1UIXA

Coiled-coil structure of the rhoa-binding domain in rho-kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
GSTSDVANLANEKEELNNKLKEAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho-associated kinase
publication title Parallel coiled-coil association of the RhoA-binding domain in Rho-kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 30
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1uixA00
3FGAD 1PL5A 1UIXA 1S1CX 1TU3F 1NYHA
chains in the Genus database with same CATH superfamily
4H13C 1EDLA 1X9VA 3FWLA 3KXDA 4BWNA 1PGJA 3OW2O 2PAJA 3PRJA 3V2RA 1NTKG 1GW4A 2GUVA 2FYZA 1A02F 3HE4A 2AXTE 1KFNA 3LIDA 2M5AA 3BCCG 1PGOA 1GD2E 1PP9J 4K3AA 3M0AA 1RF1A 3IN6A 1Q90D 2WSSH 1SFCD 5KAIE 3O6QB 3V5BA 1OWAA 3ABVC 3TF5A 2Q5UA 1HGVA 4GOFA 5KAFH 3P8CE 2KS1A 1L4AA 3B5NB 2W6BA 1GL2C 5B66H 1E79H 2WPRA 2RN0A 1YTZI 4KJMA 1BCCE 1J1EB 2W8ZA 4I2LC 1EZVG 1X8YA 1EZVD 3GF3A 1JNMA 2R5BA 3MUDA 2W6JH 3AE1C 1T3UA 1SQXG 1IZNB 1SQXD 1ZR2A 2JKVA 4C46A 1VQLP 2WSFJ 1HJ0A 4L73A 1Q86Q 4KT0J 1KYOH 3G6EP 3BASA 1S5LE 1KQSO 2V4HA 3M91A 4MN4C 1ZLLA 1VQPP 5B5EE 4RJTA 2AEMA 1U7MA 3AE3C 2NRGA 3G3ZA 3L73E 1W2BO 3FXEA 2AEFA 3B8EB 3TSIA 1H8AA 3S4RA 1SQPK 3H1KJ 1Q81Q 5E79H 3D6ZA 3IF4A 2KZIA 4HB1A 3L74E 2QRXA 3H32B 2LKMA 1IK9A 1SFCC 4OVNF 1CZQA 4RESB 2NPSB 3H1HG 3WU2H 2OYHA 4EDFA 2D2CB 1N8RQ 3AE5C 1ZR4A 1MUUA 3W67A 1PV3A 2ZJSE 3B71A 1IJDB 1LT9A 1H0TA 1P84H 2FYUE 3CMEP 5CCGD 2R3CA 1JTHB 4ZKPA 1QVFO 1LTGC 1LTJC 4PD4I 3VP8A 4JBZA 2PRRA 3FX0A 1BDDA 3AE8C 3B5ND 2JP3A 3AEEC 1AFOA 1RQUA 1SQPJ 2WPVB 3TGUJ 1OW6A 3BRTB 3D6YA 3CI9A 2N1TA 2KUBA 3CCEP 1PIXA 1M7LA 4PJ0H 2IDBA 5TISH 2PFXA 1M1JB 5AW9B 4ZKUA 2ZVOB 4LGDE 2ZFCA 2HG5D 5AVVB 5AW2B 1NH4A 1LWUC 4Z1MH 1BE3E 1NWQA 4HKZH 2I1KA 2HPCA 3GG2A 1OW8A 3A2AA 1VQ8P 3A3YB 2YMKA 2E76B 4WY4A 3BRVB 2KIKA 5GTHE 1LTTC 4I6MC 3A0BE 3FWNA 2DW3A 2OGUA 1SLQA 2C9LY 3MP7B 1RH5B 1PP9E 3KDPB 1IFMA 1U57A 2QM7A 3V2PA 2IX7C 1GW3A 5CJ0A 3NXSA 5AW6B 5APWA 1DEBA 5CCGC 2P10A 2FY8A 3L70J 2NPSD 3KZIE 1KQGB 1SVFA 3IR9A 2XZRA 1OMIA 2D2CD 5KLIB 2OARA 3B5NC 3LIEA 2W6AA 1NTMG 1PGQA 1NTMD 1RQVA 2WQYC 1J1EC 4QMAA 4R4MA 1PFIA 3CXHE 2B89A 4RKUJ 2A45H 1EDKA 2Z5HA 3S9OA 1ZXGA 1IC2A 3I5CA 1X22A 3S1KA 4IFDK 4O9BA 1QL1A 1SQVK 3G71P 4PD4D 4JPZB 3CCRP 2HODA 3L73G 4YTPC 3H6PA 1SFCA 3CWBJ 3PTZA 3L72D 1CI6B 3RK2B 1EC5A 4LLHA 2Y0DA 1NJIQ 3L74G 3L74D 3GMAA 2IPPA 3L71J 2P67A 3H1KE 1SQBK 4IFMA 1OIPA 2E76D 2NPSC 1OVRA 5GTHH 1OVUA 2FYUG 2M0BA 2D2CC 1SQVJ 4WVZA 2UWJE 2IFMA 1MFZA 1NHLA 1QX8A 2YO2A 1PPJD 3SWFA 3H1ID 1KILA 2FXOA 4BRYB 1LTBC 3OJAB 3P8MC 1W2EA 3MZWB 3JSVC 3AEFC 1FOSE 1KV4A 3JCUH 1LWUA 3AE9C 3MTUE 3C8VA 2QJYB 1NU1E 1SQPE 3TGUE 5KLVK 1SQBJ 1BGYD 2AEJA 4YXDC 2RMZA 1BE3G 1MKMA 1S9KD 1VQ9P 3H1JJ 5CMZA 4DZOA 1DEEG 1M1JC 2XDJA 2KNCB 2YKQA 2GUSA 2WSFH 4D6TJ 1KB9I 3PP5A 1YBKA 1DIPA 5CCGA 2E76C 3O6QA 1GDTA 1L0LK 2VRSA 3RK2D 3N4XA 1KILE 3VMXA 1L0NK 1R5SA 1JEKA 1NKZB 1RE4C 5KLVJ 5B66E 2OYIB 3L75D 1EZVI 2E42A 2B9BA 3RBXA 4YXWH 3D70A 3VP9A 3M9HA 1KMIZ 1YQ4C 1PGPA 3GLMA 1USEA 3L70E 1KQFB 4U3FJ 3G9RA 