4IL6X

Structure of sr-substituted photosystem ii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 14
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4il6X00
1JB0J 2QJKC 2WSCJ 2E75B 4H0LB 1VF5B 1S5LX 4I7ZB 2WPVB 2K9YA 4IL6X 4Y28J 2YIUC 4OGQB 4KT0J 3C8VA 2QJYC 2QJPC 4H44B 2FYNC 2E74B 4H13B 2ZT9B 5KLIC 2WSFJ 4RKUJ 4PV1B 5KKZC 2D2CB 1Q90D 1ZRTE 2O01J 2QIWA 2WSEJ 2QSIA 2E76B 3LW5J 5L8RJ
chains in the Genus database with same CATH superfamily
3CCMP 1UIIA 1KC8Q 2BEQD 2QVAA 2E43A 1NTMJ 3AEFC 3GHGC 2H8PD 1L0LK 1BGYJ 1FZCC 2OYIA 2JO1A 2O1KA 1OFCX 4ZKPA 1JMMA 3BRTB 4LC1A 3U1CA 4IFDK 3V4QA 1SQXJ 1M1JC 3H1KD 1OMIA 1M8OB 2QJYB 1VQPP 4MN4C 4H44B 4N78D 2XV5A 2Y0EA 2IDBA 3E7KA 5APVA 2ZVOB 2IZ0A 3HD7B 2QM8A 3GMAA 2K37A 1IFDA 1N86A 2YO2A 4BWNA 3V2RA 1L0LD 4NPEA 1J1EC 1PP9D 2NPSC 1HVVA 1U7MA 1A02F 3LW5H 2OQQA 5GTIE 1LTJC 1FE6A 2P58A 1P84H 1SQVG 1P84D 3T97B 2BCCJ 1N8RQ 1LTSC 3A5TA 1KILA 3SFEC 4PJ0H 3U1AA 3HE4B 1CI6B 3G6EP 3HTKA 2N1TB 4HH2A 3RBXA 1NU1G 3H1JE 4GDOA 2VRSA 3SSUA 5TISH 2A45G 1NAFA 2E5TA 1RF1A 1X79B 2OYHC 1LT1A 1S5LX 3CD6P 1MKMA 3RGUA 4JPZB 2W6AA 2Q9IA 2AEJA 1N7LA 2WT7A 4CPGA 3L75D 2JJLA 3AE6C 1LGHB 2YXRB 1G1IA 1LP1A 1RH5B 3L70G 1SVFA 3KPEA 1NTZG 3A0HH 2CPBA 4W80A 2LKMA 3CCRP 2P67A 5E79H 2FKWB 5AW7B 1VL2A 3RK3E 1L2PA 1YHQP 1NO4A 5BU5A 2IBZG 2RH0A 1SQBG 3KYQA 1PV3A 2KS1A 5AVSB 1JO5A 2IBZI 2J5UA 2C9LY 4JYCA 3GLMA 1Y8AA 1SQVK 2KZIA 4H0LD 2YIUC 2M8RA 3CXHI 1KN7A 1JEKA 4U3FE 4L74A 1GW3A 2W83C 4K3AA 3KQGA 1FZFA 1PL5A 3A2AA 5KLVK 1K04A 3O8ZA 3L71G 3AE1C 3M0AA 3L72J 2ZYAA 4IOIH 5CCGC 2UWJE 4N3YB 1NU1K 2W90A 2IPPA 2PRRA 3F5HA 3MHVA 1HJ0A 3V2NA 1URQC 3TGUJ 1HH0A 3WU2E 1NTMG 4PV1D 1BGYG 1SQVD 2E76D 2QEXP 1SQXG 2FYUK 1N2DC 2W6BA 1VQ9P 1BCCD 1KD1Q 1JNMA 3L70E 3A7OA 5M1BA 1FZGA 1LWUB 3S1KA 1VDFA 3SFDC 1NTZK 5AW0B 1NWQA 3Q2YA 1ZV8A 3VMAA 1HUCA 1KMIZ 3L73E 3EWKA 2KNCB 1CSBA 3FXDA 2WT7B 5CJ4A 1NU1D 3CX5E 2A45H 1GW4A 1LTIC 3H1JJ 1SQBK 5APTA 2O01H 1LP1B 1AVOA 1BSHA 2D2CC 5AVTB 1GL2C 2I1KA 2KIKA 5AVQB 2Q3IA 1XTCC 3R2PA 2PAJA 2R44A 5KLIC 3TK1A 3L70D 5KAIE 3I56P 2KUBA 3D70A 3N7NA 1JTHB 1NTZD 2WSCH 4DZOA 2BCCG 