4JYBA

Meab, a bacterial homolog of mmaa, bound to gmppnp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
323
structure length
323
Chain Sequence
DMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPGAGDELQGIKKGIFELADMIAVNKADDGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 124
structure length 323
sequence length 323
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jybA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jybA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jybA02
3EASA 2C9OA 4G5RA 3QPVA 1AGPA 2AK2A 3GJ0A 2ZI5A 4WOPA 3OFND 5JHGB 4UJ5A 2FTKA 4C7OA 4D4KA 4CEHB 3MAAC 1NI3A 1G2CB 4D26A 4JKIA 4EPWA 4FPPA 2BASA 1P3JA 1W0JA 2IYVA 2ODNA 1LTQA 3DGEA 2VA8A 3QQ5A 2CJWB 1FW6A 1XCMA 1NMXA 2D62A 1SVOA 5CJPA 1G291 1X86B 4Q1FA 3RRYA 3VMFA 1G20E 1HYQA 3ZCCA 2WSMA 5EJEA 3BGWA 1Z5ZA 3P4XA 2YKGA 3OAKA 2IXFA 2QAGB 4WW0A 4DB2A 3QKRA 4E09A 3BS4A 4C0BA 2IF2A 4RZUA 1M7GA 2VHJA 3NBFA 4QRHA 2ZRCA 1RJ9B 3SS8A 3NDPA 5EP1A 4D4LA 3UMRA 2GILA 2FV8A 4P32A 1SVMA 1S1CA 4FMCF 4WBSA 4BZQA 3SR0A 4JVSB 3GLGE 2GCOB 2OCYC 3I3SR 3Q7PA 2IUSA 4U7NA 4W5JA 3PQCA 4TLBA 4W5HA 3O8DA 4ARZA 2F55A 3V4WA 1J7KA 3RRZA 721PA 2NZ8A 1II8A 3S1AA 4BFTA 5GVSA 3E2IA 3DEFA 2O8FB 1XEWX 3B8EB 1E2MA 1UKZA 3DOFA 3HDTA 2WJVA 1KO4A 2VP2A 4KXFB 4RZ2A 3WMEA 4B6EA 3A7OA 2PT5A 1QHIA 4B6FA 4ACAA 5EUQB 1TPZA 3MMPA 4GOXA 1G8HA 3X1DA 2A30A 3WBJA 3K0EA 1CSBA 2JJ1A 2H17A 4BRWA 2C95A 1VIYA 2RKOA 1GU5A 3UWKA 3EAQA 5APUA 3LO5A 3V9PA 4RZ3A 3NH9A 4PZZA 3NG1A 2ZUDA 4X8MA 2CVHA 4DUGA 4TYWA 3OAAD 4C2UA 2BOVA 3KL4A 5AWFC 3ZRWA 3ZS8A 3KB1A 4IRUB 5JBQA 3AVOA 2O8DB 3HTKA 4GOKA 2IS6A 2HYDA 1Z0AA 1Z6YA 1EX6A 4O2LA 4HYTB 1D9ZA 2WPSA 2RH5A 3QXCA 1FNNA 2R2AA 1TQ6A 4PSAA 4QG7A 4URZR 2CVFA 4EPYA 4CIDA 4E22A 1CJUC 1MRNA 2YC4C 4IDHA 4PC3A 4Q21A 3U3JA 2OT3B 3AF4A 4B75A 3TR0A 1W4CA 2G1JA 1OIVA 2AKAB 3LV8A 5DH9A 2WM9B 1KI4A 4FI3C 1HUCA 2A9KA 3BH7A 2LFRA 3TSWA 2G88A 1GL9B 2JLUA 3GJ6A 5SZKB 3ZRXA 4YDHB 3M06A 5JSZB 1ZUIA 3VR4A 4KODA 5AJXA 3GLHA 4G3XA 2IYSA 2IXEA 3VMZA 1KHTA 5G3YA 2MMGA 5KPJA 1Z6XA 1E9EA 2C77A 2R5DA 3VN0A 2HF8A 1GL6A 5AK0A 1AS2A 5DNYB 3NBYC 1CR2A 3UKDA 5G3ZA 3BFKA 4RZXA 3U4QA 1M2OB 3I61A 1N5IA 1CKEA 5FTMA 1SHKA 1C9KA 2VF8A 2H18A 1W0KA 3I4LA 3KB2A 4BECA 3PIRA 1OH5A 4BFVA 5HKKA 2QUZA 4C9BA 4MRSA 3K70C 4TMWA 4G01B 1OXTA 1IN6A 4D2IA 1OLOA 1XD9A 2ZSDA 1GRRA 4FMDF 1S9KE 5JS8A 5EUMA 4M1SA 3ZZUA 2XB4A 2IEYA 4II7A 5EQTA 2IYLD 4JJZA 5GJWC 5JRZA 1A82A 4LX0A 3AUXA 1QVAA 3NWJA 1VIAA 3ETLA 2RGEA 1F2TB 2CCKA 2JLSA 4JLAA 4DLSA 5BN3A 3K1JA 4OK3A 2ZS8A 4RD6A 1E4YA 2FE4A 4B3XA 5KNCA 1T3HA 4IEIA 4L5BA 5EP4A 5AW8B 2VTKA 4IVQA 3ZD6A 1P75A 4UXJA 1TU4A 3ASYA 4HAXA 5KDDA 3ND9A 3BFXA 2ZI6A 3FMFA 2GCPA 4Q7MB 2LCFA 4Q18A 3R7WA 1H89A 5AW6B 5B57C 4LHXA 1E0SA 2H7HA 2OXCA 3BIFA 4HLCA 2O8CA 1XMJA 4P4UA 1OKKA 2J0VA 5IF9A 4PO8A 3IPXA 3CF2A 4BFSA 2J7PD 1GNQA 2QQEA 3K0AB 1NJFA 1Z2AA 5DN6D 3NEYA 3WMFA 5AVYB 1P9NA 3IQWA 1Z6AA 4Z54A 3A1VA 2N1BA 5G41A 3WHLA 2NGRA 1RZ3A 3UPUA 3W5IA 4DZOA 1JQJC 3RWMB 1KZGB 1UBFA 2CE7A 2Q9BA 2VYFA 3N2EA 4CT4B 4DEXA 3GLFA 4A8JA 621PA 2JCSA 1K5DA 3X1ZA 5E4FA 1KIMA 4C0KA 1X1SA 4EUNA 2I1VB 1GD2E 4ON9A 4C0JA 1R8SA 1WBBA 4MUBA 2ZRDA 5HZKA 3FOZA 1MV5A 2V1XA 4P0TA 2DBYA 5AVRB 3D6TB 5KU1A 1T8UA 1NVVQ 3IO5A 5FPYA 4EPRA 5FPSA 2KP8A 1UKEA 3O47A 1GZLA 1ZC3A 3KKQA 2WKQA 5CMZA 1TEVA 2R6FA 4FXPA 2XTNA 4I1VA 4K46A 1A5TA 1XTJA 5JWOA 5H8WA 4EQ6A 2PT7A 4KJZA 1AKYA 3ZH9B 3V4QA 1E0KA 1E2IA 1UPTA 4LI0A 4QPJA 2FFBA 1YRBA 2H5EA 1XFAA 3BH6A 3FVQA 4AURA 5J4HA 1T5IA 3V4FA 3KJIA 2R6CA 1W44A 1G6OA 4EJSA 3H86A 3VAAA 2J45A 5HE9A 5HCNA 4QPKA 4Q9KA 1K8RA 3AVPA 4B73A 2EFEB 3D7MA 4ABYA 3K53A 1E2LA 5CDFE 5KPDA 3K70B 1RPZA 3PUYA 3BBPA 1S1MA 1R5BA 421PA 3ZVMA 3W3AA 1UADA 3QUSA 4S2EA 1NVVR 1NAFA 1R0YA 4HEJA 521PA 1UDXA 1WBDA 1GKUB 4JLKA 2GJ9A 3EIEA 4GT1A 2V8OA 2RGBA 2RAPA 5KNDA 1G5PA 1SXJE 4B74A 2OCPA 1AS0A 1R2QA 4M4SA 2PLRA 3ASZA 4TQ9A 1ZNXA 2QM8A 3RRMA 2JDIA 2EVWX 4FWIB 1SP4A 3CH5A 3SYKA 3GEEA 4EFMA 1KK3A 2QL6A 1RRGA 2RB4A 1OWAA 1IM2A 4DBLC 1NBMD 2F9LA 3C15C 3QKUA 3NDBB 1OHHA 4X8OA 2XZRA 3CBQA 2FSGA 2GRJA 2X2EA 1G7SA 5KSZA 1YQTA 1I4TD 3L36A 4TMTA 2ZJOA 4YQFA 2GAOA 1D2MA 2KBFA 3BB4A 5IT5A 2ZROA 3GLIA 2EYUA 2XSZD 3Q5DA 3DM5A 4NCIA 1IQPA 2F6RA 1FQJA 2Y8EA 3EZ6A 4MGIR 4BLPA 5B58C 2CK3D 3B1WA 2JLVA 5F3WB 3UIEA 1AGRA 1XMSA 1Q21A 5E3HA 4Q4LA 3H4MA 1XJQA 3FB4A 4QOSA 3LLUA 2RGCA 3UMSA 2IYUA 3SEAA 1IN8A 4PO1A 2CNWA 3L35A 4LV6A 3VNUA 1U2RA 2ZYWX 1T9HA 4HAUA 1GM5A 2FJUA 1KO8A 4B44A 1Q20A 3EWSA 4Z1MD 4F93B 2XNDA 1PVOA 4DHEA 4LZZA 1KGDA 3G82C 2D7CA 4B43A 3BAFA 3RHFA 3OEED 5IDVA 2DR3A 2QTVB 2DWQA 3K9HA 4FW9A 4G0NA 2CJWA 1ZM9A 4Q9IA 1HE8B 4JAUA 4TYQA 4V0NA 3TVTA 5AW9B 3W6PA 5TARA 3TW4A 1AA9A 3AF3A 2JLWA 1NMYA 1A2KC 3QKRB 1OB5A 5BN4A 1F3OA 4M3LA 2QAGA 3U60B 1Z0IA 1CR1A 2BMJA 1HQYE 4TL8A 1G8GA 2NO6A 2Z4SA 4NYJQ 1Z29A 2OAQ1 1EX7A 1RJ9A 2FGKA 4B47A 2DFKB 4H1UA 1KMHB 3KZ1E 2IS4A 2QMOA 1DAEA 2HV8A 2W2VA 2GCOA 3NTUA 3FKSA 4KP4A 3TGPA 1Q22A 2OCBA 2ZM5A 1II8B 1A02J 1S9DA 1XEWY 3EPHA 3AGQA 1LS1A 1N6HA 3FFAA 3SZRA 2DWPA 2XX3A 1E79D 5L3QB 4XVUA 