2FYUK

Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
53
structure length
53
Chain Sequence
MLTRFLGPRYRQLARNWVPTASLWGAVGAVGLVWATDWRLILDWVPYINGKFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Surface-modulated motion switch: Capture and release of iron-sulfur protein in the cytochrome bc1 complex.
pubmed doi rcsb
total genus 16
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF08997 UCR_6-4kD Ubiquinol-cytochrome C reductase complex, 6.4kD protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.220 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2fyuK00
1SQVK 1SQBK 2O01H 3G3ZA 2FYUK 1NU1K 1SQXK 4IFDK 1NTKK 1L0LK 3M9QA 2WSCH 3CLQA 1L0NK 1SQQK 2OARA 2WSFH 2WSEH 1SQPK 1NTZK 2J59M 5KLVK 1NTMK 2LKMA 3LW5H
chains in the Genus database with same CATH superfamily
2HR3A 4U7JA 1YTZI 3RL0D 3CCLP 1OW7A 1T3JA 4O9BA 1VF5D 3B5NB 2LXBA 1K8AQ 1LTJC 1Y9BA 3LIDA 1CI6B 4N78D 1FU1A 2OTJP 3BATA 3GF3A 4ASVA 4OGQD 2K3RA 1K9MQ 1L0NG 4JBZA 1ZN5A 3H32B 1SQQJ 1AVOA 2JO1A 5AVZB 2QJKC 5AVYB 1KD1Q 1KMIZ 2FFDC 3ZDMA 5KAFE 2O01J 3Q1MA 1LWUC 2R3SA 2W6AA 1S9KD 2I1KA 4U3FD 2WPVB 5APVA 1ZMEC 1LT9A 2HPCB 4W7YA 2K9JA 3AEGC 2ITAA 3I56P 3RGUA 2WVRA 1KORA 3A5TA 1EC5A 3MD0A 5APQA 3V4WA 2HLOA 1KQGB 1YYCA 3CC2P 1M90Q 2JDIH 1IJDB 1NO4A 1P84H 4RKUJ 1AFOA 3IR9A 3HUSA 5CMZA 3IN6A 3L73D 2A45H 1W5CE 1HWTC 1VQKP 1R8EA 2JWAA 1PIXA 1SQQG 4JYCA 1AVYA 1KC8Q 3KZIE 4NPEA 3CCQP 2WSCH 3TNUB 4N78E 1KB9I 1N86A 5APTA 3TK1A 1LJ2A 1ZLLA 1X9VA 3IFMA 4GOFA 1RY3A 3CCVP 2QJKB 1UIXA 3CXHH 2B9BA 3L35A 3OAKA 1OWAA 3D70A 3BCCD 1LT1A 1BCCJ 4U3FE 2IX7C 1W2EA 4YXWH 3VTPC 5KKZC 2IFMA 5KLIB 1BCCE 3AE1C 1Q86Q 5EFWB 3N7NA 5M1BA 3H1JD 2FXMA 1K73Q 4I7ZB 3CD6P 3M06A 3SFDC 5CCHC 1E5WA 2M8RA 3L73E 1NKZB 2CPBA 5H2FH 1T3UA 2ZT9D 4IL6E 4D6TJ 1PP9D 1RE3A 5GTIE 1NU1D 2OGUA 1GL2A 1YBKA 3T97A 4U3FG 3CI9A 4D6TE 4IFDK 2RKLA 2OARA 1BCCG 1LTGC 3C9IA 2C9LY 2WPRA 5CJ0A 5KLVD 3FX0A 4Z1MH 1FDMA 1VQ8P 1X0TA 5KAIH 3L73G 3JSVC 2FYUD 5CHXA 3H1KD 1G1JA 1PGQA 2J58A 4KJMA 2Q3IA 4ZMDA 3G71P 2KOGA 2I8DA 3H1JE 4D6TG 4EYYQ 1URQA 1SQQK 2KI7B 4N3YB 3CXHI 1JUNA 4DCKA 1N73C 3M0AA 2N1TA 1SQXD 1BGYD 3CC7P 5B66E 4WB4A 4UB8H 3V2QA 2QG4A 1TU3F 1KZUB 1M56D 5KJ7C 3V2PA 2ZFCA 1YJNP 4BRYA 3HD7A 1DX7A 1JY3P 2NPSC 3TDKA 1HGZA 2GUSA 4A7PA 2M0BA 2E43A 1HTLC 1JTHA 1JEKA 1HH0A 1FDIA 4AUWA 4JYBA 3H1HJ 2KUBA 3TSIA 5AW3B 3D6YA 5KLVE 2ZYGA 4TT3H 5GTHH 2E75B 2IZ0A 1L4AB 1KB9D 1SFCC 2KYVA 1J1DC 2OYOA 1PFIA 1VF5C 2CPSA 1M8OB 2XNDH 3CX5H 1YQ3C 3GLMA 4IFFA 1LNQA 1QVFO 1W2BO 2B89A 4OGQC 2RN0A 1BGYE 2WZ7A 3B71A 2G3AA 2KP8A 4GKGA 1IFPA 3AE6C 3LW5H 3MIWA 1M1JC 2WITA 3A7OA 1EZVI 1RF1B 4RJTA 2WT7B 1QLED 2H43A 2XNXA 2R3CA 3PLNA 2OTKE 3TGUE 1EQ7A 2Q3EA 2MJZA 3H1HG 4HH2A 3O6QB 1SQBJ 3HTKA 2J5UA 5B5EH 5C39A 1X22A 3D6ZA 2R5DA 2ZVNB 1NTMJ 2Y9ZA 1URQB 1H0TA 1JOCA 5TJHA 1GW3A 2P2UA 3L72J 2W8ZA 1L0LD 2N1TB 4GODA 1ZW0A 2QJYC 4BXLA 3L74J 3KQGA 1NTME 4ZKUA 3KYQA 1L4AD 4R4MA 2IBZI 3NXSA 1NH4A 3F89A 2Q6QA 3PH0A 1BSNA 4PV1C 2HFED 1VDFA 3AECC 3TGUG 3HD7B 4DJGA 3B5NC 2CK3H 2YKPA 4C7NA 1SQPJ 1S3JA 3BVHA 3KPEA 1PV3A 2WSSH 3FXEA 4OWFA 1JTHB 1Q81Q 3P32A 5AW4B 1KV4A 1SQBG 1S5LH 5BVZA 1NGMB 1VQ7P 3TF5A 1IK9A 3HE5B 5KJ7D 1KYOH 1SP4A 4YXDC 1L0NJ 2NRGA 3CXHD 1NTMG 2FKWB 3CX5I 3HRNA 1R5LA 4L74A 3L72G 3L74G 2KNCA 3SWKA 4H13B 1KB9H 1KQLA 1NTZD 2AEJA 1WT6A 1S72P 3RBZA 1L0LE 1PZQA 1U57A 5CCGA 1LP1B 3L71D 3CCRP 1NTKD 1OW6A 1JY2O 2FFDA 3CPWO 2B87A 1P84E 1SFCD 1SQPG 4PD4H 1FOSF 4PV1B 4LGDE 1WMKA 1NHLA 3L75D 1FC2C 1JB0J 1RE4C 5E79H 3AE2C 1MFZA 2SPZA 2P10A 1RQVA 1K05A 3HTKB 4L73A 3Q3DA 1Q90D 4HB1A 3H1ID 1PL5A 2QJPC 1EXIA 2PRRA 4N6JA 3EQ2A 2BCCJ 2Q5UA 1H0TB 1L0LG 2IYPA 1DEBA 4K35A 2KLUA 2YO3A 2C0XA 3MZWB 3QWOC 4RO0A 3CXHE 1BE3J 1GW4A 2BCCE 2JWDA 3GHGA 2WPSA 5BU5A 3FGAD 1MZ9A 3BRTB 5APWA 5KLIC 1OX3A 1FZAA 1BE3E 3CCUP 1NTZE 1EZVD 4H13D 1FZBA 2A45G 