1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
b'MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
1NU1K 1SQPK 2WSCH 1NTZK 1SQXK 2WSFH 2J59M 3CLQA 1NTMK 2WSEH 4IFDK 2FYUK 1SQVK 2LKMA 3G3ZA 5KLVK 1L0NK 1SQBK 2OARA 3LW5H 1NTKK 1L0LK 3M9QA 1SQQK 2O01H
chains in the Genus database with same CATH superfamily
1KQLA 3HD7A 1BGYE 1MUUA 1AA0A 4N78D 1GMJA 2P58A 2Y0DA 1NU1K 2QG4A 3CWBD 3VOPA 3NFQA 2FXOA 3D71A 2E43A 3CI9A 3L36A 3RK2C 2IZ1A 1HWTC 1T2KC 1VQLP 3HE5A 3KQGA 1RF1C 3NXSA 2H89C 3RL0g 1QLED 3B5ND 1VQMP 3VMAA 1P84H 1K9MQ 3HRNA 1CZQA 2O01N 2AEFA 3JCUE 1YI2P 2KS1A 2P1JA 3HD7B 2Q5UA 2A06G 2ZT9B 1T2KD 2KXPB 2A45G 1EDKA 5H2FH 1QVFO 3B4SA 4RJTA 3BATA 1NAYA 3EFGA 3CXHE 1MZ9A 2YO3A 3RK3E 3BASA 3IFMA 3VTPC 3B5NA 2ZT9D 1NKNA 3L70G 1PGJA 1S2EA 1JM0A 2KLVA 4H0LC 2O01H 1Q2NA 1PGPA 1NVOA 2Y0CA 3RGUA 2A06D 2E74D 3HUSA 1BE3D 1J1EC 4C7NA 2OYIC 4ASVA 1A02J 3L74E 1SFCC 3V2PA 2H7HA 1GL2B 4MN4C 2J59M 2FYZA 2WQYC 3CWBJ 5AVQB 3C8VA 4NPFX 5B66H 1L0NE 2IYPA 5CCHD 1BDCA 3TGUJ 2IBZI 1EZVD 3M0AA 3RK2D 4DZOA 2YXQB 5TISH 3CMAP 2WSSH 5AVTB 5K5GB 1OX3A 1DX7A 4EYYQ 1T3UA 1BDDA 2K3RA 2KK7A 3B5NC 1T6AA 2JKVA 1U57A 1KYOE 1J2JB 1FZEA 1KQGB 3H6PA 1M1JC 3IF4A 2A45I 4YPCA 3T97A 1RHZB 1NTKK 4JYCA 4BWNA 3M9QA 5KAFH 1OWAA 2FYUJ 3H1KD 2QIWA 2W6BA 1KILE 2N9BA 1BSNA 1FDOA 2HODA 1S4XA 2HG5D 3HUSB 2KNCB 1TU3F 3CX5E 1SQBJ 3L4FA 4PV1D 5APTA 1EDIA 1LWUC 3H1HD 4N6JA 4XFJA 1NO4A 1YBKA 1L4AC 2UWJE 3KPEA 2WTYA 1BE3G 3M0DC 1Q86Q 1AV1A 4QMAA 3L72D 3IR9A 5AVSB 3H25A 3I56P 1SQQD 3L70E 4WBAA 3HD7C 2P10A 3L71E 4IOIH 4K3AA 4PJ0E 3VP9A 1FZAA 5GTIE 3Q5SA 1IK7A 1NU1E 2J5UA 1EC5A 1T8ZA 1GK4A 2WSEH 3BCCJ 3GMAA 4H13B 3G4SP 1N73B 1GK6A 1NTKJ 2FYUK 5CJ4A 2AEMA 2JDIH 2HODB 5APXA 1VQKP 1KV4A 1SQBK 1HUCA 2RN0A 2KB7P 2V4HA 4OGQB 3N7NA 3HTKB 4C7RA 2FYNB 3VN0A 2Q3IA 1OW7A 4JPZB 2Q9IA 1KILB 3NTNA 2E74B 2IBZG 3M0DA 5CHXA 5B5EE 2OQQA 2NPSC 5KLVE 3G71P 2IPPA 1NOHA 3U59A 4ASWA 2E5YA 2Z4EA 2R3CA 3GF7A 2JP3A 1FZCA 2FKWB 1JUNA 2WPQA 1NU1D 2JWDA 3PJSK 5CMZA 4ZNCA 5GTHE 2ZYAA 2O1KA 3G6EP 3H32A 1J1DB 1NYHA 2A45H 1KFNA 3V6IA 3L72E 2YKPA 2QM7A 3RK3C 1PZQA 3P7KA 4TT3H 4Y99C 1OVRA 4LGDE 4NPDA 4OGQC 2LXCB 4U3FD 3CWBG 3L75E 1QL2A 1N7SD 1NU1G 4AUWA 4Y99B 1NTKG 3H1KE 3KXDA 1OMIA 3C1LA 2E5TA 4WB4A 4C7NB 4WWIA 2BCCD 5EFWB 1ZOYC 1HGZA 1SQPE 1JTHB 1SQXE 3HE4B 1E5WA 3OAKA 3P8MC 1AVOA 2IX7C 4K35A 2WPVB 1L0LJ 1UIXA 3LIEA 1LTJB 5AVYB 2H8PD 2OYHB 3WMM0 4XE5B 2KNCA 2O01J 1LT9B 2IBZE 1IK9A 2POHA 3R2PA 4GOFA 3SSUA 1QVGO 2FXPA 2NPSD 4GDOA 1DEEG 3O6QB 3RK3B 2KSJA 2Z5IA 5APVA 3W68A 1LTGC 1PP9E 1IFJA 1U7MA 2E75B 5GTIH 3Q5RA 1EXIA 3CCEP 1YQ4C 1ZR4A 3WUTA 1USEA 5AW5B 5BU8B 1H0TA 3IN6A 2E76D 4N3YB 1KMIZ 2E75D 2P2UA 4I7ZC 4U3FG 2YO2A 1SQVK 1PPJG 2C9LY 1N8RQ 1EXJA 4UB8H 1JTHA 1ZXGA 2HLOA 2ZT9C 3KHUA 3G9RA 3F89A 4H0LD 1LTJC 2CK3H 3A0BH 3RK3D 3CCVP 1K8AQ 1L0LK 2OYHC 3M91A 2FYUE 1JB0J 1KC8Q 2OYOA 1IO4A 1LP1B 2KI7B 2WT7B 1ZN5A 1RF1B 1XTGB 2RH0A 1LGHB 2E76B 2LR2A 3CL3D 3AE3C 3SFDC 3KDPB 1KYOI 1QGKB 1P84D 1MV8A 2NPSA 2ZYDA 3GG2A 3L75J 5CBOA 1L0LG 5CJ0A 2PRRA 2V7QH 1DH3A 1JY2N 2GUVA 3MTUE 3EWKA 3D6ZA 1N2DC 4LLHA 1SQVJ 5B66E 3VMZA 1GU5A 2FFDC 3H1HJ 5GTHH 4DJGA 4PD4I 2KIKA 1SQXJ 2QM8A 3MIWA 1S5LX 1A02F 1DEBA 1SQBD 1SQQG 3S1KA 4R4MA 4WY4C 1OIPA 1URQC 2QJYC 4UB6E 3CCMP 1ZMEC 4NPEA 4UB6H 2FYUD 3FWLA 3Q5PA 3CC4P 1S5LE 1JY3P 4M3LA 1X79B 2JO1A 5AVVB 4I6MC 5C39A 5AVZB 3H1HG 1Q7YQ 3CX5I 1NTZG 1RQUA 2Q3EA 4I2LC 5CCGA 3H1IE 2E76C 3FWNA 3AE7C 1FZCB 2E75C 1FZBA 2HPCA 2WPSA 1VQ8P 1GL2C 1JY2O 1K04A 1SQQK 3GF3A 2W90A 3L75G 4PD4H 2K88A 3TF5A 3TGUD 3USSA 1KTMA 4H44B 1W2EA 2AEJA 3VP8A 2AXTE 2HFED 1KILA 3PHLA 2FYUG 1S5LH 1SQPK 2WSCH 3SWFA 3A3YB 1SQXK 2GUSA 2LXBA 5APQA 1IFMA 2AXCA 4I7ZB 2I1JA 1PFIA 3S4RA 3CC7P 1J1DC 2WSEJ 1K73Q 2XKMA 3BCCE 1YJWP 1IFDA 1FDIA 2N1TA 2QJPB 