5C39A 3CCLP 5KLIC 4N78E 4AUWA 3GW6A 1N7SB 4WBAA 3SFDC 3IFMA 2Y0CA 1S4XA 1WT6A 1L0LJ 1ZN5A 2K1AA 1K73Q 2K3RA 1L0NJ 4RO0A 1NTZK 4JF7A 4PV1B 1SQQK 5BVZA 1FC2C 2B88A 2Q9IA 3Q5PA 3V4QA 5E79E 4C7NB 3BVHA 3AEAC 2JWDA 3H32A 1JCDA 1FAVA 1AV1A 1BGYJ 2NPSA 3WU2E 3E1IA 3RK2C 3HE5B 1NTKD 2Y9ZA 1G2CB 1ZOYC 3R4YA 1KYOI 1KZUB 3CD6P 2P58A 1YIJP 3BCCD 3L71E 4U7JA 1P84E 3Q3DA 4OGQB 1G1JA 3TYYA 2HFED 5APQA 2IZ1A 1KB9D 2H89C 1JTHA 1NTZJ 1LJ2A 1BSNA 2BEZF 2IBZE 5CCHD 2PP6A 2C0WA 3HUSB 1SQQJ 1NGMB 5BU5A 2KXPB 1SQVE 3WUUA 1K04A 3CX5I 3BATA 3CC4P 2OTKE 2BCCJ 3AECC 3I55P 3NFQA 1NU1G 4PJ0E 5KTBA 5TISE 4OH8B 1NU1D 4I7ZC 1M1JA 1OZHA 2YIUB 2YKOA 1LTSC 2GA1A 2QJYC 1N7SD 2YMYA 1SQBE 3USSA 3H1LG 3H1LD 3CCSP 5DJUB 2JWAA 1YHQP 3C9IA 1J1DB 2QJKB 3H1JE 1R8EA 3L37A 2ZYDA 1FJPA 4UB6H 1RE4A 4PV1D 4D6TE 4DOJA 2G8YA 1YJ9P 1K05A 1FZGA 3U1AA 3CC2P 2Q1KA 2C9NY 5AW4B 1SP4A 1TU3F 2M3EA 4GOEA 1AVOA 1LNQA 2YXQB 1IFJA 5AVQB 5CCHC 1H88A 1MFTA 3H1HD 1JO5A 3KPEA 3CPWO 5KLVE 3Q5RA 1NTKJ 3AEGC 2OYIC 3AE2C 3CLQA 2LXBA 2E5YA 4H44B 1Z56A 4GODA 1SQXK 2B87B 1EDIA 1N73A 1XTCC 4OGQD 3BCCJ 1KYOD 5APXA 2IYOA 1HBWA 3RK3E 2XU6A 4U3FE 5AW1B 2P2UA 2K9JB 1JMBA 4KHXA 1FZBA 2L91A 2LXCB 1N7SC 3CC7P 2QEXP 1AJYA 1T2KD 3CX5D 1YJNP 1L0LE 3M9QA 2IZ0A 1GU5A 1SS1A 1L0NE 2FFDC 1CI6A 1M56D 3QWOC 3A7OA 3G4SP 5AVRB 5L8RJ 2JJLA 4PV1C 1EQ7A 1SQXJ 3T97B 3WMM0 3V4WA 1OXZA 1FZCB 1DH3A 1QVGO 2PGDA 3F89A 1FDOA 3L71G 2IFNA 1RE3C 2OQQA 4I1LA 1HH0A 4EI2A 4IL6X 1BDCA 1GL2A 3TNUB 2IBZG 2J59M 4OGQC 5CJ4A 1CW5A 4XE5B 4Y99B 3E7KA 4UB8H 4BRYA 3P8CD 4N3YB 4PD4H 3HUSC 1SQQE 2YKPA 1BCCG 1X0TA 4EYYQ 3JCUE 3A5TA 1BCCD 2KP8A 1FOSF 3WUVA 1LP1B 4H44D 2OTJP 2BCCE 3EQ2A 1T2KC 2Q3IA 3U1CA 1PL5A 4HYTB 3AEBC 5K5GB 2R3SA 1SQBG 3U59A 2YIUC 2KNCA 1FS0E 5KKZB 2KZJA 4DT0A 1JY2P 3H1JG 1J2JB 4IFFA 3OAKA 4D6TG 3L73D 3M0DC 1J1DC 2QJKC 1VDFA 1JY3O 5CCHA 4EOTA 2KOGA 2GM4A 3F5HA 2OYIA 4JYCA 4W7ZA 2Q3EA 2JO1A 1ZW0A 3TDKA 3OA7A 2N1TB 4GKGA 4IOIH 2CPBA 1KORA 1NTMK 3CXHI 1PZQA 1ZP0C 3H25A 1LTJA 1GMJA 2E74B 2ZT9B 2MKVA 2A45G 2FYUD 1N7SA 1CSBA 4H44C 4NPEA 1K9MQ 4IL6H 1OW7A 2CK3H 4WY4B 1Q82Q 4Y28J 4BXLA 1FE6A 1KD1Q 4I7ZB 3Q1MA 2I8DA 1FZFA 1L0LG 1L2PA 1EXIA 2FYNB 1L0NG 2KB7P 2W90A 2JDIH 5CHXA 2M8RA 3CCJP 4C7NA 1NTMJ 1RY3A 4NPDA 1N2DC 3VMYA 1RE3A 1BE3D 1VQ7P 2K88A 2O01J 5BU8B 1IFDA 1JUNA 3MD0A 1VPCA 3GHGB 3L4FA 1SQXE 3SWKA 2MJZA 5AW0B 5KJ7D 2KSJA 1FZCC 1S1CX 1N7LA 1VF5B 3VN0A 2QA4P 1QEXA 3VMZA 3HUSA 1PP9G 1PP9D 4HH2A 4XFJA 3L72J 5APVA 1JY3P 3PH0A 2WWWA 1HF9A 3B5NA 4TLFA 3V6IA 3EFGA 2H8PD 1SQQG 4GDOA 2N1TD 2NZ2A 3L74J 3CCMP 2J58A 4Y99C 3RL0B 3EFFK 1URQB 3SSUA 1VQNP 1LT1A 2Y0EA 1A02J 5AW3B 2BCCG 2L5GB 2E74D 1NVOA 1Y47A 2ZT9D 3CXHD 3VOPA 1KQLA 2FKWB 5APUA 5AW5B 3CMAP 2XNXA 5GTIH 1FJKA 2Y9YA 4NPFX 2QVAA 2WMMA 4WY4D 3M0DA 1HWTC 3UIAA 4ASWA 2BEQD 1NAYA 2H43A 1VQ4P 4AQRD 3H1IJ 4DCKA 2FFDB 2J5UA 4YPCA 1KB9H 4UB6E 1NO4A 5KKZC 1ZV8A 2A06E 3CCQP 1AQ5A 1T3JA 5KJ7C 3CCVP 3HTKB 1JY2N 3CCUP 1D7MA 1KILB 2RH0A 1AVYA 2WT7B 1IFPA 3CWBE 4W7YA 4C7RA 1S3JA 2QM8A 2E43A 3H1KG 3CL3D 3H1KD 3M06A 2Z5IA 2WTYA 