1WT6A 5CMZA 4LGDE 5CJ0A 3CWBD 1NHLA 3FWLA 1R8EA 3NMDA 2QM7A 3WUUA 2E42A 3L71E 2IBZD 1ZRTD 2FFDA 1SQBD 4AQRD 3IF4A 2WPRA 3E1IA 3B5NC 4PD4E 3LIEA 4YXWH 3GG2A 1X8YA 2H89C 3CXHH 1NTMK 3L74J 3CXHD 1BGYE 5KAIH 3M06A 3P8CD 1SQXK 1FAVA 1BDCA 1RY3A 1USDA 1H8AA 1L0NE 3M0DA 1OW7A 3AEEC 4DJGA 4U3FJ 3Q5RA 1IC2A 4BXLA 2Y0CA 2WWWA 1JY2O 1RHZB 3L71D 2J58A 1IFPA 5KTBA 2POHA 4EOTA 2WZ7A 1UIXA 1RF0C 2KYVA 3P8MC 1NTMD 4UB6E 1BGYD 1N73B 5B66H 3CCLP 3V5BA 1SLQA 5C39A 1SQXD 4H0LB 1CW5A 1KYOE 5APWA 1ZMEC 2PGDA 1J1DB 2R32A 4YXDC 3H25A 1ZOYC 1X9VA 2QG4A 3A0BE 4HKZH 2ZT9B 2E74C 4NPDA 3RK3C 3CCQP 1AQTA 4R4MA 1IK9A 3L73J 1NTKE 4Y99C 5K5GB 3A3YB 3FGAD 5GTHH 1SFCC 2QJPC 2V4HA 3CMEP 3IR9A 4PV1B 3L72G 1Q86Q 2P1JA 2E76B 1GU4A 1EXIA 2QJKC 4JQ0D 3OW2O 3U59A 2HODB 3KXDA 3TGUG 1NJIQ 1EDJA 4GOEA 3V2QA 2FYNC 1DD3A 3HE4A 5BU8B 1CI6A 2BCCD 1OZHA 2V7QH 3HRNA 3QWOC 2OYHA 2N1TA 4JYBA 1T6AA 5AVUB 3S4RA 4GT1A 2KLVA 5KAFH 1FDMA 1YTZI 1QL1A 1LT9C 3RK2C 5AVZB 1D7MA 1ZP0C 3OAKA 1HWTC 1KILE 2ZFCA 1GDTA 4DOJA 2YO3A 3GHGB 1YJWP 3H1JG 5CCGD 4D6TE 3H32A 2RKLA 1FZCB 2Z5IA 2OTKE 1YIJP 1JMBA 1K8AQ 1IFIA 1KTMA 4RO0A 2Z5HA 3JCUH 3SWKA 3BRVB 1OVVA 1URQD 3HUSC 4IL6E 3GF7A 2ZT9C 1L4AC 1L0NJ 3SWFA 3V2PA 3CCUP 5AW8B 1H88A 3C9IA 3AEDC 3Q1MA 3CL3D 5KJ7C 1MUUA 4I2LC 4IFFA 3D6YA 4C7RA 2JWAA 4OVNF 2WPQA 3F89A 4EIJA 4L73A 1QX8A 4GOFA 3AEGC 2K9YA 3B71A 2B88A 1FZEA 1KQGB 3L72E 3MD0A 1HGZA 1J1EB 3JSVC 1R5SA 3V4WA 4C7NB 1EDIA 4IL6H 1LTTC 4N6JA 3PTZA 2WITA 3TGUE 2D2CD 1GL2D 3L74G 1GD2E 3AE8C 1G2CB 1T3JA 5CCGA 4KT0J 4WY4C 3TNUB 3CCEP 1FS0E 5B5EE 3EFFK 2GA1A 1SS1A 1URQA 2P7JA 1PIXA 2V7QJ 4U3FG 1NTKJ 1VQ7P 2HR3A 1LTBC 3WMM0 4HJGH 3L72D 2B9BA 1OVRA 3PP5A 2P2UA 2W6JH 3PRJA 1KORA 1DIPA 3RL0C 2OYHB 2PP6A 1KQFB 3TGUD 4OWFA 1YTZT 5GTIH 1LWUA 1YBKA 1FOSE 2GUVA 4DT0A 3B5ND 1VF5C 2ZYGA 2A45I 2N9BA 2KNCA 3RL0g 3PHLA 1DEEG 3VOPA 5CCHC 3I5CA 1IFJA 2KLUA 1KV4A 1GL2A 1Z56A 1YI2P 1HF9A 4M3LA 3H32B 2KSEA 2QE7H 4OGQC 2E5YA 2N9YB 1S9KE 2XU6A 2W27A 1M1KQ 2I1JA 1OVUA 3L73G 2J59M 2IZ1A 3H1JD 2MJZA 4D6TJ 1JTHA 1RE4A 2OYIC 1ZLLA 5BVZA 4R4LA 2Q1KA 3L74E 4ASWA 3H1HE 1LJ2A 2QRXA 3IFMA 3IN6A 