1UIXA

Coiled-coil structure of the rhoa-binding domain in rho-kinase
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
b'GSTSDVANLANEKEELNNKLKEAQEQLSRLKDEEISAAAIKAQFEKQLLTERTLKTQAVNKLAEIMNRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rho-associated kinase
publication title Parallel coiled-coil association of the RhoA-binding domain in Rho-kinase
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 30
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.730 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1uixA00
1S1CX 1UIXA 3FGAD 1NYHA 1TU3F 1PL5A
chains in the Genus database with same CATH superfamily
1NU1J 1G1JA 3L70J 1FZCA 2WT7A 1N7SD 1HVVA 2ZYGA 2B88A 2M3EA 5KAIE 1FE6A 1NTZK 1IO4A 2K9JA 1N7SA 1DEBA 3G9RA 1FJPA 2YKOA 5KLVJ 3RK2D 3Q2YA 1ZRTE 3CC4P 3HUSC 1KQFB 1RE4C 1IFPA 1NVOA 1HUCA 3L75D 1DD4A 2BASA 1RY3A 5AW4B 3L75G 2O1JA 2P58A 1SQVJ 1SP4A 2Q1KA 3L71G 3BCCD 4D6TJ 5AW9B 1JMBA 2WPVB 3GHGA 1LT9C 3GLMA 2KIKA 3TGUJ 2YMKA 5TISE 1FDOA 4ZNCA 4PV1C 1IFNA 2A06E 3Q5PA 1L0LD 4NPDA 2C9NY 1EDKA 1YIJP 5AVXB 1L0LG 3H1HJ 1AQ5A 2P67A 5APUA 1PZQA 1WT6A 1LTJC 1JNMA 2HODB 4H44B 2I1JA 3TK1A 2IDBA 3GF7A 3U59A 1FOSF 1L4AD 4O9BA 5BU8B 2J5UA 1GMJA 2M5AA 1L4AA 1ZW0A 2FXOA 1HTLC 3CCEP 2OTKE 3H1LJ 1NTMG 1A02J 1NYHA 3O6QA 4H0LD 3CI9A 4H44C 4Z1MH 2E74D 4R4LA 1LTBC 3P32A 1L0NE 1GU5A 2QSIA 1LTJA 3H1JG 3T97B 2Q6QA 2L91A 3V5BA 3Q1MA 1M57D 2WSFJ 2W6JH 2JKVA 2KLVA 5KJ7C 2E75B 1NTZJ 1JOCA 3GW6A 3RL0C 1SS1A 2BEQD 3QWOC 5APVA 3V4WA 3WUTA 3SWYA 1GDTA 1E5WA 1DIPA 1J1DB 1KB9I 1W5CE 2D2CC 3CCQP 4IL6X 1IK7A 3JCUH 1VQ9P 2AEJA 2ZT9B 1DX7A 1ZR2A 5B66H 2QM8A 1H89A 3B5NB 1KV4A 1SQQE 1JMMA 3JCUE 2XU6A 4DZOA 2XDJA 5CCHD 5AVYB 5B66E 4KJMA 2BCCJ 2NPSB 3MIWA 2OTJP 1GL2B 3IN6A 2KNCA 2WPSA 3WUUA 2KS1A 4YXDC 3BCCE 1QL1A 3A3YB 3CCUP 4KHXA 1VF5C 1WRGA 3P8MC 1X8YA 3CMAP 1OXZA 1URQB 2NPSC 2DW3A 2L5GB 2IX7C 1ZOYC 3L74J 1S9KD 1GTWA 4H13C 3L72J 2ZYAA 3BRTB 1ZR4A 1MFZA 3LW5J 1H0TB 2FYUE 1G2CB 1PFIA 3TYYA 2XNXA 2XZRA 1AA0A 1BE3D 3A2AA 2CK3H 1J1EC 1BE3G 2RMZA 3CWBJ 1FAVA 1SQPK 4OH8B 3L73G 1OMIA 2Y0EA 3A0HH 1DD3A 1BCCJ 2O01J 3R4YA 4GDOA 2Y9ZA 2FYNC 2QG4A 1LGHB 4GOEA 4WY4B 4GODA 1VQNP 3P8CD 1SQXK 2JDIH 5KLVE 1HWTC 3A0HE 2K9YA 2OYIC 2QM7A 1XTCC 2WVRA 2WSEJ 4WBAA 1Q86Q 1U7JA 3RK3D 2IBZI 3L35A 3AECC 3TDKA 1QEXA 3M9HA 4C46A 3HD7D 1QLED 1FOSE 5CHXA 2FFDA 1S1CX 2V7QJ 3VYIA 1NTKE 1FZGA 3VMXA 1LTIC 5E79H 4YPCA 3FWNA 3HE5B 1T8ZA 4HH2A 1EZVE 3H1KE 1OVRA 2YMYA 1YQ3C 5KTBA 1VPCA 3H1HE 1KILB 2OYIA 5AVTB 1JCDA 1Q90D 3SFEC 2Q5UA 1W2BO 1ZRTD 2XKMA 1DEEG 2O1KA 3R2PA 3M9BA 1RF1B 1NU1K 1YJNP 2PP6A 3AE8C 3OA7A 4N3YB 1KILC 2JJLA 2B87A 3AEAC 2N1TD 3MUDC 5B5EE 4OGQC 1K05A 1M1JB 2KB7P 2C9LY 4BXLA 2N1TA 1VQ5P 3II6A 1OZHA 1EXJA 3AEGC 3WMM0 2Z4EA 3B71A 4UB8E 1GK6A 1YQ4C 2WSCJ 2WQYC 3VMYA 1LWUC 1NTMK 2A06G 4NPEA 1SQVK 1NTZE 4I1LA 4HB1A 3AE3C 1U57A 1BDDA 4HKZH 5AVRB 3PHLA 1SQXJ 2WT7B 3EFGA 1M1KQ 3MUDA 2OGUA 1CZQA 3PRJA 5AVVB 1Z56A 3C9IA 1RQUA 1PGOA 4HYTB 1KN7A 5AW3B 1YBKA 2FXPA 5APTA 2E5YA 1EQ7A 2KP8A 3CCJP 1U7MA 4NPFX 3NFQA 2C0XA 1FZBA 4EOTA 