2B87A 1FZEA 2E75B 2N1TC 1Q2NA 1VF5D 3IAOA 3HD7B 2QJPB 2JR8A 1Y9BA 4DJGA 1FZAA 1YJWP 2WSCJ 1KFMA 2R44A 2E74C 2K9JA 2ZT9C 1IFIA 2QG4A 2WPQA 3KQGA 1U7JA 2WITA 1RF0C 1AA0A 2R5DA 1MZ9A 5AVWB 3L75J 4WY4C 2P7JA 3RL0D 3E1RA 1URQD 1SQPG 3TGUG 1SQPD 2P1JA 3TGUD 5M1BA 1JCCA 2FYNC 3Q5SA 3T97A 1VQMP 1GK6A 1NTKK 3AE6C 1FZCA 4AYCA 1NTME 3A0HH 1P84I 3PLNA 1G1IA 1WRGA 1VQKP 2KSEA 2ITAA 2O3JA 3B4SA 3SWYA 5AVTB 2IBZI 2RKLA 3EWKA 3GHGC 1S5LX 3TNUA 3N7NA 2AXCA 2N9YB 2QE7H 5AVUB 1YI2P 5APTA 1KILD 1VF5C 1KN7A 4UB8E 4B86A 2R32A 4PD4E 1BSHA 3WUTA 2WVRA 3VMAA 4JQ0D 3CX5H 4GIFA 1T8ZA 4EIJA 3L72E 3AE4C 1LP1A 1NU1K 3Q2YA 3L70G 3L70D 1JY3N 4GT1A 2E75D 4W80A 3RBZA 2XV5A 1MV8A 5AVXB 3HD7D 4HJGH 3RL0C 1S72P 1JB0J 2CPSA 1URQC 4N78D 1WMKA 2O1KA 4WWIA 4H0LB 3RGUA 5DJTB 1JY2O 2YO3A 2WSEH 3HE4B 3W68A 2AXTH 2M5AB 1HVVA 5AW8B 5EFWB 1HUCA 1QL2A 1FDMA 5KJ7A 2FBWC 2ZAEB 1RF1B 3LW5H 1Y8AA 2XNDH 2KK7A 5KAIH 2A06G 2HLOA 1IFNA 1PPJE 2A06D 5AVZB 1KTMA 3H1IE 3PJSK 3PHLA 2KS1B 1NU1J 1L4AB 1M1KQ 1FBMA 1NYHA 1JM0A 2HR3A 3CWBG 2OTLP 1QGKB 3CWBD 1NOHA 2QIWA 3HRNA 2LR2A 1KILC 1EDJA 2YXRB 3H1LJ 1BGYE 2POHA 2A45I 2G3AA 3MIWA 2KI7B 3L71D 1ZRTE 4ZNCA 3NMDA 2O01H 1S9KE 1P84D 1NAFA 2IYPA 4OWFA 4ZMDA 4TT3H 1RF0A 1S5LH 4IL6E 1DD4A 2IBZD 2QSIA 3RK3B 2E75C 1W5CE 3HD7C 2QJPC 1SQVG 3M9BA 1SQVD 5B5EH 1NTZE 1YQ3C 2KYVA 1FDIA 4L75A 2Z4EA 4CPGA 3L36A 2N9BA 2ZVNB 3AE7C 1KC8Q 3H1HJ 1OX3A 2KLUA 2SPZA 3L75E 3MGNA 3RL0g 1RHZB 1E5WA 4H0LD 2K37A 5AW7B 1AQTA 3D71A 2OYHB 1SQBD 4ASVA 3GHGA 5CBNA 1FU1A 3V2NA 1NKNA 1N73B 1R5LA 3H1JD 3P32A 1LT9B 1H0TB 4M3LA 2ZXXA 2V7QH 3VTPC 4D6TD 1JOCA 5AVSB 2O01N 3NTNA 1YTZT 1L4AD 2I1JA 2KLVA 3II6A 1OFCX 5APYA 1UIXA 4H13B 1HTLC 2K9YA 1USDA 1OVVA 1ZMEC 5AVYB 4K35A 3L72G 1VQOP 1URQA 5KLVG 2FXMA 2ZYAA 5KLVD 3JC22 1VQ6P 3TK1A 2WSEJ 1XTGB 2FXPA 1NTKE 1GZLA 2BASA 5GTIE 1Q7YQ 1EXJA 2HPCB 4U3FG 3RK3D 3LW5J 4U3FD 2H7HA 3BCCE 4L74A 2WPSA 1LGHB 5H2FE 2W27A 1IK7A 4N6JA 4H0LC 2FFDA 1KB9E 2HYNA 2ZYGA 2WSCH 3A0BH 2C0XA 1JMMA 1DX7A 1GL2B 1L0LD 3ZDMA 1PPJG 4LC1A 1QLED 3H1IG 2W83C 1L0ND 3HTKA 3R2PA 1BCCJ 3FGAD 4WB4A 4R4LA 1RF1C 1T6AA 3C1LA 2WT7A 1X79B 2WZ7A 3KZIH 3HE5A 1EZVE 1GU4A 1G2CA 1L4AC 5TJHA 3I56P 1YYCA 1BGYG 3KHUA 1HGZA 1ZRTD 3HD7A 3CXHH 1LTAC 2FYUK 2OYOA 3MUDC 3P7KA 2JEEA 3H1LE 3L73J 1N86A 3SFEC 1UIIA 4L76A 2Q7CA 1NTZG 1NTZD 4H13D 1YITP 2HODB 3V2QA 3RK3C 1SQQD 1SFCB 1H89A 2E5TA 3O8ZA 1M57D 1S2EA 3KYQA 5CBOA 1GTWA 1LTIC 5KAFE 1VL2A 1K8AQ 2ZXEB 3L75G 1VQ5P 2BCCD 1HJBA 2O1JA 3H1HE 2FYUJ 3A0HE 2V7QJ 5APSA 3QH9A 5H2FH 1LTJB 3AEDC 2OYHC 1KYOE 1DD3A 4JYBA 3FXDA 2YNYA 3GF7A 1IO4A 1GL2D 2XKMA 2H88C 1N73C 2M3BA 3K5BA 2Q6QA 1LT9C 3VYIA 1M90Q 3L35A 4A7PA 3MHVA 4XA4A 3CX5E 1GK4A 1LWUB 3ITKA 1M8OB 1BE3J
chains in the Genus database with same CATH topology
