1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
1SQBK 1L0NK 2FYUK 1NTKK 3CLQA 5KLVK 1SQPK 4IFDK 2WSEH 1SQVK 1NTMK 2LKMA 1NTZK 1NU1K 3M9QA 2WSCH 2WSFH 3G3ZA 2J59M 2O01H 1SQQK 2OARA 3LW5H 1L0LK 1SQXK
chains in the Genus database with same CATH superfamily
1KMIZ 1J1DC 1PP9J 2OGUA 4H44D 1GD2E 1GW3A 1LTJC 3H1IG 5GTIE 1S9KE 2ZXEB 1FE6A 3AE4C 3HRNA 1T8ZA 2QM8A 3HE4B 1OMIA 2NPSB 1NU1K 2C0XA 4KJMA 1KB9E 3TGUD 1K73Q 1ZN5A 2OYIC 3KZIH 3L70E 4RESB 3FGAD 1FAVA 2E5TA 4PD4E 1P84E 4U3FJ 3U59A 3BCCJ 2NRGA 1R8EA 1JY2O 3H1KD 4H13C 3GF3A 3H1JG 4RO0A 4LLHA 1VDFA 1LT9C 3I5CA 1CI6A 1AFOA 1LWUC 4EOTA 5AVYB 1BDDA 2G3AA 4C7NA 3CD6P 1Z56A 3G6EP 3KYQA 5AVTB 3L36A 3O8ZA 3HD7B 4L76A 1BE3E 1YJNP 1KILA 2IFMA 2BCCE 5APXA 1Q86Q 1SQPG 2LXCB 3CWBG 1VQ9P 1BSHA 4WY4C 1M1KQ 4H13D 5AVVB 3G3ZA 2WSSH 3V2QA 4M3LA 1FJPA 3V6IA 5CJ4A 3UIAA 1KQGB 4ZKPA 2KIKA 2KZJA 5GTHE 3TYYA 1BDCA 1S3JA 4W7YA 1EDKA 4L73A 3L75J 3C9IA 1U7JA 1RE3C 3BVHA 3V2NA 3MHVA 5APSA 1PIXA 5AVUB 1SQPK 3L71J 5CCGC 4PD4I 1P84I 3AE8C 1MKMA 4WY4D 2WITA 1GL2A 3HTKB 4QMAA 2XKMA 1EDJA 4JQ0D 1PFIA 3SWYA 2KXPB 2RKLA 3S1KA 3Q5SA 2FYUD 1SFCA 3WUTA 2SPZA 1N7LA 3TGUE 3TNUA 3G71P 5TISH 2KYVA 3D6ZA 3D6YA 3VYIA 4PV1B 5CCGD 3A7OA 4R4LA 2Y9ZA 4PJ0E 1PP9D 1FOSF 1HJ0A 2JEEA 1HUCA 1HGZA 1NHLA 3H1KE 4D6TG 3QWOC 3CCVP 1NU1J 4TLFA 4I7ZB 1SQXK 2QM7A 5KLVG 3RK3B 1IFPA 2FFDB 2YO3A 1NVOA 2W27A 2H7HA 2GUSA 3BASA 1KYOI 1GTWA 1GDTA 3RBZA 4U3FD 3Q2YA 4HYTB 1JY3P 1JTHB 1PGOA 2NPSC 3P32A 3BCCD 2JR8A 1HWTC 3P8MC 4YTPC 2Y0CA 3CCJP 3O6QA 2M5AA 5GTHH 1OIPA 4N3YB 4K3AA 2O1KA 1M1JA 2OARA 1OVUA 1OW8A 2GUVA 1YJWP 2CPBA 1OW6A 2ZT9B 1BCCE 1EQ7A 3CXHH 3RK2B 4JYCA 1NTZK 2J5UA 1URQD 1RF1A 1GK4A 2BCCJ 1GMJA 2NPSD 2I1JA 3HD7C 2P10A 5KAIE 3BRVB 1RQVA 1R5LA 1IO4A 2YMKA 3H1HG 1SQVK 2XNXA 1X79B 2E74B 3L74G 3TSIA 1LTSC 3RL0D 2P2UA 4GOEA 3E1IA 1NYHA 3L75D 2R5DA 4JF7A 1LTJA 2HPCA 3GHGA 3WU2E 3NMDA 2M3EA 3JCUE 3CC2P 3TF5A 2FXOA 2QE7H 5CHXA 5APQA 4PJ0H 3L71D 3HE5B 4BRYA 2FYUE 2QIWA 3KPEA 2WT7B 5CBOA 1EZVD 3W67A 3B4SA 3HD7D 3CX5I 5AW0B 5CMZA 1HH0A 4JYBA 1PP9E 5KAFH 2ZYDA 1LT9A 1LWUA 2A45G 2J59M 1CSBA 1N73B 1EXJA 2R5BA 1HGVA 2D2CB 2KNCB 1JMMA 4XE5B 2K3RA 3TDKA 2KUBA 5B5EH 2KSEA 1E79H 2XNDH 2B87A 3LIEA 2PRRA 5DJUB 2KK7A 3MGNA 1A02J 1SQXJ 4WY4A 2M8RA 1LJ2A 1NU1D 2OYHB 2IZ0A 4PV1C 2M3BA 3H1KJ 3CI9A 2VRSA 2ITAA 3E7KA 1FDOA 1QX8A 3D70A 3MP7B 3N4XA 4JBZA 2Y0EA 1L0NK 4I7ZC 1SQBG 2E76C 3RK3C 2XDJA 2FFDC 4CPGA 2P1JA 3KHUA 1N2DC 1FZCB 2PGDA 2FXPA 4Y99B 2AXTH 5CCGA 1SQQK 1RE4C 3KZIE 1KFNA 3CCSP 2C9NY 1Q2NA 2QJYB 3AE1C 3JCUH 2JDIH 1W5CE 2HODA 1IJDB 1EDIA 1NTZJ 1OXZA 1G2CB 3P8CD 3L73G 1H89A 2UWJE 3AE3C 1BCCJ 1N8RQ 3IFMA 1ZXGA 1SQBK 1FZGA 1VQ7P 3H1JD 2Q3IA 2E76D 1M56D 3RK3D 4UB8E 2ZT9C 1S2EA 1JY3O 1L2PA 1NWQA 1SQVJ 3L71E 3HUSC 2KI7B 1EZVE 2KLUA 3MD0A 1LNQA 3IAOA 1AJYA 1W2BO 2YKQA 5APTA 1LTTC 3FWLA 3CCQP 2Y0DA 2H88C 1FZAA 1Y8AA 2YNYA 4EDFA 2E74C 4AUWA 2JJLA 2ZJSE 3ZDMA 2YKOA 2QRXA 2WQYC 3Q3DA 1URQA 2E5YA 3CXHD 2IX7C 2ZT9D 3HE4A 2NPSA 2QG4A 1X22A 5M1BA 5KJ7C 1OVRA 1KZUB 2Q7CA 1IFMA 3AEFC 1OWAA 3CCLP 2R32A 2BEQD 3PRJA 2BASA 2N9YB 1NU1E 3IN6A 4N78D 1PPJD 3KXDA 4W80A 3L70G 2E74D 1MUUA 4L75A 1X8YA 3CCEP 1L4AB 2W6JH 2JWAA 1N73C 2D2CC 4Z1MH 4L74A 2KP8A 3B71A 1AVOA 2KB7P 2KS1B 2WPVB 3VP8A 3AEEC 1SQXD 2I8DA 3HD7A 2GA1A 2YO2A 5KTBA 1KV4A 5KJ7D 3A3YB 3M9QA 1JEKA 3H1IE 4HKZH 1DX7A 1GZLA 1QL1A 5TISE 3NXSA 3M06A 1K9MQ 1L0NJ 3FWNA 1M8OB 1IC2A 1LTBC 1WT6A 1ZOYC 2Q1KA 3U1AA 1NTKJ 2OYHC 1J1EB 3IR9A 1BE3G 4YPCA 4UB8H 3L72D 1TU3F 1VQ4P 1FZFA 4IL6X 3P7KA 3P8CE 3IF4A 1RY3A 3G4SP 1YQ3C 1SQQJ 2D2CD 3H1JE 1WRGA 3CPWO 3RK3E 1GW4A 2LKMA 2E43A 4DZOA 1H0TA 1NTMJ 2KZIA 3PHLA 1FZCC 1ZR4A 4Y99C 5BVZA 3B5NB 1NTZD 4HJGH 3AE9C 2PFXA 3FXEA 4O9BA 1NGMB 1CI6B 1BCCD 2QJYC 3HTKA 2J58A 5AW8B 3GW6A 4OGQC 3WUVA 