1SQQK

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
54
structure length
54
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 14
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1sqqK00
2WSFH 1NU1K 1SQXK 1SQVK 1NTKK 2WSCH 1SQPK 3CLQA 1L0LK 3M9QA 2OARA 3G3ZA 4IFDK 1NTZK 1SQBK 2LKMA 2O01H 1NTMK 2WSEH 2J59M 5KLVK 1SQQK 3LW5H 1L0NK 2FYUK
chains in the Genus database with same CATH superfamily
3L72E 1L0LG 4JQ0D 3AE3C 1FZBA 2H88C 3VN0A 3H1LG 5AW2B 1QL1A 1L4AD 1IFNA 5H2FH 1LTJB 3VMYA 1NTZD 2OTLP 3BCCD 1FS0E 2ZYAA 2IPPA 3BCCJ 4GODA 3H25A 1X8YA 5AW7B 5AVUB 3HD7A 2CK3H 3V6IA 4EOTA 1NJIQ 1VQ4P 5E79E 1NTMG 3BRTB 4Z1MH 1ZV8A 4O9BA 1BDCA 3L74D 1JM0A 2WSFJ 1VQNP 5AW5B 3RBZA 3R2PA 1M1JA 5DJTB 3L73D 3P32A 1EXIA 5GTIH 3L73J 1RE3A 1GW3A 1NU1D 2OQQA 1XTCC 1NU1J 2O01J 1SQXJ 3CCRP 1EZVI 1L4AB 4WY4C 1LT9B 2KZJA 4ASVA 2WPVB 4PJ0H 1YIJP 2V4HA 3CC2P 3CX5H 1IFIA 1LTJC 2AEFA 3QH9A 1M1KQ 1GL2A 1EZVE 1MZ9A 3E1RA 2QM7A 5AVXB 3IAOA 2E76C 2D2CC 4IOIH 1SQVD 1Q2NA 2WPQA 4I7ZB 1ZRTD 2JO1A 1H88A 3L72D 2FXMA 2KXPB 3D71A 4JPZB 1USEA 5KLVK 2N1TA 2Q3IA 1HF9A 4Y99C 1NTKG 1MKMA 1WRGA 1CW5A 3HUSB 2LR2A 1MFZA 2WPRA 5B5EH 5AVVB 3H1HE 1FJKA 1G2CB 1IZNB 3AE4C 1YTZI 3OW2O 1OFCX 3MP7B 1BGYE 1U7JA 3AE6C 4I6MC 2B87A 1L4AC 1L2PA 1VL2A 4NPDA 1M57D 2WSCJ 1L0LK 3HTKA 4K3AA 3ABVC 1KORA 4DZOA 3SWKA 1BCCG 1CI6B 2WSEJ 3CXHI 2QJKB 2FKWB 3HE5B 4OGQD 1GK4A 4KT0J 1SLQA 3CD6P 4H44D 4L76A 5DJUB 1LTSC 3Q5RA 1KFNA 1NTMK 4C7NB 3TDKA 1DH3A 1SFCC 2A45G 2BASA 1YTZT 1NTZG 2XKMA 3BCCG 1A02F 3T97B 1RF1C 1EZVD 3L36A 3G9RA 4MN4C 3L37A 2XV5A 3UIAA 2CPBA 3VOPA 2Q1KA 3TYYA 4OGQB 3L74G 1KILE 4JF7A 3C1LA 2O3JA 3A2AA 4H44B 3WUUA 3L73G 1VQ8P 3RL0C 1JY2P 2QG4A 1YJ9P 1EDLA 1NU1G 3M0AA 1ZN5A 3KPEA 3H1HD 2QJKC 3H1HJ 1FJPA 1VPCA 2R44A 1GK6A 1BGYD 2N1TC 3ZDMA 1BGYJ 2AXCA 1AVOA 4L75A 2KUBA 3VMAA 4R4MA 1R8EA 1ZXGA 1S1CX 2K9JB 4NPEA 2QIWA 2RKLA 1VQMP 4A7PA 1N7SC 3CMEP 2E75D 2K3RA 1H0TA 3AECC 2YKQA 1SQVG 1RE4C 1M7LA 2K1AA 3SFEC 3AE2C 3RK3C 4Y28J 2KS1A 2E74C 2BCCD 3G71P 1NAYA 2C9NY 2BCCJ 2YKPA 2FYUK 2W90A 5AW0B 2FFDB 2OYHA 1X0TA 2P58A 5AW1B 3M91A 2E5TA 2E75B 3MTUE 5KKZB 3K5BA 5KLIC 1KILD 3I55P 2ZAEB 1RH5B 1GU5A 4H13D 4U3FE 3CCJP 5KJ7C 1OX3A 4BRYB 5CCHD 3MHVA 2NPSD 3RK2C 2QRXA 2Q3EA 3B4SA 4TLFA 3LW5H 2JKVA 1EXJA 2OYIA 4ZMDA 2Y0EA 2XNXA 4NPFX 1DEBA 2RMZA 1LT1A 2O1JA 1P84H 4M3LA 3GF7A 1PGQA 1SQXK 3HE4A 4JYCA 1KILB 3MZWB 1EZVG 1N73C 4EI2A 2FFDC 3PH0A 2O01N 2H89C 1GU4A 1W2BO 3PLNA 1KQFB 2NPSB 4PD4H 3EQ2A 1AA0A 3GG2A 5KKZC 1VDFA 1S5LH 3OJAB 3U1CA 4OVNF 3FX0A 1QLED 2W8ZA 1J1DB 2ZXXA 2PP6A 2KSEA 2IBZI 3H1HG 3NTNA 1JCDA 2HFED 5KAFH 2HODB 4B86A 1BGYG 5GTHH 1HVVA 1FBMA 3FWNA 3FXEA 2H8PD 1OVRA 3G3ZA 3F5HA 4C46A 1FDMA 1NH4A 2A45H 2ITAA 2YXQB 4U3FD 3MD0A 4ASWA 1DD4A 1FZCA 4U3FJ 1GZLA 1KILC 1LTGC 3GHGB 4N78E 3B5NA 1PP9E 2E76D 2D2CD 1NKNA 2QVAA 1DIPA 2FYZA 2C9LY 2L5GB 1BCCJ 2BCCG 2W83C 2NZ2A 1BDDA 5CCGA 1JY3N 2O01H 2IZ1A 1A02J 1Q7YQ 4UB6H 5TISH 2FXPA 5H2FE 2H7HA 1LWUA 1YQ3C 1QVGO 3V4WA 2AXTH 2XZRA 3IF4A 4YTPC 3CI9A 1IK9A 1KQLA 2Z5IA 2E5YA 1JTHB 3M9QA 3USSA 2KLUA 4R4LA 2OTKE 5APTA 4K35A 1YYCA 2Z5HA 1XTGB 1S3JA 3KDPB 1GW4A 1NTZJ 2AEJA 2QEXP 5KAIH 2E76B 2D2CB 1T2KD 3CX5I 3HD7D 4IL6H 2ZT9B 5GTIE 1OW7A 1SQQE 2Q6QA 2JJLA 1IFDA 1K05A 3AE1C 4Y99B 3GHGC 2QJPC 1LP1B 3L74J 5CHXA 3SWFA 4PV1B 4PJ0E 1X9VA 3RK3E 1LJ2A 1U7MA 4HYTB 2IBZD 5M1BA 1JO5A 1SFCD 3CX5E 1IO4A 4RESB 5AVQB 1OMIA 2IZ0A 2K9YA 1WT6A 2WSCH 4N78D 4ZKUA 2N9YB 1PP9D 1IFJA 3HD7B 3AE5C 3HUSA 1PP9J 1MFTA 2WSEH 1SS1A 2YO3A 3H1KE 2WWWA 1G2CA 2KYVA 4I1LA 2R32A 1BE3E 3RL0D 3O8ZA 2A06E 3B5NC 1JOCA 5B5EE 1M1JB 3GMAA 3VMXA 1SQVJ 2ZT9C 1KYOH 3MUDA 3JC22 2KB7P 3L72J 3EWKA 5B66H 1SFCB 2M5AA 2N1TD 1D7MA 2Q9IA 2SPZA 4U3FG 4PV1C 3HE5A 1RF1B 1DX7A 1CZQA 2G3AA 1N7SD 1OW6A 3VTPC 1TU3F 1E79H 1SQQD 2WQYC 4HKZH 