4I7ZC 3D71A 3L70D 3F5HA 3AE5C 3A0HH 3L71E 3KHUA 1NTKE 1RH5B 1KYOI 2IYOA 1NOHA 5AW8B 1SVFA 1M1KQ 2Z5IA 1SQBK 3QH9A 2GA1A 2L5GB 2QSIA 4PV1D 1VQ9P 3GW6A 3L75E 3NTNA 3Q5SA 5H2FE 1ZOYC 1SQVD 2P7JA 2BCCG 3B5ND 3ITKA 1Q82Q 4Y99B 1LT9C 3H1LD 1NTMK 3S4RA 3RL0g 2PP6A 3G9RA 5APYA 1KILB 1JM0A 3JCUH 1BE3G 2IPPA 4NPFX 3H1IE 2QJPB 3EFFK 4U3FJ 2IBZD 5AW2B 1LTBC 5CCHA 2FY8A 1QGKB 3MTUE 1YJWP 1N7LA 1T6AA 3Q5PA 1S9KE 4PD4I 1GU4A 1S5LX 3HUSC 3C8VA 4EI2A 2O01H 2AXCA 1K04A 2OYHA 1HUCA 3CC4P 1GZLA 1SQPK 1EDIA 1EZVE 4XA4A 5AW6B 5KAIE 2RH0A 3L75G 3L73J 2YXQB 3GMAA 3L70E 2ZYAA 1QX8A 2KS1A 3CX5D 5CJ4A 1L0NK 2KLVA 2LR2A 4WY4A 1JY2N 1USEA 2AEMA 1U7JA 3I5CA 4IFMA 2WPQA 2YIUB 5TISH 3KZIH 4UB8E 1SQVE 1LT9B 1KQSO 2K9JB 5AVVB 3W68A 5DJTB 3GHGB 3USSA 2MKVA 2IBZE 1KILD 3VMXA 4YTPC 1OXZA 1HF9A 4HKZH 3BCCE 3L70G 1WRGA 2E75C 3HUSB 1S2EA 1L4AC 1PPJD 3H1JJ 1LGHB 4WWIA 1VPCA 5GTHE 2NPSA 3RK3B 4LLHA 1ZR4A 2KSJA 3SWYA 5CBNA 2YNYA 3CLQA 4EDFA 1GL2C 2R32A 5AW7B 1IFJA 1VQNP 3CL3D 1AQ5A 1GK6A 1DD4A 2A06D 1RQUA 3AE3C 4TLFA 3A3YB 2M5AA 2K88A 2E5YA 1PP9E 1N7SA 1NU1E 1RF1C 3E7KA 3BCCG 5AVQB 1CSBA 2QEXP 1HJ0A 1OIPA 3CCEP 1USDA 1SFCA 2V7QJ 1Q2NA 1BDDA 3AEBC 3CCSP 1GD2E 2YKOA 2JP3A 2P67A 5KLVJ 1KYOD 2KB7P 2KK7A 2OYHB 2KZJA 3U59A 4OVNF 2W83C 2NZ2A 3H1JG 4C7RA 2FYUJ 1VQLP 4W7ZA 1URQC 5B5EE 2N1TC 1PGJA 1T2KC 3CCJP 2FYUE 1YI2P 2N9YB 4DOJA 3H1KE 3I55P 3CWBD 1PP9G 2W6BA 4XFJA 1KFMA 1NU1G 1BGYJ 1FDOA 3E1RA 1GL2B 2FXPA 3T97B 3HD7C 4C46A 1RF0A 1FZCA 1SQXE 4PD4D 2POHA 2E74C 2XU6A 1NWQA 3V5BA 2I1JA 3TGUJ 1X8YA 2QA4P 2WSFJ 1IFNA 1QEXA 4H0LC 5AVXB 3WUTA 2YXRB 2QRXA 2G8YA 3U1AA 5KLVG 2Y0DA 2K1AA 2UWJE 2PGDA 1Q7YQ 3CMEP 1MUUA 1RHZB 2FYUG 3AE4C 1S5LE 3H1KG 1NJIQ 1H89A 3CCMP 3WU2H 4I6MC 2E76B 2OYIA 1KYOE 1D7MA 3PP5A 2GUVA 3VOPA 3FXDA 4H13C 3RK2B 1CI6A 4HJGH 2H7HA 4QMAA 2YKQA 1SQXG 1ZXGA 1BGYG 2Y9YA 1PGPA 3H32A 1LTSC 1KB9E 2WQYC 2E75D 2H88C 1OW8A 1VQ6P 3GF7A 1FOSE 3CWBE 2FXOA 1R5SA 3VMYA 2HG5D 5AVRB 2WSEH 3V6IA 1J1EB 1DEEG 2JR8A 3Q2YA 1GU5A 4BRYB 1MV8A 3IF4A 1BSHA 1VQOP 3M9HA 2QM8A 1GDTA 1GL2D 3AE7C 3RL0B 4PD4E 2E74B 4DT0A 1FBMA 5E79E 4H0LB 3G4SP 4UB6H 2FBWC 1EDJA 1AA0A 1XTCC 1NYHA 2KZIA 3FWNA 2E42A 1N2DC 3M9QA 2KXPB 4PJ0H 5L8RJ 4B86A 2QE7H 1HBWA 1SQQD 1MKMA 1LTJA 1L0LJ 1NU1K 4L75A 3AEDC 2O3JA 3TNUA 3EWKA 3RK2D 1NAYA 2WTYA 2ZJSE 1URQD 2QM7A 2PAJA 2V4HA 2N1TD 5AW5B 1GK4A 1IFDA 1T2KD 2C0WA 1LWUA 3M0DC 3MHVA 4JQ0D 1AJYA 3BASA 2R5BA 3A0HE 1LTAC 5KLVK 1IO4A 3PTZA 3HD7D 3II6A 3MUDC 2WSCJ 2OQQA 4Y99C 1OVVA 2FYUK 5AVTB 2OYIB 5AVSB 4EOTA 2E74D 1KILC 1NVOA 1YTZT 4H0LD 1ZP0C 1IZNB 5AW0B 3JCUE 1SQXK 1LTIC 5CCGC 3N4XA 1NTZJ 5AW9B 2XKMA 1FZEA 1A02J 2H89C 2HODA 1EXJA 1YJ9P 2AXTH 1FJKA 2WMMA 1SQQE 2N9BA 4RESB 3L71J 1NTKJ 1XTGB 3A0BH 2AEFA 3JC22 1BCCD 1PGOA 4C7NB 3V2NA 3V4QA 1QL2A 3L75J 2PFXA 4AQRD 1JY3O 2K37A 3MP7B 2HYNA 2ZYDA 3FWLA 2ZT9B 2YIUC 1IC2A 3H1IJ 1VQMP 4R4LA 3GHGC 5TISE 2KNCB 1VQ5P 2Y0CA 3M9BA 3AE8C 1AV1A 1NTZG 1LTJB 4D6TD 1HJBA 3WMM0 5KAFH 1FE6A 3C1LA 3AEFC 3L71G 1NTKG 1Y47A 1IFIA 3SWFA 2FFDB 2B87B 3B8EB 3VMZA 1LWUB 2M3BA 1U7MA 3HE4A 1Z56A 3L70J 3SFEC 3H25A 5AVUB 3KDPB 3RBXA 3RK3C 3WUUA 1EDLA 4M3LA 1EDKA 1HGVA 2B88A 3OA7A 1KTMA 4EIJA 5APSA 1L2PA 2P1JA 1T8ZA 4H44C 3VN0A 1OZHA 2W6JH 5KTBA 3H1IG 1S1CX 3VP9A 2XDJA 1S4XA 1FZFA 5K5GB 1A02F 1SQVJ 1Y8AA 1SLQA 2Z5HA 4WVZA 3H1LJ 1L4AA 1G2CA 3V2RA 3OJAB 2R44A 2C9NY 3U1CA 1L0LK 1AQTA 3S9OA 4XE5B 1JMMA 3H1LE 2JJLA 4Y28J 1H88A 3P8CD 3ABVC 2HODB 1JY2P 5BU8B 3BCCJ 4GT1A 2OYHC 1M57D 1EZVG 1N73A 2YMKA 1DH3A 1X79B 1G1IA 3TYYA 2FYZA 1N8RQ 4JPZB 1P84I 4L76A 1GTWA 1JO5A 1RF1A 5KJ7A 5CCGD 2WT7A 3A2AA 1VL2A 1JMBA 1QVGO 4WY4C 2A45I 1RE3C 1UIIA 5KKZB 3H1HD 2H8PD 3O6QA 3PHLA 3NMDA 2W90A 1SQVG 4H44B 3S1KA 2RMZA 1PP9J 3H1LG 2BASA 2Y0EA 1E79H 2W27A 3B4SA 1NU1J 3OW2O 1FS0E 3CX5E 1KFNA 1DIPA 1ZRTD 2D2CC 2IBZG 4IL6H 1YIJP 3LW5J 1NTZK 2L91A 5GTIH 1JY3N 