2KUBA 2ZVOB 5KLIB 3CPWO 1KC8Q 1DH3A 3Q5RA 1L2PA 1FZCC 1LWUA 1ZN5A 4PJ0H 4JYBA 1EC5A 3H1ID 3FGAD 2IZ1A 1L0NG 3L75J 4N6JA 2E76D 1Q81Q 3L71J 1YJWP 1FC2C 1N7SC 4PJ0E 3SFDC 1M56D 3CX5E 4AQRD 5GTIH 3LIDA 5APWA 1BGYE 1ZXGA 1VQOP 5K5GB 3UIAA 1L0LJ 1PIXA 5KAIH 1S2EA 2FBWC 3HUSB 3L74E 5AW0B 3AE5C 3BVHA 3GHGC 3L72E 1SQBK 3HTKA 1MZ9A 2B9BA 3AEBC 2A45H 1VQKP 1GK4A 4R4MA 3N7NA 1SQQD 1NAFA 3WU2H 2Z5IA 1LT9B 1SQQG 1VQ8P 3PLNA 2O01H 3SWFA 2M5AB 2RN0A 1OIPA 3CWBE 4PD4I 3IF4A 4GT1A 3A0BH 3CC2P 2FXMA 1YI2P 3WU2E 1NTMJ 4PV1B 3O6QB 3D6YA 1MUUA 1PPJD 2YNYA 1SFCD 5TISH 3A0BE 3CCSP 2E42A 4I7ZC 2QEXP 1LTJB 1AVOA 3H1JJ 1Y47A 3BCCG 3VP8A 2HG5D 1L4AC 3LIEA 1NJIQ 1NKZB 1RE3A 3TSIA 1NOHA 2FYUD 1H8AA 1VQ6P 1GD2E 2UWJE 4H0LC 2FYUG 2R3CA 1GW4A 3FXEA 3CCMP 1QVGO 4UB6H 2M0BA 2IZ0A 3CCVP 4LLHA 4N78E 2W83C 2OARA 3H6PA 5L8RJ 1KTMA 2KZIA 4UB6E 3N4XA 5DJUB 3CXHD 2C0WA 1IFMA 2ZAEB 3P7KA 5KAFE 4RO0A 1YJ9P 2SPZA 3G4SP 5KLVD 1PGQA 3RL0B 1G1IA 3BRVB 3G71P 5KLVG 3BASA 2HYNA 1KZUB 4IFMA 3H1IE 3CD6P 1BDCA 1SQBJ 2D2CB 2R5BA 4Y28J 4D6TD 1N86A 3RBZA 1WMKA 1NTKD 3U1CA 3TGUD 2QA4P 4IFFA 1LNQA 1NTKG 1KYOE 1NWQA 4DJGA 5AVUB 4TT3H 1EZVD 3H1KD 1A02F 1SQPE 1EZVG 1IFJA 3H1KG 3H1HD 2YKPA 5AW1B 4A7PA 3A7OA 3H1HG 4JYCA 4H44D 2W8ZA 4EI2A 1PL5A 5APXA 2QJPC 1SQXE 4K35A 2HODA 3L73J 4RKUJ 1AV1A 4JF7A 2HR3A 1JUNA 5GTHE 1VF5B 3L36A 1X9VA 3CCRP 3I5CA 2KSEA 2FYZA 4WB4A 1HBWA 1VDFA 2ZJSE 1USEA 3CCLP 1R8EA 2LXCB 5CCHA 4H13B 1QL2A 3H1LD 4ASWA 1MFTA 5APQA 1PPJE 2N9YB 2Q3EA 1LJ2A 2QJKC 3AE2C 2LXBA 1RF0C 1EDLA 1Y9BA 3L4FA 1J1EB 1CI6B 2E75D 2FFDB 4L74A 1VQPP 3I56P 4EIJA 2CPSA 1NTZD 1OVVA 1PP9E 1S4XA 4L75A 3M0DA 2H8PD 2RH0A 2Q7CA 1NTZG 2PFXA 2FYNB 1PGJA 2HPCA 2QIWA 2BEZF 2YIUC 2AEFA 4AUWA 4U3FJ 3RK3C 1LTSC 2OYIB 3CXHH 1NU1E 2FFDC 4CPGA 2G8YA 2ZT9D 3L70E 1EXIA 4LGDE 3AE1C 4BWNA 3HD7C 1K04A 2ZYDA 3B5ND 1N73C 3CXHE 1RF0A 2K37A 2I1KA 2OYHC 4QMAA 3FXDA 3V2NA 1NAYA 2KSJA 5H2FE 3B5NA 2AEMA 2NPSD 1PGPA 1LTAC 2WSSH 1GL2D 2WPRA 1QX8A 1KFMA 1K8AQ 3CX5D 2V4HA 1GL2A 1P84H 1SQVE 1BGYD 1BSNA 1KORA 4D6TE 3H1JE 1VQMP 2VRSA 1UIXA 1BGYG 1URQD 3RGUA 2Y0DA 3TGUE 1P84E 3HD7A 2IFMA 1N73A 1VQ7P 2OYHA 3OJAB 3TNUA 3L74D 3IFMA 3JSVC 1URQA 3L72D 2N1TC 3L74G 2JWDA 5CCGD 3L72G 1FBMA 1JTHB 4DOJA 4OGQB 1KB9D 1SVFA 4DT0A 1N8RQ 3FWLA 4ZKPA 1MV8A 2ZXEB 3PH0A 3CWBD 1S5LH 1L0LK 2A45G 5B5EH 3CWBG 1ZLLA 2IPPA 1BCCD 4WY4D 2O01N 1LWUB 3PTZA 1OW8A 1S5LE 3I55P 2M8RA 2QE7H 2OTLP 4UB8H 3H1LE 2QJYC 1M8OB 1L0NJ 4WY4A 4OWFA 3KZIE 2J59M 5AW2B 1OFCX 1USDA 2JEEA 2WSFH 2KZJA 3Q5SA 1D7MA 3E7KA 2KLUA 1NO4A 1SQBE 2KYVA 1QGKB 1HH0A 4C7NB 3SWKA 3EFFK 4OVNF 1FZCB 4N78D 3HTKB 2E76C 1YHQP 2NRGA 5AVSB 1KILD 2KK7A 3B4SA 3M0AA 3CL3D 3CC7P 3HE4A 1OVUA 1W2EA 3AEFC 2K9JB 4XA4A 1N7SB 1OWAA 3E1RA 1SQQJ 1T3JA 3EWKA 3E1IA 3RK2B 3CX5H 3B8EB 1H88A 1Y8AA 1JY3P 2J58A 2BCCE 1T6AA 3GG2A 3H1IG 4GIFA 2ZFCA 5BVZA 2CPBA 1FDMA 2KI7B 3GHGB 5AVQB 3BCCJ 1Q2NA 3IAOA 1M1JA 1JY2P 2GUSA 1JB0J 1KYOD 3RK2C 1VQ4P 3MZWB 3CMEP 2FKWB 1LP1A 3FX0A 3U1AA 1SQPD 3LW5H 4RESB 4BRYA 1T3UA 1SQPG 3OW2O 5CJ0A 1EZVI 4B86A 1KMIZ 1M7LA 1KB9H 3MHVA 