1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
3CLQA 2WSFH 3M9QA 1NU1K 2OARA 2WSEH 1L0NK 2J59M 2WSCH 1NTZK 2O01H 5KLVK 4IFDK 2LKMA 1NTMK 1SQQK 1NTKK 3LW5H 1SQVK 2FYUK 1L0LK 1SQXK 1SQBK 1SQPK 3G3ZA
chains in the Genus database with same CATH superfamily
3BATA 3GHGA 2OYOA 1LT9A 2RN0A 5AW5B 5B66E 4Y28J 1BSHA 4B86A 3HUSA 4H44D 4D6TD 2KS1B 3MUDC 3GLMA 1S72P 2QA4P 3PLNA 3H32A 1FZFA 2I8DA 3QWOC 1SQBG 1IJDB 2IYOA 1SP4A 4W7ZA 2O1JA 3TGUE 4C7NB 2FYUD 3ITKA 2FFDA 1ZRTD 1S4XA 2HFED 1SQVK 2Y9YA 3AEGC 3E1IA 1DX7A 4WB4A 2QM8A 2C9LY 1KILA 1UIXA 1PP9G 1SQVD 3F89A 4PD4E 4PD4D 5DJUB 3CMAP 1LWUC 4GOFA 2P67A 4IL6H 1VQOP 1Y47A 3L73G 1GMJA 1X8YA 1T3JA 2Z5IA 3A0BH 1SQXK 2FYNC 2NZ2A 4IL6E 4UB6E 1PPJE 1UIIA 5TJHA 4ZMDA 1KILB 3MHVA 3CC2P 1EC5A 3PP5A 1LTIC 2AXTH 1SQVE 3L70J 2BEZF 3GF3A 2A06G 3L73J 2WSCJ 3S9OA 3HD7A 2OARA 1VDFA 2E74B 1EZVE 1SS1A 2ZXXA 3CWBE 1N7LA 4HKZH 1FZCC 1KILC 3AECC 1OWAA 4W80A 1SQXG 2BCCG 3G6EP 4GKGA 4IFFA 1OW8A 3HD7C 3L72E 1QL1A 1GW3A 4DCKA 1MKMA 3H25A 1GD2E 2YXQB 3A7OA 1P84E 1KYOE 5EFWB 3CCLP 2FYUG 3E1RA 5KAFH 3RK2B 1VQ9P 1KQFB 3H1HJ 3HUSC 2Q5UA 4UB8H 1SQBD 3C1LA 1N73B 3A3YB 1VQ4P 1G2CB 1BCCJ 2KLVA 3M0AA 1KMIZ 2XV5A 2PAJA 2IYPA 3VTPC 5AW2B 4LGDE 2M3BA 2BCCD 1YBKA 2QSIA 1EZVI 2KNCA 3KDPB 4N78E 4DOJA 2H43A 3CC7P 3L75D 3C8VA 4YPCA 5AVYB 2IFNA 5GTIE 1KFMA 5B5EH 3SWKA 2H89C 4KJMA 5APQA 3TNUA 3BCCJ 3Q1MA 2HYNA 2WSCH 3M0DA 3Q5SA 5APXA 1DEBA 3CX5H 4YXWH 1KYOI 1ZLLA 1LNQA 2WPQA 4JYCA 1GTWA 2KNCB 2SPZA 2XDJA 2QJPB 3B5ND 1VQ8P 1JM0A 1OW7A 3G9RA 4C7NA 3M9BA 1VQKP 1XTGB 2QEXP 4U3FD 4L74A 4YTPC 1YQ3C 3EQ2A 3V4WA 1Z56A 2KUBA 2P10A 3P8CD 5APWA 1YJWP 1NTZE 1L4AC 1RE3C 3A0HH 3CCJP 3NFQA 2CPSA 2N1TD 3PRJA 2W6AA 3VMXA 1URQD 3A5TA 3GF7A 3A2AA 3IN6A 3H1LD 3RL0C 3V2PA 1JMBA 2XKMA 4JF7A 1LGHB 1S5LX 4AYCA 3JSVC 4BWNA 3U1CA 3SWYA 3AEEC 1YQ4C 3H1KE 3BVHA 1E79H 1K04A 1OW6A 3WUUA 2FYUJ 4PD4H 1RE4C 3I55P 3L4FA 1LTTC 3HD7B 3JCUE 4L75A 2ZT9B 5TISE 4DT0A 3L74E 1NTMD 1W2BO 1SQQD 1ZR4A 2E42A 5CCHC 3BCCE 1EXJA 4IFDK 1NTMK 1JEKA 1GL2A 5APTA 4U3FJ 1RE4A 2HLOA 2WT7B 3LW5J 4NPFX 1VQ5P 1EXIA 4KHXA 3USSA 3RK3B 2Q6QA 4HYTB 1FJKA 4WWIA 5AW6B 4LLHA 1K9MQ 3H1HG 1SQQE 1N86A 1OMIA 4H0LC 1H88A 2P58A 4ASVA 5KAIH 1L0NG 5DJTB 2XNDH 3W67A 5BU8B 1KQLA 1M7LA 1T8ZA 1VQPP 2PFXA 4D6TJ 2M3EA 2E75B 2YMKA 3L71E 3L75E 2JDIH 2N1TB 3LIEA 1PGPA 1JCDA 1VF5C 3U59A 4RESB 2K37A 3PH0A 3D71A 3L72J 1JY3O 4QMAA 4WY4B 3V2RA 2FXPA 2ZYGA 4BRYA 3RK2C 2D2CC 1HGZA 1HF9A 1NHLA 1QL2A 2QJKC 1JO5A 1L0ND 2H88C 3IR9A 2E75C 2NPSA 3O6QA 4IL6X 1KC8Q 4H13C 3BASA 3BRTB 4ASWA 1J1EB 1W2EA 2LKMA 3H1HD 4A7PA 1AQ5A 4K3AA 4L76A 3C9IA 2Q3IA 1KB9E 4C7RA 1S1CX 2Z4EA 3H1IG 1K8AQ 1ZOYC 2A06E 1T3UA 2GUVA 2XNXA 3AE6C 4M3LA 3SSUA 4ZKPA 1BE3G 1U57A 1PPJD 1RF0C 4LC1A 5KLVG 5E79E 1SQPD 4TLFA 3R4YA 2MKVA 3RK3E 3TK1A 5AVVB 1HTLC 1SQXE 1M8OB 1SQPK 2R3CA 3KPEA 3S4RA 5GTHE 2QRXA 3BCCD 2HPCB 2OYHC 1BSNA 2KYVA 2YNYA 3L72D 1IK7A 1M1JA 1NU1G 2V7QH 1KD1Q 2K9YA 3AE9C 2OTLP 2A45G 2K9JB 2O01N 3UIAA 5B66H 5M1BA 2A45H 1NTZD 3H1LG 2WSEH 2C0XA 1ZW0A 3HE4A 4I7ZB 3RBXA 2KZIA 4H44B 3L74D 1CZQA 1BGYD 3HTKA 2OGUA 1M1JB 1VQ7P 1FU1A 1LTJC 3IAOA 1KQGB 1T2KD 1BDCA 1K73Q 1K05A 2JJLA 1RQUA 1MUUA 1JTHA 4U3FG 1NTKD 2POHA 4ZKUA 3OW2O 2QJPC 3H1JJ 1S9KE 2AEJA 3KHUA 1USEA 2FXMA 2WPRA 3P32A 1PV3A 1MV8A 3MZWB 2OYHA 4BXLA 3R2PA 1IFJA 2IBZD 1FZCB 3MGNA 5CBOA 3KZIH 2OYIB 1AVOA 2WPVB 1WMKA 2E75D 2FYZA 1GZLA 3CWBJ 3NTNA 3SFDC 3NMDA 5AVTB 4WVZA 1RF1C 2D2CD 2IZ1A 1M56D 4HJGH 2QJYC 5AW8B 1L2PA 2JP3A 2WSFH 1DD4A 3H1KJ 2N9BA 3L75G 2H7HA 1KN7A 3II6A 2YKQA 1ZP0C 3AE4C 1QEXA 2KSJA 1AQTA 1OVUA 3CI9A 4Z1MH 3CL3D 3CC4P 2FKWB 3CWBG 2E43A 2QG4A 2Y0DA 2IDBA 3EFGA 4N78D 1DIPA 2OTKE 1VF5B 2O1KA 5KAIE 1URQA 1S3JA 3VMAA 3O6QB 3AE3C 3WU2E 2AXCA 2FYUK 3FXEA 3L71J 2YMYA 2WVRA 4WY4C 1KYOH 1AV1A 