2ZT9C 4I7ZC 4H13C 2QJPC 4Y28J 2WSEJ 2E75D 1YQ3C 2E74D 4YXDC 2ZT9D 1AJYA 4H13D 3AE3C 2FXPA 4Z1MH 1PL5A 2QJYC 1JB0J 1FDIA 4I7ZB 1MKMA 3Q1MA 3AEBC 4YTPC 1WMKA 4H0LB 4H44D 4PV1B 1EXJA 1EXIA 2YIUC 1OW8A 3LW5J 3AE7C 3Q5PA 2YMKA 2E76B 1VL2A 3D6ZA 1IK7A 1R8EA 2BEQD 5L8RJ 5M1BA 4H0LC 3AEAC 4PV1C 1DIPA 3RL0g 2FBWC 3GMAA 2J5UA 2FYNC 4H0LD 3Q5SA 3IN6A 1Q90D 4PV1D 2G8YA 3T97B 5KKZC 2E76C 1K05A 2O01J 3O6QA 3D71A 3AE6C 2QJKC 3ABVC 1ZOYC 2D2CB 3R4YA 1KTMA 2E76D 1KILE 1TU3F 1U57A 2V7QJ 3AE5C 3FGAD 4R4LA 1FDOA 1PV3A 3B71A 1NYHA 2P10A 4U7JA 3AEDC 2OQQA 3Q3DA 1DD3A 4OGQB 1S1CX 1VF5B 2D2CC 2JO1A 2H89C 1S5LX 2QIWA 3EWKA 3GF7A 1KQGB 4IL6X 1OMIA 2H88C 2BEZF 2D2CD 3D70A 3GF3A 3Q5RA 1KMIZ 1YQ4C 3AEGC 3AE2C 3AE1C 1NGMB 1KORA 3GLMA 4OGQC 4XFJA 4H44B 1RQVA 1VF5C 1KQFB 1K04A 1ZP0C 2G3AA 3AE8C 3H25A 2WQYC 2WSFJ 1HF9A 2JP3A 4R4MA 3AEEC 4OGQD 1GMJA 1HJ0A 1RQUA 2E75B 1ZRTE 2WPVB 3G9RA 2E74B 1VF5D 3IAOA 5KLIC 4KT0J 2ZT9B 1UIXA 2MKVA 1OW6A 4H13B 4RKUJ 1Y9BA 2K9YA 3D6YA 4GDOA 4TT3H 2NZ2A 3AEFC 4H44C 3AECC 1ZMEC 3RK3E 3SFDC 2WSCJ 3AE9C 3AE4C 3S9OA 1PIXA 3C8VA 1DD4A 2QSIA 1OW7A 2E75C 2IDBA 2E74C 3Q2YA 3SFEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGA D;  1PL5 A;  1UIX A;  1S1C X;  1TU3 F;  1NYH A; 
#chains in the Genus database with same CATH topology
 4H13 C;  1EDL A;  1X9V A;  3FWL A;  3KXD A;  4BWN A;  1PGJ A;  3OW2 O;  2PAJ A;  3PRJ A;  3V2R A;  1NTK G;  1GW4 A;  2GUV A;  2FYZ A;  1A02 F;  3HE4 A;  2AXT E;  1KFN A;  3LID A;  2M5A A;  3BCC G;  1PGO A;  1GD2 E;  1PP9 J;  4K3A A;  3M0A A;  1RF1 A;  3IN6 A;  1Q90 D;  2WSS H;  1SFC D;  5KAI E;  3O6Q B;  3V5B A;  1OWA A;  3ABV C;  3TF5 A;  2Q5U A;  1HGV A;  4GOF A;  5KAF H;  3P8C E;  2KS1 A;  1L4A A;  3B5N B;  2W6B A;  1GL2 C;  5B66 H;  1E79 H;  2WPR A;  2RN0 A;  1YTZ I;  4KJM A;  1BCC E;  1J1E B;  2W8Z A;  4I2L C;  1EZV G;  1X8Y A;  1EZV D;  3GF3 A;  1JNM A;  2R5B A;  3MUD A;  2W6J H;  3AE1 C;  1T3U A;  1SQX G;  1IZN B;  1SQX D;  1ZR2 A;  2JKV A;  4C46 A;  1VQL P;  2WSF J;  1HJ0 A;  4L73 A;  1Q86 Q;  4KT0 J;  1KYO H;  3G6E P;  3BAS A;  1S5L E;  1KQS O;  2V4H A;  3M91 A;  4MN4 C;  1ZLL A;  1VQP P;  5B5E E;  4RJT A;  2AEM A;  1U7M A;  3AE3 C;  2NRG A;  3G3Z A;  3L73 E;  1W2B O;  3FXE A;  2AEF A;  3B8E B;  3TSI A;  1H8A A;  3S4R A;  1SQP K;  3H1K J;  1Q81 Q;  5E79 H;  3D6Z A;  3IF4 A;  2KZI A;  4HB1 A;  3L74 E;  2QRX A;  3H32 B;  2LKM A;  1IK9 A;  1SFC C;  4OVN F;  1CZQ A;  4RES B;  2NPS B;  3H1H G;  3WU2 H;  2OYH A;  4EDF A;  2D2C B;  1N8R Q;  3AE5 C;  1ZR4 A;  1MUU A;  3W67 A;  1PV3 A;  2ZJS E;  3B71 A;  1IJD B;  1LT9 A;  1H0T A;  1P84 H;  2FYU E;  3CME P;  5CCG D;  2R3C A;  1JTH B;  4ZKP A;  1QVF O;  1LTG C;  1LTJ C;  4PD4 I;  3VP8 A;  4JBZ A;  2PRR A;  3FX0 A;  1BDD A;  3AE8 C;  3B5N D;  2JP3 A;  3AEE C;  1AFO A;  1RQU A;  1SQP J;  2WPV B;  3TGU J;  1OW6 A;  3BRT B;  3D6Y A;  3CI9 A;  2N1T A;  2KUB A;  3CCE P;  1PIX A;  1M7L A;  4PJ0 H;  2IDB A;  5TIS H;  2PFX A;  1M1J B;  5AW9 B;  4ZKU A;  2ZVO B;  4LGD E;  2ZFC A;  2HG5 D;  5AVV B;  5AW2 B;  1NH4 A;  1LWU C;  4Z1M H;  1BE3 E;  1NWQ A;  4HKZ H;  2I1K A;  2HPC A;  3GG2 A;  1OW8 A;  3A2A A;  1VQ8 P;  3A3Y B;  2YMK A;  2E76 B;  4WY4 A;  3BRV B;  2KIK A;  5GTH E;  1LTT C;  4I6M C;  3A0B E;  3FWN A;  2DW3 A;  2OGU A;  1SLQ A;  2C9L Y;  3MP7 B;  1RH5 