1UIXA

Coiled-coil structure of the rhoa-binding domain in rho-kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
GSTSDVANLANEKEELNNKLKEAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho-associated kinase
publication title Parallel coiled-coil association of the RhoA-binding domain in Rho-kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 30
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1uixA00
3FGAD 1NYHA 1TU3F 1S1CX 1UIXA 1PL5A
chains in the Genus database with same CATH superfamily
3KZIE 1KQFB 2FFDC 1JY3P 1MZ9A 3KYQA 3A5TA 3H1HD 3CCEP 3L75G 1S2EA 1DEEG 3HD7D 4RO0A 2WT7A 1P84I 2NPSA 1UIIA 4D6TG 1VQ9P 4L73A 3P8CE 1L4AB 4YPCA 3B5NB 2A06E 3IF4A 2ZAEB 3PH0A 3P7KA 3VMZA 3NFQA 4H0LB 2P7JA 2FYUG 1EC5A 1VL2A 3L75D 3CWBE 2HPCB 2G3AA 5H2FE 2ZFCA 1H8AA 4D6TD 2G8YA 1BSNA 2KK7A 4OVNF 3B4SA 2OTKE 1YYCA 1BGYJ 1H0TA 2E42A 2K37A 2WPQA 2FYUD 3EFGA 3RK2D 1SQXG 2QJYB 2OTJP 3GLMA 2IYPA 2QJKC 1IK7A 2P10A 3CLQA 2R32A 3I5CA 1NJIQ 1OW6A 5APVA 3CX5I 2L5GB 2OYHC 2OYIC 1NAYA 2JKVA 1NVOA 4GIFA 1VQ5P 3M06A 4ASWA 1SQXD 3L75J 1K73Q 3MUDA 3M9HA 1NTKD 1MKMA 1L4AA 3B5NA 1W2BO 3H1JG 4BXLA 1CZQA 1EXIA 3KPEA 4QMAA 3CMAP 1HF9A 3L37A 2XZRA 1JB0J 2HPCA 2IZ1A 1PZQA 1MFTA 3FX0A 3FGAD 3MP7B 4W7ZA 4EIJA 1FDMA 4LC1A 1HGZA 4ASVA 3RL0D 1ZV8A 1JY2P 1PGPA 2P1JA 4AUWA 2E74C 1LNQA 4EDFA 5AW9B 5K5GB 3SSUA 1DD3A 2HODB 1NTKJ 4WY4B 5AVQB 1K05A 3V5BA 1YTZI 3L72E 2WSEJ 2WPVB 3C8VA 3KXDA 3FWNA 2L91A 1JMMA 1BCCD 5KTBA 1FZBA 2Q3EA 1SQBG 1ZW0A 2BCCG 3NXSA 1S1CX 2HLOA 1LT1A 2QM7A 4IFFA 1BDDA 1JOCA 5TJHA 1FZCC 2IBZE 5L8RJ 1SQVE 5AW8B 2Q6QA 3HE4B 1S9KD 1NTMG 2KI7B 5CJ0A 1GL2C 5AW7B 1ZRTE 2QE7H 1R5SA 1RY3A 4H44B 1H88A 1KILC 4IL6X 1HGVA 2JR8A 1NOHA 3PTZA 1WT6A 2CPSA 2JO1A 1KB9D 3A0HH 3Q5PA 1BE3G 1NTMD 2ZXXA 2QJPB 2KUBA 2B9BA 1T8ZA 1BCCJ 1LT9C 2WSFH 2YO3A 3H1LG 3V2RA 3UIAA 5AVRB 1SQPJ 2HODA 1KB9I 3IAOA 4WY4A 2LKMA 2W6AA 4RJTA 3S1KA 1N7LA 1AV1A 5KLVE 1IFNA 1YJWP 2V7QH 1NU1E 1Y47A 2KYVA 3L74E 2LXBA 2M5AB 4OGQB 1RF1B 5CMZA 3H1LD 3WU2H 1CI6B 1ZMEC 1XTGB 1SQQG 3TK1A 1NYHA 3WMM0 4XA4A 3HE4A 2ZT9B 3FWLA 2BCCE 4HKZH 1M1KQ 1NTMJ 2CPBA 3V6IA 2JDIH 1VQ4P 4DCKA 2QM8A 3A0HE 3O6QB 2E76C 1JCDA 4CPGA 1OVRA 1LTJB 1L0LG 4W80A 2W8ZA 4TLFA 3CI9A 1J1EB 1WRGA 1KD1Q 2E43A 1QGKB 2H89C 1NH4A 2B88A 2YXQB 1VQMP 3H1IE 4HYTB 3WU2E 2M5AA 3CD6P 1RF1A 1JUNA 1IJDB 3HUSB 4PV1B 1SQXK 2AEMA 1CI6A 2Z4EA 1NTKK 1KN7A 1ZOYC 2IDBA 2E74D 3GHGA 2E75C 4IFMA 5GTIE 2YMKA 3FXDA 1S3JA 3CXHH 1OZHA 4HB1A 1LTJA 3LW5H 1QEXA 3TGUE 1L0NE 2QRXA 2WSCH 2BASA 4GODA 2OGUA 3AE6C 3RK3B 3RGUA 1KQSO 5M1BA 3M0DA 1J1DC 1DH3A 1Q81Q 2O01N 2IX7C 2E5TA 2QG4A 5AVZB 1SLQA 4PD4D 1KILD 3HUSA 1L2PA 4I7ZB 2KOGA 1M57D 1OVVA 4PD4I 4L75A 3TYYA 5KJ7A 1N73B 4ZNCA 3CXHE 1EZVG 2XV5A 5KAFH 1VDFA 3OA7A 4Y99C 2OARA 4JYCA 2PRRA 1FJKA 2HFED 3KHUA 1SFCB 2M0BA 3H1KG 1OFCX 2YKPA 4H13C 3WUVA 1NTMK 2KZJA 3W68A 1EZVD 5E79H 3SWFA 4N78D 1QVFO 2Q5UA 4JBZA 2RH0A 2IYOA 3Q5RA 1Q86Q 3BRTB 3VP9A 3H1KD 3S4RA 1EZVI 3L73D 2N1TB 2E76D 3MD0A 1LGHB 1XTCC 4C7RA 2BEZF 4DOJA 2P2UA 4WB4A 4EYYQ 3Q5SA 2YXRB 