1EDIA 3G6EP 1SQXD 2ZVNB 4I7ZB 3H32A 1KB9E 1SQXG 4U3FE 4TLFA 3NXSA 1RE3C 4RJTA 2AXTE 2B89A 2P10A 4JQ0D 3BATA 1S72P 1L4AB 2OYOA 3VMAA 1T2KD 2G3AA 2Z5HA 1BCCE 2JWAA 3GF3A 2WSEH 3HRNA 3USSA 3NMDA 1SLQA 1PPJG 1OX3A 4H0LB 1NGMB 2E74B 3RL0g 1SFCA 1ZMEC 3KXDA 3L71D 2E5TA 2W27A 4K3AA 2V7QH 3O8ZA 4KT0J 1PP9D 1NTKJ 3KDPB 1PP9G 1K73Q 1EDJA 5EFWB 2E74C 4M3LA 3H1KJ 4IOIH 3V6IA 2WITA 1NU1D 1IK9A 3L70D 1OW7A 1KILE 2JO1A 5KAFH 3MGNA 1NU1G 3EQ2A 3HUSA 3L70G 1RE4A 1JY3O 2P1JA 2YKQA 2XNDH 1M90Q 2P2UA 4GOFA 1ZV8A 1K9MQ 1LT9A 4PV1D 2KNCB 1JY2O 4WVZA 4ZKUA 1NTMD 3C1LA 2KS1B 2WTYA 1SQVD 3M9QA 3CX5I 2NZ2A 1HJ0A 1HGVA 4LC1A 1KYOH 1SQVG 3H1JD 5AW8B 2WSCH 4I2LC 1KD1Q 3V2QA 1S5LX 3A5TA 2IBZE 4D6TG 1S3JA 2H89C 5M1BA 1P84D 1HGZA 2WZ7A 2QJPB 4MN4C 5CCHC 3TGUG 1CW5A 5KKZB 1BSHA 3AEEC 1YTZI 1NHLA 3VMZA 2HPCB 4YTPC 1X79B 5DJTB 4HJGH 3V2PA 2QVAA 1VL2A 1GZLA 4W7ZA 1J2JB 5GTHH 3ITKA 1N7LA 1BE3J 2W6AA 2QJKB 3AE9C 5KKZC 3VOPA 2A45I 3M0DC 3S9OA 1JEKA 1LTGC 2E75C 4W7YA 3ABVC 3K5BA 3ZDMA 3AEDC 3OAKA 5KJ7D 1Q82Q 1NH4A 3RL0D 2PGDA 4PD4D 2O3JA 1J1DC 1VQLP 3H1LG 5KJ7A 4U7JA 1GU4A 3F5HA 4L76A 2JR8A 1HJBA 2YIUB 1IFIA 1AJYA 2D2CD 2HLOA 3L75E 3RK3B 2ZT9C 2R3SA 3MD0A 1RH5B 2XV5A 1SQBD 3L71E 3AE6C 5CJ4A 3T97A 1IJDB 2H88C 4JBZA 3B5NC 1SQBG 3KHUA 2QRXA 1BGYJ 3W68A 3HD7B 4EYYQ 1ZP0C 1N73B 2YO3A 2OYHB 3TNUB 1L0NK 4AYCA 1RQVA 2M3BA 2GM4A 5APYA 1Q7YQ 1IZNB 1GL2C 1L0LE 3G3ZA 2WPQA 2ITAA 1OW6A 3KQGA 5H2FH 5AVZB 1AQTA 3VN0A 2PAJA 3L37A 1YITP 1URQC 3S1KA 3L73D 1VF5D 2Q9IA 2WMMA 2K1AA 2IFNA 2B87B 2W6BA 2BCCD 4H13D 3KPEA 2BCCG 1NTME 1JCCA 5CCGC 1XTGB 2NPSA 3M06A 2N1TB 2GA1A 2HFED 1KQLA 1SQQK 1GW3A 2IYPA 3VP9A 2R44A 2E43A 2WWWA 1KYOI 2K3RA 3V4QA 3PJSK 5APSA 4ZMDA 1AVYA 4WY4C 2P7JA 1CI6A 3S4RA 2OQQA 1R5LA 1YTZT 2POHA 3F89A 3C8VA 2AXCA 3AE7C 1IFDA 1H0TA 1G2CA 1FS0E 1X0TA 4EDFA 2QJYB 4U3FD 5CCGA 3HE4B 5AW6B 2KOGA 2R32A 2H43A 4U3FG 3PP5A 5CBNA 1FZAA 5E79E 3MP7B 1HF9A 4WWIA 3D71A 4PD4H 5AVWB 2FYUK 1KFNA 2LKMA 4XFJA 3KZIH 1QVFO 2W90A 3D6ZA 1BCCG 1JY3N 4Y99B 1JO5A 3GMAA 4PD4E 1NKNA 5TJHA 4DCKA 2R5DA 3H1IJ 1FDIA 3H25A 3MTUE 2I8DA 3SSUA 2PRRA 3JC22 2E76B 4IL6H 4JPZB 1JY2N 3W67A 2LR2A 4I6MC 3TF5A 4Y99C 1LP1B 1JM0A 5KLVK 1R5SA 1RF1C 4C7RA 4IL6E 2JP3A 3IR9A 3QH9A 2A06D 4BRYB 2MJZA 4YXWH 4ASVA 1N2DC 1SQPJ 3NTNA 2YO2A 1S9KE 3RBXA 1M1JC 2K88A 3HE5A 5CBOA 1X22A 4OGQD 3H32B 2Q3IA 1KILA 1NTKK 3CXHI 1MKMA 1CSBA 1BE3E 5C39A 1JTHA 1LT1A 2N9BA 3VTPC 4L73A 3WUVA 3L73E 5CMZA 2ZXXA 3M91A 3V2RA 4XE5B 5AW5B 3KYQA 2MKVA 2RKLA 1RF1A 1KQSO 1TU3F 1UIIA 1E79H 3Q3DA 1IC2A 3P8CE 2Y9YA 1L0ND 1SFCB 2IBZD 5BU5A 2Y0CA 2IBZG 3RK3E 2H7HA 3CLQA 4W80A 1AFOA 1P84I 2IYOA 2KXPB 5AW7B 1YYCA 2YXRB 1FZFA 1RHZB 1PP9J 2GUVA 1PV3A 2YXQB 1LTTC 5KLIC 1T2KC 2FYUJ 1KQGB 4C7NA 4IFDK 1SFCC 2AXTH 2FY8A 5GTIE 1FZEA 4GKGA 1FJKA 1FU1A 3D70A 3AE4C
chains in the Genus database with same CATH topology
