1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
2O01H 1L0NK 2WSEH 1L0LK 2J59M 2OARA 2WSFH 1SQQK 2LKMA 3M9QA 4IFDK 1NTZK 5KLVK 1SQPK 1SQXK 3LW5H 2FYUK 1SQBK 3CLQA 1SQVK 3G3ZA 1NTKK 1NU1K 1NTMK 2WSCH
chains in the Genus database with same CATH superfamily
4MN4C 3F89A 1RE4C 1QVFO 1W2BO 2ZYGA 3BCCG 3B4SA 2FYUE 3AE4C 1NTZK 4BXLA 4W7ZA 2QRXA 1BSHA 1J1EC 2IZ0A 1LTTC 1YQ3C 3CX5E 2R32A 1PGQA 1HVVA 3ZDMA 3H1HJ 1LT1A 3H1IE 4DJGA 1KILA 3AE9C 3GHGA 3AECC 3CC7P 1L4AB 4JYBA 1X9VA 1PGOA 3CX5H 2E76C 1EQ7A 2WSFH 5KAIH 1PP9J 2ZVNB 4R4LA 3OAKA 5AVUB 3IR9A 1NTMJ 4H0LB 3L75J 1IC2A 3AEDC 3LIEA 3JCUE 2NPSB 4B86A 2QJYB 3F5HA 1KB9D 2WSEJ 4HJGH 3HTKA 1EDJA 4OGQC 3L71D 4JYCA 3JCUH 2E74B 1VQLP 4ZKUA 1ZRTE 3HD7B 2ZAEB 1NTKK 1N7LA 1ZV8A 1R8EA 3KYQA 5APUA 1L0LG 1M1JB 2XV5A 2QA4P 1VQ9P 3USSA 3MD0A 2WTYA 5KLVK 5H2FE 1M90Q 4AQRD 1CI6A 4U3FE 4D6TD 1H8AA 1AA0A 3VYIA 3W68A 3OA7A 1YYCA 2P58A 3JSVC 3V2RA 2LR2A 5H2FH 3HE4A 1YHQP 2RN0A 1JNMA 3I56P 1EXJA 2OYOA 3O6QA 1BCCE 2J5UA 2R3SA 4U7JA 1Y9BA 2HODA 2WSEH 4WY4D 1T6AA 3RK3C 1NTZJ 4XE5B 3U1CA 2QJPC 4C7NB 3HD7C 2H8PD 2AXTE 3L71J 1R5LA 2LKMA 3VMAA 3M91A 1GDTA 1NTKD 3AE8C 1URQD 2OQQA 4OGQD 1PPJG 3BATA 1LTGC 2AXTH 1OIPA 2W6JH 5KLVD 1S72P 2H43A 1RE3A 3CCSP 2A45I 4HB1A 3CCMP 1QLED 4W80A 1NWQA 3L74G 3TGUD 4H13C 1MKMA 1VQ4P 3L71E 3PJSK 5AW7B 1R5SA 1JMMA 2D2CC 4UB8E 2L5GB 3CXHD 4Y99C 3HE5B 1HJ0A 1AV1A 3AE5C 5B66E 5CCHC 2IZ1A 1NU1K 1IFDA 1PL5A 3V2PA 3D6ZA 1USDA 1SQQG 4UB8H 1KQFB 3H1LD 4L74A 3SFEC 1SQXG 2YKPA 3P32A 4RKUJ 5B66H 2FFDA 1NTKJ 1S9KD 3RK3D 4D6TE 1SFCA 1L0NE 2OYHB 5CCGC 4KT0J 3VMYA 1IO4A 1TU3F 1VDFA 2WPSA 3W67A 3TNUA 2A06D 3L72E 3GLMA 1ZR4A 3M9BA 4LLHA 3TGUJ 1RF1B 3R4YA 1VQKP 1RE4A 1DIPA 1IFJA 2K9JA 4NPFX 1CSBA 2JJLA 3SWKA 2J59M 1BDDA 3OJAB 2KSEA 5BVZA 1QL2A 2KUBA 2N9YB 1NU1D 2LXBA 2O3JA 2OTLP 3NFQA 2C9NY 1JOCA 2YXRB 2E75B 3CWBE 3QH9A 2AXCA 1LTAC 5KLVE 3FX0A 1KTMA 2ZT9D 3C8VA 1S5LE 1EZVD 2A45G 1WT6A 1VF5B 2CPSA 2Y9YA 1LTJB 1RF0C 2QSIA 3L4FA 3RK2B 1YJ9P 3HUSB 3MGNA 1KYOE 1LT9A 4I2LC 5CHXA 1ZR2A 3CX5I 3BRTB 1S5LH 4L73A 2KI7B 1FOSF 2QJKC 1NKZB 3D71A 3I5CA 3L73D 3MHVA 1KMIZ 4AUWA 3AE3C 1URQA 1K04A 1YIJP 2QE7H 3H1LE 3A5TA 1KC8Q 2GA1A 3M9QA 1S9KE 1ZN5A 1OX3A 1NU1J 3KXDA 3RBZA 4EIJA 2WPVB 1Q2NA 2OGUA 1KILD 1QL1A 3H1KG 3HUSC 2QM8A 2FYNB 1SS1A 1JY2O 2WT7A 1Q7YQ 2Z4EA 3FGAD 3LW5J 1BGYG 1GMJA 2IYPA 1LNQA 2PFXA 2JP3A 5CJ0A 1CZQA 1G2CA 2R3CA 1U7MA 1OWAA 4GOEA 5C39A 1M8OB 3S9OA 1JY2N 1SP4A 3PLNA 3RBXA 1SQBK 5TJHA 1KQLA 1JTHA 1SQVK 4DOJA 2E5YA 2K3RA 1XTCC 3H32B 4HH2A 1BE3D 3MIWA 2M5AA 1EZVE 4PJ0H 1SQPK 2PGDA 1EDIA 3SWYA 2FYUG 4BWNA 1IZNB 3PTZA 1RH5B 3M9HA 3CMEP 1Q86Q 3TYYA 3H1JD 3VTPC 2CPBA 5APVA 5APTA 3NTNA 2YKQA 1RQUA 1QVGO 3H1IG 4PD4D 3L73E 1FBMA 3IFMA 3V5BA 1KV4A 3Q1MA 4I6MC 2OYIC 1VPCA 4ASWA 4WBAA 3H1HD 5CCHA 4C7NA 5CMZA 1SQVD 2OTKE 2IFNA 1J1DB 1AVYA 1N86A 1D7MA 1FE6A 1LWUC 1M7LA 1LJ2A 3T97A 1BE3J 1KILE 1P84D 2ZXEB 3SFDC 1KFMA 1NHLA 1SQPD 1UIXA 1YI2P 2V7QH 2FBWC 1PP9D 2KLUA 5CCGA 3U59A 4Z1MH 1Q90D 2KNCA 4JBZA 1GZLA 3RL0g 5KJ7D 3H1JJ 2L91A 4QMAA 1FZCC 1GL2C 2FYZA 1UIIA 2WZ7A 3CCRP 3Q2YA 2I8DA 4U3FG 1NH4A 4OVNF 4WY4B 1N7SB 1L0LK 3O8ZA 3TK1A 4EI2A 4K3AA 1SQBJ 1GD2E 1A02F 3A7OA 2MKVA 1SQVJ 5KAIE 2N1TC 3B5NB 2KB7P 4WVZA 2P2UA 2C0XA 3GW6A 2GM4A 1ZW0A 3AEAC 3AE6C 5KAFE 3L70E 4GOFA 1VQ5P 1BCCG 3H1JE 3V4WA 3G4SP 1SQPJ 3WUTA 4BRYB 3RL0C 1SFCD 5AW5B 3CCQP 1N2DC 5KTBA 3G6EP 5KAFH 4H44B 4HYTB 2R44A 4IFMA 3BCCJ 2GUSA 3H1HE 1JY3O 4OH8B 3MUDC 1NTZD 1YITP 3BASA 3PP5A 1HBWA 2JR8A 2Z5IA 1L0LD 4RO0A 5AVZB 2NZ2A 3B5NC 2O01J 1L4AC 1KYOI 1FZGA 1PP9E 1ZOYC 3D6YA 3L71G 2Y9ZA 1NTME 4JQ0D 3L75E 2B87B 1NYHA 5CBNA 4PV1B 2XNDH 5GTHE 4K35A 4H0LC 3HUSA 4H44C 4EOTA 2NPSC 1HH0A 1H0TB 2QJYC 2E76D 2KS1B 3N4XA 2YIUB 2HPCB 1LTIC 2Q6QA 5APYA 4D6TG 3TF5A 3OW2O 