4HJGH 3G4SP 3MZWB 5KAFE 3RK2B 1N73A 5APSA 1OW7A 1SFCA 4KHXA 3MUDC 1BGYG 1IFMA 1L4AC 5E79E 1YBKA 3L70J 3H1KJ 1X9VA 4H0LC 1AA0A 3L73J 1VF5C 1ZLLA 4KT0J 2W6JH 1EXJA 3PP5A 3MTUE 2BEQD 4TT3H 3VMAA 2K9YA 2E75D 3CWBD 2YIUB 2WMMA 1FDOA 1P84H 2GUVA 2N1TA 1PGOA 1IK9A 1KYOI 1VQKP 1KZUB 4ZMDA 4GDOA 2AXTH 1LTIC 2M3EA 2H7HA 1FC2C 3RK3E 2QJYC 3RL0B 1A02J 1OVUA 1Z56A 1HVVA 1OW8A 4AYCA 2POHA 3AE8C 2WWWA 2O01H 2LR2A 1R5LA 3BCCE 1JEKA 1EDIA 3CWBJ 2FYNB 3GF3A 3CX5H 3V4QA 1P84E 2KLUA 2K9JB 1NTKG 2J59M 2R5BA 2Q1KA 2AXTE 3CC4P 2I8DA 1HTLC 1VQ7P 2AEFA 3H1HE 2NPSD 2FFDB 1R8EA 2ZJSE 1GU5A 1DIPA 5AVWB 2KB7P 4H13D 1M90Q 3BATA 1LTBC 3M91A 1YJNP 1AQTA 1QX8A 3OAKA 2IPPA 1FE6A 1OWAA 3TDKA 3E1IA 5KAIH 3L75E 1RQUA 1N86A 5DJUB 2C0WA 4D6TE 1AVYA 2O1JA 4K3AA 3MIWA 1IO4A 1YQ4C 4GT1A 1PGQA 1LWUB 1WMKA 3CX5E 3USSA 2FYUE 1YJ9P 1BCCG 1X8YA 2Y9YA 4RKUJ 1IC2A 5APTA 1N2DC 3K5BA 1SQPG 2K9JA 1NTZD 2QJKB 1GW4A 1ZRTD 1M1JC 1KFNA 3FXEA 4C46A 3TNUB 4LGDE 2XKMA 2Q7CA 2FFDA 3OJAB 3KQGA 2KLVA 4NPEA 3IN6A 4MN4C 2QVAA 1SQXE 5AW4B 1L4AD 3L72J 3CCUP 2O3JA 2WQYC 1W2EA 4A7PA 1JY3N 1SQPD 2WPSA 5KAIE 4H0LD 1VF5D 1PPJG 1OMIA 1M56D 2XNXA 4EI2A 3TSIA 1BSHA 2JJLA 2K88A 1EDKA 1FZEA 1SQVJ 1HBWA 1NU1D 1FZGA 3L74D 3R2PA 2W83C 1AJYA 3AEAC 1VQ6P 2KNCB 3H1JE 1NTZJ 3H32B 1LWUA 3L36A 3AE7C 2GM4A 4U3FG 5AVYB 1U57A 1PPJD 5CCHC 1Q82Q 1KB9H 3GHGC 3SFEC 3AEDC 4IFDK 2FXOA 3CCVP 2E74B 3LIEA 3II6A 3TNUA 1LTJC 4O9BA 4U3FD 2I1KA 1BDCA 3L35A 2ITAA 3AE1C 5AVXB 2A45G 2B89A 1NU1J 3M0DC 1J1EC 1RF0A 3L74J 1RE4C 3F5HA 4K35A 2YMYA 5KKZC 2R5DA 1KORA 4OWFA 1GL2B 3F89A 2KSEA 1SQBE 4Z1MH 3H1ID 4PV1C 3B71A 4GKGA 2KNCA 3H32A 5CCGA 1KB9E 2PP6A 4JYBA 5AVSB 5GTIH 1NTME 5CHXA 3NMDA 2W27A 5KJ7C 2OQQA 4U3FJ 2A45I 2AEJA 3HE5B 1LT9B 2WSFJ 3T97B 4YTPC 1FAVA 3G71P 3CCRP 1VPCA 1JY2N 1PP9G 1BE3E 4N6JA 4OH8B 1YIJP 3G9RA 2KZIA 2V7QJ 3U59A 3TGUD 3IR9A 3QH9A 1OX3A 3H1LE 2RMZA 2XDJA 3H1IJ 1ZXGA 1Q7YQ 4XFJA 1RH5B 1T3UA 1PP9D 2DW3A 1GL2A 2R3CA 4BRYB 1GD2E 1S72P 5APXA 3AEFC 1YITP 3L71G 5AVTB 3OW2O 1SQQE 1KQGB 3O6QA 2V4HA 2D2CB 2E76B 1FS0E 3I55P 1FU1A 3ZDMA 1NKNA 1FOSE 1FOSF 2MKVA 2UWJE 1SQVK 1N73C 3D6YA 3N7NA 1N7SB 3AE2C 3HE5A 3HTKB 2J58A 1LT9A 1URQB 3TGUJ 4BWNA 4I2LC 3T97A 3CXHD 4KJMA 3L71D 3V4WA 1NTZK 3AE4C 1ZR2A 2CK3H 3AEGC 1UIXA 1SFCC 1L0LE 1NWQA 3SWYA 3KDPB 1PP9J 3AEEC 1JO5A 1NHLA 3VOPA 2AXCA 4PD4H 2Y9ZA 1SQPK 4R4LA 5CCHD 3AEBC 2JWAA 5AW0B 4GOEA 2ZXEB 2QEXP 2ZYGA 2N1TC 4BRYA 1PV3A 1NU1K 5KLIB 1LJ2A 3L71J 2NPSC 4WVZA 2VRSA 3LW5J 3L70G 2WSCJ 1PGJA 3HD7B 1OIPA 1VQ8P 1N7SA 3L73G 1CSBA 3HTKA 1URQA 1G1IA 1J1DB 1T6AA 2QIWA 1DD4A 1S5LX 3CL3D 1GW3A 3L70D 4PD4E 2H8PD 4PV1D 4U7JA 3HRNA 3EWKA 2H43A 5AW6B 3CCQP 5KJ7D 1VQNP 1HJ0A 1RE3A 2WPRA 1T2KC 4DJGA 2LXCB 2W6BA 3RBXA 4AQRD 1KV4A 3CCLP 4WWIA 2KIKA 2A06G 3VTPC 1JNMA 1K04A 3CC7P 3A3YB 3S9OA 3H25A 3CWBG 2O1KA 1T3JA 2N9BA 3HD7A 4H13B 3M9BA 3B5NC 1EZVE 1QLED 3P8CD 3EQ2A 1HUCA 3NTNA 4I1LA 1DX7A 2P67A 2A06D 2WVRA 3O8ZA 1NKZB 1H89A 1N8RQ 1KYOH 3VMYA 2WZ7A 2YO2A 3H1KE 1GMJA 3L73E 3BCCD 1AFOA 1W5CE 5B5EH 3P8MC 2Q9IA 4W7YA 1G2CB 5C39A 