4YPCA 1J2JB 4W80A 4AYCA 2JKVA 5APXA 3R2PA 1NTKK 3P8CE 3PJSK 2E76C 4CPGA 3HE4B 3TGUD 1KILE 3RK2C 2GM4A 3H1KJ 3WU2E 3KXDA 2BEQD 1M1JA 4ZKPA 1CZQA 2JEEA 2KS1B 1PPJE 3W67A 1SQBD 1NKNA 3L36A 3PRJA 4NPDA 1FZGA 4WY4B 1M7LA 3HE5A 1SQXJ 1J1EC 2BEZF 2O1KA 1N7SC 2WSEJ 1CW5A 4I2LC 2YO2A 3H1HE 3RK3D 1G2CB 3Q5RA 4JF7A 1NTMD 4WBAA 1FJPA 3AEAC 2O01N 3L72D 3RL0C 4GIFA 4ASWA 3L74D 2A06E 4H44D 2ZXXA 3VP8A 5B66H 2D2CB 5AVWB 3UIAA 1ZRTE 3H6PA 2QIWA 1N73B 3M91A 1LP1A 5CCHD 1OVRA 2Q7CA 2K9YA 2ZAEB 1PPJG 1JCDA 4UB6E 4GOEA 2Q9IA 1SQPD 1YHQP 2FYNC 5CBOA 3EFGA 2QVAA 3B5NA 2NPSB 3SSUA 2V7QH 1ZV8A 2ZVOB 2J59M 2Z4EA 3GG2A 1OVUA 4PJ0E 2LKMA 3CWBJ 1HVVA 1RF0C 1FZCC 1L0ND 1NAFA 1SQVK 4KHXA 2IZ1A 2YMYA 3VYIA 2A06G 1SQBE 1ZR2A 2M5AB 2O1JA 5DJUB 1BDCA 1N7SB 4WY4D 3RK3E 2HPCA 1JCCA 1SFCB 3NFQA 3O8ZA 3G3ZA 1OFCX 2E5TA 1J1DB 1P84D 3L72E 2IDBA 3LIEA 1VF5B 3AEEC 1H8AA 2LXCB 3L74E 4DZOA 2OYIC 2M3EA 3R4YA 3K5BA 3MGNA 3AE9C 2D2CD 2VRSA 2KSEA 4OGQB 2WWWA 1QL1A 4LC1A 5AW1B 3CMAP 2P58A 1YITP 4KT0J 1IFMA 3L4FA 1M1JB 1DD3A 3M0DA 2WSFH 4IL6X 4ZNCA 1JNMA 3IAOA 1VQPP 2FYNB 3CWBG 1GMJA 1SQPE 1KN7A 1LTTC 2OTLP 2XZRA 2DW3A 3P7KA 2E76D 4IOIH 1RE4A 1SS1A 2ZXEB 1KQFB 4GDOA 3MUDA 2NPSD 3G6EP 2BCCD 1OMIA 1YQ4C 5APUA 2XV5A 1FZCB 2IFNA 1L0NE 2AXTE 4BWNA 1KILA 4OH8B 1BE3D 1IK7A 4I1LA 3P8MC 4K3AA 1MFTA 3BRVB 3E1IA 3A0BE 3VMAA 1FAVA 4HYTB 2Q1KA 1VQ4P 2QJYB 2KIKA 1N7SD 4MN4C 3L37A 2ZT9C 3WUVA
chains in the Genus database with same CATH topology
3HTKA 1IFIA 1YTZI 3SWFA 2FFDB 3A3YB 3RL0D 1T3JA 3B8EB 4O9BA 3VMZA 1LWUB 2M3BA 2R5DA 3HE4A 1Z56A 1N7SA 5AVUB 1RF1C 3KDPB 3B5NB 5AVQB 3RK3C 1CSBA 1URQB 1LTJC 3LIDA 4M3LA 1CI6B 1JOCA 4N78D 1GW3A 1HGVA 1SFCA 2P2UA 1FU1A 2N1TB 3BATA 3OA7A 4EIJA 5APSA 3KQGA 2P1JA 4ZKUA 1T8ZA 3VN0A 1ZN5A 3H32B 3KYQA 1L4AD 5AVZB 1GD2E 2YKOA 5KTBA 2P67A 5AVYB 2KB7P 3NXSA 1NH4A 3U59A 2OYHB 3VP9A 2XDJA 2FFDC 1FZFA 2HFED 1A02F 1VDFA 4C7RA 1LWUC 1SLQA 2W6AA 2Z5HA 3HD7B 1S9KD 2I1KA 4W7ZA 5APVA 3B5NC 1L4AA 1LT9A 1G2CA 1URQC 2HPCB 4W7YA 3V2RA 3OJAB 2YKPA 4C7NA 2N1TC 2C9NY 3U1CA 1L0LK 3BVHA 3KPEA 1T2KC 4XE5B 4DOJA 1JMMA 3A5TA 1JTHB 3MD0A 2JJLA 5APQA 3V4WA 2HLOA 1H88A 3P32A 3P8CD 5AW4B 5BU8B 1YYCA 1JY2P 2HODB 2W6BA 5BVZA 4GT1A 1IJDB 1KFMA 1NO4A 2OYHC 1IK9A 3HE5B 1N73A 5KJ7D 1GL2B 1SP4A 1DH3A 1AFOA 1X79B 3IR9A 1G1IA 3HD7C 3HUSA 3TYYA 4C46A 2FYZA 1RF0A 1FZCA 5CMZA 2FKWB 2POHA 3HRNA 2A45H 1GTWA 1HWTC 1JO5A 2XU6A 1RF1A 1NWQA 5KJ7A 5CCGD 3V5BA 3A2AA 2WT7A 2I1JA 1KQLA 1X8YA 4WY4C 2A45I 1IFNA 5AVXB 4JYCA 1WT6A 1RE3C 3U1AA 2WSCH 3TNUB 4N78E 1N86A 5APTA 2H8PD 3TK1A 3NMDA 5CCGA 1ZLLA 1X9VA 3IFMA 1MUUA 1RY3A 2BASA 1H89A 1JY2O 2W27A 2FFDA 4I6MC 2OYIA 1SFCD 1KFNA 1FOSF 3PP5A 3L35A 3OAKA 1OWAA 2GUVA 3VOPA 4LGDE 3RK2B 1CI6A 2H7HA 1NTZK 1NHLA 1JY3N 1RE4C 2IX7C 1J2JB 1W2EA 3VTPC 2YKQA 1MFZA 4W80A 4AYCA 3H32A 1LTSC 5APXA 2IFMA 3HTKB 3R2PA 1NTKK 1FOSE 3N7NA 3P8CE 3VMYA 2HG5D 5AVRB 3HE4B 2WSEH 1J1EB 2FXMA 4N6JA 3EQ2A 2Q5UA 1GU5A 3M06A 1MV8A 3RK2C 2GM4A 1DEBA 3M9HA 2YO3A 2C0XA 5CCHC 2QM8A 1GDTA 1E5WA 1GL2D 2M8RA 3RL0B 1GW4A 1NKZB 1M1JA 2CPBA 4ZKPA 1CZQA 2JEEA 1T3UA 3GHGA 2WPSA 5BU5A 1MZ9A 3BRTB 1RE3A 5APWA 1NKNA 3L36A 1FZGA 1FZAA 4WY4B 1M7LA 1FBMA 3HE5A 1GL2A 1XTCC 1J1EC 1FZBA 3T97A 2O1KA 3CI9A 1N7SC 2A45G 1CW5A 4I2LC 2YO2A 3RK3D 4IFDK 1G2CB 4JF7A 2E42A 1N2DC 4WBAA 1FJPA 3M9QA 2OARA 3RL0C 1NOHA 4GIFA 1LTGC 3C9IA 5AW8B 2C9LY 4B86A 1SVFA 2WPRA 3VP8A 5AVWB 3UIAA 1HBWA 2Z5IA 1LTJA 1SQBK 3H6PA 1NU1K 1N73B 5CJ0A 3M91A 2L5GB 3TNUA 1FDMA 3NTNA 3RK2D 2P7JA 3B5ND 5CCHD 2WTYA 4Y99B 5CHXA 1LT9C 1URQD 2Q7CA 2QM7A 1NTMK 2PAJA 2PP6A 1G1JA 2N1TD 5AW5B 1GK4A 1JCDA 2J58A 5APYA 2Q3IA 1IFDA 1T2KD 2Q9IA 1KILB 2IPPA 2C0WA 2KOGA 1LWUA 3M0DC 3EFGA 5AW2B 1LTBC 3B5NA 2NPSB 5CCHA 1ZV8A 1URQA 1SQQK 3BASA 3MTUE 4N3YB 2R5BA 1N7LA 1JUNA 1LTAC 1N73C 2J59M 3M0AA 1S9KE 5KLVK 2Z4EA 1IO4A 2N1TA 2LKMA 3HD7D 1GU4A 