3EWKA 2OQQA 2K9YA 2G8YA 4H0LB 2ZT9D 1EXIA 1NGMB 2WSEJ 2J5UA 1EXJA 3AE1C 1ZP0C 1S5LX 2E74B 1GMJA 2H89C 4H0LC 5M1BA 3AEGC 4OGQD 3C8VA 3B71A 4H44D 3RL0g 1ZMEC 1K04A 3AE7C 1YQ4C 1RQVA 3AECC 2WSCJ 2WQYC 3IN6A 1OW8A 1PL5A 1MKMA 2QJPC 1PIXA 3G9RA 1NYHA 3O6QA 4H0LD 4RKUJ 4H44C 4Z1MH 2QJYC 4KT0J 5L8RJ 2FBWC 4YXDC 3AEEC 1ZRTE 3AE5C 2E74D 4R4LA 3Q2YA 1KTMA 3IAOA 1S1CX 1VF5B 1KQFB 4YTPC 1HF9A 2V7QJ 1OW6A 3D71A 2MKVA 3AE3C 3AEBC 1U57A 1JB0J 1VF5C 2QSIA 1DD4A 1VL2A 3T97B 3Q5SA 2E74C 4XFJA 1TU3F 1R8EA 4R4MA 3Q1MA 4H13B 3Q3DA 2WSFJ 1ZOYC 3D6ZA 3AE9C 3GMAA 4H13C 1VF5D 2E75B 1RQUA 1KMIZ 5KKZC 1OW7A 1YQ3C 2WPVB 1KILE 2JO1A 2QJKC 3LW5J 3AE2C 1KORA 3S9OA 3GLMA 2FXPA 2E75C 2BEQD 1K05A 1UIXA 3ABVC 1FDIA 2YMKA 3RK3E 3AEDC 4PV1B 3H25A 4H13D 3D6YA 1FDOA 1Y9BA 1Q90D 3SFEC 2E76B 4I7ZB 4PV1C 3Q5PA 1DIPA 2E75D 2D2CB 3Q5RA 2E76C 4I7ZC 4Y28J 1PV3A 5KLIC 2D2CC 4IL6X 2P10A 4U7JA 1WMKA 1IK7A 1OMIA 4PV1D 1KQGB 3AEFC 3FGAD 2ZT9B 3AE8C 2E76D 1DD3A 1AJYA 2JP3A 2D2CD 2O01J 3AEAC 3R4YA 2QIWA 2ZT9C 2BEZF 2G3AA 2YIUC 4H44B 4OGQB 4GDOA 2FYNC 2IDBA 4TT3H 3GF3A 3SFDC 3D70A 3AE6C 4OGQC 3GF7A 2H88C 2NZ2A 3AE4C 1HJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1C X;  1UIX A;  3FGA D;  1NYH A;  1TU3 F;  1PL5 A; 
#chains in the Genus database with same CATH topology
 1NU1 J;  1G1J A;  3L70 J;  1FZC A;  2WT7 A;  1N7S D;  1HVV A;  2ZYG A;  2B88 A;  2M3E A;  5KAI E;  1FE6 A;  1NTZ K;  1IO4 A;  2K9J A;  1N7S A;  1DEB A;  3G9R A;  1FJP A;  2YKO A;  5KLV J;  3RK2 D;  3Q2Y A;  1ZRT E;  3CC4 P;  3HUS C;  1KQF B;  1RE4 C;  1IFP A;  1NVO A;  1HUC A;  3L75 D;  1DD4 A;  2BAS A;  1RY3 A;  5AW4 B;  3L75 G;  2O1J A;  2P58 A;  1SQV J;  1SP4 A;  2Q1K A;  3L71 G;  3BCC D;  4D6T J;  5AW9 B;  1JMB A;  2WPV B;  3GHG A;  1LT9 C;  3GLM A;  2KIK A;  3TGU J;  2YMK A;  5TIS E;  1FDO A;  4ZNC A;  4PV1 C;  1IFN A;  2A06 E;  3Q5P A;  1L0L D;  4NPD A;  2C9N Y;  1EDK A;  1YIJ P;  5AVX B;  1L0L G;  3H1H J;  1AQ5 A;  2P67 A;  5APU A;  1PZQ A;  1WT6 A;  1LTJ C;  1JNM A;  2HOD B;  4H44 B;  2I1J A;  3TK1 A;  2IDB A;  3GF7 A;  3U59 A;  1FOS F;  1L4A D;  4O9B A;  5BU8 B;  2J5U A;  1GMJ A;  2M5A A;  1L4A A;  1ZW0 A;  2FXO A;  1HTL C;  3CCE P;  2OTK E;  3H1L J;  1NTM G;  1A02 J;  1NYH A;  3O6Q A;  4H0L D;  3CI9 A;  4H44 C;  4Z1M H;  2E74 D;  4R4L A;  1LTB C;  3P32 A;  1L0N E;  1GU5 A;  2QSI A;  1LTJ A;  3H1J G;  3T97 B;  2Q6Q A;  2L91 A;  3V5B A;  3Q1M A;  1M57 D;  2WSF J;  2W6J H;  2JKV A;  2KLV A;  5KJ7 C;  2E75 B;  1NTZ J;  1JOC A;  3GW6 A;  3RL0 C;  1SS1 A;  2BEQ D;  3QWO C;  5APV A;  3V4W A;  3WUT A;  3SWY A;  1GDT A;  1E5W A;  1DIP A;  1J1D B;  1KB9 I;  1W5C E;  2D2C C;  3CCQ P;  4IL6 X;  1IK7 A;  3JCU H;  1VQ9 P;  2AEJ A;  2ZT9 B;  1DX7 A;  1ZR2 A;  5B66 H;  2QM8 A;  1H89 A;  3B5N B;  1KV4 A;  1SQQ E;  1JMM A;  3JCU E;  2XU6 A;  4DZO A;  2XDJ A;  5CCH D;  5AVY B;  5B66 E;  4KJM A;  2BCC J;  2NPS B;  3MIW A;  2OTJ P;  1GL2 B;  3IN6 A;  2KNC A;  2WPS A;  3WUU A;  2KS1 A;  4YXD C;  3BCC E;  1QL1 A;  3A3Y B;  3CCU P;  4KHX A;  1VF5 C;  1WRG A;  3P8M C;  1X8Y A;  3CMA P;  1OXZ A;  1URQ B;  2NPS C;  2DW3 A;  2L5G B;  2IX7 C;  1ZOY C;  3L74 J;  1S9K D;  1GTW A;  4H13 C;  3L72 J;  2ZYA A;  3BRT B;  1ZR4 A;  1MFZ A;  3LW5 J;  1H0T B;  2FYU E;  