 3U60B 2Q3IA 3RRNA 2PEZA 1M8PA 3CPJB 4JKYA 2XEXA 1KMQA 2HXSA 4ZDKA 2R6GA 4HLQB 2QL6A 3LRPA 3W8RA 1BS1A 4KP4A 2V7QA 4LRWA 2UZIR 4PPFA 4C0SA 1XXHA 4PO8A 4PAQA 5JHGB 5AWFC 3RS0A 4TT3D 2NTYC 3QNUA 4KAXA 3PENA 3ZDQA 2GK7A 2RGCA 3DKPA 4S2EA 3G82C 5BXQC 3ZS9A 1BMFA 2A78A 4OHVA 1E2FA 4JT2A 1AGRA 3ICEA 4LV6A 1U0JA 4C4PA 3R8FA 5EE3A 4ASUA 1Z3IX 1QVAA 2ERYA 2VL7A 4B32A 2OILA 3AP1A 3NTNA 1DAMA 1W5SA 4DCSA 4RD6A 4L9WA 2OFOA 5BN3A 2GAOA 4MITA 5HE8A 3ZCCA 1OT3A 2C2HA 2O0JA 2WJYA 3IPXA 4R9UC 4AD8A 4TTRA 2HDNB 3QKUA 3I92A 1XPUA 2IYZA 3BB4A 2EQBA 2V7QD 5FOUA 3NTUA 4GFDA 3S1AB 1M7BA 2AHOA 3VHXA 2H5EA 1ODFA 4Z8XA 4FW9A 4HDQB 1CSBA 2PZEA 1NLZA 3EIHA 1DAIA 4LHXA 1X1SA 4LV5B 3DMDA 1WCV1 4ZIRA 5LBIA 4D4KA 4I99A 4RSGA 3VR1A 5JS8A 3SYKA 1MABB 1Q57A 3Q7PA 1GRRA 3DMNA 4F93B 3O8CA 2W83A 2ZJ5A 2WPDD 3PCRB 4NE2A 4PC3A 3D3QA 5GJCA 4BUJA 2R8RA 3A8TA 4ASUD 3IEVA 4D26A 3A2AA 4Q1DA 1G8HA 4A4DA 5HZHA 5JJKA 4XTCS 3WMGA 2NO7A 3ZYCA 4R71A 4NDZA 2JJ2A 4I1SA 3EIQA 1QBKC 5E95A 2PZGA 4AK9A 4DUGA 3ZIAD 4B2PA 2G0NA 5EXSA 3U7GA 1EWRA 1JNMA 2B92A 3V4RA 3U6KA 3BH7A 1CI6A 4XSGA 1JBKA 2ZJZA 2J0QA 3MD0A 4AKHA 2QN6A 3SHFA 3TAHA 2JLXA 4A82A 2EFEB 1UBFA 2P2LA 2KP8A 3FB4A 4D25A 4M22A 1QHSA 4LJYA 1RIFA 4LUCA 3U4QA 1OXUA 4FI3C 1T2KC 1WF3A 1KI6A 3EXAA 2Z5FA 2IYUA 4Q4AA 1GL7A 3CKLA 4CYMA 4PAOA 4AYWA 4YMTA 1R7RA 5EUQB 2VYFA 4BFUA 3V5BA 3CIOA 4OHXA 4XJXA 5J4VA 3THYB 3CX6A 4K46A 2ZROA 2YHSA 4L9SA 4DZOA 4UXJA 3MGCA 2Z5IA 1R6BX 1IXZA 2D62A 1GWNA 2A2ZA 4TYWA 3O8BA 1MR3F 1SVKA 1G8YA 2R5DA 1I4DD 1QG4A 2IL1A 3FVQA 3MJRA 1P9NA 3B8EB 3CF0A 2PJRA 1E0KA 2HV8A 2VP5A 4DWJA 2ZE5A 2HEIA 1ESMA 4BLQA 2P0EA 1E2DA 1BH2A 4LCBA 3DVLA 3I5CA 1JB1A 1ZP6A 1MH1A 1ZIOA 2ANBA 4C7OB 3SOPA 3T34A 1FTNA 2Z4SA 3TQFA 4M1KA 1AK2A 2Z43A 4Y0VA 4TWZA 3ZZUA 1NAFA 5SZJA 3WXMA 1WQ1R 4HB4A 3C5CA 3VKHA 3L43A 3OIUA 2ECKA 4DKXA 1MV8A 1NN1A 1EFRD 3OEEA 2W27A 2Q9BA 3QXXA 1PZNA 2WAYA 4OYHA 1KSGA 5AVUB 1JR3D 3ETLA 1BMFD 1U8AA 2W00A 4PC7A 1W0JD 3L2OB 5DISB 4C0KA 5JHHB 5H8WA 3BK7A 3CRRA 2FDCA 2J7KA 2WPQA 3CPEA 1NVUQ 3QUSA 1KI4A 1UADA 1EG7A 1KK2A 1SXJB 1FP7A 1N5KA 5AJWA 2QMUA 1GILA 2ZRCA 1O3YA 3KQHA 3QKTA 1YZNA 1R10A 5EP1A 1E94E 4UJ5A 5APWA 1T6NA 3LH5A 5IHPA 2IF2A 4HLUA 4H1UA 1N5LA 3EASA 3QXSA 3I5XA 2WKQA 4HYTB 2OSBA 3EPHA 3PEVA 4K8OA 4GBMA 4TL7A 4Q9LA 1J70A 1K5DA 2ZS7A 4YMWA 4AWXA 3P27A 4M4SA 3VNVA 2FPLA 3ZVMA 4OQMA 2BJWA 3EWAA 4PFSA 4JKIA 1MKYA 5FOWA 1UKYA 3NBYC 4PHHA 4ESVA 4WXRA 3GJ6A 3RAPR 4U7NA 1CBUA 2RGEA 3PITA 1FPMA 1X8YA 2QP4A 3C8UA 3V4WA 1M2OB 3U2QA 2CL0X 2K5UA 1OV4A 1NN0A 2YC2C 4CEJB 1LS6A 5APYA 3VTKA 1GU4A 1W36B 2GEDA 2DWPA 3RS5A 3TYYA 1NMXA 4ZI3A 3GJ3A 3IEUA 3GLIA 1GKIA 2JATA 4DLUA 3AKDA 1E0SA 4LJ6A 2C9LY 3A1SA 4TLCA 4EFLA 2O8CA 5AVVB 4PO1A 4Z1MA 3R9WA 5F3WB 3RYTC 4QGAA 5FBLB 3B6EA 2SHKA 3KKNA 3AQ4A 3K0FA 4AQRD 2PJZA 4B86A 5GJWC 4FMBB 5FTNA 1KMHB 1XD2A 1N6NA 1RJ9B 3B85A 4C2UA 3NFQA 2FEOA 3W6OA 3ZH9B 4DDWA 4NYIQ 1NIJA 1DH3A 1Q21A 1XU4A 2FFAA 5IT5A 4DT1A 3LDAA 1CEEA 3VKWA 3CWQA 8OHMA 5KHOC 1E98A 2VRWA 2J3EA 1MO3A 1UJ2A 1RKBA 3AM1A 1ZNWA 3BIFA 5JJIA 1E9RA 1M6NA 3FHCB 4Q19A 4LJ5A 3HR8A 1HT1E 3SYNA 1GRNA 4DLSA 2V8OA 1P4SA 3B9PA 3W3ZB 1SKYB 1ZVQA 5FTMA 1NVVR 1RW4A 5TY0A 2IXFA 2OCYC 4HB0A 1MUUA 4N3NA 2MSEB 4QJ5A 1ONBA 1OH8A 3B8HA 3KB1A 4JLAA 5D3MB 3K9NA 5B57C 3KKOA 4KSCA 3T1OA 1Z63A 3X1WA 1M74A 1TEXA 4QHTA 4EIWA 4LGMA 2G9NA 3X1ZA 3MRSA 4MT8A 3L0OA 5EP2A 1HWTC 3Q8XB 2LCFA 4Q9KA 2WPSA 4P4TA 5JWHA 5C4MA 2NMVA 2W6IA 2QNRA 5JSZA 4GZMA 4NONA 4NYIR 4AKGA 1VIAA 5KPDA 4FPPA 5B64A 1P9WA 2JJ8A 3KQUA 4JL5A 4C0BA 3QKSA 4I81A 2YOFA 2ZRDA 3CR7A 4IDQA 1KY2A 4JSTA 5DHFA 3AUYA 1G1MA 2QP3A 2YNMA 3R8CA 3TR0A 3ZRWA 1UKEA 1G7CA 2YOGA 1XXHB 2RGXA 1E3MA 1XX6A 3GJ8A 4A92A 5AJZA 3UMFA 3I32A 3NC0C 3W3AA 3NEJA 2HCJB 3GQBA 4ZCMA 1QHHA 4P31A 3VFDA 5L3SB 3GLIB 4NL4H 2BM1A 2QMHA 2CE7A 2I1VB 2FF7A 4A8JA 4US1R 2H7VA 3OIYA 4F91B 2BWJA 4D80A 3GEHA 4FWIB 1ZM7A 4D4LA 2IUUA 1RVDA 2ERXA 2F9MA 3LO5A 3QF4B 5EE9A 1KNQA 2G3YA 3FMOB 4UKDA 4DLYA 1K6MA 4WVFA 2RGNC 3WMEA 3LVRE 1QHYA 5IRCD 2ZJYA 4Z1MD 3IQWA 2LFRA 2JGNA 1NMZA 3KZ1E 3NWJA 4E03A 4NCIA 1AGPA 2KSQA 1J7KA 1U98A 3C7KA 4NCJA 4EJSB 3GPLA 5KDOA 1R8SA 3NMDA 