1ZR4A 2ZVNB 1GDTA 1YTZT 3D70A 1FBMA 2OTLP 2R44A 1KFMA 3E1RA 4ZKUA 3Q3DA 1PL5A 3M0AA 1SFCD 4N3YB 3A0BH 1A02F 3AECC 2XNDH 1G1JA 3CPWO 3E7KA 3BCCJ 2C9LY 3ABVC 1KYOE 1M8OB 2N9YB 3U1CA 1RHZB 3A7OA 1VF5B 1Q90D 2YKQA 1BGYE 2N1TD 5B5EE 2HYNA 3VYIA 1EQ7A 1LWUC 2RKLA 1PFIA 3BVHA 3CX5D 1G2CA 3L72G 3SFDC 2FXPA 2J5UA 2M3BA 2YNYA 3H1HJ 3C9IA 1Y8AA 1X0TA 4YXWH 3WUTA 4WY4C 3A0BE 2IBZG 1S4XA 2WSEH 1SQVG 1TU3F 3H6PA 2FYZA 3L72D 2O01J 1EDJA 1SS1A 1CW5A 2QA4P 1NTZG 3PRJA 1RF0C 1IFIA 4RESB 4D6TJ 1GU4A 2IBZD 1SQVD 1JM0A 4L74A 4IL6H 1T2KD 1ZP0C 2SPZA 2FYUJ 3V2PA 4C7NB 4H44C 3P32A 2Y0EA 5CCGC 2IBZI 5APUA 1D7MA 5APWA 3H1JD 2OYHB 5B66H 2OYIB 2XU6A 2QJPC 5KLVG 1IZNB 1NU1G 2HG5D 2WITA 1NTKE 3B5ND 3L74G 4B86A 2C9NY 1LTAC 1SQXJ 1U7MA 1J2JB 2FXMA 2Q3IA 5EFWB 3TF5A 3RL0g 2B87B 3EFFK 5KLVD 3MHVA 4OGQC 1RF1C 1U7JA 1DEBA 5AW1B 1ZN5A 1FZFA 2E5YA 1OXZA 1AVOA 4IL6E 5DJTB 2ZT9C 3H1JJ 4GOFA 4NPFX 3GF7A 2KS1B 1X22A 4DT0A 1NTZE 1KQLA 1HWTC 1VQOP 1SQBD 4C7NA 2BCCD 1KTMA 1KC8Q 4ZKPA 1M1JB 1IFPA 5BVZA 1JY3O 5B66E 2ZYAA 1Q2NA 2KXPB 1BCCE 2OYHA 3CCMP 2OYIA 1LTGC 3ITKA 4XE5B 1E79H 2Z5IA 3H1IG 1SQPE 3M9QA 5AVVB 2K3RA 2Z5HA 5KLVJ 1YQ3C 1FZCB 1S9KE 2B87A 1BE3D 1YHQP 3U1AA 3HUSC 1SQBJ 5TISH 2BCCJ 2A45H 1PPJE 3R4YA 1KILB 3AE3C 1LTTC 2KS1A 1JCCA 3TGUG 1L0NG 1KMIZ 2FBWC 3GHGB 4R4MA 3AE9C 3VP8A 1GK4A 4WY4D 2PGDA 1M1JA 2D2CC 5BU8B 4Y28J 4U3FE 1SQQD 2GUSA 3SWKA 1USEA 2WSSH 1N7SC 4L76A 1LTSC 1L0ND 2FYUK 1URQC 1BE3J 3RK3C 1QVGO 2GA1A 5AVUB 2K1AA 3VMXA 1NO4A 5AW3B 4UB8H 1JTHB 1NGMB 2MJZA 3H1LJ 1FZCA 2P58A 3BRVB 1K9MQ 4JF7A 2IFMA 5KKZB 5GTHH 3I56P 2H88C 1L0LD 3VN0A 3V2QA 4H44D 5TISE 3W67A 4M3LA 2KP8A 2WTYA 5CCGD 1MUUA 1EDLA 2HR3A 4UB6H 1KILA 1MV8A 4EOTA 1RE3C 4I7ZC 3MGNA 1LP1B 2QSIA 3GW6A 5CCHA 5CBOA 1SQQJ 1GTWA 1JY2O 2JP3A 1VQPP 1AQ5A 2IFNA 5KLIC 4YXDC 1IFJA 1L0NJ 1FJPA 2ZYDA 3G3ZA 2FY8A 3HD7C 4OGQD 2R3SA 3AE5C 1X79B 2NRGA 4UB8E 1L0LJ 3CXHI 3LIDA 1S5LH 2PFXA 4NPDA 5GTHE 1JTHA 2ZT9D 1PP9E 1GL2D 1RE4A 4LLHA 1GK6A 1PIXA 2FKWB 2I1JA 3A2AA 5APYA 4IOIH 4UB6E 4JPZB 5KLVK 2E75B 4DZOA 2JWDA 3PLNA 1HJBA 1LP1A 4HH2A 1IFDA 3RK2C 2Y0CA 3RBZA 3L4FA 3CC2P 3L71E 5AW5B 3N4XA 1SQBK 3WUUA 1JMBA 3GMAA 5AW2B 1QL2A 3Q2YA 3CCJP 1S5LE 3JCUH 3JC22 1GZLA 1KILE 1VQLP 5CBNA 3CCSP 5APQA 5CJ4A 1MFZA 1M7LA 4WBAA 1FZAA 2C0XA 3QWOC 2KSJA 1YI2P 2YIUC 2M8RA 2IZ0A 3PHLA 3B8EB 3Q1MA 4PJ0H 2D2CD 1QL1A 3IFMA 4Y99B 4JQ0D 3RL0C 3KZIH 2PAJA 2WT7B 1N7SD 2NPSB 1FDIA 3GG2A 1URQD 3BCCG 3RK3D 3D6ZA 3CMEP 2Y0DA 3C1LA 1SP4A 4N78E 3JCUE 3BASA 1RQVA 3L70E 1HH0A 1SQQK 1SVFA 2NZ2A 3D71A 1NAFA 1H0TB 5H2FH 1L0NK 2RN0A 2JEEA 1K8AQ 2FYNC 1KYOD 3H1HG 1Y9BA 2OYOA 5BU5A 1E5WA 4PJ0E 3JSVC 2W90A 4I6MC 1P84D 1BGYD 3V2NA 2ZVOB 3G6EP 1L0LK 1USDA 3PJSK 2YKOA
chains in the Genus database with same CATH topology