1G2C B;  1PFI A;  3TYY A;  2XNX A;  2XZR A;  1AA0 A;  1BE3 D;  3A2A A;  2CK3 H;  1J1E C;  1BE3 G;  2RMZ A;  3CWB J;  1FAV A;  1SQP K;  4OH8 B;  3L73 G;  1OMI A;  2Y0E A;  3A0H H;  1DD3 A;  1BCC J;  2O01 J;  3R4Y A;  4GDO A;  2Y9Z A;  2FYN C;  2QG4 A;  1LGH B;  4GOE A;  4WY4 B;  4GOD A;  1VQN P;  3P8C D;  1SQX K;  2JDI H;  5KLV E;  1HWT C;  3A0H E;  2K9Y A;  2OYI C;  2QM7 A;  1XTC C;  2WVR A;  2WSE J;  4WBA A;  1Q86 Q;  1U7J A;  3RK3 D;  2IBZ I;  3L35 A;  3AEC C;  3TDK A;  1QEX A;  3M9H A;  4C46 A;  3HD7 D;  1QLE D;  1FOS E;  5CHX A;  2FFD A;  1S1C X;  2V7Q J;  3VYI A;  1NTK E;  1FZG A;  3VMX A;  1LTI C;  5E79 H;  4YPC A;  3FWN A;  3HE5 B;  1T8Z A;  4HH2 A;  1EZV E;  3H1K E;  1OVR A;  2YMY A;  1YQ3 C;  5KTB A;  1VPC A;  3H1H E;  1KIL B;  2OYI A;  5AVT B;  1JCD A;  1Q90 D;  3SFE C;  2Q5U A;  1W2B O;  1ZRT D;  2XKM A;  1DEE G;  2O1K A;  3R2P A;  3M9B A;  1RF1 B;  1NU1 K;  1YJN P;  2PP6 A;  3AE8 C;  3OA7 A;  4N3Y B;  1KIL C;  2JJL A;  2B87 A;  3AEA C;  2N1T D;  3MUD C;  5B5E E;  4OGQ C;  1K05 A;  1M1J B;  2KB7 P;  2C9L Y;  4BXL A;  2N1T A;  1VQ5 P;  3II6 A;  1OZH A;  1EXJ A;  3AEG C;  3WMM 0;  2Z4E A;  3B71 A;  4UB8 E;  1GK6 A;  1YQ4 C;  2WSC J;  2WQY C;  3VMY A;  1LWU C;  1NTM K;  2A06 G;  4NPE A;  1SQV K;  1NTZ E;  4I1L A;  4HB1 A;  3AE3 C;  1U57 A;  1BDD A;  4HKZ H;  5AVR B;  3PHL A;  1SQX J;  2WT7 B;  3EFG A;  1M1K Q;  3MUD A;  2OGU A;  1CZQ A;  3PRJ A;  5AVV B;  1Z56 A;  3C9I A;  1RQU A;  1PGO A;  4HYT B;  1KN7 A;  5AW3 B;  1YBK A;  2FXP A;  5APT A;  2E5Y A;  1EQ7 A;  2KP8 A;  3CCJ P;  1U7M A;  4NPF X;  3NFQ A;  2C0X A;  1FZB A;  4EOT A;  2KUB A;  2ZVO B;  5KLI B;  3CPW O;  1KC8 Q;  1DH3 A;  3Q5R A;  1L2P A;  1FZC C;  1LWU A;  1ZN5 A;  4PJ0 H;  4JYB A;  1EC5 A;  3H1I D;  3FGA D;  2IZ1 A;  1L0N G;  3L75 J;  4N6J A;  2E76 D;  1Q81 Q;  3L71 J;  1YJW P;  1FC2 C;  1N7S C;  4PJ0 E;  3SFD C;  1M56 D;  3CX5 E;  4AQR D;  5GTI H;  3LID A;  5APW A;  1BGY E;  1ZXG A;  1VQO P;  5K5G B;  3UIA A;  1L0L J;  1PIX A;  5KAI H;  1S2E A;  2FBW C;  3HUS B;  3L74 E;  5AW0 B;  3AE5 C;  3BVH A;  3GHG C;  3L72 E;  1SQB K;  3HTK A;  1MZ9 A;  2B9B A;  3AEB C;  2A45 H;  1VQK P;  1GK4 A;  4R4M A;  3N7N A;  1SQQ D;  1NAF A;  3WU2 H;  2Z5I A;  1LT9 B;  1SQQ G;  1VQ8 P;  3PLN A;  2O01 H;  3SWF A;  2M5A B;  2RN0 A;  1OIP A;  3CWB E;  4PD4 I;  3IF4 A;  4GT1 A;  3A0B H;  3CC2 P;  2FXM A;  1YI2 P;  3WU2 E;  1NTM J;  4PV1 B;  3O6Q B;  3D6Y A;  1MUU A;  1PPJ D;  2YNY A;  1SFC D;  5TIS H;  3A0B E;  3CCS P;  2E42 A;  4I7Z C;  2QEX P;  1LTJ B;  1AVO A;  3H1J J;  1Y47 A;  3BCC G;  3VP8 A;  2HG5 D;  1L4A C;  3LIE A;  1NJI Q;  1NKZ B;  1RE3 A;  3TSI A;  1NOH A;  2FYU D;  1H8A A;  1VQ6 P;  1GD2 E;  2UWJ E;  4H0L C;  2FYU G;  2R3C A;  1GW4 A;  3FXE A;  3CCM P;  1QVG O;  4UB6 H;  2M0B A;  2IZ0 A;  3CCV P;  4LLH A;  4N78 E;  2W83 C;  2OAR A;  3H6P A;  5L8R J;  1KTM A;  2KZI A;  4UB6 E;  3N4X A;  5DJU B;  3CXH D;  2C0W A;  1IFM A;  2ZAE B;  3P7K A;  5KAF E;  4RO0 A;  1YJ9 P;  2SPZ A;  3G4S P;  5KLV D;  1PGQ A;  3RL0 