1JQJC 1OXTA 2ZRKA 3I3SR 3T5GA 3VU9B 2GJKA 4A0FA 3NC1C 4TT3A 4ZDJA 1H88A 1H8EA 3NXSA 4URZR 4QHYA 2QMOA 3O8ZA 3AVWA 1NLYA 5UKDA 3PUXA 4A0GA 5DYIA 1A5TA 1YR9A 3ZRVA 4OQXA 1EGAA 1Q1ZA 2RH5A 4CIDA 2GILA 4MGZR 3QG5A 2FZ4A 4PPNA 5DIFA 5KDDA 1W4RA 4Q48A 1MO6A 3AKEA 1Z06A 4BFYA 2ZRGA 4DC9A 2BV3A 2ORVA 1E9SA 4ZKDA 4I1VA 4LI0A 2IEYA 1MO5A 2R6AA 2PCLA 4XOIA 2CK3D 4FCVA 2E42A 2ZTSA 5EE5B 5TV2A 3KKPA 1KI6B 4Q4AB 4ZDWA 4ZDIA 1OYYA 1UF9A 5E4FA 1NKSA 1OHHA 1OXXK 2J41A 2ZAMA 2FE4A 3CRMA 3KX2A 4II7A 2QTFA 1XMIA 4KXFB 1XJCA 3IIJA 2ZRJA 3H0KA 4FMCF 5HCIA 2QUZA 1VPLA 2D4HA 4MGIR 1GFIA 2IK8A 1G18A 1W5TA 3AVQA 3EIEA 5BN4A 1E32A 1JALA 4EDHA 4TYQA 2HJGA 5J4HA 2ZRFA 2QY9A 3DL0A 3FE2A 1W0KD 1XRJA 3KJHA 4LZZA 2QPOA 3VR5A 4D0GA 1AKYA 3O8RA 1VCIA 1UBCA 5L3SA 3UG7A 1CJUC 1RFLA 4AG5A 1KI1A 2G77B 3NEYA 3C5HA 2VHUA 5J4LA 3AB3A 2Q9CA 1A02J 5KNBA 4MYHA 1PV4A 5FOXA 1NVXQ 1ETUA 3BB3A 1FOSF 2JAQA 2O8BB 4LHYA 3K53A 4LJ9A 4MYCA 4D82A 2WWXA 4KU4A 5AW9B 1Z07A 1WDTA 3FDIA 2LWIA 3V9PA 2ORWA 4TL9A 3LAWA 2VO1A 2BKEA 1AS3A 4IKEA 2QSYA 2RAPA 4PHGA 2ZYTX 3F8TA 4Z51A 1WXQA 4KO8A 4HZUA 4M3LA 1UM8A 1ZUNB 4PR0A 1FNMA 2CCJA 1Z6YA 3AP3A 3UXMA 4OI2A 2OCAA 4Q01A 3RRMA 2PH1A 2YO3A 4N0EA 3WY9A 1JPJA 5EE1A 4B3DA 2ZFCA 3P32A 4TLEA 4M9XA 4E22A 5FI0B 3SFVA 4LJAA 5K8TA 4Q4HA 5H1YA 1PLLA 2WBLC 3QI2A 5KPJA 1HH4A 3IBYA 1MRSA 1JOYA 5L3RA 4IEIA 2C98A 1VCNA 2YNYA 3NVAA 2G88A 3KKMA 3N70A 3QKRA 1AKEA 2BBSA 4MDEA 4LJ8A 4HAUA 1AQUA 4M21A 3Q72A 3VX3A 2BMDA 2I1QA 4B73A 4L5BA 2VP2A 4BLSA 4TQ9A 5KSZA 2JDIA 2O0KA 4JVNA 3GMTA 4LPSA 4EQ6B 4DSOA 3EZ7A 4RD1A 1YZLA 2A5FA 2P5SA 4KYUA 3TW8B 3W8NA 1VTKA 1KO4A 4PQRA 2G1JA 4RZ3A 5HR5A 3BB1A 4BFTA 2ONKA 1CRPA 3LQRA 3B1YA 1Q3TA 3AF0A 4L15A 1G8FA 2EWWA 2BMEA 3I1FA 5HKKA 1P6XA 1CLUA 4PZZA 4A0RA 3BWDD 4RVCA 4W5HA 4AYTA 2RGBA 5G41A 2QM8A 1XD8A 2OCPA 2XX3A 2O52A 1EFTA 2GCPA 2UKDA 3FYHA 4LBWA 4PAMA 1JECA 3B78A 2C9OA 3QPUA 5EXTA 2RMKA 3X1DA 4DLRA 4BEBA 5BYJA 2PMDA 5KSYA 4RZXA 1V5WA 4FMDB 2CHQA 3K70C 1N25A 4A9AA 1DAEA 3LXXA 1SVWA 3A1TA 2F55A 2GEVA 4W5JA 1DELA 4JT4A 3BFKA 3BXZA 4WZAE 1Z6XA 2FFHA 5AW1B 2PMKA 2ZVPX 5JEDA 5B1OA 2AK3A 1NKTA 4NCHA 3JZMA 1NVVQ 1COWD 1F5NA 1M7GA 3NHAA 4DDUA 4RFVA 1DADA 3PJRA 2FPMA 4ZPXA 2WSMA 2P6UA 1YR8A 1PUJA 1W4CA 3TSZA 4JMPA 1DO0A 2R6DA 1LNZA 2YWFA 3KUCA 4HZUB 1H8AA 5SZHB 2FMXA 5FR2A 2J0UB 1E0AA 3SS8A 4HAVA 4BZPA 5HKKD 2Q6TA 4Q7MB 2D2FA 2XOKD 2RGAA 1E2MA 1GIAA 1LW7A 3THXA 4MKHA 1W2HA 2BVNA 4Q1CA 1HQCA 1IN5A 4Q4HB 2JIZA 4LWZA 3H84A 1Q0UA 2QU8A 4Z8YA 1KI8A 2OHFA 1KO5A 3SWFA 1T91A 1Z22A 2PBRA 1FQJA 2WMOB 4QG7A 2V1XA 2AX4A 4FIDA 1G7RA 1J8YF 4BECA 4JLPA 2P7JA 2BEJA 1R5NA 2OAQ1 2JASA 1G20E 1E79D 2EFHB 2AFHE 2QAGC 5FOSA 2REOA 3UWKA 5F9HA 1G3RA 2AK2A 1HA3A 4KODA 3NH9A 3SYLA 4BPBA 3SEAA 4Y0AA 4RJLA 3M0AA 3IO5A 4A6XA 2QT1A 1GOTA 4GOJA 2HLDA 2VBCA 4HLCA 1W46A 3SU8A 2FG5A 2GDJA 1ZRHA 3CO5A 2NZJA 4DEXA 4QBFA 2QBYB 4TQAA 3S1AA 1FMLA 2ZIAA 1A7JA 1W0KA 3ZQ6A 1AQYA 2PX3A 1N6PA 5J4KA 2QT0A 1KK3A 1XEWX 1N2CE 2XZOA 4ZIRB 5AVSB 3RWOA 1FX0A 5LB4A 4JJKA 3QF4A 2P2UA 1I2DA 4Q9JA 4F92B 2GXUA 1R0WA 2P65A 1Q3HA 4LBVA 3CX7A 3VMZA 4X8MA 2WHXA 3GFPA 4D81A 5KU1A 2BBWA 2ZRMA 3VAAA 5B30A 3ADBA 2B6HA 3IILA 4OHZA 4GT1A 4JZKA 4UNQA 3DOEA 3H1TA 4DCUA 2XB2A 1QHGA 3R20A 3TE6A 2WT7A 3CH4B 5TB5A 3CNNA 1L4UA 4TMVA 3B1VA 1EXMA 5F2EA 1YE8A 2V55B 1XMSA 4PSVA 4TMTA 2DYKA 1D2EA 2CXXA 3CH5A 4R7ZA 3G0HA 1P9RA 2OFXA 2FA9A 2D3WA 3QXHA 4BQSA 2G0TA 2ZEJA 4O2RA 5JCZA 2ZXUA 2A30A 2WJJA 4PXAA 4URWR 2J0SA 1RYFA 5CM8B 3MWYW 1KYIA 2WWFA 2XNSA 3PV0A 2XJ4A 3SQWA 3B1ZA 4LY6A 4WIAA 2EW1A 3LA6A 1XB2A 4H1VA 1D2MA 5FBVB 4L16A 5AW7B 2GZAA 5CDFA 2DB3A 4ZCIA 1GP2A 1OIWA 2VHJA 2VF8A 1L4YA 1R2QA 4G01B 5FPTA 3DOFA 4C30A 2CLCX 4CVNA 4KLNA 5BQ5A 3VMYA 2YO2A 1R0XA 3HU2A 3PUYA 1XCPA 4HEJA 3TKLA 2PLFA 2QRNA 4F7WA 5AUOB 1OF1A 2E1RA 1N0WA 3RLFA 2W2VA 4UQOA 2WOOA 1QVRA 3ZVNA 2EU8A 3A1UA 3A1VA 4A0HA 5EQTA 5DLQC 5JI3E 2QTHA 3HU3A 3QG1A 3QSYA 4NPHA 3O8DA 4F4JA 3SDZA 4RCYA 1YZGA 2B21A 1IN7A 4NMMA 1ZIPA 4TQUS 2ZI5A 2BCJQ 2QRZA 4PSAA 3WRYC 5AUQA 3K0CC 1EFHA 3C15C 3QEOA 3AF4A 4B44A 1U99A 1PLKA 5KUTA 1H8HA 4QM7A 1YZUA 3C4JA 1Y3AA 4QRHA 2RGNA 1UEIA 1G7TA 1TQDA 4KVAA 5J5CA 