1UIXA

Coiled-coil structure of the rhoa-binding domain in rho-kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
GSTSDVANLANEKEELNNKLKEAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Rho-associated kinase
publication title Parallel coiled-coil association of the RhoA-binding domain in Rho-kinase
pubmed doi rcsb
source organism Bos taurus
total genus 30
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1uixA00
3FGAD 1PL5A 1UIXA 1NYHA 1S1CX 1TU3F
chains in the Genus database with same CATH superfamily
3L75G 1E5WA 1NHLA 5C39A 1SQXJ 1RF1A 1ZR2A 1VF5D 2CK3H 1OX3A 1SFCD 2P7JA 3AE6C 2JWAA 5AW4B 1BCCJ 4D6TD 1IC2A 1PP9J 1L0LJ 1IZNB 3CX5H 2H43A 3AE4C 3LW5J 3KZIH 1JEKA 1EQ7A 2FBWC 1KQSO 4XA4A 2ZT9B 3H1KE 3CCEP 3GF3A 1KYOE 1PV3A 1BE3J 1T2KC 1URQB 2R3CA 2D2CB 2FFDA 5KAFH 1NU1G 3L74J 2KSEA 1H0TA 1HBWA 5KAIE 3H1KG 3H32A 1BCCE 1DD4A 1FOSF 3TK1A 5KLVJ 1EZVI 5GTHH 1RE3C 1EXJA 2A06E 1T3JA 1QVFO 1YI2P 2JDIH 3OA7A 3CC2P 1USEA 4HKZH 5CCGD 1VQ6P 1KTMA 1JTHA 5AW7B 4H0LC 2WMMA 1BE3E 3VTPC 3M0DA 3L72J 4OWFA 3RK2C 3AE1C 2YKQA 2QJKC 1GTWA 2C9NY 1JCDA 2ITAA 4OGQD 2N9BA 1EZVG 2KS1B 1FS0E 4BXLA 3WMM0 3SSUA 3AECC 1USDA 1VPCA 3CX5E 1P84D 2K1AA 3VMYA 1WT6A 3W67A 1VF5B 4GKGA 3BVHA 2K3RA 1SFCB 3KZIE 1PGJA 1YJWP 4K35A 1OXZA 1SQPK 1EDKA 2KNCB 2E42A 5L8RJ 5KAFE 2FXPA 3L71J 1FBMA 3OAKA 1N7SC 1RF0C 3L73D 1EDLA 3B5NA 3A2AA 3HUSB 5GTHE 1QL2A 5AW0B 2P2UA 2QSIA 1LTBC 1VQMP 1BGYJ 2ZFCA 3Q5SA 4LC1A 1HH0A 2W6JH 1SQQK 4PV1D 3H1IJ 3BASA 1NTZK 3U1AA 2KUBA 4D6TE 3LIDA 3M06A 2L5GB 1M1JA 3F5HA 3H1JJ 4N3YB 1X9VA 2ZYDA 3L71E 4H0LD 2Q3IA 4WVZA 2QJPB 5APVA 1NKNA 3VMXA 4B86A 2OTJP 2K37A 4H44D 4C46A 4D6TG 1GDTA 4H13C 2FYUD 1W2EA 4RO0A 5APUA 1HGVA 3M0AA 3PH0A 4U3FG 1LJ2A 3A3YB 4GOFA 1URQA 5E79H 3M9BA 1KB9D 1KQFB 3MTUE 2WPQA 2Q1KA 1FJKA 1JOCA 3NTNA 3HE4B 4NPDA 4HYTB 2O01N 1OW7A 1Q90D 2HODA 4WWIA 2E75C 2A45G 3H6PA 2KP8A 1E79H 5AVZB 2Z5HA 2I8DA 2W27A 1LT9C 3AEBC 1L0ND 1ZXGA 3CI9A 4YTPC 3IN6A 2YIUB 1SQVK 4GIFA 3WU2E 2KZJA 3H1LD 1IFJA 1P84I 3TGUD 1PGPA 2OTKE 1GL2B 5APYA 1S5LX 1HGZA 3MUDC 4Y99B 1JY2P 4W80A 1JM0A 3PTZA 3BRVB 1KC8Q 3BATA 1K73Q 1KQGB 3TNUA 3S1KA 5AW9B 2KS1A 2I1KA 3TSIA 1KB9H 2WSEH 3CXHD 4LLHA 1SQQJ 2IBZD 5B5EH 3I55P 1N73C 3IFMA 3HTKB 2Y0DA 2ZT9C 3L73E 2BCCJ 1Q82Q 3C9IA 1YYCA 2NPSC 2E74D 4K3AA 1VQ5P 2Y9ZA 1G2CB 3HUSA 3II6A 1QL1A 2XU6A 1DIPA 1JY2O 4JPZB 2E76D 3L73G 3MZWB 4I2LC 4JBZA 3CCRP 2WSEJ 3GG2A 2HYNA 2J58A 3G9RA 1X22A 3CWBD 1NTMD 2SPZA 1PFIA 2H89C 1SVFA 1GD2E 3AE3C 2FYNB 3RL0D 4AUWA 1SQXK 3JSVC 1KORA 3B5ND 1NU1D 1BSHA 2FYUE 5AVRB 5CBOA 2FFDB 2QIWA 2YMYA 3BCCD 2HLOA 1KB9E 1H0TB 5BVZA 3RBZA 1SQVJ 1T6AA 2Z5IA 4N78D 2KLVA 4TT3H 3WUUA 4IL6H 4Y28J 1VF5C 5EFWB 3PRJA 4JQ0D 1SFCC 3GF7A 1RY3A 1L0NE 2OARA 1JTHB 1RE4A 2R44A 2KZIA 3NFQA 3H1LE 3K5BA 3TGUE 3L75J 1URQD 1L0NG 2D2CD 2FY8A 1KD1Q 1FOSE 1PPJD 2WSSH 1GL2A 2ZAEB 4ZMDA 1NAFA 3CXHI 3TDKA 2K9JB 2DW3A 1DEBA 2KB7P 3TGUG 2E74B 3HD7B 3AE2C 3UIAA 2KLUA 2R5DA 4EIJA 2Y0CA 5M1BA 2IZ0A 1LWUB 2XNXA 1JB0J 2WSCH 5CCHA 1M7LA 1X8YA 1DEEG 1GK6A 4RKUJ 1SS1A 3T97A 