B;  1G1I A;  3BRV B;  3G71 P;  5KLV G;  3BAS A;  2HYN A;  1KZU B;  4IFM A;  3H1I E;  3CD6 P;  1BDC A;  1SQB J;  2D2C B;  2R5B A;  4Y28 J;  4D6T D;  1N86 A;  3RBZ A;  1WMK A;  1NTK D;  3U1C A;  3TGU D;  2QA4 P;  4IFF A;  1LNQ A;  1NTK G;  1KYO E;  1NWQ A;  4DJG A;  5AVU B;  4TT3 H;  1EZV D;  3H1K D;  1A02 F;  1SQP E;  1EZV G;  1IFJ A;  3H1K G;  3H1H D;  2YKP A;  5AW1 B;  4A7P A;  3A7O A;  3H1H G;  4JYC A;  4H44 D;  2W8Z A;  4EI2 A;  1PL5 A;  5APX A;  2QJP C;  1SQX E;  4K35 A;  2HOD A;  3L73 J;  4RKU J;  1AV1 A;  4JF7 A;  2HR3 A;  1JUN A;  5GTH E;  1VF5 B;  3L36 A;  1X9V A;  3CCR P;  3I5C A;  2KSE A;  2FYZ A;  4WB4 A;  1HBW A;  1VDF A;  2ZJS E;  1USE A;  3CCL P;  1R8E A;  2LXC B;  5CCH A;  4H13 B;  1QL2 A;  3H1L D;  4ASW A;  1MFT A;  5APQ A;  1PPJ E;  2N9Y B;  2Q3E A;  1LJ2 A;  2QJK C;  3AE2 C;  2LXB A;  1RF0 C;  1EDL A;  1Y9B A;  3L4F A;  1J1E B;  1CI6 B;  2E75 D;  2FFD B;  4L74 A;  1VQP P;  3I56 P;  4EIJ A;  2CPS A;  1NTZ D;  1OVV A;  1PP9 E;  1S4X A;  4L75 A;  3M0D A;  2H8P D;  2RH0 A;  2Q7C A;  1NTZ G;  2PFX A;  2FYN B;  1PGJ A;  2HPC A;  2QIW A;  2BEZ F;  2YIU C;  2AEF A;  4AUW A;  4U3F J;  3RK3 C;  1LTS C;  2OYI B;  3CXH H;  1NU1 E;  2FFD C;  4CPG A;  2G8Y A;  2ZT9 D;  3L70 E;  1EXI A;  4LGD E;  3AE1 C;  4BWN A;  3HD7 C;  1K04 A;  2ZYD A;  3B5N D;  1N73 C;  3CXH E;  1RF0 A;  2K37 A;  2I1K A;  2OYH C;  4QMA A;  3FXD A;  3V2N A;  1NAY A;  2KSJ A;  5H2F E;  3B5N A;  2AEM A;  2NPS D;  1PGP A;  1LTA C;  2WSS H;  1GL2 D;  2WPR A;  1QX8 A;  1KFM A;  1K8A Q;  3CX5 D;  2V4H A;  1GL2 A;  1P84 H;  1SQV E;  1BGY D;  1BSN A;  1KOR A;  4D6T E;  3H1J E;  1VQM P;  2VRS A;  1UIX A;  1BGY G;  1URQ D;  3RGU A;  2Y0D A;  3TGU E;  1P84 E;  3HD7 A;  2IFM A;  1N73 A;  1VQ7 P;  2OYH A;  3OJA B;  3TNU A;  3L74 D;  3IFM A;  3JSV C;  1URQ A;  3L72 D;  2N1T C;  3L74 G;  2JWD A;  5CCG D;  3L72 G;  1FBM A;  1JTH B;  4DOJ A;  4OGQ B;  1KB9 D;  1SVF A;  4DT0 A;  1N8R Q;  3FWL A;  4ZKP A;  1MV8 A;  2ZXE B;  3PH0 A;  3CWB D;  1S5L H;  1L0L K;  2A45 G;  5B5E H;  3CWB G;  1ZLL A;  2IPP A;  1BCC D;  4WY4 D;  2O01 N;  1LWU B;  3PTZ A;  1OW8 A;  1S5L E;  3I55 P;  2M8R A;  2QE7 H;  2OTL P;  4UB8 H;  3H1L E;  2QJY C;  1M8O B;  1L0N J;  4WY4 A;  4OWF A;  3KZI E;  2J59 M;  5AW2 B;  1OFC X;  1USD A;  2JEE A;  2WSF H;  2KZJ A;  3Q5S A;  1D7M A;  3E7K A;  2KLU A;  1NO4 A;  1SQB E;  2KYV A;  1QGK B;  1HH0 A;  4C7N B;  3SWK A;  3EFF K;  4OVN F;  1FZC B;  4N78 D;  3HTK B;  2E76 C;  1YHQ P;  2NRG A;  5AVS B;  1KIL D;  2KK7 A;  3B4S A;  3M0A A;  3CL3 D;  3CC7 P;  3HE4 A;  1OVU A;  1W2E A;  3AEF C;  2K9J B;  4XA4 A;  1N7S B;  1OWA A;  3E1R A;  1SQQ J;  1T3J A;  3EWK A;  3E1I A;  3RK2 B;  3CX5 H;  3B8E B;  1H88 A;  1Y8A A;  1JY3 P;  2J58 A;  2BCC E;  1T6A A;  3GG2 A;  3H1I G;  4GIF A;  2ZFC A;  5BVZ A;  2CPB A;  1FDM A;  2KI7 B;  3GHG B;  5AVQ B;  3BCC J;  1Q2N A;  3IAO A;  1M1J A;  1JY2 P;  2GUS A;  1JB0 J;  1KYO D;  3RK2 C;  1VQ4 P;  3MZW B;  3CME P;  2FKW B;  1LP1 A;  3FX0 A;  3U1A A;  1SQP D;  3LW5 H;  4RES B;  