3FGAD 1EQ7A 1EZVE 1JMMA 3BCCD 1WRGA 3PRJA 3H1JE 4UB8E 5CBNA 1LTBC 2O1JA 3GHGA 1SQPG 2WMMA 3PP5A 5TISE 4JBZA 3LW5J 5KTBA 1PP9G 2H88C 1G2CA 1WT6A 1SQQJ 1L0NK 2KP8A 2OARA 1L0NG 3U1CA 1VQNP 1L4AB 1M1KQ 1YHQP 1PGQA 1FZFA 3M9HA 1AQ5A 2IBZD 1G1JA 4LC1A 2W8ZA 4JQ0D 3L74G 1KB9I 1GW4A 1SQPJ 4EOTA 3CC2P 1SFCB 3TGUE 1GTWA 1VQOP 1OZHA 2BEZF 1JNMA 2YMKA 4BRYA 3A0BE 4C46A 3Q2YA 1SQXD 2QJYB 1NTME 3E1RA 1SQPD 2W6AA 3MHVA 1IFNA 1SVFA 2AXTH 3MP7B 1VQPP 1H89A 2K9JB 1Y8AA 2RMZA 4R4LA 1LWUA 1G1IA 2C0WA 3L74J 4GOEA 3TNUB 1JY3O 3H1LJ 1M8OB 1OW8A 3AEAC 1KFMA 3HTKA 2IFMA 2JJLA 2WVRA 4GKGA 4PD4E 3I55P 1NWQA 1PV3A 1BE3E 2DW3A 1L0NJ 1BCCJ 2FYNC 2XU6A 3HE4A 1SFCA 2IYOA 2QJKB 5AW6B 5TJHA 2D2CD 3N4XA 2L5GB 5KLIC 3TDKA 2PAJA 1WMKA 5AW9B 5KLVD 1YJ9P 1RE4A 2LKMA 2I1KA 2YXRB 3OA7A 3M9BA 4DCKA 3BRVB 1IC2A 2QJKC 4GIFA 3AE9C 1RE3A 1BCCG 1P84E 4H44D 1EZVG 1IZNB 4B86A 3TYYA 1QEXA 2ZXEB 3V4WA 3B8EB 2H43A 4RO0A 1EDJA 1GZLA 5KAIE 1SQBE 3AE2C 3BRTB 1KYOH 1P84I 3C9IA 4PJ0H 1AFOA 1Q81Q 2YIUB 3JSVC 2QA4P 1SLQA 2WSFJ 4PV1C 1YITP 1PL5A 1SQVG 1JCCA 1T3JA 3QWOC 1EZVI 2WSFH 4JYBA 2B88A 2N9YB 1LT1A 4AYCA 4D6TG 3AE1C 1VDFA 2PFXA 3A2AA 1ZR2A 2FFDB 3LIDA 5APYA 1L0LD 2OTKE 2YKQA 1BGYD 2XDJA 2JR8A 4ZKPA 5KAFE 2Q7CA 1YJNP 4PD4D 3QH9A 4HB1A 3VMXA 3L71G 3WU2E 1GW3A 1NTMJ 2HPCB 4DOJA 1GU4A 3HE5B 3L72G 1U7JA 1KB9H 4WY4B 4ZKUA 1FOSF 2K1AA 1NTMD 5CCGD 3H1IJ 3H1JG 3CXHH 4H13C 3OJAB 4ZMDA 3P32A 3CPWO 2P7JA 3PTZA 1S9KD 3CD6P 2N1TD 2QRXA 5BVZA 1FE6A 2QVAA 1S3JA 4BXLA 1KORA 2OYIB 2BCCE 3U1AA 3CX5D 1VQ9P 2BEQD 4H44C 4DT0A 1PP9D 2OTLP 1E79H 1FJPA 4OWFA 5APWA 1HH0A 1OW6A 1ZRTD 2MJZA 1JMBA 3CLQA 2W27A 1IJDB 3II6A 1NTMK 3H1JD 2OYIA 5AVXB 1NTZJ 1GD2E 2HR3A 2JEEA 1VF5B 1K05A 1RF1A 1ZP0C 3K5BA 1LNQA 2XV5A 3H1JJ 4D6TE 1X0TA 1URQB 4L73A 5KJ7A 3M06A 3LW5H 2KSEA 2FBWC 3AEGC 5AVRB 1USDA 1NTMG 3CXHI 4OGQD 3L71J 1KQSO 3V4QA 1SQVE 1FZCC 4U3FE 1OVVA 2A06E 1SFCD 3AE6C 4AQRD 1M1JA 3MD0A 2XNDH 3CCRP 1RE3C 2OGUA 2ZJSE 1KB9D 2FXMA 4YTPC 3H1ID 1R5SA 5AVUB 1VQ7P 1J1EB 1FJKA 4H13D 1N7SB 1NTZK 1Y47A 1HJBA 1FDMA 1SQBG 2KYVA 4WY4A 1AJYA 4L76A 3Q3DA 1HBWA 2M3EA 3L72J 1S1CX 2BCCG 1RH5B 2NZ2A 1M57D 3L73J 1UIIA 3RL0C 1R5LA 3VYIA 3RBZA 3RK2B 1BCCE 5B5EH 1FBMA 2WITA 1NKZB 2JWAA 3I5CA 4YXWH 4IFMA 1JY2P 1X8YA 5APUA 2K9YA 1SQXG 1H88A 5KLVK 4RESB 2B9BA 2R3SA 1BGYG 3GW6A 4HJGH 1L4AD 2ZFCA 4KHXA 2G8YA 1CI6A 2G3AA 3AE4C 4BRYB 4CPGA 3MGNA 1DIPA 2KS1B 4GODA 1MFZA 4EDFA 1PPJE 3AEBC 1M56D 2R44A 3L37A 4O9BA 1BSHA 2B89A 1H0TB 1JY3N 3AEDC 3IAOA 1N7SC 2NRGA 5AW0B 1KILD 3O8ZA 1YQ3C 1KZUB 1FZGA 1VQ6P 1RF0A 1LTAC 1NAFA 1VPCA 5KJ7D 1JOCA 5E79H 1SQQE 2Q1KA 3H1LD 3L35A 3L70J 3B71A 4HH2A 3GHGC 1L4AA 5AW3B 1RE4C 1CW5A 5KLVJ 1BE3J 3P8CE 2ZVOB 3H1HE 3EQ2A 2CPSA 1X22A 1L0ND 1NTKD 1BGYJ 1DD4A 3CCSP 3FX0A 2SPZA 3Q1MA 2Y9YA 2YNYA 4TLFA 1HTLC 2KOGA 1RQVA 3L74D 3BCCG 3H32B 1PIXA 3TSIA 1KYOD 4WY4D 1SS1A 3JC22 5AW8B 2IFNA 2IZ0A 2WZ7A 3L73E 5AW4B 3ITKA 1N73A 1KN7A 5AW7B 1S72P 1NHLA 2MKVA 2YMYA 3HD7D 1EDLA 2Y9ZA 2M5AB 3H1IG 4IFFA 1KD1Q 2QJPC 3A0HH 3H1KJ 3NMDA 4IL6X 4L74A 4EIJA 3V2NA 3L75D 1DD3A 3ABVC 1FU1A 1QX8A 3T97B 3S9OA 1G2CB 1MKMA 3AE5C 3HUSC 1KILC 1YYCA 1LT9A 1N7LA 2M8RA 4L75A 3AEFC 4IFDK 1NTZE 1M7LA 1LTJA 3SFEC 2OYHA 1W5CE 1HF9A 5KLVG 2WSCJ 1VL2A 4OH8B 3TGUG 1AVYA 5H2FE 2R32A 3O6QA 4JF7A 2N1TC 4KT0J 3V2QA 1LJ2A 1N73C 1ZV8A 4U7JA 1HVVA 3F5HA 3KZIH 3KZIE 3CX5H 2C9NY 3UIAA 2N1TB 2C0XA 2Z5HA 3V2RA 1LTSC 1NTKE 3H1KG 3R4YA 1Q90D 2D2CB 3EFFK 5M1BA 5L8RJ 1QL1A 2R5BA 1OFCX 1MFTA 2PP6A 1FS0E 2XZRA 1PGOA 2ZXXA 3P8CD 3V5BA 2WT7A 3MUDA 3PH0A 1VQ5P 5DJUB 3TK1A 1HJ0A 1LTTC 2WWWA 3H1LE 2E74C 2YKOA 3CWBE 3AEEC 1RF0C 3W67A 4N78E 3WUUA 1NH4A 2V7QJ 1FAVA 1HGVA 4W7ZA 2B87B 1VQ4P 1LTIC 1CSBA 2RKLA 2VRSA 3B5NB 2BCCJ 3L73G 3G3ZA 2OTJP 3L71D 2FFDA 3L70D 5CCHC 4OVNF 1XTCC 4PV1B 2K9JA 3TNUA 