3HUSC 3II6A 1HVVA 1RF0C 1FZCC 1NAFA 1SQVK 4KHXA 4WB4A 2YMYA 4Y99C 2O01H 3VYIA 2FYUK 5AVTB 3V2QA 2OYIB 5AVSB 2OYHA 1HUCA 4EOTA 1ZR2A 1KZUB 1GZLA 5KJ7C 1KILC 2O1JA 3V2PA 1SQPK 2ZFCA 1YTZT 4XA4A 5AW6B 3HD7A 1N7SB 4WY4D 1DX7A 1JY3P 2NPSC 5AW0B 2HPCA 1JCCA 1HGZA 1SFCB 3NFQA 3O8ZA 2GUSA 3G3ZA 1SQXK 1LTIC 2E43A 5CCGC 1J1DB 3N4XA 1HTLC 5AW9B 3LIEA 2XKMA 1JTHA 1FZEA 1H8AA 1A02J 5CJ4A 1L0NK 2KLVA 1HH0A 4WY4A 4DZOA 2HODA 4AUWA 1JY2N 2OYIC 1FJKA 4JYBA 3I5CA 3TSIA 3MGNA 5AW3B 4IFMA 2VRSA 2N9BA 2WPQA 2WWWA 1QL1A 4LC1A 4RESB 5AW1B 1XTGB 1IFMA 3L4FA 1L4AB 1LT9B 5AVVB 1SFCC 1M1JB 4C7NB 3V2NA 3M0DA 2WSFH 3V4QA 2KYVA 3GHGB 1JNMA 1QL2A 1J1DC 1PFIA 2CPSA 1LTTC 4AQRD 2XZRA 3P7KA 1KILD 3VMXA 1JY3O 1OXZA 1RE4A 2ZXEB 2HYNA 4IFFA 1WRGA 3MUDA 2NPSD 1IC2A 2WZ7A 5APUA 3HUSB 2XV5A 1FZCB 2KP8A 4GKGA 2IFNA 1L4AC 1KILA 3LW5H 1LGHB 3MIWA 4OH8B 1M1JC 4I1LA 1VPCA 2WITA 3A7OA 3P8MC 3GHGC 3BRVB 1RF1B 3E1IA 2WT7B 2NPSA 3M9BA 3RK3B 4LLHA 2H43A 2XNXA 1LTJB 2R3CA 1ZR4A 1FAVA 4HYTB 2KSJA 3SWYA 1HJBA 2YNYA 3CLQA 3WMM0 1EQ7A 1GL2C 2R32A 2MJZA 4HH2A 1N7SD 5AW7B 1IFJA 3L37A 3CL3D 1AQ5A 1GK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV K;  1SQB K;  2O01 H;  3G3Z A;  2FYU K;  1NU1 K;  1SQX K;  4IFD K;  1NTK K;  1L0L K;  3M9Q A;  2WSC H;  3CLQ A;  1L0N K;  1SQQ K;  2OAR A;  2WSF H;  2WSE H;  1SQP K;  1NTZ K;  2J59 M;  5KLV K;  1NTM K;  2LKM A;  3LW5 H; 
#chains in the Genus database with same CATH topology
 2HR3 A;  4U7J A;  1YTZ I;  3RL0 D;  3CCL P;  1OW7 A;  1T3J A;  4O9B A;  1VF5 D;  3B5N B;  2LXB A;  1K8A Q;  1LTJ C;  1Y9B A;  3LID A;  1CI6 B;  4N78 D;  1FU1 A;  2OTJ P;  3BAT A;  3GF3 A;  4ASV A;  4OGQ D;  2K3R A;  1K9M Q;  1L0N G;  4JBZ A;  1ZN5 A;  3H32 B;  1SQQ J;  1AVO A;  2JO1 A;  5AVZ B;  2QJK C;  5AVY B;  1KD1 Q;  1KMI Z;  2FFD C;  3ZDM A;  5KAF E;  2O01 J;  3Q1M A;  1LWU C;  2R3S A;  2W6A A;  1S9K D;  2I1K A;  4U3F D;  2WPV B;  5APV A;  1ZME C;  1LT9 A;  2HPC B;  4W7Y A;  2K9J A;  3AEG C;  2ITA A;  3I56 P;  3RGU A;  2WVR A;  1KOR A;  3A5T A;  1EC5 A;  3MD0 A;  5APQ A;  3V4W A;  2HLO A;  1KQG B;  1YYC A;  3CC2 P;  1M90 Q;  2JDI H;  1IJD B;  1NO4 A;  1P84 H;  4RKU J;  1AFO A;  3IR9 A;  3HUS A;  5CMZ A;  3IN6 A;  3L73 D;  2A45 H;  1W5C E;  1HWT C;  1VQK P;  1R8E A;  2JWA A;  1PIX A;  1SQQ G;  4JYC A;  1AVY A;  1KC8 Q;  3KZI E;  4NPE A;  3CCQ P;  2WSC H;  3TNU B;  4N78 E;  1KB9 I;  1N86 A;  5APT A;  3TK1 A;  1LJ2 A;  1ZLL A;  1X9V A;  3IFM A;  4GOF A;  1RY3 A;  3CCV P;  2QJK B;  1UIX A;  3CXH H;  2B9B A;  3L35 A;  3OAK A;  1OWA A;  3D70 A;  3BCC D;  1LT1 A;  1BCC J;  4U3F E;  2IX7 C;  1W2E A;  4YXW H;  3VTP C;  5KKZ C;  2IFM A;  5KLI B;  1BCC E;  3AE1 C;  1Q86 Q;  5EFW B;  3N7N A;  5M1B A;  3H1J D;  2FXM A;  1K73 Q;  4I7Z B;  3CD6 P;  3M06 A;  3SFD C;  5CCH C;  1E5W A;  2M8R A;  3L73 E;  1NKZ B;  2CPB A;  5H2F H;  1T3U A;  2ZT9 D;  4IL6 E;  4D6T J;  1PP9 D;  1RE3 A;  5GTI E;  1NU1 D;  2OGU A;  1GL2 A;  1YBK A;  3T97 A;  4U3F G;  3CI9 A;  4D6T E;  4IFD K;  2RKL A;  2OAR A;  1BCC G;  1LTG C;  3C9I A;  2C9L Y;  2WPR A;  5CJ0 A;  5KLV D;  3FX0 A;  4Z1M H;  1FDM A;  1VQ8 P;  1X0T A;  5KAI H;  3L73 G;  3JSV C;  2FYU D;  5CHX A;  3H1K D;  1G1J A;  1PGQ A;  2J58 A;  4KJM A;  2Q3I A;  4ZMD A;  3G71 P;  2KOG A;  2I8D A;  3H1J E;  4D6T G;  4EYY Q;  1URQ A;  1SQQ K;  2KI7 B;  4N3Y B;  3CXH I;  1JUN A;  4DCK A;  1N73 C;  3M0A A;  2N1T A;  1SQX D;  1BGY D;  3CC7 P;  5B66 E;  4WB4 A;  4UB8 H;  3V2Q A;  2QG4 A;  1TU3 F;  1KZU B;  1M56 D;  5KJ7 C;  3V2P A;  2ZFC A;  1YJN P;  4BRY A;  3HD7 A;  1DX7 A;  1JY3 P;  2NPS C;  3TDK A;  1HGZ A;  2GUS A;  4A7P A;  2M0B A;  2E43 A;  1HTL C;  1JTH A;  1JEK A;  1HH0 A;  1FDI A;  4AUW A;  4JYB A;  3H1H J;  2KUB A;  3TSI A;  5AW3 B;  3D6Y A;  5KLV E;  2ZYG A;  4TT3 H;  5GTH H;  2E75 B;  2IZ0 A;  1L4A B;  