3Q5PA 1KQFB 2OQQA 3AEEC 1R8EA 4H0LC 2QJPC 1EXIA 5KLIC 1HF9A 4YXDC 1VF5B 1VF5C 1DIPA 4KT0J 1Q90D 1JB0J 2WSFJ 1EXJA 1K04A 4H13D 4PV1B 3T97B 4R4LA 3AEBC 1AJYA 3FGAD 4YTPC 2BEQD 3AEAC 4TT3H 3S9OA 3R4YA 2K9YA 3H25A 2E75D 3IAOA 2YIUC 1FDOA 3AE7C 4H13B 4H13C 1ZOYC 3AE3C 4OGQD 1U57A 2IDBA 3AE5C 2E74D 3G9RA 3Q1MA 2V7QJ 3RL0g 1PV3A 2D2CD 1KMIZ 2FBWC 2E75C 4GDOA 1RQUA 4H0LB 3AE9C 4R4MA 3SFDC 3SFEC 2YMKA 3AEDC 2FXPA 4OGQB 4OGQC 2J5UA 1VL2A 2E74B 2E74C 3RK3E 2ZT9D 2G3AA 2QJYC 2D2CC 4XFJA 1YQ4C 2G8YA 4Y28J 1GMJA 1ZMEC 1FDIA 3LW5J 3Q5RA 1DD3A 1PIXA 3D6ZA 1NYHA 1K05A 1WMKA 2WSCJ 2ZT9B 2ZT9C 2WSEJ 2WPVB 1TU3F 3AE6C 1OW8A 3C8VA 3GF7A 2E76D 2E75B 4RKUJ 3AEFC 2BEZF 2O01J 3AE1C 3AE8C 5M1BA 1S1CX 1RQVA 1KTMA 2QIWA 1KQGB 3Q5SA 1DD4A 1S5LX 1NGMB 3O6QA 3GLMA 2D2CB 2E76B 2QJKC 1IK7A 2E76C 3D70A 2NZ2A 2P10A 3D71A 1OW6A 5L8RJ 5KKZC 2H88C 4PV1D 4U7JA 3Q3DA 2MKVA 1PL5A 3D6YA 1KORA 4H44D 3AE2C 2FYNC 3EWKA 3GF3A 4Z1MH 3IN6A 1Y9BA 1OW7A 1ZP0C 4PV1C 1ZRTE 3B71A 3AECC 2WQYC 3AE4C 4H44C 4H44B 3GMAA 1KILE 1HJ0A 3Q2YA 3AEGC 4IL6X 1YQ3C 1UIXA 4H0LD 4I7ZB 4I7ZC 1MKMA 2H89C 1VF5D 2QSIA 1OMIA 2JO1A 3ABVC 2JP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA D;  1NYH A;  1TU3 F;  1S1C X;  1UIX A;  1PL5 A; 
#chains in the Genus database with same CATH topology
 3KZI E;  1KQF B;  2FFD C;  1JY3 P;  1MZ9 A;  3KYQ A;  3A5T A;  3H1H D;  3CCE P;  3L75 G;  1S2E A;  1DEE G;  3HD7 D;  4RO0 A;  2WT7 A;  1P84 I;  2NPS A;  1UII A;  4D6T G;  1VQ9 P;  4L73 A;  3P8C E;  1L4A B;  4YPC A;  3B5N B;  2A06 E;  3IF4 A;  2ZAE B;  3PH0 A;  3P7K A;  3VMZ A;  3NFQ A;  4H0L B;  2P7J A;  2FYU G;  1EC5 A;  1VL2 A;  3L75 D;  3CWB E;  2HPC B;  2G3A A;  5H2F E;  2ZFC A;  1H8A A;  4D6T D;  2G8Y A;  1BSN A;  2KK7 A;  4OVN F;  3B4S A;  2OTK E;  1YYC A;  1BGY J;  1H0T A;  2E42 A;  2K37 A;  2WPQ A;  2FYU D;  3EFG A;  3RK2 D;  1SQX G;  2QJY B;  2OTJ P;  3GLM A;  2IYP A;  2QJK C;  1IK7 A;  2P10 A;  3CLQ A;  2R32 A;  3I5C A;  1NJI Q;  1OW6 A;  5APV A;  3CX5 I;  2L5G B;  2OYH C;  2OYI C;  1NAY A;  2JKV A;  1NVO A;  4GIF A;  1VQ5 P;  3M06 A;  4ASW A;  1SQX D;  3L75 J;  1K73 Q;  3MUD A;  3M9H A;  1NTK D;  1MKM A;  1L4A A;  3B5N A;  1W2B O;  3H1J G;  4BXL A;  1CZQ A;  1EXI A;  3KPE A;  4QMA A;  3CMA P;  1HF9 A;  3L37 A;  2XZR A;  1JB0 J;  2HPC A;  2IZ1 A;  1PZQ A;  1MFT A;  3FX0 A;  3FGA D;  3MP7 B;  4W7Z A;  4EIJ A;  1FDM A;  4LC1 A;  1HGZ A;  4ASV A;  3RL0 D;  1ZV8 A;  1JY2 P;  1PGP A;  2P1J A;  4AUW A;  2E74 C;  1LNQ A;  4EDF A;  5AW9 B;  5K5G B;  3SSU A;  1DD3 A;  2HOD B;  1NTK J;  4WY4 B;  5AVQ B;  1K05 A;  3V5B A;  1YTZ I;  3L72 E;  2WSE J;  2WPV B;  3C8V A;  3KXD A;  3FWN A;  2L91 A;  1JMM A;  1BCC D;  5KTB A;  1FZB A;  2Q3E A;  1SQB G;  1ZW0 A;  2BCC G;  3NXS A;  1S1C X;  2HLO A;  1LT1 A;  2QM7 A;  4IFF A;  1BDD A;  1JOC A;  5TJH A;  1FZC C;  2IBZ E;  5L8R J;  1SQV E;  5AW8 B;  2Q6Q A;  3HE4 B;  1S9K D;  1NTM G;  2KI7 B;  5CJ0 A;  1GL2 C;  5AW7 B;  1ZRT E;  2QE7 H;  1R5S A;  1RY3 A;  4H44 B;  1H88 A;  1KIL C;  4IL6 X;  1HGV A;  2JR8 A;  1NOH A;  3PTZ A;  1WT6 A;  2CPS A;  2JO1 A;  1KB9 D;  3A0H H;  3Q5P A;  1BE3 G;  1NTM D;  2ZXX A;  2QJP B;  2KUB A;  2B9B A;  1T8Z A;  1BCC J;  1LT9 C;  2WSF H;  2YO3 A;  3H1L G;  3V2R A;  3UIA A;  5AVR B;  1SQP J;  2HOD A;  1KB9 I;  3IAO A;  4WY4 A;  2LKM A;  