1KB9I 1SQVD 4NPEA 5APUA 3MZWB 4IOIH 1PZQA 3CXHE 3EFFK 3I55P 2WPSA 2AEJA 2OQQA 1X0TA 5E79E 1LTAC 2JO1A 1VPCA 1SVFA 2P67A 2O01N 2KSJA 1UIXA 3AE7C 4WWIA 2ZVNB 1VQ8P 3TGUG 2IBZD 4N78E 1VQLP 1PPJE 3ITKA 5CJ0A 1USDA 2JWDA 3V4QA 4OGQD 5BU8B 5EFWB 1MFZA 2FFDA 1L0LG 2E75B 1LP1A 1IFIA 4GODA 3JSVC 1SQXE 3MUDC 1RE4A 4I1LA 1PGJA 3S4RA 2RH0A 1GL2B 1KQFB 4K35A 2WMMA 1IK7A 3VN0A 1Q7YQ 3OA7A 4GIFA 3AE5C 4EI2A 2Z5IA 3NFQA 3Q5RA 5AVZB 4N6JA 5KAFE 4W7ZA 3G9RA 3H1LG 3L72E 2FY8A 1VL2A 1H8AA 1SFCB 4HB1A 1Y9BA 4WB4A 1L0LK 1AQTA 3SWKA 5APWA 3PJSK 5B5EE 1VF5B 1ZMEC 1WMKA 3H1IJ 3CXHI 3HUSA 1D7MA 3R4YA 1L0ND 1NTKD 1MZ9A 1RF0C 2KLVA 1NTZE 1DEEG 1S5LX 5KLVK 5CCHC 4DCKA 2AXCA 1SQQD 4DOJA 4KT0J 1J1EC 2K9JA 4R4MA 4IFMA 2W83C 1W2EA 3L35A 3H1JJ 1H88A 5E79H 1NTMD 1SQVE 1BGYD 5KJ7A 3HE5A 4IFDK 5AVXB 2FYZA 1SQBD 2CPSA 2G8YA 2QA4P 1EXIA 2AXTE 1M1JB 1QGKB 3B5NC 2FYUG 5AW9B 1SQPJ 1K04A 1FDMA 4U7JA 3A0BE 2IBZE 4I2LC 1N73A 2OYIA 3W68A 2XZRA 2KNCA 2A06D 1MFTA 2R44A 3CCMP 2ZVOB 3T97B 2HG5D 5CBNA 5TJHA 2O1JA 1PP9G 1KC8Q 2MKVA 3L73D 1ZRTD 1IFNA 1N7SB 1LTIC 1X9VA 2ZFCA 3OW2O 1J1DB 4HH2A 2E42A 3V4WA 1PGQA 3H6PA 3B5ND 1EC5A 3MIWA 1LTJB 4U3FG 2H8PD 3JC22 3GHGB 3Q5PA 1NH4A 1CW5A 3BCCG 2R3CA 2O3JA 2FBWC 2N1TB 4EIJA 1JUNA 1ZV8A 3II6A 1QVFO 4OWFA 2E75C 1JY3N 1JM0A 1ZLLA 1FZCA 1KFMA 4H13B 1L0NE 2QJKB 1NTKE 1T3JA 2LXBA 2Q5UA 1QL2A 1KQLA 2DW3A 3L72J 1OX3A 1VQOP 1G2CA 1SQQE 2WPRA 1RE3A 1YIJP 2YXRB 2IYOA 3H1ID 2O01H 4D6TJ 2B87B 1SFCC 3OAKA 2HR3A 1NTME 1BGYE 5C39A 2R3SA 2E75D 4PV1D 2QEXP 1YJ9P 3L75G 4DJGA 3A0BH 1SQBE 4TT3H 2YIUB 3M0DC 3L71G 4B86A 4LGDE 3GF7A 2LR2A 3AEBC 3B8EB 3RK2C 2IYPA 1LT1A 2A06E 4GT1A 1Y47A 2WSCH 3M9BA 1JCDA 2WZ7A 1KN7A 1OFCX 3SFEC 1FJKA 4GDOA 3MUDA 4XFJA 3L73E 1ZRTE 1KD1Q 3R2PA 2O01J 3C8VA 1NKNA 1SQPD 3CWBD 2HODB 1NOHA 2B9BA 1HBWA 2IDBA 5AW3B 1SS1A 1M1JC 3CMAP 3VTPC 1GU5A 2A45H 1KYOD 4WBAA 1K05A 1M7LA 2QVAA 1QLED 3H1HJ 1VQMP 3L74J 1JO5A 3CC4P 3RK2D 3VP9A 1NU1G 2CK3H 1T6AA 2KS1A 5AVWB 1YQ4C 1JMBA 1G1JA 5B66E 1XTCC 2WSCJ 1RF0A 1M57D 5H2FE 3AE6C 3PH0A 1DH3A 1N7SC 2HYNA 4BWNA 3E1RA 4ASVA 4ZNCA 2K37A 1RHZB 3CLQA 1URQB 3CL3D 3GHGC 4IL6E 3H32B 1Q82Q 1IFDA 1ZP0C 2N1TC 3MTUE 1USEA 1EZVI 1HVVA 4NPDA 2W90A 3GLMA 2WTYA 5AW1B 3RL0B 2ZXXA 3GMAA 1L0LD 1N7SD 1S1CX 2HFED 2BCCG 1EDLA 3B5NA 2QJKC 1T2KC 1PL5A 2W6BA 5AVQB 4D6TD 2K9YA 2IFNA 1VQPP 1FOSE 2I1KA 1E5WA 3PP5A 4MN4C 1QEXA 2PAJA 5KLVD 3K5BA 1BGYJ 2IZ1A 2AEFA 2Z4EA 2N1TD 4BXLA 1M90Q 2WWWA 4C46A 3CX5D 3H1LD 2HLOA 2POHA 2IPPA 3A5TA 2YMYA 1SQBJ 2Q6QA 3SSUA 3Q1MA 3A0HH 5KKZB 1LGHB 3U1CA 3F5HA 4C7NB 1DEBA 1SQPE 3CWBE 1T2KD 1OZHA 2RN0A 3EQ2A 3GG2A 2YIUC 1PV3A 4H0LB 3AEDC 2FXMA 1KILB 5B66H 1KTMA 1KYOE 5H2FH 3RL0g 4ASWA 1SP4A 3AEGC 1H0TB 1YTZT 1CZQA 2M0BA 3L73J 1JCCA 2P58A 1PPJG 5BU5A 3WUUA 5KLIB 3PLNA 4GKGA 1KORA 5GTIH 4XA4A 2XV5A 4IL6H 1KB9H 3H1HD 3L4FA 3L74D 2W6AA 1SQXG 3I56P 2FYNB 5AW6B 4C7RA 1UIIA 4PD4H 1BSNA 3VMYA 1P84H 3H1KG 5AW7B 1N86A 3RGUA 1JTHA 1Q90D 1IK9A 1IZNB 4A7PA 4YXDC 3USSA 1RH5B 1HJBA 2H43A 1RQUA 2ZYAA 1YBKA 2RMZA 3L72G 1FBMA 2QJPB 2WSEH 3VMZA 4UB6E 4RJTA 2V7QH 1NJIQ 1L0LE 4GOFA 3M0DA 3CCUP 2WSFH 4I6MC 4NPFX 1GU4A 1JNMA 1L4AC 1S5LE 3RBXA 3TNUB 2E76B 1MV8A 4D6TE 1ZW0A 1LP1B 3V2PA 5AW5B 1JOCA 2QSIA 1URQC 2OTKE 1NTZG 3NTNA 3OJAB 3EWKA 2H89C 1YI2P 3CMEP 3L70J 2BEZF 5KLVE 3FXDA 2K1AA 3V2RA 1BCCG 1IFJA 3CX5E 3H1LE 3M91A 4ZKUA 1DIPA 3S9OA 3KQGA 1JB0J 1J2JB 3VMXA 2C0WA 3RL0C 1SQVG 1KYOH 2YXQB 4KHXA 3AECC 1OW7A 2WSEJ 1L4AD 2V7QJ 3N7NA 4IFFA 3M0AA 2WSFJ 4ZMDA 3KDPB 1T3UA 5DJTB 1BE3J 4RKUJ 2WT7A 1ZR2A 3O6QB 3T97A 2M5AB 3HUSB 1U57A 5AW4B 1GK6A 2NZ2A 3H25A 1NAFA 2IBZG 4H44B 1N7SA 2Y9YA 4YXWH 1DD4A 5CCHD 2Z5HA 3CWBJ 1YYCA 1A02F 5KKZC 3VOPA 2K9JB 2P7JA 2V4HA 1RF1B 3H1HE 3L74E 3BRTB 1HTLC 3TK1A 4H0LC 2L91A 2YKPA 2JKVA 1KILC 2N1TA 3M9HA 