2O8FA 3SQXA 4R71A 3T5DA 4A4DA 2QU8A 1KNQA 4DIDA 3NBZC 4QHTA 4LJ4A 3C14C 4BFYA 1VHTA 3I1FA 5FTKA 2NPIA 2GVZC 5CM8B 3QXHA 3DKPA 1O87A 3DHWC 2ODWA 3IHLA 1G3QA 2A5GA 4JBXA 4W7SA 1DPFA 3I62A 1CZQA 3KFVA 4MYCA 1R7RA 2W6JA 1DVRA 3EZ9A 4NYJR 2ZVPX 2WAYA 3AVTA 4K81B 3OE7A 2GK6A 4M1YA 1N2CE 4JL8A 1DOAA 1V5WA 3LW7A 4S35A 4Q1AA 4L4UA 4KBFA 2EQBA 2W83A 3LRPA 4PHHA 3KQGA 5EE1A 3GLHE 4IOLA 4Q48A 2ZJBA 3EZ2A 2VO1A 1KOFA 1W36C 2DHRA 1I4LD 4WXRA 1EFRA 1FX0B 3AVYA 3CR8A 2O8DA 4MKGA 2WJYA 4WIAA 1E9RA 1KSGA 1LV7A 1QHYA 1HV8A 4H1VA 3LD9A 3HR7A 2R32A 4I2LC 4A82A 5JMTA 1MT0A 2Q6TA 4KFTA 4QNRA 4Q4JB 3EA5A 3QSYA 3U3KA 2CE2X 2JJ2D 2FPLA 3K8YA 1OXXK 1XU4A 2X2FA 3AP2A 1ZCAA 3L0PA 2VHQA 5HTKA 4KFSA 1IONA 1JQLB 2BCJQ 1E2EA 2FEOA 2OESA 2WJIA 5SZIA 4H9GA 2BHRA 2GBLA 4D80A 2WSSA 3AF1A 3R9WA 1TL7C 4JMPA 3GLHB 5GJCA 1ZYUA 1JR6A 1T3SA 2EW1A 3B85A 4L16A 4L8GA 2FN4A 5DIFA 2HLDD 4U7OA 2P6UA 2R5BA 3LXRA 2PMDA 4DIEA 4ZI2A 3U4QB 4WVFA 4XE5B 4FMBB 1FMJA 3RNLA 4PSVA 4U7DA 2F1IA 1JBKA 3Q8XB 1SVLA 2V6JA 3B1VA 1JEDA 2W6IA 5AVVB 4KO8A 3THYA 3PITA 4C4PA 1MR3F 1Y3AA 4Q01A 1ODFA 2ZR7A 3O8ZA 4X8LA 3VU9B 1EFHA 3FHCB 1WQ1R 3L82B 4KHZA 2IWHA 1COWA 1RW4A 3ZVNA 1F51A 2ERXA 3SDZA 4TT3D 5DISB 3L0IB 4AKGA 1KO7A 4P4SB 2OFWA 2ZAOA 2PX0A 2QMUA 3A1TA 4CRWB 2C04A 1OIWA 2GZHA 4MKFA 5B64A 1JR3A 2H1LA 1SKQA 2IYXA 4KV9A 3MFYA 4GL2A 1E9DA 4URYR 3Q85A 3GLFE 3X1YA 3PENA 2BMFA 3LA6A 2PCLA 3EPKA 3MWKA 5ELXA 1MKYA 4QJ5A 5EZ6B 1ZD9A 2PMKA 4ILEA 3HYTA 3KKOA 3R7WB 3U44A 2WMOB 5FI0B 3CPEA 4NMMA 2D2FA 1P9WA 5JEDA 3U7EB 2EFCB 3QE0A 4C0QC 1JECA 2XOKD 5E7MA 5F9FA 2BBTA 5KDOA 4JSYA 1UJ2A 3IEVA 1YU9A 4QHYA 1IY2A 2NZJA 2JATA 3FE2A 3PG5A 3CPHA 3GFTA 1UM8A 1YR8A 3TRFA 3LY5A 5FPHA 5AVQB 3IHWA 4D25A 1EWQA 3VYIA 2Z83A 1HT2E 1SXJD 2VH5R 3QENA 4NL4H 4URWR 1W36B 1JJ7A 3SFVA 3PUVA 3AH8A 4KFUA 2P5TB 4LUCA 2YO3A 1VCNA 2ZRGA 5FOWA 4A6PA 3GLFB 2BEJA 4ZCIA 4N3NA 3FMPB 4D82A 4UJ3A 3U3MA 2VP6A 4NH0A 5CK5A 1UAAA 2G0NA 4C0AC 1U0HC 3LX5A 5AR1A 1R6BX 3MJRA 3A1WA 2A2ZA 4DJTA 4AKHA 2WOJA 4HLDA 1A2BA 4B86A 4PQRA 1NF3A 1S96A 4XTRA 3RLFA 1TQ4A 3GJ8A 1NSTA 1ZNZA 1NRJB 1KK2A 3PUXA 2TMKA 3ZGXA 1Z0JA 3ZQJA 2FZLA 3B13B 1U94A 2J41A 5BQ5A 1E9SA 1MO6A 4LHWA 2X1VA 2P5SA 4RKFA 4Z51A 1Z3IX 4O3MA 4OQFA 5K8IA 4FWTA 4HZIA 1KDRA 4AG5A 3ZRVA 5AJZA 4HDQB 1AIPA 2WPQA 1Z28A 1X3SA 1IAQA 4L9SA 2BBOA 4AG6A 4US2R 4Q7LA 1NL3A 1ESMA 4PTLA 5JRJA 1CJVC 1TF2A 4A15A 2JLQA 3F0TA 2X19A 5C4MA 4C3ZA 2EFGA 5DHFA 4D0NA 3GLIE 1W47A 3TAUA 2YO2A 3THOA 4A92A 1S9HA 4HB4A 4MUAA 3V00A 4M9SA 4A0GA 4QJ3A 1G21E 3NIBA 2GF0A 3R9XA 2ONJA 1PLJA 3ZIAA 1YZNA 4CVNA 3CF6R 4PHGA 3ICEA 1QRAA 1X1RA 2NO9A 2C2AA 2VBCA 3CWZA 3M0EA 2GJ8A 4TQUS 1Z6TA 2V7QA 4LYAA 2ORIA 4ZKDA 2CCJA 2JAQA 3NBXX 1E9AA 1UBCA 1JOYA 3AKDA 4X8HA 5HR5A 2W2TA 4GSYA 1CTQA 2ZYUX 1QF9A 2PEZA 2VQSA 4DT1B 4GRAA 3GJ7A 1H8HA 2IA5A 4PANA 3HPQA 3RVBA 3OF5A 3U5ZB 2JGNA 1GKIA 1NLFA 2REXB 1E3MA 3B1YA 4ZIRB 3K9GA 1G5RA 2O0KA 4BFZA 1Q3TA 3GD7A 4OK5A 2IYYA 3L43A 3SWFA 2Z43A 5FOVA 4OI1A 3MWLA 1NIPA 5JZVA 4Z8XA 1VG1A 3KQLA 2VSFA 2GXUA 4M0LA 3QF4B 2VPPA 1Q44A 2R62A 2UZIR 4EKDA 2ANBA 2QMHA 2YOHA 1VPLA 1U98A 4TN1A 5FFMA 3TUZC 4B3GA 1N5KA 4C7NB 2JA1A 4QM6A 5FBQB 5EXTA 1GDDA 5APTA 3B82A 3ECCA 4EFLA 1ZU5A 2C96A 4BEBA 2FOLA 2C9YA 1DARA 2GBLC 1TTTA 2IS2A 1CI6B 1VG9B 2HF9A 2BDTA 1L8QA 2OO7A 1A4RA 2WIAA 4QFMA 3A4NA 1S0UA 2XJ4A 1BOFA 1EFTA 2EFHB 3B6EA 1IJFA 1PLLA 3TAHA 1OFUX 2FG5A 4NKRA 2GXQA 4EPXA 3PEUA 5EZ5A 2QT1A 4HDOB 2OV2A 1KMQA 2NOAA 5FBWB 1XPOA 1E9FA 2B92A 3L8YA 3CRW1 1S4QA 4BLQA 1GWNA 3EIHA 1CF4A 4AYWA 1WB9A 1II0A 5LPNA 1VCOA 3CX6A 1GITA 3A0RA 2FH5B 2XTMA 1KMHA 3QBTA 3ZDQA 4D6PA 4ZDJA 3MSXA 2CCGA 1U9IC 2QENA 2QE7A 2YC2C 3OESA 1FFHA 2BIFA 2IBMA 5J4VA 3VKHA 5BN5A 1ZM3A 4GMDA 2YYZA 4PZLA 1VKJA 3TYYA 1T6NA 4Q1DA 3IIKA 2ZRPA 5HPYB 2HT6A 2QM7A 4DLZA 5EE5B 1HA3A 1N3BA 3GJXC 4AC9A 1OF1A 1J70A 1LVGA 2BMEA 4AI6A 4GCZA 4HB2A 5L3QA 5APQA 1VECA 2WWXA 3A4MA 5IK2D 4KAXA 3TMKA 4BLTA 1G3RA 4LDJA 2VP5A 3P8MC 4HATA 2BBWA 2ZREA 4L9WA 3VX4A 1A7JA 2FA9A 8OHMA 1GK6A 4AUWA 2G83A 3E1SA 3EZFA 2Z4RA 4BWYA 3R20A 4LC0A 3L37A 1OV4A 3P1JA 1KI1A 2BJWA 1SVWA 3DL0A 4BZXA 1GIAA 1P2SA 2O0JA 3MRSA 4ASUD 2HT1A 4OK6A 3SYLA 3TUJC 1LY1A 1S3SA 4PQYA 1OKKD 3MLEA 2QRZA 5FBVB 2ZE7A 1FZQA 2YWHA 1T2KD 1FL9A 5B1NA 4ITRC 2ZETA 1KI8A 3IEUA 1ZMXA 4Q20A 4DDVA 1HH4A 4IOKA 2WTUA 1B0UA 2AL7A 4KLZA 4HDCA 5G53C 4JYCA 2R6DA 1YRAA 4MRPA 1TAGA 3AF2A 5FOTA 3A8TA 1H65A 1FX0A 1O3YA 4C0SA 4GP7A 2GJSA 1PLKA 2ZANA 2VEDA 2ZU6A 1NN0A 1QG4A 3KKMA 3AVVA 4P4TA 3E70C 2EU8A 2QAJA 4MYTA 1E2HA 1KAOA 3IBYA 2UZ3A 1G8PA 4Q4JA 5TXGA 1FOEB 2IYTA 4US1R 4G1UC 5CYPA 1Z63A 4KSBA 4RSGA 4ZO4A 3TK1A 2J1LA 3SN6A 4ZCMA 1VCIA 3EZ7A 4TYYA 5JLJA 4G5QA 3BFVA 1GILA 5CB6A 2Z5HA 4TL6A 3X1XA 1JR3E 4PR0A 1W1WA 4Y0VA 1KK1A 3Q7QA 2A5YB 2JEOA 3MD0A 1MUUA 1E2QA 4L15A 2DPXA 1GVNB 4JT2A 4EFNA 2G3YA 4CT5A 3OFNA 2O8BB 1TF7A 1XMVA 4JASA 3AVWA 1US8B 1YZLA 4CF7A 2Z0MA 4TWZA 3AVQA 2HEIA 4DRZA 2W58A 4DSNA 4M22A 2MSDB 3THYB 3P7KA 1NIJA 2VP0A 3VQTA 3K9LA 5SZHB 5JCZA 1G1MA 1NVWQ 4O0MA 5CM9C 4DCSA 2W2XA 1W5TA 4CDGA 2XZOA 3O8RA 3QEJA 3MJHA 5KUTA 