2W6A A;  4RJT A;  3S1K A;  1N7L A;  1AV1 A;  5KLV E;  1IFN A;  1YJW P;  2V7Q H;  1NU1 E;  1Y47 A;  2KYV A;  3L74 E;  2LXB A;  2M5A B;  4OGQ B;  1RF1 B;  5CMZ A;  3H1L D;  3WU2 H;  1CI6 B;  1ZME C;  1XTG B;  1SQQ G;  3TK1 A;  1NYH A;  3WMM 0;  4XA4 A;  3HE4 A;  2ZT9 B;  3FWL A;  2BCC E;  4HKZ H;  1M1K Q;  1NTM J;  2CPB A;  3V6I A;  2JDI H;  1VQ4 P;  4DCK A;  2QM8 A;  3A0H E;  3O6Q B;  2E76 C;  1JCD A;  4CPG A;  1OVR A;  1LTJ B;  1L0L G;  4W80 A;  2W8Z A;  4TLF A;  3CI9 A;  1J1E B;  1WRG A;  1KD1 Q;  2E43 A;  1QGK B;  2H89 C;  1NH4 A;  2B88 A;  2YXQ B;  1VQM P;  3H1I E;  4HYT B;  3WU2 E;  2M5A A;  3CD6 P;  1RF1 A;  1JUN A;  1IJD B;  3HUS B;  4PV1 B;  1SQX K;  2AEM A;  1CI6 A;  2Z4E A;  1NTK K;  1KN7 A;  1ZOY C;  2IDB A;  2E74 D;  3GHG A;  2E75 C;  4IFM A;  5GTI E;  2YMK A;  3FXD A;  1S3J A;  3CXH H;  1OZH A;  4HB1 A;  1LTJ A;  3LW5 H;  1QEX A;  3TGU E;  1L0N E;  2QRX A;  2WSC H;  2BAS A;  4GOD A;  2OGU A;  3AE6 C;  3RK3 B;  3RGU A;  1KQS O;  5M1B A;  3M0D A;  1J1D C;  1DH3 A;  1Q81 Q;  2O01 N;  2IX7 C;  2E5T A;  2QG4 A;  5AVZ B;  1SLQ A;  4PD4 D;  1KIL D;  3HUS A;  1L2P A;  4I7Z B;  2KOG A;  1M57 D;  1OVV A;  4PD4 I;  4L75 A;  3TYY A;  5KJ7 A;  1N73 B;  4ZNC A;  3CXH E;  1EZV G;  2XV5 A;  5KAF H;  1VDF A;  3OA7 A;  4Y99 C;  2OAR A;  4JYC A;  2PRR A;  1FJK A;  2HFE D;  3KHU A;  1SFC B;  2M0B A;  3H1K G;  1OFC X;  2YKP A;  4H13 C;  3WUV A;  1NTM K;  2KZJ A;  3W68 A;  1EZV D;  5E79 H;  3SWF A;  4N78 D;  1QVF O;  2Q5U A;  4JBZ A;  2RH0 A;  2IYO A;  3Q5R A;  1Q86 Q;  3BRT B;  3VP9 A;  3H1K D;  3S4R A;  1EZV I;  3L73 D;  2N1T B;  2E76 D;  3MD0 A;  1LGH B;  1XTC C;  4C7R A;  2BEZ F;  4DOJ A;  2P2U A;  4WB4 A;  4EYY Q;  3Q5S A;  2YXR B;  4HJG H;  3G4S P;  3MZW B;  5KAF E;  3RK2 B;  1N73 A;  5APS A;  1OW7 A;  1SFC A;  4KHX A;  3MUD C;  1BGY G;  1IFM A;  1L4A C;  5E79 E;  1YBK A;  3L70 J;  3H1K J;  1X9V A;  4H0L C;  1AA0 A;  3L73 J;  1VF5 C;  1ZLL A;  4KT0 J;  2W6J H;  1EXJ A;  3PP5 A;  3MTU E;  2BEQ D;  4TT3 H;  3VMA A;  2K9Y A;  2E75 D;  3CWB D;  2YIU B;  2WMM A;  1FDO A;  1P84 H;  2GUV A;  2N1T A;  1PGO A;  1IK9 A;  1KYO I;  1VQK P;  1KZU B;  4ZMD A;  4GDO A;  2AXT H;  1LTI C;  2M3E A;  2H7H A;  1FC2 C;  3RK3 E;  2QJY C;  3RL0 B;  1A02 J;  1OVU A;  1Z56 A;  1HVV A;  1OW8 A;  4AYC A;  2POH A;  3AE8 C;  2WWW A;  2O01 H;  2LR2 A;  1R5L A;  3BCC E;  1JEK A;  1EDI A;  3CWB J;  2FYN B;  3GF3 A;  3CX5 H;  3V4Q A;  1P84 E;  2KLU A;  2K9J B;  1NTK G;  2J59 M;  2R5B A;  2Q1K A;  2AXT E;  3CC4 P;  2I8D A;  1HTL C;  1VQ7 P;  2AEF A;  3H1H E;  2NPS D;  2FFD B;  1R8E A;  2ZJS E;  1GU5 A;  1DIP A;  5AVW B;  2KB7 P;  4H13 D;  1M90 Q;  3BAT A;  1LTB C;  3M91 A;  1YJN P;  1AQT A;  1QX8 A;  3OAK A;  2IPP A;  1FE6 A;  1OWA A;  3TDK A;  3E1I A;  5KAI H;  3L75 E;  1RQU A;  1N86 A;  5DJU B;  2C0W A;  4D6T E;  1AVY A;  2O1J A;  4K3A A;  3MIW A;  1IO4 A;  1YQ4 C;  4GT1 A;  1PGQ A;  1LWU B;  1WMK A;  3CX5 E;  3USS A;  2FYU E;  1YJ9 P;  1BCC G;  1X8Y A;  2Y9Y A;  4RKU J;  1IC2 A;  5APT A;  1N2D C;  3K5B A;  1SQP G;  2K9J A;  1NTZ D;  2QJK B;  1GW4 A;  1ZRT D;  1M1J C;  1KFN A;  3FXE A;  4C46 A;  3TNU B;  4LGD E;  2XKM A;  2Q7C A;  2FFD A;  3OJA B;  3KQG A;  2KLV A;  4NPE A;  3IN6 A;  4MN4 C;  2QVA A;  1SQX E;  5AW4 B;  1L4A D;  3L72 J;  3CCU P;  2O3J A;  2WQY C;  1W2E A;  4A7P A;  1JY3 N;  1SQP D;  2WPS A;  5KAI E;  4H0L D;  1VF5 D;  1PPJ G;  1OMI A;  1M56 D;  2XNX A;  4EI2 A;  3TSI A;  1BSH A;  2JJL A;  2K88 A;  1EDK A;  1FZE A;  1SQV J;  1HBW A;  1NU1 D;  1FZG A;  3L74 D;  3R2P A;  2W83 C;  1AJY A;  3AEA C;  1VQ6 P;  2KNC B;  3H1J E;  1NTZ J;  3H32 B;  1LWU A;  3L36 A;  3AE7 C;  2GM4 A;  4U3F G;  5AVY B;  1U57 A;  1PPJ D;  5CCH C;  1Q82 Q;  1KB9 H;  3GHG C;  3SFE C;  3AED C;  4IFD K;  2FXO A;  3CCV P;  2E74 B;  3LIE A;  3II6 A;  3TNU A;  1LTJ C;  4O9B A;  4U3F D;  2I1K A;  1BDC A;  3L35 A;  2ITA A;  3AE1 C;  5AVX B;  2A45 G;  2B89 A;  1NU1 J;  3M0D C;  1J1E C;  1RF0 A;  3L74 J;  1RE4 C;  3F5H A;  4K35 A;  2YMY A;  5KKZ C;  2R5D A;  1KOR A;  4OWF A;  1GL2 B;  3F89 A;  2KSE A;  1SQB E;  4Z1M H;  3H1I D;  4PV1 C;  3B71 A;  4GKG A;  2KNC A;  3H32 A;  5CCG A;  1KB9 E;  2PP6 A;  4JYB A;  5AVS B;  5GTI H;  1NTM E;  5CHX A;  3NMD A;  2W27 A;  5KJ7 C;  2OQQ A;  4U3F J;  2A45 I;  2AEJ A;  3HE5 B;  1LT9 B;  2WSF J;  3T97 B;  4YTP C;  1FAV A;  3G71 P;  3CCR P;  1VPC A;  1JY2 N;  1PP9 G;  1BE3 E;  4N6J A;  4OH8 B;  1YIJ P;  3G9R A;  2KZI A;  2V7Q J;  3U59 A;  3TGU D;  3IR9 A;  3QH9 A;  1OX3 A;  3H1L E;  2RMZ A;  2XDJ A;  3H1I J;  1ZXG A;  1Q7Y Q;  4XFJ A;  1RH5 B;  1T3U A;  1PP9 D;  2DW3 A;  1GL2 A;  2R3C A;  4BRY B;  1GD2 E;  1S72 P;  5APX A;  3AEF C;  1YIT P;  3L71 G;  5AVT B;  3OW2 O;  1SQQ E;  1KQG B;  3O6Q A;  2V4H A;  2D2C B;  2E76 B;  1FS0 E;  3I55 P;  1FU1 A;  3ZDM A;  1NKN A;  1FOS E;  1FOS F;  2MKV A;  2UWJ E;  1SQV K;  1N73 C;  3D6Y A;  3N7N A;  1N7S B;  3AE2 C;  3HE5 A;  3HTK B;  2J58 A;  1LT9 A;  1URQ B;  3TGU J;  4BWN A;  4I2L C;  3T97 A;  3CXH D;  4KJM A;  3L71 D;  3V4W A;  1NTZ K;  3AE4 C;  1ZR2 A;  2CK3 H;  3AEG C;  1UIX A;  1SFC C;  1L0L E;  1NWQ A;  3SWY A;  3KDP B;  1PP9 J;  3AEE C;  1JO5 A;  1NHL A;  3VOP A;  2AXC A;  4PD4 H;  2Y9Z A;  1SQP K;  4R4L A;  5CCH D;  3AEB C;  2JWA A;  5AW0 B;  4GOE A;  2ZXE B;  2QEX P;  2ZYG A;  2N1T C;  4BRY A;  1PV3 A;  1NU1 K;  5KLI B;  1LJ2 A;  3L71 J;  2NPS C;  4WVZ A;  2VRS A;  3LW5 J;  3L70 G;  2WSC J;  1PGJ A;  3HD7 B;  1OIP A;  1VQ8 P;  1N7S A;  3L73 G;  1CSB A;  3HTK A;  1URQ A;  1G1I A;  1J1D B;  1T6A A;  2QIW A;  1DD4 A;  1S5L X;  3CL3 D;  1GW3 A;  3L70 D;  4PD4 E;  2H8P D;  4PV1 D;  4U7J A;  3HRN A;  3EWK A;  2H43 A;  5AW6 B;  3CCQ P;  5KJ7 D;  1VQN P;  1HJ0 A;  1RE3 A;  2WPR A;  1T2K C;  4DJG A;  2LXC B;  2W6B A;  3RBX A;  4AQR D;  1KV4 A;  3CCL P;  4WWI A;  2KIK A;  2A06 G;  3VTP C;  1JNM A;  1K04 A;  3CC7 P;  3A3Y B;  3S9O A;  3H25 A;  3CWB G;  2O1K A;  1T3J A;  2N9B A;  3HD7 A;  4H13 B;  3M9B A;  3B5N C;  1EZV E;  1QLE D;  3P8C D;  3EQ2 A;  1HUC A;  3NTN A;  4I1L A;  1DX7 A;  