4UB6H 3AE2C 1KQSO 1LTGC 2Q9IA 1YHQP 1JY2P 1DD3A 2N9BA 2OYHA 2FYUK 1S5LH 5KLIC 5K5GB 1FZEA 1G1IA 4OVNF 2HPCB 5APVA 4OH8B 1S72P 3CCRP 3F89A 3BATA 2B89A 4BRYB 2OYIB 2OTLP 1K8AQ 1VQ5P 3LW5H 1OVVA 1R5SA 5AVRB 1L0NG 3CX5H 2FYNC 1NTKG 2PP6A 4H0LD 1KILD 3TGUJ 1VQ6P 4WVZA 3VMAA 1VQKP 4DT0A 1YITP 4U3FE 1NKZB 1AA0A 1AQ5A 1FU1A 3BCCE 1LT9B 1SQQG 1LWUB 1GL2C 4AYCA 1L0LJ 3FX0A 2ZAEB 1SLQA 3WMM0 2XU6A 1S9KD 1FC2C 2QJPC 3L37A 1Q81Q 3ABVC 1NTMG 1BGYG 2IBZI 1KB9D 2Q3EA 2C9LY 5KAIH 3L70D 1XTGB 1FDIA 1NAYA 1NTKK 4PD4D 1P84D 5L8RJ 5KLVJ 4WY4B 3EFGA 2B88A 1VF5C 3LW5J 3D71A 2JP3A 1HF9A 3H1LJ 2W8ZA 1GL2D 3V5BA 2AEMA 1FS0E 2L5GB 3WU2H 1PGPA 2A06G 1NTMK 1EZVG 4OGQB 1BE3D 3L75E 2WVRA 5AW2B 1SFCD 2BCCD 5AVSB 4AQRD 2A45I 3SFDC 1VF5D 3CC7P 1VQNP 4Y28J 1NO4A 2K88A 3C1LA 3LIDA 4LC1A 2OTJP 3AEAC 1FZBA 4H44C 3QH9A 2KOGA 3SWFA 3A0HE 1QVGO 1JY2N 1AVYA 1L4AA 4EYYQ 2OYOA 2GM4A 2WPQA 1AV1A 3A2AA 1RF1C 2ZYGA 4JPZB 3PTZA 2FYUJ 5APYA 3H32A 1KILE 2FKWB 1U7MA 1YTZI 2MJZA 1S4XA 5CCHA
chains in the Genus database with same CATH topology
1L0NK 5BU5A 1J1DC 1GD2E 1GW3A 5KJ7A 3HE5A 4IFDK 4GKGA 5AVXB 1LTJC 3RK3C 2XDJA 2FYZA 1S9KE 4XA4A 2ZXEB 2FFDC 2P1JA 2XV5A 2CPSA 1N2DC 3HRNA 1T8ZA 2QM8A 3HE4B 2NPSB 1FZCB 1NU1K 2C0XA 4Y99B 5CCGA 3L4FA 1M1JB 1SQQK 1ZN5A 2OYIC 1RE4C 2W6AA 1KFNA 3B5NC 4RESB 5AW6B 1FAVA 5AW9B 4C7RA 2C9NY 3VMYA 1FDMA 5AW7B 1N86A 3U59A 1JTHA 4I2LC 2HODA 1IJDB 1IK9A 1N73A 2OYIA 1OXZA 1G2CB 2XZRA 3P8CD 1JY2O 1H89A 4LLHA 1HJBA 2H43A 2HG5D 1VDFA 1LT9C 2O1JA 1CI6A 1SQBK 3I5CA 1LWUC 3IFMA 4EOTA 1AFOA 1FZGA 1FBMA 5AVYB 1IFNA 2Q3IA 2WSEH 3VMZA 1N7SB 3RK3D 4C7NA 1JY3O 1LTIC 1NWQA 1Z56A 1X9VA 3KYQA 2ZFCA 5AVTB 3L36A 3O8ZA 3M0DA 2WSFH 3HD7B 3HUSC 4I6MC 1GU4A 1JNMA 1L4AC 1J1DB 4HH2A 3MD0A 2E42A 3V4WA 3H6PA 1KILA 3B5ND 2IFMA 5APXA 3TNUB 3MIWA 1MV8A 1LTJB 2YKQA 5APTA 1LTTC 2H8PD 3V2PA 3GHGB 5AW5B 1JOCA 1NH4A 1FZAA 1CW5A 4WY4C 1URQC 2YNYA 2R3CA 3NTNA 3OJAB 4AUWA 2N1TB 4EIJA 5AVVB 2JJLA 3G3ZA 1JUNA 3V2RA 3V2QA 4M3LA 1ZV8A 1FJPA 3II6A 1IFJA 2YKOA 3M91A 4ZKUA 5CJ4A 3UIAA 1URQA 4ZKPA 1JY3N 3KQGA 3TYYA 1J2JB 4W7YA 3VMXA 2IX7C 3HE4A 1ZLLA 2NPSA 1FZCA 2C0WA 1KFMA 3RL0C 3C9IA 5KJ7C 1KZUB 1RE3C 2Q7CA 4KHXA 1IFMA 1T3JA 3BVHA 3V2NA 5APSA 1L4AD 2Q5UA 1OWAA 3N7NA 1QL2A 2R32A 4IFFA 5AVUB 1KQLA 1SQPK 2BASA 5CCGC 3M0AA 4N78D 1G2CA 2WPRA 3KDPB 1T3UA 1RE3A 4WY4D 4W80A 2WITA 2WT7A 1ZR2A 3T97A 1MUUA 1GL2A 3HTKB 3HUSB 1X8YA 1L4AB 5AW4B 2XKMA 1GK6A 2O01H 1PFIA 1SFCC 1N73C 3OAKA 1NAFA 3SWYA 1N7SA 2KP8A 2KB7P 5CCHD 3VP8A 2Z5HA 1YYCA 1A02F 3HD7A 2YO2A 5KTBA 3VOPA 1SFCA 5KJ7D 3A3YB 3M9QA 1DX7A 2P7JA 1N7LA 1RF1B 1GZLA 3TNUA 1QL1A 2KYVA 3NXSA 3M06A 3VYIA 3M0DC 3BRTB 1HTLC 3TK1A 4B86A 5CCGD 1IC2A 1LTBC 1WT6A 3A7OA 4LGDE 3U1AA 2OYHC 1J1EB 3IR9A 2YKPA 1KILC 2N1TA 3M9HA 1FOSF 2JEEA 1HUCA 3B8EB 3RK2C 1FZFA 1HGZA 3P7KA 3P8CE 4GT1A 1NHLA 2WSCH 1RY3A 1LTGC 3M9BA 1JCDA 2Q9IA 2WZ7A 1SQXK 1JY2P 2QM7A 2N9BA 2OYHA 2FYUK 1FJKA 3MUDA 1FZEA 1G1IA 3RK3B 3R2PA 2FFDB 2YO3A 1WRGA 2HPCB 1GW4A 2W27A 2H7HA 2LKMA 2E43A 2GUSA 3BASA 5APVA 4DZOA 1GTWA 1GDTA 4OH8B 1NKNA 3BATA 1JY3P 4HYTB 1JTHB 2HODB 1NOHA 2NPSC 1FZCC 2OYIB 3P32A 1HBWA 1ZR4A 5AW3B 1HWTC 3LW5H 4Y99C 5BVZA 3B5NB 1M1JC 3VTPC 5AVRB 3P8MC 4O9BA 1GU5A 1CI6B 2PP6A 2A45H 4WBAA 3HTKA 1M7LA 1KILD 4N3YB 2O1KA 1JO5A 2J58A 5AW8B 3RK2D 1M1JA 1NKZB 3VP9A 1AQ5A 1FU1A 2OARA 1LT9B 1LWUB 1GL2C 5AVWB 4AYCA 5APUA 1G1JA 2GUVA 2CPBA 1XTCC 1SLQA 3WMM0 1RF0A 2XU6A 1S9KD 1EQ7A 3L37A 1DH3A 1N7SC 4JYCA 2HYNA 1NTZK 3RK2B 2WPSA 1URQD 1RF1A 1GK4A 2NPSD 1LTAC 2I1JA 3HD7C 2C9LY 1VPCA 1SVFA 3BRVB 1XTGB 2P67A 2KSJA 1NTKK 3CLQA 1IO4A 4WY4B 1URQB 3EFGA 3CL3D 1SQVK 4N78E 2XNXA 3GHGC 1X79B 3H32B 1LTSC 3RL0D 3TSIA 5CJ0A 2P2UA 3V4QA 1IFDA 2N1TC 3MTUE 3E1IA 5BU8B 2R5DA 4JF7A 1MFZA 1LTJA 1HVVA 1GL2D 2FFDA 3V5BA 2HPCA 