5GTHH 2P7JA 3Q5SA 1L0NG 2O01N 2WSCJ 2E74C 3A2AA 3E1RA 2JO1A 1IFNA 3HRNA 1SQXK 3CCEP 1VL2A 3L72G 1E79H 1M1JC 3L37A 1L0LJ 2IBZI 1PPJD 2H7HA 1IK9A 4GDOA 1VQ8P 2JKVA 1HF9A 2ZT9B 1GU5A 4YXWH 1FC2C 1USEA 5KJ7A 1N73B 4PV1C 4EDFA 3L74D 1ZMEC 1LP1A 2YXQB 1OVVA 1S5LX 2B9BA 5B5EE 3CWBG 1KB9E 5AVYB 1NTZE 3D70A 5KLVG 2YKOA 2XDJA 3EFFK 5K5GB 1AQTA 5B5EH 2NPSD 2WSCH 2FXPA 2Q1KA 1KB9H 3WUVA 3G71P 2OYIA 2HG5D 4IFFA 1SQXD 1MZ9A 1NJIQ 5AVXB 2KOGA 1LWUA 2ZYAA 3HD7D 1RQVA 1J2JB 1KILB 3KQGA 2OARA 3GHGB 1LTSC 1W2EA 3CC2P 4XA4A 3RGUA 3H1LG 3ABVC 3L74J 1OW8A 2BASA 1OW6A 1X22A 1QGKB 2RMZA 1K05A 3CD6P 3K5BA 2G8YA 5CJ4A 5KLIB 1FZCA 1PGJA 1H88A 4H13D 1GL2A 2P67A 1NGMB 1NTKE 2E43A 4O9BA 2C0WA 5AVRB 2IBZG 3AEFC 4YXDC 5KKZB 2D2CD 1SQQJ 3HTKB 1T8ZA 2JEEA 2R5DA 4LC1A 3AE2C 1SQXJ 3ITKA 3KHUA 5CCHD 3Q5PA 2OYHC 1MFZA 2N1TA 3CL3D 4RESB 3TGUE 2WSSH 2IDBA 1JY2P 2KZIA 3L36A 1RF1C 3E1IA 1LGHB 1CI6B 3V2QA 3CXHE 5CCGD 2XKMA 1Y8AA 5KLIC 2B88A 1M57D 3VP8A 2QEXP 5L8RJ 3BRVB 1M56D 3MUDA 3HE4B 1SQXE 2SPZA 3CXHH 3O6QB 2E75C 5KKZC 2IYOA 3RK3E 2FYUK 2HODB 1X8YA 2FY8A 4DT0A 1PGPA 5APXA 1OZHA 1L4AA 3IN6A 3L73G 1ZXGA 1VF5C 3H1KD 4KHXA 1LTJC 2A06E 4C7RA 1FZEA 3RK2C 2HR3A 2NRGA 4GKGA 3H25A 1FJPA 4DCKA 1KN7A 3WU2E 5BU8B 2IX7C 1SLQA 2K37A 5EFWB 2W90A 1IFIA 2NPSA 3N7NA 3CCLP 4JPZB 2AEFA 4DZOA 4N6JA 3WU2H 3SSUA 4PJ0E 1NU1E 5AVSB 2E5TA 1JB0J 2WMMA 2YMKA 1WRGA 5AVQB 2P1JA 3M06A 2KXPB 3HD7A 3CMAP 1QEXA 1M1JA 2WVRA 4CPGA 1FZFA 1S4XA 3II6A 5GTIE 4YTPC 1NAYA 1EC5A 2KP8A 2E75D 2FYNC 3H1KJ 3CX5D 5CBOA 2FFDB 1SFCB 1BGYJ 5GTIH 3CC4P 3LW5H 3AEGC 1E5WA 3P7KA 2PP6A 2Q3EA 3TNUB 2M0BA 2Y0EA 3WMM0 3L70G 1N8RQ 1SQBD 2K9JB 3CI9A 1KORA 2IFMA 4N3YB 3VOPA 2JDIH 1AQ5A 3H1KE 3MTUE 3S1KA 2FYUJ 3A0BE 4R4MA 1KB9I 1RY3A 3H1HG 1GW3A 2BCCD 1T2KC 3FXEA 3KZIE 3NMDA 2KK7A 1OFCX 1QX8A 2FXOA 3FWLA 1ZRTD 1PZQA 4GT1A 2E42A 2RH0A 3A0BH 3GF7A 3BCCD 2CK3H 2WQYC 2WSFJ 3KZIH 2QM7A 2PRRA 3H1IJ 1VQNP 1OMIA 2WPQA 1PP9G 1HWTC 1LT9B 3VP9A 4U3FD 1WMKA 1NTMG 3L75G 2QG4A 2C9LY 3HE5A 3BVHA 2HFED 1BE3E 1FU1A 1J1DC 3M0DC 1DD4A 3MZWB 4XFJA 1URQB 5AW8B 4OGQB 1BCCD 3GMAA 1T3UA 3B71A 2JWAA 2M3BA 1OVUA 2B89A 2Y0DA 4UB6E 2OYHA 1MV8A 2QVAA 2BCCJ 2I1JA 1BSNA 1RF0A 4PD4E 4L75A 1PIXA 2XZRA 5AVTB 4UB6H 1RF1A 1LTBC 3MP7B 4OWFA 1T2KD 1L0NK 1LT9C 2WT7B 1SQBE 4IFDK 4PD4H 1SQVE 4WY4C 2XU6A 1N7SC 2ITAA 4HKZH 4U3FJ 3SWFA 2JWDA 1G2CB 3L35A 5DJTB 1P84E 1VQMP 5APWA 1GL2D 1JY3N 4ZKPA 1URQC 1SQPE 1DEBA 3A0HE 3NXSA 2KZJA 1EDLA 3GF3A 2BCCE 1NTZG 1JTHB 1GU4A 5AW1B 1JCDA 3CXHI 3RK3B 2QJPB 4L76A 1BCCJ 1P84H 5BU5A 2M5AB 4IL6X 3FXDA 1LTJA 3BCCE 3A0HH 2N1TD 3AEEC 2FKWB 1JCCA 1K8AQ 2FXMA 3E7KA 3V2NA 5AW0B 1X0TA 1FOSE 3V4QA 1L0ND 2RKLA 3QWOC 2WPRA 3RL0D 1IJDB 1S1CX 4TLFA 2YMYA 4H13B 1DD3A 1SQQK 3U1AA 3L72D 4JF7A 1S2EA 1PV3A 2D2CB 1OVRA 3H6PA 2KSJA 4Y99B 2O01H 1N7SD 3CCUP 3V6IA 1FDMA 3TSIA 1AJYA 4NPDA 5AW9B 1HGVA 4I1LA 3I55P 3T97B 2ZXXA 3B5ND 5AW6B 1L4AD 1NTKG 1FZBA 2KLVA 5APQA 1AVOA 2MJZA 3CWBD 2G3AA 2Y0CA 3FWNA 2YIUC 1HJBA 1YJWP 2Q3IA 5APSA 2DW3A 3KDPB 2VRSA 1EZVI 1FAVA 1JO5A 2KNCB 4D6TJ 3P8CD 3TDKA 4H0LD 4C46A 1NKNA 1L0NJ 4WB4A 1L0LE 3TGUG 4H44D 1GW4A 3IF4A 1KYOD 3GG2A 1K9MQ 1SQQD 5AW2B 3L72J 3Q3DA 4IL6E 3H32A 2Q5UA 5AVVB 1VQOP 2ZT9C 2E74D 3EQ2A 3PRJA 1S3JA 1N73C 1HGZA 1K73Q 1RHZB 1U7JA 1X79B 1NAFA 2M8RA 3CCVP 1HTLC 2O1KA 4IL6H 4ZMDA 1HUCA 1CW5A 1G1JA 1H89A 1FJKA 3UIAA 1NOHA 3KPEA 3CWBJ 1YTZT 2PAJA 1XTGB 4PV1D 1IK7A 5KLVJ 1FZAA 1KQGB 1IFMA 2I1KA 2A06G 5AW3B 3VMXA 2LXCB 3PHLA 3RL0B 2IBZD 1PPJE 2QJKB 1YJNP 3LIDA 5E79E 3M0DA 1YQ4C 1MFTA 2WITA 2YO3A 1IFPA 4KJMA 4NPEA 3WUUA 2K88A 3L74E 1OXZA 3C9IA 4YPCA 3AEBC 2J58A 1KILC 3GHGC 3VMZA 1L2PA 1NU1G 1A02J 5E79H 4N78D 1T3JA 2GUVA 2KYVA 2ZYDA 2YO2A 3H1LJ 4WWIA 4I7ZB 4AYCA 4GODA 2AEMA 1VQ6P 3P8CE 2Q7CA 1EZVG 1SVFA 1KQSO 3G3ZA 3C1LA 