5KAIH 4UB8H 2V4HA 3W68A 3L75E 1FDIA 1X0TA 4M3LA 2IBZE 1HWTC 3RL0B 3PJSK 5CCGC 1IFMA 1J1DB 3VMZA 4ZKUA 3CMAP 3CD6P 1QEXA 3A5TA 4IL6E 3CCSP 3H1KJ 2IBZG 3HE5B 1G2CA 3R4YA 1SQBD 2HPCA 1NTKD 1AV1A 2WSCJ 4KT0J 1SLQA 2HG5D 3RK3B 4OGQC 3CWBE 3EFGA 1NTME 2POHA 2V7QH 1M1KQ 1M1JB 1OFCX 3M91A 2N1TA 2W6AA 2W90A 1S4XA 3IR9A 3A7OA 3PLNA 2WTYA 3CWBG 2YIUC 4U3FD 1NTMG 1PZQA 3VOPA 1NU1E 1MUUA 1MKMA 1M56D 2VRSA 1FAVA 3D6YA 4DOJA 2IZ1A 5AW2B 1L4AA 3P32A 1GL2C 1SP4A 2KOGA 2Y0EA 2Q7CA 3BCCE 1IK9A 2GA1A 1K8AQ 2ZYGA 3BRTB 1FZGA 4N78E 1GMJA 4WY4B 2HODB 1AQTA 4UB8E 2JO1A 4IL6X 1VDFA 4JYBA 3BCCG 3NMDA 2LR2A 3USSA 1JMMA 3WUTA 2M0BA 3OW2O 4PV1C 4IFFA 3PP5A 3CCUP 3AE9C 1YJ9P 1AA0A 1EZVE 3VP8A 1MZ9A 2YXQB 1PPJE 1RQVA 4H44C 1Y9BA 3TNUB 1RF1C 2WPSA 2K9JA 3E1IA 3HD7A 1KMIZ 1PPJG 1GW3A 2YKOA 1NYHA 3Q5PA 5KJ7A 2J5UA 1IK7A 4NPFX 2IYPA 4BRYA 2A45H 5TISH 1VQPP 1LWUA 1JY3P 1Y8AA 3KYQA 1HJBA 2AEFA 4D6TJ 1LTAC 1NGMB 3CCMP 2FYNC 4PD4I 1GL2D 1PL5A 2R5BA 2OYIA 2JJLA 4U3FJ 1IO4A 3P7KA 2ZXXA 3ABVC 3S4RA 2FFDC 3NXSA 3WU2H 2OYHA 4QMAA 2WQYC 5B66E 1NTKE 3SWFA 3HE5A 1Q7YQ 5CCHD 1HVVA 3RGUA 1LTTC 3Q5RA 1OVVA 1SQPD 2B9BA 1G1JA 1LTSC 1SQBG 1NTKG 4L75A 4WB4A 1AVYA 1KQLA 4TLFA 1M57D 3CMEP 1S9KD 2FYUK 1KILB 4U3FE 1P84H 3CLQA 1S3JA 3M0DC 4DZOA 5AVXB 3RL0g 3L70D 1BDDA 3B4SA 1NTZD 2WZ7A 1HF9A 2W6BA 5TISE 4L74A 1ZLLA 3V4WA 1YTZI 1FZCB 2E74C 2QEXP 1IFIA 4WY4A 2BASA 2N1TD 3N4XA 4HB1A 1JCCA 3MIWA 2E76C 3V2PA 2LKMA 2JR8A 4W7YA 2H7HA 1U7MA 5BU8B 5CBNA 1L4AD 1LTJA 2B89A 5AVWB 1A02J 3RL0C 1KZUB 2RN0A 3H1IG 1J1DC 1OIPA 2QVAA 3B5NC 3H1HD 2FXOA 3H1JG 3L73J 1JY2N 5CJ0A 5APXA 3P8MC 1J1EB 1LNQA 1P84E 3E1RA 4DJGA 5CMZA 3RK3C 1TU3F 1M1JC 1ZRTD 3T97B 5CHXA 3H25A 2C0XA 3MD0A 4Z1MH 4BWNA 1YJNP 5AW5B 3FWLA 3GHGA 1ZV8A 4OH8B 3Q3DA 1GU4A 3HD7D 2FYUJ 1URQC 2RMZA 1OZHA 2D2CC 1K04A 2HPCB 4DCKA 1NTMK 5KJ7D 3L36A 1JO5A 4PJ0H 1NJIQ 3CCLP 1OMIA 1SQPE 3CL3D 2YO2A 2FXMA 4JYCA 2N1TB 1CZQA 1NU1K 2O01H 5AVVB 1SQPG 1RH5B 2H8PD 5KKZB 1VQ7P 1KILA 1L0NJ 2R32A 3SFEC 2FYZA 1M90Q 3KHUA 5K5GB 1GU5A 2IFMA 2KIKA 4C7RA 1L4AB 3CPWO 2M3EA 4RESB 2PP6A 3H1LJ 3CXHH 3TGUJ 5AW8B 1AFOA 3L70E 2NZ2A 2BEZF 3GLMA 1NTZE 5GTIH 2PFXA 4CPGA 3Q2YA 5AVQB 3ITKA 3AEAC 1N7SB 1FDOA 3RK3D 4A7PA 1FZCA 2OTLP 1SQQG 2G8YA 2O01J 3L70G 1SQXD 1NTZG 1NOHA 2H88C 1D7MA 2BCCG 1J2JB 3IAOA 2P1JA 2JWDA 1VQ9P 1IFPA 1EXIA 1S2EA 4YXWH 1BCCD 3B8EB 1PP9D 5AVUB 4PJ0E 1L0LD 3VN0A 3KXDA 1LGHB 4NPEA 3H1HE 4GODA 4WY4D 1NO4A 3HUSC 1LTGC 3LIEA 1CI6A 1OVRA 4H13B 2C9LY 2KSJA 1AJYA 1BE3D 1YBKA 2J59M 3H1HG 2B87B 1Q86Q 3O6QA 3L74D 4BRYB 1MFTA 1DH3A 1DX7A 3EQ2A 3AEGC 3JC22 1ZRTE 5KLVD 3CWBJ 1NTMJ 3EWKA 2IYOA 3FWNA 3CXHE 2ZVNB 2E75B 5DJUB 1UIIA 2OYIB 1U7JA 5GTIE 2QJPC 1ZW0A 1RE3A 3A0HH 2XV5A 1Y47A 3V2NA 2N9YB 3ZDMA 1LT9B 2M3BA 3GW6A 1IFNA 1NU1J 1ZP0C 2QG4A 2OYHB 3L72D 1JMBA 2Q6QA 3N7NA 2YO3A 2CPBA 1PGOA 3WUVA 5KLIB 3BCCJ 4PD4D 1UIXA 3VP9A 3LW5H 3B71A 1R5LA 1FZAA 3L4FA 1K05A 1XTCC 2O3JA 3G6EP 3JCUH 1VQNP 3I56P 1LT1A 1RE4C 1QGKB 1R5SA 1AVOA 3G71P 1KYOI 5CJ4A 3L35A 4XE5B 4UB6H 4JF7A 1T8ZA 4EDFA 1K9MQ 1H89A 3L71D 