3GHGA 1IFIA 2L5GB 3NMDA 2WTYA 5AW1B 3RL0B 5CHXA 1NTMK 5APQA 1N7SD 3HE5B 1RE4A 2HFED 4I1LA 3B5NA 3KPEA 2WT7B 1T2KC 1GL2B 3HD7D 2W6BA 5AW2B 1SFCD 5AVQB 5AVSB 3VN0A 4AQRD 3OA7A 2A45I 4GIFA 2Z5IA 3NFQA 2IFNA 5AW0B 5AVZB 1FOSE 2I1KA 4N6JA 5CMZA 1HH0A 1E5WA 4W7ZA 4JYBA 3PP5A 2PAJA 1LT9A 1LWUA 1H8AA 2A45G 2Z4EA 2N1TD 2J59M 1CSBA 1SFCB 1N73B 2R5BA 1NO4A 1HGVA 2WWWA 4C46A 1JMMA 4WB4A 2HLOA 1L0LK 3LIDA 4XE5B 2POHA 4LC1A 2IPPA 3A5TA 1FZBA 2YMYA 5APWA 2KOGA 3SWFA 3HUSA 1JY2N 1LGHB 3U1CA 1L4AA 4C7NB 1MZ9A 1RF0C 2GM4A 2WPQA 1DEBA 3LIEA 1T2KD 3A2AA 1RF1C 2KLVA 3MGNA 3EQ2A 1A02J 4WY4A 2M8RA 5KLVK 5CCHC 5APYA 2OYHB 2FXMA 3H32A 1KILB 2M3BA 4DOJA 1J1EC 2FKWB 3CI9A 2VRSA 1YTZI 4IFMA 2MJZA 1W2EA 3L35A 1SP4A 1YTZT 1CZQA 5CCHA 1JCCA 1H88A 3N4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB K;  1L0N K;  2FYU K;  1NTK K;  3CLQ A;  5KLV K;  1SQP K;  4IFD K;  2WSE H;  1SQV K;  1NTM K;  2LKM A;  1NTZ K;  1NU1 K;  3M9Q A;  2WSC H;  2WSF H;  3G3Z A;  2J59 M;  2O01 H;  1SQQ K;  2OAR A;  3LW5 H;  1L0L K;  1SQX K; 
#chains in the Genus database with same CATH topology
 1KMI Z;  1J1D C;  1PP9 J;  2OGU A;  4H44 D;  1GD2 E;  1GW3 A;  1LTJ C;  3H1I G;  5GTI E;  1S9K E;  2ZXE B;  1FE6 A;  3AE4 C;  3HRN A;  1T8Z A;  2QM8 A;  3HE4 B;  1OMI A;  2NPS B;  1NU1 K;  2C0X A;  4KJM A;  1KB9 E;  3TGU D;  1K73 Q;  1ZN5 A;  2OYI C;  3KZI H;  3L70 E;  4RES B;  3FGA D;  1FAV A;  2E5T A;  4PD4 E;  1P84 E;  4U3F J;  3U59 A;  3BCC J;  2NRG A;  1R8E A;  1JY2 O;  3H1K D;  4H13 C;  3GF3 A;  3H1J G;  4RO0 A;  4LLH A;  1VDF A;  1LT9 C;  3I5C A;  1CI6 A;  1AFO A;  1LWU C;  4EOT A;  5AVY B;  1BDD A;  2G3A A;  4C7N A;  3CD6 P;  1Z56 A;  3G6E P;  3KYQ A;  5AVT B;  3L36 A;  3O8Z A;  3HD7 B;  4L76 A;  1BE3 E;  1YJN P;  1KIL A;  2IFM A;  2BCC E;  5APX A;  1Q86 Q;  1SQP G;  2LXC B;  3CWB G;  1VQ9 P;  1BSH A;  4WY4 C;  1M1K Q;  4H13 D;  5AVV B;  3G3Z A;  2WSS H;  3V2Q A;  4M3L A;  1FJP A;  3V6I A;  5CJ4 A;  3UIA A;  1KQG B;  4ZKP A;  2KIK A;  2KZJ A;  5GTH E;  3TYY A;  1BDC A;  1S3J A;  4W7Y A;  1EDK A;  4L73 A;  3L75 J;  3C9I A;  1U7J A;  1RE3 C;  3BVH A;  3V2N A;  3MHV A;  5APS A;  1PIX A;  5AVU B;  1SQP K;  3L71 J;  5CCG C;  4PD4 I;  1P84 I;  3AE8 C;  1MKM A;  4WY4 D;  2WIT A;  1GL2 A;  3HTK B;  4QMA A;  2XKM A;  1EDJ A;  4JQ0 D;  1PFI A;  3SWY A;  2KXP B;  2RKL A;  3S1K A;  3Q5S A;  2FYU D;  1SFC A;  3WUT A;  2SPZ A;  1N7L A;  3TGU E;  3TNU A;  3G71 P;  5TIS H;  2KYV A;  3D6Z A;  3D6Y A;  3VYI A;  4PV1 B;  5CCG D;  3A7O A;  4R4L A;  2Y9Z A;  4PJ0 E;  1PP9 D;  1FOS F;  1HJ0 A;  2JEE A;  1HUC A;  1HGZ A;  1NHL A;  3H1K E;  4D6T G;  3QWO C;  3CCV P;  1NU1 J;  4TLF A;  4I7Z B;  1SQX K;  2QM7 A;  5KLV G;  3RK3 B;  1IFP A;  2FFD B;  2YO3 A;  1NVO A;  2W27 A;  2H7H A;  2GUS A;  3BAS A;  1KYO I;  1GTW A;  1GDT A;  3RBZ A;  4U3F D;  3Q2Y A;  4HYT B;  1JY3 P;  1JTH B;  1PGO A;  2NPS C;  3P32 A;  3BCC D;  2JR8 A;  1HWT C;  3P8M C;  4YTP C;  2Y0C A;  3CCJ P;  3O6Q A;  2M5A A;  5GTH H;  1OIP A;  4N3Y B;  4K3A A;  2O1K A;  1M1J A;  2OAR A;  1OVU A;  1OW8 A;  2GUV A;  1YJW P;  2CPB A;  1OW6 A;  2ZT9 B;  1BCC E;  1EQ7 A;  3CXH H;  3RK2 B;  4JYC A;  1NTZ K;  2J5U A;  1URQ D;  1RF1 A;  1GK4 A;  2BCC J;  1GMJ A;  2NPS D;  2I1J A;  3HD7 C;  2P10 A;  5KAI E;  3BRV B;  1RQV A;  1R5L A;  1IO4 A;  2YMK A;  3H1H G;  1SQV K;  2XNX A;  1X79 B;  2E74 B;  3L74 G;  3TSI A;  1LTS C;  3RL0 D;  2P2U A;  4GOE A;  3E1I A;  1NYH A;  3L75 D;  2R5D A;  4JF7 A;  1LTJ A;  2HPC A;  3GHG A;  3WU2 E;  3NMD A;  2M3E A;  3JCU E;  3CC2 P;  3TF5 A;  2FXO A;  2QE7 H;  5CHX A;  5APQ A;  4PJ0 H;  3L71 D;  3HE5 B;  4BRY A;  2FYU E;  2QIW A;  3KPE A;  2WT7 B;  5CBO A;  1EZV D;  3W67 A;  3B4S A;  3HD7 D;  3CX5 I;  5AW0 B;  5CMZ A;  1HH0 