2BASA 2D2CC 4WVZA 3A5TA 2YIUC 5KKZB 2O3JA 2W83C 2KUBA 2QEXP 4U3FJ 1M90Q 2B87A 2HYNA 3D6YA 3GLMA 4IL6H 2GA1A 2W6JH 3VMYA 1KB9E 3MUDC 1ZW0A 1NTZD 5KKZC 2J58A 2QE7H 2CPBA 2R5DA 1OXZA 2I8DA 3WU2H 4Z1MH 1CI6B 2P67A 3FXEA 3RBXA 3RL0D 1VF5C 1Q82Q 2Y0EA 2QSIA 2XNXA 4HKZH 3CCLP 1JO5A 3SWYA 5APSA 1PP9J 3JCUH 3GHGB 2M5AA 2ZYGA 3AE8C 3RL0B 5BU5A 3OW2O 1NGMB 3KYQA 1YTZT 3PLNA 5AVWB 1M1JB 1YTZI 3L73D 1RY3A 4A7PA 1LT9C 4GT1A 1SP4A 2L91A 1KQFB 1SQVD 3BVHA 1FC2C 5KAIH 3MZWB 1ZLLA 1N7SA 1ZRTE 3AECC 4Y28J 2M3BA 4EI2A 2K37A 1H8AA 1LWUB 1IFPA 2KZJA 1R8EA 2M0BA 1YIJP 3D70A 5KJ7C 1NJIQ 1AQTA 4XA4A 4YXDC 4KJMA 3E7KA 5DJTB 4D6TD 4W7YA 4D6TJ 5CCGC 1Z56A 3CXHD 4I1LA 3CCUP 1S9KE 4H0LB 1GDTA 1N86A 1URQA 1IFIA 1URQD 1OVUA 2E42A 1NU1J 3E1IA 4IL6E 2ZAEB 3CMEP 2ZVNB 1VF5D 3FXDA 5AW2B 3WUVA 1L0LE 3SWKA 3CCJP 1JCDA 1PPJD 3CCQP 1Y9BA 2ITAA 3A0HE 3A7OA 2FY8A 1LP1A 1GL2A 2WPRA 1FOSE 1GL2D 2NPSB 4RKUJ 4W80A 2KLUA 5AW1B 3ZDMA 1JEKA 2Q6QA 2GM4A 1W2BO 4HYTB 2IDBA 1D7MA 5KLIB 1L2PA 2PGDA 5CCHA 5E79E 1X9VA 2KZIA 1BCCD 3H1LG
chains in the Genus database with same CATH topology
1KQLA 3HD7A 1MUUA 4N78D 1NU1K 3VOPA 2E43A 3NFQA 3CI9A 3L36A 3RK2C 1HWTC 3HE5A 3KQGA 1RF1C 3NXSA 3B5ND 3HRNA 1CZQA 2P1JA 3HD7B 2Q5UA 1T2KD 2A45G 3BATA 3EFGA 1MZ9A 2YO3A 3BASA 3IFMA 3VTPC 3B5NA 1NKNA 2KLVA 2O01H 4C7NA 3HUSA 2OYIC 1J1EC 1A02J 3V2PA 1SFCC 2H7HA 1GL2B 2J59M 2FYZA 5AVQB 5CCHD 3RK2D 3M0AA 4DZOA 1H88A 1DX7A 5AVTB 1T3UA 3B5NC 1J2JB 1FZEA 3H6PA 1M1JC 2A45I 3T97A 4JYCA 1NTKK 3M9QA 1OWAA 2W6BA 2N9BA 2HODA 2HG5D 3HUSB 3L4FA 5APTA 1LWUC 4N6JA 1NO4A 3KPEA 1L4AC 3M0DC 3IR9A 5AVSB 4WBAA 3HD7C 3VP9A 1FZAA 1T8ZA 1GK4A 2WSEH 1N73B 1GK6A 2FYUK 5CJ4A 2HODB 5APXA 1SQBK 1HUCA 2KB7P 4C7RA 3N7NA 3HTKB 4AUWA 3VN0A 2Q3IA 2Q9IA 1KILB 3NTNA 3M0DA 5CHXA 2NPSC 2IPPA 1NOHA 3U59A 2Z4EA 2R3CA 1JUNA 1FZCA 2FKWB 2WPQA 5CMZA 2O1KA 3H32A 1J1DB 2A45H 1KFNA 2YKPA 2QM7A 3RK3C 3P7KA 4Y99C 4LGDE 1QL2A 1N7SD 4Y99B 4WB4A 4C7NB 1HGZA 1JTHB 3HE4B 1E5WA 3OAKA 3P8MC 2IX7C 3LIEA 5AVYB 1LTJB 2OYHB 2H8PD 3WMM0 4XE5B 2POHA 1LT9B 1IK9A 3R2PA 2NPSD 3RK3B 2KSJA 2Z5IA 5APVA 1LTGC 1IFJA 1ZR4A 5AW5B 5BU8B 4N3YB 2P2UA 2C9LY 2YO2A 1SQVK 1JTHA 2HLOA 3RK3D 1LTJC 2OYHC 1L0LK 3M91A 1IO4A 2WT7B 1ZN5A 1RF1B 1XTGB 1LGHB 3CL3D 3KDPB 1MV8A 2NPSA 5CJ0A 1DH3A 1JY2N 2GUVA 3MTUE 1N2DC 4LLHA 3VMZA 1GU5A 2FFDC 2QM8A 1A02F 3MIWA 1DEBA 4WY4C 1URQC 1JY3P 4M3LA 1X79B 5AVVB 4I6MC 5AVZB 1FZCB 4I2LC 5CCGA 1FZBA 2HPCA 2WPSA 1GL2C 1JY2O 1SQQK 1W2EA 3SWFA 2HFED 1KILA 1SQPK 2WSCH 3A3YB 1SQXK 2GUSA 5APQA 1IFMA 2I1JA 1J1DC 2XKMA 1IFDA 2N1TA 1JMMA 1EQ7A 1WRGA 1LTBC 2O1JA 3GHGA 3PP5A 5KTBA 1G2CA 1L0NK 1WT6A 2KP8A 2OARA 3U1CA 1L4AB 1FZFA 3M9HA 1AQ5A 1G1JA 4LC1A 4EOTA 1GW4A 1SFCB 1GTWA 4C46A 2W6AA 1IFNA 1SVFA 1H89A 3TNUB 1GDTA 1LWUA 1G1IA 2C0WA 1JY3O 3HTKA 1KFMA 4GKGA 2IFMA 2JJLA 2XU6A 3HE4A 1SFCA 2WTYA 5AW6B 3N4XA 2L5GB 1NWQA 2PAJA 5AW9B 1RE4A 2LKMA 2I1KA 3OA7A 3M9BA 3BRVB 1IC2A 4GIFA 1RE3A 4B86A 3TYYA 2ZXEB 3V4WA 3B8EB 2H43A 1GZLA 3BRTB 3C9IA 1AFOA 1SLQA 1T3JA 1JCCA 1JNMA 2WSFH 4JYBA 4AYCA 1VDFA 3A2AA 1ZR2A 2FFDB 3LIDA 5APYA 4ZKPA 2YKQA 2XDJA 2Q7CA 2HPCB 3VMXA 1GW3A 4DOJA 1GU4A 3HE5B 4WY4B 4ZKUA 5CCGD 1S9KD 3OJAB 3P32A 2P7JA 2N1TD 5BVZA 2OYIB 3U1AA 1FJPA 5APWA 1HH0A 2MJZA 3CLQA 2W27A 1IJDB 3II6A 1NTMK 2OYIA 5AVXB 1GD2E 2JEEA 1RF1A 2XV5A 1URQB 5KJ7A 3M06A 3LW5H 5AVRB 3V4QA 1FZCC 1SFCD 4AQRD 1M1JA 3MD0A 1RE3C 2FXMA 5AVUB 1J1EB 1FJKA 1N7SB 1NTZK 1HJBA 1FDMA 2KYVA 4WY4A 1HBWA 3RL0C 1T2KC 1PFIA 3VYIA 3RK2B 1FBMA 2WITA 1NKZB 3I5CA 4IFMA 1JY2P 1X8YA 5APUA 5KLVK 4RESB 1L4AD 2ZFCA 4KHXA 1CI6A 3MGNA 1MFZA 4O9BA 3L37A 1JY3N 1N7SC 5AW0B 1KILD 3O8ZA 1KZUB 1FZGA 1RF0A 1LTAC 1NAFA 1VPCA 5KJ7D 1JOCA 3L35A 4HH2A 3GHGC 1L4AA 5AW3B 1RE4C 1CW5A 3P8CE 3EQ2A 2CPSA 2YNYA 1HTLC 2KOGA 3H32B 3TSIA 4WY4D 5AW8B 