1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
2WSFH 1L0LK 1NTZK 2O01H 1SQBK 4IFDK 2J59M 5KLVK 2WSCH 2FYUK 2LKMA 3CLQA 1SQXK 1SQQK 1SQPK 2WSEH 3G3ZA 1NU1K 3LW5H 3M9QA 1NTMK 1SQVK 1NTKK 2OARA 1L0NK
chains in the Genus database with same CATH superfamily
1MZ9A 1RY3A 5KAFH 1LTTC 1AQTA 5AW9B 3V5BA 2KYVA 3L71E 3MIWA 5AVQB 1YJWP 2E5YA 4I7ZC 1AA0A 1SQXJ 1JUNA 5KLVG 3BCCE 1OIPA 2YKOA 1VQKP 4IFMA 3H1JG 5KAFE 3CWBG 2Z5IA 1BE3D 1J1EC 3EFGA 1JY2N 1KYOH 2B87A 1GW4A 4TLFA 3RK3E 3OAKA 1KQSO 4GOFA 1EZVI 4HH2A 3KYQA 3AE5C 1D7MA 1SQVE 2KOGA 1NTZE 2XZRA 1QX8A 2AEJA 3M9QA 3RL0D 3CC4P 1NTKK 2E74C 2WT7A 2D2CC 2BCCD 1JY3O 1S5LX 2IYOA 1L4AD 3KXDA 4ZKPA 4GT1A 3CCUP 2OYHC 1EDJA 2OGUA 1P84E 2N9YB 4LC1A 5M1BA 3AE7C 3TSIA 2V7QH 1VQ9P 2E76B 1PPJG 3C1LA 3R4YA 4B86A 1L4AB 4ZNCA 1FU1A 2M5AA 1BCCJ 2BEZF 3WUVA 1NWQA 3SSUA 1LJ2A 1KQFB 2XU6A 5KJ7D 4GODA 4YTPC 2P7JA 3VOPA 1G1JA 3ABVC 1T3UA 1J1DB 3L70J 2FXPA 1PGOA 4ZKUA 3RBXA 1KFNA 1AVOA 2QE7H 2IFMA 3L75G 1SQPK 4WY4A 3VYIA 3H6PA 2FYUD 3L36A 1X0TA 1Q82Q 1OZHA 2J5UA 1R5LA 5AW7B 4GDOA 2FXOA 1LWUB 1QVGO 1JM0A 1SQVG 2HPCA 3RK2D 1DX7A 2FFDA 4YXWH 2AXTH 3KZIE 3RK3B 3H1LD 3PLNA 2O1KA 2BCCG 3CCVP 1BCCG 4QMAA 1IFPA 3M9BA 1CI6A 2Y9YA 1GL2C 2KZJA 1QLED 3F5HA 1JY2O 3AEEC 3H1IE 5AVRB 1S3JA 3V2RA 3CCSP 1CI6B 2HFED 1SFCC 1VQ7P 3HE4A 1S2EA 3L74G 1HGZA 1L0LG 1ZRTD 1SQBK 4H13B 1KTMA 2Y0EA 1NTKE 4JYBA 2E43A 1NTMJ 1NTMD 2B9BA 3AEBC 3O6QA 5E79H 3VTPC 4IFFA 2R44A 5CCGA 1NTZD 4L73A 1YJ9P 1NTZJ 2OYHA 5APVA 1ZN5A 1NVOA 4K3AA 2W6BA 4NPDA 4DOJA 4EI2A 1Q81Q 3CCEP 1BE3G 3CPWO 2I1JA 4I6MC 3CXHE 3W67A 2Q3EA 2M5AB 3PJSK 3N4XA 2R3CA 1USDA 3RK2C 5KLVD 5KLVE 5APQA 2O1JA 3Q5RA 4RKUJ 2Y0DA 1Y47A 1H89A 3VP9A 5BU8B 3BCCD 2N1TD 4Y28J 3BCCJ 1GDTA 2YO2A 1MFTA 2OTLP 3QWOC 1YHQP 4IL6E 1SQQD 2N9BA 1G2CB 2ZVNB 3H1IJ 3H1ID 4NPEA 1GZLA 1FOSE 2E42A 1GW3A 1HUCA 1DD3A 2YNYA 2E74D 2WSSH 1K73Q 1G2CA 2NRGA 1NTZK 5AW3B 1GU4A 1IZNB 2WITA 3UIAA 1M1JB 1FJPA 3TGUG 1OW8A 3D6ZA 2BCCJ 3AECC 2E74B 2WVRA 3CCJP 5CBOA 1NU1J 2KZIA 3T97A 4IL6X 1LTJC 3Q1MA 1LP1A 2ZVOB 1GK6A 2QJPB 1RE3A 3V2PA 1HJBA 1SVFA 1X22A 1EC5A 1L4AC 2OTKE 1LP1B 1PV3A 2V7QJ 5BVZA 4AUWA 1L4AA 1NTMG 1H0TA 1GTWA 3IAOA 3L72J 3SFDC 1N73B 1LTJA 2WPQA 4EOTA 1LGHB 2OARA 2K37A 4O9BA 1X79B 1RQVA 5CMZA 2NPSA 3L73J 4HJGH 3A7OA 2P10A 3WU2H 3B8EB 4DZOA 5AVSB 1IK7A 5KAIH 1RE3C 3A0BE 5GTHH 3WMM0 1OWAA 1Q90D 2E5TA 3AEFC 2C9NY 1N8RQ 3H1LJ 1NAYA 3RK3C 1PP9G 1VF5B 2I8DA 1EXIA 3CX5D 3M91A 4MN4C 4D6TJ 1EXJA 1YQ3C 1M7LA 3OJAB 3AE4C 1L0LD 3TGUE 1BCCE 2DW3A 1EQ7A 3SWKA 5KJ7A 4D6TG 2A06E 2AXTE 1L0NJ 2NPSD 3KZIH 1L0ND 1FJKA 1ZR2A 3HTKA 2N1TA 5AVZB 2ZT9B 4L75A 4PJ0H 1YJNP 1HH0A 1KB9E 1HTLC 1URQC 1Q86Q 2ZJSE 1LTBC 1PP9J 2HR3A 2VRSA 3H1JJ 1XTCC 4BWNA 3MHVA 3H1KG 4PD4I 5KKZB 1S9KD 5APWA 1S9KE 3H1HD 2IDBA 4H0LB 4L76A 3AE3C 1RE4C 2QM7A 5KLIB 1SFCA 4GKGA 1WT6A 3RK3D 4JYCA 1E79H 1U7MA 2O01H 1YI2P 1KD1Q 2AEMA 1N7SD 1SLQA 2E75D 2W6JH 1BE3E 1K05A 3CI9A 2WSFJ 4XFJA 1VQ4P 3D70A 1HF9A 1RF1B 3CCMP 3GHGC 1IFIA 2KB7P 3A3YB 3CXHD 2E75B 1SQXK 4OGQB 4UB8E 3RL0C 4GOEA 3O6QB 2YXRB 2NPSC 4CPGA 3M0DC 5CJ4A 2POHA 1NJIQ 3GLMA 1IFJA 2FYUJ 4N3YB 3II6A 1YTZI 1M8OB 1JMBA 3JCUE 3HD7C 1KILE 3Q3DA 4U3FD 2Y0CA 1JCCA 4U3FJ 2Z4EA 2KP8A 1NTMK 2ZXEB 3GF3A 2Q7CA 4AYCA 2IBZD 1ZRTE 3USSA 1KB9I 2AEFA 3FX0A 1RQUA 1KZUB 2M8RA 2QJPC 3HE5B 2YKQA 4C7RA 4KHXA 3N7NA 3SFEC 4AQRD 1YIJP 3NFQA 5L8RJ 3JSVC 1K9MQ 3C9IA 4L74A 2KSEA 3V4WA 1IJDB 1KQGB 1AFOA 2QJKB 1NH4A 4RESB 3GHGA 1JCDA 2PRRA 1N73C 1NTME 4WY4D 3MUDC 3G71P 2CPBA 2CPSA 1JOCA 1KB9H 3L75E 5AVWB 2HG5D 2FYUG 2N1TC 4HKZH 1S1CX 4KJMA 4M3LA 1LT9B 2M3BA 1GL2D 1LTAC 1PGQA 4OWFA 2JP3A 4U3FE 1T3JA 2M0BA 3B5NC 4PD4H 2QA4P 1DH3A 2K88A 1QEXA 3FGAD 4C7NB 4BXLA 3KQGA 1NKZB 2JDIH 1EZVE 1FZCC 3A2AA 1VQNP 1SQPE 1KILB 3C8VA 4C7NA 2WTYA 1SQQE 