3ZLJA 1U2RA 4MYTA 4N1AA 3ZZ0A 2QBYA 1FNNA 2OAP1 4WA7A 1G41A 3TUIC 1KI7A 5KO2A 1WB9A 4GI7A 5EXPA 2IW3A 1E96A 2VP6A 4LOAA 721PA 2DPXA 1NLFA 3PEWA 3M0DA 2IWRA 4F38A 3ZVRA 1SXJA 2J59A 1XEXA 1ZC4A 4DCTA 2HCBA 3Q5EA 1YVDA 3QVVA 3SZRA 5L3QB 2GZDA 4RZ2A 2QZ4A 3AVYA 2ZYWX 4HLUC 3UWOA 1GSIA 2CJWB 5APQA 1M34E 2FGKA 2YWGA 3MJHA 5JBQA 1F48A 1SVSA 5AUNB 1W2GA 3LX5A 3TGPA 5CYOA 2FU5C 2J9RA 2BC9A 4DXAA 4LV8B 5AW6B 5FFMA 1RZ3A 4Q1AA 5K8IA 1L7VC 4PZLA 5TARA 4FMTA 2IYWA 2XTZA 1TL7C 3ZJYA 4I6MC 2C77A 2RGDA 4LPKA 1VIYA 3M1IA 1KKMA 4LK2A 4MA4A 4PC1A 4XD7A 5DH9A 1RRCA 1ESNA 1HT2E 4QGHA 3DDCA 4IFBA 1E69A 1R0YA 1KSJA 4XTRA 2ZI6A 2F7SA 1KI3A 2AL7A 3ZZTA 2DFTA 2XJ9A 4DCVA 2NO1A 5CK4A 2XOKA 3LLMA 4JLBA 3FMPB 2DHRA 4UNNA 4QBIA 1G3QA 1HY3A 2ORIA 4FXPA 2O8CB 1DAFA 1KTVA 3CM0A 1XF9A 1WE2A 4BLTA 2VQSA 4MRRA 4M8NE 2ZPTX 3KJGA 2FEMA 3KKQA 3R9IA 4DLZA 4US2R 4XVRA 2EYUA 1Z6TA 2R5BA 1F3OA 3HE5A 1LF5A 4C9BA 3PUWA 4OQLA 2WJHA 2ZI9A 2CK3A 2EFGA 1FQKA 1GNQA 3HYRA 2WIAA 4OJKA 4F4CA 3OFNA 2HYIC 4C0AC 4IOMA 3WHKA 3GLGB 4TYYA 4BLOA 3W5IA 1N6LA 4JVLA 1VYVA 4LDJA 1K5GA 1MABA 1TF7A 2J1LA 2H7HA 3DM9B 3D31A 1OKKA 3W6PA 1EWQA 3LY5A 2KB0A 4K81B 4QHSA 4ARZB 4YQFA 4EOTA 3EG5A 4JL8A 4UXHA 3LW8A 3TQCA 2WV9A 3U5ZB 3CPHA 1BYIA 4JVSB 4NH0A 1AS0A 2JJ1D 3AF3A 5APSA 2WICA 2O8DB 4D6PA 2HYDA 1HE8B 1KAGA 2C78A 3T12A 2REXB 3GLIE 1P2TA 2QM7A 4Q47A 4V02A 1XTQA 1XEXB 5CLLA 2DY1A 4URUR 1YZKA 4GP7A 3VKGA 3HJNA 1YU9A 3AVUA 3KXKA 1T3SA 2CJWA 4CRWB 2ZANA 5GJBA 4OBEA 1JXOA 4DLTA 3KDPB 3EPKA 4OHWA 4ITRC 2FFBA 1R5BA 3AVTA 3GEEA 1AIPA 1XJQA 1AJEA 4ZV4A 3NBFA 5DE3A 2C5LA 2VSXA 1UBGA 3GFOA 3UKDA 4LHWA 3I4LA 1Z0KA 4WZBE 5DO9A 1XTJA 2IA5A 3THYA 3THXB 1AM4D 4ZKEA 1GDDA 1F51A 4B6FA 5FPKA 4P33A 4HSEA 1VDZA 2GVDC 4URXR 1N0UA 2A5GA 4JYCA 5FPSA 1ZD8A 4L8GA 2QAGB 1KNXA 4IRUB 4IW3B 4BE7B 3GJXC 1PVOA 2R62A 4IEEA 3F5FA 2QORA 5DN6A 4B43A 1QHHB 1SVIA 2REBA 4TTPA 4DB2A 3HYTA 2GAAA 2YINC 5SZKB 5FH9A 3U44A 1N6IA 4B47A 3KJEA 1CR4A 1Z6AA 2OBMA 3X2SA 1CIPA 3FKSD 2LKDA 3AF1A 5FL7A 5K8LA 3AP2A 1FL9A 1RRFA 1EFCA 5JECA 2VPPA 5CDFE 3KDSE 3VQTA 2Z0MA 1T5IA 3JVVA 2QG6A 3TH5A 4DEYA 1A4RA 4A8JC 1I2MA 4O2LA 5ANRB 3EZ9A 1N6RA 1XJ0A 3EWSA 3M9HA 1E9BA 2YV5A 1TPZA 4G0NA 2ZUCA 1B0UA 1R8QA 4KFTA 4TYPA 5A4JA 1MRNA 4EJSA 2VRSA 4MKIA 1P3JA 4MTXA 4TSFD 3A58B 3A4LA 2ZSAA 3VU9A 1XWIA 2YKGA 1SULA 2Y8EA 3AGPA 1CR0A 4EFNA 2Q3MA 3PUVA 3OEHA 1JNYA 2CMKA 1W4BA 1AZTA 2JJ2D 3LD9A 4M1OA 1D2NA 2ZITA 1TF2A 2H8KA 3A4NA 1UEJA 5J4YA 2ODEA 1IY1A 3TW4A 2I3BA 2ZRPA 4IXNA 2V4ZA 5BYKA 2CVFA 1CR1A 1ZM2A 4O0MA 1CF4A 1IXSB 3QIAA 2WT7B 5FTLA 4JIMA 4YXWA 3LBHA 1JR6A 2FOLA 1DARA 1GNRA 2EYQA 2N1BA 3NBXX 3IDQA 4GPTA 3T06B 1W48A 1NY6A 4BFSA 2VP0A 4GL2A 2FSGA 3X1YA 3SC3A 4CT4B 5CLQA 3OE7D 1D5CA 1P2VA 1V43A 4DBLC 3UIAA 1IJEA 1P73A 2E43A 1H8ED 5GADl 5TMPA 3MCAA 1NBME 3L82B 1S9DA 1OKKD 5E7JA 3W6NA 1ZYUA 2BOVA 2NIPA 2V3CC 3X1XA 1I4LD 2ZRHA 2QPTA 2UVQA 4QGFA 4CEJA 1QHXA 3IQXA 3KTAA 2IS2A 1UPTA 1WA5A 5AVRB 1TU4A 4Q1FA 3WYGA 1RE0A 2IHYA 2UZ3A 4UXIA 1U90A 1BIFA 2EFCB 4X8LA 2JLYA 4P4UA 2OZEA 3VHLB 3FKQA 2ZJ2A 1ZM4A 3Q5DA 5KYKA 5FPYA 3ND8A 3AVOA 5AVQB 1BYUA 3PR1A 1IY0A 4GMXA 3UMRA 4QKQA 4CGZA 4NU0A 2AD1A 4AY2A 1QRAA 1FFHA 4HUTA 1DG3A 4LX0A 3M91A 2VP4A 1JR3E 1U9IC 3K0EA 3K0FB 2NO9A 4QNRA 3HDTA 3TVDA 5IK2D 1P62B 1RJ9A 3U44B 4XIGS 2OO7A 3T1TA 3UANA 1US8A 5CIWA 4ILEA 4V0LA 3FHTA 1Q12A 4BFWA 5AW5B 3CBQA 1CJKC 3B2EA 4KJZA 2BBTA 1GM5A 3THWB 3A5TA 5JMTA 2V6JA 4D0LB 1OFIA 3KQLA 2O8BA 2W2TA 2ZE8A 4R2IA 2J0VA 2OBLA 2VHQA 4OK3A 4PO9A 3OFND 4TMXA 3UPUA 1GTWA 1D9ZA 1G21E 1S0UA 1TQ6A 4TZ0A 1CULC 1LS1A 4POAA 1VYUA 2WKPA 3U3RA 2OV2A 3IIKA 2AWNA 1JJVA 1XD9A 2FSFA 3K09C 1YR6A 1N6OA 2XSZD 1S4QA 2Q0HA 2FNAA 3CRW1 1G3UA 3GJ0A 3AKYA 3PIRA 1GK4A 3U6BA 1HUCA 2IYTA 3PXGA 5D3QA 2XITA 2IUSA 3TJZA 3ADDA 2BASA 5L3QA 5B58C 2JLWA 1NNEA 1Q1BA 4YONB 3AH8A 2EVWX 3LLUA 3N5CA 3L8ZA 5LB2A 1Z0IA 5JFGA 3ZRXA 421PA 3U3JA 4PHTA 3IUYA 2GKSA 3KXLA 4NHOA 2JJLA 1AA9A 3OESA 4TYNA 1GVNB 4OHYA 4JLOA 4Q9HA 1HYQA 2QQEA 5G53C 1FMJA 2XZPA 4M1SA 2OLJA 4KSBA 4D4MA 1M1YE 5EP4A 3MWLA 5E7IA 3CWZA 1OIXA 4OQFA 1G16A 4EQ6A 2BJVA 2R3CA 1XTRA 2ZI3A 2VF7A 4WAUA 4CEHA 2X77A 1E2KA 