3Q5RA 1SQQE 2ZVOB 3PH0A 4M3LA 2W6BA 1KZUB 4WY4A 1N7SA 2K9YA 2HYNA 1OW7A 1EDKA 4TT3H 4IOIH 1KYOH 4RJTA 4PD4I 1Q82Q 3B5NA 2H88C 2W27A 3G9RA 4A7PA 2H89C 1JMBA 1PFIA 1JEKA 1YBKA 1AFOA 2POHA 1BGYD 2ZJSE 4I7ZC 4BRYA 4EYYQ 2KIKA 2V4HA 2N9BA 2HLOA 1P84I 4W7YA 1LP1B 1JM0A 2IBZE 1W5CE 4LGDE 1FS0E 2QIWA 2Z5HA 1GK6A 3EWKA 2FYUD 3JC22 1FDOA 2YNYA 1DH3A 1YTZI 4N78E 2OYIB 3L73J 1GTWA 4ZNCA 3EFGA 2IPPA 2B87A 3AE7C 1VQPP 2A45H 1NVOA 3AE1C 1NO4A 3R2PA 1BE3G 1LWUB 2K1AA 4Y28J 5KJ7C 2V7QJ 1RE3C 4GIFA 3H1ID 1VF5D 1FDIA 2ZFCA 1H0TA 1BDCA 2Q9IA 2P10A 2KS1A 3VN0A 1NTMK 3RK2D 2BEQD 3CPWO 3L70D 2HPCA 3B8EB 5AW4B 5M1BA 1G1IA 3H1JG 5AVWB 2O1JA 2BEZF 2W83C 2WWWA 5TISE 1DX7A 3IAOA 1EXIA 1FZCB 2OTJP 1JUNA 1GL2B 2AEJA 2W8ZA 1J1EB 1DEEG 4ASVA 5TISH 1GK4A 1BGYE 1M1KQ 3CCJP 2UWJE 1SQBG 2FFDC 1SQVG 3P8MC 3CLQA 1N73A 3M0AA 1Q81Q 1SFCC 2W6AA 2XNXA 1Y47A 1Z56A 2N1TB 1KD1Q 3A3YB 3S4RA 1ZP0C 2M3EA 1SQPG 1MUUA 2E76B 1KFNA 1JY3P 2BCCG 1VQ7P 1NTMD 2R5BA 3L75D 1ZLLA 1U57A 3L70J 5DJUB
chains in the Genus database with same CATH topology
3RL0D 1RE4C 1IJDB 5CJ0A 1CZQA 1G2CA 2R3CA 1OWAA 2YMYA 1FZCA 1H88A 1SQQK 1GL2A 1JY2N 1SP4A 3U1AA 1NTZK 4JF7A 2P67A 4W7ZA 1SQBK 2E43A 1KQLA 4O9BA 1J1EC 1JTHA 2C0WA 5AVRB 1SQVK 4DOJA 1LTTC 3H6PA 2KSJA 3HTKB 4Y99B 1T8ZA 2O01H 2JEEA 2R32A 1N7SD 2R5DA 4LC1A 1XTCC 1HVVA 3H32B 4HH2A 3MIWA 5CCHD 1FDMA 2OYHC 3TSIA 1MFZA 2N1TA 3CL3D 1SQPK 3SWYA 1KILA 5AW9B 1HGVA 3GHGA 4I1LA 4RESB 1L4AB 3B5ND 5AW6B 4JYBA 1L4AD 1X9VA 1JY2P 1FZBA 2KLVA 3M9HA 5APQA 2MJZA 3L36A 3TYYA 1RF1C 3VTPC 1HJBA 1EQ7A 2WSFH 3E1IA 2CPBA 1LGHB 1CI6B 5APVA 2Q3IA 3V2QA 5APSA 5CCGD 2XKMA 3OAKA 3KDPB 5APTA 2VRSA 3NTNA 2YKQA 5AVUB 1FAVA 3IR9A 1JO5A 1IC2A 3P8CD 4C46A 1NKNA 3LIEA 4WB4A 2NPSB 3VP8A 1GW4A 4B86A 1FBMA 3BRVB 3IFMA 3V5BA 3MUDA 3HE4B 5AW2B 4I6MC 2OYIC 1VPCA 3HTKA 4WBAA 4JYCA 3H32A 5CCHA 4C7NA 5CMZA 2Q5UA 2FYUK 2HODB 2IFNA 1J1DB 5AVVB 1X8YA 1N86A 4ZKUA 3HD7B 3EQ2A 1NTKK 1M7LA 1LWUC 1N7LA 1ZV8A 3KYQA 5APUA 3T97A 5APXA 1N73C 1L4AA 1HGZA 1M1JB 2XV5A 2ZXEB 1X79B 1KFMA 1NAFA 1LTJC 2M8RA 4KHXA 1HTLC 1NHLA 2O1KA 4C7RA 1FZEA 3MD0A 3RK2C 2WTYA 1HUCA 5KLVK 4GKGA 1CW5A 1G1JA 1H89A 1FJPA 4AQRD 1CI6A 5CCGA 3U59A 1FJKA 3UIAA 5BU8B 1NOHA 2IX7C 1H8AA 3KPEA 1SLQA 1GZLA 1YTZT 2PAJA 1XTGB 5KJ7D 1IFIA 1FZAA 3VYIA 2NPSA 3OA7A 1YYCA 3V2RA 3N7NA 1IFMA 1FZCC 2I1KA 5AW3B 3VMXA 3HE4A 1JNMA 1GL2C 4N6JA 4DZOA 2FYZA 2WZ7A 5AVSB 1WRGA 1NH4A 2HODA 5AVQB 4WY4B 3LIDA 1N7SB 2P1JA 2WSEH 1L0LK 4WY4D 3M0DA 3M06A 3O8ZA 3HD7A 3RK3C 3TK1A 4XE5B 3U1CA 4C7NB 2WITA 3HD7C 2H8PD 1GD2E 2LKMA 2YO3A 1A02F 1M1JA 3A7OA 3M91A 1FZFA 3II6A 1OXZA 1GDTA 2N1TC 3B5NB 3C9IA 2KB7P 2J58A 2P2UA 2C0XA 1KILC 2GM4A 1URQD 3GHGC 3VMZA 1A02J 2KP8A 4N78D 1T3JA 3BATA 3V4WA 2GUVA 2KYVA 1LTGC 2YO2A 2FFDB 4AYCA 2H43A 1SFCB 3RL0C 1RE3A 1SFCD 5AW5B 3LW5H 2A45I 3P8CE 2Q7CA 1N2DC 5KTBA 1E5WA 4W80A 1NWQA 3P7KA 2PP6A 1SVFA 4HYTB 3TNUB 3G3ZA 4IFMA 3WMM0 2GUSA 4M3LA 1JY3O 4OH8B 5AW7B 2W6BA 1KZUB 4WY4A 1JMMA 1N7SA 2L5GB 4Y99C 2HYNA 3HE5B 3CI9A 3BASA 3PP5A 5CCHC 1HBWA 1NU1K 2IFMA 2Z5IA 1IFDA 4N3YB 3VOPA 5AVZB 3B5NA 1AQ5A 3MTUE 2W27A 3B5NC 3V2PA 1L4AC 1FZGA 1RY3A 2YKPA 3P32A 1PFIA 1GW3A 1AFOA 2POHA 1T2KC 2FFDA 3NMDA 1S9KD 3RK3D 1SFCA 2OYHB 5CCGC 2N9BA 3VMYA 4GT1A 1IO4A 2E42A 2HLOA 1VDFA 2WPSA 4W7YA 3TNUA 3HUSA 4EOTA 2NPSC 1HH0A 2QM7A 1ZR4A 3M9BA 4LLHA 2WPQA 3N4XA 2HPCB 1RF1B 1HWTC 1LT9B 1LTIC 3VP9A 5APYA 4LGDE 1RE4A 1IFJA 2C9LY 3HE5A 2P7JA 3BVHA 1CSBA 2HFED 2JJLA 1FU1A 1J1DC 2J59M 3A2AA 3OJAB 3M0DC 1IFNA 2Z5HA 1GK6A 3HRNA 1SQXK 5BVZA 1QL2A 1M1JC 2YNYA 1DH3A 3L37A 1YTZI 1URQB 5AW8B 4N78E 2OYIB 3NFQA 2C9NY 1GTWA 2H7HA 1JOCA 1IK9A 3EFGA 1T3UA 2IPPA 2M3BA 1LTAC 2OYHA 2A45H 1MV8A 1NO4A 1GU5A 3R2PA 1LWUB 5KJ7A 1N73B 2I1JA 5KJ7C 2A45G 1RF0A 1WT6A 1RE3C 4GIFA 2CPSA 1LTJB 1RF0C 