3H1KJ 1KQLA 2A06G 3D6YA 2IBZI 3L71J 1KYOD 3TK1A 2IX7C 1YQ4C 2O3JA 2YO3A 1MUUA 3CXHH 3IFMA 1DEBA 3L74E 3MP7B 3A0HH 1AQ5A 2LXBA 5KAIE 1T2KC 2HPCB 1JO5A 3L70E 1JTHA 3HTKB 3WU2E 1VQLP 2LR2A 2FKWB 2Q1KA 5TISE 5AW0B 3B4SA 3PP5A 2KNCB 1S5LE 4YPCA 1T6AA 3U1CA 1ZXGA 4IOIH 5H2FE 1VQMP 2W8ZA 5DJUB 2P2UA 3L75J 5TJHA 1JY3P 2WZ7A 5KKZC 2KSJA 1G1IA 4NPFX 3H1JE 1SP4A 3VMXA 3AE6C 3GW6A 1VQOP 3CL3D 5DJTB 3H1LG 3K5BA 4LGDE 5CCHC 3CXHI 3P8CD 1OVVA 5K5GB 5CJ0A 4Y99B 3CCLP 2O01J 1EZVG 5EFWB 2PFXA 4C46A 1RH5B 1GL2A 2H43A 1JY2P 1LNQA 1SQPG 2A45G 1FZEA 2WSFH 2YIUC 3GHGB 1SQQG 2R5DA 1L0LK 4H44C 3KDPB 3P7KA 1NKNA 1N7SA 1JY3N 2NPSB 4TT3H 2K9JB 3U59A 4PJ0E 4YXDC 3CMEP 5AW4B 2V4HA 2OYOA 2GUVA 1JNMA 1IK9A 2FYNB 2Q6QA 1YITP 3KPEA 3L74D 1LT9A 5B5EH 3TDKA 1PL5A 3G9RA 2YMKA 1S72P 2A06D 2I1KA 3E1RA 3H1KE 1IC2A 1SQXE 2BEQD 2E76D 1OFCX 5B66H 1J2JB 2H88C 1A02J 1NU1G 4HB1A 1SS1A 1UIXA 5AVVB 2ZYGA 3L71D 1BGYG 1OW6A 3L37A 2W6AA 4EYYQ 1FZAA 3IR9A 3GF7A 3CCQP 3E7KA 1NGMB 1FZCA 1ZW0A 1J1DC 2KS1A 3HUSB 1P84H 2OYIA 3CWBJ 1L2PA 2ITAA 1VQPP 2GA1A 1DD4A 1LT1A 4EDFA 2ZXXA 3LIDA 1J1EB 5E79E 4ZMDA 2ZYDA 5KJ7C 2QEXP 3GMAA 1FDMA 3Q5PA 2JWAA 1BDCA 3BCCG 1FZBA 2K1AA 3M06A 1LWUC 4OH8B 3CWBE 2KUBA 2BCCE 1LT9C 5APYA 3V6IA 3TGUD 3HE5A 1ZV8A 1M57D 5KLVK 1U7JA 3P32A 3M9HA 1KMIZ 4R4LA 3V2NA 3B5NB 4KT0J 2R5BA 3U1AA 5CHXA 4DCKA 4W7ZA 1N73A 1NTKG 2QSIA 3FWLA 3H32A 1CW5A 1SQQK 1Q2NA 2OYHB 4EIJA 2LXCB 2BASA 3AE9C 1KILC 4WB4A 2XNXA 1Q7YQ 2FFDC 2HLOA 1MV8A 1BGYE 1KV4A 3G4SP 2PGDA 4D6TE 1NU1K 5C39A 3S4RA 2KK7A 2G3AA 1GK4A 3I5CA 1Z56A 1GU5A 1P84I 2UWJE 1HVVA 4IL6H 2OTJP 1PPJE 1FZGA 1NU1D 1EDLA 3OW2O 2MJZA 1KC8Q 1HBWA 1L0LJ 3HD7A 2KIKA 3D71A 3BRTB 3M0DA 2C0WA 3VMYA 1KILA 3L35A 3WUUA 4N78E 4W80A 3B71A 1FDIA 2G8YA 3IF4A 3V2QA 3W68A 3L72D 3RBZA 3L72E 3RK2B 3A5TA 1YBKA 3P8CE 3AE1C 4ASVA 1RF0A 1DEEG 2B88A 1OVRA 2GUSA 2IPPA 3AE2C 3MTUE 4N78D 5APSA 5AW2B 3EQ2A 3H1JD 2LKMA 1KILD 3RGUA 5TISH 1A02F 1S5LH 2YKPA 2ZFCA 3IN6A 2OYIB 1GL2B 2YIUB 4H44B 1BGYJ 3A0HE 1LWUA 3NXSA 2O01N 1KORA 1SQXD 3A0BH 2JEEA 2L91A 2RMZA 2QM8A 1M1JC 4H44D 1ZR4A 1AVYA 1KYOI 1LTIC 1NTKD 2XNDH 4H13C 4R4MA 1OW7A 1N2DC 2KLUA 1WRGA 2RKLA 3L70G 4BRYB 4D6TD 2Q9IA 1M90Q 1L0NK 3LIEA 1LTJB 1KYOE 2YMYA 4N6JA 1SQQJ 4PV1B 4PD4D 3CX5H 3OA7A 1L0LE 3BASA 5B5EE 2IYPA 3AEGC 1ZOYC 5KTBA 1PPJD 2WT7B 3L72G 2K9JA 3FWNA 1PGPA 3H1LE 3HRNA 2QG4A 4DJGA 2IFNA 2R32A 3CWBD 3HUSC 3TNUB 1W2BO 4WWIA 2HODA 2J58A 5GTIE 5CBNA 2ZYAA 4ASWA 1RHZB 3MUDA 1OVUA 3EWKA 3L75D 1DIPA 1BCCD 3H1HE 2GM4A 1HWTC 1Y8AA 1YTZT 2A45I 1VF5C 2W83C 1SQVD 2B87B 3CX5E 5AVUB 3L70D 3PHLA 1NHLA 3GG2A 5H2FH 1MKMA 3WUTA 1KB9D 2QJYB 3KHUA 2R3SA 1EDKA 2KXPB 3CX5I 2KS1B 3HUSA 3L73D 3MGNA 3O8ZA 3VN0A 1SQXG 1W2EA 2IZ0A 2JWDA 5AW6B 2WWWA 2P67A 1ZLLA 2WPSA 2WQYC 3SWFA 3MD0A 3Q5SA 1H88A 2FFDB 3CD6P 2ZT9C 1LTGC 1USEA 2P1JA 3JCUH 1BSHA 1URQB 3AE8C 2WSEJ 1FOSF 1VQ5P 2A45H 2QRXA 3ITKA 1OXZA 1RE4A 1BE3J 1M56D 2SPZA 3R2PA 4WY4C 2FYUK 3SWYA 3JC22 1N86A 1XTGB 2WPVB 4UB8H 1W5CE 1PGJA 2Q3IA 1IO4A 1KFMA 1OX3A 3B5NA 3BATA 2WPRA 1JB0J 4H0LD 4K35A 4PD4E 4UB6H 2C9LY 1H0TB 1TU3F 2C0XA 1QL1A 2FXMA 1X9VA 4WVZA 2JJLA 1T2KD 1ZP0C 1N7SB 4U7JA 1R8EA 1LTSC 2H7HA 2PP6A 2HYNA 4W7YA 1VF5D 2E75C 1JTHB 3RL0B 1OMIA 3H1IG 5CCGC 3FXDA 1GMJA 1MFZA 2KNCA 1S4XA 2HODB 2JR8A 3H1HJ 5APTA 2OYIC 5APXA 3HD7B 2B89A 1PP9E 2L5GB 3B5ND 3V4QA 3Q2YA 4I2LC 4JF7A 1X8YA 1SQVJ 2H8PD 2ZT9D 3HD7D 1Y9BA 3PH0A 3CC7P 4I1LA 4UB6E 1L0NE 1NO4A 2XV5A 3CLQA 2K9YA 3LW5J 1QL2A 5BU5A 3PTZA 1NOHA 5AW5B 1T8ZA 3H32B 1WMKA 1E5WA 2MKVA 2RN0A 4JQ0D 4PV1C 1NU1E 2FYZA 2WMMA 3NMDA 2W27A 4I7ZB 4H0LC 3G3ZA 2Z5HA 5GTHE 3H25A 1VL2A 1VDFA 1NYHA 2KLVA 2QJKC 5AW1B 4LLHA 5KLIC 4RJTA 5CCHD 1AJYA 2K3RA 1HGVA 3L74J 1R5SA 3CMAP 3T97B 3CC2P 2ZAEB 3P8MC 2FYUE 1PZQA 1RF1C 5B66E 3TNUA 4OGQC 4RO0A 