2YIUB 3AE3C 1EXJA 3GF3A 1M7LA 2HLOA 2B87B 3MUDA 1M90Q 3H1LE 3RBZA 3RK3D 3L4FA 2XKMA 3BASA 1IO4A 3HE5A 5CBOA 1SFCD 1URQB 2KK7A 4BRYA 3L74D 3TDKA 4ZNCA 1LTGC 3PH0A 2R5BA 1IZNB 2KZJA 1W2BO 5AW6B 1JCCA 3MZWB 4PD4I 1RF0A 2E75C 1EZVG 5CHXA 1KFNA 3IAOA 1JCDA 1OIPA 4B86A 1PGJA 4U3FD 2O1JA 1L0NG 4XFJA 2JKVA 1IFMA 1KILC 5APYA 1BE3J 1N73A 2XNDH 1T2KC 1NGMB 1GK4A 5AW4B 1IJDB 3C8VA 3AE7C 1FBMA 1FZBA 3RK2D 1AJYA 2OYOA 2D2CB 2ZVNB 1GL2B 3WU2H 1JB0J 1RF1C 3BATA 1K9MQ 1M56D 2ZXXA 1GZLA 1K05A 1SFCA 5KLIB 3CI9A 4GODA 2A06E 4NPFX 3AEBC 3NFQA 2QSIA 2JP3A 1YYCA 5H2FE 1L4AD 1VQ8P 3D71A 4GKGA 1PZQA 3L73D 2PFXA 2YKPA 2FXMA 1KQSO 3CX5H 4I7ZC 1VQ4P 1NYHA 3CX5D 2HODA 1JM0A 1NTKG 5KJ7D 3P7KA 2K9JB 1E79H 3P32A 2Q3EA 3VN0A 3B5NB 1H89A 2FYZA 4I6MC 5AVRB 1VPCA 5EFWB 2CPSA 3VP9A 3BVHA 2NZ2A 1JY3N 1VQ6P 1SQQG 2Q6QA 3L35A 3H1HJ 1OX3A 2WSEJ 2NPSD 4IFMA 5AW9B 1EZVE 1ZN5A 1RQVA 4WB4A 3Q5SA 1L0NK 3HE5B 4W7ZA 1MFZA 4WY4D 1HBWA 4BRYB 3GHGA 1A02J 3KDPB 4XE5B 1FZCA 3H1LJ 2WSSH 2LXBA 1AFOA 2Y9YA 2AXCA 1M1JA 3M9QA 1L4AA 1SP4A 2IX7C 2YXQB 1Q81Q 4PD4H 2FXPA 4PD4D 4GIFA 1BCCJ 5KJ7A 4Z1MH 4AUWA 4D6TG 4RJTA 5KLVJ 1EZVD 1S4XA 4OH8B 4EI2A 1S1CX 3R4YA 1DD4A 1L0ND 1FJPA 4RESB 3V6IA 1U57A 1T3UA 1USEA 3RK3B 5CCHD 1KZUB 2NPSA 1SQPE 1S5LE 4XA4A 2XZRA 4C7NA 1VQLP 4Y99B 1VQKP 1NH4A 2IYOA 1PGQA 5APSA 3G3ZA 2L5GB 5APQA 1NTKK 3M91A 1LTJA 4OGQD 3M9BA 1AQ5A 1SFCB 2QJPB 4Y28J 2FYUJ 4C46A 2BASA 4WY4A 3H1IJ 1G2CA 3GW6A 2R3SA 3N4XA 1OWAA 3G71P 4UB6H 2FY8A 3TNUA 1PPJE 2QJKB 1QVGO 5KKZC 1N7SC 1KYOH 1KYOD 3CWBJ 2C9NY 1W5CE 1SQQE 2FYNB 3VYIA 2DW3A 3BCCJ 3A0BH 2NRGA 1S5LH 1Y9BA 2WSFJ 4H13C 3AEAC 4PV1C 2KI7B 3D6ZA 2E76C 1OW8A 2H7HA 1NTKD 1YJ9P 2YNYA 2HYNA 1LT9B 3MIWA 1IFNA 3RK2B 2AEMA 1BE3G 2O3JA 2QIWA 2FFDC 1MZ9A 4QMAA 2GM4A 2M5AB 1VQMP 1W2EA 4N78E 3HUSB 4O9BA 3FX0A 2FXOA 1M1JB 1L4AB 1NKNA 3CCSP 3LIDA 3G9RA 1VQNP 2IFNA 2R5DA 3KHUA 3AECC 3M0DC 2Y0DA 2E75D 1CZQA 2YMYA 1AV1A 1L0LE 1OXZA 3NXSA 1LNQA 1YQ4C 1PP9E 4YPCA 2K1AA 3AE4C 1TU3F 3B4SA 1KILD 2LXCB 2XNXA 1HJBA 5AVVB 1T2KD 1EQ7A 4D6TD 1FU1A 2QJYC 3KZIE 1S72P 1MV8A 2XDJA 1P84E 2NPSB 4ZMDA 3MTUE 4H44C 1PFIA 1EDKA 