1KB9 D;  1SFC C;  2KYV A;  1J1D C;  2OYO A;  1PFI A;  1VF5 C;  2CPS A;  1M8O B;  2XND H;  3CX5 H;  1YQ3 C;  3GLM A;  4IFF A;  1LNQ A;  1QVF O;  1W2B O;  2B89 A;  4OGQ C;  2RN0 A;  1BGY E;  2WZ7 A;  3B71 A;  2G3A A;  2KP8 A;  4GKG A;  1IFP A;  3AE6 C;  3LW5 H;  3MIW A;  1M1J C;  2WIT A;  3A7O A;  1EZV I;  1RF1 B;  4RJT A;  2WT7 B;  1QLE D;  2H43 A;  2XNX A;  2R3C A;  3PLN A;  2OTK E;  3TGU E;  1EQ7 A;  2Q3E A;  2MJZ A;  3H1H G;  4HH2 A;  3O6Q B;  1SQB J;  3HTK A;  2J5U A;  5B5E H;  5C39 A;  1X22 A;  3D6Z A;  2R5D A;  2ZVN B;  1NTM J;  2Y9Z A;  1URQ B;  1H0T A;  1JOC A;  5TJH A;  1GW3 A;  2P2U A;  3L72 J;  2W8Z A;  1L0L D;  2N1T B;  4GOD A;  1ZW0 A;  2QJY C;  4BXL A;  3L74 J;  3KQG A;  1NTM E;  4ZKU A;  3KYQ A;  1L4A D;  4R4M A;  2IBZ I;  3NXS A;  1NH4 A;  3F89 A;  2Q6Q A;  3PH0 A;  1BSN A;  4PV1 C;  2HFE D;  1VDF A;  3AEC C;  3TGU G;  3HD7 B;  4DJG A;  3B5N C;  2CK3 H;  2YKP A;  4C7N A;  1SQP J;  1S3J A;  3BVH A;  3KPE A;  1PV3 A;  2WSS H;  3FXE A;  4OWF A;  1JTH B;  1Q81 Q;  3P32 A;  5AW4 B;  1KV4 A;  1SQB G;  1S5L H;  5BVZ A;  1NGM B;  1VQ7 P;  3TF5 A;  1IK9 A;  3HE5 B;  5KJ7 D;  1KYO H;  1SP4 A;  4YXD C;  1L0N J;  2NRG A;  3CXH D;  1NTM G;  2FKW B;  3CX5 I;  3HRN A;  1R5L A;  4L74 A;  3L72 G;  3L74 G;  2KNC A;  3SWK A;  4H13 B;  1KB9 H;  1KQL A;  1NTZ D;  2AEJ A;  1WT6 A;  1S72 P;  3RBZ A;  1L0L E;  1PZQ A;  1U57 A;  5CCG A;  1LP1 B;  3L71 D;  3CCR P;  1NTK D;  1OW6 A;  1JY2 O;  2FFD A;  3CPW O;  2B87 A;  1P84 E;  1SFC D;  1SQP G;  4PD4 H;  1FOS F;  4PV1 B;  4LGD E;  1WMK A;  1NHL A;  3L75 D;  1FC2 C;  1JB0 J;  1RE4 C;  5E79 H;  3AE2 C;  1MFZ A;  2SPZ A;  2P10 A;  1RQV A;  1K05 A;  3HTK B;  4L73 A;  3Q3D A;  1Q90 D;  4HB1 A;  3H1I D;  1PL5 A;  2QJP C;  1EXI A;  2PRR A;  4N6J A;  3EQ2 A;  2BCC J;  2Q5U A;  1H0T B;  1L0L G;  2IYP A;  1DEB A;  4K35 A;  2KLU A;  2YO3 A;  2C0X A;  3MZW B;  3QWO C;  4RO0 A;  3CXH E;  1BE3 J;  1GW4 A;  2BCC E;  2JWD A;  3GHG A;  2WPS A;  5BU5 A;  3FGA D;  1MZ9 A;  3BRT B;  5APW A;  5KLI C;  1OX3 A;  1FZA A;  1BE3 E;  3CCU P;  1NTZ E;  1EZV D;  4H13 D;  1FZB A;  2A45 G;  4I7Z C;  3D71 A;  3L70 D;  3F5H A;  3AE5 C;  3A0H H;  3L71 E;  3KHU A;  1NTK E;  1RH5 B;  1KYO I;  2IYO A;  1NOH A;  5AW8 B;  1SVF A;  1M1K Q;  2Z5I A;  1SQB K;  3QH9 A;  2GA1 A;  2L5G B;  2QSI A;  4PV1 D;  1VQ9 P;  3GW6 A;  3L75 E;  3NTN A;  3Q5S A;  5H2F E;  1ZOY C;  1SQV D;  2P7J A;  2BCC G;  3B5N D;  3ITK A;  1Q82 Q;  4Y99 B;  1LT9 C;  3H1L D;  1NTM K;  3S4R A;  3RL0 g;  2PP6 A;  3G9R A;  5APY A;  1KIL B;  1JM0 A;  3JCU H;  1BE3 G;  2IPP A;  4NPF X;  3H1I E;  2QJP B;  3EFF K;  4U3F J;  2IBZ D;  5AW2 B;  1LTB C;  5CCH A;  2FY8 A;  1QGK B;  3MTU E;  1YJW P;  1N7L A;  1T6A A;  3Q5P A;  1S9K E;  4PD4 I;  1GU4 A;  1S5L X;  3HUS C;  3C8V A;  4EI2 A;  2O01 H;  2AXC A;  1K04 A;  2OYH A;  1HUC A;  3CC4 P;  1GZL A;  1SQP K;  1EDI A;  1EZV E;  4XA4 A;  5AW6 B;  5KAI E;  2RH0 A;  3L75 G;  3L73 J;  2YXQ B;  3GMA A;  3L70 E;  2ZYA A;  1QX8 A;  2KS1 A;  3CX5 D;  5CJ4 A;  1L0N K;  2KLV A;  2LR2 A;  4WY4 A;  1JY2 N;  1USE A;  2AEM A;  1U7J A;  3I5C A;  4IFM A;  2WPQ A;  2YIU B;  5TIS H;  3KZI H;  4UB8 E;  1SQV E;  1LT9 B;  1KQS O;  2K9J B;  5AVV B;  3W68 A;  5DJT B;  3GHG B;  3USS A;  2MKV A;  2IBZ E;  1KIL D;  3VMX A;  4YTP C;  1OXZ A;  1HF9 A;  4HKZ H;  3BCC E;  3L70 G;  1WRG A;  2E75 C;  3HUS B;  1S2E A;  1L4A C;  1PPJ D;  3H1J J;  1LGH B;  4WWI A;  1VPC A;  5GTH E;  2NPS A;  3RK3 B;  4LLH A;  1ZR4 A;  2KSJ A;  3SWY A;  5CBN A;  2YNY A;  3CLQ A;  4EDF A;  1GL2 C;  2R32 A;  5AW7 B;  1IFJ A;  1VQN P;  3CL3 D;  1AQ5 A;  1GK6 A;  1DD4 A;  2A06 D;  1RQU A;  3AE3 C;  4TLF A;  3A3Y B;  2M5A A;  2K88 A;  2E5Y A;  1PP9 E;  1N7S A;  1NU1 E;  1RF1 C;  3E7K A;  3BCC G;  5AVQ B;  1CSB A;  2QEX P;  1HJ0 A;  1OIP A;  3CCE