A;  4JYB A;  1PP9 E;  5KAF H;  2ZYD A;  1LT9 A;  1LWU A;  2A45 G;  2J59 M;  1CSB A;  1N73 B;  1EXJ A;  2R5B A;  1HGV A;  2D2C B;  2KNC B;  1JMM A;  4XE5 B;  2K3R A;  3TDK A;  2KUB A;  5B5E H;  2KSE A;  1E79 H;  2XND H;  2B87 A;  3LIE A;  2PRR A;  5DJU B;  2KK7 A;  3MGN A;  1A02 J;  1SQX J;  4WY4 A;  2M8R A;  1LJ2 A;  1NU1 D;  2OYH B;  2IZ0 A;  4PV1 C;  2M3B A;  3H1K J;  3CI9 A;  2VRS A;  2ITA A;  3E7K A;  1FDO A;  1QX8 A;  3D70 A;  3MP7 B;  3N4X A;  4JBZ A;  2Y0E A;  1L0N K;  4I7Z C;  1SQB G;  2E76 C;  3RK3 C;  2XDJ A;  2FFD C;  4CPG A;  2P1J A;  3KHU A;  1N2D C;  1FZC B;  2PGD A;  2FXP A;  4Y99 B;  2AXT H;  5CCG A;  1SQQ K;  1RE4 C;  3KZI E;  1KFN A;  3CCS P;  2C9N Y;  1Q2N A;  2QJY B;  3AE1 C;  3JCU H;  2JDI H;  1W5C E;  2HOD A;  1IJD B;  1EDI A;  1NTZ J;  1OXZ A;  1G2C B;  3P8C D;  3L73 G;  1H89 A;  2UWJ E;  3AE3 C;  1BCC J;  1N8R Q;  3IFM A;  1ZXG A;  1SQB K;  1FZG A;  1VQ7 P;  3H1J D;  2Q3I A;  2E76 D;  1M56 D;  3RK3 D;  4UB8 E;  2ZT9 C;  1S2E A;  1JY3 O;  1L2P A;  1NWQ A;  1SQV J;  3L71 E;  3HUS C;  2KI7 B;  1EZV E;  2KLU A;  3MD0 A;  1LNQ A;  3IAO A;  1AJY A;  1W2B O;  2YKQ A;  5APT A;  1LTT C;  3FWL A;  3CCQ P;  2Y0D A;  2H88 C;  1FZA A;  1Y8A A;  2YNY A;  4EDF A;  2E74 C;  4AUW A;  2JJL A;  2ZJS E;  3ZDM A;  2YKO A;  2QRX A;  2WQY C;  3Q3D A;  1URQ A;  2E5Y A;  3CXH D;  2IX7 C;  2ZT9 D;  3HE4 A;  2NPS A;  2QG4 A;  1X22 A;  5M1B A;  5KJ7 C;  1OVR A;  1KZU B;  2Q7C A;  1IFM A;  3AEF C;  1OWA A;  3CCL P;  2R32 A;  2BEQ D;  3PRJ A;  2BAS A;  2N9Y B;  1NU1 E;  3IN6 A;  4N78 D;  1PPJ D;  3KXD A;  4W80 A;  3L70 G;  2E74 D;  1MUU A;  4L75 A;  1X8Y A;  3CCE P;  1L4A B;  2W6J H;  2JWA A;  1N73 C;  2D2C C;  4Z1M H;  4L74 A;  2KP8 A;  3B71 A;  1AVO A;  2KB7 P;  2KS1 B;  2WPV B;  3VP8 A;  3AEE C;  1SQX D;  2I8D A;  3HD7 A;  2GA1 A;  2YO2 A;  5KTB A;  1KV4 A;  5KJ7 D;  3A3Y B;  3M9Q A;  1JEK A;  3H1I E;  4HKZ H;  1DX7 A;  1GZL A;  1QL1 A;  5TIS E;  3NXS A;  3M06 A;  1K9M Q;  1L0N J;  3FWN A;  1M8O B;  1IC2 A;  1LTB C;  1WT6 A;  1ZOY C;  2Q1K A;  3U1A A;  1NTK J;  2OYH C;  1J1E B;  3IR9 A;  1BE3 G;  4YPC A;  4UB8 H;  3L72 D;  1TU3 F;  1VQ4 P;  1FZF A;  4IL6 X;  3P7K A;  3P8C E;  3IF4 A;  1RY3 A;  3G4S P;  1YQ3 C;  1SQQ J;  2D2C D;  3H1J E;  1WRG A;  3CPW O;  3RK3 E;  1GW4 A;  2LKM A;  2E43 A;  4DZO A;  1H0T A;  1NTM J;  2KZI A;  3PHL A;  1FZC C;  1ZR4 A;  4Y99 C;  5BVZ A;  3B5N B;  1NTZ D;  4HJG H;  3AE9 C;  2PFX A;  3FXE A;  4O9B A;  1NGM B;  1CI6 B;  1BCC D;  2QJY C;  3HTK A;  2J58 A;  5AW8 B;  3GW6 A;  4OGQ C;  3WUV A;  1KB9 I;  1SQV D;  4NPE A;  5APU A;  3MZW B;  4IOI H;  1PZQ A;  3CXH E;  3EFF K;  3I55 P;  2WPS A;  2AEJ A;  2OQQ A;  1X0T A;  5E79 E;  1LTA C;  2JO1 A;  1VPC A;  1SVF A;  2P67 A;  2O01 N;  2KSJ A;  1UIX A;  3AE7 C;  4WWI A;  2ZVN B;  1VQ8 P;  3TGU G;  2IBZ D;  4N78 E;  1VQL P;  1PPJ E;  3ITK A;  5CJ0 A;  1USD A;  2JWD A;  3V4Q A;  4OGQ D;  5BU8 B;  5EFW B;  1MFZ A;  2FFD A;  1L0L G;  2E75 B;  1LP1 A;  1IFI A;  4GOD A;  3JSV C;  1SQX E;  3MUD C;  1RE4 A;  4I1L A;  1PGJ A;  3S4R A;  2RH0 A;  1GL2 B;  1KQF B;  4K35 A;  2WMM A;  1IK7 A;  3VN0 A;  1Q7Y Q;  3OA7 A;  4GIF A;  3AE5 C;  4EI2 A;  2Z5I A;  3NFQ A;  3Q5R A;  5AVZ B;  4N6J A;  5KAF E;  4W7Z A;  3G9R A;  3H1L G;  3L72 E;  2FY8 A;  1VL2 A;  1H8A A;  1SFC B;  4HB1 A;  1Y9B A;  4WB4 A;  1L0L K;  1AQT A;  3SWK A;  5APW A;  3PJS K;  5B5E E;  1VF5 B;  1ZME C;  1WMK A;  3H1I J;  3CXH I;  3HUS A;  1D7M A;  3R4Y A;  1L0N D;  1NTK D;  1MZ9 A;  1RF0 C;  2KLV A;  1NTZ E;  1DEE G;  1S5L X;  5KLV K;  5CCH C;  4DCK A;  2AXC A;  1SQQ D;  4DOJ A;  4KT0 J;  1J1E C;  2K9J A;  4R4M A;  4IFM A;  2W83 C;  1W2E A;  3L35 A;  3H1J J;  1H88 A;  5E79 H;  1NTM D;  1SQV E;  1BGY D;  5KJ7 