4BRY A;  1T3U A;  1SQP G;  3OW2 O;  5CJ0 A;  1EZV I;  4B86 A;  1KMI Z;  1M7L A;  1KB9 H;  3MHV A;  1EDI A;  3G6E P;  1SQX D;  2ZVN B;  4I7Z B;  3H32 A;  1KB9 E;  1SQX G;  4U3F E;  4TLF A;  3NXS A;  1RE3 C;  4RJT A;  2AXT E;  2B89 A;  2P10 A;  4JQ0 D;  3BAT A;  1S72 P;  1L4A B;  2OYO A;  3VMA A;  1T2K D;  2G3A A;  2Z5H A;  1BCC E;  2JWA A;  3GF3 A;  2WSE H;  3HRN A;  3USS A;  3NMD A;  1SLQ A;  1PPJ G;  1OX3 A;  4H0L B;  1NGM B;  2E74 B;  3RL0 g;  1SFC A;  1ZME C;  3KXD A;  3L71 D;  2E5T A;  2W27 A;  4K3A A;  2V7Q H;  3O8Z A;  4KT0 J;  1PP9 D;  1NTK J;  3KDP B;  1PP9 G;  1K73 Q;  1EDJ A;  5EFW B;  2E74 C;  4M3L A;  3H1K J;  4IOI H;  3V6I A;  2WIT A;  1NU1 D;  1IK9 A;  3L70 D;  1OW7 A;  1KIL E;  2JO1 A;  5KAF H;  3MGN A;  1NU1 G;  3EQ2 A;  3HUS A;  3L70 G;  1RE4 A;  1JY3 O;  2P1J A;  2YKQ A;  2XND H;  1M90 Q;  2P2U A;  4GOF A;  1ZV8 A;  1K9M Q;  1LT9 A;  4PV1 D;  2KNC B;  1JY2 O;  4WVZ A;  4ZKU A;  1NTM D;  3C1L A;  2KS1 B;  2WTY A;  1SQV D;  3M9Q A;  3CX5 I;  2NZ2 A;  1HJ0 A;  1HGV A;  4LC1 A;  1KYO H;  1SQV G;  3H1J D;  5AW8 B;  2WSC H;  4I2L C;  1KD1 Q;  3V2Q A;  1S5L X;  3A5T A;  2IBZ E;  4D6T G;  1S3J A;  2H89 C;  5M1B A;  1P84 D;  1HGZ A;  2WZ7 A;  2QJP B;  4MN4 C;  5CCH C;  3TGU G;  1CW5 A;  5KKZ B;  1BSH A;  3AEE C;  1YTZ I;  1NHL A;  3VMZ A;  2HPC B;  4YTP C;  1X79 B;  5DJT B;  4HJG H;  3V2P A;  2QVA A;  1VL2 A;  1GZL A;  4W7Z A;  1J2J B;  5GTH H;  3ITK A;  1N7L A;  1BE3 J;  2W6A A;  2QJK B;  3AE9 C;  5KKZ C;  3VOP A;  2A45 I;  3M0D C;  3S9O A;  1JEK A;  1LTG C;  2E75 C;  4W7Y A;  3ABV C;  3K5B A;  3ZDM A;  3AED C;  3OAK A;  5KJ7 D;  1Q82 Q;  1NH4 A;  3RL0 D;  2PGD A;  4PD4 D;  2O3J A;  1J1D C;  1VQL P;  3H1L G;  5KJ7 A;  4U7J A;  1GU4 A;  3F5H A;  4L76 A;  2JR8 A;  1HJB A;  2YIU B;  1IFI A;  1AJY A;  2D2C D;  2HLO A;  3L75 E;  3RK3 B;  2ZT9 C;  2R3S A;  3MD0 A;  1RH5 B;  2XV5 A;  1SQB D;  3L71 E;  3AE6 C;  5CJ4 A;  3T97 A;  1IJD B;  2H88 C;  4JBZ A;  3B5N C;  1SQB G;  3KHU A;  2QRX A;  1BGY J;  3W68 A;  3HD7 B;  4EYY Q;  1ZP0 C;  1N73 B;  2YO3 A;  2OYH B;  3TNU B;  1L0N K;  4AYC A;  1RQV A;  2M3B A;  2GM4 A;  5APY A;  1Q7Y Q;  1IZN B;  1GL2 C;  1L0L E;  3G3Z A;  2WPQ A;  2ITA A;  1OW6 A;  3KQG A;  5H2F H;  5AVZ B;  1AQT A;  3VN0 A;  2PAJ A;  3L37 A;  1YIT P;  1URQ C;  3S1K A;  3L73 D;  1VF5 D;  2Q9I A;  2WMM A;  2K1A A;  2IFN A;  2B87 B;  2W6B A;  2BCC D;  4H13 D;  3KPE A;  2BCC G;  1NTM E;  1JCC A;  5CCG C;  1XTG B;  2NPS A;  3M06 A;  2N1T B;  2GA1 A;  2HFE D;  1KQL A;  1SQQ K;  1GW3 A;  2IYP A;  3VP9 A;  2R44 A;  2E43 A;  2WWW A;  1KYO I;  2K3R A;  3V4Q A;  3PJS K;  5APS A;  4ZMD A;  1AVY A;  4WY4 C;  2P7J A;  1CI6 A;  3S4R A;  2OQQ A;  1R5L A;  1YTZ T;  2POH A;  3F89 A;  3C8V A;  2AXC A;  3AE7 C;  1IFD A;  1H0T A;  1G2C A;  1FS0 E;  1X0T A;  4EDF A;  2QJY B;  4U3F D;  5CCG A;  3HE4 B;  5AW6 B;  2KOG A;  2R32 A;  2H43 A;  4U3F G;  3PP5 A;  5CBN A;  1FZA A;  5E79 E;  3MP7 B;  1HF9 A;  4WWI A;  3D71 A;  4PD4 H;  5AVW B;  2FYU K;  1KFN A;  2LKM A;  4XFJ A;  3KZI