4OGQD 1VQ8P 3EFFK 1SQPJ 1SQPD 5CCGD 1BSNA 2Q5UA 1FZFA 3F89A 2D2CD 3E1IA 1EZVD 3L4FA 2QVAA 3S1KA 1QGKB 3FXEA 3L73G 1SQBD 1SQBE 2JO1A 2J59M 1FS0E 1PIXA 3VP8A 2D2CB 1RF1A 1VQ6P 3I55P 2FY8A 2WSCH 1FZCB 1CZQA 1EDIA 4H13D 2AXCA 1IFDA 2QJYC 4PV1D 4A7PA 3RL0g 3TF5A 2E76C 5APUA 1UIIA 1BGYD 2NZ2A 1L0NG 2WSEH 2YXQB 3PRJA 4JPZB 1H8AA 5AVYB 2IBZE 3AEAC 3M0AA 1JMMA 3ZDMA 1M1KQ 1AV1A 1FE6A 1NTKJ 4Z1MH 2KI7B 2P58A 4OVNF 5KLVJ 3NTNA 1FAVA 1IFNA 1URQA 2CK3H 3L71G 1GD2E 4WY4B 1K04A 1KN7A 5AVXB 2FBWC 2JKVA 3HE4B 2M3EA 4XA4A 3I56P 3H1KD 1HJ0A 1BDDA 2N1TB 2XKMA 1N7LA 1M1JA 3H1HG 1RF0C 2IZ1A 3L73E 5AW8B 3TYYA 1SQBG 1U57A 4IFDK 1N7SC 4HYTB 4XE5B 2RH0A 3S9OA 3VMAA 2Y9ZA 4GIFA 1CSBA 4Y99C 1PP9D 1PFIA 2QIWA 3BRVB 1SFCD 2OQQA 3AEDC 1NAFA 4U3FG 3VMZA 1ZMEC 1JEKA 3MZWB 4JBZA 1IFMA 4BRYA 3BVHA 3QH9A 2H89C 1SFCB 4DT0A 5CCHA 1K8AQ 3LW5H 3TGUJ 1URQD 2FYNC 1P84D 2WSCJ 3CCRP 1FDOA 1NTZG 1SQBJ 1SQVK 1YYCA 1FC2C 2IBZG 2XDJA 2PAJA 4WBAA 1FBMA 5AVTB 1QVFO 5GTIH 1VPCA 2W90A 3G6EP
chains in the Genus database with same CATH topology
1MZ9A 1RY3A 1LTTC 5AW9B 3V5BA 2KYVA 3MIWA 5AVQB 1JUNA 2YKOA 4IFMA 2Z5IA 1J1EC 3EFGA 1JY2N 1GW4A 3OAKA 4HH2A 3KYQA 2KOGA 2XZRA 3RL0D 3M9QA 1NTKK 2WT7A 4ZKPA 1JY3O 1L4AD 4GT1A 2OYHC 4LC1A 3TSIA 4B86A 1L4AB 1FU1A 1NWQA 2XU6A 5KJ7D 2P7JA 3VOPA 1G1JA 1T3UA 1J1DB 4ZKUA 1KFNA 2IFMA 1SQPK 4WY4A 3VYIA 3H6PA 3L36A 5AW7B 1LWUB 2HPCA 1DX7A 3RK2D 2FFDA 3RK3B 2O1KA 3M9BA 1CI6A 1GL2C 1JY2O 5AVRB 3V2RA 1CI6B 2HFED 1SFCC 3HE4A 1HGZA 1SQBK 4JYBA 2E43A 3VTPC 5CCGA 4IFFA 2OYHA 5APVA 1ZN5A 2W6BA 4DOJA 2I1JA 4I6MC 3N4XA 2R3CA 3RK2C 5APQA 2O1JA 1H89A 1GDTA 3VP9A 5BU8B 2N1TD 2YO2A 2N9BA 1G2CB 2E42A 1GZLA 1FOSE 1GW3A 1HUCA 2YNYA 1G2CA 5AW3B 1NTZK 1GU4A 2WITA 3UIAA 1M1JB 1FJPA 3T97A 1LTJC 1GK6A 1HJBA 1RE3A 3V2PA 1SVFA 1L4AC 5BVZA 4AUWA 1L4AA 1GTWA 1N73B 1LTJA 2WPQA 4EOTA 1LGHB 2OARA 4O9BA 5CMZA 1X79B 2NPSA 3A7OA 3B8EB 4DZOA 5AVSB 1RE3C 3WMM0 1OWAA 2C9NY 3RK3C 3M91A 1M7LA 3OJAB 1EQ7A 5KJ7A 2NPSD 1FJKA 1ZR2A 3HTKA 2N1TA 5AVZB 1HH0A 1HTLC 1URQC 1LTBC 2VRSA 1XTCC 1S9KD 5APWA 1S9KE 1RE4C 2QM7A 1SFCA 4GKGA 1WT6A 3RK3D 4JYCA 2O01H 1N7SD 1SLQA 3CI9A 1RF1B 3GHGC 1IFIA 2KB7P 3A3YB 1SQXK 3RL0C 2NPSC 3M0DC 5CJ4A 2POHA 1IFJA 4N3YB 3II6A 1YTZI 3HD7C 2Z4EA 1JCCA 2KP8A 1NTMK 2ZXEB 2Q7CA 4AYCA 1KZUB 2M8RA 3HE5B 2YKQA 4C7RA 4KHXA 3N7NA 4AQRD 3NFQA 3C9IA 3V4WA 1IJDB 1AFOA 1NH4A 4RESB 3GHGA 1JCDA 1N73C 4WY4D 2CPBA 2CPSA 1JOCA 5AVWB 2HG5D 2N1TC 4M3LA 1LT9B 2M3BA 1GL2D 1LTAC 1T3JA 3B5NC 4C7NB 3KQGA 1NKZB 1FZCC 3A2AA 2WTYA 1KILB 4C7NA 1KQLA 3TK1A 2IX7C 2YO3A 1MUUA 3IFMA 1DEBA 1AQ5A 1JO5A 2HPCB 1JTHA 3HTKB 2FKWB 1FOSF 3U1CA 5AW0B 3PP5A 2P2UA 1JY3P 2WZ7A 2KSJA 1G1IA 1SP4A 3VMXA 3CL3D 4LGDE 5CCHC 3P8CD 5CJ0A 4Y99B 4C46A 1GL2A 2H43A 3GHGB 1JY2P 2A45G 2WSFH 1FZEA 4I2LC 1RF1A 2R5DA 1L0LK 3P7KA 3KDPB 1NKNA 1N7SA 1JY3N 2NPSB 3U59A 5AW4B 2GUVA 1JNMA 1IK9A 3KPEA 1LT9A 2I1KA 1IC2A 1A02J 1J2JB 5AVVB 3L37A 2W6AA 1FZAA 3IR9A 1FZCA 1J1DC 3HUSB 2OYIA 5KJ7C 3LIDA 1J1EB 1FDMA 1FZBA 3M06A 1LWUC 4OH8B 5APYA 1LT9C 3HE5A 1ZV8A 5KLVK 3P32A 3M9HA 3V2NA 3B5NB 2R5BA 3U1AA 5CHXA 1N73A 4W7ZA 3H32A 1CW5A 1SQQK 2OYHB 4EIJA 2BASA 4WB4A 1KILC 2XNXA 2FFDC 2HLOA 1MV8A 1NU1K 3I5CA 1GK4A 1GU5A 1Z56A 1HVVA 1FZGA 2MJZA 1HBWA 3HD7A 3BRTB 3M0DA 2C0WA 3VMYA 1KILA 3L35A 4N78E 4W80A 3V2QA 3RK2B 3A5TA 3P8CE 1RF0A 2GUSA 4N78D 2IPPA 5APSA 3MTUE 5AW2B 1PFIA 1A02F 3EQ2A 2LKMA 1KILD 2YKPA 2ZFCA 2OYIB 1GL2B 1LWUA 3NXSA 2JEEA 2QM8A 1M1JC 1ZR4A 1LTIC 1N2DC 1DH3A 1WRGA 2Q9IA 1L0NK 3LIEA 1LTJB 2YMYA 4N6JA 3OA7A 3BASA 5KTBA 2WT7B 3HRNA 2IFNA 2R32A 3HUSC 3TNUB 2HODA 2J58A 3MUDA 2GM4A 1HWTC 1YTZT 2A45I 5AVUB 1NHLA 3MGNA 3HUSA 3O8ZA 3VN0A 1W2EA 5AW6B 2WWWA 2P67A 1ZLLA 2WPSA 3SWFA 1H88A 3MD0A 2FFDB 1LTGC 2P1JA 1URQB 2A45H 1OXZA 1RE4A 3R2PA 4WY4C 