2ZFCA 2Q9IA 2XZRA 3L4FA 3RK2B 3VN0A 1NTMK 3HUSB 3MGNA 5AVTB 3RK2D 2HPCA 1LTBC 1RF1A 1T2KD 1LT9A 1L0NK 3B8EB 4I2LC 5CHXA 1ZR2A 1LT9C 5AVYB 3BRTB 2WT7B 5AW4B 1G1IA 5AVWB 2O1JA 1FOSF 4IFDK 2YKOA 2XDJA 2WWWA 4WY4C 2XU6A 1N7SC 3SWFA 1DX7A 1NKZB 1G2CB 3L35A 2NPSD 3I5CA 1FZCB 2WSCH 4AUWA 1JUNA 1GL2B 1URQA 5APWA 1GL2D 2OYIA 1JY3N 4ZKPA 1URQC 2HG5D 1DEBA 4IFFA 3NXSA 3A5TA 1J1EB 1MZ9A 3M9QA 1JTHB 1GK4A 5AVXB 1S9KE 1GU4A 1ZN5A 5AW1B 1JCDA 2KOGA 3RK3B 1LWUA 2FFDC 5CJ4A 3P8MC 3CLQA 1N73A 3HD7D 3M0AA 5BU5A 1SFCC 2W6AA 2XNXA 1Z56A 1LTJA 2N1TB 1J2JB 4EIJA 2N1TD 3A3YB 1KILB 3KQGA 2OARA 3GHGB 1KILD 1QL1A 1LTSC 2FKWB 1JCCA 1W2EA 3HUSC 2QM8A 4XA4A 2FXMA 1MUUA 2BASA 1KFNA 1JY2O 1JY3P 3V2NA 2WT7A 2Z4EA 2R5BA 5AW0B 1FOSE 3V4QA 3RL0B 1ZLLA 2WPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 H;  1L0N K;  2WSE H;  1L0L K;  2J59 M;  2OAR A;  2WSF H;  1SQQ K;  2LKM A;  3M9Q A;  4IFD K;  1NTZ K;  5KLV K;  1SQP K;  1SQX K;  3LW5 H;  2FYU K;  1SQB K;  3CLQ A;  1SQV K;  3G3Z A;  1NTK K;  1NU1 K;  1NTM K;  2WSC H; 
#chains in the Genus database with same CATH topology
 4MN4 C;  3F89 A;  1RE4 C;  1QVF O;  1W2B O;  2ZYG A;  3BCC G;  3B4S A;  2FYU E;  3AE4 C;  1NTZ K;  4BXL A;  4W7Z A;  2QRX A;  1BSH A;  1J1E C;  2IZ0 A;  1LTT C;  1YQ3 C;  3CX5 E;  2R32 A;  1PGQ A;  1HVV A;  3ZDM A;  3H1H J;  1LT1 A;  3H1I E;  4DJG A;  1KIL A;  3AE9 C;  3GHG A;  3AEC C;  3CC7 P;  1L4A B;  4JYB A;  1X9V A;  1PGO A;  3CX5 H;  2E76 C;  1EQ7 A;  2WSF H;  5KAI H;  1PP9 J;  2ZVN B;  4R4L A;  3OAK A;  5AVU B;  3IR9 A;  1NTM J;  4H0L B;  3L75 J;  1IC2 A;  3AED C;  3LIE A;  3JCU E;  2NPS B;  4B86 A;  2QJY B;  3F5H A;  1KB9 D;  2WSE J;  4HJG H;  3HTK A;  1EDJ A;  4OGQ C;  3L71 D;  4JYC A;  3JCU H;  2E74 B;  1VQL P;  4ZKU A;  1ZRT E;  3HD7 B;  2ZAE B;  1NTK K;  1N7L A;  1ZV8 A;  1R8E A;  3KYQ A;  5APU A;  1L0L G;  1M1J B;  2XV5 A;  2QA4 P;  1VQ9 P;  3USS A;  3MD0 A;  2WTY A;  5KLV K;  5H2F E;  1M90 Q;  4AQR D;  1CI6 A;  4U3F E;  4D6T D;  1H8A A;  1AA0 A;  3VYI A;  3W68 A;  3OA7 A;  1YYC A;  2P58 A;  3JSV C;  3V2R A;  2LR2 A;  5H2F H;  3HE4 A;  1YHQ P;  2RN0 A;  1JNM A;  3I56 P;  1EXJ A;  2OYO A;  3O6Q A;  1BCC E;  2J5U A;  2R3S A;  4U7J A;  1Y9B A;  2HOD A;  2WSE H;  4WY4 D;  1T6A A;  3RK3 C;  1NTZ J;  4XE5 B;  3U1C A;  2QJP C;  4C7N B;  3HD7 C;  2H8P D;  2AXT E;  3L71 J;  1R5L A;  2LKM A;  3VMA A;  3M91 A;  1GDT A;  1NTK D;  3AE8 C;  1URQ D;  2OQQ A;  4OGQ D;  1PPJ G;  3BAT A;  1LTG C;  2AXT H;  1OIP A;  2W6J H;  5KLV D;  1S72 P;  2H43 A;  1RE3 A;  3CCS P;  2A45 I;  4HB1 A;  3CCM P;  1QLE D;  4W80 A;  1NWQ A;  3L74 G;  3TGU D;  4H13 C;  1MKM A;  1VQ4 P;  3L71 E;  3PJS K;  5AW7 B;  1R5S A;  1JMM A;  2D2C C;  4UB8 E;  2L5G B;  3CXH D;  4Y99 C;  3HE5 B;  1HJ0 A;  1AV1 A;  3AE5 C;  5B66 E;  5CCH C;  2IZ1 A;  1NU1 K;  1IFD A;  1PL5 A;  3V2P A;  3D6Z A;  1USD A;  1SQQ G;  4UB8 H;  1KQF B;  3H1L D;  4L74 A;  3SFE C;  1SQX G;  2YKP A;  3P32 A;  4RKU J;  5B66 H;  2FFD A;  1NTK J;  1S9K D;  3RK3 D;  4D6T E;  1SFC A;  1L0N E;  2OYH B;  5CCG C;  4KT0 J;  3VMY A;  1IO4 A;  1TU3 F;  1VDF A;  2WPS A;  3W67 A;  3TNU A;  2A06 D;  3L72 E;  3GLM A;  1ZR4 A;  3M9B A;  4LLH A;  3TGU J;  1RF1 B;  3R4Y A;  1VQK P;  1RE4 A;  1DIP A;  1IFJ A;  2K9J A;  4NPF X;  1CSB A;  2JJL A;  3SWK A;  2J59 M;  1BDD A;  3OJA B;  2KSE A;  5BVZ A;  1QL2 A;  2KUB A;  2N9Y B;  1NU1 D;  2LXB A;  2O3J A;  2OTL P;  3NFQ A;  2C9N Y;  1JOC A;  2YXR B;  2E75 B;  3CWB E;  3QH9 A;  2AXC A;  1LTA C;  5KLV E;  3FX0 A;  1KTM A;  2ZT9 D;  3C8V A;  1S5L E;  1EZV D;  2A45 G;  1WT6 A;  1VF5 B;  2CPS A;  2Y9Y A;  1LTJ B;  1RF0 C;  2QSI A;  3L4F A;  3RK2 B;  1YJ9 P;  3HUS B;  3MGN A;  1KYO E;  1LT9 A;  4I2L C;  5CHX A;  1ZR2 A;  3CX5 I;  3BRT