P;  1USD A;  1SFC A;  2V7Q J;  1Q2N A;  1BDD A;  3AEB C;  3CCS P;  1GD2 E;  2YKO A;  2JP3 A;  2P67 A;  5KLV J;  1KYO D;  2KB7 P;  2KK7 A;  2OYH B;  2KZJ A;  3U59 A;  4OVN F;  2W83 C;  2NZ2 A;  3H1J G;  4C7R A;  2FYU J;  1VQL P;  4W7Z A;  1URQ C;  5B5E E;  2N1T C;  1PGJ A;  1T2K C;  3CCJ P;  2FYU E;  1YI2 P;  2N9Y B;  4DOJ A;  3H1K E;  3I55 P;  3CWB D;  1PP9 G;  2W6B A;  4XFJ A;  1KFM A;  1NU1 G;  1BGY J;  1FDO A;  3E1R A;  1GL2 B;  2FXP A;  3T97 B;  3HD7 C;  4C46 A;  1RF0 A;  1FZC A;  1SQX E;  4PD4 D;  2POH A;  2E74 C;  2XU6 A;  1NWQ A;  3V5B A;  2I1J A;  3TGU J;  1X8Y A;  2QA4 P;  2WSF J;  1IFN A;  1QEX A;  4H0L C;  5AVX B;  3WUT A;  2YXR B;  2QRX A;  2G8Y A;  3U1A A;  5KLV G;  2Y0D A;  2K1A A;  2UWJ E;  2PGD A;  1Q7Y Q;  3CME P;  1MUU A;  1RHZ B;  2FYU G;  3AE4 C;  1S5L E;  3H1K G;  1NJI Q;  1H89 A;  3CCM P;  3WU2 H;  4I6M C;  2E76 B;  2OYI A;  1KYO E;  1D7M A;  3PP5 A;  2GUV A;  3VOP A;  3FXD A;  4H13 C;  3RK2 B;  1CI6 A;  4HJG H;  2H7H A;  4QMA A;  2YKQ A;  1SQX G;  1ZXG A;  1BGY G;  2Y9Y A;  1PGP A;  3H32 A;  1LTS C;  1KB9 E;  2WQY C;  2E75 D;  2H88 C;  1OW8 A;  1VQ6 P;  3GF7 A;  1FOS E;  3CWB E;  2FXO A;  1R5S A;  3VMY A;  2HG5 D;  5AVR B;  2WSE H;  3V6I A;  1J1E B;  1DEE G;  2JR8 A;  3Q2Y A;  1GU5 A;  4BRY B;  1MV8 A;  3IF4 A;  1BSH A;  1VQO P;  3M9H A;  2QM8 A;  1GDT A;  1GL2 D;  3AE7 C;  3RL0 B;  4PD4 E;  2E74 B;  4DT0 A;  1FBM A;  5E79 E;  4H0L B;  3G4S P;  4UB6 H;  2FBW C;  1EDJ A;  1AA0 A;  1XTC C;  1NYH A;  2KZI A;  3FWN A;  2E42 A;  1N2D C;  3M9Q A;  2KXP B;  4PJ0 H;  5L8R J;  4B86 A;  2QE7 H;  1HBW A;  1SQQ D;  1MKM A;  1LTJ A;  1L0L J;  1NU1 K;  4L75 A;  3AED C;  2O3J A;  3TNU A;  3EWK A;  3RK2 D;  1NAY A;  2WTY A;  2ZJS E;  1URQ D;  2QM7 A;  2PAJ A;  2V4H A;  2N1T D;  5AW5 B;  1GK4 A;  1IFD A;  1T2K D;  2C0W A;  1LWU A;  3M0D C;  3MHV A;  4JQ0 D;  1AJY A;  3BAS A;  2R5B A;  3A0H E;  1LTA C;  5KLV K;  1IO4 A;  3PTZ A;  3HD7 D;  3II6 A;  3MUD C;  2WSC J;  2OQQ A;  4Y99 C;  1OVV A;  2FYU K;  5AVT B;  2OYI B;  5AVS B;  4EOT A;  2E74 D;  1KIL C;  1NVO A;  1YTZ T;  4H0L D;  1ZP0 C;  1IZN B;  5AW0 B;  3JCU E;  1SQX K;  1LTI C;  5CCG C;  3N4X A;  1NTZ J;  5AW9 B;  2XKM A;  1FZE A;  1A02 J;  2H89 C;  2HOD A;  1EXJ A;  1YJ9 P;  2AXT H;  1FJK A;  2WMM A;  1SQQ E;  2N9B A;  4RES B;  3L71 J;  1NTK J;  1XTG B;  3A0B H;  2AEF A;  3JC2 2;  1BCC D;  1PGO A;  4C7N B;  3V2N A;  3V4Q A;  1QL2 A;  3L75 J;  2PFX A;  4AQR D;  1JY3 O;  2K37 A;  3MP7 B;  2HYN A;  2ZYD A;  3FWL A;  2ZT9 B;  2YIU C;  1IC2 A;  3H1I J;  1VQM P;  4R4L A;  3GHG C;  5TIS E;  2KNC B;  1VQ5 P;  2Y0C A;  3M9B A;  3AE8 C;  1AV1 A;  1NTZ G;  1LTJ B;  4D6T D;  1HJB A;  3WMM 0;  5KAF H;  1FE6 A;  3C1L A;  3AEF C;  3L71 G;  1NTK G;  1Y47 A;  1IFI A;  3SWF A;  2FFD B;  2B87 B;  3B8E B;  3VMZ A;  1LWU B;  2M3B A;  1U7M A;  3HE4 A;  1Z56 A;  3L70 J;  3SFE C;  3H25 A;  5AVU B;  3KDP B;  3RBX A;  3RK3 C;  3WUU A;  1EDL A;  4M3L A;  1EDK A;  1HGV A;  2B88 A;  3OA7 A;  1KTM A;  4EIJ A;  5APS A;  1L2P A;  2P1J A;  1T8Z A;  4H44 C;  3VN0 A;  1OZH A;  2W6J H;  5KTB A;  3H1I G;  1S1C X;  3VP9 A;  2XDJ A;  1S4X A;  1FZF A;  5K5G B;  1A02 F;  1SQV J;  1Y8A A;  1SLQ A;  2Z5H A;  4WVZ A;  3H1L J;  1L4A A;  1G2C A;  3V2R A;  3OJA B;  2R44 A;  2C9N Y;  3U1C A;  1L0L K;  1AQT A;  3S9O A;  4XE5 B;  1JMM A;  3H1L E;  2JJL A;  4Y28 J;  1H88 A;  3P8C D;  3ABV C;  2HOD B;  1JY2 P;  5BU8 B;  3BCC J;  4GT1 A;  2OYH C;  1M57 D;  1EZV G;  1N73 A;  2YMK A;  1DH3 A;  1X79 B;  1G1I A;  3TYY A;  2FYZ A;  1N8R Q;  4JPZ B;  1P84 I;  4L76 A;  1GTW A;  1JO5 A;  1RF1 A;  5KJ7 A;  5CCG D;  2WT7 A;  3A2A A;  1VL2 A;  1JMB A;  1QVG O;  4WY4 C;  2A45 I;  1RE3 C;  1UII A;  5KKZ B;  3H1H D;  2H8P D;  3O6Q A;  3PHL A;  3NMD A;  2W90 A;  1SQV G;  4H44 B;  3S1K A;  2RMZ A;  1PP9 