4IFDK 1GK4A 4Y99C 2IDBA 1R8EA 1N86A 1VL2A 1MFZA 3RK3E 2QJYB 1N73B 2V7QJ 1N7SA 1RF0A 2P10A 3V6IA 3AEEC 2NPSB 1OVUA 1SQXE 2WSFH 1BGYD 1J1EC 5APWA 3D71A 5CCHC 1OW8A 1Q2NA 3A0HE 2WT7A 3GMAA 1H88A 1KILD 5B66H 1YTZT 2QA4P 1EDIA 3PHLA 3H1ID 2B88A 4PD4H 1LTJB 2KYVA 1SQXG 2R3SA 5DJTB 1KN7A 1PP9E 3H1JD 1L0LE 2WWWA 5AVTB 1VQOP 3L37A 4GT1A 4XFJA 1QLED 3C1LA 2M5AA 1BCCG 1ZOYC 3C8VA 3SWYA 1NWQA 1PP9G 4GDOA 1BDCA 2PRRA 2WPRA 2A06G 1L0LG 3CX5I 1EDJA 4ASVA 2WSFJ 5H2FH 2ZJSE 2IX7C 3JCUE 3MGNA 2GUVA 1FE6A 3L74E 1SQBJ 1NTKJ 2ZVOB 2B87A 1S5LH 5APTA 2N1TC 1YITP 3P8CD 2QRXA 1S1CX 5KLVE 1BE3G 2XKMA 4UB6E 2AXTH 1LP1A 2GUSA 3CCQP 1LTIC 3L74G 4KHXA 5AW1B 1ZR4A 3EFFK 1JY3N 2PGDA 1IJDB 5KKZC 2E5YA 2QE7H 1YHQP 4YXDC 3V5BA 1N2DC 3GHGB 5KLVG 2XZRA 2Q9IA 2QM7A 4L73A 1L4AC 5KTBA 3QWOC 1LT9A 5AVYB 4EYYQ 3L72E 1VQ4P 1SQBE 2WITA 1T2KD 3R2PA 3IF4A 3KQGA 2XDJA 3CC4P 4I7ZB 4PD4E 3E7KA 3L72G 3MUDA 4L76A 2YKPA 1RQUA 2O1JA 1S72P 1U57A 1CW5A 5AVSB 3D70A 2P67A 1M8OB 1JY3O 1VQ8P 1FZBA 1YQ3C 1T3UA 5H2FE 2NRGA 2A45I 1ZMEC 3SWKA 3FXDA 1SQQD 3RK2D 2HR3A 1S5LE 1EC5A 2IPPA 3CCJP 2C0WA 4AQRD 1NVOA 3HRNA 2BCCD 2ZXEB 1QX8A 2AXTE 3HD7C 2W83C 1N73A 1L0NK 3L71G 5KJ7C 2KI7B 1BGYE 3KDPB 2NPSA 2K88A 3I5CA 1LWUC 1KILE 1PGQA 2O1KA 3FX0A 1OWAA 3U1CA 3H1IE 4I1LA 2KXPB 3FXEA 2PAJA 2L91A 2UWJE 1BGYG 3CCVP 4OGQB 3H1JE 3D6ZA 2OYIC 2LXBA 2QM8A 1VQKP 3SFDC 4GOEA 1FZFA 3MHVA 1ZN5A 1N7SD 1CI6B 2Q5UA 1X79B 2OYHC 2XNDH 1NKZB 5BU5A 3S9OA 4ZNCA 1IFDA 5KLIC 3O6QB 3QH9A 3AE7C 1SQVD 1FDMA 1SQPJ 3P8CE 1BSNA 2P58A 3CC7P 3MP7B 2GM4A 1PIXA 3U59A 3F89A 3VMAA 3G3ZA 1AQ5A 4PV1B 3Q1MA 1SFCA 1KFMA 2YNYA 1Q81Q 3FGAD 1HUCA 4H13D 1FU1A 1KV4A 4ZKPA 4W7ZA 3L75D 2KNCA 5E79E 4H0LB 1N7LA 2AEMA 2JKVA 1HJ0A 1WRGA 3RK2B 2OYOA 3L70J 1NTZJ 4WY4C 2W8ZA 2QJYC 4C7NB 2Z4EA 4H44B 3AEDC 1G1IA 2QJKB 2JP3A 2MKVA 3AE8C 1YIJP 1RF1B 3KPEA 5AW3B 2E75D 1S9KE 3A0BH 1KFNA 2WVRA 3G4SP 2BEQD 1LTJC 3OJAB 4ASWA 4IFMA 2AXCA 2Q3EA 1KB9I 5APSA 4O9BA 1SQQE 1NAYA 2ZYAA 3V4QA 1Z56A 4LGDE 3H1HJ 2BCCE 4EOTA 2G3AA 2JEEA 3TYYA 2YXRB 5APQA 5CCGA 4N6JA 3H1KD 1N8RQ 3AEFC 1KYOD 2WT7B 2OQQA 4IOIH 2E43A 2Y9YA 3V2RA 1VQLP 3RBXA 1L0LK 3H32B 2FYUG 1WMKA 1CSBA 3M9HA 4WBAA 3V2QA 1JUNA 2M8RA 3HE4A 1QVGO 2HFED 1RHZB 4RJTA 3M9QA 2AEJA 2A06D 5B5EE 2I1JA 2KK7A 2WPVB 2M5AB 3GHGC 2MJZA 4HJGH 2LXCB 1DD3A 2OGUA 1OW6A 2ZT9D 1FC2C 2K9YA 2FKWB 1GZLA 4MN4C 2NPSD 4EI2A 2YMKA 3A0BE 5KLVK 4R4LA 1EZVD 1YQ4C 4AYCA 1FJPA 1SQVE 2CPSA 4I7ZC 4HH2A 4YPCA 1A02F 1JNMA 3H1LG 1LP1B 5AW6B 2IBZI 3AE5C 1SQVG 1KYOH 2E5TA 1KILC 3CX5D 1FZEA 1GW4A 2E76B 4R4MA 4KJMA 3TF5A 4I6MC 1SQBK 1NTKK 1L2PA 4OVNF 1HTLC 1W5CE 2RKLA 1NH4A 1W2BO 2IFNA 3O8ZA 4DT0A 1H8AA 1MV8A 1FZCC 3VYIA 4U7JA 2RH0A 3B5NB 5TJHA 4C7NA 1XTGB 3HTKA
chains in the Genus database with same CATH topology