2B87A 2JR8A 4PJ0E 1LTJB 3VMZA 4WY4B 2HFED 2IFMA 3H1HG 3HD7C 1QLED 3OJAB 1U7JA 5TJHA 1SQPJ 5AVWB 2HPCB 3AE9C 2G8YA 2OTLP 3WUTA 2OARA 2ZXEB 1JY3P 5TISE 2QA4P 5AVYB 1BE3E 1KB9E 3H1LG 1JUNA 1GTWA 3KZIH 2KXPB 4W7YA 3ITKA 3RL0B 1NVOA 3L75E 2YMKA 2I8DA 3TYYA 1BCCG 2KB7P 1VF5B 1SQQJ 3AE2C 4U7JA 1VQ5P 2P10A 1H0TB 5KLVG 2Z4EA 5AVXB 3A0HE 5B5EH 3MP7B 5E79E 1DEBA 4OGQB 1ZR2A 2N1TC 1BE3D 3TSIA 1KB9H 1VQOP 1KB9D 3JC22 3G4SP 3CCJP 1ZW0A 4DCKA 1NOHA 1PGPA 1Y47A 1RE3C 3W68A 2FYUG 3H1KJ 1FZAA 3H1IG 3FXEA 4JF7A 4KHXA 2H88C 3CX5I 2OYIB 3W67A 3VMYA 2O01N 3USSA 3CWBG 1Q90D 1ZXGA 1GMJA 3BCCG 2K9JA 2A06G 3B5NA 1S9KD 1Q2NA 1L0LJ 5APUA 1PP9J 1XTGB 1K73Q 2C0XA 3E1RA 1FJKA 4WBAA 2E74D 3LW5J 3Q3DA 1GK6A 1ZR4A 4HYTB 1SQVE 3CC4P 3OA7A 1JY2N 1Q82Q 2KSJA 1BCCE 5AW5B 2WTYA 3WUVA 3M9HA 2ZYDA 3H1HD 2WSEH 4WVZA 1N7SD 5KLVE 2E75B 1WMKA 4ZKUA 1BDDA 4I1LA 4IL6X 3L36A 1NU1E 3CLQA 2K3RA 1KILB 1MFTA 4RKUJ 1EZVI 2KP8A 3K5BA 3H1LD 4H13D 5L8RJ 3Q5PA 2RN0A 2FBWC 1S3JA 3MGNA 1X0TA 3HTKB 2FYUE 1QEXA 4AYCA 1KFMA 2M3BA 3H1IE 1FDOA 3L75J 1RF1B 2SPZA 4EDFA 3CC2P 1NTZE 1IK7A 5APXA 5KLVD 1LWUC 4JBZA 1YQ3C 3CWBE 2R3CA 4EYYQ 5AW3B 3BCCE 2IBZE 1ZRTE 1SQBE 1N7SA 1KYOI 1HGVA 4A7PA 2ZT9D 1SQPG 4I7ZB 2WPVB 1EC5A 2WVRA 3EFGA 1BSNA 2L91A 1FDIA 2FYUD 3VTPC 2OTJP 2WQYC 3H1ID 2H43A 3CPWO 2RMZA 3CXHE 3CC7P 1DX7A 2BEZF 3C1LA 3P8CE 3O6QA 2Q5UA 4ASVA 1PPJG 3UIAA 3L37A 2KS1B 5DJUB 1Q7YQ 3II6A 1RE4C 1LT9A 5CBNA 3BCCD 2A06D 1R5LA 2JWDA 4H44D 2WSFH 2ZJSE 2YKOA 5H2FH 3QH9A 4UB8E 3VMXA 3HD7D 3NTNA 2M5AA 4K35A 4L76A 2W8ZA 2M3EA 1NTME 2CK3H 2KOGA 3MUDC 2Y9ZA 1GU5A 3ABVC 5B66E 3HUSA 1G1JA 1SQXE 1SQVJ 2AXTE 4YTPC 2B89A 4LLHA 3H1KG 1OW6A 1QGKB 2YKQA 2AEFA 1X22A 1NKZB 2G3AA 4UB8H 3RL0D 3AE5C 1AA0A 2ZAEB 3H6PA 1KQLA 1DH3A 2M0BA 3CCVP 1NU1J 3EQ2A 1JOCA 1VF5D 5GTHE 2E74B 1EDLA 2WPSA 1SQPK 2O01J 2IYPA 2AXTH 1E5WA 5AW1B 1L0LG 1N73C 2N1TD 1PP9G 1YITP 3HD7A 4H0LC 3VP8A 3TF5A 1J1DC 1HTLC 5KKZB 3B8EB 1NAYA 3L70J 2LR2A 1N7SB 2BCCE 1T8ZA 1NTZJ 2K88A 1QVFO 2WSCJ 2HPCA 2ITAA 1PGOA 1SQQK 4KJMA 2Q7CA 4HB1A 1P84I 5KAFE 2OGUA 2JEEA 4H13B 4L75A 1AVYA 3O6QB 1S2EA 1SQBJ 1JY2P 2HG5D 3T97A 1SQPD 3ZDMA 2JDIH 3I55P 3FWNA 3CMAP 2GUSA 3S9OA 2C0WA 1H0TA 3JCUE 2FFDB 5CCHA 1PPJD 3PLNA 1QL2A 4WWIA 3PJSK 3SWYA 1LTAC 2WMMA 1KB9I 3H1KE 1WRGA 2MKVA 3L75G 1RQUA 1SQQD 5AW2B 1M57D 1J2JB 3L71J 1FOSF 1FC2C 5DJTB 4TT3H 1YJNP 1RE3A 1JY3O 4TLFA