1GTVA 1U0LA 2VHUA 4PPNA 4Z8YA 3VU9A 2VRWA 1XXHB 1ZW6A 2W27A 2BC9A 5APYA 5B2ZA 4RVCA 5KTYA 1KTVA 1ZIPA 2F1RA 4M9QA 5EXXA 4P4SA 5APXA 4AQRD 5AVTB 3B9QA 3OEHD 2XEXA 3A6PC 5FTJA 1UF9A 3PV0A 4NDZA 4TLCA 3WYAA 1S3GA 4JSTA 3I8XA 2ZRLA 1JALA 1GP2A 1N0UA 4DEYA 5A4JA 1KNXA 1U0JA 4LOAA 4LJYA 4XSHA 2ANCA 4D4MA 1D8TA 3U6BA 2ZE8A 2WWYA 3R8FA 5APWA 3D8BA 3P27A 4JL6A 2GCNA 2K5UA 2VSOA 3KKNA 4LWZA 4Q1BA 2AXNA 4UKDA 3U44B 1OHHD 1WCV1 3NHAA 4UQOA 1TEXA 1DG1G 2P2UA 5J4YA 1U81A 1VYVA 2GVDC 3D3QA 3Q9LA 4A0HA 4M1WA 3LH5A 4HZUA 2GDJA 5J4KA 2QZ4A 5J5CA 1XTKA 1E1QD 2AHOA 4FMTA 2WPDA 2IXGA 2YINC 2A5FA 3QI2A 4B35A 4UXIA 2F3RA 3VMYA 5FL3A 4A36A 4DSTA 1HQCA 2ZSEA 1A1VA 1CJMA 2HCJB 1XTRA 3IKJA 3UANA 2WBLC 4IOMA 3LXXA 3PUWA 2GJAA 3QVVA 3WXMA 2IYQA 3C16C 4CGZA 3JZMA 1JEEA 4XD7A 1II9A 1JXMA 4QGFA 4C46A 2O5VA 1CJKC 3NC1C 3WP1B 3T34A 1GZSA 1G4AE 2QORA 2WICA 2R6AA 3LQRA 2XB2A 3CONA 2NO1A 4GPTA 4MKIA 3W8RA 2P2LA 3Q3JB 1DS6A 1PUJA 1FTNA 1M6NA 3TNUB 5AJYA 2QSZA 3CLVA 2O52A 1CLUA 4LY6A 1JXOA 4Y0AA 4DB4A 2ZE5A 2Q3MA 1D5CA 4O25A 1E0JA 3FDIA 4B2IA 1DEKA 1QG2A 4CYMA 3K9NA 1P2VA 1N6RA 3EA0A 4QJ4A 1Z08A 1MO4A 3BOSA 2KSQA 4FCWA 3P4YA 4JIMA 2OHFA 2FPKA 3BJIC 1EESA 1N5LA 4C0HA 4NP6A 5JECA 2FGJA 3WP0A 3CKLA 3TBKA 3EWAA 4B3CA 1NVXQ 1M34E 2KE5A 2P6NA 2QQ0A 1G16A 1G4UR 1NJGA 4JL5A 5E95A 2G1KA 4B71A 2VP4A 1UKVY 4DZZA 3R8CA 2Q5UA 1QHSA 2CLSA 3G5UA 2ZR9A 3FPAA 4A0FA 3B7GA 3GCGA 4I1OA 2W0SA 3BD9A 3CNOA 1DAKA 4GZLA 1CS4C 2RGNC 3WRXC 2OILA 2D3WA 4Q03A 4RD0A 4Q1CA 1Z0KA 3EPLA 4Q7KA 2XXAA 1E9CA 3TQFA 3OE7D 1BYUA 4AWXA 4DT1A 3SQWA 1OSNA 1VCMA 5DO9A 2ODEA 4OHXA 2PJZA 3BE4A 1XJCA 3H2YA 1GG2A 2ZUCA 4CEIB 2FWRA 3VFDA 3QPUA 2QMEA 1D2EA 4ZIRA 1NP6A 2YNYA 1ZAKA 1P2UA 3BXZA 4JLOA 1DAGA 3WBKA 1E9BA 2C9NY 5UKDA 4GZMA 1EFRD 1XEXA 2FMXA 4QXAA 5ANRB 5D3MB 1AS3A 2J7KA 1W7AA 3HE4B 3FHOA 3QF4A 2CL0X 2WAXA 4JLMA 4LJ6A 4PHFA 4URVR 4TQAA 3LWNA 4DLYA 2V4ZA 2VP9A 4ZPXA 1F5NA 1G6HA 4Q9JA 1OXUA 1CJTC 2EWWA 2FFHA 1WE2A 4PXAA 2F9MA 2ZRFA 4TTPA 4C7NA 4LJ9A 4IVRA 4TLAA 5AW3B 3MGNA 4JS0A 3AM1A 5LBIA 2W0MA 2JIZA 3M1IA 1VHLA 1XPUA 1N6NA 4TZ6A 3GJ5A 1CI6A 4ESVA 1OH6A 1OYYA 2J7PA 3WRYC 1P73A 1YHNA 2RGXA 5DN6A 4QGGA 4UXHA 4PAMA 3WYFA 2R3CA 1R8QA 3RSLA 1E2GA 3L0SA 2QEQA 1UBEA 3ZQ6A 3CIOA 3THWB 1PV4A 5KYKA 3THXB 1R10A 4HUQB 5DYGA 2IS1A 4GFDA 3AP3A 4M1OA 1AZSC 1FNMA 1D6JA 4XWAA 4MYHA 3UG6A 4OHZA 2AXPA 1EFUA 1C1YA 1RRCA 1MO3A 1ZP6A 2OSBA 4BLOA 4YXWD 1JI0A 1I2MA 3TH5A 4OKSA 2E42A 4HLUC 2W6ID 1CRPA 2RHDA 1R4AA 3U6KA 3TSZA 4GI7A 5A0FA 5FH9A 4IOJA 3NC0C 1BYIA 2KJQA 4KVGA 5CJ2A 2J59A 3VR3A 2YNMA 4POAA 1T0JB 4TSFA 2J0QA 1UEIA 4YMWA 4MGYR 4BLSA 3SC3A 2IK8A 2IYZA 1DO2A 2VL7A 2YZ2A 2C78A 1H8EA 4LCBA 3KDSE 2ZRKA 2IPPA 2YOGA 3QY0A 4I1UA 3NKVA 3M9BA 3LX8A 5EP2A 2CHGA 3RSOA 1ZUNB 4OBEA 1NN5A 2QPTA 2ZRIA 4OQXA 1XNJA 3T1VA 3ADKA 4Q4HA 4QBIA 1NLYA 4LK2A 2AKYA 4TMZA 1OJLA 1ZRHA 1GNRA 2ZSFA 4M2LA 2EWVA 1T3LA 4G5GA 4HAVA 3PXGA 2IYWA 3ZS9A 3KQHA 1M8PA 1AJEA 2AD5A 2RGDA 3EW9A 3AF0A 3OIVA 1U8ZA 1GAJA 4QHSA 1S9KD 3W5JA 3ZLJA 3IUYA 3B1ZA 3W8NA 3PUZA 3K09A 2JLXA 1SKYE 3IQXA 1KAGA 2AK3A 5DSZA 4IDOA 3RABA 3LVRE 5EP3A 4Q1EA 4D4JA 2A7QA 1WRBA 5AVSB 3DPUA 5DE3A 4V03A 1E2JA 3HP1A 4Q7JB 1FPMA 3C41J 3QKSB 4DLVA 3ZVLA 4I81A 2OCAA 3NMDA 2BJVA 4NBSA 5KSYA 2CDNA 5BYKA 4PQFA 1T2KC 1TNDA 1NBMA 2ZR0A 2C2HA 1X8LA 5E7JA 3D36A 3QXSA 5FL7D 3RS2A 3KUCA 2C5LA 2PZGA 1ZNWA 1XZPA 3HU2A 3LIEA 3RS3A 3LVQE 2G9NA 4IEEA 4R2IA 3QEOA 4PPGA 4ZI3A 1R0WA 1CU1A 2DCUA 2NG1A 2XSZA 3O8BA 5G40A 4ERNA 2YOFA 2CK3A 5AVZB 2ATXA 5CIWA 1G19A 2XV5A 1SKYB 5HZHA 1KDTA 1JPNA 3GMTA 4DVGA 3T97A 2RMKA 4AKEA 3A3YB 4N0EA 1UDWA 3GJ3A 5JFGA 1P4SA 2LWIA 3PJRA 4OI0A 1DG3A 4PO9A 3FMIA 4DC9A 3CR7A 1QHGA 2FEMA 4Z1MA 2O8BA 1US8A 5KHOC 4JVMA 3OHMA 3NHBA 2GEUA 4OYHA 1IXSB 1G7CA 3B60A 2D2EA 3OEEA 2GA8A 4PC6A 2ZSBA 2OZEA 2UVQA 3K70D 1RYFA 3A2AA 2QT0A 4RCYA 2C99A 1U9IA 5J47A 4MA4A 3M6AA 2XITA 1XXHA 4PPFA 2ZJYA 4R9UC 3SNHA 4DLRA 1DTSA 4TMKA 2GESA 3BB1A 4URXR 3A5TA 5AJVB 3ZIAD 4JLJA 4A9AA 5C46F 4ZKIA 2JJLA 2WOOA 1FUUA 2ONKA 3RAPR 4LPSA 2NMVA 2YWGA 1DO0A 2WMNB 2V55B 1N0WA 4AK9A 5GADl 2FU5C 1VG8A 1KQLA 4Q9HA 2XNSA 2PLFA 2XJ9A 4E5UA 4BUJA 3ZZTA 3NVAA 4Q9LA 5KDLA 1CP2A 5AW1B 2N46A 1E69A 1A02F 4DWJA 2REBA 4IDPA 1SZPA 1W4RA 2ZXUA 2JLZA 1BMFD 1OXSC 2BKEA 2FPMA 3CWQA 3RS0A 3VMXA 5FI1B 4HZUB 1M74A 1E79A 4NPHA 2OLKA 2W00A 1UKYA 3P26A 3RC3A 4MDEA 3CUEF 1GRQA 4RD1A 4J0QA 4TZ0A 3CO5A 4IVPA 4Q02A 3F3YA 2ZI7A 1W49A 5DGXA 1AN0A 3FFBA 3GPLA 2QGNA 3EC2A 1M7BA 4IDNA 1W4AA 1LF5A 1QBKC 4JZKA 4M1TA 3TR5A 5HCIA 4MH0R 2F3TA 1EWRA 3CRMA 3T1OA 2ZRMA 4E03A 5AW7B 4CEJB 1E2DA 2IHYA 5D3QA 4Q5IA 4MYUA 5LDDC 3Q72A 3TQCA 1W0JD 2HDNB 3BK7A 221PA 1ZIOA 4WXPA 3M4YA 5FR1A 1P5ZB 3IIMA 1WXQA 3TNUA 2AX4A 3DVLA 2ZS9A 3QOFA 3OIYA 2C9CA 5JHHB 3L8ZA 3LFUA 1AQUA 1RVDA 3M91A 4KHXA 3MWYW 1J8MF 4ZCLA 1E99A 4TMVA 1I4DD 2F7SA 4FINA 4V0KA 1NNEA 3G0HA 1Q1EA 2JJ2A 2B6HA 1G7TA 4JT4A 4BRUA 1DAMA 1KI2A 2IT1A 1N6LA 4ZV4A 1Z83A 3I5XA 4LRWA 4MRVA 5JEEA 4TTQA 2P67A 2JASA 1F60A 2F1HA 3FGNA 2ZRAA 4NONA 1YZTA 2J87A 4V0OA 5DI3B 3T12A 2QPAA 5JI3E 2JJ8A 3HE5B 4TLEA 4JAVA 