1FZFA 1SQQJ 3N7NA 1YHQP 1GL2B 2IYPA 2PAJA 3O6QB 2KK7A 3RL0B 1T2KC 3TNUA 1R5LA 3HD7C 1LGHB 3CC4P 1RF0A 1ZLLA 3RK3D 1SQPE 3QWOC 1W2EA 3M9HA 2E74D 1W5CE 2FYNB 3VMZA 2V7QJ 4XA4A 2N1TB 1KZUB 1URQA 2MKVA 3CX5D 1VQ7P 3A0BH 3SFDC 2I1JA 3AEAC 1M1JC 2KNCA 5BVZA 1QGKB 1Q86Q 1RE3C 1M56D 3V2NA 3CWBE 3L35A 1N7SB 4DCKA 2B87B 3H1KD 4YPCA 4IFDK 3H1KJ 5AVRB 4DOJA 1RQUA 3CC7P 1BE3D 5KJ7D 3B8EB 1LTIC 2A06D 2HPCA 3W67A 2GM4A 3II6A 1BE3J 1ZMEC 5APUA 3RK2D 3RK3B 3KZIH 1ZOYC 2C0WA 5BU8B 2E74B 3BVHA 4WBAA 1JUNA 2IFNA 4GT1A 2XDJA 2R3CA 1GL2C 4LGDE 1GMJA 3L71E 2DW3A 3CXHH 2IBZG 2UWJE 3WUVA 3A3YB 1GD2E 3KQGA 1RY3A 3H1LE 2FYNC 2XU6A 2KI7B 1PIXA 1YQ4C 3Q2YA 2OYOA 1NKZB 5KLIB 3D70A 1YITP 1FDIA 1PP9G 2QSIA 4RKUJ 1NTKK 3RK2B 2FBWC 1SQPD 1S2EA 1KTMA 2Z4EA 2YKOA 1SQPJ 2KZIA 2E43A 2FY8A 1NYHA 3CCVP 3H32A 2O1KA 2B9BA 3RL0g 1OW8A 2GUSA 3L72G 1Q81Q 3V4QA 1DD3A 3JSVC 4XFJA 4JYBA 4KHXA 3CWBD 3FXDA 3PP5A 3ITKA 4LLHA 1UIXA 3Q3DA 4BRYA 1KQGB 4DJGA 4LC1A 1N73B 1YBKA 1USDA 3CLQA 3LIEA 2J58A 3C8VA 1HGZA 2AEMA 4UB8E 4GOFA 4YXWH 2HLOA 2HR3A 1P84I 1SQQG 5APWA 4L74A 1JY2N 1EDJA 2RH0A 2JDIH 3H1JE 2KSJA 2KLVA 4C7RA 3AE8C 1H0TB 1NTZK 3L71D 4EDFA 3A0HH 3GLMA 1QVFO 3L71J 2KOGA 2KS1B 3H1LD 4WVZA 1P84E 1OXZA 2R5BA 5L8RJ 3PRJA 5CCHA 1KB9H 1Y9BA 1K73Q 2IFMA 2IX7C 5AVZB 1L0NE 2OYHB 3WUTA 1Y47A 1NO4A 3H1KG 4PD4E 1HH0A 3MGNA 4XE5B 3H6PA 1NU1K 3AE7C 3AEDC 1MUUA 2HODA 1BE3G 1X22A 3VYIA 2FYUE 1N8RQ 2WT7B 1K9MQ 2QJYC 2WSSH 4GOEA 4HH2A 1QEXA 3OA7A 5GTHE 5APVA 1KC8Q 2JP3A 1HWTC 2OYIB 1JY3P 5BU5A 5AVSB 2QE7H 2ZJSE 3NMDA 2FXOA 4W80A 3V5BA 1SQVK 3AEBC 3RBXA 2H43A 1GDTA 3H1JD 5TJHA 4WWIA 3HE4B 3S1KA 1OIPA 1JMMA 3H1JJ 2QA4P 2M0BA 4H0LC 2Y9ZA 2OYHC 4N6JA 1SQPG 3V2RA 5APQA 3FWLA 4WY4A 2BEQD 3EFFK 2I8DA 4W7YA 2I1KA 1P84D 3V2QA 2QJPB 1SQXE 1SQQK 5TISE 3CL3D 3P8CE 1N86A 3HRNA 2WSFH 3B5ND 2AXTE 1NWQA 3CWBG 1L0ND 2ZT9D 1LTJA 1IFMA 1VQ6P 1L0NJ 1G1JA 2YNYA 2OYIC 1JY3O 3WU2H 4GIFA 2YMKA 4W7ZA 2M3BA 3R4YA 1R5SA 2JWAA 3G4SP 3M9BA 1VF5D 4PV1D 1ZW0A 4L73A 3S9OA 3Q1MA 2PGDA 1PGOA 2FYUD 1PFIA 5KAIE 2P2UA 2FYUJ 3JCUH 3P8MC 1FZCB 3PHLA 5AW4B 4IL6E 2YMYA 1KV4A 3KYQA 2ZYGA 3Q5SA 2C0XA 3CCLP 3L71G 1SQBE 3B5NB 2OARA 1MV8A 1L4AA 3TGUE 1LT9A 1NOHA 2WPSA 1LTAC 3N4XA 3I56P 1AQTA 1S5LX 1LWUB 1VF5B 2RN0A 1YJNP 2Y0CA 1IJDB 1KYOI 1J2JB 4AUWA 1Z56A 2YIUB 4IFFA 2BEZF 1KQSO 2NRGA 2P67A 4OWFA 1BSNA 5E79H 4BXLA 1SQXD 5CBNA 2ZVOB 1PV3A 1SFCA 3P8CD 4QMAA 1FZCC 1OWAA 3TSIA 2HG5D 3CCMP 1OVUA 1Y8AA 1KYOE 1RF1A 5B66E 1IK7A 2V7QH 1UIIA 1FZGA 1SQPK 2WZ7A 1GL2D 2L91A 2IDBA 1FU1A 2XNDH 3M0DA 2WITA 3D6ZA 1S72P 4JBZA 5CCGC 1PL5A 3H1JG 3O6QA 1CI6A 3EFGA 1LWUC 1JEKA 1VF5C 1HJBA 1JMBA 3NFQA 2Y0DA 1SQBD 4RJTA 2KIKA 1QX8A 3MIWA 2PFXA 1SQBJ 3BATA 1VQ5P 1Q82Q 1J1EB 4CPGA 3TGUD 2YIUC 3TGUJ 4U7JA 1OZHA 2W6BA 5CJ0A 4EIJA 1PPJE 4C7NA 1LTTC 1M8OB 1N7SA 3A0BE 2P7JA 2KP8A 1L0NG 1K04A 3SWYA 1NVOA 2P1JA 3BASA 1U57A 5CMZA 1LT9C 2W27A 3L75E 3F89A 3T97A 2LXBA 3NXSA 1FZAA 2POHA 2M5AB 1RE4A 2J5UA 1H89A 1URQD 4IL6X 1EQ7A 5CJ4A 3TK1A 2J59M 2FYUG 2MJZA 1AQ5A 2PRRA 2W6AA 1ZR2A 4D6TE 5AVYB 4N3YB 1HTLC 3KZIE 3L70E 1EDIA 5KLVE 1KYOD 3PTZA 4I7ZC 1KN7A 1AJYA 3HTKB 5AW8B 2YO2A 1YI2P 3KXDA 4EYYQ 2BCCE 1S4XA 5AW6B 3TNUB 4ZKPA 1J1EC 3CXHE 3HUSC 3H1IE 3A5TA 2K9JA 1AV1A 1JNMA 1URQB 5KJ7A 1SP4A 2VRSA 1L0LE 3M0DC 2Q7CA 2KNCB 3U1AA 3AEFC 1S9KE 3MUDC 2Q5UA 2K88A 3IFMA 3IR9A 1FE6A 3G6EP 4ZNCA 1SQXG 3VP8A 1YJWP 3C9IA 1PPJD 4KJMA 1NTME 2HPCB 1HBWA 2Y9YA 1JB0J 1PZQA 3S4RA 1N73A 3L75D 2FFDA 3L75J 3PJSK 3D6YA 2WTYA 2JR8A 2QM8A 2K37A 1SVFA 2E42A 3CMAP 2OGUA 1PGJA 1LNQA 4OH8B 1RF0C 3GW6A 1FC2C 3CPWO 4D6TD 5EFWB 2M8RA 3LIDA 3BRVB 4D6TJ 3CWBJ 1HUCA 1URQC 1L0NK 3IN6A 3L70D 4HB1A 1HJ0A 5KLVD 2IYOA 3L70J 1KB9I 1ZP0C 5KLVJ 1DEEG 1K8AQ 1WMKA 1SQBG 4H0LD 4OGQC 3TGUG 2QJYB 1JCCA 1JY2O 2G8YA 1T3JA 4H44C 4HJGH 3A0HE 3CXHD 