chains in the Genus database with same CATH topology
1RQVA 2D2CC 2E75B 2D2CD 1WMKA 3Q5SA 3AE8C 2BEQD 1NGMB 4H0LC 4IL6X 4H0LD 1UIXA 2YIUC 4KT0J 3C8VA 2QJYC 3AE7C 3AEFC 2JO1A 5KLIC 1Y9BA 4R4LA 2WSFJ 4RKUJ 1AJYA 1PIXA 1ZP0C 2D2CB 4H44C 4H44D 4H13C 3AEAC 1KILE 4GDOA 4H13D 2V7QJ 5L8RJ 3D70A 4PV1C 1PL5A 1JB0J 3Q5PA 2WSCJ 4H0LB 3D6ZA 3IN6A 1K04A 2E76C 1OW8A 1OMIA 3AE3C 1S5LX 1ZMEC 1MKMA 2FBWC 2H88C 3AE1C 1EXJA 2FXPA 3GF3A 4YXDC 1K05A 3H25A 1KTMA 1ZOYC 4H44B 4H13B 1R8EA 1FDOA 4Z1MH 1KORA 1HJ0A 2E74C 1DIPA 3AEBC 2IDBA 1Q90D 2QIWA 3AE9C 2G8YA 3ABVC 2QSIA 2JP3A 1KQFB 3GF7A 1IK7A 1GMJA 3AE6C 4PV1D 4YTPC 4R4MA 2ZT9C 3D71A 1S1CX 2E76D 3GMAA 3R4YA 1DD4A 1YQ3C 1VF5C 3FGAD 3AEDC 4I7ZC 1U57A 1NYHA 3Q1MA 1OW6A 2QJPC 2H89C 3S9OA 3RL0g 3D6YA 4PV1B 1VL2A 1ZRTE 2G3AA 2E74D 5M1BA 2YMKA 2E76B 3RK3E 1EXIA 3LW5J 3AE5C 3Q3DA 3SFDC 2QJKC 3G9RA 2OQQA 1HF9A 1VF5B 3Q2YA 2ZT9D 3AE2C 4OGQC 3AEGC 4OGQD 4I7ZB 2MKVA 3AECC 1KMIZ 2K9YA 2WPVB 1OW7A 3EWKA 2E75C 3AEEC 1RQUA 2E75D 3B71A 4U7JA 4Y28J 3IAOA 1FDIA 2P10A 1KQGB 3Q5RA 1VF5D 2WQYC 1PV3A 2NZ2A 2FYNC 2E74B 1DD3A 3T97B 2J5UA 4TT3H 1YQ4C 4XFJA 2BEZF 3AE4C 1TU3F 5KKZC 2O01J 2WSEJ 3O6QA 3SFEC 2ZT9B 4OGQB 3GLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB0 J;  2QJK C;  2WSC J;  2E75 B;  4H0L B;  1VF5 B;  1S5L X;  4I7Z B;  2WPV B;  2K9Y A;  4IL6 X;  4Y28 J;  2YIU C;  4OGQ B;  4KT0 J;  3C8V A;  2QJY C;  2QJP C;  4H44 B;  2FYN C;  2E74 B;  4H13 B;  2ZT9 B;  5KLI C;  2WSF J;  4RKU J;  4PV1 B;  5KKZ C;  2D2C B;  1Q90 D;  1ZRT E;  2O01 J;  2QIW A;  2WSE J;  2QSI A;  2E76 B;  3LW5 J;  5L8R J; 
#chains in the Genus database with same CATH topology