1VYUA 4FD2A 2HLDA 2WWWA 1RKBA 4RJLA 3NTNA 1E2PA 1N6IA 3EARA 3A36A 1YYCA 2PZEA 5EE0A 1CBUA 2ERYA 4XWKA 4B2PA 1C4OA 1HTWA 3MGCA 3VTKA 3X1WA 4XVQA 1MH1A 4IHQA 2JJ1D 5EXSA 4JLPA 3V4RA 3KDPB 4PC2A 1GFIA 2XXAB 1P60A 2Q9AA 5KSPA 2B21A 4A1FA 2ZAMA 3PEWA 4XWOA 4UNSA 2ZPTX 3AB3A 4ZDIA 2V3CC 4R7ZA 4AYXA 1VTKA 4DSOA 4AYCA 4KITB 5L8VA 4TT3A 2ZRHA 3ADBA 1GRNA 1D9XA 2DWOA 3EC1A 3EG5A 3K09C 4JBWA 4DUGD 4E07A 4CEIA 4Q47A 1RYHA 1G3IA 1TU3A 4DKXA 2O0HA 5AVXB 1ZD1A 3SYNA 4D0GA 1AK2A 5K8LA 1DELA 3J81k 4XJXA 2BV3A 1XEXB 2H57A 4TYNA 3CX8A 3AKCA 3BC1A 2N42A 2ZUBA 2EYQA 5D3MA 1Q0UA 3HE4A 2ZU0C 2VRSA 4OI4A 4WZ6A 5L3RA 1Z0FA 2WPRA 1X8KA 2R8RA 4GBMA 2MSCB 5APVA 1CR0A 1Q3HA 5HE8A 1SLQA 1L4UA 5AW2B 2P65A 2ZJZA 4GP6A 3WNCA 1H88A 1G3MA 1HT1E 5K8UA 5IHPA 4G5SA 3RS7A 2AFIE 4MQBA 5FBRB 1S2MA 2R65A 3Q5EA 1P61B 2XOKA 4LBVA 2P0EA 2ZXEB 3IDQA 1XBTA 2I1QA 1E1RA 1QDEA 5LB2A 1T5LA 4F38A 1KJYA 4IFBA 4V02A 2D4HA 3EIQA 4HAZA 1IN5A 2GHIA 4HUTA 1G9XA 1X6VA 3KUDA 1ONBA 2CHVA 2E1RA 3SJCA 5FUXA 3T15A 4ZDKA 4DCNA 1KY2A 4M9XA 1HWTC 4D81A 3THWA 4HUQA 3THXA 1ZUHA 4BEJA 4EDHA 1FOSF 4EPVA 2WWGA 5KOYA 1W0KD 2OM2A 5EE9A 1J99A 4LBYA 1CEEA 3HPRA 1CIPA 2C9LY 3VR2A 5HKKD 3F8TA 5LD2C 2A5DA 4DCVA 3DDCA 4MITA 3REGA 2O8EA 4DSUA 1XX6A 3SE0A 1KI9A 2ZTSA 4HI0E 1IY0A 2GTPA 2ZRBA 3QXJA 4PHTA 1EXMA 4PZYA 5JJKA 2B7CA 4FIDA 4NYIQ 5TVKA 4DCTA 1XTIA 1F48A 1NN1A 3I73A 2Q3FA 1K6MA 2QSYA 4ZDWA 2CHQA 3KX2A 4BLRA 1E98A 4UNNA 2YHSA 1ZINA 2F43B 2QPOA 2WT7B 3UATA 1NBME 3U2QA 4M21A 4Q4HB 1RE0A 5AUQA 3QJYA 4IJMA 2RGNA 1LB1B 1JAHA 2DFLA 4MGZR 4NYMQ 821PA 5FOXA 2Q7CA 2R9VA 2G77B 4A2QA 2WZQA 2H92A 5AVWB 4BFWA 2AWNA 3C4JA 4DDUA 1IBRA 5C2JB 3SBEA 4RD3A 3JVUA 5IRCD 5AW4B 3PFIA 3GEIA 1Q1QA 4TYPA 2WPDD 3R9IA 1YZKA 4PSKA 3ONWA 1M7HA 4LGMA 3U3OA 1SVIA 4C30A 4DCUA 4NYIR 4PAOA 5AJWA 5TDHA 2Q21A 1ZVQA 4QGAA 1W36D 3UK6A 1AZTA 1YE8A 2YWEA 2GNOA 2QN6A 2CLDX 3QKSA 1ELOA 1IXZA 2CL6X 2DY1A 4XD7D 1CXZA 1KSHA 3GLGB 4JKYA 4LPKA 2QBYA 4I5SA 3CZPA 5M04A 2ZFCA 3CRVA 5H68A 2OEPA 4AKIA 4M1KA 1DADA 1E2NA 4NYMR 3UMFA 2QTFA 2ZS7A 3A58B 1G64A 3BERA 4P3YA 4XTCS 3LBIA 3OIWA 1KI6B 1XXHE 1S8FA 2LKCA 4Q4AA 3LQQA 3GEHA 4DLXA 1Y63A 5FR2A 3BORA 2FFAA 3KXKA 4F7WA 1V43A 2XZLA 3ZJYA 1YZUA 4UNPA 2WVJA 3ADDA 3B8HA 5JJIA 4RFSA 1OYWA 4ZKEA 4I1SA 4OQLA 2QGZA 5C4GB 1WP9A 3IO3A 5H70A 2GKSA 1G18A 2WJJA 4BIUA 2NO0A 5L3SA 2ZYTX 5B1OA 4DLTA 2Q9CA 4F92B 2FSFA 3GFPA 1YZQA 4HLUA 2OFOA 1GKYA 4N1AA 4U5XA 4I6MC 4I4LA 2JLRA 2XZPA 3TJZA 2BMDA 3GQBA 4LJ8A 3TW8B 5LD2B 1QZXA 1KY3A 3SJZA 5GJBA 1X8JA 2ZQ5A 4GNKA 1SVSA 1ZM2A 2BBSA 1TUEA 3BB3A 4NCJA 3HYRA 1KYIA 1MOZA 1U8AA 1XCPA 3ZVRA 2BCGY 1SVKA 1G17A 2WKPA 4NU0A 3A37A 2BM0A 2OBMA 3T61A 5C1BA 4QKQA 1Q1ZA 3NEJA 2D7DA 1GU4A 2MSEB 3U7GA 3VKGA 2JDID 4RD4A 2LFSA 4R2HA 2IWRA 5JWHA 1P2TA 5AUPB 4RY2A 4YMVA 4ESHA 4QBFA 1XDBA 1SQ5A 1HEIA 2YV5A 2VHCA 3HU3A 3SBDA 2A5JA 3ZYCA 4NCNA 4BASA 1XP8A 2H7VA 3T1TA 1ZJ6A 4YMUA 4M1MA 1FMLA 1KKLA 4WZBE 4GDFA 1XCGB 1KJWA 1XF9A 2C98A 2ODBA 2V6IA 3F5FA 3K0FB 3ZD7A 4OHYA 2QNRA 4DDWA 1F2UA 2KI5A 1Z22A 2OLJA 4M9ZA 1Q1BA 5IK2A 3W9YA 1OT3A 1YR7A 1HUQA 3H0KA 3BWDD 1OPXA 4BE7B 3WMGA 4KVAA 2PCJA 1J2JA 3E5HA 3RRNA 1IOZA 3LNCA 5FOSA 4B33A 5AUNB 3FYHA 3C7KA 4JBYA 1KI7A 2CNWD 1OE0A 4ASUA 1GL7A 2ZE6A 1ZC4A 2F1JA 1L2TA 1G3UA 1Z6GA 2DFNA 4LV8B 4PAQA 3TE6A 2JIZD 3B78A 2XNDD 4CEJA 1OW3B 2NTYC 3KJGA 5FPTA 3K0CC 3JZAA 2I4IA 1YR6A 2CBZA 3FMOB 3OAAA 4WZAE 1XRJA 3LBNA 5CITA 3IIJA 4NTZA 2HJGA 2RGAA 2VHTA 1SXJC 2GWHA 4JLVA 4OQMA 2P6RA 4DXAA 4I99A 2FZ4A 1P6XA 4NE2A 3IGFA 1TUIA 1R0ZA 1XD2B 5J4LA 1F6BA 1FP7A 2P3SA 3HJNA 3REFA 2H8KA 3GFOA 4G5OA 1HY3A 4MTXA 1MABA 4HSEA 3WYGA 4RKEA 1YKSA 3CZQA 1E2FA 1Z2CA 4KFRA 3M9HA 1BH2A 1BIFA 1AM4D 1LNZA 1LS6A 1WMSA 2RGGA 4B48A 2Z5IA 3T1QA 3PEYA 2B8WA 1SGWA 1U99A 3OIUA 5H1YA 3EXAA 3I5CA 4OI2A 4B76A 4QGHA 3ADCA 5CIQA 1W2GA 4F4CA 2ECKA 2C8VA 3FKSD 4IXMA 2E43A 4D0LB 1D2NA 1IN7A 2HUPA 4TSFD 3O8CA 3AKYA 3UWOA 1YR9A 5DI3A 3KTAB 1PUIA 1FAVA 1H8ED 4NCKA 1RRFA 4GOJA 3HE5A 3NXSA 2GF9A 2VSXA 3I5YA 1Z07A 4KCGA 1JPJA 3BRWD 2QP9X 3SFZA 2ZITA 1QHHA 4LC1A 2ASEA 1GNPA 1YVDA 2J9RA 1EG7A 2PX3A 4NCHA 2V1UA 3AV0B 2EFDB 1OFHA 4YLGA 3NH6A 1EK0A 2W6JD 3W6NA 3CRQA 4V0MA 3IR9A 1NVUQ 4LV5B 4FCVA 1VG0B 1WF3A 3VHLB 2OBNA 1NLZA 1FOSE 2AWOA 1E96A 3AUYA 3QXXA 5FTNA 1G41A 3D31A 3P20A 1ZM4A 1HBWA 5TMPA 1G8YA 3FTQA 2QP4A 4B3DA 1XB2A 2QY9A 1JJVA 3SOPA 1I2DA 4BFXA 4QC2A 3TVDA 1MO5A 1VMAA 4U02A 1P62B 1NKTA 3OEHA 1L7VC 2B8TA 4P31A 3SHWA 3WY9A 4MKHA 1MV8A 3W34A 4LHVA 1K5GA 4JLNA 1W2HA 2ORVA 1BS1A 2GZAA 4OL0A 4AYTA 2PH1A 2E87A 1ZNYA 3KJEA 1E94E 4JVNA 1G7RA 1SULA 2B7BA 2CLCX 3RS4A 1NG1A 4LJAA 1W46A 2IYRA 2H16A 2FDCA 2XU6A 2ZJ5A 3BH0A 2J0UB 3B2EA 1E6CA 1XTQA 1GK4A 4XSGA 4AD8A 2WV9A 3WNBA 3L2OB 3LAWA 3QKTA 3UG7A 2J0SA 2YVUA 1OFIA 3KKPA 1PZNA 2NIPA 1E1QA 1N6PA 4B3BA 1G5TA 2WSSD 1Z8FA 4BIZA 2FSHA 3T35A 4MT8A 4R98A 2QI9C 4WA7A 1SXJB 2ZVQX 2G0TA 3AVXA 2HCBA 3K0SA 1U90A 3SHFA 4JYBA 1FTSA 3UXMA 1IO4A 2FFQA 2QRNA 5KNBA 2GJKA 3DOEA 3FKQA 4XH9B 3OZXA 1OH7A 4BQSA 1GSIA 2IF0A 4C7OB 2CEAA 3U7FB 3QF7A 1WDTA 4UNRA 1DE0A 5JI2E 3DKVA 5P21A 3RYTC 