3M06A 3H1ID 5AVTB 1N7LA 3H1IJ 3V2PA 1OVVA 1FOSF 3H32B 3CCSP 1ZR4A 5CBOA 1VQOP 2JWDA 4PD4I 1L0LD 3P7KA 2OTJP 1KB9E 1BSHA 1L0LJ 1RHZB 3CCUP 1NTKE 1KILA 1QL2A 1S9KD 3KHUA 4UB8H 3H1LJ 1HGVA 4RO0A 2WT7A 2ZXEB 2NPSA 2LXCB 1KMIZ 4H0LB 5AW3B 4WB4A 5C39A 1VQPP 3GF3A 4GKGA 1KFMA 1NTMD 1G1IA 4IFMA 3L4FA 1NTMJ 1S5LE 1BCCE 1M90Q 5APXA 4AQRD 2A45I 2A06G 2ZYDA 2WMMA 2GUVA 2R3SA 1FZEA 3U59A 3I5CA 1EDKA 1RQVA 5KAFE 5AW9B 3SSUA 2B89A 1X79B 3AE9C 1NGMB 5AVWB 3W68A 4H13B 1KD1Q 1VQLP 2YXRB 5APSA 2E75C 1LTBC 1Q90D 4YXDC 1N2DC 4DT0A 3A7OA 1GTWA 1NTZE 1AFOA 3GHGA 3BCCE 3CCEP 1PGPA 1VQ9P 1VQKP 2WVRA 1PPJG 1FDOA 1EC5A 5K5GB 3LW5J 2ZVNB 2W6JH 4TT3H 1T3UA 1CSBA 2B88A 3L74E 1KB9D 3L75G 5KTBA 3CCQP 1NTKD 4WY4D 1SQBK 2LKMA 1H8AA 3VP9A 3L73E 3FGAD 1NTKJ 1AVYA 2JEEA 1NU1E 3WU2E 2N9BA 1JTHA 2IBZE 4UB6E 4BWNA 1NHLA 1NAFA 2M3EA 4D6TG 3B71A 2CPSA 1T6AA 3L70G 3JCUE 5KLVG 4PD4D 4H13C 5CCGD 2ZFCA 3OAKA 5APYA 5CCHC 3Q5PA 1BCCD 2NPSC 3TF5A 1IC2A 1IFPA 2HYNA 2R5DA 4AYCA 3E1IA 1FAVA 2GA1A 3RGUA 1T8ZA 3E7KA 3AEEC 3H1IG 1J1DC 4I2LC 1LP1A 1FOSE 4GDOA 2P10A 4WY4B 1E5WA 1SQVE 3AEGC 3WMM0 1ZRTE
chains in the Genus database with same CATH topology
3BATA 1J1EB 1SQXK 3HE4A 4JYCA 1NTKK 1KILB 1FZBA 1N73C 3VN0A 2FFDC 3RK2B 2W6BA 5CJ0A 4EIJA 5AW2B 4C7NA 1LTTC 1QL1A 1L4AD 1IFNA 1N7SA 1GU4A 1LTJB 3VMYA 2P7JA 2YKOA 2Z4EA 2KP8A 2NPSB 2E43A 3SWYA 2P1JA 3BASA 3EQ2A 3H32A 2IPPA 5CMZA 1VDFA 2O1KA 1LT9C 2W27A 1X8YA 5AW7B 2GUSA 3OJAB 3HD7A 5AVUB 3U1CA 3T97A 3NXSA 4EOTA 1FZAA 3V4QA 2POHA 1J1DB 2PP6A 1RE4A 1H89A 1URQD 3BRTB 4JYBA 4KHXA 1EQ7A 3NTNA 5CJ4A 1JCDA 1ZV8A 3PP5A 3TK1A 2HFED 2J59M 4LLHA 2HODB 2MJZA 4O9BA 4B86A 1AQ5A 2W6AA 1HVVA 5AW5B 1ZR2A 1FBMA 3R2PA 1M1JA 5AVYB 3P32A 4N3YB 4LC1A 1N73B 1HTLC 3CLQA 1RE3A 1GW3A 2H8PD 2J58A 1HGZA 3LIEA 3G3ZA 4C46A 1XTCC 2HLOA 1FDMA 1NH4A 5APWA 1JY2N 3HTKB 2A45H 5AW8B 1L4AB 2YO2A 4WY4C 2KSJA 1LT9B 3MD0A 2KLVA 5AW6B 1FZCA 4C7RA 3TNUB 1GZLA 4ZKPA 1J1EC 3HUSC 1KILC 3A5TA 1NTZK 1JNMA 1LTGC 3GHGB 1URQB 4N78E 5KJ7A 1IFIA 1LTJC 2KOGA 3B5NA 1SP4A 2VRSA 1NKNA 3M0DC 2Q7CA 1GL2A 1OXZA 2FYZA 3U1AA 1MZ9A 2L5GB 2C9LY 2R5BA 2QM7A 5AVXB 5CCHA 1S9KE 2WPQA 5CCGA 1JY3N 2O01H 1H88A 2IFMA 2Q5UA 2IX7C 2FXMA 5AVZB 1A02J 2OYHB 3IFMA 3IR9A 1NO4A 5KLVK 2H7HA 1LWUA 2N1TA 2Q3IA 3V4WA 3VP8A 4Y99C 2XZRA 1HH0A 3MGNA 4XE5B 3CI9A 1WRGA 3C9IA 3H6PA 1CW5A 1NU1K 3HUSB 1IK9A 1KQLA 2Z5IA 1MFZA 1MUUA 1JTHB 2WPRA 3M9QA 2HODA 5AVVB 2HPCB 1FJKA 1G2CB 1HBWA 5APTA 3VYIA 1YYCA 1YTZI 2WT7B 1N73A 1XTGB 3KDPB 2FFDA 1GW4A 4I6MC 4HH2A 1L4AC 3OA7A 2WTYA 2QM8A 5APVA 1SVFA 2E42A 3HTKA 1L0LK 1T2KD 1HWTC 3HD7D 2OYIB 4DZOA 4OH8B 1RF0C 1JY3P 5BU5A 5AVSB 1CI6B 2JJLA 1IFDA 2M8RA 3LIDA 4Y99B 3BRVB 3GHGC 3NMDA 1HUCA 1URQC 4W80A 3V5BA 2FKWB 3HE5B 1L0NK 5CHXA 3SWFA 1SQVK 1GK4A 2H43A 1SLQA 1GDTA 1X9VA 4HYTB 3HE4B 1LTSC 1JMMA 1KFNA 1NTMK 1JCCA 1SFCD 1JO5A 1JY2O 3WMM0 1T3JA 1IO4A 3M06A 4RESB 5AVQB 2OYHC 4C7NB 5AVTB 4N6JA 1N7LA 1WT6A 1DH3A 3V2PA 3V2RA 1SFCC 2A45G 5APQA 2BASA 2WSCH 1YTZT 4M3LA 1FOSF 4N78D 4WY4A 4ZKUA 3H32B 1ZR4A 2XKMA 1IFJA 1A02F 4W7YA 3HD7B 2I1KA 3P7KA 1RF1C 3V2QA 3HUSA 2WSEH 3L36A 1SQQK 2YO3A 1KILA 1QL2A 1S9KD 3L37A 3CL3D 2XV5A 3P8CE 1N86A 3HRNA 2WWWA 2WSFH 3UIAA 1G2CA 3B5ND 2KYVA 2CPBA 4I1LA 2R32A 1NWQA 1HGVA 3VOPA 2WT7A 1LTJA 3TYYA 1IFMA 3RL0D 3O8ZA 2ZXEB 2NPSA 3B5NC 1JOCA 4JF7A 1G1JA 1M1JB 2YNYA 2OYIC 1JY3O 4GIFA 3VMXA 3A2AA 4W7ZA 2M3BA 3RL0C 1JY2P 5AW3B 3MUDA 4WB4A 2KB7P 4GKGA 3M0AA 1KFMA 1ZN5A 3KPEA 1SFCB 1G1IA 2N1TD 3M9BA 4IFMA 3L4FA 1FJPA 1VPCA 1GK6A 2Q9IA 1PFIA 2P2UA 2N1TC 5APXA 3P8MC 4AQRD 1FZCB 3HE5A 1RF1B 2A45I 5AW4B 2YMYA 1DX7A 1CZQA 2GUVA 3KYQA 1N7SD 1FZEA 3U59A 3VTPC 3I5CA 5AW9B 2C0XA 1X79B 1N7SC 1FZFA 3B5NB 3N7NA 5AVWB 2OARA 1MV8A 1L4AA 1GL2B 2PAJA 1LT9A 3RL0B 1NOHA 2WPSA 1LTAC 3N4XA 1T2KC 3TNUA 5APSA 3HD7C 