3SWYA 2FYUK 1N86A 1XTGB 2Q3IA 1IO4A 1KFMA 3BATA 3B5NA 2WPRA 2C9LY 2C0XA 1QL1A 2FXMA 1X9VA 1T2KD 2JJLA 1N7SB 1LTSC 2H7HA 2PP6A 2HYNA 4W7YA 1JTHB 3RL0B 5CCGC 1MFZA 2HODB 2OYIC 5APTA 5APXA 3HD7B 3B5ND 2L5GB 3V4QA 4JF7A 1X8YA 2H8PD 3HD7D 4I1LA 1NO4A 2XV5A 3CLQA 1QL2A 5BU5A 1NOHA 5AW5B 1T8ZA 3H32B 1T2KC 1E5WA 2FYZA 3NMDA 2W27A 3G3ZA 2Z5HA 1VDFA 2KLVA 5AW1B 5CCHD 4LLHA 1HGVA 3P8MC 1RF1C 3TNUA 5CCGD 1FZFA 2Q5UA 3E1IA 3L4FA 2J59M 3VP8A 2WSCH 1FZCB 1CZQA 1IFDA 5APUA 2WSEH 1H8AA 5AVYB 3M0AA 1JMMA 3NTNA 1FAVA 1IFNA 1URQA 1GD2E 4WY4B 5AVXB 3HE4B 4XA4A 2N1TB 2XKMA 1N7LA 1M1JA 1RF0C 3TYYA 5AW8B 4IFDK 1N7SC 4HYTB 4XE5B 4GIFA 1CSBA 4Y99C 3BRVB 1SFCD 1NAFA 3VMZA 1IFMA 3BVHA 1SFCB 5CCHA 3LW5H 1URQD 1YYCA 4WBAA 1SQVK 2XDJA 2PAJA 5AVTB 1FBMA 1VPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF H;  1L0L K;  1NTZ K;  2O01 H;  1SQB K;  4IFD K;  2J59 M;  5KLV K;  2WSC H;  2FYU K;  2LKM A;  3CLQ A;  1SQX K;  1SQQ K;  1SQP K;  2WSE H;  3G3Z A;  1NU1 K;  3LW5 H;  3M9Q A;  1NTM K;  1SQV K;  1NTK K;  2OAR A;  1L0N K; 
#chains in the Genus database with same CATH topology
 1MZ9 A;  1RY3 A;  5KAF H;  1LTT C;  1AQT A;  5AW9 B;  3V5B A;  2KYV A;  3L71 E;  3MIW A;  5AVQ B;  1YJW P;  2E5Y A;  4I7Z C;  1AA0 A;  1SQX J;  1JUN A;  5KLV G;  3BCC E;  1OIP A;  2YKO A;  1VQK P;  4IFM A;  3H1J G;  5KAF E;  3CWB G;  2Z5I A;  1BE3 D;  1J1E C;  3EFG A;  1JY2 N;  1KYO H;  2B87 A;  1GW4 A;  4TLF A;  3RK3 E;  3OAK A;  1KQS O;  4GOF A;  1EZV I;  4HH2 A;  3KYQ A;  3AE5 C;  1D7M A;  1SQV E;  2KOG A;  1NTZ E;  2XZR A;  1QX8 A;  2AEJ A;  3M9Q A;  3RL0 D;  3CC4 P;  1NTK K;  2E74 C;  2WT7 A;  2D2C C;  2BCC D;  1JY3 O;  1S5L X;  2IYO A;  1L4A D;  3KXD A;  4ZKP A;  4GT1 A;  3CCU P;  2OYH C;  1EDJ A;  2OGU A;  1P84 E;  2N9Y B;  4LC1 A;  5M1B A;  3AE7 C;  3TSI A;  2V7Q H;  1VQ9 P;  2E76 B;  1PPJ G;  3C1L A;  3R4Y A;  4B86 A;  1L4A B;  4ZNC A;  1FU1 A;  2M5A A;  1BCC J;  2BEZ F;  3WUV A;  1NWQ A;  3SSU A;  1LJ2 A;  1KQF B;  2XU6 A;  5KJ7 D;  4GOD A;  4YTP C;  2P7J A;  3VOP A;  1G1J A;  3ABV C;  1T3U A;  1J1D B;  3L70 J;  2FXP A;  1PGO A;  4ZKU A;  3RBX A;  1KFN A;  1AVO A;  2QE7 H;  2IFM A;  3L75 G;  1SQP K;  4WY4 A;  3VYI A;  3H6P A;  2FYU D;  3L36 A;  1X0T A;  1Q82 Q;  1OZH A;  2J5U A;  1R5L A;  5AW7 B;  4GDO A;  2FXO A;  1LWU B;  1QVG O;  1JM0 A;  1SQV G;  2HPC A;  3RK2 D;  1DX7 A;  2FFD A;  4YXW H;  2AXT H;  3KZI E;  3RK3 B;  3H1L D;  3PLN A;  2O1K A;  2BCC G;  3CCV P;  1BCC G;  4QMA A;  1IFP A;  3M9B A;  1CI6 A;  2Y9Y A;  1GL2 C;  2KZJ A;  1QLE D;  3F5H A;  1JY2 O;  3AEE C;  3H1I E;  5AVR B;  1S3J A;  3V2R A;  3CCS P;  1CI6 B;  2HFE D;  1SFC C;  1VQ7 P;  3HE4 A;  1S2E A;  3L74 G;  1HGZ A;  1L0L G;  1ZRT D;  1SQB K;  4H13 B;  1KTM A;  2Y0E A;  1NTK E;  4JYB A;  2E43 A;  1NTM J;  1NTM D;  2B9B A;  3AEB C;  3O6Q A;  5E79 H;  3VTP C;  4IFF A;  2R44 A;  5CCG A;  1NTZ D;  4L73 A;  1YJ9 P;  1NTZ J;  2OYH A;  5APV A;  1ZN5 A;  1NVO A;  4K3A A;  2W6B A;  4NPD A;  4DOJ A;  4EI2 A;  1Q81 Q;  3CCE P;  1BE3 G;  3CPW O;  2I1J A;  4I6M C;  3CXH E;  3W67 A;  2Q3E A;  2M5A B;  3PJS K;  3N4X A;  2R3C A;  1USD A;  3RK2 C;  5KLV D;  5KLV E;  5APQ A;  2O1J A;  3Q5R A;  4RKU J;  2Y0D A;  1Y47 A;  1H89 A;  3VP9 A;  5BU8 B;  3BCC D;  2N1T D;  4Y28 J;  3BCC J;  1GDT A;  2YO2 A;  1MFT A;  2OTL P;  3QWO C;  1YHQ P;  4IL6 E;  1SQQ D;  2N9B A;  1G2C B;  2ZVN B;  3H1I J;  3H1I D;  4NPE A;  1GZL A;  1FOS E;  2E42 A;  1GW3 A;  1HUC A;  1DD3 A;  2YNY A;  2E74 D;  2WSS H;  1K73 Q;  1G2C A;  2NRG A;  1NTZ K;  5AW3 B;  1GU4 A;  1IZN B;  2WIT A;  3UIA A;  1M1J B;  1FJP A;  3TGU G;  1OW8 A;  3D6Z A;  2BCC J;  3AEC C;  2E74 B;  2WVR A;  3CCJ P;  5CBO A;  1NU1 J;  2KZI A;  3T97 A;  4IL6 X;  1LTJ C;  3Q1M A;  1LP1 