B;  1S5L H;  4L73 A;  2KI7 B;  1FOS F;  2QJK C;  1NKZ B;  3D71 A;  3I5C A;  3L73 D;  3MHV A;  1KMI Z;  4AUW A;  3AE3 C;  1URQ A;  1K04 A;  1YIJ P;  2QE7 H;  3H1L E;  3A5T A;  1KC8 Q;  2GA1 A;  3M9Q A;  1S9K E;  1ZN5 A;  1OX3 A;  1NU1 J;  3KXD A;  3RBZ A;  4EIJ A;  2WPV B;  1Q2N A;  2OGU A;  1KIL D;  1QL1 A;  3H1K G;  3HUS C;  2QM8 A;  2FYN B;  1SS1 A;  1JY2 O;  2WT7 A;  1Q7Y Q;  2Z4E A;  3FGA D;  3LW5 J;  1BGY G;  1GMJ A;  2IYP A;  1LNQ A;  2PFX A;  2JP3 A;  5CJ0 A;  1CZQ A;  1G2C A;  2R3C A;  1U7M A;  1OWA A;  4GOE A;  5C39 A;  1M8O B;  3S9O A;  1JY2 N;  1SP4 A;  3PLN A;  3RBX A;  1SQB K;  5TJH A;  1KQL A;  1JTH A;  1SQV K;  4DOJ A;  2E5Y A;  2K3R A;  1XTC C;  3H32 B;  4HH2 A;  1BE3 D;  3MIW A;  2M5A A;  1EZV E;  4PJ0 H;  1SQP K;  2PGD A;  1EDI A;  3SWY A;  2FYU G;  4BWN A;  1IZN B;  3PTZ A;  1RH5 B;  3M9H A;  3CME P;  1Q86 Q;  3TYY A;  3H1J D;  3VTP C;  2CPB A;  5APV A;  5APT A;  3NTN A;  2YKQ A;  1RQU A;  1QVG O;  3H1I G;  4PD4 D;  3L73 E;  1FBM A;  3IFM A;  3V5B A;  1KV4 A;  3Q1M A;  4I6M C;  2OYI C;  1VPC A;  4ASW A;  4WBA A;  3H1H D;  5CCH A;  4C7N A;  5CMZ A;  1SQV D;  2OTK E;  2IFN A;  1J1D B;  1AVY A;  1N86 A;  1D7M A;  1FE6 A;  1LWU C;  1M7L A;  1LJ2 A;  3T97 A;  1BE3 J;  1KIL E;  1P84 D;  2ZXE B;  3SFD C;  1KFM A;  1NHL A;  1SQP D;  1UIX A;  1YI2 P;  2V7Q H;  2FBW C;  1PP9 D;  2KLU A;  5CCG A;  3U59 A;  4Z1M H;  1Q90 D;  2KNC A;  4JBZ A;  1GZL A;  3RL0 g;  5KJ7 D;  3H1J J;  2L91 A;  4QMA A;  1FZC C;  1GL2 C;  2FYZ A;  1UII A;  2WZ7 A;  3CCR P;  3Q2Y A;  2I8D A;  4U3F G;  1NH4 A;  4OVN F;  4WY4 B;  1N7S B;  1L0L K;  3O8Z A;  3TK1 A;  4EI2 A;  4K3A A;  1SQB J;  1GD2 E;  1A02 F;  3A7O A;  2MKV A;  1SQV J;  5KAI E;  2N1T C;  3B5N B;  2KB7 P;  4WVZ A;  2P2U A;  2C0X A;  3GW6 A;  2GM4 A;  1ZW0 A;  3AEA C;  3AE6 C;  5KAF E;  3L70 E;  4GOF A;  1VQ5 P;  1BCC G;  3H1J E;  3V4W A;  3G4S P;  1SQP J;  3WUT A;  4BRY B;  3RL0 C;  1SFC D;  5AW5 B;  3CCQ P;  1N2D C;  5KTB A;  3G6E P;  5KAF H;  4H44 B;  4HYT B;  2R44 A;  4IFM A;  3BCC J;  2GUS A;  3H1H E;  1JY3 O;  4OH8 B;  3MUD C;  1NTZ D;  1YIT P;  3BAS A;  3PP5 A;  1HBW A;  2JR8 A;  2Z5I A;  1L0L D;  4RO0 A;  5AVZ B;  2NZ2 A;  3B5N C;  2O01 J;  1L4A C;  1KYO I;  1FZG A;  1PP9 E;  1ZOY C;  3D6Y A;  3L71 G;  2Y9Z A;  1NTM E;  4JQ0 D;  3L75 E;  2B87 B;  1NYH A;  5CBN A;  4PV1 B;  2XND H;  5GTH E;  4K35 A;  4H0L C;  3HUS A;  4H44 C;  4EOT A;  2NPS C;  1HH0 A;  1H0T B;  2QJY C;  2E76 D;  2KS1 B;  3N4X A;  2YIU B;  2HPC B;  1LTI C;  2Q6Q A;  5APY A;  4D6T G;  3TF5 A;  3OW2 O;  5GTH H;  2P7J A;  3Q5S A;  1L0N G;  2O01 N;  2WSC J;  2E74 C;  3A2A A;  3E1R A;  2JO1 A;  1IFN A;  3HRN A;  1SQX K;  3CCE P;  1VL2 A;  3L72 G;  1E79 H;  1M1J C;  3L37 A;  1L0L J;  2IBZ I;  1PPJ D;  2H7H A;  1IK9 A;  4GDO A;  1VQ8 P;  2JKV A;  1HF9 A;  2ZT9 B;  1GU5 A;  4YXW H;  1FC2 C;  1USE A;  5KJ7 A;  1N73 B;  4PV1 C;  4EDF A;  3L74 D;  1ZME C;  1LP1 A;  2YXQ B;  1OVV A;  1S5L X;  2B9B A;  5B5E E;  3CWB G;  1KB9 E;  5AVY B;  1NTZ E;  3D70 A;  5KLV G;  2YKO A;  2XDJ A;  3EFF K;  5K5G B;  1AQT A;  5B5E H;  2NPS D;  2WSC H;  2FXP A;  2Q1K A;  1KB9 H;  3WUV A;  3G71 P;  2OYI A;  2HG5 D;  4IFF A;  1SQX D;  1MZ9 A;  1NJI Q;  5AVX B;  2KOG A;  1LWU A;  2ZYA A;  3HD7 D;  1RQV A;  1J2J B;  1KIL B;  3KQG A;  2OAR A;  3GHG B;  1LTS C;  1W2E A;  3CC2 P;  4XA4 A;  3RGU A;  3H1L G;  3ABV C;  3L74 J;  1OW8 A;  2BAS A;  1OW6 A;  1X22 A;  1QGK B;  2RMZ A;  1K05 A;  3CD6 P;  3K5B A;  2G8Y A;  5CJ4 A;  5KLI B;  1FZC A;  1PGJ A;  1H88 A;  4H13 D;  1GL2 A;  2P67 A;  1NGM B;  1NTK E;  2E43 A;  4O9B A;  2C0W A;  5AVR B;  2IBZ G;  3AEF C;  4YXD C;  5KKZ B;  2D2C D;  1SQQ J;  3HTK B;  1T8Z A;  2JEE A;  2R5D A;  4LC1 A;  3AE2 C;  1SQX