3NH6A 1W49A 3HE4B 1G6HA 1P60A 1Q44A 3HPQA 2X8AA 4KI0A 2ZJBA 2VTKA 3LBIA 3KTAB 2A7QA 4U00A 1IXMA 4B34A 3QPWA 3E5HA 4HLDA 3QBTA 4KBFA 1XZQA 3Q3JB 3E1SA 5C18A 2OM2A 3SQXA 2R9VA 5IDVA 2JLVA 1VG1A 4BRUA 2IF0A 3EZ2A 1FTSA 1HE1C 4A8JB 3CRVA 2FPKA 2FZLA 4N0DA 5AJVB 5DSZA 1NJGA 5C1BA 1E1RA 1G17A 3K70B 2ZRAA 3IR9A 1JEDA 4NP6A 3VNUA 2ATVA 2DCUA 5DN6D 1VKJA 4ACBA 2Z4RA 3A37A 4KLZA 2XZLA 3T15A 3N2EA 3QXJA 4B3FX 2GXAA 1Z47A 2ODNA 3T97A 5APVA 3T35A 5APUA 4M1MA 2IHBA 5JWOA 1OH5A 4LYJA 1NVWQ 3GLGA 2C04A 4GOXA 3TR5A 2VSOA 4IDHA 3PFIA 1QDEA 2P5TB 3D6TB 4KBGA 1RRGA 2DFNA 2V1UA 3O47A 1Z08A 2AXNA 2QMEA 2ZI7A 4GOKA 4DRZA 1XTIA 3Q9LA 4M1TA 2C9NY 3B60A 3EAQA 4Q18A 1GNPA 2GCOB 3P20A 2YJTD 2Q21A 3QBVA 1HQYE 2J5XA 4PQYA 4ABYA 2WPDA 2F3RA 3TVTA 3M06A 2ZU0C 2O8DA 5HTKA 2ZE7A 2ZR0A 4URYR 4V0OA 5IDJA 4WOPA 1IN8A 3DZDA 4PX9A 4B48A 4JJZA 4Z54A 5K8UA 3GLFB 4Q5IA 3SNHA 1NJFA 1VG9B 2VHTA 2BMJA 3TSWA 4JSYA 3HP1A 2JCSA 3WBKA 3C14C 4G1UC 4MKFA 3A6PC 3U3KA 5AVXB 4LYHA 1IO4A 3A4MA 2C2AA 1OSNA 1XNJA 2KWIA 4OI1A 2X1VA 5LPNA 1X86B 3KFVA 3AVVA 4A36A 4RY2A 3SJCA 3P1JA 3ZD6A 2ONJA 1DPFA 3KUDA 1G3MA 2ZUBA 4RD3A 4B6EA 2C8VA 1FZQA 4RKFA 1P7CA 4IDNA 1IM2A 4P4SA 2N46A 3TMKA 4DSNA 4GCZA 4FMDF 1F6BA 3BFVA 1KI2A 2QAGA 2P6RA 1E1QD 4FN5A 2H1LA 1GK6A 1S3GA 2JA1A 5HE9A 3D7MA 1XPOA 3HU1A 1W4AA 2X19A 2AR7A 3KL4A 4JBYA 4M2LA 1EX7A 4TMWA 2OXCA 1GD2E 2OXRA 1KGDA 3UMSA 2N42A 2J45A 2GJAA 5FTJA 2ZSBA 1YYCA 1BO6A 1OXVA 2GCNA 4OL0A 1GZLA 4DCNA 3GLGE 4MH0R 1G4UR 4QNMA 3GP8A 2OG2A 2PEYA 4AYCA 1G3IA 1JJ7A 5FUXA 3JVUA 1GG2A 2IYSA 2OLKA 4RESB 4BZQA 1SHZA 4MRPA 1E1RD 2W0SA 3BJIC 3CONA 2GBLA 3WNDA 4QBHA 2RGGA 4HAZA 1WMSA 1Z2CA 2QP9X 4MGKR 4Q03A 4A2QA 2XXAB 4AYXA 3U3MA 1T5LA 1S2MA 1X8LA 4M1YA 4Q9IA 2OE2A 2ZYUX 2R32A 3GLHE 1CS4C 3ONWA 4DSTA 4M9ZA 1C4OA 2XAUA 3ZGXA 2D7DA 1XDBA 3CZQA 2RHMA 2QEQA 2HUPA 4B3CA 2XNDD 4QC2A 4LBZA 2CLSA 3RHFA 4KITB 3K0SA 4YMSA 1KJZA 1Q20A 1E99A 2ZUDA 3QEJA 1CJTC 1E1QA 5AUPB 1T0JB 3MLEA 1E6CA 1T0HB 1CRQA 1EESA 2BDTA 3SBDA 3B82A 2W0MA 2CBZA 4RD4A 3I8SA 2GJ9A 4DLVA 2X2FA 5FL7D 1OW3B 3K8YA 4Q1EA 5BN5A 3M4YA 3DHWC 2YC4C 4B2IA 2DBYA 3FMFA 3EX7C 1JAIA 4UNPA 4EFMA 3MAAC 1U9IA 4FCTA 2WKRA 5AJYA 2ZQ5A 2A3RA 1DBSA 2QAJA 1DAGA 4HB3A 1LFDB 1OH7A 1GTVA 5E7MA 2FGJA 2ZREA 1HUQA 2ZR9A 5EZ5A 4R98A 4RD0A 5FR1A 4UNRA 1OE0A 4JAUA 1II9A 1TNDA 3WYAA 5JJLA 2XNDA 2GVZC 1M7HA 1BOFA 1NRJB 3OAAA 3QY0A 4P4SB 1YKSA 2IC5A 4B33A 1E9EA 3I8XA 2IS6A 1CJVC 4M0LA 4ON9A 2F1RA 5EXXA 3LBNA 4PC2A 2ZRBA 4QFMA 4JLMA 5KTYA 5EP3A 5IF9A 1T8UA 1OXSC 1ZUIA 5DHAA 4CEIA 3TUZC 1S96A 2PX0A 4RD2A 2HT1A 2WWWA 1UDWA 2WWYA 4U02A 1XP8A 2ZSDA 4DDVA 1QG2A 3BBPA 1RPZA 2CHGA 1TX4B 1Z28A 3DO6A 3IKJA 1US8B 4P3YA 1Q1EA 3KXIA 2OBNA 1RYHA 4M53A 5LDDC 2JDID 1SVMA 3F0TA 1DEKA 2ZRNA 1KJWA 2WZQA 3THWA 4DIEA 1G2CB 1E9DA 2NPFA 4XWAA 2OESA 2P3SA 2N9BA 1W44A 3Q85A 4U7OA 3DZ8A 3NIBA 3A1WA 4JL6A 4X8HA 4CT5A 2CDNA 2XTMA 1OYWA 1U0HC 3LX8A 3PEYA 4G5GA 1TMKA 4QPKA 4TLDA 4DB4A 2ODWA 5L8VA 1XZPA 4B35A 1TUIA 2W2XA 1CXZA 2RHDA 2ZRLA 4NYJR 1GITA 5TDHA 3VR6A 2WSSA 2XXAA 1E9FA 1W0JA 4UNSA 4ZO4A 1J2JA 4IDPA 4GP6A 3LWNA 4OK6A 2OEPA 2J0UA 3B5JA 2V54A 1IY2A 3L0IB 1HTWA 3BERA 4C46A 2D06A 3DEFA 5CYPA 1SXJD 4LSGA 4NCNA 1E0JA 1G64A 1N0VC 2F1JA 2DFLA 1KY3A 1NN5A 2R6FA 4C0LA 1SVLA 3TLXA 2DR3A 4TL6A 3QE0A 4BWYA 1SLQA 4TN1A 1X8JA 1KQLA 1XEWY 2W6ID 3NG1A 5CMZA 4HATA 4HAYA 1G7SA 1CP2A 1T8TA 5EE0A 4Q02A 1OB5A 3EC2A 2B8WA 1WBDA 5APTA 2RB4A 3VR2A 1NMYA 4Q4JA 1ZNZA 5DGXA 1EFRA 4G5SA 1D6JA 4PPGA 3RNLA 2D7CA 3TSOA 4A1FA 3I5YA 1G291 3FMIA 3LQQA 4EPYA 3ADKA 3VR4A 3ZQJA 1TQ4A 1VCOA 1YJ5A 3EW9A 3IIMA 3OE7A 4TLBA 1E2LA 4RZUA 4TL8A 1KDPA 4LYAA 1TF5A 4US0R 2IYYA 3W5JA 1IN4A 1TU3A 1U8ZA 1GU5A 4CEIB 3P7KA 4B71A 3TK1A 4DIDA 4Q20A 5HCNA 4KV9A 1UAAA 1DOAA 3RS2A 4BZXA 1YQTA 4ARZA 1T9HA 1TADA 1ZMXA 2YWEA 3FPAA 4IJMA 1UFQA 2FN4A 1OLOA 5TXGA 4I4LA 1KSHA 4Q21A 3R7WB 2ZJOA 2V9PA 3GJ4A 1A1VA 3G5UA 3LIEA 5AVZB 3CB4A 5JEEA 2QI9C 1KOFA 1N6HA 2IBMA 2GESA 1SKYE 4RCZA 3AVXA 2ANCA 5AW4B 1W36C 2ODBA 2WIBA 4V03A 4BLPA 1U81A 3I62A 3F3YA 4RKEA 1OWAA 2HF8A 4PZYA 4RFSB 2AFIE 2Q3HA 2VA8A 2ZJAA 4XE5B 1KDOA 4TMZA 4ESHA 5G3YA 3GJ5A 5IK2A 1ZM3A 2OFWA 4W5WA 1FUUA 4AKEA 3SN6A 1SKQA 1YHNA 2BKUA 3RABA 5A5GA 3FFAA 1Q1QA 4XH9B 1ZU4A 1IOZA 4HDOB 4PANA 4FINA 2PT7A 1SXJE 1GUAA 2P6NA 4D4JA 4MYUA 3H86A 5FBQB 5EUMA 2IS1A 4M9QA