1LGHB 1RF0A 2YKQA 1ZLLA 1LTBC 3RK3D 1RE4C 1W2EA 3M9HA 1N2DC 3A7OA 1GTWA 1M7LA 3VMZA 1AFOA 4XA4A 3GHGA 1LWUB 2N1TB 1KZUB 1URQA 3RK3C 1IJDB 2I1JA 1J2JB 4AUWA 1M1JC 5BVZA 2C9NY 2YKPA 1RE3C 1Z56A 2FYUK 3V2NA 4IFFA 3L35A 5AW0B 1N7SB 1T3UA 2P67A 1CSBA 2FFDB 2OYHA 5KTBA 4WY4D 4IFDK 1SQBK 2LKMA 5AW1B 1SFCA 3M91A 3VP9A 3P8CD 1H8AA 5AVRB 1FZCC 4DOJA 1OWAA 3TSIA 2JEEA 3MTUE 2HG5D 2N9BA 1JTHA 5KJ7D 3B8EB 1LTIC 1KILD 2HPCA 2GM4A 1NHLA 3II6A 1RF1A 1NAFA 5APUA 3RK2D 3RK3B 1GU5A 1FZGA 1SQPK 2WZ7A 2C0WA 1GL2D 5KJ7C 5BU8B 2CPSA 3BVHA 4WBAA 1FU1A 3M0DA 5CCHD 2NPSD 3RK2C 1JUNA 2IFNA 2WITA 4GT1A 2XDJA 5CCGD 2R3CA 1GL2C 4LGDE 3LW5H 2ZFCA 3OAKA 5APYA 5CCHC 2NPSC 2OYIA 1IC2A 5CCGC 2HYNA 2R5DA 3A3YB 1GD2E 3KQGA 4AYCA 1RY3A 1FAVA 3E1IA 1CI6A 2XNXA 1T8ZA 3EFGA 1LWUC 1J1DC 2XU6A 4I2LC 1DEBA 1FOSE 1HJBA 4WY4B 3NFQA 1NKZB 1E5WA 2O1JA 3MIWA 2Z5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF H;  1NU1 K;  1SQX K;  1SQV K;  1NTK K;  2WSC H;  1SQP K;  3CLQ A;  1L0L K;  3M9Q A;  2OAR A;  3G3Z A;  4IFD K;  1NTZ K;  1SQB K;  2LKM A;  2O01 H;  1NTM K;  2WSE H;  2J59 M;  5KLV K;  1SQQ K;  3LW5 H;  1L0N K;  2FYU K; 
#chains in the Genus database with same CATH topology
 3L72 E;  1L0L G;  4JQ0 D;  3AE3 C;  1FZB A;  2H88 C;  3VN0 A;  3H1L G;  5AW2 B;  1QL1 A;  1L4A D;  1IFN A;  5H2F H;  1LTJ B;  3VMY A;  1NTZ D;  2OTL P;  3BCC D;  1FS0 E;  2ZYA A;  2IPP A;  3BCC J;  4GOD A;  3H25 A;  1X8Y A;  5AW7 B;  5AVU B;  3HD7 A;  2CK3 H;  3V6I A;  4EOT A;  1NJI Q;  1VQ4 P;  5E79 E;  1NTM G;  3BRT B;  4Z1M H;  1ZV8 A;  4O9B A;  1BDC A;  3L74 D;  1JM0 A;  2WSF J;  1VQN P;  5AW5 B;  3RBZ A;  3R2P A;  1M1J A;  5DJT B;  3L73 D;  3P32 A;  1EXI A;  5GTI H;  3L73 J;  1RE3 A;  1GW3 A;  1NU1 D;  2OQQ A;  1XTC C;  1NU1 J;  2O01 J;  1SQX J;  3CCR P;  1EZV I;  1L4A B;  4WY4 C;  1LT9 B;  2KZJ A;  4ASV A;  2WPV B;  4PJ0 H;  1YIJ P;  2V4H A;  3CC2 P;  3CX5 H;  1IFI A;  1LTJ C;  2AEF A;  3QH9 A;  1M1K Q;  1GL2 A;  1EZV E;  1MZ9 A;  3E1R A;  2QM7 A;  5AVX B;  3IAO A;  2E76 C;  2D2C C;  4IOI H;  1SQV D;  1Q2N A;  2WPQ A;  4I7Z B;  1ZRT D;  2JO1 A;  1H88 A;  3L72 D;  2FXM A;  2KXP B;  3D71 A;  4JPZ B;  1USE A;  5KLV K;  2N1T A;  2Q3I A;  1HF9 A;  4Y99 C;  1NTK G;  1MKM A;  1WRG A;  1CW5 A;  3HUS B;  2LR2 A;  1MFZ A;  2WPR A;  5B5E H;  5AVV B;  3H1H E;  1FJK A;  1G2C B;  1IZN B;  3AE4 C;  1YTZ I;  3OW2 O;  1OFC X;  3MP7 B;  1BGY E;  1U7J A;  3AE6 C;  4I6M C;  2B87 A;  1L4A C;  1L2P A;  1VL2 A;  4NPD A;  1M57 D;  2WSC J;  1L0L K;  3HTK A;  4K3A A;  3ABV C;  1KOR A;  4DZO A;  3SWK A;  1BCC G;  1CI6 B;  2WSE J;  3CXH I;  2QJK B;  2FKW B;  3HE5 B;  4OGQ D;  1GK4 A;  4KT0 J;  1SLQ A;  3CD6 P;  4H44 D;  4L76 A;  5DJU B;  1LTS C;  3Q5R A;  1KFN A;  1NTM K;  4C7N B;  3TDK A;  1DH3 A;  1SFC C;  2A45 G;  2BAS A;  1YTZ T;  1NTZ G;  2XKM A;  3BCC G;  1A02 F;  3T97 B;  1RF1 C;  1EZV D;  3L36 A;  3G9R A;  4MN4 C;  3L37 A;  2XV5 A;  3UIA A;  2CPB A;  3VOP A;  2Q1K A;  3TYY A;  4OGQ B;  3L74 G;  1KIL E;  4JF7 A;  3C1L A;  2O3J A;  3A2A A;  4H44 B;  3WUU A;  3L73 G;  1VQ8 P;  3RL0 C;  1JY2 P;  2QG4 A;  1YJ9 P;  1EDL A;  1NU1 G;  3M0A A;  1ZN5 A;  3KPE A;  3H1H D;  2QJK C;  3H1H J;  1FJP A;  1VPC A;  2R44 A;  1GK6 A;  1BGY D;  2N1T C;  3ZDM A;  1BGY J;  2AXC A;  1AVO A;  4L75 A;  2KUB A;  3VMA A;  4R4M A;  1R8E A;  1ZXG A;  1S1C X;  2K9J B;  4NPE A;  2QIW A;  2RKL A;  1VQM P;  4A7P A;  1N7S C;  3CME P;  2E75 D;  2K3R A;  1H0T A;  3AEC C;  2YKQ A;  1SQV G;  1RE4 C;  1M7L A;  2K1A A;  3SFE C;  3AE2 C;  3RK3 C;  4Y28 J;  2KS1 A;  2E74 C;  2BCC D;  3G71 P;  1NAY A;  2C9N Y;  2BCC J;  2YKP A;  2FYU K;  2W90 A;  5AW0 B;  2FFD B;  2OYH A;  1X0T A;  2P58 A;  5AW1 B;  3M91 A;  2E5T A;  2E75 B;  3MTU E;  5KKZ B;  3K5B A;  5KLI C;  1KIL D;  