J;  3ITK A;  3KHU A;  5CCH D;  3Q5P A;  2OYH C;  1MFZ A;  2N1T A;  3CL3 D;  4RES B;  3TGU E;  2WSS H;  2IDB A;  1JY2 P;  2KZI A;  3L36 A;  1RF1 C;  3E1I A;  1LGH B;  1CI6 B;  3V2Q A;  3CXH E;  5CCG D;  2XKM A;  1Y8A A;  5KLI C;  2B88 A;  1M57 D;  3VP8 A;  2QEX P;  5L8R J;  3BRV B;  1M56 D;  3MUD A;  3HE4 B;  1SQX E;  2SPZ A;  3CXH H;  3O6Q B;  2E75 C;  5KKZ C;  2IYO A;  3RK3 E;  2FYU K;  2HOD B;  1X8Y A;  2FY8 A;  4DT0 A;  1PGP A;  5APX A;  1OZH A;  1L4A A;  3IN6 A;  3L73 G;  1ZXG A;  1VF5 C;  3H1K D;  4KHX A;  1LTJ C;  2A06 E;  4C7R A;  1FZE A;  3RK2 C;  2HR3 A;  2NRG A;  4GKG A;  3H25 A;  1FJP A;  4DCK A;  1KN7 A;  3WU2 E;  5BU8 B;  2IX7 C;  1SLQ A;  2K37 A;  5EFW B;  2W90 A;  1IFI A;  2NPS A;  3N7N A;  3CCL P;  4JPZ B;  2AEF A;  4DZO A;  4N6J A;  3WU2 H;  3SSU A;  4PJ0 E;  1NU1 E;  5AVS B;  2E5T A;  1JB0 J;  2WMM A;  2YMK A;  1WRG A;  5AVQ B;  2P1J A;  3M06 A;  2KXP B;  3HD7 A;  3CMA P;  1QEX A;  1M1J A;  2WVR A;  4CPG A;  1FZF A;  1S4X A;  3II6 A;  5GTI E;  4YTP C;  1NAY A;  1EC5 A;  2KP8 A;  2E75 D;  2FYN C;  3H1K J;  3CX5 D;  5CBO A;  2FFD B;  1SFC B;  1BGY J;  5GTI H;  3CC4 P;  3LW5 H;  3AEG C;  1E5W A;  3P7K A;  2PP6 A;  2Q3E A;  3TNU B;  2M0B A;  2Y0E A;  3WMM 0;  3L70 G;  1N8R Q;  1SQB D;  2K9J B;  3CI9 A;  1KOR A;  2IFM A;  4N3Y B;  3VOP A;  2JDI H;  1AQ5 A;  3H1K E;  3MTU E;  3S1K A;  2FYU J;  3A0B E;  4R4M A;  1KB9 I;  1RY3 A;  3H1H G;  1GW3 A;  2BCC D;  1T2K C;  3FXE A;  3KZI E;  3NMD A;  2KK7 A;  1OFC X;  1QX8 A;  2FXO A;  3FWL A;  1ZRT D;  1PZQ A;  4GT1 A;  2E42 A;  2RH0 A;  3A0B H;  3GF7 A;  3BCC D;  2CK3 H;  2WQY C;  2WSF J;  3KZI H;  2QM7 A;  2PRR A;  3H1I J;  1VQN P;  1OMI A;  2WPQ A;  1PP9 G;  1HWT C;  1LT9 B;  3VP9 A;  4U3F D;  1WMK A;  1NTM G;  3L75 G;  2QG4 A;  2C9L Y;  3HE5 A;  3BVH A;  2HFE D;  1BE3 E;  1FU1 A;  1J1D C;  3M0D C;  1DD4 A;  3MZW B;  4XFJ A;  1URQ B;  5AW8 B;  4OGQ B;  1BCC D;  3GMA A;  1T3U A;  3B71 A;  2JWA A;  2M3B A;  1OVU A;  2B89 A;  2Y0D A;  4UB6 E;  2OYH A;  1MV8 A;  2QVA A;  2BCC J;  2I1J A;  1BSN A;  1RF0 A;  4PD4 E;  4L75 A;  1PIX A;  2XZR A;  5AVT B;  4UB6 H;  1RF1 A;  1LTB C;  3MP7 B;  4OWF A;  1T2K D;  1L0N K;  1LT9 C;  2WT7 B;  1SQB E;  4IFD K;  4PD4 H;  1SQV E;  4WY4 C;  2XU6 A;  1N7S C;  2ITA A;  4HKZ H;  4U3F J;  3SWF A;  2JWD A;  1G2C B;  3L35 A;  5DJT B;  1P84 E;  1VQM P;  5APW A;  1GL2 D;  1JY3 N;  4ZKP A;  1URQ C;  1SQP E;  1DEB A;  3A0H E;  3NXS A;  2KZJ A;  1EDL A;  3GF3 A;  2BCC E;  1NTZ G;  1JTH B;  1GU4 A;  5AW1 B;  1JCD A;  3CXH I;  3RK3 B;  2QJP B;  4L76 A;  1BCC J;  1P84 H;  5BU5 A;  2M5A B;  4IL6 X;  3FXD A;  1LTJ A;  3BCC E;  3A0H H;  2N1T D;  3AEE C;  2FKW B;  1JCC A;  1K8A Q;  2FXM A;  3E7K A;  3V2N A;  5AW0 B;  1X0T A;  1FOS E;  3V4Q A;  1L0N D;  2RKL A;  3QWO C;  2WPR A;  3RL0 D;  1IJD B;  1S1C X;  4TLF A;  2YMY A;  4H13 B;  1DD3 A;  1SQQ K;  3U1A A;  3L72 D;  4JF7 A;  1S2E A;  1PV3 A;  2D2C B;  1OVR A;  3H6P A;  2KSJ A;  4Y99 B;  2O01 H;  1N7S D;  3CCU P;  3V6I A;  1FDM A;  3TSI A;  1AJY A;  4NPD A;  5AW9 B;  1HGV A;  4I1L A;  3I55 P;  3T97 B;  2ZXX A;  3B5N D;  5AW6 B;  1L4A D;  1NTK G;  1FZB A;  2KLV A;  5APQ A;  1AVO A;  2MJZ A;  3CWB D;  2G3A A;  2Y0C A;  3FWN A;  2YIU C;  1HJB A;  1YJW P;  2Q3I A;  5APS A;  2DW3 A;  3KDP B;  2VRS A;  1EZV I;  1FAV A;  1JO5 A;  2KNC B;  4D6T J;  3P8C D;  3TDK A;  4H0L D;  4C46 A;  1NKN A;  1L0N J;  4WB4 A;  1L0L E;  3TGU G;  4H44 D;  1GW4 A;  3IF4 A;  1KYO D;  3GG2 A;  1K9M Q;  1SQQ D;  5AW2 B;  3L72 J;  3Q3D A;  4IL6 E;  3H32 A;  2Q5U A;  5AVV B;  1VQO P;  2ZT9 C;  2E74 D;  3EQ2 A;  3PRJ A;  1S3J A;  1N73 C;  1HGZ A;  1K73 Q;  1RHZ B;  1U7J A;  1X79 B;  1NAF A;  2M8R A;  3CCV P;  1HTL C;  2O1K A;  4IL6 H;  4ZMD A;  