2IFNA 2WZ7A 5AW4B 1N73A 5AW7B 1NHLA 2YMYA 3HD7D 4IFFA 3NMDA 4EIJA 3V2NA 1FU1A 1G2CB 3HUSC 1KILC 1YYCA 1LT9A 1N7LA 2M8RA 4IFDK 1M7LA 1LTJA 2OYHA 4OH8B 2R32A 4JF7A 2N1TC 3V2QA 1N73C 1ZV8A 1HVVA 2C9NY 3UIAA 2N1TB 2C0XA 2Z5HA 3V2RA 1LTSC 3VP8A 1QL1A 2R5BA 3V5BA 2PP6A 2XZRA 3P8CD 2WT7A 3MUDA 3TK1A 2WWWA 1LTTC 2YKOA 1RF0C 4N78E 1NH4A 1FAVA 1HGVA 4W7ZA 1LTIC 1CSBA 3B5NB 2VRSA 3G3ZA 2FFDA 5CCHC 1XTCC 3TNUA 2BASA 3A5TA 2HYNA 2J58A 2CPBA 2R5DA 1OXZA 1CI6B 2P67A 3RL0D 2XNXA 1JO5A 3SWYA 5APSA 3GHGB 3RL0B 5BU5A 3KYQA 1YTZT 5AVWB 1M1JB 1YTZI 1RY3A 1LT9C 4GT1A 1SP4A 3BVHA 1ZLLA 1N7SA 1H8AA 2M3BA 1LWUB 5KJ7C 4XA4A 4W7YA 5CCGC 1Z56A 4I1LA 1S9KE 1N86A 1URQA 1IFIA 1URQD 2E42A 3E1IA 5AW2B 1JCDA 3A7OA 1GL2A 2WPRA 1FOSE 1GL2D 2NPSB 4W80A 5AW1B 2GM4A 4HYTB 5CCHA 1FOSF 1X9VA 3VMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU1 K;  1SQP K;  2WSC H;  1NTZ K;  1SQX K;  2WSF H;  2J59 M;  3CLQ A;  1NTM K;  2WSE H;  4IFD K;  2FYU K;  1SQV K;  2LKM A;  3G3Z A;  5KLV K;  1L0N K;  1SQB K;  2OAR A;  3LW5 H;  1NTK K;  1L0L K;  3M9Q A;  1SQQ K;  2O01 H; 
#chains in the Genus database with same CATH topology
 1KQL A;  3HD7 A;  1BGY E;  1MUU A;  1AA0 A;  4N78 D;  1GMJ A;  2P58 A;  2Y0D A;  1NU1 K;  2QG4 A;  3CWB D;  3VOP A;  3NFQ A;  2FXO A;  3D71 A;  2E43 A;  3CI9 A;  3L36 A;  3RK2 C;  2IZ1 A;  1HWT C;  1T2K C;  1VQL P;  3HE5 A;  3KQG A;  1RF1 C;  3NXS A;  2H89 C;  3RL0 g;  1QLE D;  3B5N D;  1VQM P;  3VMA A;  1P84 H;  1K9M Q;  3HRN A;  1CZQ A;  2O01 N;  2AEF A;  3JCU E;  1YI2 P;  2KS1 A;  2P1J A;  3HD7 B;  2Q5U A;  2A06 G;  2ZT9 B;  1T2K D;  2KXP B;  2A45 G;  1EDK A;  5H2F H;  1QVF O;  3B4S A;  4RJT A;  3BAT A;  1NAY A;  3EFG A;  3CXH E;  1MZ9 A;  2YO3 A;  3RK3 E;  3BAS A;  3IFM A;  3VTP C;  3B5N A;  2ZT9 D;  1NKN A;  3L70 G;  1PGJ A;  1S2E A;  1JM0 A;  2KLV A;  4H0L C;  2O01 H;  1Q2N A;  1PGP A;  1NVO A;  2Y0C A;  3RGU A;  2A06 D;  2E74 D;  3HUS A;  1BE3 D;  1J1E C;  4C7N A;  2OYI C;  4ASV A;  1A02 J;  3L74 E;  1SFC C;  3V2P A;  2H7H A;  1GL2 B;  4MN4 C;  2J59 M;  2FYZ A;  2WQY C;  3CWB J;  5AVQ B;  3C8V A;  4NPF X;  5B66 H;  1L0N E;  2IYP A;  5CCH D;  1BDC A;  3TGU J;  2IBZ I;  1EZV D;  3M0A A;  3RK2 D;  4DZO A;  2YXQ B;  5TIS H;  3CMA P;  2WSS H;  5AVT B;  5K5G B;  1OX3 A;  1DX7 A;  4EYY Q;  1T3U A;  1BDD A;  2K3R A;  2KK7 A;  3B5N C;  1T6A A;  2JKV A;  1U57 A;  1KYO E;  1J2J B;  1FZE A;  1KQG B;  3H6P A;  1M1J C;  3IF4 A;  2A45 I;  4YPC A;  3T97 A;  1RHZ B;  1NTK K;  4JYC A;  4BWN A;  3M9Q A;  5KAF H;  1OWA A;  2FYU J;  3H1K D;  2QIW A;  2W6B A;  1KIL E;  2N9B A;  1BSN A;  1FDO A;  2HOD A;  1S4X A;  2HG5 D;  3HUS B;  2KNC B;  1TU3 F;  3CX5 E;  1SQB J;  3L4F A;  4PV1 D;  5APT A;  1EDI A;  1LWU C;  3H1H D;  4N6J A;  4XFJ A;  1NO4 A;  1YBK A;  1L4A C;  2UWJ E;  3KPE A;  2WTY A;  1BE3 G;  3M0D C;  1Q86 Q;  1AV1 A;  4QMA A;  3L72 D;  3IR9 A;  5AVS B;  3H25 A;  3I56 P;  1SQQ D;  3L70 E;  4WBA A;  3HD7 C;  2P10 A;  3L71 E;  4IOI H;  4K3A A;  4PJ0 E;  3VP9 A;  1FZA A;  5GTI E;  3Q5S A;  1IK7 A;  1NU1 E;  2J5U A;  1EC5 A;  1T8Z A;  1GK4 A;  2WSE H;  3BCC J;  3GMA A;  4H13 B;  3G4S P;  1N73 B;  1GK6 A;  1NTK J;  2FYU K;  5CJ4 A;  2AEM A;  2JDI H;  2HOD B;  5APX A;  1VQK P;  1KV4 A;  1SQB K;  1HUC A;  2RN0 A;  2KB7 P;  2V4H A;  4OGQ B;  3N7N A;  3HTK B;  4C7R A;  2FYN B;  3VN0 A;  2Q3I A;  1OW7 A;  4JPZ B;  2Q9I A;  1KIL B;  3NTN A;  2E74 B;  2IBZ G;  3M0D A;  5CHX A;  5B5E E;  2OQQ A;  2NPS C;  5KLV E;  3G71 P;  2IPP A;  1NOH A;  3U59 A;  4ASW A;  2E5Y A;  2Z4E A;  2R3C A;  3GF7 A;  2JP3 A;  1FZC A;  2FKW B;  1JUN A;  2WPQ A;  1NU1 D;  2JWD A;  3PJS K;  5CMZ A;  4ZNC A;  5GTH E;  2ZYA A;  2O1K A;  3G6E P;  3H32 A;  1J1D B;  1NYH A;  2A45 H;  1KFN A;  3V6I A;  3L72 E;  