1FZAA 3QH9A 4OWFA 5L8RJ 5AW4B 1GW4A 3MTUE 2ZYDA 3HE4B 2RKLA 1FBMA 1AA0A 1SQQJ 4I1LA 3CWBD 5AW9B 1CI6A 3RK2D 3VMYA 1YJNP 1HUCA 1NAYA 5AW0B 1PGJA 1SQXD 2Q3EA 3TF5A 4U7JA 2Y0CA 5KLIC 1Q7YQ 2YO2A 4UB6H 2HODA 3EWKA 5CCGA 1Y9BA 3HRNA 2I1JA 3P8MC 4NPDA 1FE6A 1G1IA 5B5EE 1VQMP 1AFOA 5CMZA 2A06D 2AXTE 3FXDA 3MD0A 1WT6A 1NU1J 3AE1C 1PP9E 1PIXA 3TGUD 1EZVD 2E74D 2IBZG 2QE7H 1H89A 1JNMA 1YIJP 2ZXEB 1FDMA 1KZUB 1URQC 3AE5C 5APVA 2YXRB 3D6ZA 1L4AD 3L73D 3TSIA 3VN0A 1RF1B 1QVGO 3L35A 1L0LD 3FWLA 3HTKB 1N73A 1PP9D 1RHZB 1SQVG 1YTZT 5CCHD 1VQNP 1L0LK 1S9KD 2I1KA 5CCGC 1BGYG 1MFZA 1SQBK 3A0HE 1PGOA 3CXHI 1N73C 3B8EB 4JBZA 5AVUB 1NTZG 2FBWC 2OQQA 2BCCE 1PFIA 1NTZJ 1NKNA 2BEQD 2W83C 3M91A 3L75J 1NU1D 3RL0D 2Q7CA 3L72G 4D6TG 1OIPA 2ZT9D 1NU1K 2KK7A 2WSFJ 3KQGA 4WY4A 1S5LH 3B4SA 3L36A 1KV4A 1AJYA 1H0TA 1SQPG 1FDIA 3P8CE 2KB7P 2A45I 3S1KA 1BE3D 2AEMA 3GHGB 4MN4C 1P84I 2O01H 5KLVD 3WUTA 5H2FE 4C46A 2FYNB 1EDIA 3H1ID 1PP9J 3GW6A 1YTZI 2B9BA 2GM4A 1Q90D 3IFMA 3ABVC 1NGMB 1A02J 1VQ6P 4EI2A 1N8RQ 4EYYQ 2ZFCA 4K35A 2R3SA 3W68A 1OXZA 1GU4A 1M1JC 1SFCA 1NYHA 1BDDA 1J2JB 3V2NA 3O8ZA 1IFDA 3H1HE 3CCRP 3D6YA 5CJ0A 1Q2NA 3AEBC 4EIJA 3I56P 5KAFE 1KILD 3CCSP 3CCVP 1RY3A 4YXDC 1SFCB 2WSEJ 1YHQP 3M9QA 1PGQA 4H0LB 2P7JA 1M1KQ 2YO3A 2J58A 4IFMA 1MFTA 1KQSO 1YYCA 2FFDC 1FZEA 4Y99B 5CJ4A 1QGKB 2Y0EA 1SQQK 1FC2C 1N2DC 2PRRA 1OX3A 3PTZA 2O01J 2GUSA 3KXDA 1SQVJ 2JR8A 3P7KA 4EDFA 1KTMA 3Q2YA 3D70A 3HD7D 1KB9H 4L73A 5AVXB 4DJGA 3CCUP 3H6PA 2C9NY 1USDA 1NTMG 3CX5E 3LIDA 4Y99C 5E79H 3OA7A 5AVZB 1J1EC 3TGUG 3VP9A 1R8EA 2D2CB 1BE3E 5KLVE 1FJPA 1U7MA 2QJKB 1JY2P 1KORA 2ZAEB 1GL2B 2NRGA 5GTHH 3CCEP 2WMMA 5KLIB 2LR2A 3H1JE 2WTYA 2ITAA 2AEFA 5KKZC 1M90Q 1P84H 2JEEA 4H44C 2YIUB 5AVQB 2HR3A 4PV1B 2K9JA 1BCCE 2J59M 1ZXGA 1WRGA 1FZBA 1LTJB 2KS1A 3B71A 3M06A 3VYIA 5KTBA 1GL2C 1HVVA 1IO4A 2R5DA 3FGAD 1L0LG 1RF1A 2FY8A 1FOSE 3CD6P 3SFEC 1ZR2A 2M8RA 4XFJA 2YIUC 3ZDMA 5CCGD 1JY2O 4RJTA 2OYIA 3AE2C 3CXHD 3L71G 1H8AA 1EDJA 5KJ7A 1LTBC 2N9YB 4U3FE 3JCUH 2WPSA 3GHGC 1GU5A 1SQXJ 2IFMA 2JKVA 2K3RA 2O3JA 1HH0A 2W8ZA 3MIWA 1Q81Q 3RK3D 1X0TA 2G8YA 2IZ0A 4I6MC 1M57D 2LXCB 3KZIE 2V4HA 2ZT9C 4O9BA 4WBAA 2K88A 4XE5B 1L0LJ 1NKZB 3N7NA 3L70E 1LJ2A 1L4AA 1KB9D 1LWUB 1RE3A 2G3AA 2IBZI 2Q1KA 2ZVNB 3CXHE 3L70D 3PHLA 1P84D 3VP8A 1CW5A 1ZMEC 2W90A 2E5YA 4I2LC 1SLQA 4GODA 2WZ7A 5CCHA 3H1IJ 2LXBA 1NTZK 3WMM0 1JTHB 5CBNA 3G4SP 2B89A 3V5BA 3HE5A 3I5CA 1N7SD 1QX8A 1LT9C 2R32A 3OJAB 3RL0g 2K1AA 1JY3N 1OVRA 1ZV8A 1VPCA 2KP8A 1XTCC 2WSSH 4PJ0H 1NTKE 2P2UA 4N6JA 5BVZA 1Q86Q 3TGUJ 4WY4D 2CK3H 4D6TE 3A0BE 1HJ0A 1JMMA 2KXPB 3AE7C 2E74C 4HH2A 3L37A 1BCCD 4OGQB 1SQPJ 1JB0J 2WT7A 2C0WA 3Q3DA 2V7QJ 1RH5B 3OAKA 2WITA 5AVWB 1D7MA 1NAFA 2OYIC 2JWAA 3H1JD 1TU3F 1EZVG 1QLED 3CLQA 4NPEA 1X9VA 3TYYA 3V4QA 3RGUA 1YITP 1FZGA 2DW3A 1LP1A 2M5AA 3V6IA 3H1JG 2QJYB 4OGQC 1HGVA 2XZRA 1PZQA 1SFCD 2B87A 3L74J 3M0DC 1MZ9A 1BGYJ 1BCCG 2Z5HA 2RH0A 1ZRTE 1PL5A 2FYUE 1IFMA 2FFDB 4DZOA 1CI6B 4OVNF 4TT3H 1S2EA 5CHXA 1YJ9P 2OTJP 4BRYB 2VRSA 3FWNA 4GDOA 4JPZB 4GOEA 4AQRD 3L74G 2IX7C 4GT1A 3G71P 1NJIQ 2KSEA 2MJZA 4N3YB 2NPSD 4RO0A 3HUSB 2E76B 2YKPA 4PV1C 5KJ7C 2HODB 4R4MA 1ZN5A 4I7ZC 4OH8B 3CMEP 1BGYE 1IFIA 1LTAC 3CX5I 3F5HA 1SVFA 1URQB 3CCQP 3VOPA 2H8PD 2KI7B 3T97A 3AEAC 2W27A 1KILE 3N4XA 2E76D 3L73E 3U1AA 3V2QA 1JY2N 3MP7B 3RBZA 4JYBA 3L70G 1LTJA 1U7JA 1YI2P 1PPJG 1QVFO 1VQLP 1L0NJ 2FXOA 1NTMJ 1NTME 3NXSA 1CSBA 1G1JA 2HPCA 1HBWA 3B5NB 1VL2A 2PGDA 1HWTC 2L91A 2NPSC 3LW5H 4HB1A 4AUWA 1FZCA 2B88A 2R44A 3L71D 3AEFC 3HE5B 1T2KC 5AVSB 1HJBA 1GK6A 5AW7B 3FX0A 1DEEG 3KYQA 1NTKG 4RKUJ 5AW1B 5K5GB 1FOSF 1IFNA 1LTGC 4PD4I 1LT9B 1KB9I 1IC2A 1NVOA 4W7YA 2WQYC 1IFPA 2CPBA 2IBZE 1SQBJ 2QVAA 4H13D 1L4AB 1LWUA 2KLUA 4PJ0E 2WWWA 2E76C 1SFCC 3G3ZA 5KKZB 3SWFA 1Q82Q 2J5UA 