2P67 A;  2A06 D;  2WVR A;  3O8Z A;  1NKZ B;  1H89 A;  1N8R Q;  1KYO H;  3VMY A;  2WZ7 A;  2YO2 A;  3H1K E;  1GMJ A;  3L73 E;  3BCC D;  1AFO A;  1W5C E;  5B5E H;  3P8M C;  2Q9I A;  4W7Y A;  1G2C B;  5C39 A;  1ZR4 A;  2ZVN B;  1GDT A;  1YTZ T;  3D70 A;  1FBM A;  2OTL P;  2R44 A;  1KFM A;  3E1R A;  4ZKU A;  3Q3D A;  1PL5 A;  3M0A A;  1SFC D;  4N3Y B;  3A0B H;  1A02 F;  3AEC C;  2XND H;  1G1J A;  3CPW O;  3E7K A;  3BCC J;  2C9L Y;  3ABV C;  1KYO E;  1M8O B;  2N9Y B;  3U1C A;  1RHZ B;  3A7O A;  1VF5 B;  1Q90 D;  2YKQ A;  1BGY E;  2N1T D;  5B5E E;  2HYN A;  3VYI A;  1EQ7 A;  1LWU C;  2RKL A;  1PFI A;  3BVH A;  3CX5 D;  1G2C A;  3L72 G;  3SFD C;  2FXP A;  2J5U A;  2M3B A;  2YNY A;  3H1H J;  3C9I A;  1Y8A A;  1X0T A;  4YXW H;  3WUT A;  4WY4 C;  3A0B E;  2IBZ G;  1S4X A;  2WSE H;  1SQV G;  1TU3 F;  3H6P A;  2FYZ A;  3L72 D;  2O01 J;  1EDJ A;  1SS1 A;  1CW5 A;  2QA4 P;  1NTZ G;  3PRJ A;  1RF0 C;  1IFI A;  4RES B;  4D6T J;  1GU4 A;  2IBZ D;  1SQV D;  1JM0 A;  4L74 A;  4IL6 H;  1T2K D;  1ZP0 C;  2SPZ A;  2FYU J;  3V2P A;  4C7N B;  4H44 C;  3P32 A;  2Y0E A;  5CCG C;  2IBZ I;  5APU A;  1D7M A;  5APW A;  3H1J D;  2OYH B;  5B66 H;  2OYI B;  2XU6 A;  2QJP C;  5KLV G;  1IZN B;  1NU1 G;  2HG5 D;  2WIT A;  1NTK E;  3B5N D;  3L74 G;  4B86 A;  2C9N Y;  1LTA C;  1SQX J;  1U7M A;  1J2J B;  2FXM A;  2Q3I A;  5EFW B;  3TF5 A;  3RL0 g;  2B87 B;  3EFF K;  5KLV D;  3MHV A;  4OGQ C;  1RF1 C;  1U7J A;  1DEB A;  5AW1 B;  1ZN5 A;  1FZF A;  2E5Y A;  1OXZ A;  1AVO A;  4IL6 E;  5DJT B;  2ZT9 C;  3H1J J;  4GOF A;  4NPF X;  3GF7 A;  2KS1 B;  1X22 A;  4DT0 A;  1NTZ E;  1KQL A;  1HWT C;  1VQO P;  1SQB D;  4C7N A;  2BCC D;  1KTM A;  1KC8 Q;  4ZKP A;  1M1J B;  1IFP A;  5BVZ A;  1JY3 O;  5B66 E;  2ZYA A;  1Q2N A;  2KXP B;  1BCC E;  2OYH A;  3CCM P;  2OYI A;  1LTG C;  3ITK A;  4XE5 B;  1E79 H;  2Z5I A;  3H1I G;  1SQP E;  3M9Q A;  5AVV B;  2K3R A;  2Z5H A;  5KLV J;  1YQ3 C;  1FZC B;  1S9K E;  2B87 A;  1BE3 D;  1YHQ P;  3U1A A;  3HUS C;  1SQB J;  5TIS H;  2BCC J;  2A45 H;  1PPJ E;  3R4Y A;  1KIL B;  3AE3 C;  1LTT C;  2KS1 A;  1JCC A;  3TGU G;  1L0N G;  1KMI Z;  2FBW C;  3GHG B;  4R4M A;  3AE9 C;  3VP8 A;  1GK4 A;  4WY4 D;  2PGD A;  1M1J A;  2D2C C;  5BU8 B;  4Y28 J;  4U3F E;  1SQQ D;  2GUS A;  3SWK A;  1USE A;  2WSS H;  1N7S C;  4L76 A;  1LTS C;  1L0N D;  2FYU K;  1URQ C;  1BE3 J;  3RK3 C;  1QVG O;  2GA1 A;  5AVU B;  2K1A A;  3VMX A;  1NO4 A;  5AW3 B;  4UB8 H;  1JTH B;  1NGM B;  2MJZ A;  3H1L J;  1FZC A;  2P58 A;  3BRV B;  1K9M Q;  4JF7 A;  2IFM A;  5KKZ B;  5GTH H;  3I56 P;  2H88 C;  1L0L D;  3VN0 A;  3V2Q A;  4H44 D;  5TIS E;  3W67 A;  4M3L A;  2KP8 A;  2WTY A;  5CCG D;  1MUU A;  1EDL A;  2HR3 A;  4UB6 H;  1KIL A;  1MV8 A;  4EOT A;  1RE3 C;  4I7Z C;  3MGN A;  1LP1 B;  2QSI A;  3GW6 A;  5CCH A;  5CBO A;  1SQQ J;  1GTW A;  1JY2 O;  2JP3 A;  1VQP P;  1AQ5 A;  2IFN A;  5KLI C;  4YXD C;  1IFJ A;  1L0N J;  1FJP A;  2ZYD A;  3G3Z A;  2FY8 A;  3HD7 C;  4OGQ D;  2R3S A;  3AE5 C;  1X79 B;  2NRG A;  4UB8 E;  