chains in the Genus database with same CATH superfamily
4TLLB 4DIBA 2X3FA 4QUEA 4YUVA 3QPAA 2CGEA 1NP6A 3ICQB 1BXRB 4H4EA 2MYUA 2XZTA 5DI3A 5IH3A 4B3TO 1T9CA 3CNLA 3JQAB 5AJXA 1I2AA 3H1HD 5E6RB 1YIJV 2C03A 4LDJA 3V4FA 4P9NA 1PUIA 3LUBA 4LBEC 2ODPA 3V2HA 3NAMA 2W98A 1IC6A 5LYYA 5KYVA 3RJTA 2RDCA 4QOHA 5GV8A 1M1KQ 1YRAA 1Z83A 1PR1A 1S2EA 3NANA 1EJ0A 1HM5A 3TQQA 2VLIA 3HKDA 3WLJA 3D3WB 3K0CA 3ENZA 3ADCA 4MVJF 4B3XA 3EQZA 1P84D 1Y9DA 2QTVB 3CZ4A 2RK3A 2B1QA 4QJ4A 1PO7A 1V9CA 1FLAA 4RGYA 1TVKA 3GRCA 1Y3BE 2BMWA 4I1OA 4IOLA 3VTPC 5C8YB 4JLNA 4XWTA 4NBRA 1DS6A 3DZFA 2WNSA 1T13A 2BMVA 1AXRA 3P4XA 4R1LA 1YTLA 2FYUJ 1R6KA 4XWWA 2AXQA 3TTYA 3LIIA 4BQEA 2OUKA 3OO1A 3H8JA 5KNCA 4JLSA 3RJ9A 3LV8A 2EIJB 3E1RA 4FGJA 1GLNA 2MMCA 2ROQA 2NO5A 2D1FA 2L0XA 2KXPB 1CW5A 1SXJC 1VJ5A 3AESB 3OX3A 4UBIA 3U4IA 5CJJA 3P30A 3OTOB 4MR7A 1PNTA 4XEHA 5LBTA 1AURA 2ATKC 2EBWA 1XFDA 3I6IA 4GZRB 4MQFB 4Q3LA 1RWMA 4PX5A 3NJ8A 4TSFA 4XFJA 1K66A 3PE4A 1PP9E 1IH8A 2X2EA 2W0XA 1JA1A 4GKGA 1TVCA 3BZUA 2EFJA 2IXAA 3JWGA 3OKPA 1HJBA 4E3WA 1SXPA 1PX2A 2GXQA 5GM1A 1O57A 5EIBD 3WRXC 4D3DA 4QM6A 2LD4A 3O9OA 1XVLA 3W5AA 1GU0A 4Z0TA 1KK0A 1OAAA 2BFBA 2D2EA 1IZYA 1K27A 2HWWA 1JDUA 3THOA 4L4UA 4URVR 2I2CA 5ALUA 4OQPA 2FH5B 5FV4A 2BE9A 2ZBDA 4AIIA 3EDRA 3OZCA 3KEOA 4IIVA 4U3JA 4ENSA 5BUCA 3RIMA 2O4UX 4JIGA 4RFSA 3UB3A 1MEJA 1S2IA 2FLVA 1YRQA 1NIPA 1U97A 1FXWF 2IDJA 2IX9A 4IDOA 5ALXA 4ZU3A 3WGYA 5JQGF 1QH8A 3F2VA 4OA5A 2HG5C 2WT8A 3PPIA 3KDAA 3WHLA 3E7XA 4I55F 3RK2C 5AVKA 3E58A 3TLKA 4BVLA 1GUYA 5HMLA 3C6ZA 2AN9A 1LTTC 4NYJQ 4N0MA 3SCZA 2RCNA 2C99A 3ICWA 5IEBA 2ZIVB 3AE5C 4XQEA 4ANFA 9MHTA 1KI9A 2GZ3A 1HE3A 1RAIA 1Q86W 4XW2A 1X77A 2KMLA 1QCDA 1BXGA 2OCBA 1QE3A 3ROKA 3D3KA 3IURA 1Y6XA 2J9FA 4RE6A 4G28B 3AQIA 2H4FA 4JBGA 4D1YA 4JI3O 1G9XA 1O87A 3Q8MA 2HRQA 3P2JA 1XJ5A 2XWPA 3H4MA 4FNOA 3T38A 1XCMA 1SXGA 2BR4A 3TEFA 3PN1A 2XCIA 4PYJA 2B1IA 3EQ9A 3KZIE 1XMJA 4CM4A 5KYWB 1JN0A 2XHBA 4FUTA 1JMKC 3ABMB 4KP7A 4EPVA 3HE5B 4PDRA 1OFHA 1NURA 2JIZD 2X8LA 3VR5D 3HBNA 3DYIA 4PSKA 3VNQA 5BURA 4J42A 3BORA 4JV5B 1RRPA 2HWKA 3C3XA 1VLVA 3HKDB 1SUAA 4Q48A 3HO1A 5KWVA 1DHTA 1PJLA 1PD3A 3A3NA 4OEHA 5D00A 1T2EA 1EI9A 3SIWA 4F85A 2WWIA 3DTVA 2G6BA 4RZQA 4DV6B 1XXHE 2KBFA 4FYXA 3B1FA 3IAYA 3L0SA 4MCIA 3APQA 2KBEA 2HHJA 4N3BA 3IOMA 3QYFA 3KXPA 1E2JA 1YZFA 4MGYR 5F2NA 1MX1A 5EN4A 4QRDA 2DUNA 4B87A 1WXXA 4YAGA 1SQBG 4MQLA 5EXXA 5I7AA 4B6JA 4HWRA 4PELA 1D2DA 2BKAA 2YZ2A 2HQBA 5AK0A 3RSGA 3P26A 2AG0A 1ZUQA 1P84I 3FB7C 5DW0A 5K3AA 1ULBA 3S99A 4BRWA 5LKAA 1E9AA 3I01M 3JQ8B 3SHVA 4Z9AA 2ZM5A 4DR2O 2HP8A 1BHQ1 2YIDA 5LHHA 4GKJB 3H6PA 1QANA 2IOHA 3U4HA 5C5EA 4X65B 2BIFA 3RF6A 5K51A 5JT1A 1P4AA 4QD3A 5HFMA 4EB3A 1GA1A 2AD5A 1AA0A 1C7IA 1A32A 1T2DA 4IZIA 1G6KA 5JADA 1E2IA 2OSVA 4N8EA 1GQFA 1V1RA 1VQ6V 1NVFA 5I7HA 5JFOA 4DMUB 3P19A 4PY2A 1Y63A 2M0BA 1YRBA 3PUZA 3FYIB 5CN0A 1KF0A 4P3YA 1FKAO 3S9OA 1EA7A 1X13A 1ZV8A 2GK3A 3M5PA 4HUQB 4MRMA 3VOBA 3CRAA 2OXEA 2ASEA 1CUVA 5CBPB 5JOQA 2Z1MA 4HK4A 1NV8A 3QE4A 1D5WA 5EHQA 2JFNA 4BX2A 5JANA 1SHKA 3MINB 4ADSG 4EJSC 4ZJUA 3NXKA 2A5YB 1FPOA 1L4LA 1KKDA 5FQNA 4ZJPA 3NNDA 4OH7A 1GRQA 4A2PA 1X9HA 2IPMA 3MBKA 4GAEA 2GF0A 4HQRA 4OM7A 2A06E 1T2NA 2QUBA 3QFTA 2B7CA 4GF5A 4PBTA 3INRA 5JVDB 3SR0A 4F5ZA 3OT7A 1F9EA 3GP3A 2OXTA 1CF9A 1EWYA 2QENA 2VHYA 2OT5A 1W85B 4DLWA 3AILA 2BHNA 5LBQA 1TZKA 3FBWA 4JBWA 4WL0A 4CHTA 5KKNB 2VS1A 2IS4A 2YS7A 1T4DA 4Z2YA 2J87A 4IYHA 1OFVA 2CVHA 2VUUA 1TM7E 3T41A 5BU5A 1SQPJ 1D4FA 3A6LA 3UAVA 4C6TB 3C3TA 2BBOA 2C7GA 3CCSV 4B4VA 1HFWA 2K2WA 3SFDC 1NF8A 3Q0TA 1PJZA 1JKIA 1G21B 2AH5A 3MWKA 3ANNA 2WLMA 4MPRA 4K6FA 4HVTA 1I30A 1O4VA 5EIEA 2VQ3A 1XEFA 1G1XB 2A4KA 3CVJA 2F90A 4ZOBA 4JZYA 5KYXA 1KQ3A 3KCXA 5DDIP 2NZ8A 2OTCA 2SPZA 1D6MA 3H5RA 3RIXA 3GT3A 5JAZA 4K9LA 3STTA 2YVUA 5P8WA 3WLIA 1JVBA 1UJ4A 4EKNB 1GMGA 5C46F 3HCEA 1TQ2A 1CDDA 1KO8A 3B7WA 1VQMV 2YI8A 1GUDA 2XQFA 1X3SA 3AV0B 1DX6A 1EAYA 2HBQA 3TE7A 2Y0DA 1QV6A 3AZQA 3BFRA 2HDWA 3EARA 