A;  3HE5 A;  4IFD K;  5AVX B;  2FYZ A;  1SQB D;  2CPS A;  2G8Y A;  2QA4 P;  1EXI A;  2AXT E;  1M1J B;  1QGK B;  3B5N C;  2FYU G;  5AW9 B;  1SQP J;  1K04 A;  1FDM A;  4U7J A;  3A0B E;  2IBZ E;  4I2L C;  1N73 A;  2OYI A;  3W68 A;  2XZR A;  2KNC A;  2A06 D;  1MFT A;  2R44 A;  3CCM P;  2ZVO B;  3T97 B;  2HG5 D;  5CBN A;  5TJH A;  2O1J A;  1PP9 G;  1KC8 Q;  2MKV A;  3L73 D;  1ZRT D;  1IFN A;  1N7S B;  1LTI C;  1X9V A;  2ZFC A;  3OW2 O;  1J1D B;  4HH2 A;  2E42 A;  3V4W A;  1PGQ A;  3H6P A;  3B5N D;  1EC5 A;  3MIW A;  1LTJ B;  4U3F G;  2H8P D;  3JC2 2;  3GHG B;  3Q5P A;  1NH4 A;  1CW5 A;  3BCC G;  2R3C A;  2O3J A;  2FBW C;  2N1T B;  4EIJ A;  1JUN A;  1ZV8 A;  3II6 A;  1QVF O;  4OWF A;  2E75 C;  1JY3 N;  1JM0 A;  1ZLL A;  1FZC A;  1KFM A;  4H13 B;  1L0N E;  2QJK B;  1NTK E;  1T3J A;  2LXB A;  2Q5U A;  1QL2 A;  1KQL A;  2DW3 A;  3L72 J;  1OX3 A;  1VQO P;  1G2C A;  1SQQ E;  2WPR A;  1RE3 A;  1YIJ P;  2YXR B;  2IYO A;  3H1I D;  2O01 H;  4D6T J;  2B87 B;  1SFC C;  3OAK A;  2HR3 A;  1NTM E;  1BGY E;  5C39 A;  2R3S A;  2E75 D;  4PV1 D;  2QEX P;  1YJ9 P;  3L75 G;  4DJG A;  3A0B H;  1SQB E;  4TT3 H;  2YIU B;  3M0D C;  3L71 G;  4B86 A;  4LGD E;  3GF7 A;  2LR2 A;  3AEB C;  3B8E B;  3RK2 C;  2IYP A;  1LT1 A;  2A06 E;  4GT1 A;  1Y47 A;  2WSC H;  3M9B A;  1JCD A;  2WZ7 A;  1KN7 A;  1OFC X;  3SFE C;  1FJK A;  4GDO A;  3MUD A;  4XFJ A;  3L73 E;  1ZRT E;  1KD1 Q;  3R2P A;  2O01 J;  3C8V A;  1NKN A;  1SQP D;  3CWB D;  2HOD B;  1NOH A;  2B9B A;  1HBW A;  2IDB A;  5AW3 B;  1SS1 A;  1M1J C;  3CMA P;  3VTP C;  1GU5 A;  2A45 H;  1KYO D;  4WBA A;  1K05 A;  1M7L A;  2QVA A;  1QLE D;  3H1H J;  1VQM P;  3L74 J;  1JO5 A;  3CC4 P;  3RK2 D;  3VP9 A;  1NU1 G;  2CK3 H;  1T6A A;  2KS1 A;  5AVW B;  1YQ4 C;  1JMB A;  1G1J A;  5B66 E;  1XTC C;  2WSC J;  1RF0 A;  1M57 D;  5H2F E;  3AE6 C;  3PH0 A;  1DH3 A;  1N7S C;  2HYN A;  4BWN A;  3E1R A;  4ASV A;  4ZNC A;  2K37 A;  1RHZ B;  3CLQ A;  1URQ B;  3CL3 D;  3GHG C;  4IL6 E;  3H32 B;  1Q82 Q;  1IFD A;  1ZP0 C;  2N1T C;  3MTU E;  1USE A;  1EZV I;  1HVV A;  4NPD A;  2W90 A;  3GLM A;  2WTY A;  5AW1 B;  3RL0 B;  2ZXX A;  3GMA A;  1L0L D;  1N7S D;  1S1C X;  2HFE D;  2BCC G;  1EDL A;  3B5N A;  2QJK C;  1T2K C;  1PL5 A;  2W6B A;  5AVQ B;  4D6T D;  2K9Y A;  2IFN A;  1VQP P;  1FOS E;  2I1K A;  1E5W A;  3PP5 A;  4MN4 C;  1QEX A;  2PAJ A;  5KLV D;  3K5B A;  1BGY J;  2IZ1 A;  2AEF A;  2Z4E A;  2N1T D;  4BXL A;  1M90 Q;  2WWW A;  4C46 A;  3CX5 D;  3H1L D;  2HLO A;  2POH A;  2IPP A;  3A5T A;  2YMY A;  1SQB J;  2Q6Q A;  3SSU A;  3Q1M A;  3A0H H;  5KKZ B;  1LGH B;  3U1C A;  3F5H A;  4C7N B;  1DEB A;  1SQP E;  3CWB E;  1T2K D;  1OZH A;  2RN0 A;  3EQ2 A;  3GG2 A;  2YIU C;  1PV3 A;  4H0L B;  3AED C;  2FXM A;  1KIL B;  5B66 H;  1KTM A;  1KYO E;  5H2F H;  3RL0 g;  4ASW A;  1SP4 A;  3AEG C;  1H0T B;  1YTZ T;  1CZQ A;  2M0B A;  3L73 J;  1JCC A;  2P58 A;  1PPJ G;  5BU5 A;  3WUU A;  5KLI B;  3PLN A;  4GKG A;  1KOR A;  5GTI H;  4XA4 A;  2XV5 A;  4IL6 H;  1KB9 H;  3H1H D;  3L4F A;  3L74 D;  2W6A A;  1SQX G;  3I56 P;  2FYN B;  5AW6 B;  4C7R A;  1UII A;  4PD4 H;  1BSN A;  3VMY A;  1P84 H;  3H1K G;  5AW7 B;  1N86 A;  3RGU A;  1JTH A;  1Q90 D;  1IK9 A;  1IZN B;  4A7P A;  4YXD C;  3USS A;  1RH5 B;  1HJB A;  2H43 A;  1RQU A;  2ZYA A;  1YBK A;  2RMZ A;  3L72 G;  1FBM A;  2QJP B;  2WSE H;  3VMZ A;  4UB6 E;  4RJT A;  2V7Q H;  1NJI Q;  1L0L E;  4GOF A;  3M0D A;  3CCU P;  2WSF H;  4I6M C;  4NPF X;  1GU4 A;  1JNM A;  1L4A C;  1S5L E;  3RBX A;  3TNU B;  2E76 B;  1MV8 A;  4D6T E;  1ZW0 A;  1LP1 B;  3V2P A;  5AW5 B;  1JOC A;  2QSI A;  1URQ C;  2OTK E;  1NTZ G;  3NTN A;  3OJA B;  3EWK A;  2H89 C;  1YI2 P;  3CME P;  3L70 J;  2BEZ F;  5KLV E;  3FXD A;  2K1A A;  3V2R A;  