1ZM7A 4JVLA 1NG9A 4CEHA 1PJRA 4GMXA 2GETA 2ORWA 4HAYA 3DZ8A 3NFQA 2O8EB 5CYOA 3JVVA 1IJEA 3M0DA 1UFQA 1VDZA 5C93A 1COWD 4OJKA 4LJ7A 4FMCB 4BGDA 1NKSA 1E32A 1TQ2A 1QVRA 2IEZA 2AD1A 3PEVA 5K8TA 3VNVA 3VR1A 1FUKA 5AW5B 1NWQA 2GEDA 4UNQA 4ACBA 4LHYA 5TV2A 2W6AA 1JR3D 3B5JA 3UIAA 4RCZA 4TTRA 1JUNA 1CR4A 3N5CA 4IXNA 3KJHA 2F43A 1IY1A 2WT7A 2C03A 4FCTA 1GTWA 2NO7A 3CNNA 3CW2A 5CLQA 1LW7A 3I8SA 1ZBDA 1RIFA 2ZJ8A 4TL7A 4ARZB 4F4IA 5FPKA 2HYIC 2HXYA 2V54A 5A5GA 5AUOB 1SHZA 2ZIAA 3HWSA 3S1AB 4NZYA 1RRPA 1XPRA 5FUVA 1KDPA 3N70A 5DYIA 5GJVC 4NHOA 3VTPC 1DBSA 2AFHE 1KO5A 3GJ4A 1R5NA 3MWJA 2ZI3A 4M53A 2HJVA 4A2WA 5FTLA 3CM0A 3RWOA 1E0AA 3QVUA 4IKEA 1Z0DA 3IBGA 4HB3A 5CLLA 4YMTA 1VYTA 3A1UA 2GAAA 1RFLA 1YZGA 4LSGA 5EXPA 5FUWA 3N2IA 3H1TA 4PX9A 4Q00A 2FSIA 2IL1A 2Z6VA 2QBYB 2Q0HA 1FQKA 3TIFA 4OHVA 1Z47A 2GZDA 3GLGA 1JAIA 2WIBA 1FP6A 2D06A 3FWYA 3SJAA 2IUTA 3SJBA 2Q3HA 4A6XA 4HB0A 3A4LA 2PJRA 4O2RA 3ZRWB 2VF7A 4M8NE 4Q4AB 1OIXA 3PVSA 1KI6A 1ZCBA 1P72A 4YONB 3W3ZB 3KQKA 4F91B 4XVRA 5AVUB 4AY2A 1OB2A 3RANA 5BW8A 4Q19A 4RD2A 3QG5A 4RFSB 4A8JC 5KSOA 3KFXA 2IC5A 2BM1A 2QTHA 2ZI4A 4LJ5A 1CRQA 4LYHA 2Z5FA 1OXVA 4W9MC 3FHTA 5L3SB 5C18A 1KKMA 3HR8A 3A1SA 3DMNA 2BVNA 2J46A 2QA5A 2R44A 1NN3A 3X2SA 5L3VA 2J3EA 3P32A 2OXRA 2UKDA 1ETUA 4HAWA 5LB4A 1HURA 1TMKA 2PL3A 1LF0A 2KBEA 3LIDA 3KQUA 4IW3B 5FBLB 1W4BA 5JSZA 1DH3A 1N0VC 1XJ0A 2XTZA 2QROA 3I32A 3GP8A 1L4YA 2OE2A 1OXZA 4IDQA 4MRNA 2ZJAA 4LBWA 2SHKA 3DMDA 3LDAA 2RHMA 1NY6A 1P9RA 5F2EA 4FMDB 5GVRA 4QBGB 3DO6A 4KSCA 2G6BA 1T0HB 3WHKA 3QNUA 2JLYA 2NPFA 3QIAA 4MRRA 4PC7A 4YXWA 4EJSC 3AQ4A 3WNDA 4EPTA 2V7QD 3QG1A 5BWMA 1NSFA 1TF5A 1KK0A 1ZU4A 3IILA 3U61B 1TQDA 3U7HB 2AN9A 3AVUA 1GOTA 1UBGA 3VR6A 1KDOA 1H8HD 2KWIA 2WHXA 1XD8A 1E2KA 4MGKR 1XMIA 3AGPA 3EX7C 5TY0A 121PA 1Z06A 4HLQB 1ESNA 4YDSA 2Q3IA 1BO6A 5IDJA 2I3BA 2ZRNA 4TMXA 3K0FA 1F2UB 2QG6A 3TLXA 4A2PA 2MMCA 4TLDA 1XEFA 2E9SA 2R6GA 2WKRA 2BWJA 3LBHA 5BYJA 1IHUA 1F2TA 2A78A 2ZJ2A 1KZ7B 1HJBA 5J40A 1JB1A 1J2JB 3ZZ0A 1M1YE 1DAFA 2PEYA 3MUFA 2WTYA 1R0XA 1N6KA 2PZFA 2WWIA 1G8FA 2A3RA 1QHNA 3T06B 2J5XA 3RC8A 3TSOA 2ZRJA 4KYIB 2WJGA 3ND8A 4B34A 2O8CB 1BKDR 2KB0A 4B2LA 1DAHA 3C8UA 1XWIA 2BEKA 3CH4B 3PCRB 2OUKA 4PC1A 1CULC 3AKEA 1E1RD 2N9BA 2VIIA 3MCAA 4A0RA 1WA5A 3K0AA 2DFTA 5CB8A 2WWFA 4TL9A 4US0R 4C0LA 2IHBA 4XIGS 3U3RA 4EAQA 4QNMA 2FF7A 1X8YA 1OH8A 1TX4B 5JJLA 1N6OA 3CNLA 1B23P 1XD2A 1QHXA 1U8YA 3W6OA 4A8JB 5BXQC 2D74A 1MABB 1AQYA 4QM7A 5F9HA 1XZQA 1ZD8A 4GKGA 2GEVA 4K8OA 5FL7A 3I92A 4BZPA 3H84A 4V0ME 3I72A 4B32A 4JLDA 5APSA 3CX7A 1Q57A 3HU1A 4KLNA 5EE3A 2NQ2C 1YJ5A 1DAIA 1LFDB 2QE7D 4WAUA 2ZYVX 4YMSA 5JCPA 1T8TA 2HXSA 2OBLA 2X8AA 5FOUA 1KSFX 3EPJA 1KI3A 2CMKA 1W5SA 4FN5A 2QAGC 4RFVA 4MDFA 4RESB 2YJTD 5CK4A 2ZEJA 3KTAA 3LLMA 4URUR 3W90A 2QP3A 3B1XA 4EQ6B 2XGJA 1KO1A 2CL7X 2OG2A 1R5OA 3CPJB 4BPBA 4U00A 4KBGA 2WJHA 3QPWA 2IUUA 2BKUA 4OJQA 4LBZA 1QHHB 2YWFA 2ZSAA 5DHAA 2OAP1 2P7JA 4EOTA 1E4VA 4PPQA 4LYFA 2REOA 5JWRA 1N5JA 3KXLA 3V5BA 4EJSB 2FX3A 3TKLA 3RDPA 5DI9A 3TNFA 1IN4A 2GK7A 3DM9B 1NY5A 3IPYA 3ICQB 4KU4A 4BFUA 1H8AA 3AP1A 3LW8A 1GUAA 5DLQC 1MFZA 2OFXA 3B9PA 3VR5A 1IXMA 1XTSA 2ZI9A 1J90A 4QL3A 6Q21A 2CXXA 3CF0A 1AKEA 5B30A 4B3FX 1KSJA 3QBVA 3M0AA 4LHZA 3TUIC 3VX3A 4JJKA 2IW3A 1J8YF 4C2TA 4CW7A 2RCNA 2X77A 3T5GA 3KQNA 2GXAA 4V0LA 3DZDA 4JLBA 4KYUA 3SU8A 4HYYA 5KO2A 1RC8A 1HE1C 2VLIA 4F4JA 4KI0A 1Q12A 4XOIA 2DB3A 3PR1A 4DLWA 3RS5A 4OHWA 3AEZA 3VKWA 2ATVA 4DDTA 3KXIA 2DYKA 2XAUA 4LYJA 5FUYA 3MG9A 5F98A 3L0OA 1BMFA 5AW0B 5SZJA 2J0UA 1IXRC 1EGAA 4N0DA 5E7IA 5CDFA 1UEJA 1JNMA 1MRSA 2WWHA 4OQNA 4Q66C 1W48A 2GXSA 3SI7A 4YC7A 3GLIB 2V9PA 4DLUA 1P7CA 4CZ2A 4AIIA 2LKDA 4EIWA 1N25A 2PBRA 3K0CA 1ANKA 1KJZA 1JNYA 3VHXA 4PFSA 4IFEA 4W5WA 1OFTA 2L0XA 3C5CA 1T4GA 1T91A 3C5HA 4P33A 1SXJA 2AR7A 2IX3A 5TB5A 1EFCA 1NMZA 1TADA 5JS7A 3CRRA 4QBHA 2FNAA 3CB4A
chains in the Genus database with same CATH superfamily
4R1QA 1NQVA 3IVRA 2VZ9A 3R0QA 4WOPA 5JHGB 5D85A 1CQXA 2BASA 2YICA 3Q3EA 4FK5C 4ZZ1A 1NMXA 1G20E 5KYGA 1G2PA 4Y7DA 3IUNA 5LYYA 4RGQA 2IIPA 5BMVA 2ZBRA 1YVPA 4OATA 1T8WA 3WRVA 2W6CX 2NUTA 4OL9A 4WN3A 4GO1A 2QZJA 4U7NA 3O91A 3QU2A 2E3CA 2PO5A 4YJHB 1MSWD 1Y66A 5C8ZA 1DRUA 5TISH 4KX3A 1QC5A 4EUHA 2AF4C 3DOFA 4H7EA 5FO0A 3ZGVA 2VQEB 2V7QG 5KI6A 4O4LA 4ACAA 1M76A 5CVJA 4DGSA 4DRXB 2QF7A 3EGIA 5JOQA 4BVJA 3ZXSA 3D71A 1ESDA 1H4QA 1GU0A 1JVBA 3STYA 2JRIA 1MGOA 4ZOLA 2I87A 4FFWA 2D1QA 2FWMX 4EFKA 1YONA 5BSKA 4DMKA 1IPEA 1TQ6A 2ZUSA 1TK9A 2COEA 5CD9A 2CNDA 3AF4A 3B8NA 3GT7A 4EJ0A 3U0BA 4H6PA 5THKA 4K40A 1FXHA 4C4SA 1T8RA 4CDRA 1Q7GA 2ZB2A 2FYUE 3TRJA 5KPJA 3TRIA 3KYCB 2WP0A 1WAMA 4AN4A 3I61A 2G09A 4UXNA 2VF8A 3Q3HA 3M82A 1TOAA 2VJOA 1Q81W 3H1HJ 1OLOA 5F1OA 5BQPA 4AF6A 4IHJA 1WDLA 3OZGA 3CLRC 5B3KA 5D1HA 2RGEA 2CCKA 4JLAA 4OK3A 2ZS8A 4KQWA 4IEIA 5CH5A 5BW6B 4HAXA 1Q43A 2O8CA 4P4UA 4LRTB 4PD4H 1GNQA 1AUXA 1AQ6A 5F77A 3NEYA 3C3PA 5K8VA 3OZRA 3LWBA 2LV8A 1KETA 4DL9A 3GLFA 1YJ8A 2PWBA 3MOIA 3Q1KA 3T3EA 3GVPA 1X1SA 3JRWA 1MV5A 5KU1A 5K20A 1NVVQ 1Y5NA 3AR9A 1QRUA 3GV0A 2Z98A 1SC6A 2G5GX 