3FGAD 4H13B 3ABVC 4H13D 1KQGB 4IL6X 4H0LC 1AJYA 1FDIA 2WQYC 2WPVB 4H0LB 4H0LD 2QIWA 3AE1C 3O6QA 5KKZC 1HJ0A 1KILE 2IDBA 1VF5D 4YXDC 3AEGC 2QJKC 4PV1C 2QJYC 1R8EA 3Q5RA 1VL2A 4H44B 3SFEC 3AEDC 4H44D 1DD3A 1ZRTE 3RK3E 2JP3A 3AE6C 4H13C 4TT3H 2V7QJ 2MKVA 1OW6A 2ZT9D 2K9YA 4OGQB 3AE8C 3EWKA 4OGQD 2P10A 3AEEC 3D6ZA 3AE9C 2YMKA 2E75B 2E75D 3R4YA 4Y28J 3D71A 4R4LA 1OW8A 3AECC 1VF5C 3SFDC 1YQ4C 2NZ2A 2QJPC 3GMAA 2BEZF 3GLMA 4I7ZC 1RQVA 2WSCJ 3GF7A 4H44C 3Q2YA 1VF5B 4KT0J 1TU3F 1KQFB 2BEQD 4I7ZB 3AEAC 2ZT9C 3AE4C 3LW5J 1FDOA 3T97B 4OGQC 1Y9BA 2FBWC 1OW7A 1Q90D 1ZP0C 2E74D 2ZT9B 2G8YA 1RQUA 3S9OA 3H25A 2E75C 2O01J 3GF3A 3AE5C 1PV3A 1U57A 5KLIC 5L8RJ 1DIPA 1KMIZ 3D70A 4Z1MH 2D2CB 1NYHA 2D2CD 2FXPA 2H88C 3RL0g 3AE7C 3Q5PA 4XFJA 2J5UA 1IK7A 1HF9A 2E76B 3IAOA 4R4MA 2E76D 3AEBC 2WSEJ 2YIUC 1YQ3C 1ZOYC 3C8VA 2G3AA 4YTPC 3IN6A 1EXIA 1UIXA 3G9RA 2E74C 3B71A 1MKMA 4GDOA 3Q3DA 1DD4A 3D6YA 2E74B 2H89C 1NGMB 2WSFJ 3AE2C 3AEFC 2QSIA 1ZMEC 2D2CC 1K04A 1EXJA 2OQQA 1K05A 2FYNC 3Q5SA 1PIXA 2E76C 5M1BA 3AE3C 1PL5A 1S5LX 1OMIA 1JB0J 4U7JA 1GMJA 1WMKA 1KORA 4PV1B 4PV1D 3Q1MA 4RKUJ 1KTMA 1S1CX 2JO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA D;  1PL5 A;  1UIX A;  1NYH A;  1S1C X;  1TU3 F; 
#chains in the Genus database with same CATH topology
 3L75 G;  1E5W A;  1NHL A;  5C39 A;  1SQX J;  1RF1 A;  1ZR2 A;  1VF5 D;  2CK3 H;  1OX3 A;  1SFC D;  2P7J A;  3AE6 C;  2JWA A;  5AW4 B;  1BCC J;  4D6T D;  1IC2 A;  1PP9 J;  1L0L J;  1IZN B;  3CX5 H;  2H43 A;  3AE4 C;  3LW5 J;  3KZI H;  1JEK A;  1EQ7 A;  2FBW C;  1KQS O;  4XA4 A;  2ZT9 B;  3H1K E;  3CCE P;  3GF3 A;  1KYO E;  1PV3 A;  1BE3 J;  1T2K C;  1URQ B;  2R3C A;  2D2C B;  2FFD A;  5KAF H;  1NU1 G;  3L74 J;  2KSE A;  1H0T A;  1HBW A;  5KAI E;  3H1K G;  3H32 A;  1BCC E;  1DD4 A;  1FOS F;  3TK1 A;  5KLV J;  1EZV I;  5GTH H;  1RE3 C;  1EXJ A;  2A06 E;  1T3J A;  1QVF O;  1YI2 P;  2JDI H;  3OA7 A;  3CC2 P;  1USE A;  4HKZ H;  5CCG D;  1VQ6 P;  1KTM A;  1JTH A;  5AW7 B;  4H0L C;  2WMM A;  1BE3 E;  3VTP C;  3M0D A;  3L72 J;  4OWF A;  3RK2 C;  3AE1 C;  2YKQ A;  2QJK C;  1GTW A;  2C9N Y;  1JCD A;  2ITA A;  4OGQ D;  2N9B A;  1EZV G;  2KS1 B;  1FS0 E;  4BXL A;  3WMM 0;  3SSU A;  3AEC C;  1USD A;  1VPC A;  3CX5 E;  1P84 D;  2K1A A;  3VMY A;  1WT6 A;  3W67 A;  1VF5 B;  4GKG A;  3BVH A;  2K3R A;  1SFC B;  3KZI E;  1PGJ A;  1YJW P;  4K35 A;  1OXZ A;  1SQP K;  1EDK A;  2KNC B;  2E42 A;  5L8R J;  5KAF E;  2FXP A;  3L71 J;  1FBM A;  3OAK A;  1N7S C;  1RF0 C;  3L73 D;  1EDL A;  3B5N A;  3A2A A;  3HUS B;  5GTH E;  1QL2 A;  5AW0 B;  2P2U A;  2QSI A;  1LTB C;  1VQM P;  1BGY J;  2ZFC A;  3Q5S A;  4LC1 A;  1HH0 A;  2W6J H;  1SQQ K;  4PV1 D;  3H1I J;  3BAS A;  1NTZ K;  3U1A A;  2KUB A;  4D6T E;  3LID A;  3M06 A;  2L5G B;  1M1J A;  3F5H A;  3H1J J;  4N3Y B;  1X9V A;  2ZYD A;  3L71 E;  4H0L D;  2Q3I A;  4WVZ A;  2QJP B;  5APV A;  1NKN A;  3VMX A;  4B86 A;  2OTJ P;  2K37 A;  4H44 D;  4C46 A;  4D6T G;  1GDT A;  4H13 C;  2FYU D;  1W2E A;  4RO0 A;  5APU A;  1HGV A;  3M0A A;  3PH0 A;  4U3F G;  1LJ2 A;  3A3Y B;  4GOF A;  1URQ A;  5E79 H;  3M9B A;  1KB9 D;  1KQF B;  3MTU E;  2WPQ A;  2Q1K A;  1FJK A;  1JOC A;  3NTN A;  3HE4 B;  4NPD A;  4HYT B;  2O01 N;  1OW7 A;  1Q90 D;  2HOD A;  4WWI A;  2E75 C;  2A45 G;  3H6P A;  2KP8 A;  1E79 