B;  1PP9 E;  3KDP B;  1IFM A;  1U57 A;  2QM7 A;  3V2P A;  2IX7 C;  1GW3 A;  5CJ0 A;  3NXS A;  5AW6 B;  5APW A;  1DEB A;  5CCG C;  2P10 A;  2FY8 A;  3L70 J;  2NPS D;  3KZI E;  1KQG B;  1SVF A;  3IR9 A;  2XZR A;  1OMI A;  2D2C D;  5KLI B;  2OAR A;  3B5N C;  3LIE A;  2W6A A;  1NTM G;  1PGQ A;  1NTM D;  1RQV A;  2WQY C;  1J1E C;  4QMA A;  4R4M A;  1PFI A;  3CXH E;  2B89 A;  4RKU J;  2A45 H;  1EDK A;  2Z5H A;  3S9O A;  1ZXG A;  1IC2 A;  3I5C A;  1X22 A;  3S1K A;  4IFD K;  4O9B A;  1QL1 A;  1SQV K;  3G71 P;  4PD4 D;  4JPZ B;  3CCR P;  2HOD A;  3L73 G;  4YTP C;  3H6P A;  1SFC A;  3CWB J;  3PTZ A;  3L72 D;  1CI6 B;  3RK2 B;  1EC5 A;  4LLH A;  2Y0D A;  1NJI Q;  3L74 G;  3L74 D;  3GMA A;  2IPP A;  3L71 J;  2P67 A;  3H1K E;  1SQB K;  4IFM A;  1OIP A;  2E76 D;  2NPS C;  1OVR A;  5GTH H;  1OVU A;  2FYU G;  2M0B A;  2D2C C;  1SQV J;  4WVZ A;  2UWJ E;  2IFM A;  1MFZ A;  1NHL A;  1QX8 A;  2YO2 A;  1PPJ D;  3SWF A;  3H1I D;  1KIL A;  2FXO A;  4BRY B;  1LTB C;  3OJA B;  3P8M C;  1W2E A;  3MZW B;  3JSV C;  3AEF C;  1FOS E;  1KV4 A;  3JCU H;  1LWU A;  3AE9 C;  3MTU E;  3C8V A;  2QJY B;  1NU1 E;  1SQP E;  3TGU E;  5KLV K;  1SQB J;  1BGY D;  2AEJ A;  4YXD C;  2RMZ A;  1BE3 G;  1MKM A;  1S9K D;  1VQ9 P;  3H1J J;  5CMZ A;  4DZO A;  1DEE G;  1M1J C;  2XDJ A;  2KNC B;  2YKQ A;  2GUS A;  2WSF H;  4D6T J;  1KB9 I;  3PP5 A;  1YBK A;  1DIP A;  5CCG A;  2E76 C;  3O6Q A;  1GDT A;  1L0L K;  2VRS A;  3RK2 D;  3N4X A;  1KIL E;  3VMX A;  1L0N K;  1R5S A;  1JEK A;  1NKZ B;  1RE4 C;  5KLV J;  5B66 E;  2OYI B;  3L75 D;  1EZV I;  2E42 A;  2B9B A;  3RBX A;  4YXW H;  3D70 A;  3VP9 A;  3M9H A;  1KMI Z;  1YQ4 C;  1PGP A;  3GLM A;  1USE A;  3L70 E;  1KQF B;  4U3F J;  3G9R A;  5C39 A;  3CCL P;  5KLI C;  4N78 E;  4AUW A;  3GW6 A;  1N7S B;  4WBA A;  3SFD C;  3IFM A;  2Y0C A;  1S4X A;  1WT6 A;  1L0L J;  1ZN5 A;  2K1A A;  1K73 Q;  2K3R A;  1L0N J;  4RO0 A;  1NTZ K;  4JF7 A;  4PV1 B;  1SQQ K;  5BVZ A;  1FC2 C;  2B88 A;  2Q9I A;  3Q5P A;  3V4Q A;  5E79 E;  4C7N B;  3BVH A;  3AEA C;  2JWD A;  3H32 A;  1JCD A;  1FAV A;  1AV1 A;  1BGY J;  2NPS A;  3WU2 E;  3E1I A;  3RK2 C;  3HE5 B;  1NTK D;  2Y9Z A;  1G2C B;  1ZOY C;  3R4Y A;  1KYO I;  1KZU B;  3CD6 P;  2P58 A;  1YIJ P;  3BCC D;  3L71 E;  4U7J A;  1P84 E;  3Q3D A;  4OGQ B;  1G1J A;  3TYY A;  2HFE D;  5APQ A;  2IZ1 A;  1KB9 D;  2H89 C;  1JTH A;  1NTZ J;  1LJ2 A;  1BSN A;  2BEZ F;  2IBZ E;  5CCH D;  2PP6 A;  2C0W A;  3HUS B;  1SQQ J;  1NGM B;  5BU5 A;  2KXP B;  1SQV E;  3WUU A;  1K04 A;  3CX5 I;  3BAT A;  3CC4 P;  2OTK E;  2BCC J;  3AEC C;  3I55 P;  3NFQ A;  1NU1 G;  4PJ0 E;  5KTB A;  5TIS E;  4OH8 B;  1NU1 D;  4I7Z C;  1M1J A;  1OZH A;  2YIU B;  2YKO A;  1LTS C;  2GA1 A;  2QJY C;  1N7S D;  2YMY A;  1SQB E;  3USS A;  3H1L G;  3H1L D;  3CCS P;  5DJU B;  2JWA A;  1YHQ P;  3C9I A;  1J1D B;  2QJK B;  3H1J E;  1R8E A;  3L37 A;  2ZYD A;  1FJP A;  4UB6 H;  1RE4 A;  4PV1 D;  4D6T E;  4DOJ A;  2G8Y A;  1YJ9 P;  1K05 A;  1FZG A;  3U1A A;  3CC2 P;  2Q1K A;  2C9N Y;  5AW4 