3NOOA 3Q12A 4X61A 3RKSA 4COKA 1UBSB 5IMBA 4EQZA 5JNUA 1N73C 1J1EB 2X3YA 1ZLXA 2E75B 2YVAA 1Y47A 2XZDA 3GG2A 2POQX 3H0EA 1OHHG 3U7RA 4YCLA 1QL2A 3PUJA 3EWNA 3PC3A 5KDDA 1JT2A 1R0ZA 3NHBA 3QWOC 4CZ2A 1KZYC 4PLYA 5DWDA 2P3OA 1SQQJ 3D5EA 4B4KA 3GB7C 1JFRA 1K8XB 1P4HA 4RADA 4BKUA 4LDZA 1NV9A 1KYOE 4I2LC 1J2UA 5HJ5A 1DEHA 1A8IA 3D36C 4C2TA 1SVOA 3FIJA 1J9GA 1ULSA 1QAQA 1TIPA 2J7PD 1UANA 2JFYA 3GZTB 5FLEX 1TRHA 2PWAA 2Z5LA 1N5OX 1LJ2A 3ZRSA 1ZCBA 3L70J 2XB6A 2WFLB 4GI3A 4KFRA 4TV8F 3GARA 3DONA 1OHHD 4CS2A 1V1JA 5K3CA 3EHEA 5JI2E 1KZGB 1MVOA 3ZBPA 2KNCB 3GGDA 4UB6Z 1F14A 1O2DA 2RSLA 4QOGA 3S5UA 1V2GA 3VAYA 4WBNF 1JUNA 1DKPA 1J1DB 1P61B 3U3DA 1T29A 2QWPB 1MG0A 3E1GA 3CLRC 1KILC 1S1CA 3SQOA 2PTGA 5JXGA 2EIXA 2VDMB 1KU9A 2XWJI 3MOSA 4LNHA 1JWBB 4KR6A 4MQBA 4D4IA 3ICOA 4FHZA 1P72A 5FUWA 5CBFA 2JGKA 1E66A 5DCYA 4CIAA 2POHA 4X1OA 2GN0A 4ZA2A 4QL3A 3K6RA 5ALVA 4W8GA 4YJGB 4XKJA 1RFGE 1I0HA 3S3XA 1QL1A 4ID3A 3M0EA 2OYRA 1ZNYA 5L3DA 1II8B 2XB4A 5EAIA 3HTKA 5A02A 4B3RB 1SQ5A 4FMCB 4IGAA 5HQ3A 1P2SA 4RHCA 3EIXA 4L7VA 1DV1A 5CVDA 1ZUNA 5ALZA 2Q2OA 3A6JA 4FGKA 2PL3A 2NPSB 1VMAA 2D3TA 4BRYB 2JEOA 3CINA 4P2ZA 3P9YA 5JD3A 2SKEA 3V1YA 2V6IA 2SBTA 4JVMA 1YZQA 3U3OA 3LW7A 3L8HA 3T5MA 2HHHB 3SS7X 4CC6A 2E4VA 3QX9A 4QFCA 3LL7A 4WLNA 7ADHA 2FX3A 5JQGA 4KI7A 3CUKA 1YVEI 4DDTA 4LFBB 2UYYA 4CJXA 5JIBA 1Z4LA 4RKRA 3JX9A 2IOFA 3G3ZA 3ETHA 4M89A 1UQRA 3IAS1 2A9VA 3W68A 4NV1A 1VQ7P 3GFVA 1K5HA 3ZMUA 3GPBA 4N6GA 3DV9A 4BFZA 2CVOA 1DTSA 1O5TA 4MVWA 3UQYS 1DEBA 1FFEA 1ZJYA 3RANA 1VL8A 5IP5A 5JAQA 3R75A 3STVA 1XBLA 4UUJC 1LD3A 1G8GA 1U0LA 4FYMA 3C3MA 4ZYTA 3C48A 3DLBA 2XWSA 2C7VA 1YRHA 5ALLA 2QL7A 3KK0A 3PFWO 3MUDC 1TEZA 3FOZA 4KRFA 4MTFA 1V9SA 2H5LA 1VL2A 1E5QA 4IUCS 4Q00A 1QF6A 2PKWA 1N5JA 1L5NA 821PA 3ND6A 1S7CA 5B5EH 1SQGA 3MTJA 3UIEA 3TTVA 1E4YA 5AOBA 3K4HA 4KLRA 3PJFA 5DT2A 4G9BA 3E9DA 2CUZA 3T5DA 4EHLA 4D0NA 4D45A 5IABA 2FHPA 5B4VA 3LGXA 1ZBDA 1OXZA 2DQZA 2HA4A 4MUMA 4QXAA 2NUTA 2JLQA 1Z5PA 2QTOA 4IOJA 4QSMA 2PGIA 5KTOA 3Q5GA 5I9LA 2ODAA 5ALJA 1UBEA 4G36A 3ZTTA 3VHRA 3F1KA 4QAQA 1KYOD 3EF1A 1F8YA 3KQVA 4KQWA 3W1VA 4IAOA 4HD8A 3V32A 2ZIWB 3WIDA 3RVOA 4AJ2A 2BCEA 3HA3A 1L5HA 3VNAA 2YIJA 2FTKA 4HFJA 3QWHA 2WLKA 4GBGA 5FNVB 1UJ5A 1Y34E 4I5IA 3SXPA 1V8ZA 2BFBB 2VFAA 1SC6A 3QFHA 5F23A 3QO5A 4WW0A 1DD4A 3A4IA 3DOUA 4C0QC 3ZCRA 1CETA 1EFUA 4LA4A 3MSXA 3OLXA 3P8MC 2JHPA 2ZI4A 4CTKA 1Y98A 3PGJA 4DSUA 1JVNA 3CUYA 4HDNB 4JMLA 3RARA 1N7LA 4DVJA 3COJA 2O1SA 1VDFA 4CEHB 3ZV3A 2LPMA 4JXJA 1HFJA 4V0NA 3U0BA 1K0UA 3F49S 5FI3A 1Y3CE 3WKAA 4BMOB 3LC0A 4L4XA 3A2MA 3KR0A 3SSAA 1LV7A 1WZ2A 1JA0A 5JWRA 1RZRD 2ZS8A 3BXFA 1COWA 3WMFA 5ENDA 4MDFA 3ZW9A 4PC6A 1W29A 4YV1A 2FPSA 4JITA 4DR5O 1KU0A 2J46A 4HTFA 3G1UA 2ZIXB 4LE2A 2QJWA 2WLTA 3OIVA 4IVRA 2JC3A 3CMEV 3AE7C 1UFRA 4O25A 3A7OA 2Y0PA 2C54A 1U2GA 2YXDA 3GBPA 4KXUA 4OGFA 4Q7JB 4WLUA 4A15A 1WAZA 1NTZJ 1BT8A 4AAYA 1EE9A 1Q1GA 2KB7P 1U0RA 2QXTA 4IOKA 2GJSA 1CJMA 3A0RA 2X5XA 2I29A 3EXG2 1HURA 4CT0A 1EX9A 2V4DA 1JEKA 3USSA 3A1DA 4TTAA 5HBGA 4KFSA 2JJQA 4XDHA 1UFOA 2DHQA 1H2LA 1HEIA 3S3TA 5BWLA 4QPPA 1UDXA 4GBJA 3MVEA 4CCYB 1WSDA 2VQFO 3ZOZA 2VUTA 1N1MA 1B6GA 4GKKB 4H0NA 5G3ZA 3VPFA 4GKVA 1R9JA 5EIXA 4IIJB 4ITVA 2GETA 3QYJA 1NI3A 1OCEA 4H0LB 5FJJA 3T1NA 2GA8A 2NYRA 1SUIA 3LLSA 1C14A 4I4CA 3TNUA 4Z99A 4BRZA 1EK0A 5JO0A 3UUEA 5C8ZA 3HXMA 2ATXA 1BSMA 3EXIB 1HDRA 2ZM6O 1JI0A 3BQ9A 4LRXA 3L92A 1SHJA 3VMXA 4MZDA 2X8JA 4I50A 5BMOA 1L4HA 1OFUX 2ZR7A 4R2HA 4JASA 1O97D 5MF6A 3PF8A 4DIMA 1SNYA 3SJ7A 5KLVD 4JA0A 4Q05A 2P4EA 3ABSB 1ZD1A 1GZ3A 2ZIOA 1KPIA 1K4CC 2H43A 4LF6B 1LBEA 2YOHA 2L82A 2Z83A 4K9RA 4L6AA 4NESA 5CIQA 2FZKA 2JJ1A 4OPAA 1TC2A 2JLRA 1YJWP 4ZXPA 4B83A 4J3NA 1BFDA 1AX9A 1H8HD 2W58A 2YYSA 3E48A 3MUOA 2H9YA 1GGHA 4CH5A 1DQZA 2H7XA 2XW6A 1DG1G 1GGNA 2GBLC 3HCPA 4H3KB 1BCSB 4L0CA 4FHDA 5H3LA 3LHFA 4IJ6A 1N2OA 3CJHA 1AU9A 2CCGA 2VXBA 2MSDB 4XDKA 1SRYA 1KDTA 4HEA6 5EJEA 5HP4A 1IONA 1G6Q1 1KTMA 5FNVA 4MPDA 4K9MA 4PLGA 3GLHB 2R7KA 1HFKA 3OFSA 4R05A 5B1HA 2QG4A 3BOSA 1Z0FA 3AUXA 4P54A 3L0PA 3L36A 3JQ9A 1UAYA 1VSVA 1A8PA 3ASZA 3AU9A 3MSCA 4NYMR 1H8HG 1N9ZA 4KHZA 4XR4A 1CY0A 2IGTA 