J;  3H1L G;  2BAS A;  2Y0E A;  1E79 H;  2W27 A;  3B4S A;  1NU1 J;  3OW2 O;  1FS0 E;  3CX5 E;  1KFN A;  1DIP A;  1ZRT D;  2D2C C;  2IBZ G;  4IL6 H;  1YIJ P;  3LW5 J;  1NTZ K;  2L91 A;  5GTI H;  1JY3 N;  4YPC A;  1J2J B;  4W80 A;  4AYC A;  2JKV A;  5APX A;  3R2P A;  1NTK K;  3P8C E;  3PJS K;  2E76 C;  4CPG A;  3HE4 B;  3TGU D;  1KIL E;  3RK2 C;  2GM4 A;  3H1K J;  3WU2 E;  3KXD A;  2BEQ D;  1M1J A;  4ZKP A;  1CZQ A;  2JEE A;  2KS1 B;  1PPJ E;  3W67 A;  1SQB D;  1NKN A;  3L36 A;  3PRJ A;  4NPD A;  1FZG A;  4WY4 B;  1M7L A;  3HE5 A;  1SQX J;  1J1E C;  2BEZ F;  2O1K A;  1N7S C;  2WSE J;  1CW5 A;  4I2L C;  2YO2 A;  3H1H E;  3RK3 D;  1G2C B;  3Q5R A;  4JF7 A;  1NTM D;  4WBA A;  1FJP A;  3AEA C;  2O01 N;  3L72 D;  3RL0 C;  4GIF A;  4ASW A;  3L74 D;  2A06 E;  4H44 D;  2ZXX A;  3VP8 A;  5B66 H;  2D2C B;  5AVW B;  3UIA A;  1ZRT E;  3H6P A;  2QIW A;  1N73 B;  3M91 A;  1LP1 A;  5CCH D;  1OVR A;  2Q7C A;  2K9Y A;  2ZAE B;  1PPJ G;  1JCD A;  4UB6 E;  4GOE A;  2Q9I A;  1SQP D;  1YHQ P;  2FYN C;  5CBO A;  3EFG A;  2QVA A;  3B5N A;  2NPS B;  3SSU A;  2V7Q H;  1ZV8 A;  2ZVO B;  2J59 M;  2Z4E A;  3GG2 A;  1OVU A;  4PJ0 E;  2LKM A;  3CWB J;  1HVV A;  1RF0 C;  1FZC C;  1L0N D;  1NAF A;  1SQV K;  4KHX A;  2IZ1 A;  2YMY A;  3VYI A;  2A06 G;  1SQB E;  1ZR2 A;  2M5A B;  2O1J A;  5DJU B;  1BDC A;  1N7S B;  4WY4 D;  3RK3 E;  2HPC A;  1JCC A;  1SFC B;  3NFQ A;  3O8Z A;  3G3Z A;  1OFC X;  2E5T A;  1J1D B;  1P84 D;  3L72 E;  2IDB A;  3LIE A;  1VF5 B;  3AEE C;  1H8A A;  2LXC B;  3L74 E;  4DZO A;  2OYI C;  2M3E A;  3R4Y A;  3K5B A;  3MGN A;  3AE9 C;  2D2C D;  2VRS A;  2KSE A;  4OGQ B;  2WWW A;  1QL1 A;  4LC1 A;  5AW1 B;  3CMA P;  2P58 A;  1YIT P;  4KT0 J;  1IFM A;  3L4F A;  1M1J B;  1DD3 A;  3M0D A;  2WSF H;  4IL6 X;  4ZNC A;  1JNM A;  3IAO A;  1VQP P;  2FYN B;  3CWB G;  1GMJ A;  1SQP E;  1KN7 A;  1LTT C;  2OTL P;  2XZR A;  2DW3 A;  3P7K A;  2E76 D;  4IOI H;  1RE4 A;  1SS1 A;  2ZXE B;  1KQF B;  4GDO A;  3MUD A;  2NPS D;  3G6E P;  2BCC D;  1OMI A;  1YQ4 C;  5APU A;  2XV5 A;  1FZC B;  2IFN A;  1L0N E;  2AXT E;  4BWN A;  1KIL A;  4OH8 B;  1BE3 D;  1IK7 A;  4I1L A;  3P8M C;  4K3A A;  1MFT A;  3BRV B;  3E1I A;  3A0B E;  3VMA A;  1FAV A;  4HYT B;  2Q1K A;  1VQ4 P;  2QJY B;  2KIK A;  1N7S D;  4MN4 C;  3L37 A;  2ZT9 C;  3WUV A; 
#chains in the Genus database with same CATH homology
 3HTK A;  1IFI A;  1YTZ I;  3SWF A;  2FFD B;  3A3Y B;  3RL0 D;  1T3J A;  3B8E B;  4O9B A;  3VMZ A;  1LWU B;  2M3B A;  2R5D A;  3HE4 A;  1Z56 A;  1N7S A;  5AVU B;  1RF1 C;  3KDP B;  3B5N B;  5AVQ B;  3RK3 C;  1CSB A;  1URQ B;  1LTJ C;  3LID A;  4M3L A;  1CI6 B;  1JOC A;  4N78 D;  1GW3 A;  1HGV A;  1SFC A;  2P2U A;  1FU1 A;  2N1T B;  3BAT A;  3OA7 A;  4EIJ A;  5APS A;  3KQG A;  2P1J A;  4ZKU A;  1T8Z A;  3VN0 A;  1ZN5 A;  3H32 B;  3KYQ A;  1L4A D;  5AVZ B;  1GD2 E;  2YKO A;  5KTB A;  2P67 A;  5AVY B;  2KB7 P;  3NXS A;  1NH4 A;  3U59 A;  2OYH B;  3VP9 A;  2XDJ A;  2FFD C;  1FZF A;  2HFE D;  1A02 F;  1VDF A;  4C7R A;  1LWU C;  1SLQ A;  2W6A A;  2Z5H A;  3HD7 B;  1S9K D;  2I1K A;  4W7Z A;  5APV A;  3B5N C;  1L4A A;  1LT9 A;  1G2C A;  1URQ C;  2HPC B;  4W7Y A;  3V2R A;  3OJA B;  2YKP A;  4C7N A;  2N1T C;  2C9N Y;  3U1C A;  1L0L K;  3BVH A;  3KPE A;  1T2K C;  4XE5 B;  4DOJ A;  1JMM A;  3A5T A;  1JTH B;  3MD0 A;  2JJL A;  5APQ A;  3V4W A;  2HLO A;  1H88 A;  3P32 A;  3P8C D;  5AW4 B;  5BU8 B;  1YYC A;  1JY2 P;  2HOD B;  2W6B A;  5BVZ A;  4GT1 A;  1IJD B;  1KFM A;  1NO4 A;  2OYH C;  1IK9 A;  3HE5 B;  1N73 A;  5KJ7 D;  1GL2 B;  1SP4 A;  1DH3 A;  1AFO A;  1X79 B;  3IR9 A;  1G1I A;  3HD7 C;  3HUS A;  3TYY A;  4C46 A;  2FYZ A;  1RF0 A;  1FZC A;  5CMZ A;  2FKW B;  2POH A;  3HRN A;  2A45 H;  1GTW A;  1HWT C;  1JO5 A;  2XU6 A;  1RF1 A;  1NWQ A;  5KJ7 A;  5CCG D;  3V5B A;  