1L0L J;  3CXH I;  3LID A;  1S5L H;  2PFX A;  4NPD A;  5GTH E;  1JTH A;  2ZT9 D;  1PP9 E;  1GL2 D;  1RE4 A;  4LLH A;  1GK6 A;  1PIX A;  2FKW B;  2I1J A;  3A2A A;  5APY A;  4IOI H;  4UB6 E;  4JPZ B;  5KLV K;  2E75 B;  4DZO A;  2JWD A;  3PLN A;  1HJB A;  1LP1 A;  4HH2 A;  1IFD A;  3RK2 C;  2Y0C A;  3RBZ A;  3L4F A;  3CC2 P;  3L71 E;  5AW5 B;  3N4X A;  1SQB K;  3WUU A;  1JMB A;  3GMA A;  5AW2 B;  1QL2 A;  3Q2Y A;  3CCJ P;  1S5L E;  3JCU H;  3JC2 2;  1GZL A;  1KIL E;  1VQL P;  5CBN A;  3CCS P;  5APQ A;  5CJ4 A;  1MFZ A;  1M7L A;  4WBA A;  1FZA A;  2C0X A;  3QWO C;  2KSJ A;  1YI2 P;  2YIU C;  2M8R A;  2IZ0 A;  3PHL A;  3B8E B;  3Q1M A;  4PJ0 H;  2D2C D;  1QL1 A;  3IFM A;  4Y99 B;  4JQ0 D;  3RL0 C;  3KZI H;  2PAJ A;  2WT7 B;  1N7S D;  2NPS B;  1FDI A;  3GG2 A;  1URQ D;  3BCC G;  3RK3 D;  3D6Z A;  3CME P;  2Y0D A;  3C1L A;  1SP4 A;  4N78 E;  3JCU E;  3BAS A;  1RQV A;  3L70 E;  1HH0 A;  1SQQ K;  1SVF A;  2NZ2 A;  3D71 A;  1NAF A;  1H0T B;  5H2F H;  1L0N K;  2RN0 A;  2JEE A;  1K8A Q;  2FYN C;  1KYO D;  3H1H G;  1Y9B A;  2OYO A;  5BU5 A;  1E5W A;  4PJ0 E;  3JSV C;  2W90 A;  4I6M C;  1P84 D;  1BGY D;  3V2N A;  2ZVO B;  3G6E P;  1L0L K;  1USD A;  3PJS K;  2YKO A; 
#chains in the Genus database with same CATH homology
 3Q5P A;  1KQF B;  2OQQ A;  3AEE C;  1R8E A;  4H0L C;  2QJP C;  1EXI A;  5KLI C;  1HF9 A;  4YXD C;  1VF5 B;  1VF5 C;  1DIP A;  4KT0 J;  1Q90 D;  1JB0 J;  2WSF J;  1EXJ A;  1K04 A;  4H13 D;  4PV1 B;  3T97 B;  4R4L A;  3AEB C;  1AJY A;  3FGA D;  4YTP C;  2BEQ D;  3AEA C;  4TT3 H;  3S9O A;  3R4Y A;  2K9Y A;  3H25 A;  2E75 D;  3IAO A;  2YIU C;  1FDO A;  3AE7 C;  4H13 B;  4H13 C;  1ZOY C;  3AE3 C;  4OGQ D;  1U57 A;  2IDB A;  3AE5 C;  2E74 D;  3G9R A;  3Q1M A;  2V7Q J;  3RL0 g;  1PV3 A;  2D2C D;  1KMI Z;  2FBW C;  2E75 C;  4GDO A;  1RQU A;  4H0L B;  3AE9 C;  4R4M A;  3SFD C;  3SFE C;  2YMK A;  3AED C;  2FXP A;  4OGQ B;  4OGQ C;  2J5U A;  1VL2 A;  2E74 B;  2E74 C;  3RK3 E;  2ZT9 D;  2G3A A;  2QJY C;  2D2C C;  4XFJ A;  1YQ4 C;  2G8Y A;  4Y28 J;  1GMJ A;  1ZME C;  1FDI A;  3LW5 J;  3Q5R A;  1DD3 A;  1PIX A;  3D6Z A;  1NYH A;  1K05 A;  1WMK A;  2WSC J;  2ZT9 B;  2ZT9 C;  2WSE J;  2WPV B;  1TU3 F;  3AE6 C;  1OW8 A;  3C8V A;  3GF7 A;  2E76 D;  2E75 B;  4RKU J;  3AEF C;  2BEZ F;  2O01 J;  3AE1 C;  3AE8 C;  5M1B A;  1S1C X;  1RQV A;  1KTM A;  2QIW A;  1KQG B;  3Q5S A;  1DD4 A;  1S5L X;  1NGM B;  3O6Q A;  3GLM A;  2D2C B;  2E76 B;  2QJK C;  1IK7 A;  2E76 C;  3D70 A;  2NZ2 A;  2P10 A;  3D71 A;  1OW6 A;  5L8R J;  5KKZ C;  2H88 C;  4PV1 D;  4U7J A;  3Q3D A;  2MKV A;  1PL5 A;  3D6Y A;  1KOR A;  4H44 D;  3AE2 C;  2FYN C;  3EWK A;  3GF3 A;  4Z1M H;  3IN6 A;  1Y9B A;  1OW7 A;  1ZP0 C;  4PV1 C;  1ZRT E;  3B71 A;  3AEC C;  2WQY C;  3AE4 C;  4H44 C;  4H44 B;  3GMA A;  1KIL E;  1HJ0 A;  3Q2Y A;  3AEG C;  4IL6 X;  1YQ3 C;  1UIX A;  4H0L D;  4I7Z B;  4I7Z C;  1MKM A;  2H89 C;  1VF5 D;  2QSI A;  1OMI A;  2JO1 A;  3ABV C;  2JP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...