H;  5AVZ B;  2Z5H A;  2I8D A;  2W27 A;  1LT9 C;  3AEB C;  1L0N D;  1ZXG A;  3CI9 A;  4YTP C;  3IN6 A;  2YIU B;  1SQV K;  4GIF A;  3WU2 E;  2KZJ A;  3H1L D;  1IFJ A;  1P84 I;  3TGU D;  1PGP A;  2OTK E;  1GL2 B;  5APY A;  1S5L X;  1HGZ A;  3MUD C;  4Y99 B;  1JY2 P;  4W80 A;  1JM0 A;  3PTZ A;  3BRV B;  1KC8 Q;  3BAT A;  1K73 Q;  1KQG B;  3TNU A;  3S1K A;  5AW9 B;  2KS1 A;  2I1K A;  3TSI A;  1KB9 H;  2WSE H;  3CXH D;  4LLH A;  1SQQ J;  2IBZ D;  5B5E H;  3I55 P;  1N73 C;  3IFM A;  3HTK B;  2Y0D A;  2ZT9 C;  3L73 E;  2BCC J;  1Q82 Q;  3C9I A;  1YYC A;  2NPS C;  2E74 D;  4K3A A;  1VQ5 P;  2Y9Z A;  1G2C B;  3HUS A;  3II6 A;  1QL1 A;  2XU6 A;  1DIP A;  1JY2 O;  4JPZ B;  2E76 D;  3L73 G;  3MZW B;  4I2L C;  4JBZ A;  3CCR P;  2WSE J;  3GG2 A;  2HYN A;  2J58 A;  3G9R A;  1X22 A;  3CWB D;  1NTM D;  2SPZ A;  1PFI A;  2H89 C;  1SVF A;  1GD2 E;  3AE3 C;  2FYN B;  3RL0 D;  4AUW A;  1SQX K;  3JSV C;  1KOR A;  3B5N D;  1NU1 D;  1BSH A;  2FYU E;  5AVR B;  5CBO A;  2FFD B;  2QIW A;  2YMY A;  3BCC D;  2HLO A;  1KB9 E;  1H0T B;  5BVZ A;  3RBZ A;  1SQV J;  1T6A A;  2Z5I A;  4N78 D;  2KLV A;  4TT3 H;  3WUU A;  4IL6 H;  4Y28 J;  1VF5 C;  5EFW B;  3PRJ A;  4JQ0 D;  1SFC C;  3GF7 A;  1RY3 A;  1L0N E;  2OAR A;  1JTH B;  1RE4 A;  2R44 A;  2KZI A;  3NFQ A;  3H1L E;  3K5B A;  3TGU E;  3L75 J;  1URQ D;  1L0N G;  2D2C D;  2FY8 A;  1KD1 Q;  1FOS E;  1PPJ D;  2WSS H;  1GL2 A;  2ZAE B;  4ZMD A;  1NAF A;  3CXH I;  3TDK A;  2K9J B;  2DW3 A;  1DEB A;  2KB7 P;  3TGU G;  2E74 B;  3HD7 B;  3AE2 C;  3UIA A;  2KLU A;  2R5D A;  4EIJ A;  2Y0C A;  5M1B A;  2IZ0 A;  1LWU B;  2XNX A;  1JB0 J;  2WSC H;  5CCH A;  1M7L A;  1X8Y A;  1DEE G;  1GK6 A;  4RKU J;  1SS1 A;  3T97 A;  5KAI H;  4UB8 H;  2V4H A;  3W68 A;  3L75 E;  1FDI A;  1X0T A;  4M3L A;  2IBZ E;  1HWT C;  3RL0 B;  3PJS K;  5CCG C;  1IFM A;  1J1D B;  3VMZ A;  4ZKU A;  3CMA P;  3CD6 P;  1QEX A;  3A5T A;  4IL6 E;  3CCS P;  3H1K J;  2IBZ G;  3HE5 B;  1G2C A;  3R4Y A;  1SQB D;  2HPC A;  1NTK D;  1AV1 A;  2WSC J;  4KT0 J;  1SLQ A;  2HG5 D;  3RK3 B;  4OGQ C;  3CWB E;  3EFG A;  1NTM E;  2POH A;  2V7Q H;  1M1K Q;  1M1J B;  1OFC X;  3M91 A;  2N1T A;  2W6A A;  2W90 A;  1S4X A;  3IR9 A;  3A7O A;  3PLN A;  2WTY A;  3CWB G;  2YIU C;  4U3F D;  1NTM G;  1PZQ A;  3VOP A;  1NU1 E;  1MUU A;  1MKM A;  1M56 D;  2VRS A;  1FAV A;  3D6Y A;  4DOJ A;  2IZ1 A;  5AW2 B;  1L4A A;  3P32 A;  1GL2 C;  1SP4 A;  2KOG A;  2Y0E A;  2Q7C A;  3BCC E;  1IK9 A;  2GA1 A;  1K8A Q;  2ZYG A;  3BRT B;  1FZG A;  4N78 E;  1GMJ A;  4WY4 B;  2HOD B;  1AQT A;  4UB8 E;  2JO1 A;  4IL6 X;  1VDF A;  4JYB A;  3BCC G;  3NMD A;  2LR2 A;  3USS A;  1JMM A;  3WUT A;  2M0B A;  3OW2 O;  4PV1 C;  4IFF A;  3PP5 A;  3CCU P;  3AE9 C;  1YJ9 P;  1AA0 A;  1EZV E;  3VP8 A;  1MZ9 A;  2YXQ B;  1PPJ E;  1RQV A;  4H44 C;  1Y9B A;  3TNU B;  1RF1 C;  2WPS A;  2K9J A;  3E1I A;  3HD7 A;  1KMI Z;  1PPJ G;  1GW3 A;  2YKO A;  1NYH A;  3Q5P A;  5KJ7 A;  2J5U A;  1IK7 A;  4NPF X;  2IYP A;  4BRY A;  2A45 H;  5TIS H;  1VQP P;  