1XMQB 1M72A 1Y74A 5I4IA 1N8SA 2ATEA 4JPRA 2VAPA 1W44A 4RZQA 5HCNA 5TQ2A 3I0MA 1XUOA 1RLJA 421PA 1UADA 4YLEA 1KQNA 1T8YA 1KRWA 5A7GA 2K9JB 4JXXA 3TOXA 2G4VA 1IL0A 1G7SA 1VB5A 3UTDA 2D54A 1VSTA 3DEJA 3PX7A 4JQYA 4AO6A 1P18A 2GASA 1T9DA 2RAUA 1U4NA 3CL3D 2Y6VA 5E3HA 2YZNA 3JSLA 3K0HA 3TZEA 3GEPA 2PANA 3PC3A 4UTPA 1LRLA 4DHEA 4NK4A 1YBFA 4Y28J 4GLJA 5AKEA 1H2YA 3AFOA 3COWA 1C4WA 1E3SA 5IY5C 3W2EA 4JI1B 1KPHA 4P9NA 1XNGA 3HCBA 2W2VA 1GU1A 2F3QA 5H59A 4BO6A 1XCLA 1BSVA 1WB7A 1II8B 2ZBFA 3EPHA 4TKVB 2XX3A 5L3QB 2X8BA 2BMAA 3DE7X 3A0BE 2OYHA 1QL2A 3ONFA 3VDNB 1VQ8P 4X62B 3DKPA 3TB6A 1NDHA 2FW0A 4HDMA 1HDIA 3UBMA 2X14A 4MPRA 4FOPA 3JQBA 2QUHA 1JQEA 1JE0A 1MG5A 2IU6A 4B6SA 2G80A 3QYAA 1IBCA 5HRAA 2XD9A 5T5QA 4YHBA 3D2AA 2ZXWC 4Q4JB 1A5SB 1C1DB 2BMVA 4K26A 4LA4A 5LL6Y 2NV2B 4O8CA 1IRXA 3OTOO 1DQPA 1GPAA 3L6UA 3FNIA 3V8NA 3JYQA 3IQHX 1SQQG 3OLCX 2AXEA 4DUZB 3JQRA 1LT9C 4PSVA 1U0GA 4NENB 5TX7A 3D8HA 1J24A 3B1VA 3U49A 2ZR7A 4R8LA 2GZ1A 1WQ1R 1LI5A 4NYKA 1DDIA 3VBBA 3G23A 2ZAOA 3MJSA 1U1CA 5F7ZA 3FUUA 6PFKA 1S01A 3CW9A 4KV9A 5E6RA 1Z4OA 1GZUA 4WI1A 2RBEA 1MKYA 1ZD9A 2WNSA 2HPAA 1HNZO 3GN1A 4FDLA 3CPHA 4EENA 4NL4H 4JELA 5L3DA 1WHSB 1NBMG 4ZT4A 2XXJA 4GIBA 3NXKA 1IOLA 5AR1A 2ONCA 1LA2A 1Q2NA 2B99A 5FWAA 3O92A 4NNOA 4QGBA 4XDKA 4GMKA 1E18A 4DCCA 5BV0A 1PL5A 2JFGA 3UVEA 2YNMC 5JWPA 1XL1A 3S2FA 1PGNA 5DHFA 3DVQX 2RJZA 1AI4A 3HSSA 1O5TA 1K5HA 7MDHA 3HSYA 3IDOA 1NH2D 2YS7A 2C2AA 4PQGA 2CCJA 5IAGA 1K33A 4X8HA 1JYSA 1CTQA 1R0BA 3ZMTA 3CLSD 3Q3GE 4K87A 4AZTA 3P2EA 5CMLA 4IFDK 3EAFA 2C9BA 4HDKB 1KQPA 3HZRA 2ZW9A 3ZWYA 4KIFA 2HRQA 2FWIA 3IPAA 1XFDA 1KEWA 3OMIB 2PD3A 1C7JA 1CQZA 1TCAA 2X6AA 3IAUA 4MYRA 4HUJA 1XKLA 1MHPA 4MQEA 4Q3AA 1DARA 4KP7A 4X20A 3QK7A 5FBHA 2E76C 3MB8A 3LX4A 3IELA 3WWDA 2V0CA 4CG0A 3CRW1 4F3YA 1CF4A 4D6PA 4E5NA 2VUSA 4F5ZA 5HPYB 3HXPA 3H1LG 4MKRA 1TMOA 3AFIA 1K73Q 4QUAA 1L0NH 4MP8A 4XLTA 2IEBA 3H9GA 2R7NA 1UWKA 4OHPA 2NVUB 3P1JA 4G1MB 4ASUD 3MWEA 4WX2B 2RCVA 2PG3A 1PG0A 3IH5A 5E0OA 4JLUA 4IOKA 5CA0F 2WTUA 2J9FB 2WYWA 5CCHC 1FLNA 3OOHA 1IUNA 3ZEIA 1PTJC 1H65A 4P4TA 3MTDA 1I1HA 2EU8A 2VPIA 1OTYA 2YXNA 1JW9B 3UHOA 1K7XB 3WU2Z 4N21A 1NUUA 5PGMA 2C1XA 4TYYA 3N2KA 2WPNA 2EQ5A 3GA5A 2H4JA 2DKOA 1ZOSA 1W1WA 1Z5NA 3SLGA 1U3GA 2PKQP 3JCZA 4ZXFA 2G3YA 2GAIA 5CX1B 3FR8A 4GC5A 4L6AA 2VP0A 4LE2A 4U2CA 4CDGA 4PVCA 1HNNA 4ZAWA 3LL7A 1DBIA 4GX0A 4AQRD 2XEXA 3ANLA 3HCDA 5K5EA 4B3TB 2VG8A 4V38A 2WHRA 1D07A 1XOIA 1H2MA 2C61A 4Q1BA 4UKDA 3BRTB 3U44B 4H0LD 2GVDC 4P53A 4OXNA 2CBXA 5FUBA 5B2FA 4FMTA 1N0NA 2GSDA 3TDKA 2YINC 4FHFA 5AO9A 1A1VA 3IKJA 4MRMB 1R8EA 2MCFA 3UW1A 1G1IA 2IYQA 2QTRA 4CGZA 3JZMA 1PDWA 2HG5C 3AI2A 1A4XA 1U2EA 1BHAA 3AK4A 3IBFA 1W19A 4BVBA 3KOWA 3JQ9C 4GQIA 3H2KA 1P2VA 1VF6A 1LKZA 1RQNA 3ETCA 5B1AC 4FCWA 2C7GA 1B6SA 1MX1A 1DKRA 1GO2A 5JECA 4FE3A 3DHVA 5JDCA 3Q0EA 4EMUA 2QTOA 4CNBA 1KD1W 1YTUA 2VJAA 3I28A 4RW0A 5BO5A 5HKAA 4UEOA 2GTHA 1IB0A 3E7XA 4QXMA 1KOJA 4GZLA 3HNRA 2UYYA 4AQDA 2IPXA 2WIDA 1SQPK 2AUTA 1N2IA 5H9CA 1IZZA 3L1IA 4MS2A 1JSLA 1RM3A 4OPAA 1GG2A 1D2EA 2P7IA 1P2UA 2OG1A 1PZEA 4GZMA 2POHA 2HLPA 4OH8B 2PZKA 3MINB 4G0ZA 3QF4A 4G1EB 1RC0A 3RKRA 1JU4A 1NJ1A 1F1BA 1AT1A 1IHXA 4PVDA 2W0MA 1VHLA 4DNFA 4YMGA 3E6AA 3A1EA 4UXHA 2WLKA 1E2GA 3OWXA 1ECPA 1RM1B 4NU6A 5AYVA 2ECQA 1WOMA 5GMOA 1POXA 2KJQA 3ABLC 4XM0A 4ANFA 4EWLA 2B1JA 3LX8A 5EP2A 5C1OA 4ZCTA 2V1DA 1ADYA 4Q4HA 1VE9A 2CNNA 2QM4A 3HO6A 1AP5A 4KRXA 4EG6A 1GNRA 2ZSFA 1JU3A 1ZCJA 1Y5LA 1DLIA 1SCQA 3K6KA 4IRXA 2ZCEA 3UFXA 2XYHA 2HMTA 1P2DA 3NHZA 5EJ4A 4YT5A 3GDGA 4EZBA 4ND4A 4CODB 3V1MA 4RYDA 4Q7JB 3TN7A 3BULA 5CA3A 3HVIA 5EIHA 3L73E 3OHPA 2QHXA 3UJPA 1TNDA 4G8CA 3HTXA 3PK0A 5KMGB 1DMRA 3RS3A 3LVQE 4QBKA 4R2IA 1JHDA 3NAZA 2FEXA 5G40A 2YYAA 2FEPA 4K6FA 4L7VA 4YH1A 4F3TA 1HFKA 4RIFA 4WEOA 4MW2A 1M67A 3WL3A 5KC9A 4CLOA 2DLNA 5I7WA 4ENQA 3CNQS 4MB0A 1US8A 2EDAA 2GA8A 4GLXA 4MUYA 3A2AA 1OAKA 1UC4B 3CUYA 3VR5D 1UH5A 5GTIZ 1VQKP 4YASA 1EXWA 4D8VA 4URXR 2WF5A 4IXWA 3P2IA 5AT1A 1T9ZA 2FCAA 2Z57A 3CXHE 2H89C 2A0FA 3P9PA 4Q9LA 1DX6A 1T2CA 4Z1OA 1E69A 4DWJA 3JX9A 4DILA 4B5KA 2XNXA 4XA4A 3WLQA 1E79A 2WK1A 3PRYA 1TVMA 5DP1A 3WFZA 2FP4B 4WWHA 2QGNA 1L9KA 2L17A 3TLZA 4FFVA 3IUQA 2AQKA 3T1OA 1V55C 4PGHA 3Q9NA 3WGQA 2I0FA 1YS1X 4MYUA 1WMFA 3M6VA 1DC8A 5ALGA 1Q0ZA 1U8UA 2ZS9A 2QTLA 3K5IA 3FPCA 2BLNA 4JI5B 1I4DD 4GVLA 5IKOA 2B6HA 4RVFA 1L5LA 1USIA 4KN5A 1RJGA 4HCJA 2H5LA 2H6EA 5E38A 1RKBA 3A36A 4A1OA 4BV2A 1DRKA 1WPXA 3H8WA 3S2IA 4MW8A 4LLHA 5KOHB 2ZT9D 3DE6X 1R6UA 2W71A 4P7JA 5BNFA 4AYCA 2EP8A 3DC5A 1KYOF 2RDCA 4K03A 2MWMA 1AJQA 5D3MA 4N23A 1DTWA 2P4EA 2HIHA 5HE8A 1OI2A 4AO8A 4ZU1X 5AW3A 2AFIE 5FBRB 2BZ0A 1N8KA 1QBZA 1B41A 2ZXEB 4RPHA 4PNZA 5LB2A 4HUTA 1H2LA 1WLSA 1SUEA 4MCHA 3WKEA 5K0BA 3QU4A 2HMWA 1HZJA 3ASOC 1F9AA 4HDNB 2DSTA 3H2HA 3HPRA 3S3XA 3IJ4A 2G63A 3NO4A 2J5BA 3EZLA 5LD2C 1CUGA 1RP1A 3ADOA 5EC2C 3VSCA 1UBKS 4ALJA 2FSUA 4QEKA 4YAUA 1JCCA 1ZUNA 5FPRA 3QJYA 2DFLA 1IG3A 4ZARA 5KHLB 4EI9A 1X9IA 3C4JA 2CLLB 2X2PA 1ZJJA 5AW4B 1Q1QA 4BVKA 2UZ1A 1M7HA 4J0JA 2Q21A 4QGAA 3H6KA 3HNPA 4EDFA 1SCJA 