2YKP A;  2QM7 A;  3RK3 C;  1PZQ A;  3P7K A;  4TT3 H;  4Y99 C;  1OVR A;  4LGD E;  4NPD A;  4OGQ C;  2LXC B;  4U3F D;  3CWB G;  3L75 E;  1QL2 A;  1N7S D;  1NU1 G;  4AUW A;  4Y99 B;  1NTK G;  3H1K E;  3KXD A;  1OMI A;  3C1L A;  2E5T A;  4WB4 A;  4C7N B;  4WWI A;  2BCC D;  5EFW B;  1ZOY C;  1HGZ A;  1SQP E;  1JTH B;  1SQX E;  3HE4 B;  1E5W A;  3OAK A;  3P8M C;  1AVO A;  2IX7 C;  4K35 A;  2WPV B;  1L0L J;  1UIX A;  3LIE A;  1LTJ B;  5AVY B;  2H8P D;  2OYH B;  3WMM 0;  4XE5 B;  2KNC A;  2O01 J;  1LT9 B;  2IBZ E;  1IK9 A;  2POH A;  3R2P A;  4GOF A;  3SSU A;  1QVG O;  2FXP A;  2NPS D;  4GDO A;  1DEE G;  3O6Q B;  3RK3 B;  2KSJ A;  2Z5I A;  5APV A;  3W68 A;  1LTG C;  1PP9 E;  1IFJ A;  1U7M A;  2E75 B;  5GTI H;  3Q5R A;  1EXI A;  3CCE P;  1YQ4 C;  1ZR4 A;  3WUT A;  1USE A;  5AW5 B;  5BU8 B;  1H0T A;  3IN6 A;  2E76 D;  4N3Y B;  1KMI Z;  2E75 D;  2P2U A;  4I7Z C;  4U3F G;  2YO2 A;  1SQV K;  1PPJ G;  2C9L Y;  1N8R Q;  1EXJ A;  4UB8 H;  1JTH A;  1ZXG A;  2HLO A;  2ZT9 C;  3KHU A;  3G9R A;  3F89 A;  4H0L D;  1LTJ C;  2CK3 H;  3A0B H;  3RK3 D;  3CCV P;  1K8A Q;  1L0L K;  2OYH C;  3M91 A;  2FYU E;  1JB0 J;  1KC8 Q;  2OYO A;  1IO4 A;  1LP1 B;  2KI7 B;  2WT7 B;  1ZN5 A;  1RF1 B;  1XTG B;  2RH0 A;  1LGH B;  2E76 B;  2LR2 A;  3CL3 D;  3AE3 C;  3SFD C;  3KDP B;  1KYO I;  1QGK B;  1P84 D;  1MV8 A;  2NPS A;  2ZYD A;  3GG2 A;  3L75 J;  5CBO A;  1L0L G;  5CJ0 A;  2PRR A;  2V7Q H;  1DH3 A;  1JY2 N;  2GUV A;  3MTU E;  3EWK A;  3D6Z A;  1N2D C;  4LLH A;  1SQV J;  5B66 E;  3VMZ A;  1GU5 A;  2FFD C;  3H1H J;  5GTH H;  4DJG A;  4PD4 I;  2KIK A;  1SQX J;  2QM8 A;  3MIW A;  1S5L X;  1A02 F;  1DEB A;  1SQB D;  1SQQ G;  3S1K A;  4R4M A;  4WY4 C;  1OIP A;  1URQ C;  2QJY C;  4UB6 E;  3CCM P;  1ZME C;  4NPE A;  4UB6 H;  2FYU D;  3FWL A;  3Q5P A;  3CC4 P;  1S5L E;  1JY3 P;  4M3L A;  1X79 B;  2JO1 A;  5AVV B;  4I6M C;  5C39 A;  5AVZ B;  3H1H G;  1Q7Y Q;  3CX5 I;  1NTZ G;  1RQU A;  2Q3E A;  4I2L C;  5CCG A;  3H1I E;  2E76 C;  3FWN A;  3AE7 C;  1FZC B;  2E75 C;  1FZB A;  2HPC A;  2WPS A;  1VQ8 P;  1GL2 C;  1JY2 O;  1K04 A;  1SQQ K;  3GF3 A;  2W90 A;  3L75 G;  4PD4 H;  2K88 A;  3TF5 A;  3TGU D;  3USS A;  1KTM A;  4H44 B;  1W2E A;  2AEJ A;  3VP8 A;  2AXT E;  2HFE D;  1KIL A;  3PHL A;  2FYU G;  1S5L H;  1SQP K;  2WSC H;  3SWF A;  3A3Y B;  1SQX K;  2GUS A;  2LXB A;  5APQ A;  1IFM A;  2AXC A;  4I7Z B;  2I1J A;  1PFI A;  3S4R A;  3CC7 P;  1J1D C;  2WSE J;  1K73 Q;  2XKM A;  3BCC E;  1YJW P;  1IFD A;  1FDI A;  2N1T A;  2QJP B;  3FGA D;  1EQ7 A;  1EZV E;  1JMM A;  3BCC D;  1WRG A;  3PRJ A;  3H1J E;  4UB8 E;  5CBN A;  1LTB C;  2O1J A;  3GHG A;  1SQP G;  2WMM A;  3PP5 A;  5TIS E;  4JBZ A;  3LW5 J;  5KTB A;  1PP9 G;  2H88 C;  1G2C A;  1WT6 A;  1SQQ J;  1L0N K;  2KP8 A;  2OAR A;  1L0N G;  3U1C A;  1VQN P;  1L4A B;  1M1K Q;  1YHQ P;  1PGQ A;  1FZF A;  3M9H A;  1AQ5 A;  2IBZ D;  1G1J A;  4LC1 A;  2W8Z A;  4JQ0 D;  3L74 G;  1KB9 I;  1GW4 A;  1SQP J;  4EOT A;  3CC2 P;  1SFC B;  3TGU E;  1GTW A;  1VQO P;  1OZH A;  2BEZ F;  1JNM A;  2YMK A;  4BRY A;  3A0B E;  4C46 A;  3Q2Y A;  1SQX D;  2QJY B;  1NTM E;  3E1R A;  1SQP D;  2W6A A;  3MHV A;  1IFN A;  1SVF A;  2AXT H;  3MP7 B;  1VQP P;  1H89 A;  2K9J B;  1Y8A A;  2RMZ A;  4R4L A;  1LWU A;  1G1I A;  2C0W A;  3L74 J;  4GOE A;  3TNU B;  1JY3 O;  3H1L J;  1M8O B;  1OW8 A;  3AEA C;  1KFM A;  3HTK A;  2IFM A;  2JJL A;  2WVR A;  4GKG A;  4PD4 E;  3I55 P;  1NWQ A;  1PV3 A;  1BE3 E;  2DW3 A;  1L0N J;  1BCC J;  2FYN C;  2XU6 A;  3HE4 A;  1SFC A;  2IYO A;  2QJK B;  5AW6 B;  5TJH A;  2D2C D;  3N4X A;  2L5G B;  5KLI C;  3TDK A;  2PAJ A;  1WMK A;  5AW9 B;  5KLV D;  1YJ9 P;  1RE4 A;  2LKM A;  2I1K A;  2YXR B;  3OA7 A;  3M9B A;  4DCK A;  3BRV B;  1IC2 A;  2QJK C;  4GIF