1JCCA 3H1KG 3H1IE 5BU5A 1J1DC 4OGQD 4ZNCA 2OYHB 2RMZA 1H0TB 3PJSK 1SQBE 1AVYA 1EDKA 1NH4A 4PV1D 4R4LA 1W5CE 5APSA 5KJ7D 5AVRB 1L0NK 3WUVA 3TNUB 5TISH 1OFCX 1LP1B 2M5AB 2XU6A 2ZJSE 3BCCG 3IF4A 2L5GB 5GTIH 3MUDA 5KLVK 1NOHA 1R5SA 2PP6A 1NU1E 2JO1A 2P1JA 2YKOA 2GA1A 3GG2A 4XA4A 3VMZA 1N7SB 3CCMP 1A02F 3H1LE 2NPSB 1RQVA 1FDOA 2Y9ZA 1SQQG 4JQ0D 1RF0A 1DD3A 2W6BA 1E5WA 3H32B 2JWDA 1L0NE 4EOTA 2QIWA 2Q9IA 3K5BA 2QM7A 1LT1A 4CPGA 3GMAA 4GIFA 1SQPE 3JC22 3RL0B 5APUA 2KOGA 1Y8AA 2M0BA 1N7SA 2IPPA 1VF5D 1T6AA 2UWJE 3B5NA 3M9HA 4H13B 3WU2H 3H1KD 4UB8E 1OVVA 1DH3A 1NTKJ 1J1DB 5APYA 2BCCJ 1X79B 1FS0E 1X22A 2W6JH 3EFFK 4H0LD 1JOCA 5C39A 1NWQA 2ZYAA 3TDKA 3AE8C 1LTSC 1FAVA 2N1TA 1BE3J 5KLVJ 2ZVOB 2N1TC 3Q5PA 1EQ7A 1GDTA 3RK3C 1NTKK 1JUNA 2R5BA 1NO4A 1EDLA 1S5LE 1L0LE 2HG5D 3BRVB 1JY3P 1KFNA 2E5TA 1KYOD 3H1LJ 3Q5RA 1GK4A 1N7SC 1IZNB 2B87B 1G2CA 1IK9A 2BASA 2KZJA 3CPWO 1OZHA 3CX5D 2KIKA 3E7KA 4IOIH 5AW3B 1R5LA 5H2FH 3B5NC 4KT0J 3AEDC 3T97B 1GL2D 3CXHH
chains in the Genus database with same CATH topology
3BATA 3GHGA 1LT9A 5AW5B 4B86A 3HUSA 3H32A 1FZFA 1IJDB 1SP4A 4W7ZA 2O1JA 4C7NB 2FFDA 1DX7A 2HFED 1SQVK 3E1IA 4WB4A 2QM8A 2C9LY 1KILA 1LWUC 2P67A 1X8YA 1T3JA 2Z5IA 1SQXK 1KILB 3PP5A 1LTIC 3HD7A 2OARA 1VDFA 1FZCC 1N7LA 1KILC 1OWAA 4W80A 4GKGA 4IFFA 3HD7C 1QL1A 1GW3A 1GD2E 3A7OA 3RK2B 3HUSC 2Q5UA 1N73B 3A3YB 1G2CB 2KLVA 3M0AA 2XV5A 2PAJA 3VTPC 5AW2B 4LGDE 2M3BA 3KDPB 4DOJA 4N78E 2H43A 5AVYB 2IFNA 1KFMA 5APQA 3TNUA 2HYNA 3M0DA 2WSCH 5APXA 1DEBA 1ZLLA 2WPQA 4JYCA 1GTWA 2XDJA 3B5ND 4C7NA 3M9BA 1XTGB 3V4WA 3EQ2A 1Z56A 3P8CD 5APWA 1L4AC 1RE3C 3NFQA 2CPSA 2N1TD 2W6AA 3VMXA 1URQD 3A5TA 3A2AA 3RL0C 3V2PA 2XKMA 4JF7A 1LGHB 4AYCA 3U1CA 3SWYA 3BVHA 1RE4C 3L4FA 1LTTC 3HD7B 2E42A 1ZR4A 5CCHC 4IFDK 1NTMK 5APTA 1GL2A 2WT7B 1RE4A 2HLOA 4KHXA 3RK3B 4HYTB 1FJKA 5AW6B 4LLHA 1N86A 1H88A 5BU8B 1KQLA 1M7LA 1T8ZA 2N1TB 3LIEA 1JCDA 3U59A 4RESB 1RF1C 4AUWA 3V2RA 1JY3O 4WY4B 3RK2C 1HGZA 1NHLA 1QL2A 1JO5A 3IR9A 2NPSA 3BASA 3BRTB 1J1EB 1W2EA 2LKMA 1AQ5A 3C9IA 2Q3IA 4C7RA 2Z4EA 2XNXA 1T3UA 2GUVA 4M3LA 4ZKPA 1RF0C 4LC1A 5AVVB 1HTLC 1SQPK 3KPEA 2R3CA 2HPCB 2OYHC 2KYVA 2YNYA 1M1JA 2A45G 3UIAA 2A45H 2WSEH 2C0XA 3HE4A 1CZQA 3HTKA 1M1JB 1FU1A 1LTJC 1T2KD 2JJLA 1MUUA 1JTHA 4ZKUA 2POHA 1S9KE 2FXMA 2WPRA 3P32A 1MV8A 2OYHA 3R2PA 1IFJA 1FZCB 3MGNA 2OYIB 3NTNA 2FYZA 1GZLA 3NMDA 5AVTB 5AW8B 2WSFH 2N9BA 2H7HA 3II6A 2YKQA 2KSJA 3CI9A 3CL3D 2FKWB 2E43A 3EFGA 4N78D 2O1KA 1URQA 2FYUK 2YMYA 4WY4C 1FZAA 5AW4B 1GW4A 3MTUE 3HE4B 4I1LA 1FBMA 3RK2D 5AW9B 1CI6A 3VMYA 1HUCA 5AW0B 2YO2A 2HODA 5CCGA 3HRNA 1AFOA 2I1JA 3P8MC 1G1IA 5CMZA 3MD0A 1WT6A 1H89A 1JNMA 2ZXEB 1FDMA 1KZUB 1URQC 5APVA 1L4AD 3TSIA 3VN0A 1RF1B 3L35A 3HTKB 1N73A 5CCHD 1YTZT 1L0LK 1S9KD 2I1KA 5CCGC 1MFZA 1SQBK 1N73C 3B8EB 5AVUB 1PFIA 3M91A 1NKNA 3RL0D 2Q7CA 1NU1K 3KQGA 4WY4A 3L36A 3P8CE 2KB7P 2A45I 3TK1A 3GHGB 2O01H 4C46A 1YTZI 2GM4A 3IFMA 2ZFCA 1OXZA 1GU4A 1M1JC 1SFCA 1J2JB 3V2NA 3O8ZA 1IFDA 5CJ0A 4EIJA 1KILD 1RY3A 1SFCB 3M9QA 2P7JA 2YO3A 2J58A 4IFMA 1YYCA 2FFDC 1FZEA 4Y99B 5CJ4A 1SQQK 1N2DC 2GUSA 3P7KA 3HD7D 5AVXB 3H6PA 2C9NY 5AVZB 3VP9A 3LIDA 4Y99C 3OA7A 1J1EC 1FJPA 1JY2P 1GL2B 2WTYA 2JEEA 5AVQB 1A02J 2J59M 3M06A 1CW5A 1WRGA 1FZBA 1LTJB 5KTBA 3VYIA 1GL2C 1HVVA 1IO4A 2R5DA 1RF1A 1FOSE 1ZR2A 2M8RA 5CCGD 1JY2O 2OYIA 1H8AA 5KJ7A 1LTBC 1GU5A 2WPSA 3GHGC 2IFMA 1HH0A 3MIWA 3RK3D 4I6MC 4O9BA 4WBAA 4XE5B 1NKZB 3N7NA 1L4AA 1LWUB 1RE3A 3VP8A 5CCHA 4I2LC 1SLQA 2WZ7A 1NTZK 3WMM0 1JTHB 3V5BA 3HE5A 3I5CA 1N7SD 1LT9C 2R32A 3OJAB 1JY3N 1ZV8A 1VPCA 2KP8A 1XTCC 5BVZA 2P2UA 4N6JA 4WY4D 1JMMA 4HH2A 3L37A 2WT7A 2C0WA 5AVWB 3OAKA 2WITA 1NAFA 2OYIC 3TYYA 3CLQA 1X9VA 3V4QA 1FZGA 1HGVA 2XZRA 1SFCD 3M0DC 1MZ9A 2Z5HA 1IFMA 2FFDB 4DZOA 1CI6B 5CHXA 2VRSA 4AQRD 2IX7C 