1HUC A;  1CW5 A;  1G1J A;  1H89 A;  1FJK A;  3UIA A;  1NOH A;  3KPE A;  3CWB J;  1YTZ T;  2PAJ A;  1XTG B;  4PV1 D;  1IK7 A;  5KLV J;  1FZA A;  1KQG B;  1IFM A;  2I1K A;  2A06 G;  5AW3 B;  3VMX A;  2LXC B;  3PHL A;  3RL0 B;  2IBZ D;  1PPJ E;  2QJK B;  1YJN P;  3LID A;  5E79 E;  3M0D A;  1YQ4 C;  1MFT A;  2WIT A;  2YO3 A;  1IFP A;  4KJM A;  4NPE A;  3WUU A;  2K88 A;  3L74 E;  1OXZ A;  3C9I A;  4YPC A;  3AEB C;  2J58 A;  1KIL C;  3GHG C;  3VMZ A;  1L2P A;  1NU1 G;  1A02 J;  5E79 H;  4N78 D;  1T3J A;  2GUV A;  2KYV A;  2ZYD A;  2YO2 A;  3H1L J;  4WWI A;  4I7Z B;  4AYC A;  4GOD A;  2AEM A;  1VQ6 P;  3P8C E;  2Q7C A;  1EZV G;  1SVF A;  1KQS O;  3G3Z A;  3C1L A;  3Q5R A;  1SQQ E;  2ZVO B;  3PH0 A;  4M3L A;  2W6B A;  1KZU B;  4WY4 A;  1N7S A;  2K9Y A;  2HYN A;  1OW7 A;  1EDK A;  4TT3 H;  4IOI H;  1KYO H;  4RJT A;  4PD4 I;  1Q82 Q;  3B5N A;  2H88 C;  2W27 A;  3G9R A;  4A7P A;  2H89 C;  1JMB A;  1PFI A;  1JEK A;  1YBK A;  1AFO A;  2POH A;  1BGY D;  2ZJS E;  4I7Z C;  4BRY A;  4EYY Q;  2KIK A;  2V4H A;  2N9B A;  2HLO A;  1P84 I;  4W7Y A;  1LP1 B;  1JM0 A;  2IBZ E;  1W5C E;  4LGD E;  1FS0 E;  2QIW A;  2Z5H A;  1GK6 A;  3EWK A;  2FYU D;  3JC2 2;  1FDO A;  2YNY A;  1DH3 A;  1YTZ I;  4N78 E;  2OYI B;  3L73 J;  1GTW A;  4ZNC A;  3EFG A;  2IPP A;  2B87 A;  3AE7 C;  1VQP P;  2A45 H;  1NVO A;  3AE1 C;  1NO4 A;  3R2P A;  1BE3 G;  1LWU B;  2K1A A;  4Y28 J;  5KJ7 C;  2V7Q J;  1RE3 C;  4GIF A;  3H1I D;  1VF5 D;  1FDI A;  2ZFC A;  1H0T A;  1BDC A;  2Q9I A;  2P10 A;  2KS1 A;  3VN0 A;  1NTM K;  3RK2 D;  2BEQ D;  3CPW O;  3L70 D;  2HPC A;  3B8E B;  5AW4 B;  5M1B A;  1G1I A;  3H1J G;  5AVW B;  2O1J A;  2BEZ F;  2W83 C;  2WWW A;  5TIS E;  1DX7 A;  3IAO A;  1EXI A;  1FZC B;  2OTJ P;  1JUN A;  1GL2 B;  2AEJ A;  2W8Z A;  1J1E B;  1DEE G;  4ASV A;  5TIS H;  1GK4 A;  1BGY E;  1M1K Q;  3CCJ P;  2UWJ E;  1SQB G;  2FFD C;  1SQV G;  3P8M C;  3CLQ A;  1N73 A;  3M0A A;  1Q81 Q;  1SFC C;  2W6A A;  2XNX A;  1Y47 A;  1Z56 A;  2N1T B;  1KD1 Q;  3A3Y B;  3S4R A;  1ZP0 C;  2M3E A;  1SQP G;  1MUU A;  2E76 B;  1KFN A;  1JY3 P;  2BCC G;  1VQ7 P;  1NTM D;  2R5B A;  3L75 D;  1ZLL A;  1U57 A;  3L70 J;  5DJU B; 
#chains in the Genus database with same CATH homology
 3RL0 D;  1RE4 C;  1IJD B;  5CJ0 A;  1CZQ A;  1G2C A;  2R3C A;  1OWA A;  2YMY A;  1FZC A;  1H88 A;  1SQQ K;  1GL2 A;  1JY2 N;  1SP4 A;  3U1A A;  1NTZ K;  4JF7 A;  2P67 A;  4W7Z A;  1SQB K;  2E43 A;  1KQL A;  4O9B A;  1J1E C;  1JTH A;  2C0W A;  5AVR B;  1SQV K;  4DOJ A;  1LTT C;  3H6P A;  2KSJ A;  3HTK B;  4Y99 B;  1T8Z A;  2O01 H;  2JEE A;  2R32 A;  1N7S D;  2R5D A;  4LC1 A;  1XTC C;  1HVV A;  3H32 B;  4HH2 A;  3MIW A;  5CCH D;  1FDM A;  2OYH C;  3TSI A;  1MFZ A;  2N1T A;  3CL3 D;  1SQP K;  3SWY A;  1KIL A;  5AW9 B;  1HGV A;  3GHG A;  4I1L A;  4RES B;  1L4A B;  3B5N D;  5AW6 B;  4JYB A;  1L4A D;  1X9V A;  1JY2 P;  1FZB A;  2KLV A;  3M9H A;  5APQ A;  2MJZ A;  3L36 A;  3TYY A;  1RF1 C;  3VTP C;  1HJB A;  1EQ7 A;  2WSF H;  3E1I A;  2CPB A;  1LGH B;  1CI6 B;  5APV A;  2Q3I A;  3V2Q A;  5APS A;  5CCG D;  2XKM A;  3OAK A;  3KDP B;  5APT A;  2VRS A;  3NTN A;  2YKQ A;  5AVU B;  1FAV A;  3IR9 A;  1JO5 A;  1IC2 A;  3P8C D;  4C46 A;  1NKN A;  3LIE A;  4WB4 A;  2NPS B;  3VP8 A;  1GW4 A;  4B86 A;  1FBM A;  3BRV B;  3IFM A;  3V5B A;  3MUD A;  3HE4 B;  5AW2 B;  4I6M C;  2OYI C;  1VPC A;  3HTK A;  4WBA A;  4JYC A;  3H32 A;  5CCH A;  4C7N A;  5CMZ A;  2Q5U A;  2FYU K;  2HOD B;  2IFN A;  1J1D B;  5AVV B;  1X8Y A;  1N86 A;  4ZKU A;  3HD7 B;  3EQ2 A;  1NTK K;  1M7L A;  1LWU C;  1N7L A;  1ZV8 A;  3KYQ A;  5APU A;  3T97 A;  5APX A;  1N73 C;  1L4A A;  1HGZ A;  1M1J B;  2XV5 A;  2ZXE B;  1X79 B;  1KFM A;  1NAF A;  1LTJ C;  2M8R A;  4KHX A;  