1BCC G;  1IFJ A;  3CX5 E;  3H1L E;  3M91 A;  4ZKU A;  1DIP A;  3S9O A;  3KQG A;  1JB0 J;  1J2J B;  3VMX A;  2C0W A;  3RL0 C;  1SQV G;  1KYO H;  2YXQ B;  4KHX A;  3AEC C;  1OW7 A;  2WSE J;  1L4A D;  2V7Q J;  3N7N A;  4IFF A;  3M0A A;  2WSF J;  4ZMD A;  3KDP B;  1T3U A;  5DJT B;  1BE3 J;  4RKU J;  2WT7 A;  1ZR2 A;  3O6Q B;  3T97 A;  2M5A B;  3HUS B;  1U57 A;  5AW4 B;  1GK6 A;  2NZ2 A;  3H25 A;  1NAF A;  2IBZ G;  4H44 B;  1N7S A;  2Y9Y A;  4YXW H;  1DD4 A;  5CCH D;  2Z5H A;  3CWB J;  1YYC A;  1A02 F;  5KKZ C;  3VOP A;  2K9J B;  2P7J A;  2V4H A;  1RF1 B;  3H1H E;  3L74 E;  3BRT B;  1HTL C;  3TK1 A;  4H0L C;  2L91 A;  2YKP A;  2JKV A;  1KIL C;  2N1T A;  3M9H A;  4UB6 H;  3AE2 C;  1KQS O;  1LTG C;  2Q9I A;  1YHQ P;  1JY2 P;  1DD3 A;  2N9B A;  2OYH A;  2FYU K;  1S5L H;  5KLI C;  5K5G B;  1FZE A;  1G1I A;  4OVN F;  2HPC B;  5APV A;  4OH8 B;  1S72 P;  3CCR P;  3F89 A;  3BAT A;  2B89 A;  4BRY B;  2OYI B;  2OTL P;  1K8A Q;  1VQ5 P;  3LW5 H;  1OVV A;  1R5S A;  5AVR B;  1L0N G;  3CX5 H;  2FYN C;  1NTK G;  2PP6 A;  4H0L D;  1KIL D;  3TGU J;  1VQ6 P;  4WVZ A;  3VMA A;  1VQK P;  4DT0 A;  1YIT P;  4U3F E;  1NKZ B;  1AA0 A;  1AQ5 A;  1FU1 A;  3BCC E;  1LT9 B;  1SQQ G;  1LWU B;  1GL2 C;  4AYC A;  1L0L J;  3FX0 A;  2ZAE B;  1SLQ A;  3WMM 0;  2XU6 A;  1S9K D;  1FC2 C;  2QJP C;  3L37 A;  1Q81 Q;  3ABV C;  1NTM G;  1BGY G;  2IBZ I;  1KB9 D;  2Q3E A;  2C9L Y;  5KAI H;  3L70 D;  1XTG B;  1FDI A;  1NAY A;  1NTK K;  4PD4 D;  1P84 D;  5L8R J;  5KLV J;  4WY4 B;  3EFG A;  2B88 A;  1VF5 C;  3LW5 J;  3D71 A;  2JP3 A;  1HF9 A;  3H1L J;  2W8Z A;  1GL2 D;  3V5B A;  2AEM A;  1FS0 E;  2L5G B;  3WU2 H;  1PGP A;  2A06 G;  1NTM K;  1EZV G;  4OGQ B;  1BE3 D;  3L75 E;  2WVR A;  5AW2 B;  1SFC D;  2BCC D;  5AVS B;  4AQR D;  2A45 I;  3SFD C;  1VF5 D;  3CC7 P;  1VQN P;  4Y28 J;  1NO4 A;  2K88 A;  3C1L A;  3LID A;  4LC1 A;  2OTJ P;  3AEA C;  1FZB A;  4H44 C;  3QH9 A;  2KOG A;  3SWF A;  3A0H E;  1QVG O;  1JY2 N;  1AVY A;  1L4A A;  4EYY Q;  2OYO A;  2GM4 A;  2WPQ A;  1AV1 A;  3A2A A;  1RF1 C;  2ZYG A;  4JPZ B;  3PTZ A;  2FYU J;  5APY A;  3H32 A;  1KIL E;  2FKW B;  1U7M A;  1YTZ I;  2MJZ A;  1S4X A;  5CCH A; 
#chains in the Genus database with same CATH homology
 1L0N K;  5BU5 A;  1J1D C;  1GD2 E;  1GW3 A;  5KJ7 A;  3HE5 A;  4IFD K;  4GKG A;  5AVX B;  1LTJ C;  3RK3 C;  2XDJ A;  2FYZ A;  1S9K E;  4XA4 A;  2ZXE B;  2FFD C;  2P1J A;  2XV5 A;  2CPS A;  1N2D C;  3HRN A;  1T8Z A;  2QM8 A;  3HE4 B;  2NPS B;  1FZC B;  1NU1 K;  2C0X A;  4Y99 B;  5CCG A;  3L4F A;  1M1J B;  1SQQ K;  1ZN5 A;  2OYI C;  1RE4 C;  2W6A A;  1KFN A;  3B5N C;  4RES B;  5AW6 B;  1FAV A;  5AW9 B;  4C7R A;  2C9N Y;  3VMY A;  1FDM A;  5AW7 B;  1N86 A;  3U59 A;  1JTH A;  4I2L C;  2HOD A;  1IJD B;  1IK9 A;  1N73 A;  2OYI A;  1OXZ A;  1G2C B;  2XZR A;  3P8C D;  1JY2 O;  1H89 A;  4LLH A;  1HJB A;  2H43 A;  2HG5 D;  1VDF A;  1LT9 C;  2O1J A;  1CI6 A;  1SQB K;  3I5C A;  1LWU C;  3IFM A;  4EOT A;  1AFO A;  1FZG A;  1FBM A;  5AVY B;  1IFN A;  2Q3I A;  2WSE H;  3VMZ A;  1N7S B;  3RK3 D;  4C7N A;  1JY3 O;  1LTI C;  1NWQ A;  1Z56 A;  1X9V A;  3KYQ A;  2ZFC A;  5AVT B;  3L36 A;  3O8Z A;  3M0D A;  2WSF H;  3HD7 B;  3HUS C;  4I6M C;  1GU4 A;  1JNM A;  1L4A C;  1J1D B;  4HH2 A;  3MD0 A;  2E42 A;  3V4W A;  3H6P A;  1KIL A;  3B5N D;  2IFM A;  5APX A;  3TNU B;  3MIW A;  1MV8 A;  1LTJ B;  2YKQ A;  5APT A;  1LTT C;  2H8P D;  3V2P A;  3GHG B;  5AW5 B;  1JOC A;  1NH4 A;  1FZA A;  1CW5 A;  4WY4 C;  1URQ C;  2YNY A;  2R3C A;  3NTN A;  3OJA B;  4AUW A;  2N1T B;  4EIJ A;  5AVV B;  2JJL A;  3G3Z A;  1JUN A;  3V2R A;  3V2Q A;  4M3L A;  1ZV8 A;  1FJP A;  3II6 A;  1IFJ A;  2YKO A;  3M91 A;  4ZKU A;  5CJ4 A;  3UIA A;  1URQ A;  4ZKP A;  1JY3 N;  