A;  3AE9 C;  1RE3 A;  1BCC G;  1P84 E;  4H44 D;  1EZV G;  1IZN B;  4B86 A;  3TYY A;  1QEX A;  2ZXE B;  3V4W A;  3B8E B;  2H43 A;  4RO0 A;  1EDJ A;  1GZL A;  5KAI E;  1SQB E;  3AE2 C;  3BRT B;  1KYO H;  1P84 I;  3C9I A;  4PJ0 H;  1AFO A;  1Q81 Q;  2YIU B;  3JSV C;  2QA4 P;  1SLQ A;  2WSF J;  4PV1 C;  1YIT P;  1PL5 A;  1SQV G;  1JCC A;  1T3J A;  3QWO C;  1EZV I;  2WSF H;  4JYB A;  2B88 A;  2N9Y B;  1LT1 A;  4AYC A;  4D6T G;  3AE1 C;  1VDF A;  2PFX A;  3A2A A;  1ZR2 A;  2FFD B;  3LID A;  5APY A;  1L0L D;  2OTK E;  2YKQ A;  1BGY D;  2XDJ A;  2JR8 A;  4ZKP A;  5KAF E;  2Q7C A;  1YJN P;  4PD4 D;  3QH9 A;  4HB1 A;  3VMX A;  3L71 G;  3WU2 E;  1GW3 A;  1NTM J;  2HPC B;  4DOJ A;  1GU4 A;  3HE5 B;  3L72 G;  1U7J A;  1KB9 H;  4WY4 B;  4ZKU A;  1FOS F;  2K1A A;  1NTM D;  5CCG D;  3H1I J;  3H1J G;  3CXH H;  4H13 C;  3OJA B;  4ZMD A;  3P32 A;  3CPW O;  2P7J A;  3PTZ A;  1S9K D;  3CD6 P;  2N1T D;  2QRX A;  5BVZ A;  1FE6 A;  2QVA A;  1S3J A;  4BXL A;  1KOR A;  2OYI B;  2BCC E;  3U1A A;  3CX5 D;  1VQ9 P;  2BEQ D;  4H44 C;  4DT0 A;  1PP9 D;  2OTL P;  1E79 H;  1FJP A;  4OWF A;  5APW A;  1HH0 A;  1OW6 A;  1ZRT D;  2MJZ A;  1JMB A;  3CLQ A;  2W27 A;  1IJD B;  3II6 A;  1NTM K;  3H1J D;  2OYI A;  5AVX B;  1NTZ J;  1GD2 E;  2HR3 A;  2JEE A;  1VF5 B;  1K05 A;  1RF1 A;  1ZP0 C;  3K5B A;  1LNQ A;  2XV5 A;  3H1J J;  4D6T E;  1X0T A;  1URQ B;  4L73 A;  5KJ7 A;  3M06 A;  3LW5 H;  2KSE A;  2FBW C;  3AEG C;  5AVR B;  1USD A;  1NTM G;  3CXH I;  4OGQ D;  3L71 J;  1KQS O;  3V4Q A;  1SQV E;  1FZC C;  4U3F E;  1OVV A;  2A06 E;  1SFC D;  3AE6 C;  4AQR D;  1M1J A;  3MD0 A;  2XND H;  3CCR P;  1RE3 C;  2OGU A;  2ZJS E;  1KB9 D;  2FXM A;  4YTP C;  3H1I D;  1R5S A;  5AVU B;  1VQ7 P;  1J1E B;  1FJK A;  4H13 D;  1N7S B;  1NTZ K;  1Y47 A;  1HJB A;  1FDM A;  1SQB G;  2KYV A;  4WY4 A;  1AJY A;  4L76 A;  3Q3D A;  1HBW A;  2M3E A;  3L72 J;  1S1C X;  2BCC G;  1RH5 B;  2NZ2 A;  1M57 D;  3L73 J;  1UII A;  3RL0 C;  1R5L A;  3VYI A;  3RBZ A;  3RK2 B;  1BCC E;  5B5E H;  1FBM A;  2WIT A;  1NKZ B;  2JWA A;  3I5C A;  4YXW H;  4IFM A;  1JY2 P;  1X8Y A;  5APU A;  2K9Y A;  1SQX G;  1H88 A;  5KLV K;  4RES B;  2B9B A;  2R3S A;  1BGY G;  3GW6 A;  4HJG H;  1L4A D;  2ZFC A;  4KHX A;  2G8Y A;  1CI6 A;  2G3A A;  3AE4 C;  4BRY B;  4CPG A;  3MGN A;  1DIP A;  2KS1 B;  4GOD A;  1MFZ A;  4EDF A;  1PPJ E;  3AEB C;  1M56 D;  2R44 A;  3L37 A;  4O9B A;  1BSH A;  2B89 A;  1H0T B;  1JY3 N;  3AED C;  3IAO A;  1N7S C;  2NRG A;  5AW0 B;  1KIL D;  3O8Z A;  1YQ3 C;  1KZU B;  1FZG A;  1VQ6 P;  1RF0 A;  1LTA C;  1NAF A;  1VPC A;  5KJ7 D;  1JOC A;  5E79 H;  1SQQ E;  2Q1K A;  3H1L D;  3L35 A;  3L70 J;  3B71 A;  4HH2 A;  3GHG C;  1L4A A;  5AW3 B;  1RE4 C;  1CW5 A;  5KLV J;  1BE3 J;  3P8C E;  2ZVO B;  3H1H E;  3EQ2 A;  2CPS A;  1X22 A;  1L0N D;  1NTK D;  1BGY J;  1DD4 A;  3CCS P;  3FX0 A;  2SPZ A;  3Q1M A;  2Y9Y A;  2YNY A;  4TLF A;  1HTL C;  2KOG A;  1RQV A;  3L74 D;  3BCC G;  3H32 B;  1PIX A;  3TSI A;  1KYO D;  4WY4 D;  1SS1 A;  3JC2 2;  5AW8 B;  2IFN A;  2IZ0 A;  2WZ7 A;  3L73 E;  5AW4 B;  3ITK A;  1N73 A;  1KN7 A;  5AW7 B;  1S72 P;  1NHL A;  2MKV A;  2YMY A;  3HD7 D;  1EDL A;  2Y9Z A;  2M5A B;  3H1I G;  4IFF A;  1KD1 Q;  2QJP C;  3A0H H;  3H1K J;  3NMD A;  4IL6 X;  4L74 A;  4EIJ A;  3V2N A;  3L75 D;  1DD3 A;  3ABV C;  1FU1 A;  1QX8 A;  3T97 B;  3S9O A;  1G2C B;  1MKM A;  3AE5 C;  3HUS C;  1KIL C;  1YYC A;  1LT9 A;  1N7L A;  2M8R A;  4L75 A;  3AEF C;  4IFD K;  1NTZ E;  1M7L A;  1LTJ A;  3SFE C;  2OYH A;  1W5C E;  1HF9 A;  5KLV G;  2WSC J;  1VL2 A;  4OH8 B;  3TGU G;  1AVY A;  5H2F E;  2R32 A;  3O6Q A;  4JF7 A;  2N1T C;  4KT0 J;  3V2Q A;  1LJ2 A;  1N73 C;  1ZV8 A;  4U7J A;  1HVV A;  3F5H A;  3KZI H;  3KZI E;  3CX5 H;  2C9N