2OL4A 5H3CA 1TZMA 4BNIA 2CXUA 1OOEA 1MTZA 2PYJA 3GCZA 1KO7A 3EVKA 1UKZA 4R0NA 5KC8A 3HB9A 4Q4JB 3L37A 1T34A 1L7QA 3AG1C 1Z7BA 3V46A 4OI0A 4NSNA 1JQLB 3B5IA 3L7IA 1JXQA 4GO1A 5K0JA 4XVUA 1UBOS 4UCUA 1LK5A 2ZU6A 3CZPA 1ONSA 2UUPA 3L49A 1IHUA 1WEHA 4UDYX 2A88A 3DVAB 3DV2A 4NJEA 3ZS8A 3H2IA 4ZT2A 4HTFB 4MW7A 1VQ9V 4KYTA 2WT9A 1ND6A 1SEVA 3BE6A 3I73A 1M2OA 1OTYA 3RAGA 3ZY2A 2Z4TA 5EZYF 2QYHA 1CEZA 5AVTB 1W1IA 4FEYA 4NZYA 1IFJA 1CQXA 1QHIA 4OXYA 4YMVA 1GYPA 3FIUA 5TVGA 1FZCA 4DARA 1NXVA 1AUVA 2AKAB 2AKYA 4HKTA 2O3QA 1VQ4P 1W6RA 4EENA 1C80A 1G4AE 1KERA 4G5RA 3V1NA 5KYXB 4FNAA 2HJFC 3VOUA 1KGSA 1Q0RA 1PI3A 3HYNA 4YLEA 1XEQA 1S6YA 3OAAD 3R7BA 4GKAA 4NENB 1BS2A 3DBOB 1B23P 3RYFB 2JEXA 4F6EA 1QHFA 3L74G 1P6QA 3Q10A 4D79A 4UTPA 1MZEA 3M6AA 4Q3AA 3L8FA 5LL6Y 3EG9A 4FQ7A 3HD7B 1T25A 1E9CA 1YV9A 2WWHA 2IUTA 1QK3A 3HN2A 4GRIA 2H57A 4L6CA 4GMGA 4PX3A 2CMDA 3RUFA 4C0HA 4DA8A 5LQMA 3BCRA 5FUBA 1KDRA 4A91A 2XTNA 4HYQA 2X6AA 2QA5A 5TISE 2DKOA 4AJHA 2DWUA 4QOSA 1SQQE 2XUIA 4HRYA 2PGDA 2I71A 2K1AA 5TQ2B 3V4VB 2AX3A 2PR7A 3T1QA 5IN4A 3EJWA 1TYZA 2VG8A 1ZWKA 3ESRA 1U1IA 3ZU6A 5KHHA 1DLBA 1Z2OX 3TEJA 1PP9H 4OM8A 3IOYA 1FFTB 1Z8HA 5B1NA 4M8LA 4R2XA 3S2YA 2WMNB 5ADUS 1T3HA 2VAWA 1QAMA 3AHCA 4U3FG 1HH0A 2GZMA 4WLFA 2GD6A 2QGZA 3L8YA 1NF3A 2BHSA 2GZHA 2WA4A 1Y4ZA 1NSTA 2KLBA 3OEHD 4FYIA 5FEMA 3HCWA 1QP7A 2FSHA 3DUFA 4OMFG 4HFMA 3LDCA 1IK4A 3DM5A 2QUIA 1H2KA 1AR1B 1H2YA 4PGHA 2GHQA 4BV3A 2Z5GA 5HJEA 2E4AA 5HG0A 3PLAE 2QJPC 3E2EA 1UWCA 2GDSA 1UOOA 2ZSUA 3UTCA 2RMZA 3E7WA 3K71B 4DYDA 2GF9A 1NSFA 4BAZA 1BTOA 1U94A 2F8TA 3L74E 2ODQA 4DJTA 3QVGA 2IU6A 4G0XA 2I6TA 4QDZA 3MWEB 3SHWA 1XAJA 4MVJP 2Z2JA 1A9PA 1ZHOA 5L4LA 4R2MA 3U1CA 4FFMA 4LWSB 4OOEA 2WSEJ 3B8MA 1AK1A 4LGCA 5HF5A 1R0CA 1Z25A 3E3LA 3FKSA 2V7QH 3TIFA 2CTPA 1UZUA 4AJOA 5K8LA 4CR8A 2IHNA 3L9DA 3NOQA 1LQ2A 3FTQA 1R88A 2Q5LA 4MK4A 4OU5A 4AI6A 3NHYA 4D4HA 2VWGA 3KQPA 4RVOA 2PA3A 4C7MA 2XECA 1BHBA 1DP4A 2YV2A 4JKYA 5KA6A 1SQVE 4WVZA 5BR8B 4H4CA 4E11A 3ANMA 4BL5A 4YV7A 4XIIA 4WFGA 5J2TB 3W8RA 4LF7B 2V7QA 2UZIR 4PPFA 1SU7A 2DEUA 4I7ZC 4PAQA 5EPUA 3KZIZ 2VPWA 1P18A 3QNUA 4KAXA 2GK7A 2RGCA 2EZTA 5B7QA 1M66A 4RTRA 3AEUA 1NAHA 1GZHB 2O2EA 4QECA 4YCDA 4XYLA 1FZCB 2ZB3A 3EWKA 1V6AA 3S8EA 1ENYA 3SF8A 1ORTA 4MR7B 4OHVA 2YIUB 4AS1A 2Q1XA 1EGHA 4ZGGA 3FD8A 4J41A 3ICEA 1YKFA 5T4BA 3EGIA 2P4KA 1QVWA 4O4IF 5EE3A 1W8IA 5JV5A 4LGDE 3LUTB 2A6PA 1MH9A 2FEXA 3W6UA 4KWHA 4RWUA 1DAMA 5B6IA 4V0RA 4OJNA 3AE8C 3AECC 2VT7A 5GW7A 4G89A 5DFAA 3O8QA 4FOTA 5L8RJ 5ALPA 1T6AA 2EATA 2GAOA 3DMGA 1SU6A 5BN3A 5BWOA 2P91A 3JS5A 3KVOA 3ENVA 4J7AA 1TIKA 1YIDA 3INNA 1T5BA 2HMSA 4N5NA 4A16A 1RWBA 2RHRA 3I92A 4DJAA 2GTHA 1Z56C 2ZCUA 3KTOA 3CH6A 1R0KA 2IYZA 2H1CA 3BB4A 5BMVA 1QGDA 3HUDA 3K6JA 4YJ2F 3WWCA 4D9MA 1Q6UA 3DC2A 1JTHA 3I30X 4IQ4A 1NRIA 3KUKA 4INZA 3FLBA 2Z30A 1QH8B 4N7MA 3IC7A 1Y80A 4UBNA 4HDQB 1IVSA 3CCRV 1SFCD 1E7YA 1WRGA 2Q0SA 2I2FA 1NLZA 1VQLP 1V8FA 1IQ0A 1DAIA 3EEQA 1X1SA 4X1YA 2DT5A 3EIHA 3I76A 1KPHA 4LV5B 4P5EA 5BOVA 3S2EA 5A9SB 5ITVA 5TGDA 5A3RA 4RSGA 1J25A 1W88B 1Z4NA 1SHTX 2XF2A 1L4EA 4IZHA 3NBKA 4E31A 3JW8A 4O5OA 4Q37A 3PCRB 1MA0A 4NE2A 1PAUA 3RB8A 5GJCA 1GG8A 2R8RA 1O97C 4BUJA 5JYCA 3H9EO 4FSHA 2M5AA 3ETJA 3BYZA 1ZJ4A 4Q1DA 5HZHA 1U3TA 2VRCA 3BBLA 1OZHA 4EYOA 4R1UA 5JJKA 1JZTA 3DFMA 3VSCA 4CWAA 1TUEB 3HD7D 2JFXA 2JJ2A 3GOHA 3EIQA 4ARUA 4D9EA 4RTKA 3GVIA 4DUGA 2ODMA 2G0NA 3KALA 2W22A 3SXJA 5K3OA 2E18A 3DJYA 2WF5A 2NTNA 3KZXA 1XNQB 4ID9A 1C9DB 1E5VA 1CI6A 1WT6A 1GTSA 3F5TA 3DJFA 4Q7QA 1GUZA 4DAOA 3FWPA 4KHPO 4OSPA 5JALA 2JLXA 1UBFA 3HBLA 3OTQA 3QLVA 4YB8A 1KILB 2BR5A 2JAHA 5LHIA 3CO0S 2BEUA 3U4QA 1OXUA 2IP2A 4KB5A 4YJ3B 1KI6A 1WF3A 2V8BA 2C4UA 2ZKIA 1E1CA 3M83A 3O91A 3WHPA 1YOVA 5CA1A 1B8VA 3T9EA 1R7RA 2CWWA 2VYFA 3OLQA 4WFAV 4KL8S 3AJ9A 3N74A 5ECDA 3ABMC 5ITZB 2EWMA 3UJHA 2B87B 1VF6C 2W9XA 4OJTA 4F6CA 2JIOA 1RM3A 3ACDA 3KWFA 4IYJA 3NHRA 4P53A 4LQ4A 3FLEA 2VKTA 3GI1A 4RKWA 1H1DA 5CFOA 1QGED 3C8ZA 3GN2A 4DZOA 1RWXA 4IG4A 1V5FA 2G3AA 1EVYA 4JQZA 1MKMA 4MW0A 4IDBA 4UXJA 3CLTD 5BN4B 5A3JA 4MUNA 2D6FA 2Z5IA 3KM0A 1M56C 1BGVA 1R6BX 1GWNA 2J8ZA 4RVHA 1Y1KE 2B89A 1CZHA 2LGQA 4UQPA 3D6MA 4BNVA 1SVKA 1G8YA 2YFYA 3D7NA 5NLLA 3ZYCA 3GP5A 1U2TA 4Y1EA 4PXYA 1GN8A 1E0KA 4DK0A 2HV8A 4LZPA 5AW2A 5BXYA 2P90A 1WOYA 1ESMA 2HEIA 4UTZA 4N0QA 4TUYF 1E2DA 2HFED 1BH2A 4QYIB 4BLQA 2WYVA 3C8HA 4JC5A 3PCTA 4YLYA 5TISH 1MH1A 1ZIOA 2I66A 1ZY2A 2DFDA 3KPWA 5IBCA 2XEDA 2PMFA 5JZBA 2J5BA 3TQFA 2O2DA 3CX5D 4H0FA 4HDMB 4PLZA 4RPHA 4XUGB 1G98A 3TTSA 3ZZUA 1XELA 4TVSA 1YVPA 5GTIE 1VF5B 2A14A 2E5LO 2ECKA 3L43A 4W9RA 4DKXA 3UT0A 3DC7A 4X64B 2PSHA 3I2IA 3OEEA 2O01H 3WB9A 3ZVKA 1YXBA 4XRRA 1KSGA 4LVUA 4J6EA 3JTEA 3A2NA 1JR3D 1PW5A 2YZGA 4KWTA 5TRTA 4B2YA 2BYTA 1NM5C 4FXOA 4PRKA 3LMKA 4DMMA 1GPJA 1RKUA 1PWEA 4MS1B 3HDYA 3JATB 1M3SA 2PXHA 4S1OA 5HNKA 2J7KA 2WPQA 1T0PA 3CPEA 2G72A 1NVUQ 2QJRA 1UADA 3A25A 5DHQA 5BQOA 3LCUA 4BWVA 4KPFC 2WLNA 2O2YA 1SXJB 5C3MA 3DAYA 4JKOA 3WMXA 5AJWA 2LJ2A 3I6BA 2K9JB 1O6FA 3C6QA 4NATA 4N5DA 5APWA 1PFUA 2C3MA 1F4PA 1NI8A 2ALJA 3O95A 2H4XA 4H18A 1YBMA 3EXEA 3ILVA 4C7BA 2X9VA 3BMNA 3BSYA 3U31A 3PI6A 5ERYA 1R74A 4K8OA 1QLJA 4TL7A 4YIHA 4YT2A 3P27A 9LDBA 4M4SA 4BGVA 4B7EA 2IYOA 3IN6A 3Q7IA 4CHGA 5ERXA 5CPFA 1X7XA 3IOCA 4Y6GB 3ZVMA 3MTDA 4OQMA 3UPTA 1WUYA 2F93B 3A9WA 1OCCB 3GMDA 3H04A 3NBYC 4OLJA 3BAZA 1IZ8A 3L5OA 3SQNA 5LJLA 1A72A 1QS0B 1XUOA 2D5BA 1M2NA 1GGVA 2XUGA 4QFDA 4ATNA 3CZ5A 2K88A 4U7NA 4EG0A 1CBUA 1YZYA 3PITA 3KHTA 5A3SA 2OOKA 4GDOA 4CMIA 5A2GA 1GG5A 5F73A 1FSPA 4DCCA 4CS3A 4X92A 3U2QA 3WXBA 2ZTVA 1OV4A 5EBLC 1D7OA 3K9QO 3A9UA 2AFIB 4CEJB 1UMBA 1JB9A 1G1AA 2Q2NA 2OCGA 1IX9A 2WWRA 4HF7A 4OG2A 2QR3A 3SZ3A 4IDCA 5BUQA 2DWPA 3G9RA 5B3LA 1R4ZA 2QTTA 5IVDA 1EG2A 3VPHA 2UZ1B 4OB8A 5EIBC 1DX9A 3VU0A 4DLUA 1CUWA 2YQ5A 3AKDA 5CT9A 3WYCA 3A1SA 4BFLA 4KJXA 2JIMA 1DRUA 4E21A 3I28A 5CCGC 3SX2A 4F2DA 2V6BA 1NR1A 4QGAA 5DNWA 4HEA1 4HS9A 1RQ7A 1KAHA 3DZHA 3O7WA 3KKNA 1FTGA 4QXRA 4JGIA 4AQRD 3CCUV 1JB0J 4JUFA 3UGKA 1SK8A 3SWWA 4FLEA 4BX8A 3B85A 1PT6A 5KDOA 4O4LA 2CBXA 3R76A 3LDEA 4MVJE 3WQHA 4WFEA 3CWBJ 1T35A 4PRLA 1Q21A 4AP6A 4ENQA 2FFAA 5EEGA 5F51A 2BGWA 1DT3A 1JIKA 3VKWA 3WQRA 3U7IA 4NMLA 2EKLA 3DEJA 4Q34A 1F0NA 1FFCA 2J3EA 1MO3A 4DLAA 1P17A 5JJIA 4L0QA 4E4RA 4M7RA 1TU3F 2W6NA 4LNUB 1ZSNA 4L8LA 4X84A 1AP5A 2B20A 2P7IA 3BD7A 2OAEA 3W5BA 1PYGA 3ZDRA 1D4OA 2IEDA 2O2JA 3B9PA 1YITV 4JWTA 3GRKA 5FTMA 1BN7A 1ZVQA 3O83A 4G0MA 4DCMA 6PFKA 1RW4A 4H4DA 3PGA1 4HB0A 1V4NA 4NZZA 3W9BA 4EZEA 1MUUA 1R1BA 1FFGA 3ZE8A 4QJ5A 1ONBA 1Y6JA 4YA6A 3SSOA 3TLBA 1OH8A 3T7KA 3KB1A 4MPTA 5TJHA 4X6YA 3I64A 5D3MB 1YA4A 1GW4A 4KPUA 4UVBA 4QUKA 5LSAA 4PIMA 3X1WA 3ZGYA 1EXVA 1YA6A 4X6LA 3AJ8A 2BHLA 1JV2B 4QHTA 1K7XB 1SD1A 3BL8A 3KOZA 1GMJA 3L0OA 3MRSA 2L35A 4U2FA 4R41A 5D5HA 2LCFA 5EP2A 1FXVA 1LDYA 2OGTA 3FXEA 4P4TA 5C4MA 2XUJA 3T5BA 1SKVA 5ILOA 2QNRA 2V7GA 5G2OA 4NONA 1QO7A 4NYIR 4KMRA 1Z8DA 2ICAA 3IMKA 4ND8B 2IELA 4S1VA 1FD9A 3Q8KA 1FJKA 2WPVB 1PTJC 1N9GA 5JY6A 1U2QA 2CF5A 3QKSA 5AQEA 3KPVA 3WBFA 1UIRA 1L1QA 3M4ZA 1TKAA 3HSKA 1P74A 3LBAA 3PGLA 1MFTA 3SC4A 3AUYA 3H13A 1D5NA 5IT0A 3MGAA 4PNEA 1Z18A 1Y8ZA 3UA4A 1G7CA 4Y6SA 2NXEA 3AWIA 2IY7A 3P4YA 4WKPA 2PS1A 2JGLA 3AUKA 4X97A 5U4XA 1W76A 1NTMH 1XX6A 5ARCA 3W4KA 3E9EA 4AJ4A 1E3MA 2WE8A 4CIBA 4A92A 1NU6A 2OCKA 3GXBA 4RZSA 4XX1A 4ZAGA 4EWLA 3S1SA 2Z6UA 4WY5A 2WSSH 2RG1A 3NEJA 3W3AA 3EVEA 4FR2A 1TCVA 3DAPA 2P2ZA 1M90W 5CBHA 1OFUA 2FE1A 5ALRA 3FSRA 1QHHA 4G8JA 2K7ZA 3KIPA 5H83A 3K4QA 1Y42X 3ONEA 2QMHA 2CE7A 2QQFA 1AHPA 2AEFA 1DV2A 4BJ3A 4MWZA 1YHYA 5IAGA 3RC7A 3ZBUA 1L5YA 1WXEA 2BWJA 1Q8IA 1WLYA 2PD3A 2R85A 2PYDA 2QLNA 1ZK3A 3GEHA 2IUUA 4D4LA 2ERXA 4MWTA 3LO5A 1H2NA 2G9RA 1AT1A 3HLYA 4JP5A 1KNQA 4RA6A 3TECE 3U0VA 2I1JA 4AJPA 5LQAA 3WMEA 2F59A 3K1AB 4TT3H 1SUBA 2ZJYA 1VKOA 4KRYA 2P9EA 3KZ1E 2I1KA 4NCIA 1JIQA 2E37A 4P6VF 1U98A 3C7KA 3GUVA 3H8WA 3S44A 3UOWA 2CLOB 4TQFA 2CPBA 3NMDA 1JQJC 2VNKA 2QZZA 5DASA 3VVBA 1ENOA 1PFIA 3DBRB 3NC1C 3IDZA 4TT3A 2HGZA 2BAGA 4YIOA 3ABQB 3PL5A 2PVPA 4MKRA 4Y2QA 2X0FA 1N7SC 2VJMB 4U2DA 5DTEA 2XTAA 2QMOA 3O8ZA 3QO8A 4CLHA 5IDWA 5UKDA 4FFRA 3AVWA 3EVCA 1PS0A 1G66A 3ICXA 1MW9X 3ZRVA 4IS2A 4QVKA 4EJ0A 4BMXA 2HJSA 2SKCA 3UW1A 3OW2O 3K5MA 3LKZA 5DTRA 4GUAA 2QTRA 2ACKA 4JB2A 2XVYA 1JU3A 3RAJA 1B74A 1OLXA 1AKWA