4RPJA 3BXOA 3N39C 4RAOA 5BNZA 3LSQA 3A58B 1JN0A 2MW2B 1Y3HA 1UJ4A 3WRYA 1H05A 4C7VA 1SQXK 1C5KA 4NH4A 4ZKEA 4I1SA 5HJ2A 2GK4A 2J4DA 2GKSA 3AC0A 2HW8A 5D5QA 1YI2V 1Z5OA 2KYRA 4F92B 1U2GC 2V7QH 1YZQA 1I08A 3TINA 3UT0A 4P35A 5KQRA 4H0NA 4DYLA 2EGHA 4UB6H 3HU5A 2P4SA 1HSOA 2ZBDA 2VDUE 4MTCA 3BMQB 4U3FG 3DF7A 1T1EA 4MUHA 5CBOA 1SHTX 5JASA 4YHHO 2V6IA 2EW2A 3HL4A 1MKMA 7AT1A 2QK4A 2O19A 3CLHA 5LKRA 1BKSB 2IOFK 1KI7A 1W30A 2ZE6A 3K6RA 5FPTA 4IIJA 3IIJA 4J3FA 2FZ4A 3FCSB 3SVZA 1XN1A 1JEYB 3GFOA 1AJYA 1XKTA 1HY3A 1Y8QB 2QVXX 4CL3A 4OUKX 3RRFA 4G37A 3SOZA 1ZIYA 1GTOA 5BN1A 1E20A 2ZPAA 4WZAB 1PUIA 2JGIA 1F4NA 1UOEA 1BVHA 2VSXA 4D8XA 4ATNA 1GNPA 4FGKA 2FQWA 3WIOA 1XAHA 3E53A 2CTPA 4P3PA 1KPIA 4RK1A 3MMXA 1E5QA 3URKA 1H2BA 1A3CA 2QDXA 3GNSA 2A7XA 3UK0A 5M2QA 4OOEA 1K5GA 2AFVA 3V7WA 1DINA 5JADA 4I55F 1QEXA 2M5AA 3EG9A 2PKEA 1L4BA 2L69A 4YRMA 2H16A 2J0UB 4ZQGA 3B3AA 1U7OA 5U1PA 1W73A 2VHVA 2HA4A 1M90W 1OZGA 3VHXB 2JK0A 4ZBMA 4JYBA 5KLVG 3FKQA 2F8SA 1RXYA 2PV0A 1PNTA 4C4TA 4K9NA 2GCIA 2GETA 1Z33A 1EK1A 3EEBA 2V5UA 4NBVA 4LS3A 5BMVB 1NQWA 3EJ6A 2Z04A 1N57A 4JENA 2QRQA 2NUTB 4DM3A 2EZOA 3AG6A 4FCTA 2B34A 2ZIZA 5KS2A 1VQ6P 4YUZA 2ZIAA 1FK8A 1PP9G 4YJHA 4OH7A 4GRDA 3ZUPA 1QC5B 5GJVC 4NHOA 4GZRB 4RUFA 2GBPA 2JDIG 2F3UA 1DFHA 2ZI3A 1P45A 4EZEA 5FTLA 1VMKA 1M6VA 2WD8A 2BOCC 5AICA 5EXPA 4YP6A 4D9MA 2QBYB 2Q0HA 4ZOLB 1EWKA 4K05A 2QOEA 5DJTB 4MULA 2MR5A 1ORRA 3P2JA 2I1JA 3M2PA 2QTHA 2Q5EA 1QQTA 4IJKA 4ABMA 1ATIA 5DTIA 4D3FA 3UV6A 4XUEA 1NN3A 2AXTH 1NTMJ 4DNPA 2XUQA 3AJ8A 5L3FA 4RQBA 1ZKMA 3ZW7A 4F45A 3G2JA 3P0EA 2SHKA 3DMDA 4WEQA 4N8DA 4UEJA 5K3AA 3K5OA 3EXIA 4EJSC 3WNDA 4CFYA 3IILA 1KK0A 3P8CE 3BWVA 5CCGD 3RL0g 4IHJB 2ZWOA 4D9JA 1EHIA 2WT9A 3WV5A 3EEQA 1YJBA 1AU9A 1R1BA 2C7QA 4H13C 2RI6A 2PMFA 2PZFA 1G8FA 4K0KO 1WQ3A 4R83A 1ODCA 4DQ0A 2O8CB 1R6DA 1BKDR 1PJ2A 4BIMA 3FD9A 4YUWA 2B4QA 3C8UA 1SPXA 3AKEA 1R74A 3WBBA 4ZVSA 3GA7A 4XIGS 4AECA 2A0WA 1VXRA 1XZQA 5FL7A 4GPZA 1U7TA 5AP9A 3TBHA 4NXMB 1M1XB 2ZYVX 3O5AA 2N05A 2VRNA 2EKDA 1Z68A 2ZZMA 4OAOA 4QECA 3ZHYA 3KTAA 3IUBA 4BAYA 2N74A 4BPBA 1Y74B 2HRBA 4KBGA 3PJSK 1R4MA 3HI4A 5FULA 3FCCA 3SKYA 2KS1B 1E4VA 1ODLA 3BK1A 1V4BA 4JI6O 5TQ2B 3DNFA 5H7XA 4MMZB 4BBAA 4BX0A 2PUDA 1AGNA 3LKZA 4B3RB 5A7FA 3DLIA 3EUEA 1ZMRA 4Q15A 3GWOA 2QJYC 2VLIA 1SD5A 1ATZA 1R6XA 1GQQA 2DYKA 4DLLA 3MG9A 2QJKC 1W29A 3N75A 1NTZK 4N0DA 2V9PA 4AIIA 2R8BA 2PAJA 1VEWA 3K8ZA 1NJ6A 4PS1A 2HH9A 2DPMA 2FR8C 2OXIA 3GJ0A 3GVCA 2H2GA 2FWAA 2FW9A 1B73A 2Q29A 5EEHA 5BURA 3WKCA 2QVYX 5AI8A 4DT0A 1VFNA 4DB2A 1DWUA 3M6FA 3KD3A 4C0BA 4O5AA 4R4JA 2ZB4A 2WHYA 5TISZ 1JMBA 3HMKA 4H44D 1II8A 3ENKA 2QZ9A 3DEFA 2OYHB 1YR1A 3RM3A 1QWSA 1U96A 4LJSA 4ENPA 4GOXA 3T6KA 2Y0EA 2ACEA 2RKOA 4HDMB 4JC0A 3NH9A 4IL6H 2WV7A 2JGLA 1Z88A 4DUGA 1BHQ1 3L93A 5AWFC 4MEJA 4O2AB 4CI0B 3NBKA 1FS0G 5K8CA 2I4TA 1K75A 1EZVD 1T6ZA 4NBKA 2R2AA 2X40A 2QWPB 1MQSA 4NC9A 4PC3A 1C1DA 3U3JA 3H1LH 3GT4A 4PLHA 5IKXA 1WMBA 4INPA 4OQZA 4N0MA 1RPAA 4K3AA 3NV9A 5JSZB 1YCHA 4H1HA 4KODA 3TLGB 4TQFA 1BH6A 4FW8A 4G3XA 1NU1K 3NTXA 3EBPA 5JXJA 2PQ0A 1OFCX 3PJDA 2Y71A 3UKDA 2WTNA 3LCUA 1VQLP 4JHLA 1Q83A 1TECE 3EMVA 1SWWA 4BDTA 5KTBA 3K70C 3ICCA 1GRRA 1KQGA 1DBWA 2OIGA 4KO4S 3WK6A 1IZYA 2G36A 3ZYZA 5BYBA 5JXHA 5E6RB 3ITDA 4RQFA 1K04A 4EHIA 1SHLA 4Q7MB 5F5LA 4Q18A 5B57C 2P4KA 4R8KA 1WXFA 3RGGA 4QOEA 4H3HB 3KLPX 2UUBO 5LJLA 3PC4A 2Q9BA 2QRHA 3N2EA 5AESA 3T7DA 4FZRA 4C0KA 4BGEA 2QL7A 1LUWA 3DFIA 3L70D 3HXQA 2HEGA 3NM6B 4DG8A 1KA9H 2JCYA 2JEZA 5ES3A 1HLPA 3O47A 2QJRA 2JS7A 1T0UA 3R0XA 4A8TA 3C6MA 1AK9A 1FRQA 4P83A 1A9YA 1JAYA 3IURA 1WCYA 3FX2A 1MZVA 3FZNA 3BD8A 1X1BA 3P9ZA 4D98A 4GKKB 5KPDA 3VQVA 3V48A 3WLLA 4J0EA 3QMMA 1XHLA 1ZNXA 3DH0A 2YXEA 4EFMA 2F9LA 3PT5A 2PV7A 3ZDZB 1GO3F 1Q0RA 2UYGA 1NUPA 4WFAV 5KSZA 1XL0A 1O97D 2BP7B 2TRSB 2ZROA 3MS4A 3Q5GA 5B58C 1UJBA 4MUGA 1J49A 3LLUA 3OAAG 4MQEB 4Z1MD 1OR8A 1ZHHA 3DULA 4X20B 1JFVA 3QV1A 3K9HA 1L8DA 3PXBA 4MVJM 4MMXB 5IAAA 4YPOA 5AW9B 1OB5A 3OETA 1RYNA 4TL8A 2Z4SA 4FE7A 4IM7A 2R7KA 1XKXA 4OKIA 2HV8A 3C9IA 2GCOA 3BZWA 1GEGA 3BICA 3TGPA 1Q22A 5HW0A 3OU7A 1XQ9A 2HJDA 5B3LA 4ITVA 1MOSA 3LPLA 3CF4G 5JY1A 5KIAA 1G3QA 1G6UA 4MVJG 3G6BA 4WLVA 5CTJA 3AVTA 4QQFA 4K81B 2W8BB 3LW7A 2P22C 3ORQA 2IU3A 2J59M 2J9FA 1NT4A 1Q1GA 1W36C 1Q6UA 3WAKA 2DHRA 4MUXA 1HDXA 5JMTA 4BAUA 1HYHA 4CM3A 1UZMA 4ZRNA 5HTKA 4KFSA 1N2CB 1BQZA 5SZIA 3N2KB 4W7YA 3AF1A 4BVAA 4R6ZA 5LZ7A 2DXIA 3H25A 3NJ4A 3OCYA 4RHCA 2NSYA 2VCEA 1XE3A 5JBNA 4Z4CA 2Y0CA 2F1IA 3M4JA 5CX1A 2V6JA 3OLQA 2AR0A 4ND2A 5CHEA 1C4XA 1HDOA 1WDKA 3IQDB 2GUZA 2MR6A 2RHTA 5CDGA 4NU8X 3G4SP 4X88A 1N7LA 3SDZA 2Y69C 1QF7A 4O8ZA 1E60A 3F49S 3DPSA 1KB9H 2QW0X 1E9DA 2D00A 5BORA 3HUUA 3U44A 2D2FA 4QTYA 5ALNA 5F9FA 3KVOA 4QHYA 2OYCA 1UM8A 4MO2A 2CGNA 2HVKC 4NE7A 4EG4A 1WZNA 1JSCA 1LJ8A 2MK3A 1NXSA 2JAWA 2YO3A 3IDSA 4O0LA 3FAZA 3FMPB 1CB0A 3MJRA 3RBXA 4HF7A 3WLPA 3EGDA 1BU8A 5BSEA 1RBZA 2E5YA 3B13B 4A10A 3QUBA 3O95A 1P2FA 1T4MA 4M0KA 4Z51A 3GGJA 1UEXC 5AJZA 3BD6A 2Y66A 4BGIA 2QD4A 4DDKA 4ZVUA 1W52X 5COQA 4J0CA 1FFAA 4I66A 3THOA 4OCZA 2B30A 3C98A 