4GT1A 2MJZA 4N3YB 2NPSD 3HUSB 2YKPA 5KJ7C 2HODB 1ZN5A 4OH8B 1IFIA 1LTAC 1SVFA 1URQB 3VOPA 2H8PD 3T97A 2W27A 3U1AA 3N4XA 3V2QA 1JY2N 4JYBA 1LTJA 1HBWA 3NXSA 2HPCA 1CSBA 1G1JA 3B5NB 1HWTC 2NPSC 3LW5H 1FZCA 3HE5B 1T2KC 5AVSB 1HJBA 1GK6A 5AW7B 3KYQA 5AW1B 1FOSF 1IFNA 1LTGC 4W7YA 1LT9B 1IC2A 2CPBA 1L4AB 1LWUA 2WWWA 1SFCC 3G3ZA 3SWFA 1JCCA 5BU5A 1J1DC 2OYHB 1NH4A 5KJ7D 5APSA 5AVRB 1L0NK 3TNUB 2XU6A 2L5GB 3MUDA 5KLVK 1NOHA 2PP6A 2YKOA 4XA4A 2P1JA 3VMZA 1N7SB 1A02F 2NPSB 1RF0A 2W6BA 1E5WA 3H32B 4EOTA 2Q9IA 2QM7A 4GIFA 3RL0B 5APUA 2KOGA 3B5NA 1N7SA 2IPPA 3M9HA 1DH3A 1J1DB 5APYA 1X79B 1NWQA 1JOCA 1LTSC 1FAVA 2N1TA 2N1TC 1EQ7A 1GDTA 3RK3C 1NTKK 1JUNA 2R5BA 1NO4A 2HG5D 3BRVB 1JY3P 1KFNA 1GK4A 1N7SC 2BASA 1G2CA 1IK9A 5AW3B 3B5NC 1GL2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLQ A;  2WSF H;  3M9Q A;  1NU1 K;  2OAR A;  2WSE H;  1L0N K;  2J59 M;  2WSC H;  1NTZ K;  2O01 H;  5KLV K;  4IFD K;  2LKM A;  1NTM K;  1SQQ K;  1NTK K;  3LW5 H;  1SQV K;  2FYU K;  1L0L K;  1SQX K;  1SQB K;  1SQP K;  3G3Z A; 
#chains in the Genus database with same CATH topology
 3BAT A;  3GHG A;  2OYO A;  1LT9 A;  2RN0 A;  5AW5 B;  5B66 E;  4Y28 J;  1BSH A;  4B86 A;  3HUS A;  4H44 D;  4D6T D;  2KS1 B;  3MUD C;  3GLM A;  1S72 P;  2QA4 P;  3PLN A;  3H32 A;  1FZF A;  2I8D A;  3QWO C;  1SQB G;  1IJD B;  2IYO A;  1SP4 A;  4W7Z A;  2O1J A;  3TGU E;  4C7N B;  2FYU D;  3ITK A;  2FFD A;  1ZRT D;  1S4X A;  2HFE D;  1SQV K;  2Y9Y A;  3AEG C;  3E1I A;  1DX7 A;  4WB4 A;  2QM8 A;  2C9L Y;  1KIL A;  1UIX A;  1PP9 G;  1SQV D;  3F89 A;  4PD4 E;  4PD4 D;  5DJU B;  3CMA P;  1LWU C;  4GOF A;  2P67 A;  4IL6 H;  1VQO P;  1Y47 A;  3L73 G;  1GMJ A;  1X8Y A;  1T3J A;  2Z5I A;  3A0B H;  1SQX K;  2FYN C;  2NZ2 A;  4IL6 E;  4UB6 E;  1PPJ E;  1UII A;  5TJH A;  4ZMD A;  1KIL B;  3MHV A;  3CC2 P;  1EC5 A;  3PP5 A;  1LTI C;  2AXT H;  1SQV E;  3L70 J;  2BEZ F;  3GF3 A;  2A06 G;  3L73 J;  2WSC J;  3S9O A;  3HD7 A;  2OAR A;  1VDF A;  2E74 B;  1EZV E;  1SS1 A;  2ZXX A;  3CWB E;  1N7L A;  4HKZ H;  1FZC C;  1KIL C;  3AEC C;  1OWA A;  4W80 A;  1SQX G;  2BCC G;  3G6E P;  4GKG A;  4IFF A;  1OW8 A;  3HD7 C;  3L72 E;  1QL1 A;  1GW3 A;  4DCK A;  1MKM A;  3H25 A;  1GD2 E;  2YXQ B;  3A7O A;  1P84 E;  1KYO E;  5EFW B;  3CCL P;  2FYU G;  3E1R A;  5KAF H;  3RK2 B;  1VQ9 P;  1KQF B;  3H1H J;  3HUS C;  2Q5U A;  4UB8 H;  1SQB D;  3C1L A;  1N73 B;  3A3Y B;  1VQ4 P;  1G2C B;  1BCC J;  2KLV A;  3M0A A;  1KMI Z;  2XV5 A;  2PAJ A;  2IYP A;  3VTP C;  5AW2 B;  4LGD E;  2M3B A;  2BCC D;  1YBK A;  2QSI A;  1EZV I;  2KNC A;  3KDP B;  4N78 E;  4DOJ A;  2H43 A;  3CC7 P;  3L75 D;  3C8V A;  4YPC A;  5AVY B;  2IFN A;  5GTI E;  1KFM A;  5B5E H;  3SWK A;  2H89 C;  4KJM A;  5APQ A;  3TNU A;  3BCC J;  3Q1M A;  2HYN A;  2WSC H;  3M0D A;  3Q5S A;  5APX A;  1DEB A;  3CX5 H;  4YXW H;  1KYO I;  1ZLL A;  1LNQ A;  2WPQ A;  4JYC A;  1GTW A;  2KNC B;  2SPZ A;  2XDJ A;  2QJP B;  3B5N D;  1VQ8 P;  1JM0 A;  1OW7 A;  3G9R A;  4C7N A;  3M9B A;  1VQK P;  1XTG B;  2QEX P;  4U3F D;  4L74 A;  4YTP C;  1YQ3 C;  3EQ2 A;  3V4W A;  1Z56 A;  2KUB A;  2P10 A;  3P8C D;  5APW A;  1YJW P;  1NTZ E;  1L4A C;  1RE3 C;  3A0H H;  3CCJ P;  3NFQ A;  2CPS A;  2N1T D;  3PRJ A;  2W6A A;  3VMX A;  1URQ D;  3A5T A;  3GF7 A;  3A2A A;  3IN6 A;  3H1L D;  3RL0 C;  3V2P A;  1JMB A;  2XKM A;  4JF7 A;  1LGH B;  1S5L X;  4AYC A;  3JSV C;  4BWN A;  3U1C A;  3SWY A;  3AEE C;  1YQ4 C;  3H1K E;  3BVH A;  1E79 H;  1K04 A;  1OW6 A;  3WUU A;  2FYU J;  4PD4 H;  1RE4 C;  3I55 P;  3L4F A;  1LTT C;  3HD7 B;  3JCU E;  4L75 A;  2ZT9 B;  5TIS E;  4DT0 A;  3L74 E;  1NTM D;  1W2B O;  1SQQ D;  1ZR4 A;  2E42 A;  5CCH C;  3BCC E;  1EXJ A;  4IFD K;  1NTM K;  1JEK A;  1GL2 A;  5APT A;  4U3F J;  1RE4 