1LWU A;  1JY3 P;  1Y8A A;  3KYQ A;  1HJB A;  2AEF A;  4D6T J;  1LTA C;  1NGM B;  3CCM P;  2FYN C;  4PD4 I;  1GL2 D;  1PL5 A;  2R5B A;  2OYI A;  2JJL A;  4U3F J;  1IO4 A;  3P7K A;  2ZXX A;  3ABV C;  3S4R A;  2FFD C;  3NXS A;  3WU2 H;  2OYH A;  4QMA A;  2WQY C;  5B66 E;  1NTK E;  3SWF A;  3HE5 A;  1Q7Y Q;  5CCH D;  1HVV A;  3RGU A;  1LTT C;  3Q5R A;  1OVV A;  1SQP D;  2B9B A;  1G1J A;  1LTS C;  1SQB G;  1NTK G;  4L75 A;  4WB4 A;  1AVY A;  1KQL A;  4TLF A;  1M57 D;  3CME P;  1S9K D;  2FYU K;  1KIL B;  4U3F E;  1P84 H;  3CLQ A;  1S3J A;  3M0D C;  4DZO A;  5AVX B;  3RL0 g;  3L70 D;  1BDD A;  3B4S A;  1NTZ D;  2WZ7 A;  1HF9 A;  2W6B A;  5TIS E;  4L74 A;  1ZLL A;  3V4W A;  1YTZ I;  1FZC B;  2E74 C;  2QEX P;  1IFI A;  4WY4 A;  2BAS A;  2N1T D;  3N4X A;  4HB1 A;  1JCC A;  3MIW A;  2E76 C;  3V2P A;  2LKM A;  2JR8 A;  4W7Y A;  2H7H A;  1U7M A;  5BU8 B;  5CBN A;  1L4A D;  1LTJ A;  2B89 A;  5AVW B;  1A02 J;  3RL0 C;  1KZU B;  2RN0 A;  3H1I G;  1J1D C;  1OIP A;  2QVA A;  3B5N C;  3H1H D;  2FXO A;  3H1J G;  3L73 J;  1JY2 N;  5CJ0 A;  5APX A;  3P8M C;  1J1E B;  1LNQ A;  1P84 E;  3E1R A;  4DJG A;  5CMZ A;  3RK3 C;  1TU3 F;  1M1J C;  1ZRT D;  3T97 B;  5CHX A;  3H25 A;  2C0X A;  3MD0 A;  4Z1M H;  4BWN A;  1YJN P;  5AW5 B;  3FWL A;  3GHG A;  1ZV8 A;  4OH8 B;  3Q3D A;  1GU4 A;  3HD7 D;  2FYU J;  1URQ C;  2RMZ A;  1OZH A;  2D2C C;  1K04 A;  2HPC B;  4DCK A;  1NTM K;  5KJ7 D;  3L36 A;  1JO5 A;  4PJ0 H;  1NJI Q;  3CCL P;  1OMI A;  1SQP E;  3CL3 D;  2YO2 A;  2FXM A;  4JYC A;  2N1T B;  1CZQ A;  1NU1 K;  2O01 H;  5AVV B;  1SQP G;  1RH5 B;  2H8P D;  5KKZ B;  1VQ7 P;  1KIL A;  1L0N J;  2R32 A;  3SFE C;  2FYZ A;  1M90 Q;  3KHU A;  5K5G B;  1GU5 A;  2IFM A;  2KIK A;  4C7R A;  1L4A B;  3CPW O;  2M3E A;  4RES B;  2PP6 A;  3H1L J;  3CXH H;  3TGU J;  5AW8 B;  1AFO A;  3L70 E;  2NZ2 A;  2BEZ F;  3GLM A;  1NTZ E;  5GTI H;  2PFX A;  4CPG A;  3Q2Y A;  5AVQ B;  3ITK A;  3AEA C;  1N7S B;  1FDO A;  3RK3 D;  4A7P A;  1FZC A;  2OTL P;  1SQQ G;  2G8Y A;  2O01 J;  3L70 G;  1SQX D;  1NTZ G;  1NOH A;  2H88 C;  1D7M A;  2BCC G;  1J2J B;  3IAO A;  2P1J A;  2JWD A;  1VQ9 P;  1IFP A;  1EXI A;  1S2E A;  4YXW H;  1BCC D;  3B8E B;  1PP9 D;  5AVU B;  4PJ0 E;  1L0L D;  3VN0 A;  3KXD A;  1LGH B;  4NPE A;  3H1H E;  4GOD A;  4WY4 D;  1NO4 A;  3HUS C;  1LTG C;  3LIE A;  1CI6 A;  1OVR A;  4H13 B;  2C9L Y;  2KSJ A;  1AJY A;  1BE3 D;  1YBK A;  2J59 M;  3H1H G;  2B87 B;  1Q86 Q;  3O6Q A;  3L74 D;  4BRY B;  1MFT A;  1DH3 A;  1DX7 A;  3EQ2 A;  3AEG C;  3JC2 2;  1ZRT E;  5KLV D;  3CWB J;  1NTM J;  3EWK A;  2IYO A;  3FWN A;  3CXH E;  2ZVN B;  2E75 B;  5DJU B;  1UII A;  2OYI B;  1U7J A;  5GTI E;  2QJP C;  1ZW0 A;  1RE3 A;  3A0H H;  2XV5 A;  1Y47 A;  3V2N A;  2N9Y B;  3ZDM A;  1LT9 B;  2M3B A;  3GW6 A;  1IFN A;  1NU1 J;  1ZP0 C;  2QG4 A;  2OYH B;  3L72 D;  1JMB A;  2Q6Q A;  3N7N A;  2YO3 A;  2CPB A;  1PGO A;  3WUV A;  5KLI B;  3BCC J;  4PD4 D;  1UIX A;  3VP9 A;  3LW5 H;  3B71 A;  1R5L A;  1FZA A;  3L4F A;  1K05 A;  1XTC C;  