A;  2ZVO B;  1GK6 A;  2QJP B;  1RE3 A;  3V2P A;  1HJB A;  1SVF A;  1X22 A;  1EC5 A;  1L4A C;  2OTK E;  1LP1 B;  1PV3 A;  2V7Q J;  5BVZ A;  4AUW A;  1L4A A;  1NTM G;  1H0T A;  1GTW A;  3IAO A;  3L72 J;  3SFD C;  1N73 B;  1LTJ A;  2WPQ A;  4EOT A;  1LGH B;  2OAR A;  2K37 A;  4O9B A;  1X79 B;  1RQV A;  5CMZ A;  2NPS A;  3L73 J;  4HJG H;  3A7O A;  2P10 A;  3WU2 H;  3B8E B;  4DZO A;  5AVS B;  1IK7 A;  5KAI H;  1RE3 C;  3A0B E;  5GTH H;  3WMM 0;  1OWA A;  1Q90 D;  2E5T A;  3AEF C;  2C9N Y;  1N8R Q;  3H1L J;  1NAY A;  3RK3 C;  1PP9 G;  1VF5 B;  2I8D A;  1EXI A;  3CX5 D;  3M91 A;  4MN4 C;  4D6T J;  1EXJ A;  1YQ3 C;  1M7L A;  3OJA B;  3AE4 C;  1L0L D;  3TGU E;  1BCC E;  2DW3 A;  1EQ7 A;  3SWK A;  5KJ7 A;  4D6T G;  2A06 E;  2AXT E;  1L0N J;  2NPS D;  3KZI H;  1L0N D;  1FJK A;  1ZR2 A;  3HTK A;  2N1T A;  5AVZ B;  2ZT9 B;  4L75 A;  4PJ0 H;  1YJN P;  1HH0 A;  1KB9 E;  1HTL C;  1URQ C;  1Q86 Q;  2ZJS E;  1LTB C;  1PP9 J;  2HR3 A;  2VRS A;  3H1J J;  1XTC C;  4BWN A;  3MHV A;  3H1K G;  4PD4 I;  5KKZ B;  1S9K D;  5APW A;  1S9K E;  3H1H D;  2IDB A;  4H0L B;  4L76 A;  3AE3 C;  1RE4 C;  2QM7 A;  5KLI B;  1SFC A;  4GKG A;  1WT6 A;  3RK3 D;  4JYC A;  1E79 H;  1U7M A;  2O01 H;  1YI2 P;  1KD1 Q;  2AEM A;  1N7S D;  1SLQ A;  2E75 D;  2W6J H;  1BE3 E;  1K05 A;  3CI9 A;  2WSF J;  4XFJ A;  1VQ4 P;  3D70 A;  1HF9 A;  1RF1 B;  3CCM P;  3GHG C;  1IFI A;  2KB7 P;  3A3Y B;  3CXH D;  2E75 B;  1SQX K;  4OGQ B;  4UB8 E;  3RL0 C;  4GOE A;  3O6Q B;  2YXR B;  2NPS C;  4CPG A;  3M0D C;  5CJ4 A;  2POH A;  1NJI Q;  3GLM A;  1IFJ A;  2FYU J;  4N3Y B;  3II6 A;  1YTZ I;  1M8O B;  1JMB A;  3JCU E;  3HD7 C;  1KIL E;  3Q3D A;  4U3F D;  2Y0C A;  1JCC A;  4U3F J;  2Z4E A;  2KP8 A;  1NTM K;  2ZXE B;  3GF3 A;  2Q7C A;  4AYC A;  2IBZ D;  1ZRT E;  3USS A;  1KB9 I;  2AEF A;  3FX0 A;  1RQU A;  1KZU B;  2M8R A;  2QJP C;  3HE5 B;  2YKQ A;  4C7R A;  4KHX A;  3N7N A;  3SFE C;  4AQR D;  1YIJ P;  3NFQ A;  5L8R J;  3JSV C;  1K9M Q;  3C9I A;  4L74 A;  2KSE A;  3V4W A;  1IJD B;  1KQG B;  1AFO A;  2QJK B;  1NH4 A;  4RES B;  3GHG A;  1JCD A;  2PRR A;  1N73 C;  1NTM E;  4WY4 D;  3MUD C;  3G71 P;  2CPB A;  2CPS A;  1JOC A;  1KB9 H;  3L75 E;  5AVW B;  2HG5 D;  2FYU G;  2N1T C;  4HKZ H;  1S1C X;  4KJM A;  4M3L A;  1LT9 B;  2M3B A;  1GL2 D;  1LTA C;  1PGQ A;  4OWF A;  2JP3 A;  4U3F E;  1T3J A;  2M0B A;  3B5N C;  4PD4 H;  2QA4 P;  1DH3 A;  2K88 A;  1QEX A;  3FGA D;  4C7N B;  4BXL A;  3KQG A;  1NKZ B;  2JDI H;  1EZV E;  1FZC C;  3A2A A;  1VQN P;  1SQP E;  1KIL B;  3C8V A;  4C7N A;  2WTY A;  1SQQ E;  3H1K J;  1KQL A;  2A06 G;  3D6Y A;  2IBZ I;  3L71 J;  1KYO D;  3TK1 A;  2IX7 C;  1YQ4 C;  2O3J A;  2YO3 A;  1MUU A;  3CXH H;  3IFM A;  1DEB A;  3L74 E;  3MP7 B;  3A0H H;  1AQ5 A;  2LXB A;  5KAI E;  1T2K C;  2HPC B;  1JO5 A;  3L70 E;  1JTH A;  3HTK B;  3WU2 E;  1VQL P;  2LR2 A;  2FKW B;  2Q1K A;  5TIS E;  5AW0 B;  3B4S A;  3PP5 A;  2KNC B;  1S5L E;  4YPC A;  1T6A A;  3U1C A;  1ZXG A;  4IOI H;  5H2F E;  1VQM P;  2W8Z A;  5DJU B;  2P2U A;  3L75 J;  5TJH A;  1JY3 P;  2WZ7 A;  5KKZ C;  2KSJ A;  1G1I A;  4NPF X;  3H1J E;  1SP4 A;  3VMX A;  3AE6 C;  3GW6 A;  1VQO P;  3CL3 D;  5DJT B;  3H1L G;  3K5B A;  4LGD E;  5CCH C;  3CXH I;  3P8C D;  1OVV A;  5K5G B;  5CJ0 A;  4Y99 B;  3CCL P;  2O01 J;  1EZV G;  5EFW B;  2PFX A;  4C46 A;  1RH5 B;  1GL2 A;  2H43 A;  1JY2 P;  1LNQ A;  1SQP G;  2A45 G;  1FZE A;  2WSF H;  2YIU C;  3GHG B;  1SQQ G;  2R5D A;  1L0L K;  4H44 C;  3KDP B;  3P7K A;  1NKN A;  1N7S A;  1JY3 N;  2NPS B;  4TT3 H;  2K9J B;  3U59 A;  4PJ0 E;  4YXD C;  3CME P;  5AW4 B;  2V4H A;  2OYO A;  2GUV A;  1JNM A;  1IK9 A;  2FYN B;  2Q6Q A;  1YIT P;  3KPE A;  3L74 D;  1LT9 A;  5B5E H;  3TDK A;  1PL5 A;  3G9R A;  2YMK A;  