A;  2HLO A;  2WT7 B;  3LW5 J;  4NPF X;  1VQ5 P;  1EXI A;  4KHX A;  3USS A;  3RK3 B;  2Q6Q A;  4HYT B;  1FJK A;  4WWI A;  5AW6 B;  4LLH A;  1K9M Q;  3H1H G;  1SQQ E;  1N86 A;  1OMI A;  4H0L C;  1H88 A;  2P58 A;  4ASV A;  5KAI H;  1L0N G;  5DJT B;  2XND H;  3W67 A;  5BU8 B;  1KQL A;  1M7L A;  1T8Z A;  1VQP P;  2PFX A;  4D6T J;  2M3E A;  2E75 B;  2YMK A;  3L71 E;  3L75 E;  2JDI H;  2N1T B;  3LIE A;  1PGP A;  1JCD A;  1VF5 C;  3U59 A;  4RES B;  2K37 A;  3PH0 A;  3D71 A;  3L72 J;  1JY3 O;  4QMA A;  4WY4 B;  3V2R A;  2FXP A;  2ZYG A;  4BRY A;  3RK2 C;  2D2C C;  1HGZ A;  1HF9 A;  1NHL A;  1QL2 A;  2QJK C;  1JO5 A;  1L0N D;  2H88 C;  3IR9 A;  2E75 C;  2NPS A;  3O6Q A;  4IL6 X;  1KC8 Q;  4H13 C;  3BAS A;  3BRT B;  4ASW A;  1J1E B;  1W2E A;  2LKM A;  3H1H D;  4A7P A;  1AQ5 A;  4K3A A;  4L76 A;  3C9I A;  2Q3I A;  1KB9 E;  4C7R A;  1S1C X;  2Z4E A;  3H1I G;  1K8A Q;  1ZOY C;  2A06 E;  1T3U A;  2GUV A;  2XNX A;  3AE6 C;  4M3L A;  3SSU A;  4ZKP A;  1BE3 G;  1U57 A;  1PPJ D;  1RF0 C;  4LC1 A;  5KLV G;  5E79 E;  1SQP D;  4TLF A;  3R4Y A;  2MKV A;  3RK3 E;  3TK1 A;  5AVV B;  1HTL C;  1SQX E;  1M8O B;  1SQP K;  2R3C A;  3KPE A;  3S4R A;  5GTH E;  2QRX A;  3BCC D;  2HPC B;  2OYH C;  1BSN A;  2KYV A;  2YNY A;  3L72 D;  1IK7 A;  1M1J A;  1NU1 G;  2V7Q H;  1KD1 Q;  2K9Y A;  3AE9 C;  2OTL P;  2A45 G;  2K9J B;  2O01 N;  3UIA A;  5B66 H;  5M1B A;  2A45 H;  1NTZ D;  3H1L G;  2WSE H;  2C0X A;  1ZW0 A;  3HE4 A;  4I7Z B;  3RBX A;  2KZI A;  4H44 B;  3L74 D;  1CZQ A;  1BGY D;  3HTK A;  2OGU A;  1M1J B;  1VQ7 P;  1FU1 A;  1LTJ C;  3IAO A;  1KQG B;  1T2K D;  1BDC A;  1K73 Q;  1K05 A;  2JJL A;  1RQU A;  1MUU A;  1JTH A;  4U3F G;  1NTK D;  2POH A;  4ZKU A;  3OW2 O;  2QJP C;  3H1J J;  1S9K E;  2AEJ A;  3KHU A;  1USE A;  2FXM A;  2WPR A;  3P32 A;  1PV3 A;  1MV8 A;  3MZW B;  2OYH A;  4BXL A;  3R2P A;  1IFJ A;  2IBZ D;  1FZC B;  3MGN A;  5CBO A;  3KZI H;  2OYI B;  1AVO A;  2WPV B;  1WMK A;  2E75 D;  2FYZ A;  1GZL A;  3CWB J;  3NTN A;  3SFD C;  3NMD A;  5AVT B;  4WVZ A;  1RF1 C;  2D2C D;  2IZ1 A;  1M56 D;  4HJG H;  2QJY C;  5AW8 B;  1L2P A;  2JP3 A;  2WSF H;  1DD4 A;  3H1K J;  2N9B A;  3L75 G;  2H7H A;  1KN7 A;  3II6 A;  2YKQ A;  1ZP0 C;  3AE4 C;  1QEX A;  2KSJ A;  1AQT A;  1OVU A;  3CI9 A;  4Z1M H;  3CL3 D;  3CC4 P;  2FKW B;  3CWB G;  2E43 A;  2QG4 A;  2Y0D A;  2IDB A;  3EFG A;  4N78 D;  1DIP A;  2OTK E;  1VF5 B;  2O1K A;  5KAI E;  1URQ A;  1S3J A;  3VMA A;  3O6Q B;  3AE3 C;  3WU2 E;  2AXC A;  2FYU K;  3FXE A;  3L71 J;  2YMY A;  2WVR A;  4WY4 C;  1KYO H;  1AV1 A;  1FZA A;  3QH9 A;  4OWF A;  5L8R J;  5AW4 B;  1GW4 A;  3MTU E;  2ZYD A;  3HE4 B;  2RKL A;  1FBM A;  1AA0 A;  1SQQ J;  4I1L A;  3CWB D;  5AW9 B;  1CI6 A;  3RK2 D;  3VMY A;  1YJN P;  1HUC A;  1NAY A;  5AW0 B;  1PGJ A;  1SQX D;  2Q3E A;  3TF5 A;  4U7J A;  2Y0C A;  5KLI C;  1Q7Y Q;  2YO2 A;  4UB6 H;  2HOD A;  3EWK A;  5CCG A;  1Y9B A;  3HRN A;  2I1J A;  3P8M C;  4NPD A;  1FE6 A;  1G1I A;  5B5E E;  1VQM P;  1AFO A;  5CMZ A;  2A06 D;  2AXT E;  3FXD A;  3MD0 A;  1WT6 A;  1NU1 J;  3AE1 C;  1PP9 E;  1PIX A;  3TGU D;  1EZV D;  2E74 D;  2IBZ G;  2QE7 H;  1H89 A;  1JNM A;  1YIJ P;  2ZXE B;  1FDM A;  1KZU B;  1URQ C;  3AE5 C;  5APV A;  2YXR B;  3D6Z A;  1L4A D;  3L73 D;  3TSI A;  3VN0 A;  1RF1 B;  1QVG O;  3L35 A;  1L0L D;  3FWL A;  3HTK B;  1N73 A;  1PP9 D;  1RHZ B;  1SQV G;  1YTZ T;  5CCH D;  1VQN P;  1L0L K;  1S9K D;  2I1K A;  5CCG C;  1BGY G;  1MFZ A;  1SQB K;  3A0H E;  1PGO A;  3CXH I;  1N73 C;  3B8E B;  4JBZ A;  5AVU B;  1NTZ G;  2FBW C;  2OQQ A;  2BCC E;  1PFI A;  1NTZ J;  1NKN A;  2BEQ D;  2W83 C;  3M91 A;  3L75 J;  1NU1 D;  3RL0 D;  2Q7C A;  3L72 G;  4D6T G;  1OIP A;  2ZT9 D;  1NU1 K;  2KK7 A;  2WSF J;  3KQG