Y;  3UIA A;  2N1T B;  2C0X A;  2Z5H A;  3V2R A;  1LTS C;  1NTK E;  3H1K G;  3R4Y A;  1Q90 D;  2D2C B;  3EFF K;  5M1B A;  5L8R J;  1QL1 A;  2R5B A;  1OFC X;  1MFT A;  2PP6 A;  1FS0 E;  2XZR A;  1PGO A;  2ZXX A;  3P8C D;  3V5B A;  2WT7 A;  3MUD A;  3PH0 A;  1VQ5 P;  5DJU B;  3TK1 A;  1HJ0 A;  1LTT C;  2WWW A;  3H1L E;  2E74 C;  2YKO A;  3CWB E;  3AEE C;  1RF0 C;  3W67 A;  4N78 E;  3WUU A;  1NH4 A;  2V7Q J;  1FAV A;  1HGV A;  4W7Z A;  2B87 B;  1VQ4 P;  1LTI C;  1CSB A;  2RKL A;  2VRS A;  3B5N B;  2BCC J;  3L73 G;  3G3Z A;  2OTJ P;  3L71 D;  2FFD A;  3L70 D;  5CCH C;  4OVN F;  1XTC C;  4PV1 B;  2K9J A;  3TNU A;  2BAS A;  2D2C C;  4WVZ A;  3A5T A;  2YIU C;  5KKZ B;  2O3J A;  2W83 C;  2KUB A;  2QEX P;  4U3F J;  1M90 Q;  2B87 A;  2HYN A;  3D6Y A;  3GLM A;  4IL6 H;  2GA1 A;  2W6J H;  3VMY A;  1KB9 E;  3MUD C;  1ZW0 A;  1NTZ D;  5KKZ C;  2J58 A;  2QE7 H;  2CPB A;  2R5D A;  1OXZ A;  2I8D A;  3WU2 H;  4Z1M H;  1CI6 B;  2P67 A;  3FXE A;  3RBX A;  3RL0 D;  1VF5 C;  1Q82 Q;  2Y0E A;  2QSI A;  2XNX A;  4HKZ H;  3CCL P;  1JO5 A;  3SWY A;  5APS A;  1PP9 J;  3JCU H;  3GHG B;  2M5A A;  2ZYG A;  3AE8 C;  3RL0 B;  5BU5 A;  3OW2 O;  1NGM B;  3KYQ A;  1YTZ T;  3PLN A;  5AVW B;  1M1J B;  1YTZ I;  3L73 D;  1RY3 A;  4A7P A;  1LT9 C;  4GT1 A;  1SP4 A;  2L91 A;  1KQF B;  1SQV D;  3BVH A;  1FC2 C;  5KAI H;  3MZW B;  1ZLL A;  1N7S A;  1ZRT E;  3AEC C;  4Y28 J;  2M3B A;  4EI2 A;  2K37 A;  1H8A A;  1LWU B;  1IFP A;  2KZJ A;  1R8E A;  2M0B A;  1YIJ P;  3D70 A;  5KJ7 C;  1NJI Q;  1AQT A;  4XA4 A;  4YXD C;  4KJM A;  3E7K A;  5DJT B;  4D6T D;  4W7Y A;  4D6T J;  5CCG C;  1Z56 A;  3CXH D;  4I1L A;  3CCU P;  1S9K E;  4H0L B;  1GDT A;  1N86 A;  1URQ A;  1IFI A;  1URQ D;  1OVU A;  2E42 A;  1NU1 J;  3E1I A;  4IL6 E;  2ZAE B;  3CME P;  2ZVN B;  1VF5 D;  3FXD A;  5AW2 B;  3WUV A;  1L0L E;  3SWK A;  3CCJ P;  1JCD A;  1PPJ D;  3CCQ P;  1Y9B A;  2ITA A;  3A0H E;  3A7O A;  2FY8 A;  1LP1 A;  1GL2 A;  2WPR A;  1FOS E;  1GL2 D;  2NPS B;  4RKU J;  4W80 A;  2KLU A;  5AW1 B;  3ZDM A;  1JEK A;  2Q6Q A;  2GM4 A;  1W2B O;  4HYT B;  2IDB A;  1D7M A;  5KLI B;  1L2P A;  2PGD A;  5CCH A;  5E79 E;  1X9V A;  2KZI A;  1BCC D;  3H1L G; 
#chains in the Genus database with same CATH homology
 1KQL A;  3HD7 A;  1MUU A;  4N78 D;  1NU1 K;  3VOP A;  2E43 A;  3NFQ A;  3CI9 A;  3L36 A;  3RK2 C;  1HWT C;  3HE5 A;  3KQG A;  1RF1 C;  3NXS A;  3B5N D;  3HRN A;  1CZQ A;  2P1J A;  3HD7 B;  2Q5U A;  1T2K D;  2A45 G;  3BAT A;  3EFG A;  1MZ9 A;  2YO3 A;  3BAS A;  3IFM A;  3VTP C;  3B5N A;  1NKN A;  2KLV A;  2O01 H;  4C7N A;  3HUS A;  2OYI C;  1J1E C;  1A02 J;  3V2P A;  1SFC C;  2H7H A;  1GL2 B;  2J59 M;  2FYZ A;  5AVQ B;  5CCH D;  3RK2 D;  3M0A A;  4DZO A;  1H88 A;  1DX7 A;  5AVT B;  1T3U A;  3B5N C;  1J2J B;  1FZE A;  3H6P A;  1M1J C;  2A45 I;  3T97 A;  4JYC A;  1NTK K;  3M9Q A;  1OWA A;  2W6B A;  2N9B A;  2HOD A;  2HG5 D;  3HUS B;  3L4F A;  5APT A;  1LWU C;  4N6J A;  1NO4 A;  3KPE A;  1L4A C;  3M0D C;  3IR9 A;  5AVS B;  4WBA A;  3HD7 C;  3VP9 A;  1FZA A;  1T8Z A;  1GK4 A;  2WSE H;  1N73 B;  1GK6 A;  2FYU K;  5CJ4 A;  2HOD B;  5APX A;  1SQB K;  1HUC A;  2KB7 P;  4C7R A;  3N7N A;  3HTK B;  4AUW A;  3VN0 A;  2Q3I A;  2Q9I A;  1KIL B;  3NTN A;  3M0D A;  5CHX A;  2NPS C;  2IPP A;  1NOH A;  3U59 A;  2Z4E A;  2R3C A;  1JUN A;  1FZC A;  2FKW B;  2WPQ A;  5CMZ A;  2O1K A;  3H32 A;  1J1D B;  2A45 H;  1KFN A;  2YKP A;  2QM7 A;  3RK3 C;  3P7K A;  4Y99 C;  4LGD E;  1QL2 A;  1N7S D;  4Y99 B;  4WB4 A;  4C7N B;  1HGZ A;  1JTH B;  3HE4 B;  1E5W A;  3OAK A;  3P8M C;  2IX7 C;  3LIE A;  5AVY B;  1LTJ B;  2OYH B;  2H8P D;  3WMM 0;  4XE5 B;  2POH A;  1LT9 B;  1IK9 A;  3R2P A;  2NPS D;  3RK3 B;  2KSJ A;  2Z5I A;  5APV A;  1LTG C;  1IFJ A;  1ZR4 A;  5AW5 B;  5BU8 B;  4N3Y B;  2P2U A;  2C9L Y;  2YO2 A;  1SQV K;  1JTH A;  2HLO A;  3RK3 D;  1LTJ C;  2OYH C;  1L0L K;  3M91 A;  1IO4 A;  2WT7 B;  1ZN5 A;  1RF1 B;  1XTG B;  1LGH B;  3CL3 D;  3KDP B;  1MV8 A;  2NPS A;  5CJ0 A;  1DH3 A;  1JY2 N;  2GUV A;  3MTU E;  1N2D C;  4LLH A;  3VMZ A;  1GU5 A;  2FFD C;  2QM8 A;  1A02 F;  3MIW A;  1DEB A;  4WY4 C;  1URQ C;  1JY3 P;  4M3L A;  1X79 B;  5AVV B;  4I6M C;  5AVZ B;  1FZC B;  4I2L C;  5CCG A;  1FZB A;  2HPC A;  2WPS A;  1GL2 C;  1JY2 O;  1SQQ K;  1W2E A;  3SWF A;  2HFE D;  1KIL A;  1SQP K;  2WSC H;  3A3Y B;  1SQX K;  2GUS A;  5APQ A;  1IFM A;  2I1J A;  1J1D C;  2XKM A;  1IFD A;  2N1T A;  1JMM A;  1EQ7 A;  1WRG A;  1LTB C;  2O1J A;  3GHG A;  3PP5 A;  5KTB A;  1G2C A;  1L0N K;  1WT6 A;  2KP8 A;  2OAR A;  3U1C A;  1L4A B;  1FZF A;  3M9H A;  1AQ5 A;  1G1J A;  4LC1 A;  4EOT A;  1GW4 A;  1SFC B;  1GTW A;  4C46 A;  2W6A A;  1IFN A;  1SVF A;  1H89 A;  3TNU B;  1GDT A;  1LWU A;  1G1I A;  2C0W A;  1JY3 O;  3HTK A;  1KFM A;  4GKG A;  2IFM A;  2JJL A;  2XU6 A;  3HE4 A;  1SFC A;  2WTY A;  5AW6 B;  3N4X A;  2L5G B;  1NWQ A;  2PAJ A;  5AW9 B;  1RE4 A;  2LKM A;  2I1K A;  3OA7 A;  3M9B A;  3BRV B;  1IC2 A;  4GIF A;  1RE3 A;  4B86 A;  3TYY A;  2ZXE B;  3V4W A;  3B8E B;  2H43 A;  1GZL A;  3BRT B;  3C9I A;  1AFO A;  1SLQ A;  1T3J A;  1JCC A;  1JNM A;  2WSF H;  4JYB A;  4AYC A;  1VDF A;  3A2A A;  1ZR2 A;  2FFD B;  3LID A;  5APY A;  4ZKP A;  2YKQ A;  2XDJ A;  2Q7C A;  2HPC B;  3VMX A;  1GW3 A;  4DOJ A;  1GU4 A;  3HE5 B;  4WY4 B;  4ZKU A;  5CCG D;  1S9K D;  3OJA B;  3P32 A;  2P7J A;  2N1T D;  5BVZ A;  2OYI B;  3U1A A;  1FJP A;  5APW A;  1HH0 A;  2MJZ A;  3CLQ A;  2W27 A;  1IJD B;  3II6 A;  1NTM K;  2OYI A;  5AVX B;  1GD2 E;  2JEE A;  1RF1 A;  2XV5 A;  1URQ B;  5KJ7 A;  3M06 A;  3LW5 H;  5AVR B;  3V4Q A;  1FZC C;  1SFC D;  4AQR D;  1M1J A;  3MD0 A;  1RE3 C;  2FXM A;  5AVU B;  1J1E B;  1FJK A;  1N7S B;  1NTZ K;  1HJB A;  1FDM A;  2KYV A;  4WY4 A;  1HBW A;  3RL0 C;  1T2K C;  1PFI A;  3VYI A;  3RK2 B;  1FBM A;  2WIT A;  1NKZ B;  3I5C A;  4IFM A;  1JY2 P;  1X8Y A;  5APU A;  5KLV K;  4RES B;  1L4A D;  2ZFC A;  4KHX A;  1CI6 A;  3MGN A;  1MFZ A;  4O9B A;  3L37 A;  1JY3 N;  1N7S C;  5AW0 B;  1KIL D;  3O8Z A;  1KZU B;  1FZG A;  1RF0 A;  1LTA C;  1NAF A;  1VPC A;  5KJ7 D;  1JOC A;  3L35 A;  4HH2 A;  3GHG C;  1L4A A;  5AW3 B;  1RE4 C;  1CW5 A;  3P8C E;  3EQ2 A;  2CPS A;  2YNY A;  1HTL C;  2KOG A;  3H32 B;  3TSI A;  4WY4 D;  5AW8 B;  2IFN A;  2WZ7 A;  5AW4 B;  1N73 A;  5AW7 B;  1NHL A;  2YMY A;  3HD7 D;  4IFF A;  3NMD A;  4EIJ A;  3V2N A;  1FU1 A;  1G2C B;  3HUS C;  1KIL C;  1YYC A;  1LT9 A;  1N7L A;  2M8R A;  4IFD K;  1M7L A;  1LTJ A;  2OYH A;  4OH8 B;  2R32 A;  4JF7 A;  2N1T C;  3V2Q A;  1N73 C;  1ZV8 A;  1HVV A;  2C9N Y;  3UIA A;  2N1T B;  2C0X A;  2Z5H A;  3V2R A;  1LTS C;  3VP8 A;  1QL1 A;  2R5B A;  3V5B A;  2PP6 A;  2XZR A;  3P8C D;  2WT7 A;  3MUD A;  3TK1 A;  2WWW A;  1LTT C;  2YKO A;  1RF0 C;  4N78 E;  1NH4 A;  1FAV A;  1HGV A;  4W7Z A;  1LTI C;  1CSB A;  3B5N B;  2VRS A;  3G3Z A;  2FFD A;  5CCH C;  1XTC C;  3TNU A;  2BAS A;  3A5T A;  2HYN A;  2J58 A;  2CPB A;  2R5D A;  1OXZ A;  1CI6 B;  2P67 A;  3RL0 D;  2XNX A;  1JO5 A;  3SWY A;  5APS A;  3GHG B;  3RL0 B;  5BU5 A;  3KYQ A;  1YTZ T;  5AVW B;  1M1J B;  1YTZ I;  1RY3 A;  1LT9 C;  4GT1 A;  1SP4 A;  3BVH A;  1ZLL A;  1N7S A;  1H8A A;  2M3B A;  1LWU B;  5KJ7 C;  4XA4 A;  4W7Y A;  5CCG C;  1Z56 A;  4I1L A;  1S9K E;  1N86 A;  1URQ A;  1IFI A;  1URQ D;  2E42 A;  3E1I A;  5AW2 B;  1JCD A;  3A7O A;  1GL2 A;  2WPR A;  1FOS E;  1GL2 D;  2NPS B;  4W80 A;  5AW1 B;  2GM4 A;  4HYT B;  5CCH A;  1FOS F;  1X9V A;  3VMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...