1S72 P;  2A06 D;  2I1K A;  3E1R A;  3H1K E;  1IC2 A;  1SQX E;  2BEQ D;  2E76 D;  1OFC X;  5B66 H;  1J2J B;  2H88 C;  1A02 J;  1NU1 G;  4HB1 A;  1SS1 A;  1UIX A;  5AVV B;  2ZYG A;  3L71 D;  1BGY G;  1OW6 A;  3L37 A;  2W6A A;  4EYY Q;  1FZA A;  3IR9 A;  3GF7 A;  3CCQ P;  3E7K A;  1NGM B;  1FZC A;  1ZW0 A;  1J1D C;  2KS1 A;  3HUS B;  1P84 H;  2OYI A;  3CWB J;  1L2P A;  2ITA A;  1VQP P;  2GA1 A;  1DD4 A;  1LT1 A;  4EDF A;  2ZXX A;  3LID A;  1J1E B;  5E79 E;  4ZMD A;  2ZYD A;  5KJ7 C;  2QEX P;  3GMA A;  1FDM A;  3Q5P A;  2JWA A;  1BDC A;  3BCC G;  1FZB A;  2K1A A;  3M06 A;  1LWU C;  4OH8 B;  3CWB E;  2KUB A;  2BCC E;  1LT9 C;  5APY A;  3V6I A;  3TGU D;  3HE5 A;  1ZV8 A;  1M57 D;  5KLV K;  1U7J A;  3P32 A;  3M9H A;  1KMI Z;  4R4L A;  3V2N A;  3B5N B;  4KT0 J;  2R5B A;  3U1A A;  5CHX A;  4DCK A;  4W7Z A;  1N73 A;  1NTK G;  2QSI A;  3FWL A;  3H32 A;  1CW5 A;  1SQQ K;  1Q2N A;  2OYH B;  4EIJ A;  2LXC B;  2BAS A;  3AE9 C;  1KIL C;  4WB4 A;  2XNX A;  1Q7Y Q;  2FFD C;  2HLO A;  1MV8 A;  1BGY E;  1KV4 A;  3G4S P;  2PGD A;  4D6T E;  1NU1 K;  5C39 A;  3S4R A;  2KK7 A;  2G3A A;  1GK4 A;  3I5C A;  1Z56 A;  1GU5 A;  1P84 I;  2UWJ E;  1HVV A;  4IL6 H;  2OTJ P;  1PPJ E;  1FZG A;  1NU1 D;  1EDL A;  3OW2 O;  2MJZ A;  1KC8 Q;  1HBW A;  1L0L J;  3HD7 A;  2KIK A;  3D71 A;  3BRT B;  3M0D A;  2C0W A;  3VMY A;  1KIL A;  3L35 A;  3WUU A;  4N78 E;  4W80 A;  3B71 A;  1FDI A;  2G8Y A;  3IF4 A;  3V2Q A;  3W68 A;  3L72 D;  3RBZ A;  3L72 E;  3RK2 B;  3A5T A;  1YBK A;  3P8C E;  3AE1 C;  4ASV A;  1RF0 A;  1DEE G;  2B88 A;  1OVR A;  2GUS A;  2IPP A;  3AE2 C;  3MTU E;  4N78 D;  5APS A;  5AW2 B;  3EQ2 A;  3H1J D;  2LKM A;  1KIL D;  3RGU A;  5TIS H;  1A02 F;  1S5L H;  2YKP A;  2ZFC A;  3IN6 A;  2OYI B;  1GL2 B;  2YIU B;  4H44 B;  1BGY J;  3A0H E;  1LWU A;  3NXS A;  2O01 N;  1KOR A;  1SQX D;  3A0B H;  2JEE A;  2L91 A;  2RMZ A;  2QM8 A;  1M1J C;  4H44 D;  1ZR4 A;  1AVY A;  1KYO I;  1LTI C;  1NTK D;  2XND H;  4H13 C;  4R4M A;  1OW7 A;  1N2D C;  2KLU A;  1WRG A;  2RKL A;  3L70 G;  4BRY B;  4D6T D;  2Q9I A;  1M90 Q;  1L0N K;  3LIE A;  1LTJ B;  1KYO E;  2YMY A;  4N6J A;  1SQQ J;  4PV1 B;  4PD4 D;  3CX5 H;  3OA7 A;  1L0L E;  3BAS A;  5B5E E;  2IYP A;  3AEG C;  1ZOY C;  5KTB A;  1PPJ D;  2WT7 B;  3L72 G;  2K9J A;  3FWN A;  1PGP A;  3H1L E;  3HRN A;  2QG4 A;  4DJG A;  2IFN A;  2R32 A;  3CWB D;  3HUS C;  3TNU B;  1W2B O;  4WWI A;  2HOD A;  2J58 A;  5GTI E;  5CBN A;  2ZYA A;  4ASW A;  1RHZ B;  3MUD A;  1OVU A;  3EWK A;  3L75 D;  1DIP A;  1BCC D;  3H1H E;  2GM4 A;  1HWT C;  1Y8A A;  1YTZ T;  2A45 I;  1VF5 C;  2W83 C;  1SQV D;  2B87 B;  3CX5 E;  5AVU B;  3L70 D;  3PHL A;  1NHL A;  3GG2 A;  5H2F H;  1MKM A;  3WUT A;  1KB9 D;  2QJY B;  3KHU A;  2R3S A;  1EDK A;  2KXP B;  3CX5 I;  2KS1 B;  3HUS A;  3L73 D;  3MGN A;  3O8Z A;  3VN0 A;  1SQX G;  1W2E A;  2IZ0 A;  2JWD A;  5AW6 B;  2WWW A;  2P67 A;  1ZLL A;  2WPS A;  2WQY C;  3SWF A;  3MD0 A;  3Q5S A;  1H88 A;  2FFD B;  3CD6 P;  2ZT9 C;  1LTG C;  1USE A;  2P1J A;  3JCU H;  1BSH A;  1URQ B;  3AE8 C;  2WSE J;  1FOS F;  1VQ5 P;  2A45 H;  2QRX A;  3ITK A;  1OXZ A;  1RE4 A;  1BE3 J;  1M56 D;  2SPZ A;  3R2P A;  4WY4 C;  2FYU K;  3SWY A;  3JC2 2;  1N86 A;  1XTG B;  2WPV B;  4UB8 H;  1W5C E;  1PGJ A;  2Q3I A;  1IO4 A;  1KFM A;  1OX3 A;  3B5N A;  3BAT A;  2WPR A;  1JB0 J;  4H0L D;  4K35 A;  4PD4 E;  4UB6 H;  2C9L Y;  1H0T B;  1TU3 F;  2C0X A;  1QL1 A;  2FXM A;  1X9V A;  4WVZ A;  2JJL A;  1T2K D;  1ZP0 C;  1N7S B;  4U7J A;  1R8E A;  1LTS C;  2H7H A;  2PP6 A;  2HYN A;  4W7Y A;  1VF5 D;  2E75 C;  1JTH B;  3RL0 B;  1OMI A;  3H1I G;  5CCG C;  3FXD A;  1GMJ A;  1MFZ A;  2KNC A;  1S4X A;  2HOD B;  2JR8 A;  3H1H J;  5APT A;  2OYI C;  5APX A;  3HD7 B;  