A;  4WY4 A;  1S5L H;  3B4S A;  3L36 A;  1KV4 A;  1AJY A;  1H0T A;  1SQP G;  1FDI A;  3P8C E;  2KB7 P;  2A45 I;  3S1K A;  1BE3 D;  2AEM A;  3GHG B;  4MN4 C;  1P84 I;  2O01 H;  5KLV D;  3WUT A;  5H2F E;  4C46 A;  2FYN B;  1EDI A;  3H1I D;  1PP9 J;  3GW6 A;  1YTZ I;  2B9B A;  2GM4 A;  1Q90 D;  3IFM A;  3ABV C;  1NGM B;  1A02 J;  1VQ6 P;  4EI2 A;  1N8R Q;  4EYY Q;  2ZFC A;  4K35 A;  2R3S A;  3W68 A;  1OXZ A;  1GU4 A;  1M1J C;  1SFC A;  1NYH A;  1BDD A;  1J2J B;  3V2N A;  3O8Z A;  1IFD A;  3H1H E;  3CCR P;  3D6Y A;  5CJ0 A;  1Q2N A;  3AEB C;  4EIJ A;  3I56 P;  5KAF E;  1KIL D;  3CCS P;  3CCV P;  1RY3 A;  4YXD C;  1SFC B;  2WSE J;  1YHQ P;  3M9Q A;  1PGQ A;  4H0L B;  2P7J A;  1M1K Q;  2YO3 A;  2J58 A;  4IFM A;  1MFT A;  1KQS O;  1YYC A;  2FFD C;  1FZE A;  4Y99 B;  5CJ4 A;  1QGK B;  2Y0E A;  1SQQ K;  1FC2 C;  1N2D C;  2PRR A;  1OX3 A;  3PTZ A;  2O01 J;  2GUS A;  3KXD A;  1SQV J;  2JR8 A;  3P7K A;  4EDF A;  1KTM A;  3Q2Y A;  3D70 A;  3HD7 D;  1KB9 H;  4L73 A;  5AVX B;  4DJG A;  3CCU P;  3H6P A;  2C9N Y;  1USD A;  1NTM G;  3CX5 E;  3LID A;  4Y99 C;  5E79 H;  3OA7 A;  5AVZ B;  1J1E C;  3TGU G;  3VP9 A;  1R8E A;  2D2C B;  1BE3 E;  5KLV E;  1FJP A;  1U7M A;  2QJK B;  1JY2 P;  1KOR A;  2ZAE B;  1GL2 B;  2NRG A;  5GTH H;  3CCE P;  2WMM A;  5KLI B;  2LR2 A;  3H1J E;  2WTY A;  2ITA A;  2AEF A;  5KKZ C;  1M90 Q;  1P84 H;  2JEE A;  4H44 C;  2YIU B;  5AVQ B;  2HR3 A;  4PV1 B;  2K9J A;  1BCC E;  2J59 M;  1ZXG A;  1WRG A;  1FZB A;  1LTJ B;  2KS1 A;  3B71 A;  3M06 A;  3VYI A;  5KTB A;  1GL2 C;  1HVV A;  1IO4 A;  2R5D A;  3FGA D;  1L0L G;  1RF1 A;  2FY8 A;  1FOS E;  3CD6 P;  3SFE C;  1ZR2 A;  2M8R A;  4XFJ A;  2YIU C;  3ZDM A;  5CCG D;  1JY2 O;  4RJT A;  2OYI A;  3AE2 C;  3CXH D;  3L71 G;  1H8A A;  1EDJ A;  5KJ7 A;  1LTB C;  2N9Y B;  4U3F E;  3JCU H;  2WPS A;  3GHG C;  1GU5 A;  1SQX J;  2IFM A;  2JKV A;  2K3R A;  2O3J A;  1HH0 A;  2W8Z A;  3MIW A;  1Q81 Q;  3RK3 D;  1X0T A;  2G8Y A;  2IZ0 A;  4I6M C;  1M57 D;  2LXC B;  3KZI E;  2V4H A;  2ZT9 C;  4O9B A;  4WBA A;  2K88 A;  4XE5 B;  1L0L J;  1NKZ B;  3N7N A;  3L70 E;  1LJ2 A;  1L4A A;  1KB9 D;  1LWU B;  1RE3 A;  2G3A A;  2IBZ I;  2Q1K A;  2ZVN B;  3CXH E;  3L70 D;  3PHL A;  1P84 D;  3VP8 A;  1CW5 A;  1ZME C;  2W90 A;  2E5Y A;  4I2L C;  1SLQ A;  4GOD A;  2WZ7 A;  5CCH A;  3H1I J;  2LXB A;  1NTZ K;  3WMM 0;  1JTH B;  5CBN A;  3G4S P;  2B89 A;  3V5B A;  3HE5 A;  3I5C A;  1N7S D;  1QX8 A;  1LT9 C;  2R32 A;  3OJA B;  3RL0 g;  2K1A A;  1JY3 N;  1OVR A;  1ZV8 A;  1VPC A;  2KP8 A;  1XTC C;  2WSS H;  4PJ0 H;  1NTK E;  2P2U A;  4N6J A;  5BVZ A;  1Q86 Q;  3TGU J;  4WY4 D;  2CK3 H;  4D6T E;  3A0B E;  1HJ0 A;  1JMM A;  2KXP B;  3AE7 C;  2E74 C;  4HH2 A;  3L37 A;  1BCC D;  4OGQ B;  1SQP J;  1JB0 J;  2WT7 A;  2C0W A;  3Q3D A;  2V7Q J;  1RH5 B;  3OAK A;  2WIT A;  5AVW B;  1D7M A;  1NAF A;  2OYI C;  2JWA A;  3H1J D;  1TU3 F;  1EZV G;  1QLE D;  3CLQ A;  4NPE A;  1X9V A;  3TYY A;  3V4Q A;  3RGU A;  1YIT P;  1FZG A;  2DW3 A;  1LP1 A;  2M5A A;  3V6I A;  3H1J G;  2QJY B;  4OGQ C;  1HGV A;  2XZR A;  1PZQ A;  1SFC D;  2B87 A;  3L74 J;  3M0D C;  1MZ9 A;  1BGY J;  1BCC G;  2Z5H A;  2RH0 A;  1ZRT E;  1PL5 A;  2FYU E;  1IFM A;  2FFD B;  4DZO A;  1CI6 B;  4OVN F;  4TT3 H;  1S2E A;  5CHX A;  1YJ9 P;  2OTJ P;  4BRY B;  2VRS A;  3FWN A;  4GDO A;  4JPZ B;  4GOE A;  4AQR D;  3L74 G;  2IX7 C;  4GT1 A;  3G71 P;  1NJI Q;  2KSE A;  2MJZ A;  4N3Y B;  2NPS D;  4RO0 A;  3HUS B;  2E76 B;  2YKP A;  4PV1 C;  5KJ7 C;  2HOD B;  4R4M A;  1ZN5 A;  4I7Z C;  4OH8 B;  3CME P;  1BGY E;  1IFI A;  1LTA C;  3CX5 I;  3F5H A;  1SVF A;  1URQ B;  3CCQ P;  3VOP A;  2H8P D;  2KI7 B;  3T97 A;  3AEA C;  2W27 A;  1KIL E;  3N4X A;  2E76 D;  3L73 E;  3U1A A;  3V2Q A;  