2O3J A;  3G6E P;  3JCU H;  1VQN P;  3I56 P;  1LT1 A;  1RE4 C;  1QGK B;  1R5S A;  1AVO A;  3G71 P;  1KYO I;  5CJ4 A;  3L35 A;  4XE5 B;  4UB6 H;  4JF7 A;  1T8Z A;  4EDF A;  1K9M Q;  1H89 A;  3L71 D;  4IFD K;  1GK4 A;  4Y99 C;  2IDB A;  1R8E A;  1N86 A;  1VL2 A;  1MFZ A;  3RK3 E;  2QJY B;  1N73 B;  2V7Q J;  1N7S A;  1RF0 A;  2P10 A;  3V6I A;  3AEE C;  2NPS B;  1OVU A;  1SQX E;  2WSF H;  1BGY D;  1J1E C;  5APW A;  3D71 A;  5CCH C;  1OW8 A;  1Q2N A;  3A0H E;  2WT7 A;  3GMA A;  1H88 A;  1KIL D;  5B66 H;  1YTZ T;  2QA4 P;  1EDI A;  3PHL A;  3H1I D;  2B88 A;  4PD4 H;  1LTJ B;  2KYV A;  1SQX G;  2R3S A;  5DJT B;  1KN7 A;  1PP9 E;  3H1J D;  1L0L E;  2WWW A;  5AVT B;  1VQO P;  3L37 A;  4GT1 A;  4XFJ A;  1QLE D;  3C1L A;  2M5A A;  1BCC G;  1ZOY C;  3C8V A;  3SWY A;  1NWQ A;  1PP9 G;  4GDO A;  1BDC A;  2PRR A;  2WPR A;  2A06 G;  1L0L G;  3CX5 I;  1EDJ A;  4ASV A;  2WSF J;  5H2F H;  2ZJS E;  2IX7 C;  3JCU E;  3MGN A;  2GUV A;  1FE6 A;  3L74 E;  1SQB J;  1NTK J;  2ZVO B;  2B87 A;  1S5L H;  5APT A;  2N1T C;  1YIT P;  3P8C D;  2QRX A;  1S1C X;  5KLV E;  1BE3 G;  2XKM A;  4UB6 E;  2AXT H;  1LP1 A;  2GUS A;  3CCQ P;  1LTI C;  3L74 G;  4KHX A;  5AW1 B;  1ZR4 A;  3EFF K;  1JY3 N;  2PGD A;  1IJD B;  5KKZ C;  2E5Y A;  2QE7 H;  1YHQ P;  4YXD C;  3V5B A;  1N2D C;  3GHG B;  5KLV G;  2XZR A;  2Q9I A;  2QM7 A;  4L73 A;  1L4A C;  5KTB A;  3QWO C;  1LT9 A;  5AVY B;  4EYY Q;  3L72 E;  1VQ4 P;  1SQB E;  2WIT A;  1T2K D;  3R2P A;  3IF4 A;  3KQG A;  2XDJ A;  3CC4 P;  4I7Z B;  4PD4 E;  3E7K A;  3L72 G;  3MUD A;  4L76 A;  2YKP A;  1RQU A;  2O1J A;  1S72 P;  1U57 A;  1CW5 A;  5AVS B;  3D70 A;  2P67 A;  1M8O B;  1JY3 O;  1VQ8 P;  1FZB A;  1YQ3 C;  1T3U A;  5H2F E;  2NRG A;  2A45 I;  1ZME C;  3SWK A;  3FXD A;  1SQQ D;  3RK2 D;  2HR3 A;  1S5L E;  1EC5 A;  2IPP A;  3CCJ P;  2C0W A;  4AQR D;  1NVO A;  3HRN A;  2BCC D;  2ZXE B;  1QX8 A;  2AXT E;  3HD7 C;  2W83 C;  1N73 A;  1L0N K;  3L71 G;  5KJ7 C;  2KI7 B;  1BGY E;  3KDP B;  2NPS A;  2K88 A;  3I5C A;  1LWU C;  1KIL E;  1PGQ A;  2O1K A;  3FX0 A;  1OWA A;  3U1C A;  3H1I E;  4I1L A;  2KXP B;  3FXE A;  2PAJ A;  2L91 A;  2UWJ E;  1BGY G;  3CCV P;  4OGQ B;  3H1J E;  3D6Z A;  2OYI C;  2LXB A;  2QM8 A;  1VQK P;  3SFD C;  4GOE A;  1FZF A;  3MHV A;  1ZN5 A;  1N7S D;  1CI6 B;  2Q5U A;  1X79 B;  2OYH C;  2XND H;  1NKZ B;  5BU5 A;  3S9O A;  4ZNC A;  1IFD A;  5KLI C;  3O6Q B;  3QH9 A;  3AE7 C;  1SQV D;  1FDM A;  1SQP J;  3P8C E;  1BSN A;  2P58 A;  3CC7 P;  3MP7 B;  2GM4 A;  1PIX A;  3U59 A;  3F89 A;  3VMA A;  3G3Z A;  1AQ5 A;  4PV1 B;  3Q1M A;  1SFC A;  1KFM A;  2YNY A;  1Q81 Q;  3FGA D;  1HUC A;  4H13 D;  1FU1 A;  1KV4 A;  4ZKP A;  4W7Z A;  3L75 D;  2KNC A;  5E79 E;  4H0L B;  1N7L A;  2AEM A;  2JKV A;  1HJ0 A;  1WRG A;  3RK2 B;  2OYO A;  3L70 J;  1NTZ J;  4WY4 C;  2W8Z A;  2QJY C;  4C7N B;  2Z4E A;  4H44 B;  3AED C;  1G1I A;  2QJK B;  2JP3 A;  2MKV A;  3AE8 C;  1YIJ P;  1RF1 B;  3KPE A;  5AW3 B;  2E75 D;  1S9K E;  3A0B H;  1KFN A;  2WVR A;  3G4S P;  2BEQ D;  