2B89 A;  1PP9 E;  2L5G B;  3B5N D;  3V4Q A;  3Q2Y A;  4I2L C;  4JF7 A;  1X8Y A;  1SQV J;  2H8P D;  2ZT9 D;  3HD7 D;  1Y9B A;  3PH0 A;  3CC7 P;  4I1L A;  4UB6 E;  1L0N E;  1NO4 A;  2XV5 A;  3CLQ A;  2K9Y A;  3LW5 J;  1QL2 A;  5BU5 A;  3PTZ A;  1NOH A;  5AW5 B;  1T8Z A;  3H32 B;  1WMK A;  1E5W A;  2MKV A;  2RN0 A;  4JQ0 D;  4PV1 C;  1NU1 E;  2FYZ A;  2WMM A;  3NMD A;  2W27 A;  4I7Z B;  4H0L C;  3G3Z A;  2Z5H A;  5GTH E;  3H25 A;  1VL2 A;  1VDF A;  1NYH A;  2KLV A;  2QJK C;  5AW1 B;  4LLH A;  5KLI C;  4RJT A;  5CCH D;  1AJY A;  2K3R A;  1HGV A;  3L74 J;  1R5S A;  3CMA P;  3T97 B;  3CC2 P;  2ZAE B;  3P8M C;  2FYU E;  1PZQ A;  1RF1 C;  5B66 E;  3TNU A;  4OGQ C;  4RO0 A;  4OGQ D;  1VQ8 P;  3EFF K;  1SQP J;  1SQP D;  5CCG D;  1BSN A;  2Q5U A;  1FZF A;  3F89 A;  2D2C D;  3E1I A;  1EZV D;  3L4F A;  2QVA A;  3S1K A;  1QGK B;  3FXE A;  3L73 G;  1SQB D;  1SQB E;  2JO1 A;  2J59 M;  1FS0 E;  1PIX A;  3VP8 A;  2D2C B;  1RF1 A;  1VQ6 P;  3I55 P;  2FY8 A;  2WSC H;  1FZC B;  1CZQ A;  1EDI A;  4H13 D;  2AXC A;  1IFD A;  2QJY C;  4PV1 D;  4A7P A;  3RL0 g;  3TF5 A;  2E76 C;  5APU A;  1UII A;  1BGY D;  2NZ2 A;  1L0N G;  2WSE H;  2YXQ B;  3PRJ A;  4JPZ B;  1H8A A;  5AVY B;  2IBZ E;  3AEA C;  3M0A A;  1JMM A;  3ZDM A;  1M1K Q;  1AV1 A;  1FE6 A;  1NTK J;  4Z1M H;  2KI7 B;  2P58 A;  4OVN F;  5KLV J;  3NTN A;  1FAV A;  1IFN A;  1URQ A;  2CK3 H;  3L71 G;  1GD2 E;  4WY4 B;  1K04 A;  1KN7 A;  5AVX B;  2FBW C;  2JKV A;  3HE4 B;  2M3E A;  4XA4 A;  3I56 P;  3H1K D;  1HJ0 A;  1BDD A;  2N1T B;  2XKM A;  1N7L A;  1M1J A;  3H1H G;  1RF0 C;  2IZ1 A;  3L73 E;  5AW8 B;  3TYY A;  1SQB G;  1U57 A;  4IFD K;  1N7S C;  4HYT B;  4XE5 B;  2RH0 A;  3S9O A;  3VMA A;  2Y9Z A;  4GIF A;  1CSB A;  4Y99 C;  1PP9 D;  1PFI A;  2QIW A;  3BRV B;  1SFC D;  2OQQ A;  3AED C;  1NAF A;  4U3F G;  3VMZ A;  1ZME C;  1JEK A;  3MZW B;  4JBZ A;  1IFM A;  4BRY A;  3BVH A;  3QH9 A;  2H89 C;  1SFC B;  4DT0 A;  5CCH A;  1K8A Q;  3LW5 H;  3TGU J;  1URQ D;  2FYN C;  1P84 D;  2WSC J;  3CCR P;  1FDO A;  1NTZ G;  1SQB J;  1SQV K;  1YYC A;  1FC2 C;  2IBZ G;  2XDJ A;  2PAJ A;  4WBA A;  1FBM A;  5AVT B;  1QVF O;  5GTI H;  1VPC A;  2W90 A;  3G6E P; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  1RY3 A;  1LTT C;  5AW9 B;  3V5B A;  2KYV A;  3MIW A;  5AVQ B;  1JUN A;  2YKO A;  4IFM A;  2Z5I A;  1J1E C;  3EFG A;  1JY2 N;  1GW4 A;  3OAK A;  4HH2 A;  3KYQ A;  2KOG A;  2XZR A;  3RL0 D;  3M9Q A;  1NTK K;  2WT7 A;  4ZKP A;  1JY3 O;  1L4A D;  4GT1 A;  2OYH C;  4LC1 A;  3TSI A;  4B86 A;  1L4A B;  1FU1 A;  1NWQ A;  2XU6 A;  5KJ7 D;  2P7J A;  3VOP A;  1G1J A;  1T3U A;  1J1D B;  4ZKU A;  1KFN A;  2IFM A;  1SQP K;  4WY4 A;  3VYI A;  3H6P A;  3L36 A;  5AW7 B;  1LWU B;  2HPC A;  1DX7 A;  3RK2 D;  2FFD A;  3RK3 B;  2O1K A;  3M9B A;  1CI6 A;  1GL2 C;  1JY2 O;  5AVR B;  3V2R A;  1CI6 B;  2HFE D;  1SFC C;  3HE4 A;  1HGZ A;  1SQB K;  4JYB A;  2E43 A;  3VTP C;  5CCG A;  4IFF A;  2OYH A;  5APV A;  1ZN5 A;  2W6B A;  4DOJ A;  2I1J A;  4I6M C;  3N4X A;  2R3C A;  3RK2 C;  5APQ A;  2O1J A;  1H89 A;  1GDT A;  3VP9 A;  5BU8 B;  2N1T D;  2YO2 A;  2N9B A;  1G2C B;  2E42 A;  1GZL A;  1FOS E;  1GW3 A;  1HUC A;  2YNY A;  1G2C A;  5AW3 B;  1NTZ K;  1GU4 A;  2WIT A;  3UIA A;  1M1J B;  1FJP A;  3T97 A;  1LTJ C;  1GK6 A;  1HJB A;  1RE3 A;  3V2P A;  1SVF A;  1L4A C;  5BVZ A;  4AUW A;  1L4A A;  1GTW A;  1N73 B;  1LTJ A;  2WPQ A;  4EOT A;  1LGH B;  2OAR A;  4O9B A;  5CMZ A;  1X79 B;  2NPS A;  3A7O A;  3B8E B;  4DZO A;  5AVS B;  1RE3 C;  3WMM 0;  1OWA A;  2C9N Y;  3RK3 C;  3M91 A;  1M7L A;  3OJA B;  1EQ7 A;  5KJ7 A;  2NPS D;  1FJK A;  1ZR2 A;  3HTK A;  2N1T A;  5AVZ B;  1HH0 A;  1HTL C;  1URQ C;  1LTB C;  2VRS A;  1XTC C;  1S9K D;  5APW A;  1S9K