 3CCM P;  1UII A;  1KC8 Q;  2BEQ D;  2QVA A;  2E43 A;  1NTM J;  3AEF C;  3GHG C;  2H8P D;  1L0L K;  1BGY J;  1FZC C;  2OYI A;  2JO1 A;  2O1K A;  1OFC X;  4ZKP A;  1JMM A;  3BRT B;  4LC1 A;  3U1C A;  4IFD K;  3V4Q A;  1SQX J;  1M1J C;  3H1K D;  1OMI A;  1M8O B;  2QJY B;  1VQP P;  4MN4 C;  4H44 B;  4N78 D;  2XV5 A;  2Y0E A;  2IDB A;  3E7K A;  5APV A;  2ZVO B;  2IZ0 A;  3HD7 B;  2QM8 A;  3GMA A;  2K37 A;  1IFD A;  1N86 A;  2YO2 A;  4BWN A;  3V2R A;  1L0L D;  4NPE A;  1J1E C;  1PP9 D;  2NPS C;  1HVV A;  1U7M A;  1A02 F;  3LW5 H;  2OQQ A;  5GTI E;  1LTJ C;  1FE6 A;  2P58 A;  1P84 H;  1SQV G;  1P84 D;  3T97 B;  2BCC J;  1N8R Q;  1LTS C;  3A5T A;  1KIL A;  3SFE C;  4PJ0 H;  3U1A A;  3HE4 B;  1CI6 B;  3G6E P;  3HTK A;  2N1T B;  4HH2 A;  3RBX A;  1NU1 G;  3H1J E;  4GDO A;  2VRS A;  3SSU A;  5TIS H;  2A45 G;  1NAF A;  2E5T A;  1RF1 A;  1X79 B;  2OYH C;  1LT1 A;  1S5L X;  3CD6 P;  1MKM A;  3RGU A;  4JPZ B;  2W6A A;  2Q9I A;  2AEJ A;  1N7L A;  2WT7 A;  4CPG A;  3L75 D;  2JJL A;  3AE6 C;  1LGH B;  2YXR B;  1G1I A;  1LP1 A;  1RH5 B;  3L70 G;  1SVF A;  3KPE A;  1NTZ G;  3A0H H;  2CPB A;  4W80 A;  2LKM A;  3CCR P;  2P67 A;  5E79 H;  2FKW B;  5AW7 B;  1VL2 A;  3RK3 E;  1L2P A;  1YHQ P;  1NO4 A;  5BU5 A;  2IBZ G;  2RH0 A;  1SQB G;  3KYQ A;  1PV3 A;  2KS1 A;  5AVS B;  1JO5 A;  2IBZ I;  2J5U A;  2C9L Y;  4JYC A;  3GLM A;  1Y8A A;  1SQV K;  2KZI A;  4H0L D;  2YIU C;  2M8R A;  3CXH I;  1KN7 A;  1JEK A;  4U3F E;  4L74 A;  1GW3 A;  2W83 C;  4K3A A;  3KQG A;  1FZF A;  1PL5 A;  3A2A A;  5KLV K;  1K04 A;  3O8Z A;  3L71 G;  3AE1 C;  3M0A A;  3L72 J;  2ZYA A;  4IOI H;  5CCG C;  2UWJ E;  4N3Y B;  1NU1 K;  2W90 A;  2IPP A;  2PRR A;  3F5H A;  3MHV A;  1HJ0 A;  3V2N A;  1URQ C;  3TGU J;  1HH0 A;  3WU2 E;  1NTM G;  4PV1 D;  1BGY G;  1SQV D;  2E76 D;  2QEX P;  1SQX G;  2FYU K;  1N2D C;  2W6B A;  1VQ9 P;  1BCC D;  1KD1 Q;  1JNM A;  3L70 E;  3A7O A;  5M1B A;  1FZG A;  1LWU B;  3S1K A;  1VDF A;  3SFD C;  1NTZ K;  5AW0 B;  1NWQ A;  3Q2Y A;  1ZV8 A;  3VMA A;  1HUC A;  1KMI Z;  3L73 E;  3EWK A;  2KNC B;  1CSB A;  3FXD A;  2WT7 B;  5CJ4 A;  1NU1 D;  3CX5 E;  2A45 H;  1GW4 A;  1LTI C;  3H1J J;  1SQB K;  5APT A;  2O01 H;  1LP1 B;  1AVO A;  1BSH A;  2D2C C;  5AVT B;  1GL2 C;  2I1K A;  2KIK A;  5AVQ B;  2Q3I A;  1XTC C;  3R2P A;  