3I55 P;  2ZAE B;  1RH5 B;  1GU5 A;  4H13 D;  4U3F E;  3CCJ P;  5KJ7 C;  1OX3 A;  4BRY B;  5CCH D;  3MHV A;  2NPS D;  3RK2 C;  2QRX A;  2Q3E A;  3B4S A;  4TLF A;  3LW5 H;  2JKV A;  1EXJ A;  2OYI A;  4ZMD A;  2Y0E A;  2XNX A;  4NPF X;  1DEB A;  2RMZ A;  1LT1 A;  2O1J A;  1P84 H;  4M3L A;  3GF7 A;  1PGQ A;  1SQX K;  3HE4 A;  4JYC A;  1KIL B;  3MZW B;  1EZV G;  1N73 C;  4EI2 A;  2FFD C;  3PH0 A;  2O01 N;  2H89 C;  1GU4 A;  1W2B O;  3PLN A;  1KQF B;  2NPS B;  4PD4 H;  3EQ2 A;  1AA0 A;  3GG2 A;  5KKZ C;  1VDF A;  1S5L H;  3OJA B;  3U1C A;  4OVN F;  3FX0 A;  1QLE D;  2W8Z A;  1J1D B;  2ZXX A;  2PP6 A;  2KSE A;  2IBZ I;  3H1H G;  3NTN A;  1JCD A;  2HFE D;  5KAF H;  2HOD B;  4B86 A;  1BGY G;  5GTH H;  1HVV A;  1FBM A;  3FWN A;  3FXE A;  2H8P D;  1OVR A;  3G3Z A;  3F5H A;  4C46 A;  1FDM A;  1NH4 A;  2A45 H;  2ITA A;  2YXQ B;  4U3F D;  3MD0 A;  4ASW A;  1DD4 A;  1FZC A;  4U3F J;  1GZL A;  1KIL C;  1LTG C;  3GHG B;  4N78 E;  3B5N A;  1PP9 E;  2E76 D;  2D2C D;  1NKN A;  2QVA A;  1DIP A;  2FYZ A;  2C9L Y;  2L5G B;  1BCC J;  2BCC G;  2W83 C;  2NZ2 A;  1BDD A;  5CCG A;  1JY3 N;  2O01 H;  2IZ1 A;  1A02 J;  1Q7Y Q;  4UB6 H;  5TIS H;  2FXP A;  5H2F E;  2H7H A;  1LWU A;  1YQ3 C;  1QVG O;  3V4W A;  2AXT H;  2XZR A;  3IF4 A;  4YTP C;  3CI9 A;  1IK9 A;  1KQL A;  2Z5I A;  2E5Y A;  1JTH B;  3M9Q A;  3USS A;  2KLU A;  4R4L A;  2OTK E;  5APT A;  4K35 A;  1YYC A;  2Z5H A;  1XTG B;  1S3J A;  3KDP B;  1GW4 A;  1NTZ J;  2AEJ A;  2QEX P;  5KAI H;  2E76 B;  2D2C B;  1T2K D;  3CX5 I;  3HD7 D;  4IL6 H;  2ZT9 B;  5GTI E;  1OW7 A;  1SQQ E;  2Q6Q A;  2JJL A;  1IFD A;  1K05 A;  3AE1 C;  4Y99 B;  3GHG C;  2QJP C;  1LP1 B;  3L74 J;  5CHX A;  3SWF A;  4PV1 B;  4PJ0 E;  1X9V A;  3RK3 E;  1LJ2 A;  1U7M A;  4HYT B;  2IBZ D;  5M1B A;  1JO5 A;  1SFC D;  3CX5 E;  1IO4 A;  4RES B;  5AVQ B;  1OMI A;  2IZ0 A;  2K9Y A;  1WT6 A;  2WSC H;  4N78 D;  4ZKU A;  2N9Y B;  1PP9 D;  1IFJ A;  3HD7 B;  3AE5 C;  3HUS A;  1PP9 J;  1MFT A;  2WSE H;  1SS1 A;  2YO3 A;  3H1K E;  2WWW A;  1G2C A;  2KYV A;  4I1L A;  2R32 A;  1BE3 E;  3RL0 D;  3O8Z A;  2A06 E;  3B5N C;  1JOC A;  5B5E E;  1M1J B;  3GMA A;  3VMX A;  1SQV J;  2ZT9 C;  1KYO H;  3MUD A;  3JC2 2;  2KB7 P;  3L72 J;  3EWK A;  5B66 H;  1SFC B;  2M5A A;  2N1T D;  1D7M A;  2Q9I A;  2SPZ A;  4U3F G;  4PV1 C;  3HE5 A;  1RF1 B;  1DX7 A;  1CZQ A;  2G3A A;  1N7S D;  1OW6 A;  3VTP C;  1TU3 F;  1E79 H;  1SQQ D;  2WQY C;  4HKZ H;  1FZF A;  1SQQ J;  3N7N A;  1YHQ P;  1GL2 B;  2IYP A;  2PAJ A;  3O6Q B;  2KK7 A;  3RL0 B;  1T2K C;  3TNU A;  1R5L A;  3HD7 C;  1LGH B;  3CC4 P;  1RF0 A;  1ZLL A;  3RK3 D;  1SQP E;  3QWO C;  1W2E A;  3M9H A;  2E74 D;  1W5C E;  2FYN B;  3VMZ A;  2V7Q J;  4XA4 A;  2N1T B;  1KZU B;  1URQ A;  2MKV A;  3CX5 D;  1VQ7 P;  3A0B H;  3SFD C;  2I1J A;  3AEA C;  1M1J C;  2KNC A;  5BVZ A;  1QGK B;  1Q86 Q;  1RE3 C;  1M56 D;  3V2N A;  3CWB E;  3L35 A;  1N7S B;  4DCK A;  2B87 B;  3H1K D;  4YPC A;  4IFD K;  3H1K J;  5AVR B;  4DOJ A;  1RQU A;  3CC7 P;  1BE3 D;  5KJ7 D;  3B8E B;  1LTI C;  2A06 D;  2HPC A;  3W67 A;  2GM4 A;  3II6 A;  1BE3 J;  1ZME C;  5APU A;  3RK2 D;  3RK3 B;  3KZI H;  1ZOY C;  2C0W A;  5BU8 B;  2E74 B;  3BVH A;  4WBA A;  1JUN A;  2IFN A;  4GT1 A;  2XDJ A;  2R3C A;  1GL2 C;  4LGD E;  1GMJ A;  3L71 E;  2DW3 A;  3CXH H;  2IBZ G;  2UWJ E;  3WUV A;  3A3Y B;  1GD2 E;  3KQG A;  1RY3 A;  3H1L E;  2FYN C;  2XU6 A;  2KI7 B;  1PIX A;  1YQ4 C;  3Q2Y A;  2OYO A;  1NKZ B;  5KLI B;  3D70 A;  1YIT P;  1FDI A;  1PP9 G;  2QSI A;  4RKU J;  1NTK K;  3RK2 B;  2FBW C;  1SQP D;  1S2E A;  1KTM A;  2Z4E A;  2YKO A;  1SQP J;  2KZI A;  2E43 A;  2FY8 A;  1NYH A;  3CCV P;  3H32 A;  2O1K A;  2B9B A;  3RL0 g;  1OW8 A;  2GUS A;  3L72 G;  1Q81 Q;  3V4Q A;  1DD3 A;  3JSV C;  4XFJ A;  4JYB A;  4KHX A;  3CWB D;  3FXD A;  3PP5 A;  3ITK A;  4LLH A;  1UIX A;  3Q3D A;  4BRY A;  1KQG B;  4DJG A;  4LC1 A;  1N73 B;  1YBK A;  1USD A;  3CLQ A;  3LIE A;  2J58 A;  3C8V A;  1HGZ A;  2AEM A;  4UB8 E;  4GOF A;  4YXW H;  2HLO A;  2HR3 A;  1P84 I;  1SQQ G;  5APW A;  4L74 A;  1JY2 N;  1EDJ A;  2RH0 A;  2JDI H;  3H1J E;  2KSJ A;  2KLV A;  4C7R A;  3AE8 C;  1H0T B;  1NTZ K;  3L71 D;  4EDF A;  3A0H H;  3GLM A;  1QVF O;  3L71 J;  2KOG A;  2KS1 B;  3H1L D;  4WVZ A;  1P84 E;  1OXZ A;  2R5B A;  5L8R J;  3PRJ A;  5CCH A;  1KB9 H;  1Y9B A;  1K73 Q;  2IFM A;  2IX7 C;  5AVZ B;  1L0N E;  2OYH B;  3WUT A;  1Y47 A;  1NO4 A;  3H1K G;  4PD4 E;  1HH0 A;  3MGN A;  4XE5 B;  3H6P A;  1NU1 K;  3AE7 C;  3AED C;  1MUU A;  2HOD A;  1BE3 G;  1X22 A;  3VYI A;  2FYU E;  1N8R Q;  2WT7 B;  1K9M Q;  2QJY C;  2WSS H;  4GOE A;  4HH2 A;  1QEX A;  3OA7 A;  5GTH E;  5APV A;  1KC8 Q;  2JP3 A;  1HWT C;  2OYI B;  1JY3 P;  5BU5 A;  5AVS B;  2QE7 H;  2ZJS E;  3NMD A;  2FXO A;  4W80 A;  3V5B A;  1SQV K;  3AEB C;  3RBX A;  2H43 A;  1GDT A;  3H1J D;  5TJH A;  4WWI A;  3HE4 B;  3S1K A;  1OIP A;  1JMM A;  3H1J J;  2QA4 P;  2M0B A;  4H0L C;  2Y9Z A;  2OYH C;  4N6J A;  1SQP G;  3V2R A;  5APQ A;  3FWL A;  4WY4 A;  2BEQ D;  3EFF K;  2I8D A;  4W7Y A;  2I1K A;  1P84 D;  3V2Q A;  2QJP B;  1SQX E;  1SQQ K;  5TIS E;  3CL3 D;  3P8C E;  1N86 A;  3HRN A;  2WSF H;  3B5N D;  2AXT E;  1NWQ A;  3CWB G;  1L0N D;  2ZT9 D;  1LTJ A;  1IFM A;  1VQ6 P;  1L0N J;  1G1J A;  2YNY A;  2OYI C;  1JY3 O;  3WU2 H;  4GIF A;  2YMK A;  4W7Z A;  2M3B A;  3R4Y A;  1R5S A;  2JWA A;  3G4S P;  3M9B A;  1VF5 D;  4PV1 D;  1ZW0 A;  4L73 A;  3S9O A;  3Q1M A;  2PGD A;  1PGO A;  2FYU D;  1PFI A;  5KAI E;  2P2U A;  2FYU J;  3JCU H;  3P8M C;  1FZC B;  3PHL A;  5AW4 B;  4IL6 E;  2YMY A;  1KV4 A;  3KYQ A;  2ZYG A;  3Q5S A;  2C0X A;  3CCL P;  3L71 G;  1SQB E;  3B5N B;  2OAR A;  1MV8 A;  1L4A A;  3TGU E;  1LT9 A;  1NOH A;  2WPS A;  1LTA C;  3N4X A;  3I56 P;  1AQT A;  1S5L X;  1LWU B;  1VF5 B;  2RN0 A;  1YJN P;  2Y0C A;  1IJD B;  1KYO I;  1J2J B;  4AUW A;  1Z56 A;  2YIU B;  4IFF A;  2BEZ F;  1KQS O;  2NRG A;  2P67 A;  4OWF A;  1BSN A;  5E79 H;  4BXL A;  1SQX D;  5CBN A;  2ZVO B;  1PV3 A;  1SFC A;  3P8C D;  4QMA A;  1FZC C;  1OWA A;  3TSI A;  2HG5 D;  3CCM P;  1OVU A;  1Y8A A;  1KYO E;  1RF1 A;  5B66 E;  1IK7 A;  2V7Q H;  1UII A;  1FZG A;  1SQP K;  2WZ7 A;  1GL2 D;  2L91 A;  2IDB A;  1FU1 A;  2XND H;  3M0D A;  2WIT A;  3D6Z A;  1S72 P;  4JBZ A;  5CCG C;  1PL5 A;  3H1J G;  3O6Q A;  1CI6 A;  3EFG A;  1LWU C;  1JEK A;  1VF5 C;  1HJB A;  1JMB A;  3NFQ A;  2Y0D A;  1SQB D;  4RJT A;  2KIK A;  1QX8 A;  3MIW A;  2PFX A;  1SQB J;  3BAT A;  1VQ5 P;  1Q82 Q;  1J1E B;  4CPG A;  3TGU D;  2YIU C;  3TGU J;  4U7J A;  1OZH A;  2W6B A;  5CJ0 A;  4EIJ A;  1PPJ E;  4C7N A;  1LTT C;  1M8O B;  1N7S A;  3A0B E;  2P7J A;  2KP8 A;  1L0N G;  1K04 A;  3SWY A;  1NVO A;  2P1J A;  3BAS A;  1U57 A;  5CMZ A;  1LT9 C;  2W27 A;  3L75 E;  3F89 A;  3T97 A;  2LXB A;  3NXS A;  1FZA A;  2POH A;  2M5A B;  1RE4 A;  2J5U A;  1H89 A;  1URQ D;  4IL6 X;  1EQ7 A;  5CJ4 A;  3TK1 A;  2J59 M;  2FYU G;  2MJZ A;  1AQ5 A;  2PRR A;  2W6A A;  1ZR2 A;  4D6T E;  5AVY B;  4N3Y B;  1HTL C;  3KZI E;  3L70 E;  1EDI A;  5KLV E;  1KYO D;  3PTZ A;  4I7Z C;  1KN7 A;  1AJY A;  3HTK B;  5AW8 B;  2YO2 A;  1YI2 P;  3KXD A;  4EYY Q;  2BCC E;  1S4X A;  5AW6 B;  3TNU B;  4ZKP A;  1J1E C;  3CXH E;  3HUS C;  3H1I E;  3A5T A;  2K9J A;  1AV1 A;  1JNM A;  1URQ B;  5KJ7 A;  1SP4 A;  2VRS A;  1L0L E;  3M0D C;  2Q7C A;  2KNC B;  3U1A A;  3AEF C;  1S9K E;  3MUD C;  2Q5U A;  2K88 A;  3IFM A;  3IR9 A;  1FE6 A;  3G6E P;  4ZNC A;  1SQX G;  3VP8 A;  1YJW P;  3C9I A;  1PPJ D;  4KJM A;  1NTM E;  2HPC B;  1HBW A;  2Y9Y A;  