E;  1RE4 C;  2QM7 A;  1SFC A;  4GKG A;  1WT6 A;  3RK3 D;  4JYC A;  2O01 H;  1N7S D;  1SLQ A;  3CI9 A;  1RF1 B;  3GHG C;  1IFI A;  2KB7 P;  3A3Y B;  1SQX K;  3RL0 C;  2NPS C;  3M0D C;  5CJ4 A;  2POH A;  1IFJ A;  4N3Y B;  3II6 A;  1YTZ I;  3HD7 C;  2Z4E A;  1JCC A;  2KP8 A;  1NTM K;  2ZXE B;  2Q7C A;  4AYC A;  1KZU B;  2M8R A;  3HE5 B;  2YKQ A;  4C7R A;  4KHX A;  3N7N A;  4AQR D;  3NFQ A;  3C9I A;  3V4W A;  1IJD B;  1AFO A;  1NH4 A;  4RES B;  3GHG A;  1JCD A;  1N73 C;  4WY4 D;  2CPB A;  2CPS A;  1JOC A;  5AVW B;  2HG5 D;  2N1T C;  4M3L A;  1LT9 B;  2M3B A;  1GL2 D;  1LTA C;  1T3J A;  3B5N C;  4C7N B;  3KQG A;  1NKZ B;  1FZC C;  3A2A A;  2WTY A;  1KIL B;  4C7N A;  1KQL A;  3TK1 A;  2IX7 C;  2YO3 A;  1MUU A;  3IFM A;  1DEB A;  1AQ5 A;  1JO5 A;  2HPC B;  1JTH A;  3HTK B;  2FKW B;  1FOS F;  3U1C A;  5AW0 B;  3PP5 A;  2P2U A;  1JY3 P;  2WZ7 A;  2KSJ A;  1G1I A;  1SP4 A;  3VMX A;  3CL3 D;  4LGD E;  5CCH C;  3P8C D;  5CJ0 A;  4Y99 B;  4C46 A;  1GL2 A;  2H43 A;  3GHG B;  1JY2 P;  2A45 G;  2WSF H;  1FZE A;  4I2L C;  1RF1 A;  2R5D A;  1L0L K;  3P7K A;  3KDP B;  1NKN A;  1N7S A;  1JY3 N;  2NPS B;  3U59 A;  5AW4 B;  2GUV A;  1JNM A;  1IK9 A;  3KPE A;  1LT9 A;  2I1K A;  1IC2 A;  1A02 J;  1J2J B;  5AVV B;  3L37 A;  2W6A A;  1FZA A;  3IR9 A;  1FZC A;  1J1D C;  3HUS B;  2OYI A;  5KJ7 C;  3LID A;  1J1E B;  1FDM A;  1FZB A;  3M06 A;  1LWU C;  4OH8 B;  5APY A;  1LT9 C;  3HE5 A;  1ZV8 A;  5KLV K;  3P32 A;  3M9H A;  3V2N A;  3B5N B;  2R5B A;  3U1A A;  5CHX A;  1N73 A;  4W7Z A;  3H32 A;  1CW5 A;  1SQQ K;  2OYH B;  4EIJ A;  2BAS A;  4WB4 A;  1KIL C;  2XNX A;  2FFD C;  2HLO A;  1MV8 A;  1NU1 K;  3I5C A;  1GK4 A;  1GU5 A;  1Z56 A;  1HVV A;  1FZG A;  2MJZ A;  1HBW A;  3HD7 A;  3BRT B;  3M0D A;  2C0W A;  3VMY A;  1KIL A;  3L35 A;  4N78 E;  4W80 A;  3V2Q A;  3RK2 B;  3A5T A;  3P8C E;  1RF0 A;  2GUS A;  4N78 D;  2IPP A;  5APS A;  3MTU E;  5AW2 B;  1PFI A;  1A02 F;  3EQ2 A;  2LKM A;  1KIL D;  2YKP A;  2ZFC A;  2OYI B;  1GL2 B;  1LWU A;  3NXS A;  2JEE A;  2QM8 A;  1M1J C;  1ZR4 A;  1LTI C;  1N2D C;  1DH3 A;  1WRG A;  2Q9I A;  1L0N K;  3LIE A;  1LTJ B;  2YMY A;  4N6J A;  3OA7 A;  3BAS A;  5KTB A;  2WT7 B;  3HRN A;  2IFN A;  2R32 A;  3HUS C;  3TNU B;  2HOD A;  2J58 A;  3MUD A;  2GM4 A;  1HWT C;  1YTZ T;  2A45 I;  5AVU B;  1NHL A;  3MGN A;  3HUS A;  3O8Z A;  3VN0 A;  1W2E A;  5AW6 B;  2WWW A;  2P67 A;  1ZLL A;  2WPS A;  3SWF A;  1H88 A;  3MD0 A;  2FFD B;  1LTG C;  2P1J A;  1URQ B;  2A45 H;  1OXZ A;  1RE4 A;  3R2P A;  4WY4 C;  3SWY A;  2FYU K;  1N86 A;  1XTG B;  2Q3I A;  1IO4 A;  1KFM A;  3BAT A;  3B5N A;  2WPR A;  2C9L Y;  2C0X A;  1QL1 A;  2FXM A;  1X9V A;  1T2K D;  2JJL A;  1N7S B;  1LTS C;  2H7H A;  2PP6 A;  2HYN A;  4W7Y A;  1JTH B;  3RL0 B;  5CCG C;  1MFZ A;  2HOD B;  2OYI C;  5APT A;  5APX A;  3HD7 B;  3B5N D;  2L5G B;  3V4Q A;  4JF7 A;  1X8Y A;  2H8P D;  3HD7 D;  4I1L A;  1NO4 A;  2XV5 A;  3CLQ A;  1QL2 A;  5BU5 A;  1NOH A;  5AW5 B;  1T8Z A;  3H32 B;  1T2K C;  1E5W A;  2FYZ A;  3NMD A;  2W27 A;  3G3Z A;  2Z5H A;  1VDF A;  2KLV A;  5AW1 B;  5CCH D;  4LLH A;  1HGV A;  3P8M C;  1RF1 C;  3TNU A;  5CCG D;  1FZF A;  2Q5U A;  3E1I A;  3L4F A;  2J59 M;  3VP8 A;  2WSC H;  1FZC B;  1CZQ A;  1IFD A;  5APU A;  2WSE H;  1H8A A;  5AVY B;  3M0A A;  1JMM A;  3NTN A;  1FAV A;  1IFN A;  1URQ A;  1GD2 E;  4WY4 B;  5AVX B;  3HE4 B;  4XA4 A;  2N1T B;  2XKM A;  1N7L A;  1M1J A;  1RF0 C;  3TYY A;  5AW8 B;  4IFD K;  1N7S C;  4HYT B;  4XE5 B;  4GIF A;  1CSB A;  4Y99 C;  3BRV B;  1SFC D;  1NAF A;  3VMZ A;  1IFM A;  3BVH A;  1SFC B;  5CCH A;  3LW5 H;  1URQ D;  1YYC A;  4WBA A;  1SQV K;  2XDJ A;  2PAJ A;  5AVT B;  1FBM A;  1VPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...