B;  1SP4 A;  1TU3 F;  2M3E A;  4GOE A;  1AVO A;  1LNQ A;  2YXQ B;  1IFJ A;  5AVQ B;  5CCH C;  1H88 A;  1MFT A;  3H1H D;  1JO5 A;  3KPE A;  3CPW O;  5KLV E;  3Q5R A;  1NTK J;  3AEG C;  2OYI C;  3AE2 C;  3CLQ A;  2LXB A;  2E5Y A;  4H44 B;  1Z56 A;  4GOD A;  1SQX K;  2B87 B;  1EDI A;  1N73 A;  1XTC C;  4OGQ D;  3BCC J;  1KYO D;  5APX A;  2IYO A;  1HBW A;  3RK3 E;  2XU6 A;  4U3F E;  5AW1 B;  2P2U A;  2K9J B;  1JMB A;  4KHX A;  1FZB A;  2L91 A;  2LXC B;  1N7S C;  3CC7 P;  2QEX P;  1AJY A;  1T2K D;  3CX5 D;  1YJN P;  1L0L E;  3M9Q A;  2IZ0 A;  1GU5 A;  1SS1 A;  1L0N E;  2FFD C;  1CI6 A;  1M56 D;  3QWO C;  3A7O A;  3G4S P;  5AVR B;  5L8R J;  2JJL A;  4PV1 C;  1EQ7 A;  1SQX J;  3T97 B;  3WMM 0;  3V4W A;  1OXZ A;  1FZC B;  1DH3 A;  1QVG O;  2PGD A;  3F89 A;  1FDO A;  3L71 G;  2IFN A;  1RE3 C;  2OQQ A;  4I1L A;  1HH0 A;  4EI2 A;  4IL6 X;  1BDC A;  1GL2 A;  3TNU B;  2IBZ G;  2J59 M;  4OGQ C;  5CJ4 A;  1CW5 A;  4XE5 B;  4Y99 B;  3E7K A;  4UB8 H;  4BRY A;  3P8C D;  4N3Y B;  4PD4 H;  3HUS C;  1SQQ E;  2YKP A;  1BCC G;  1X0T A;  4EYY Q;  3JCU E;  3A5T A;  1BCC D;  2KP8 A;  1FOS F;  3WUV A;  1LP1 B;  4H44 D;  2OTJ P;  2BCC E;  3EQ2 A;  1T2K C;  2Q3I A;  3U1C A;  1PL5 A;  4HYT B;  3AEB C;  5K5G B;  2R3S A;  1SQB G;  3U59 A;  2YIU C;  2KNC A;  1FS0 E;  5KKZ B;  2KZJ A;  4DT0 A;  1JY2 P;  3H1J G;  1J2J B;  4IFF A;  3OAK A;  4D6T G;  3L73 D;  3M0D C;  1J1D C;  2QJK C;  1VDF A;  1JY3 O;  5CCH A;  4EOT A;  2KOG A;  2GM4 A;  3F5H A;  2OYI A;  4JYC A;  4W7Z A;  2Q3E A;  2JO1 A;  1ZW0 A;  3TDK A;  3OA7 A;  2N1T B;  4GKG A;  4IOI H;  2CPB A;  1KOR A;  1NTM K;  3CXH I;  1PZQ A;  1ZP0 C;  3H25 A;  1LTJ A;  1GMJ A;  2E74 B;  2ZT9 B;  2MKV A;  2A45 G;  2FYU D;  1N7S A;  1CSB A;  4H44 C;  4NPE A;  1K9M Q;  4IL6 H;  1OW7 A;  2CK3 H;  4WY4 B;  1Q82 Q;  4Y28 J;  4BXL A;  1FE6 A;  1KD1 Q;  4I7Z B;  3Q1M A;  2I8D A;  1FZF A;  1L0L G;  1L2P A;  1EXI A;  2FYN B;  1L0N G;  2KB7 P;  2W90 A;  2JDI H;  5CHX A;  2M8R A;  3CCJ P;  4C7N A;  1NTM J;  1RY3 A;  4NPD A;  1N2D C;  3VMY A;  1RE3 A;  1BE3 D;  1VQ7 P;  2K88 A;  2O01 J;  5BU8 B;  1IFD A;  1JUN A;  3MD0 A;  1VPC A;  3GHG B;  3L4F A;  1SQX E;  3SWK A;  2MJZ A;  5AW0 B;  5KJ7 D;  2KSJ A;  1FZC C;  1S1C X;  1N7L A;  1VF5 B;  3VN0 A;  2QA4 P;  1QEX A;  3VMZ A;  3HUS A;  1PP9 G;  1PP9 D;  4HH2 A;  4XFJ A;  3L72 J;  5APV A;  1JY3 P;  3PH0 A;  2WWW A;  1HF9 A;  3B5N A;  4TLF A;  3V6I A;  3EFG A;  2H8P D;  1SQQ G;  4GDO A;  2N1T D;  2NZ2 A;  3L74 J;  3CCM P;  2J58 A;  4Y99 C;  3RL0 B;  3EFF K;  1URQ B;  3SSU A;  1VQN P;  1LT1 A;  2Y0E A;  1A02 J;  5AW3 B;  2BCC G;  2L5G B;  2E74 D;  1NVO A;  1Y47 A;  2ZT9 D;  3CXH D;  3VOP A;  1KQL A;  2FKW B;  5APU A;  5AW5 B;  3CMA P;  2XNX A;  5GTI H;  1FJK A;  2Y9Y A;  4NPF X;  2QVA A;  2WMM A;  4WY4 D;  3M0D A;  1HWT C;  3UIA A;  4ASW A;  2BEQ D;  1NAY A;  2H43 A;  1VQ4 P;  4AQR D;  3H1I J;  4DCK A;  2FFD B;  2J5U A;  4YPC A;  1KB9 H;  4UB6 E;  1NO4 A;  5KKZ C;  1ZV8 A;  2A06 E;  3CCQ P;  1AQ5 A;  1T3J A;  