H;  1QVF O;  2W90 A;  3D6Z A;  1BCC G;  1JY3 N;  4Y99 B;  1JO5 A;  3GMA A;  4PD4 E;  1NKN A;  5TJH A;  4DCK A;  2R5D A;  3H1I J;  1FDI A;  3H25 A;  3MTU E;  2I8D A;  3SSU A;  2PRR A;  3JC2 2;  2E76 B;  4IL6 H;  4JPZ B;  1JY2 N;  3W67 A;  2LR2 A;  4I6M C;  3TF5 A;  4Y99 C;  1LP1 B;  1JM0 A;  5KLV K;  1R5S A;  1RF1 C;  4C7R A;  4IL6 E;  2JP3 A;  3IR9 A;  3QH9 A;  2A06 D;  4BRY B;  2MJZ A;  4YXW H;  4ASV A;  1N2D C;  1SQP J;  3NTN A;  2YO2 A;  1S9K E;  3RBX A;  1M1J C;  2K88 A;  3HE5 A;  5CBO A;  1X22 A;  4OGQ D;  3H32 B;  2Q3I A;  1KIL A;  1NTK K;  3CXH I;  1MKM A;  1CSB A;  1BE3 E;  5C39 A;  1JTH A;  1LT1 A;  2N9B A;  3VTP C;  4L73 A;  3WUV A;  3L73 E;  5CMZ A;  2ZXX A;  3M91 A;  3V2R A;  4XE5 B;  5AW5 B;  3KYQ A;  2MKV A;  2RKL A;  1RF1 A;  1KQS O;  1TU3 F;  1UII A;  1E79 H;  3Q3D A;  1IC2 A;  3P8C E;  2Y9Y A;  1L0N D;  1SFC B;  2IBZ D;  5BU5 A;  2Y0C A;  2IBZ G;  3RK3 E;  2H7H A;  3CLQ A;  4W80 A;  1AFO A;  1P84 I;  2IYO A;  2KXP B;  5AW7 B;  1YYC A;  2YXR B;  1FZF A;  1RHZ B;  1PP9 J;  2GUV A;  1PV3 A;  2YXQ B;  1LTT C;  5KLI C;  1T2K C;  2FYU J;  1KQG B;  4C7N A;  4IFD K;  1SFC C;  2AXT H;  2FY8 A;  5GTI E;  1FZE A;  4GKG A;  1FJK A;  1FU1 A;  3D70 A;  3AE4 C; 
#chains in the Genus database with same CATH homology
 3EWK A;  2OQQ A;  2K9Y A;  2G8Y A;  4H0L B;  2ZT9 D;  1EXI A;  1NGM B;  2WSE J;  2J5U A;  1EXJ A;  3AE1 C;  1ZP0 C;  1S5L X;  2E74 B;  1GMJ A;  2H89 C;  4H0L C;  5M1B A;  3AEG C;  4OGQ D;  3C8V A;  3B71 A;  4H44 D;  3RL0 g;  1ZME C;  1K04 A;  3AE7 C;  1YQ4 C;  1RQV A;  3AEC C;  2WSC J;  2WQY C;  3IN6 A;  1OW8 A;  1PL5 A;  1MKM A;  2QJP C;  1PIX A;  3G9R A;  1NYH A;  3O6Q A;  4H0L D;  4RKU J;  4H44 C;  4Z1M H;  2QJY C;  4KT0 J;  5L8R J;  2FBW C;  4YXD C;  3AEE C;  1ZRT E;  3AE5 C;  2E74 D;  4R4L A;  3Q2Y A;  1KTM A;  3IAO A;  1S1C X;  1VF5 B;  1KQF B;  4YTP C;  1HF9 A;  2V7Q J;  1OW6 A;  3D71 A;  2MKV A;  3AE3 C;  3AEB C;  1U57 A;  1JB0 J;  1VF5 C;  2QSI A;  1DD4 A;  1VL2 A;  3T97 B;  3Q5S A;  2E74 C;  4XFJ A;  1TU3 F;  1R8E A;  4R4M A;  3Q1M A;  4H13 B;  3Q3D A;  2WSF J;  1ZOY C;  3D6Z A;  3AE9 C;  3GMA A;  4H13 C;  1VF5 D;  2E75 B;  1RQU A;  1KMI Z;  5KKZ C;  1OW7 A;  1YQ3 C;  2WPV B;  1KIL E;  2JO1 A;  2QJK C;  3LW5 J;  3AE2 C;  1KOR A;  3S9O A;  3GLM A;  2FXP A;  2E75 C;  2BEQ D;  1K05 A;  1UIX A;  3ABV C;  1FDI A;  2YMK A;  3RK3 E;  3AED C;  4PV1 B;  3H25 A;  4H13 D;  3D6Y A;  1FDO A;  1Y9B A;  1Q90 D;  3SFE C;  2E76 B;  4I7Z B;  4PV1 C;  3Q5P A;  1DIP A;  2E75 D;  2D2C B;  3Q5R A;  2E76 C;  4I7Z C;  4Y28 J;  1PV3 A;  5KLI C;  2D2C C;  4IL6 X;  2P10 A;  4U7J A;  1WMK A;  1IK7 A;  1OMI A;  4PV1 D;  1KQG B;  3AEF C;  3FGA D;  2ZT9 B;  3AE8 C;  2E76 D;  1DD3 A;  1AJY A;  2JP3 A;  2D2C D;  2O01 J;  3AEA C;  3R4Y A;  2QIW A;  2ZT9 C;  2BEZ F;  2G3A A;  2YIU C;  4H44 B;  4OGQ B;  4GDO A;  2FYN C;  2IDB A;  4TT3 H;  3GF3 A;  3SFD C;  3D70 A;  3AE6 C;  4OGQ C;  3GF7 A;  2H88 C;  2NZ2 A;  3AE4 C;  1HJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...