1LTJ C;  3OJA B;  4ASW A;  4IFM A;  2AXC A;  2Q3E A;  1KB9 I;  5APS A;  4O9B A;  1SQQ E;  1NAY A;  2ZYA A;  3V4Q A;  1Z56 A;  4LGD E;  3H1H J;  2BCC E;  4EOT A;  2G3A A;  2JEE A;  3TYY A;  2YXR B;  5APQ A;  5CCG A;  4N6J A;  3H1K D;  1N8R Q;  3AEF C;  1KYO D;  2WT7 B;  2OQQ A;  4IOI H;  2E43 A;  2Y9Y A;  3V2R A;  1VQL P;  3RBX A;  1L0L K;  3H32 B;  2FYU G;  1WMK A;  1CSB A;  3M9H A;  4WBA A;  3V2Q A;  1JUN A;  2M8R A;  3HE4 A;  1QVG O;  2HFE D;  1RHZ B;  4RJT A;  3M9Q A;  2AEJ A;  2A06 D;  5B5E E;  2I1J A;  2KK7 A;  2WPV B;  2M5A B;  3GHG C;  2MJZ A;  4HJG H;  2LXC B;  1DD3 A;  2OGU A;  1OW6 A;  2ZT9 D;  1FC2 C;  2K9Y A;  2FKW B;  1GZL A;  4MN4 C;  2NPS D;  4EI2 A;  2YMK A;  3A0B E;  5KLV K;  4R4L A;  1EZV D;  1YQ4 C;  4AYC A;  1FJP A;  1SQV E;  2CPS A;  4I7Z C;  4HH2 A;  4YPC A;  1A02 F;  1JNM A;  3H1L G;  1LP1 B;  5AW6 B;  2IBZ I;  3AE5 C;  1SQV G;  1KYO H;  2E5T A;  1KIL C;  3CX5 D;  1FZE A;  1GW4 A;  2E76 B;  4R4M A;  4KJM A;  3TF5 A;  4I6M C;  1SQB K;  1NTK K;  1L2P A;  4OVN F;  1HTL C;  1W5C E;  2RKL A;  1NH4 A;  1W2B O;  2IFN A;  3O8Z A;  4DT0 A;  1H8A A;  1MV8 A;  1FZC C;  3VYI A;  4U7J A;  2RH0 A;  3B5N B;  5TJH A;  4C7N A;  1XTG B;  3HTK A; 
#chains in the Genus database with same CATH homology
 3FGA D;  4H13 B;  3ABV C;  4H13 D;  1KQG B;  4IL6 X;  4H0L C;  1AJY A;  1FDI A;  2WQY C;  2WPV B;  4H0L B;  4H0L D;  2QIW A;  3AE1 C;  3O6Q A;  5KKZ C;  1HJ0 A;  1KIL E;  2IDB A;  1VF5 D;  4YXD C;  3AEG C;  2QJK C;  4PV1 C;  2QJY C;  1R8E A;  3Q5R A;  1VL2 A;  4H44 B;  3SFE C;  3AED C;  4H44 D;  1DD3 A;  1ZRT E;  3RK3 E;  2JP3 A;  3AE6 C;  4H13 C;  4TT3 H;  2V7Q J;  2MKV A;  1OW6 A;  2ZT9 D;  2K9Y A;  4OGQ B;  3AE8 C;  3EWK A;  4OGQ D;  2P10 A;  3AEE C;  3D6Z A;  3AE9 C;  2YMK A;  2E75 B;  2E75 D;  3R4Y A;  4Y28 J;  3D71 A;  4R4L A;  1OW8 A;  3AEC C;  1VF5 C;  3SFD C;  1YQ4 C;  2NZ2 A;  2QJP C;  3GMA A;  2BEZ F;  3GLM A;  4I7Z C;  1RQV A;  2WSC J;  3GF7 A;  4H44 C;  3Q2Y A;  1VF5 B;  4KT0 J;  1TU3 F;  1KQF B;  2BEQ D;  4I7Z B;  3AEA C;  2ZT9 C;  3AE4 C;  3LW5 J;  1FDO A;  3T97 B;  4OGQ C;  1Y9B A;  2FBW C;  1OW7 A;  1Q90 D;  1ZP0 C;  2E74 D;  2ZT9 B;  2G8Y A;  1RQU A;  3S9O A;  3H25 A;  2E75 C;  2O01 J;  3GF3 A;  3AE5 C;  1PV3 A;  1U57 A;  5KLI C;  5L8R J;  1DIP A;  1KMI Z;  3D70 A;  4Z1M H;  2D2C B;  1NYH A;  2D2C D;  2FXP A;  2H88 C;  3RL0 g;  3AE7 C;  3Q5P A;  4XFJ A;  2J5U A;  1IK7 A;  1HF9 A;  2E76 B;  3IAO A;  4R4M A;  2E76 D;  3AEB C;  2WSE J;  2YIU C;  1YQ3 C;  1ZOY C;  3C8V A;  2G3A A;  4YTP C;  3IN6 A;  1EXI A;  1UIX A;  3G9R A;  2E74 C;  3B71 A;  1MKM A;  4GDO A;  3Q3D A;  1DD4 A;  3D6Y A;  2E74 B;  2H89 C;  1NGM B;  2WSF J;  3AE2 C;  3AEF C;  2QSI A;  1ZME C;  2D2C C;  1K04 A;  1EXJ A;  2OQQ A;  1K05 A;  2FYN C;  3Q5S A;  1PIX A;  2E76 C;  5M1B A;  3AE3 C;  1PL5 A;  1S5L X;  1OMI A;  1JB0 J;  4U7J A;  1GMJ A;  1WMK A;  1KOR A;  4PV1 B;  4PV1 D;  3Q1M A;  4RKU J;  1KTM A;  1S1C X;  2JO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...