5KJ7 C;  3CCV P;  3HTK B;  1JY2 N;  3CCU P;  1D7M A;  1KIL B;  2RH0 A;  1AVY A;  2WT7 B;  1IFP A;  3CWB E;  4W7Y A;  4C7R A;  1S3J A;  2QM8 A;  2E43 A;  3H1K G;  3CL3 D;  3H1K D;  3M06 A;  2Z5I A;  2WTY A;  2B87 A;  1FZE A;  2E75 B;  2N1T C;  1Q2N A;  1VF5 D;  3IAO A;  3HD7 B;  2QJP B;  2JR8 A;  1Y9B A;  4DJG A;  1FZA A;  1YJW P;  2WSC J;  1KFM A;  2R44 A;  2E74 C;  2K9J A;  2ZT9 C;  1IFI A;  2QG4 A;  2WPQ A;  3KQG A;  1U7J A;  2WIT A;  1RF0 C;  1AA0 A;  2R5D A;  1MZ9 A;  5AVW B;  3L75 J;  4WY4 C;  2P7J A;  3RL0 D;  3E1R A;  1URQ D;  1SQP G;  3TGU G;  1SQP D;  2P1J A;  3TGU D;  5M1B A;  1JCC A;  2FYN C;  3Q5S A;  3T97 A;  1VQM P;  1GK6 A;  1NTK K;  3AE6 C;  1FZC A;  4AYC A;  1NTM E;  3A0H H;  1P84 I;  3PLN A;  1G1I A;  1WRG A;  1VQK P;  2KSE A;  2ITA A;  2O3J A;  3B4S A;  3SWY A;  5AVT B;  2IBZ I;  2RKL A;  3EWK A;  3GHG C;  1S5L X;  3TNU A;  3N7N A;  2AXC A;  2N9Y B;  2QE7 H;  5AVU B;  1YI2 P;  5APT A;  1KIL D;  1VF5 C;  1KN7 A;  4UB8 E;  4B86 A;  2R32 A;  4PD4 E;  1BSH A;  3WUT A;  2WVR A;  3VMA A;  4JQ0 D;  3CX5 H;  4GIF A;  1T8Z A;  4EIJ A;  3L72 E;  3AE4 C;  1LP1 A;  1NU1 K;  3Q2Y A;  3L70 G;  3L70 D;  1JY3 N;  4GT1 A;  2E75 D;  4W80 A;  3RBZ A;  2XV5 A;  1MV8 A;  5AVX B;  3HD7 D;  4HJG H;  3RL0 C;  1S72 P;  1JB0 J;  2CPS A;  1URQ C;  4N78 D;  1WMK A;  2O1K A;  4WWI A;  4H0L B;  3RGU A;  5DJT B;  1JY2 O;  2YO3 A;  2WSE H;  3HE4 B;  3W68 A;  2AXT H;  2M5A B;  1HVV A;  5AW8 B;  5EFW B;  1HUC A;  1QL2 A;  1FDM A;  5KJ7 A;  2FBW C;  2ZAE B;  1RF1 B;  3LW5 H;  1Y8A A;  2XND H;  2KK7 A;  5KAI H;  2A06 G;  2HLO A;  1IFN A;  1PPJ E;  2A06 D;  5AVZ B;  1KTM A;  3H1I E;  3PJS K;  3PHL A;  2KS1 B;  1NU1 J;  1L4A B;  1M1K Q;  1FBM A;  1NYH A;  1JM0 A;  2HR3 A;  3CWB G;  2OTL P;  1QGK B;  3CWB D;  1NOH A;  2QIW A;  3HRN A;  2LR2 A;  1KIL C;  1EDJ A;  2YXR B;  3H1L J;  1BGY E;  2POH A;  2A45 I;  2G3A A;  3MIW A;  2KI7 B;  3L71 D;  1ZRT E;  4ZNC A;  3NMD A;  2O01 H;  1S9K E;  1P84 D;  1NAF A;  2IYP A;  4OWF A;  4ZMD A;  4TT3 H;  1RF0 A;  1S5L H;  4IL6 E;  1DD4 A;  2IBZ D;  2QSI A;  3RK3 B;  2E75 C;  1W5C E;  3HD7 C;  2QJP C;  1SQV G;  3M9B A;  1SQV D;  5B5E H;  1NTZ E;  1YQ3 C;  2KYV A;  1FDI A;  4L75 A;  2Z4E A;  4CPG A;  3L36 A;  2N9B A;  2ZVN B;  3AE7 C;  1KC8 Q;  3H1H J;  1OX3 A;  2KLU A;  2SPZ A;  3L75 E;  3MGN A;  3RL0 g;  1RHZ B;  1E5W A;  4H0L D;  2K37 A;  5AW7 B;  1AQT A;  3D71 A;  2OYH B;  1SQB D;  4ASV A;  3GHG A;  5CBN A;  1FU1 A;  3V2N A;  1NKN A;  1N73 B;  1R5L A;  3H1J D;  3P32 A;  1LT9 B;  1H0T B;  4M3L A;  2ZXX A;  2V7Q H;  3VTP C;  4D6T D;  1JOC A;  5AVS B;  2O01 N;  3NTN A;  1YTZ T;  1L4A D;  2I1J A;  2KLV A;  3II6 A;  1OFC X;  5APY A;  1UIX A;  4H13 B;  1HTL C;  2K9Y A;  1USD A;  1OVV A;  1ZME C;  5AVY B;  4K35 A;  3L72 G;  1VQO P;  1URQ A;  5KLV G;  2FXM A;  2ZYA A;  5KLV D;  3JC2 2;  1VQ6 P;  3TK1 A;  2WSE J;  1XTG B;  2FXP A;  1NTK E;  1GZL A;  2BAS A;  5GTI E;  1Q7Y Q;  1EXJ A;  2HPC B;  4U3F G;  3RK3 D;  3LW5 J;  4U3F D;  2H7H A;  3BCC E;  