1JY2 N;  3MP7 B;  3RBZ A;  4JYB A;  3L70 G;  1LTJ A;  1U7J A;  1YI2 P;  1PPJ G;  1QVF O;  1VQL P;  1L0N J;  2FXO A;  1NTM J;  1NTM E;  3NXS A;  1CSB A;  1G1J A;  2HPC A;  1HBW A;  3B5N B;  1VL2 A;  2PGD A;  1HWT C;  2L91 A;  2NPS C;  3LW5 H;  4HB1 A;  4AUW A;  1FZC A;  2B88 A;  2R44 A;  3L71 D;  3AEF C;  3HE5 B;  1T2K C;  5AVS B;  1HJB A;  1GK6 A;  5AW7 B;  3FX0 A;  1DEE G;  3KYQ A;  1NTK G;  4RKU J;  5AW1 B;  5K5G B;  1FOS F;  1IFN A;  1LTG C;  4PD4 I;  1LT9 B;  1KB9 I;  1IC2 A;  1NVO A;  4W7Y A;  2WQY C;  1IFP A;  2CPB A;  2IBZ E;  1SQB J;  2QVA A;  4H13 D;  1L4A B;  1LWU A;  2KLU A;  4PJ0 E;  2WWW A;  2E76 C;  1SFC C;  3G3Z A;  5KKZ B;  3SWF A;  1Q82 Q;  2J5U A;  1JCC A;  3H1K G;  3H1I E;  5BU5 A;  1J1D C;  4OGQ D;  4ZNC A;  2OYH B;  2RMZ A;  1H0T B;  3PJS K;  1SQB E;  1AVY A;  1EDK A;  1NH4 A;  4PV1 D;  4R4L A;  1W5C E;  5APS A;  5KJ7 D;  5AVR B;  1L0N K;  3WUV A;  3TNU B;  5TIS H;  1OFC X;  1LP1 B;  2M5A B;  2XU6 A;  2ZJS E;  3BCC G;  3IF4 A;  2L5G B;  5GTI H;  3MUD A;  5KLV K;  1NOH A;  1R5S A;  2PP6 A;  1NU1 E;  2JO1 A;  2P1J A;  2YKO A;  2GA1 A;  3GG2 A;  4XA4 A;  3VMZ A;  1N7S B;  3CCM P;  1A02 F;  3H1L E;  2NPS B;  1RQV A;  1FDO A;  2Y9Z A;  1SQQ G;  4JQ0 D;  1RF0 A;  1DD3 A;  2W6B A;  1E5W A;  3H32 B;  2JWD A;  1L0N E;  4EOT A;  2QIW A;  2Q9I A;  3K5B A;  2QM7 A;  1LT1 A;  4CPG A;  3GMA A;  4GIF A;  1SQP E;  3JC2 2;  3RL0 B;  5APU A;  2KOG A;  1Y8A A;  2M0B A;  1N7S A;  2IPP A;  1VF5 D;  1T6A A;  2UWJ E;  3B5N A;  3M9H A;  4H13 B;  3WU2 H;  3H1K D;  4UB8 E;  1OVV A;  1DH3 A;  1NTK J;  1J1D B;  5APY A;  2BCC J;  1X79 B;  1FS0 E;  1X22 A;  2W6J H;  3EFF K;  4H0L D;  1JOC A;  5C39 A;  1NWQ A;  2ZYA A;  3TDK A;  3AE8 C;  1LTS C;  1FAV A;  2N1T A;  1BE3 J;  5KLV J;  2ZVO B;  2N1T C;  3Q5P A;  1EQ7 A;  1GDT A;  3RK3 C;  1NTK K;  1JUN A;  2R5B A;  1NO4 A;  1EDL A;  1S5L E;  1L0L E;  2HG5 D;  3BRV B;  1JY3 P;  1KFN A;  2E5T A;  1KYO D;  3H1L J;  3Q5R A;  1GK4 A;  1N7S C;  1IZN B;  2B87 B;  1G2C A;  1IK9 A;  2BAS A;  2KZJ A;  3CPW O;  1OZH A;  3CX5 D;  2KIK A;  3E7K A;  4IOI H;  5AW3 B;  1R5L A;  5H2F H;  3B5N C;  4KT0 J;  3AED C;  3T97 B;  1GL2 D;  3CXH H; 
#chains in the Genus database with same CATH homology
 3BAT A;  3GHG A;  1LT9 A;  5AW5 B;  4B86 A;  3HUS A;  3H32 A;  1FZF A;  1IJD B;  1SP4 A;  4W7Z A;  2O1J A;  4C7N B;  2FFD A;  1DX7 A;  2HFE D;  1SQV K;  3E1I A;  4WB4 A;  2QM8 A;  2C9L Y;  1KIL A;  1LWU C;  2P67 A;  1X8Y A;  1T3J A;  2Z5I A;  1SQX K;  1KIL B;  3PP5 A;  1LTI C;  3HD7 A;  2OAR A;  1VDF A;  1FZC C;  1N7L A;  1KIL C;  1OWA A;  4W80 A;  4GKG A;  4IFF A;  3HD7 C;  1QL1 A;  1GW3 A;  1GD2 E;  3A7O A;  3RK2 B;  3HUS C;  2Q5U A;  1N73 B;  3A3Y B;  1G2C B;  2KLV A;  3M0A A;  2XV5 A;  2PAJ A;  3VTP C;  5AW2 B;  4LGD E;  2M3B A;  3KDP B;  4DOJ A;  4N78 E;  2H43 A;  5AVY B;  2IFN A;  1KFM A;  5APQ A;  3TNU A;  2HYN A;  3M0D A;  2WSC H;  5APX A;  1DEB A;  1ZLL A;  2WPQ A;  4JYC A;  1GTW A;  2XDJ A;  3B5N D;  4C7N A;  3M9B A;  1XTG B;  3V4W A;  3EQ2 A;  1Z56 A;  3P8C D;  5APW A;  1L4A C;  1RE3 C;  3NFQ A;  2CPS A;  2N1T D;  2W6A A;  3VMX A;  1URQ D;  3A5T A;  3A2A A;  3RL0 C;  3V2P A;  2XKM A;  4JF7 A;  1LGH B;  4AYC A;  3U1C A;  3SWY A;  3BVH A;  1RE4 C;  3L4F A;  1LTT C;  3HD7 B;  2E42 A;  1ZR4 A;  5CCH C;  4IFD K;  1NTM K;  5APT A;  1GL2 A;  2WT7 B;  1RE4 A;  2HLO A;  4KHX A;  3RK3 B;  4HYT B;  1FJK A;  5AW6 B;  4LLH A;  1N86 A;  1H88 A;  5BU8 B;  1KQL A;  1M7L A;  1T8Z A;  2N1T B;  3LIE A;  1JCD A;  3U59 A;  4RES B;  1RF1 C;  4AUW A;  3V2R A;  1JY3 O;  4WY4 B;  3RK2 C;  1HGZ A;  1NHL A;  1QL2 A;  1JO5 A;  3IR9 A;  2NPS A;  3BAS A;  3BRT B;  1J1E B;  1W2E A;  2LKM A;  1AQ5 A;  3C9I A;  2Q3I A;  4C7R A;  2Z4E A;  2XNX