1HTL C;  1NHL A;  2O1K A;  4C7R A;  1FZE A;  3MD0 A;  3RK2 C;  2WTY A;  1HUC A;  5KLV K;  4GKG A;  1CW5 A;  1G1J A;  1H89 A;  1FJP A;  4AQR D;  1CI6 A;  5CCG A;  3U59 A;  1FJK A;  3UIA A;  5BU8 B;  1NOH A;  2IX7 C;  1H8A A;  3KPE A;  1SLQ A;  1GZL A;  1YTZ T;  2PAJ A;  1XTG B;  5KJ7 D;  1IFI A;  1FZA A;  3VYI A;  2NPS A;  3OA7 A;  1YYC A;  3V2R A;  3N7N A;  1IFM A;  1FZC C;  2I1K A;  5AW3 B;  3VMX A;  3HE4 A;  1JNM A;  1GL2 C;  4N6J A;  4DZO A;  2FYZ A;  2WZ7 A;  5AVS B;  1WRG A;  1NH4 A;  2HOD A;  5AVQ B;  4WY4 B;  3LID A;  1N7S B;  2P1J A;  2WSE H;  1L0L K;  4WY4 D;  3M0D A;  3M06 A;  3O8Z A;  3HD7 A;  3RK3 C;  3TK1 A;  4XE5 B;  3U1C A;  4C7N B;  2WIT A;  3HD7 C;  2H8P D;  1GD2 E;  2LKM A;  2YO3 A;  1A02 F;  1M1J A;  3A7O A;  3M91 A;  1FZF A;  3II6 A;  1OXZ A;  1GDT A;  2N1T C;  3B5N B;  3C9I A;  2KB7 P;  2J58 A;  2P2U A;  2C0X A;  1KIL C;  2GM4 A;  1URQ D;  3GHG C;  3VMZ A;  1A02 J;  2KP8 A;  4N78 D;  1T3J A;  3BAT A;  3V4W A;  2GUV A;  2KYV A;  1LTG C;  2YO2 A;  2FFD B;  4AYC A;  2H43 A;  1SFC B;  3RL0 C;  1RE3 A;  1SFC D;  5AW5 B;  3LW5 H;  2A45 I;  3P8C E;  2Q7C A;  1N2D C;  5KTB A;  1E5W A;  4W80 A;  1NWQ A;  3P7K A;  2PP6 A;  1SVF A;  4HYT B;  3TNU B;  3G3Z A;  4IFM A;  3WMM 0;  2GUS A;  4M3L A;  1JY3 O;  4OH8 B;  5AW7 B;  2W6B A;  1KZU B;  4WY4 A;  1JMM A;  1N7S A;  2L5G B;  4Y99 C;  2HYN A;  3HE5 B;  3CI9 A;  3BAS A;  3PP5 A;  5CCH C;  1HBW A;  1NU1 K;  2IFM A;  2Z5I A;  1IFD A;  4N3Y B;  3VOP A;  5AVZ B;  3B5N A;  1AQ5 A;  3MTU E;  2W27 A;  3B5N C;  3V2P A;  1L4A C;  1FZG A;  1RY3 A;  2YKP A;  3P32 A;  1PFI A;  1GW3 A;  1AFO A;  2POH A;  1T2K C;  2FFD A;  3NMD A;  1S9K D;  3RK3 D;  1SFC A;  2OYH B;  5CCG C;  2N9B A;  3VMY A;  4GT1 A;  1IO4 A;  2E42 A;  2HLO A;  1VDF A;  2WPS A;  4W7Y A;  3TNU A;  3HUS A;  4EOT A;  2NPS C;  1HH0 A;  2QM7 A;  1ZR4 A;  3M9B A;  4LLH A;  2WPQ A;  3N4X A;  2HPC B;  1RF1 B;  1HWT C;  1LT9 B;  1LTI C;  3VP9 A;  5APY A;  4LGD E;  1RE4 A;  1IFJ A;  2C9L Y;  3HE5 A;  2P7J A;  3BVH A;  1CSB A;  2HFE D;  2JJL A;  1FU1 A;  1J1D C;  2J59 M;  3A2A A;  3OJA B;  3M0D C;  1IFN A;  2Z5H A;  1GK6 A;  3HRN A;  1SQX K;  5BVZ A;  1QL2 A;  1M1J C;  2YNY A;  1DH3 A;  3L37 A;  1YTZ I;  1URQ B;  5AW8 B;  4N78 E;  2OYI B;  3NFQ A;  2C9N Y;  1GTW A;  2H7H A;  1JOC A;  1IK9 A;  3EFG A;  1T3U A;  2IPP A;  2M3B A;  1LTA C;  2OYH A;  2A45 H;  1MV8 A;  1NO4 A;  1GU5 A;  3R2P A;  1LWU B;  5KJ7 A;  1N73 B;  2I1J A;  5KJ7 C;  2A45 G;  1RF0 A;  1WT6 A;  1RE3 C;  4GIF A;  2CPS A;  1LTJ B;  1RF0 C;  2ZFC A;  2Q9I A;  2XZR A;  3L4F A;  3RK2 B;  3VN0 A;  1NTM K;  3HUS B;  3MGN A;  5AVT B;  3RK2 D;  2HPC A;  1LTB C;  1RF1 A;  1T2K D;  1LT9 A;  1L0N K;  3B8E B;  4I2L C;  5CHX A;  1ZR2 A;  1LT9 C;  5AVY B;  3BRT B;  2WT7 B;  5AW4 B;  1G1I A;  5AVW B;  2O1J A;  1FOS F;  4IFD K;  2YKO A;  2XDJ A;  2WWW A;  4WY4 C;  2XU6 A;  1N7S C;  3SWF A;  1DX7 A;  1NKZ B;  1G2C B;  3L35 A;  2NPS D;  3I5C A;  1FZC B;  2WSC H;  4AUW A;  1JUN A;  1GL2 B;  1URQ A;  5APW A;  1GL2 D;  2OYI A;  1JY3 N;  4ZKP A;  1URQ C;  2HG5 D;  1DEB A;  4IFF A;  3NXS A;  3A5T A;  1J1E B;  1MZ9 A;  3M9Q A;  1JTH B;  1GK4 A;  5AVX B;  1S9K E;  1GU4 A;  1ZN5 A;  5AW1 B;  1JCD A;  2KOG A;  3RK3 B;  1LWU A;  2FFD C;  5CJ4 A;  3P8M C;  3CLQ A;  1N73 A;  3HD7 D;  3M0A A;  5BU5 A;  1SFC C;  2W6A A;  2XNX A;  1Z56 A;  1LTJ A;  2N1T B;  1J2J B;  4EIJ A;  2N1T D;  3A3Y B;  1KIL B;  3KQG A;  2OAR A;  3GHG B;  1KIL D;  1QL1 A;  1LTS C;  2FKW B;  1JCC A;  1W2E A;  3HUS C;  2QM8 A;  4XA4 A;  2FXM A;  1MUU A;  2BAS A;  1KFN A;  1JY2 O;  1JY3 P;  3V2N A;  2WT7 A;  2Z4E A;  2R5B A;  5AW0 B;  1FOS E;  3V4Q A;  3RL0 B;  1ZLL A;  2WPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...