1JB0 J;  1PZQ A;  3S4R A;  1N73 A;  3L75 D;  2FFD A;  3L75 J;  3PJS K;  3D6Y A;  2WTY A;  2JR8 A;  2QM8 A;  2K37 A;  1SVF A;  2E42 A;  3CMA P;  2OGU A;  1PGJ A;  1LNQ A;  4OH8 B;  1RF0 C;  3GW6 A;  1FC2 C;  3CPW O;  4D6T D;  5EFW B;  2M8R A;  3LID A;  3BRV B;  4D6T J;  3CWB J;  1HUC A;  1URQ C;  1L0N K;  3IN6 A;  3L70 D;  4HB1 A;  1HJ0 A;  5KLV D;  2IYO A;  3L70 J;  1KB9 I;  1ZP0 C;  5KLV J;  1DEE G;  1K8A Q;  1WMK A;  1SQB G;  4H0L D;  4OGQ C;  3TGU G;  2QJY B;  1JCC A;  1JY2 O;  2G8Y A;  1T3J A;  4H44 C;  4HJG H;  3A0H E;  3CXH D;  3M06 A;  3H1I D;  5AVT B;  1N7L A;  3H1I J;  3V2P A;  1OVV A;  1FOS F;  3H32 B;  3CCS P;  1ZR4 A;  5CBO A;  1VQO P;  2JWD A;  4PD4 I;  1L0L D;  3P7K A;  2OTJ P;  1KB9 E;  1BSH A;  1L0L J;  1RHZ B;  3CCU P;  1NTK E;  1KIL A;  1QL2 A;  1S9K D;  3KHU A;  4UB8 H;  3H1L J;  1HGV A;  4RO0 A;  2WT7 A;  2ZXE B;  2NPS A;  2LXC B;  1KMI Z;  4H0L B;  5AW3 B;  4WB4 A;  5C39 A;  1VQP P;  3GF3 A;  4GKG A;  1KFM A;  1NTM D;  1G1I A;  4IFM A;  3L4F A;  1NTM J;  1S5L E;  1BCC E;  1M90 Q;  5APX A;  4AQR D;  2A45 I;  2A06 G;  2ZYD A;  2WMM A;  2GUV A;  2R3S A;  1FZE A;  3U59 A;  3I5C A;  1EDK A;  1RQV A;  5KAF E;  5AW9 B;  3SSU A;  2B89 A;  1X79 B;  3AE9 C;  1NGM B;  5AVW B;  3W68 A;  4H13 B;  1KD1 Q;  1VQL P;  2YXR B;  5APS A;  2E75 C;  1LTB C;  1Q90 D;  4YXD C;  1N2D C;  4DT0 A;  3A7O A;  1GTW A;  1NTZ E;  1AFO A;  3GHG A;  3BCC E;  3CCE P;  1PGP A;  1VQ9 P;  1VQK P;  2WVR A;  1PPJ G;  1FDO A;  1EC5 A;  5K5G B;  3LW5 J;  2ZVN B;  2W6J H;  4TT3 H;  1T3U A;  1CSB A;  2B88 A;  3L74 E;  1KB9 D;  3L75 G;  5KTB A;  3CCQ P;  1NTK D;  4WY4 D;  1SQB K;  2LKM A;  1H8A A;  3VP9 A;  3L73 E;  3FGA D;  1NTK J;  1AVY A;  2JEE A;  1NU1 E;  3WU2 E;  2N9B A;  1JTH A;  2IBZ E;  4UB6 E;  4BWN A;  1NHL A;  1NAF A;  2M3E A;  4D6T G;  3B71 A;  2CPS A;  1T6A A;  3L70 G;  3JCU E;  5KLV G;  4PD4 D;  4H13 C;  5CCG D;  2ZFC A;  3OAK A;  5APY A;  5CCH C;  3Q5P A;  1BCC D;  2NPS C;  3TF5 A;  1IC2 A;  1IFP A;  2HYN A;  2R5D A;  4AYC A;  3E1I A;  1FAV A;  2GA1 A;  3RGU A;  1T8Z A;  3E7K A;  3AEE C;  3H1I G;  1J1D C;  4I2L C;  1LP1 A;  1FOS E;  4GDO A;  2P10 A;  4WY4 B;  1E5W A;  1SQV E;  3AEG C;  3WMM 0;  1ZRT E; 
#chains in the Genus database with same CATH homology
 3BAT A;  1J1E B;  1SQX K;  3HE4 A;  4JYC A;  1NTK K;  1KIL B;  1FZB A;  1N73 C;  3VN0 A;  2FFD C;  3RK2 B;  2W6B A;  5CJ0 A;  4EIJ A;  5AW2 B;  4C7N A;  1LTT C;  1QL1 A;  1L4A D;  1IFN A;  1N7S A;  1GU4 A;  1LTJ B;  3VMY A;  2P7J A;  2YKO A;  2Z4E A;  2KP8 A;  2NPS B;  2E43 A;  3SWY A;  2P1J A;  3BAS A;  3EQ2 A;  3H32 A;  2IPP A;  5CMZ A;  1VDF A;  2O1K A;  1LT9 C;  2W27 A;  1X8Y A;  5AW7 B;  2GUS A;  3OJA B;  3HD7 A;  5AVU B;  3U1C A;  3T97 A;  3NXS A;  4EOT A;  1FZA A;  3V4Q A;  2POH A;  1J1D B;  2PP6 A;  1RE4 A;  1H89 A;  1URQ D;  3BRT B;  4JYB A;  4KHX A;  1EQ7 A;  3NTN A;  5CJ4 A;  1JCD A;  1ZV8 A;  3PP5 A;  3TK1 A;  2HFE D;  2J59 M;  4LLH A;  2HOD B;  2MJZ A;  4O9B A;  4B86 A;  1AQ5 A;  2W6A A;  1HVV A;  5AW5 B;  1ZR2 A;  1FBM A;  3R2P A;  1M1J A;  5AVY B;  3P32 A;  4N3Y B;  4LC1 A;  1N73 B;  1HTL C;  3CLQ A;  1RE3 A;  1GW3 A;  2H8P D;  2J58 A;  1HGZ A;  3LIE A;  3G3Z A;  4C46 A;  1XTC C;  2HLO A;  1FDM A;  1NH4 A;  5APW A;  1JY2 N;  3HTK B;  2A45 H;  5AW8 B;  1L4A B;  2YO2 A;  4WY4 C;  2KSJ A;  1LT9 B;  3MD0 A;  2KLV A;  5AW6 B;  1FZC A;  4C7R A;  3TNU B;  1GZL A;  4ZKP A;  1J1E C;  3HUS C;  1KIL C;  3A5T A;  1NTZ K;  1JNM A;  1LTG C;  3GHG B;  1URQ B;  4N78 E;  5KJ7 A;  1IFI A;  1LTJ C;  2KOG A;  3B5N A;  1SP4 A;  2VRS A;  1NKN A;  3M0D C;  2Q7C A;  1GL2 A;  1OXZ A;  2FYZ A;  3U1A A;  1MZ9 A;  2L5G B;  2C9L Y;  2R5B A;  2QM7 A;  5AVX B;  5CCH A;  1S9K E;  2WPQ A;  5CCG A;  1JY3 N;  2O01 H;  