3A2A A;  2WT7 A;  2I1J A;  1KQL A;  1X8Y A;  4WY4 C;  2A45 I;  1IFN A;  5AVX B;  4JYC A;  1WT6 A;  1RE3 C;  3U1A A;  2WSC H;  3TNU B;  4N78 E;  1N86 A;  5APT A;  2H8P D;  3TK1 A;  3NMD A;  5CCG A;  1ZLL A;  1X9V A;  3IFM A;  1MUU A;  1RY3 A;  2BAS A;  1H89 A;  1JY2 O;  2W27 A;  2FFD A;  4I6M C;  2OYI A;  1SFC D;  1KFN A;  1FOS F;  3PP5 A;  3L35 A;  3OAK A;  1OWA A;  2GUV A;  3VOP A;  4LGD E;  3RK2 B;  1CI6 A;  2H7H A;  1NTZ K;  1NHL A;  1JY3 N;  1RE4 C;  2IX7 C;  1J2J B;  1W2E A;  3VTP C;  2YKQ A;  1MFZ A;  4W80 A;  4AYC A;  3H32 A;  1LTS C;  5APX A;  2IFM A;  3HTK B;  3R2P A;  1NTK K;  1FOS E;  3N7N A;  3P8C E;  3VMY A;  2HG5 D;  5AVR B;  3HE4 B;  2WSE H;  1J1E B;  2FXM A;  4N6J A;  3EQ2 A;  2Q5U A;  1GU5 A;  3M06 A;  1MV8 A;  3RK2 C;  2GM4 A;  1DEB A;  3M9H A;  2YO3 A;  2C0X A;  5CCH C;  2QM8 A;  1GDT A;  1E5W A;  1GL2 D;  2M8R A;  3RL0 B;  1GW4 A;  1NKZ B;  1M1J A;  2CPB A;  4ZKP A;  1CZQ A;  2JEE A;  1T3U A;  3GHG A;  2WPS A;  5BU5 A;  1MZ9 A;  3BRT B;  1RE3 A;  5APW A;  1NKN A;  3L36 A;  1FZG A;  1FZA A;  4WY4 B;  1M7L A;  1FBM A;  3HE5 A;  1GL2 A;  1XTC C;  1J1E C;  1FZB A;  3T97 A;  2O1K A;  3CI9 A;  1N7S C;  2A45 G;  1CW5 A;  4I2L C;  2YO2 A;  3RK3 D;  4IFD K;  1G2C B;  4JF7 A;  2E42 A;  1N2D C;  4WBA A;  1FJP A;  3M9Q A;  2OAR A;  3RL0 C;  1NOH A;  4GIF A;  1LTG C;  3C9I A;  5AW8 B;  2C9L Y;  4B86 A;  1SVF A;  2WPR A;  3VP8 A;  5AVW B;  3UIA A;  1HBW A;  2Z5I A;  1LTJ A;  1SQB K;  3H6P A;  1NU1 K;  1N73 B;  5CJ0 A;  3M91 A;  2L5G B;  3TNU A;  1FDM A;  3NTN A;  3RK2 D;  2P7J A;  3B5N D;  5CCH D;  2WTY A;  4Y99 B;  5CHX A;  1LT9 C;  1URQ D;  2Q7C A;  2QM7 A;  1NTM K;  2PAJ A;  2PP6 A;  1G1J A;  2N1T D;  5AW5 B;  1GK4 A;  1JCD A;  2J58 A;  5APY A;  2Q3I A;  1IFD A;  1T2K D;  2Q9I A;  1KIL B;  2IPP A;  2C0W A;  2KOG A;  1LWU A;  3M0D C;  3EFG A;  5AW2 B;  1LTB C;  3B5N A;  2NPS B;  5CCH A;  1ZV8 A;  1URQ A;  1SQQ K;  3BAS A;  3MTU E;  4N3Y B;  2R5B A;  1N7L A;  1JUN A;  1LTA C;  1N73 C;  2J59 M;  3M0A A;  1S9K E;  5KLV K;  2Z4E A;  1IO4 A;  2N1T A;  2LKM A;  3HD7 D;  1GU4 A;  3HUS C;  3II6 A;  1HVV A;  1RF0 C;  1FZC C;  1NAF A;  1SQV K;  4KHX A;  4WB4 A;  2YMY A;  4Y99 C;  2O01 H;  3VYI A;  2FYU K;  5AVT B;  3V2Q A;  2OYI B;  5AVS B;  2OYH A;  1HUC A;  4EOT A;  1ZR2 A;  1KZU B;  1GZL A;  5KJ7 C;  1KIL C;  2O1J A;  3V2P A;  1SQP K;  2ZFC A;  1YTZ T;  4XA4 A;  5AW6 B;  3HD7 A;  1N7S B;  4WY4 D;  1DX7 A;  1JY3 P;  2NPS C;  5AW0 B;  2HPC A;  1JCC A;  1HGZ A;  1SFC B;  3NFQ A;  3O8Z A;  2GUS A;  3G3Z A;  1SQX K;  1LTI C;  2E43 A;  5CCG C;  1J1D B;  3N4X A;  1HTL C;  5AW9 B;  3LIE A;  2XKM A;  1JTH A;  1FZE A;  1H8A A;  1A02 J;  5CJ4 A;  1L0N K;  2KLV A;  1HH0 A;  4WY4 A;  4DZO A;  2HOD A;  4AUW A;  1JY2 N;  2OYI C;  1FJK A;  4JYB A;  3I5C A;  3TSI A;  3MGN A;  5AW3 B;  4IFM A;  2VRS A;  2N9B A;  2WPQ A;  2WWW A;  1QL1 A;  4LC1 A;  4RES B;  5AW1 B;  1XTG B;  1IFM A;  3L4F A;  1L4A B;  1LT9 B;  5AVV B;  1SFC C;  1M1J B;  4C7N B;  3V2N A;  3M0D A;  2WSF H;  3V4Q A;  2KYV A;  3GHG B;  1JNM A;  1QL2 A;  1J1D C;  1PFI A;  2CPS A;  1LTT C;  4AQR D;  2XZR A;  3P7K A;  1KIL D;  3VMX A;  1JY3 O;  1OXZ A;  1RE4 A;  2ZXE B;  2HYN A;  4IFF A;  1WRG A;  3MUD A;  2NPS D;  1IC2 A;  2WZ7 A;  5APU A;  3HUS B;  2XV5 A;  1FZC B;  2KP8 A;  4GKG A;  2IFN A;  1L4A C;  1KIL A;  3LW5 H;  1LGH B;  3MIW A;  4OH8 B;  1M1J C;  4I1L A;  1VPC A;  2WIT A;  3A7O A;  3P8M C;  3GHG C;  3BRV B;  1RF1 B;  3E1I A;  2WT7 B;  2NPS A;  3M9B A;  3RK3 B;  4LLH A;  2H43 A;  2XNX A;  1LTJ B;  2R3C A;  1ZR4 A;  1FAV A;  4HYT B;  2KSJ A;  3SWY A;  1HJB A;  2YNY A;  3CLQ A;  3WMM 0;  1EQ7 A;  1GL2 C;  2R32 A;  2MJZ A;  4HH2 A;  1N7S D;  5AW7 B;  1IFJ A;  3L37 A;  3CL3 D;  1AQ5 A;  1GK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...