4L74 A;  2WPS A;  1LGH B;  5H2F E;  2W27 A;  1IK7 A;  4N6J A;  4H0L C;  2FFD A;  1KB9 E;  2HYN A;  2ZYG A;  2WSC H;  3A0B H;  2C0X A;  1JMM A;  1DX7 A;  1GL2 B;  1L0L D;  3ZDM A;  1PPJ G;  4LC1 A;  1QLE D;  3H1I G;  2W83 C;  1L0N D;  3HTK A;  3R2P A;  1BCC J;  3FGA D;  4WB4 A;  4R4L A;  1RF1 C;  1T6A A;  3C1L A;  2WT7 A;  1X79 B;  2WZ7 A;  3KZI H;  3HE5 A;  1EZV E;  1GU4 A;  1G2C A;  1L4A C;  5TJH A;  3I56 P;  1YYC A;  1BGY G;  3KHU A;  1HGZ A;  1ZRT D;  3HD7 A;  3CXH H;  1LTA C;  2FYU K;  2OYO A;  3MUD C;  3P7K A;  2JEE A;  3H1L E;  3L73 J;  1N86 A;  3SFE C;  1UII A;  4L76 A;  2Q7C A;  1NTZ G;  1NTZ D;  4H13 D;  1YIT P;  2HOD B;  3V2Q A;  3RK3 C;  1SQQ D;  1SFC B;  1H89 A;  2E5T A;  3O8Z A;  1M57 D;  1S2E A;  3KYQ A;  5CBO A;  1GTW A;  1LTI C;  5KAF E;  1VL2 A;  1K8A Q;  2ZXE B;  3L75 G;  1VQ5 P;  2BCC D;  1HJB A;  2O1J A;  3H1H E;  2FYU J;  3A0H E;  2V7Q J;  5APS A;  3QH9 A;  5H2F H;  1LTJ B;  3AED C;  2OYH C;  1KYO E;  1DD3 A;  4JYB A;  3FXD A;  2YNY A;  3GF7 A;  1IO4 A;  1GL2 D;  2XKM A;  2H88 C;  1N73 C;  2M3B A;  3K5B A;  2Q6Q A;  1LT9 C;  3VYI A;  1M90 Q;  3L35 A;  4A7P A;  3MHV A;  4XA4 A;  3CX5 E;  1GK4 A;  1LWU B;  3ITK A;  1M8O B;  1BE3 J; 
#chains in the Genus database with same CATH homology
 2ZT9 C;  4I7Z C;  4H13 C;  2QJP C;  4Y28 J;  2WSE J;  2E75 D;  1YQ3 C;  2E74 D;  4YXD C;  2ZT9 D;  1AJY A;  4H13 D;  3AE3 C;  2FXP A;  4Z1M H;  1PL5 A;  2QJY C;  1JB0 J;  1FDI A;  4I7Z B;  1MKM A;  3Q1M A;  3AEB C;  4YTP C;  1WMK A;  4H0L B;  4H44 D;  4PV1 B;  1EXJ A;  1EXI A;  2YIU C;  1OW8 A;  3LW5 J;  3AE7 C;  3Q5P A;  2YMK A;  2E76 B;  1VL2 A;  3D6Z A;  1IK7 A;  1R8E A;  2BEQ D;  5L8R J;  5M1B A;  4H0L C;  3AEA C;  4PV1 C;  1DIP A;  3RL0 g;  2FBW C;  3GMA A;  2J5U A;  2FYN C;  4H0L D;  3Q5S A;  3IN6 A;  1Q90 D;  4PV1 D;  2G8Y A;  3T97 B;  5KKZ C;  2E76 C;  1K05 A;  2O01 J;  3O6Q A;  3D71 A;  3AE6 C;  2QJK C;  3ABV C;  1ZOY C;  2D2C B;  3R4Y A;  1KTM A;  2E76 D;  1KIL E;  1TU3 F;  1U57 A;  2V7Q J;  3AE5 C;  3FGA D;  4R4L A;  1FDO A;  1PV3 A;  3B71 A;  1NYH A;  2P10 A;  4U7J A;  3AED C;  2OQQ A;  3Q3D A;  1DD3 A;  4OGQ B;  1S1C X;  1VF5 B;  2D2C C;  2JO1 A;  2H89 C;  1S5L X;  2QIW A;  3EWK A;  3GF7 A;  1KQG B;  4IL6 X;  1OMI A;  2H88 C;  2BEZ F;  2D2C D;  3D70 A;  3GF3 A;  3Q5R A;  1KMI Z;  1YQ4 C;  3AEG C;  3AE2 C;  3AE1 C;  1NGM B;  1KOR A;  3GLM A;  4OGQ C;  4XFJ A;  4H44 B;  1RQV A;  1VF5 C;  1KQF B;  1K04 A;  1ZP0 C;  2G3A A;  3AE8 C;  3H25 A;  2WQY C;  2WSF J;  1HF9 A;  2JP3 A;  4R4M A;  3AEE C;  4OGQ D;  1GMJ A;  1HJ0 A;  1RQU A;  2E75 B;  1ZRT E;  2WPV B;  3G9R A;  2E74 B;  1VF5 D;  3IAO A;  5KLI C;  4KT0 J;  2ZT9 B;  1UIX A;  2MKV A;  1OW6 A;  4H13 B;  4RKU J;  1Y9B A;  2K9Y A;  3D6Y A;  4GDO A;  4TT3 H;  2NZ2 A;  3AEF C;  4H44 C;  3AEC C;  1ZME C;  3RK3 E;  3SFD C;  2WSC J;  3AE9 C;  3AE4 C;  3S9O A;  1PIX A;  3C8V A;  1DD4 A;  2QSI A;  1OW7 A;  2E75 C;  2IDB A;  2E74 C;  3Q2Y A;  3SFE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...