1H88 A;  2IFM A;  2Q5U A;  2IX7 C;  2FXM A;  5AVZ B;  1A02 J;  2OYH B;  3IFM A;  3IR9 A;  1NO4 A;  5KLV K;  2H7H A;  1LWU A;  2N1T A;  2Q3I A;  3V4W A;  3VP8 A;  4Y99 C;  2XZR A;  1HH0 A;  3MGN A;  4XE5 B;  3CI9 A;  1WRG A;  3C9I A;  3H6P A;  1CW5 A;  1NU1 K;  3HUS B;  1IK9 A;  1KQL A;  2Z5I A;  1MFZ A;  1MUU A;  1JTH B;  2WPR A;  3M9Q A;  2HOD A;  5AVV B;  2HPC B;  1FJK A;  1G2C B;  1HBW A;  5APT A;  3VYI A;  1YYC A;  1YTZ I;  2WT7 B;  1N73 A;  1XTG B;  3KDP B;  2FFD A;  1GW4 A;  4I6M C;  4HH2 A;  1L4A C;  3OA7 A;  2WTY A;  2QM8 A;  5APV A;  1SVF A;  2E42 A;  3HTK A;  1L0L K;  1T2K D;  1HWT C;  3HD7 D;  2OYI B;  4DZO A;  4OH8 B;  1RF0 C;  1JY3 P;  5BU5 A;  5AVS B;  1CI6 B;  2JJL A;  1IFD A;  2M8R A;  3LID A;  4Y99 B;  3BRV B;  3GHG C;  3NMD A;  1HUC A;  1URQ C;  4W80 A;  3V5B A;  2FKW B;  3HE5 B;  1L0N K;  5CHX A;  3SWF A;  1SQV K;  1GK4 A;  2H43 A;  1SLQ A;  1GDT A;  1X9V A;  4HYT B;  3HE4 B;  1LTS C;  1JMM A;  1KFN A;  1NTM K;  1JCC A;  1SFC D;  1JO5 A;  1JY2 O;  3WMM 0;  1T3J A;  1IO4 A;  3M06 A;  4RES B;  5AVQ B;  2OYH C;  4C7N B;  5AVT B;  4N6J A;  1N7L A;  1WT6 A;  1DH3 A;  3V2P A;  3V2R A;  1SFC C;  2A45 G;  5APQ A;  2BAS A;  2WSC H;  1YTZ T;  4M3L A;  1FOS F;  4N78 D;  4WY4 A;  4ZKU A;  3H32 B;  1ZR4 A;  2XKM A;  1IFJ A;  1A02 F;  4W7Y A;  3HD7 B;  2I1K A;  3P7K A;  1RF1 C;  3V2Q A;  3HUS A;  2WSE H;  3L36 A;  1SQQ K;  2YO3 A;  1KIL A;  1QL2 A;  1S9K D;  3L37 A;  3CL3 D;  2XV5 A;  3P8C E;  1N86 A;  3HRN A;  2WWW A;  2WSF H;  3UIA A;  1G2C A;  3B5N D;  2KYV A;  2CPB A;  4I1L A;  2R32 A;  1NWQ A;  1HGV A;  3VOP A;  2WT7 A;  1LTJ A;  3TYY A;  1IFM A;  3RL0 D;  3O8Z A;  2ZXE B;  2NPS A;  3B5N C;  1JOC A;  4JF7 A;  1G1J A;  1M1J B;  2YNY A;  2OYI C;  1JY3 O;  4GIF A;  3VMX A;  3A2A A;  4W7Z A;  2M3B A;  3RL0 C;  1JY2 P;  5AW3 B;  3MUD A;  4WB4 A;  2KB7 P;  4GKG A;  3M0A A;  1KFM A;  1ZN5 A;  3KPE A;  1SFC B;  1G1I A;  2N1T D;  3M9B A;  4IFM A;  3L4F A;  1FJP A;  1VPC A;  1GK6 A;  2Q9I A;  1PFI A;  2P2U A;  2N1T C;  5APX A;  3P8M C;  4AQR D;  1FZC B;  3HE5 A;  1RF1 B;  2A45 I;  5AW4 B;  2YMY A;  1DX7 A;  1CZQ A;  2GUV A;  3KYQ A;  1N7S D;  1FZE A;  3U59 A;  3VTP C;  3I5C A;  5AW9 B;  2C0X A;  1X79 B;  1N7S C;  1FZF A;  3B5N B;  3N7N A;  5AVW B;  2OAR A;  1MV8 A;  1L4A A;  1GL2 B;  2PAJ A;  1LT9 A;  3RL0 B;  1NOH A;  2WPS A;  1LTA C;  3N4X A;  1T2K C;  3TNU A;  5APS A;  3HD7 C;  1LGH B;  1RF0 A;  2YKQ A;  1ZLL A;  1LTB C;  3RK3 D;  1RE4 C;  1W2E A;  3M9H A;  1N2D C;  3A7O A;  1GTW A;  1M7L A;  3VMZ A;  1AFO A;  4XA4 A;  3GHG A;  1LWU B;  2N1T B;  1KZU B;  1URQ A;  3RK3 C;  1IJD B;  2I1J A;  1J2J B;  4AUW A;  1M1J C;  5BVZ A;  2C9N Y;  2YKP A;  1RE3 C;  1Z56 A;  2FYU K;  3V2N A;  4IFF A;  3L35 A;  5AW0 B;  1N7S B;  1T3U A;  2P67 A;  1CSB A;  2FFD B;  2OYH A;  5KTB A;  4WY4 D;  4IFD K;  1SQB K;  2LKM A;  5AW1 B;  1SFC A;  3M91 A;  3VP9 A;  3P8C D;  1H8A A;  5AVR B;  1FZC C;  4DOJ A;  1OWA A;  3TSI A;  2JEE A;  3MTU E;  2HG5 D;  2N9B A;  1JTH A;  5KJ7 D;  3B8E B;  1LTI C;  1KIL D;  2HPC A;  2GM4 A;  1NHL A;  3II6 A;  1RF1 A;  1NAF A;  5APU A;  3RK2 D;  3RK3 B;  1GU5 A;  1FZG A;  1SQP K;  2WZ7 A;  2C0W A;  1GL2 D;  5KJ7 C;  5BU8 B;  2CPS A;  3BVH A;  4WBA A;  1FU1 A;  3M0D A;  5CCH D;  2NPS D;  3RK2 C;  1JUN A;  2IFN A;  2WIT A;  4GT1 A;  2XDJ A;  5CCG D;  2R3C A;  1GL2 C;  4LGD E;  3LW5 H;  2ZFC A;  3OAK A;  5APY A;  5CCH C;  2NPS C;  2OYI A;  1IC2 A;  5CCG C;  2HYN A;  2R5D A;  3A3Y B;  1GD2 E;  3KQG A;  4AYC A;  1RY3 A;  1FAV A;  3E1I A;  1CI6 A;  2XNX A;  1T8Z A;  3EFG A;  1LWU C;  1J1D C;  2XU6 A;  4I2L C;  1DEB A;  1FOS E;  1HJB A;  4WY4 B;  3NFQ A;  1NKZ B;  1E5W A;  2O1J A;  3MIW A;  2Z5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...