2PAJ A;  2R44 A;  5KLI C;  3TK1 A;  3L70 D;  5KAI E;  3I56 P;  2KUB A;  3D70 A;  3N7N A;  1JTH B;  1NTZ D;  2WSC H;  4DZO A;  2BCC G;  1WT6 A;  5CMZ A;  4LGD E;  5CJ0 A;  3CWB D;  1NHL A;  3FWL A;  1R8E A;  3NMD A;  2QM7 A;  3WUU A;  2E42 A;  3L71 E;  2IBZ D;  1ZRT D;  2FFD A;  1SQB D;  4AQR D;  3IF4 A;  2WPR A;  3E1I A;  3B5N C;  4PD4 E;  3LIE A;  4YXW H;  3GG2 A;  1X8Y A;  2H89 C;  3CXH H;  1NTM K;  3L74 J;  3CXH D;  1BGY E;  5KAI H;  3M06 A;  3P8C D;  1SQX K;  1FAV A;  1BDC A;  1RY3 A;  1USD A;  1H8A A;  1L0N E;  3M0D A;  1OW7 A;  3AEE C;  4DJG A;  4U3F J;  3Q5R A;  1IC2 A;  4BXL A;  2Y0C A;  2WWW A;  1JY2 O;  1RHZ B;  3L71 D;  2J58 A;  1IFP A;  5KTB A;  2POH A;  4EOT A;  2WZ7 A;  1UIX A;  1RF0 C;  2KYV A;  3P8M C;  1NTM D;  4UB6 E;  1BGY D;  1N73 B;  5B66 H;  3CCL P;  3V5B A;  1SLQ A;  5C39 A;  1SQX D;  4H0L B;  1CW5 A;  1KYO E;  5APW A;  1ZME C;  2PGD A;  1J1D B;  2R32 A;  4YXD C;  3H25 A;  1ZOY C;  1X9V A;  2QG4 A;  3A0B E;  4HKZ H;  2ZT9 B;  2E74 C;  4NPD A;  3RK3 C;  3CCQ P;  1AQT A;  4R4M A;  1IK9 A;  3L73 J;  1NTK E;  4Y99 C;  5K5G B;  3A3Y B;  3FGA D;  5GTH H;  1SFC C;  2QJP C;  2V4H A;  3CME P;  3IR9 A;  4PV1 B;  3L72 G;  1Q86 Q;  2P1J A;  2E76 B;  1GU4 A;  1EXI A;  2QJK C;  4JQ0 D;  3OW2 O;  3U59 A;  2HOD B;  3KXD A;  3TGU G;  1NJI Q;  1EDJ A;  4GOE A;  3V2Q A;  2FYN C;  1DD3 A;  3HE4 A;  5BU8 B;  1CI6 A;  2BCC D;  1OZH A;  2V7Q H;  3HRN A;  3QWO C;  2OYH A;  2N1T A;  4JYB A;  1T6A A;  5AVU B;  3S4R A;  4GT1 A;  2KLV A;  5KAF H;  1FDM A;  1YTZ I;  1QL1 A;  1LT9 C;  3RK2 C;  5AVZ B;  1D7M A;  1ZP0 C;  3OAK A;  1HWT C;  1KIL E;  2ZFC A;  1GDT A;  4DOJ A;  2YO3 A;  3GHG B;  1YJW P;  3H1J G;  5CCG D;  4D6T E;  3H32 A;  2RKL A;  1FZC B;  2Z5I A;  2OTK E;  1YIJ P;  1JMB A;  1K8A Q;  1IFI A;  1KTM A;  4RO0 A;  2Z5H A;  3JCU H;  3SWK A;  3BRV B;  1OVV A;  1URQ D;  3HUS C;  4IL6 E;  3GF7 A;  2ZT9 C;  1L4A C;  1L0N J;  3SWF A;  3V2P A;  3CCU P;  5AW8 B;  1H88 A;  3C9I A;  3AED C;  3Q1M A;  3CL3 D;  5KJ7 C;  1MUU A;  4I2L C;  4IFF A;  3D6Y A;  4C7R A;  2JWA A;  4OVN F;  2WPQ A;  3F89 