3KQG A;  3TYY A;  1J2J B;  4W7Y A;  3VMX A;  2IX7 C;  3HE4 A;  1ZLL A;  2NPS A;  1FZC A;  2C0W A;  1KFM A;  3RL0 C;  3C9I A;  5KJ7 C;  1KZU B;  1RE3 C;  2Q7C A;  4KHX A;  1IFM A;  1T3J A;  3BVH A;  3V2N A;  5APS A;  1L4A D;  2Q5U A;  1OWA A;  3N7N A;  1QL2 A;  2R32 A;  4IFF A;  5AVU B;  1KQL A;  1SQP K;  2BAS A;  5CCG C;  3M0A A;  4N78 D;  1G2C A;  2WPR A;  3KDP B;  1T3U A;  1RE3 A;  4WY4 D;  4W80 A;  2WIT A;  2WT7 A;  1ZR2 A;  3T97 A;  1MUU A;  1GL2 A;  3HTK B;  3HUS B;  1X8Y A;  1L4A B;  5AW4 B;  2XKM A;  1GK6 A;  2O01 H;  1PFI A;  1SFC C;  1N73 C;  3OAK A;  1NAF A;  3SWY A;  1N7S A;  2KP8 A;  2KB7 P;  5CCH D;  3VP8 A;  2Z5H A;  1YYC A;  1A02 F;  3HD7 A;  2YO2 A;  5KTB A;  3VOP A;  1SFC A;  5KJ7 D;  3A3Y B;  3M9Q A;  1DX7 A;  2P7J A;  1N7L A;  1RF1 B;  1GZL A;  3TNU A;  1QL1 A;  2KYV A;  3NXS A;  3M06 A;  3VYI A;  3M0D C;  3BRT B;  1HTL C;  3TK1 A;  4B86 A;  5CCG D;  1IC2 A;  1LTB C;  1WT6 A;  3A7O A;  4LGD E;  3U1A A;  2OYH C;  1J1E B;  3IR9 A;  2YKP A;  1KIL C;  2N1T A;  3M9H A;  1FOS F;  2JEE A;  1HUC A;  3B8E B;  3RK2 C;  1FZF A;  1HGZ A;  3P7K A;  3P8C E;  4GT1 A;  1NHL A;  2WSC H;  1RY3 A;  1LTG C;  3M9B A;  1JCD A;  2Q9I A;  2WZ7 A;  1SQX K;  1JY2 P;  2QM7 A;  2N9B A;  2OYH A;  2FYU K;  1FJK A;  3MUD A;  1FZE A;  1G1I A;  3RK3 B;  3R2P A;  2FFD B;  2YO3 A;  1WRG A;  2HPC B;  1GW4 A;  2W27 A;  2H7H A;  2LKM A;  2E43 A;  2GUS A;  3BAS A;  5APV A;  4DZO A;  1GTW A;  1GDT A;  4OH8 B;  1NKN A;  3BAT A;  1JY3 P;  4HYT B;  1JTH B;  2HOD B;  1NOH A;  2NPS C;  1FZC C;  2OYI B;  3P32 A;  1HBW A;  1ZR4 A;  5AW3 B;  1HWT C;  3LW5 H;  4Y99 C;  5BVZ A;  3B5N B;  1M1J C;  3VTP C;  5AVR B;  3P8M C;  4O9B A;  1GU5 A;  1CI6 B;  2PP6 A;  2A45 H;  4WBA A;  3HTK A;  1M7L A;  1KIL D;  4N3Y B;  2O1K A;  1JO5 A;  2J58 A;  5AW8 B;  3RK2 D;  1M1J A;  1NKZ B;  3VP9 A;  1AQ5 A;  1FU1 A;  2OAR A;  1LT9 B;  1LWU B;  1GL2 C;  5AVW B;  4AYC A;  5APU A;  1G1J A;  2GUV A;  2CPB A;  1XTC C;  1SLQ A;  3WMM 0;  1RF0 A;  2XU6 A;  1S9K D;  1EQ7 A;  3L37 A;  1DH3 A;  1N7S C;  4JYC A;  2HYN A;  1NTZ K;  3RK2 B;  2WPS A;  1URQ D;  1RF1 A;  1GK4 A;  2NPS D;  1LTA C;  2I1J A;  3HD7 C;  2C9L Y;  1VPC A;  1SVF A;  3BRV B;  1XTG B;  2P67 A;  2KSJ A;  1NTK K;  3CLQ A;  1IO4 A;  4WY4 B;  1URQ B;  3EFG A;  3CL3 D;  1SQV K;  4N78 E;  2XNX A;  3GHG C;  1X79 B;  3H32 B;  1LTS C;  3RL0 D;  3TSI A;  5CJ0 A;  2P2U A;  3V4Q A;  1IFD A;  2N1T C;  3MTU E;  3E1I A;  5BU8 B;  2R5D A;  4JF7 A;  1MFZ A;  1LTJ A;  1HVV A;  1GL2 D;  2FFD A;  3V5B A;  2HPC A;  3GHG A;  1IFI A;  2L5G B;  3NMD A;  2WTY A;  5AW1 B;  3RL0 B;  5CHX A;  1NTM K;  5APQ A;  1N7S D;  3HE5 B;  1RE4 A;  2HFE D;  4I1L A;  3B5N A;  3KPE A;  2WT7 B;  1T2K C;  1GL2 B;  3HD7 D;  2W6B A;  5AW2 B;  1SFC D;  5AVQ B;  5AVS B;  3VN0 A;  4AQR D;  3OA7 A;  2A45 I;  4GIF A;  2Z5I A;  3NFQ A;  2IFN A;  5AW0 B;  5AVZ B;  1FOS E;  2I1K A;  4N6J A;  5CMZ A;  1HH0 A;  1E5W A;  4W7Z A;  4JYB A;  3PP5 A;  2PAJ A;  1LT9 A;  1LWU A;  1H8A A;  2A45 G;  2Z4E A;  2N1T D;  2J59 M;  1CSB A;  1SFC B;  1N73 B;  2R5B A;  1NO4 A;  1HGV A;  2WWW A;  4C46 A;  1JMM A;  4WB4 A;  2HLO A;  1L0L K;  3LID A;  4XE5 B;  2POH A;  4LC1 A;  2IPP A;  3A5T A;  1FZB A;  2YMY A;  5APW A;  2KOG A;  3SWF A;  3HUS A;  1JY2 N;  1LGH B;  3U1C A;  1L4A A;  4C7N B;  1MZ9 A;  1RF0 C;  2GM4 A;  2WPQ A;  1DEB A;  3LIE A;  1T2K D;  3A2A A;  1RF1 C;  2KLV A;  3MGN A;  3EQ2 A;  1A02 J;  4WY4 A;  2M8R A;  5KLV K;  5CCH C;  5APY A;  2OYH B;  2FXM A;  3H32 A;  1KIL B;  2M3B A;  4DOJ A;  1J1E C;  2FKW B;  3CI9 A;  2VRS A;  1YTZ I;  4IFM A;  2MJZ A;  1W2E A;  3L35 A;  1SP4 A;  1YTZ T;  1CZQ A;  5CCH A;  1JCC A;  1H88 A;  3N4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...