4A16A 5LNK6 4LFCB 4IH9A 3D7NA 5MN4A 3MHHC 4OLJA 1O1YA 5HR5A 1XQ6A 5TLSA 3T9AA 3FWNA 3V9AA 1E4EA 1NTKK 4ZZ3A 1Z4MA 3L43A 1X39A 1REQB 3CCBA 4CJXA 1AHNA 2VSFA 3OIGA 2YYSA 3QF4B 2YTZA 3IP7A 4JA2A 4EKDA 2W6NA 3TXSA 1CNMA 1MA3A 2JA1A 5CLJA 4OSOA 1ZMTA 4BEBA 2Q8VA 4BJ5A 1LTKA 1A4RA 2WIAA 1P8AA 2IYPA 2R87A 1UOOA 3PEUA 4LWQA 3EF1A 3OICA 4HHEA 4RSRA 2FPSA 3KOXA 4PO3X 3W7BA 2XBMA 2XTMA 1ZM3A 3TYYA 5LHHA 4RL4A 4MHOA 4CR6A 5AI9A 2IBZH 1SKMA 3M9XA 4KAXA 5T57A 2C0WA 2ZREA 4QASA 3FGZA 4LC0A 4HLNA 1GIAA 3JQPA 4HVAA 4OK6A 3JD2A 5KVAA 3AI3A 4I9UA 5FBVB 1T2KD 3UFXB 5CJ4A 1KI8A 4DDVA 5JT1A 4HDCA 4CV0A 2C0XA 5G53C 4JYCA 2OARA 1XV5A 4BMPB 2LIPA 1ZGHA 4F21A 1E63A 1NN0A 1MORA 3AONB 5KMGA 2RI1A 1XTPA 5CYPA 1E6KA 2XDWA 3ISTA 3EH1A 3E82A 4ZAFA 1KK1A 2FN7A 3D8NA 1RZUA 2DPXA 1V6SA 1I2AA 1US8B 4OGLA 5ALEA 1VLVA 3DUFA 1FDIA 5JSHA 2PVSA 2Y0BA 2IY9A 3H9EO 3VU9A 2VRWA 4JXKA 1DAPA 3ST7A 3KZKA 3S70A 1V54B 2CKDA 3N28A 1YL5A 5AM0A 3EXEB 2PT6A 3GY0A 5A4JA 3MN1A 5EBMC 4FZJA 1YTFB 3EAGA 1X42A 1TEXA 1DG1G 1U81A 3ID6C 3RVPA 5BVHA 2EARA 1K06A 1HQCA 3EMKA 5ADUS 3CCLP 3QV2A 4R3WA 1YRWA 2V7XA 3SZLA 1TLTA 4G23A 4KQJA 1J22A 3W6ZA 4QUJA 3AK1A 4PCUA 2O48X 4U3FH 4RK5A 4RTQA 5DCUA 1MVLA 3ROMA 1KTMA 2ZE5A 5KAMA 1SQQJ 1LPOA 1XXLA 1AUQA 3FM9A 2I55A 2F1OA 3GOQA 1U9JA 2V7GA 3R5FA 4DPKA 2ZKIA 1XYVA 4PAGA 2OXFA 2WVRA 1QYRA 1G4UR 5DGIA 4B71A 2HPCA 3T9CA 4I1OA 3OURA 2BE7A 4FZ1A 3NJRA 1I36A 4RD0A 1VQMP 3ZV7A 2POCA 4MV8A 4KJMA 3S1SA 3SC6A 1NP6A 4AQ7A 2YNYA 1ZAKA 1E9BA 1PCXA 4HKZH 5D3MB 3FRIA 3SX0A 1DTWB 4EATA 4QUHA 1NOIA 3D02A 4DJGA 4BWGA 2F9MA 2FK8A 2ZRFA 4MK4A 1HR0O 4JWTA 5AW3B 1SQSA 1ZGGA 2ZXEA 3D6JA 3KO8A 3PVCA 1CY1A 5FWNA 3CIOA 4MR9A 4WY4C 1R10A 1JJ2U 4GFDA 3R4YA 1D6JA 2W4MA 2XE4A 3I55P 1DD3A 3GPCA 2ZDIC 3PQ2A 5JXIA 4HDNA 4OKSA 2FMHA 2RHDA 3KIPA 3TSZA 3JD4A 4POAA 5KQMA 1J1DC 3DWFA 3ZWBA 5IAJA 3WL5A 2BCEA 3BDAA 1Z8NA 4PZEA 1ZUNB 2DPYA 4OO3A 2D3OW 3ESBA 4EVIA 4CETA 2D0OB 1G5IA 2HFJA 1QKIA 2PQ2A 5HWSA 2HMAA 1YE3A 3D7RA 4FPXA 4CQNA 4D3DA 4CKYA 1P84F 3HZZA 5KLVH 2UZ1B 2WYOA 1GGEA 3FWPA 1KAGA 4IDOA 1LX7A 1BS3A 2W8ZA 5DE3A 5JISA 2OPHA 4I81A 2QUIA 3KUCA 2NZ2A 2SKCA 1OQAA 4EG5A 4ML3A 4J9VA 2VAWA 2G8NA 2O14A 5JXWA 3NCTA 2XV5A 3WJAA 1PFGA 4R7CA 2WLIA 4UASA 2QR3A 4G1BA 2FXMA 4OI0A 3FMIA 1QHGA 3W7XA 1AZLA 2CFIA 2JDIH 2VR1A 5KHOC 1XRNA 4DR3O 4YP1A 1FFBA 4BN0A 2ZSBA 2OZEA 3IAYA 4TV9F 1U9IA 5J47A 5G1NA 3PXDA 1I7PA 3P2MA 2IEDA 3AL2A 4FLFA 3OZSA 3RAPR 1PZXA 2NMVA 5EWLB 2H9AA 1PGJA 1VG8A 1KP2A 4BUJA 4EL5A 3I83A 2ZXUA 1SO8A 1I5EA 1J56A 5K1XA 5TGZA 3F3YA 4XCVA 1DX9A 3SSNA 2FN8A 2MSKA 3T4ZA 4Q5IA 3X1KA 3TQCA 4IIJB 4Z2AA 1GQSA 2R97A 2C9CA 4JB8A 3CUKA 3LFUA 3BRQA 3SXUA 1GFWA 4KHXA 1QGUA 3Q5RA 1LQ2A 3QW2A 2P4QA 1P33A 4FINA 1PR5A 3LKBA 4YCBA 1G7TA 1Y1PA 4R1OA 5JEEA 2F1HA 5E2BA 4V0OA 2QPAA 2V6FA 2JJ8A 4WZAA 3SEZA 2C4WA 3DZBA 3AZOA 3CC2P 1M6WA 1CQPA 3QHAA 1W75A 1FU8A 3M6LA 3GLTA 5EXSA 1YIJP 4PC2A 5A5VA 4CQMA 2H00A 4UNSA 2ZPTX 3ERCA 2XCQA 3RG8A 3STWA 2Y0PA 2DUMA 1E89A 4Q47A 1OCZC 2ZBVA 4JBZA 3J81k 4XJXA 4XVCA 1NHGA 3HE4A 2M5AB 1N8TA 3EG9B 5EVJA 3QU5A 3O38A 3RQIA 2R8RA 4BATA 1Q3HA 3TM4A 3U7QB 2GYUA 3WYCA 1GR0A 1RLUA 2BH9A 2D4HA 2VDOB 4HAZA 2HDWA 2ZIMA 4TKLA 2QR4A 4BEJA 1FOSF 1GPNA 1QHFA 4B84A 2QY6A 1PG2A 4UDYX 4XUGB 4QAQA 2ZD9A 1VRCA 1Y7IA 2C58A 3FSGA 3IKLA 1V41E 1JTHB 4MTOA 2NW6A 3QXJA 4RU1A 1FDOA 1NN1A 1ZL2A 2CHQA 2PH7A 3RS9A 1I30A 3CRAA 4MGZR 5BSFA 4PNPA 3BTOA 4GSKA 4AJNA 3RR2A 3PQEA 4TTJA 4TYPA 1EGMB 1M6VB 1SVIA 4DCOA 1ZEMA 1J5XA 2EIHA 2HJWA 5ABPA 2QBYA 5BNTA 1ITZA 3GRVA 3GFRA 4EW6A 5FFFA 3JQAD 1PSWA 1YZVA 2AFHA 1V43A 2YS8A 5JC8A 5GPBA 2QZZA 4PGAA 3RK3C 3U1CA 3F74A 1OASA 3GFPA 2RD2A 4HLUA 4CHTA 4UB6Z 4U5XA 3K79A 4NPEA 1S3JA 7ADHA 3SJZA 2ZQ5A 4RO2A 4D9HA 2J6IA 5KWEA 3V4OA 5MF6A 4KL8S 3D9QX 5A71A 2WKPA 3EXIB 5BR8B 3AWIA 3T61A 3LUKA 1URQC 3DT6A 2EZ4A 4AROA 2FBWC 3N7TA 2W7TA 2IWRA 4MUJA 2C57A 4ESHA 3PKJA 2RN9A 1YIOA 5DSXA 2VT2A 1JIUA 4M76B 1MH9A 4RQAA 3QOXA 4B17A 1AB6A 1TYDE 1C7FA 1RKVA 2R8PA 3RK0A 3RRNA 2GARA 4JBYA 2XKBA 1RE3A 4PV1D 1QB8A 3UAZA 4DE5A 2C9DA 2XNDD 2KLBA 4IJWA 3KJGA 1J8FA 3JZAA 4N9QA 2Q9UA 3C1LA 5C7YA 2BFMA 2P6RA 4Y2YA 1QONA 1M2KA 3WIDA 4PGFA 1TUIA 3FBWA 4WK2B 3AB7A 3R2JA 4QU9A 4KO2S 1C0LA 2XUGA 4B48A 3V2NA 3W5DA 1V3VA 3U0ZA 1ZCFA 3O8CA 2EKPA 1N0IA 3KTAB 3IGAC 2QUJA 1W0KG 1L7AA 1UOQA 1R4MB 4TXHA 4M7PA 5BR4A 2KS1A 2J9RA 3L72E 1Z9BA 3W6NA 2PGJA 4DAOA 1H2RS 4LVNA 3V1YA 4MWBA 2CF6A 4PYNA 1A5AB 3HYCA 2BL4A 3P20A 2ECPA 3ABIA 3LF2A 5DYWA 3TVDA 2OYSA 5FPOA 1A2OA 5BRNA 1W2HA 3WMXA 4C7XA 4JVNA 3E8XA 1FTQA 1MDBA 2CLCX 5K9ZA 3GN2A 1VKZA 5AJTA 1TXGA 1JG4A 4J1NA 4ID3A 4O1IA 4DABA 3ICVA 4P5EA 1EB9A 2JC3A 3LY9A 4QE9A 5CW2A 1G5TA 3ETDA 2CUKA 5J2TB 4XQ0A 1JTEA 4MAMA 5AI5A 1FTSA 3DOEA 4XH9B 3VVBA 3SZMA 4OA5A 2ZUFA 1YO6A 3R7LA 4BNGA 4GXNA 1NF9A 5BV1A 3OA2A 3AI7A 1KEUA 1NATA 3VYUB 4LJ7A 3UB4A 4OXXA 4EGAA 3OFJA 5K8TA 3SR3A 2W6AA 1S5HC 2OHIA 2ST1A 1JUNA 3DTVA 3H1IG 2FOIA 1X4TA 4UE2A 3V97A 2HL6A 4DM7A 1ARZA 2JFZA 3IDFA 3FH0A 3KVRA 1EP2B 4JBHA 2P9JA 3DS8A 3VRHA 3QQPA 2J5KA 2HJVA 3SLKA 1ZOOA 3BXXA 5INTA 4YI5A 2CTWA