A;  1T3U A;  2GUV A;  4M3L A;  4ZKP A;  1RF0 C;  4LC1 A;  5AVV B;  1HTL C;  1SQP K;  3KPE A;  2R3C A;  2HPC B;  2OYH C;  2KYV A;  2YNY A;  1M1J A;  2A45 G;  3UIA A;  2A45 H;  2WSE H;  2C0X A;  3HE4 A;  1CZQ A;  3HTK A;  1M1J B;  1FU1 A;  1LTJ C;  1T2K D;  2JJL A;  1MUU A;  1JTH A;  4ZKU A;  2POH A;  1S9K E;  2FXM A;  2WPR A;  3P32 A;  1MV8 A;  2OYH A;  3R2P A;  1IFJ A;  1FZC B;  3MGN A;  2OYI B;  3NTN A;  2FYZ A;  1GZL A;  3NMD A;  5AVT B;  5AW8 B;  2WSF H;  2N9B A;  2H7H A;  3II6 A;  2YKQ A;  2KSJ A;  3CI9 A;  3CL3 D;  2FKW B;  2E43 A;  3EFG A;  4N78 D;  2O1K A;  1URQ A;  2FYU K;  2YMY A;  4WY4 C;  1FZA A;  5AW4 B;  1GW4 A;  3MTU E;  3HE4 B;  4I1L A;  1FBM A;  3RK2 D;  5AW9 B;  1CI6 A;  3VMY A;  1HUC A;  5AW0 B;  2YO2 A;  2HOD A;  5CCG A;  3HRN A;  1AFO A;  2I1J A;  3P8M C;  1G1I A;  5CMZ A;  3MD0 A;  1WT6 A;  1H89 A;  1JNM A;  2ZXE B;  1FDM A;  1KZU B;  1URQ C;  5APV A;  1L4A D;  3TSI A;  3VN0 A;  1RF1 B;  3L35 A;  3HTK B;  1N73 A;  5CCH D;  1YTZ T;  1L0L K;  1S9K D;  2I1K A;  5CCG C;  1MFZ A;  1SQB K;  1N73 C;  3B8E B;  5AVU B;  1PFI A;  3M91 A;  1NKN A;  3RL0 D;  2Q7C A;  1NU1 K;  3KQG A;  4WY4 A;  3L36 A;  3P8C E;  2KB7 P;  2A45 I;  3TK1 A;  3GHG B;  2O01 H;  4C46 A;  1YTZ I;  2GM4 A;  3IFM A;  2ZFC A;  1OXZ A;  1GU4 A;  1M1J C;  1SFC A;  1J2J B;  3V2N A;  3O8Z A;  1IFD A;  5CJ0 A;  4EIJ A;  1KIL D;  1RY3 A;  1SFC B;  3M9Q A;  2P7J A;  2YO3 A;  2J58 A;  4IFM A;  1YYC A;  2FFD C;  1FZE A;  4Y99 B;  5CJ4 A;  1SQQ K;  1N2D C;  2GUS A;  3P7K A;  3HD7 D;  5AVX B;  3H6P A;  2C9N Y;  5AVZ B;  3VP9 A;  3LID A;  4Y99 C;  3OA7 A;  1J1E C;  1FJP A;  1JY2 P;  1GL2 B;  2WTY A;  2JEE A;  5AVQ B;  1A02 J;  2J59 M;  3M06 A;  1CW5 A;  1WRG A;  1FZB A;  1LTJ B;  5KTB A;  3VYI A;  1GL2 C;  1HVV A;  1IO4 A;  2R5D A;  1RF1 A;  1FOS E;  1ZR2 A;  2M8R A;  5CCG D;  1JY2 O;  2OYI A;  1H8A A;  5KJ7 A;  1LTB C;  1GU5 A;  2WPS A;  3GHG C;  2IFM A;  1HH0 A;  3MIW A;  3RK3 D;  4I6M C;  4O9B A;  4WBA A;  4XE5 B;  1NKZ B;  3N7N A;  1L4A A;  1LWU B;  1RE3 A;  3VP8 A;  5CCH A;  4I2L C;  1SLQ A;  2WZ7 A;  1NTZ K;  3WMM 0;  1JTH B;  3V5B A;  3HE5 A;  3I5C A;  1N7S D;  1LT9 C;  2R32 A;  3OJA B;  1JY3 N;  1ZV8 A;  1VPC A;  2KP8 A;  1XTC C;  5BVZ A;  2P2U A;  4N6J A;  4WY4 D;  1JMM A;  4HH2 A;  3L37 A;  2WT7 A;  2C0W A;  5AVW B;  3OAK A;  2WIT A;  1NAF A;  2OYI C;  3TYY A;  3CLQ A;  1X9V A;  3V4Q A;  1FZG A;  1HGV A;  2XZR A;  1SFC D;  3M0D C;  1MZ9 A;  2Z5H A;  1IFM A;  2FFD B;  4DZO A;  1CI6 B;  5CHX A;  2VRS A;  4AQR D;  2IX7 C;  4GT1 A;  2MJZ A;  4N3Y B;  2NPS D;  3HUS B;  2YKP A;  5KJ7 C;  2HOD B;  1ZN5 A;  4OH8 B;  1IFI A;  1LTA C;  1SVF A;  1URQ B;  3VOP A;  2H8P D;  3T97 A;  2W27 A;  3U1A A;  3N4X A;  3V2Q A;  1JY2 N;  4JYB A;  1LTJ A;  1HBW A;  3NXS A;  2HPC A;  1CSB A;  1G1J A;  3B5N B;  1HWT C;  2NPS C;  3LW5 H;  1FZC A;  3HE5 B;  1T2K C;  5AVS B;  1HJB A;  1GK6 A;  5AW7 B;  3KYQ A;  5AW1 B;  1FOS F;  1IFN A;  1LTG C;  4W7Y A;  1LT9 B;  1IC2 A;  2CPB A;  1L4A B;  1LWU A;  2WWW A;  1SFC C;  3G3Z A;  3SWF A;  1JCC A;  5BU5 A;  1J1D C;  2OYH B;  1NH4 A;  5KJ7 D;  5APS A;  5AVR B;  1L0N K;  3TNU B;  2XU6 A;  2L5G B;  3MUD A;  5KLV K;  1NOH A;  2PP6 A;  2YKO A;  4XA4 A;  2P1J A;  3VMZ A;  1N7S B;  1A02 F;  2NPS B;  1RF0 A;  2W6B A;  1E5W A;  3H32 B;  4EOT A;  2Q9I A;  2QM7 A;  4GIF A;  3RL0 B;  5APU A;  2KOG A;  3B5N A;  1N7S A;  2IPP A;  3M9H A;  1DH3 A;  1J1D B;  5APY A;  1X79 B;  1NWQ A;  1JOC A;  1LTS C;  1FAV A;  2N1T A;  2N1T C;  1EQ7 A;  1GDT A;  3RK3 C;  1NTK K;  1JUN A;  2R5B A;  1NO4 A;  2HG5 D;  3BRV B;  1JY3 P;  1KFN A;  1GK4 A;  1N7S C;  2BAS A;  1G2C A;  1IK9 A;  5AW3 B;  3B5N C;  1GL2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...