A;  4EIJ A;  4L73 A;  1QX8 A;  4GOF A;  3AEG C;  2K9Y A;  3B71 A;  2B88 A;  1FZE A;  1KQG B;  3L72 E;  3MD0 A;  1HGZ A;  1J1E B;  3JSV C;  1R5S A;  3V4W A;  4C7N B;  1EDI A;  4IL6 H;  1LTT C;  4N6J A;  3PTZ A;  2WIT A;  3TGU E;  2D2C D;  1GL2 D;  3L74 G;  1GD2 E;  3AE8 C;  1G2C B;  1T3J A;  5CCG A;  4KT0 J;  4WY4 C;  3TNU B;  3CCE P;  1FS0 E;  5B5E E;  3EFF K;  2GA1 A;  1SS1 A;  1URQ A;  2P7J A;  1PIX A;  2V7Q J;  4U3F G;  1NTK J;  1VQ7 P;  2HR3 A;  1LTB C;  3WMM 0;  4HJG H;  3L72 D;  2B9B A;  1OVR A;  3PP5 A;  2P2U A;  2W6J H;  3PRJ A;  1KOR A;  1DIP A;  3RL0 C;  2OYH B;  2PP6 A;  1KQF B;  3TGU D;  4OWF A;  1YTZ T;  5GTI H;  1LWU A;  1YBK A;  1FOS E;  2GUV A;  4DT0 A;  3B5N D;  1VF5 C;  2ZYG A;  2A45 I;  2N9B A;  2KNC A;  3RL0 g;  3PHL A;  1DEE G;  3VOP A;  5CCH C;  3I5C A;  1IFJ A;  2KLU A;  1KV4 A;  1GL2 A;  1Z56 A;  1YI2 P;  1HF9 A;  4M3L A;  3H32 B;  2KSE A;  2QE7 H;  4OGQ C;  2E5Y A;  2N9Y B;  1S9K E;  2XU6 A;  2W27 A;  1M1K Q;  2I1J A;  1OVU A;  3L73 G;  2J59 M;  2IZ1 A;  3H1J D;  2MJZ A;  4D6T J;  1JTH A;  1RE4 A;  2OYI C;  1ZLL A;  5BVZ A;  4R4L A;  2Q1K A;  3L74 E;  4ASW A;  3H1H E;  1LJ2 A;  2QRX A;  3IFM A;  3IN6 A;  2YIU B;  3AE3 C;  1EXJ A;  3GF3 A;  1M7L A;  2HLO A;  2B87 B;  3MUD A;  1M90 Q;  3H1L E;  3RBZ A;  3RK3 D;  3L4F A;  2XKM A;  3BAS A;  1IO4 A;  3HE5 A;  5CBO A;  1SFC D;  1URQ B;  2KK7 A;  4BRY A;  3L74 D;  3TDK A;  4ZNC A;  1LTG C;  3PH0 A;  2R5B A;  1IZN B;  2KZJ A;  1W2B O;  5AW6 B;  1JCC A;  3MZW B;  4PD4 I;  1RF0 A;  2E75 C;  1EZV G;  5CHX A;  1KFN A;  3IAO A;  1JCD A;  1OIP A;  4B86 A;  1PGJ A;  4U3F D;  2O1J A;  1L0N G;  4XFJ A;  2JKV A;  1IFM A;  1KIL C;  5APY A;  1BE3 J;  1N73 A;  2XND H;  1T2K C;  1NGM B;  1GK4 A;  5AW4 B;  1IJD B;  3C8V A;  3AE7 C;  1FBM A;  1FZB A;  3RK2 D;  1AJY A;  2OYO A;  2D2C B;  2ZVN B;  1GL2 B;  3WU2 H;  1JB0 J;  1RF1 C;  3BAT A;  1K9M Q;  1M56 D;  2ZXX A;  1GZL A;  1K05 A;  1SFC A;  5KLI B;  3CI9 A;  4GOD A;  2A06 E;  4NPF X;  3AEB C;  3NFQ A;  2QSI A;  2JP3 A;  1YYC A;  5H2F E;  1L4A D;  1VQ8 P;  3D71 A;  4GKG A;  1PZQ A;  3L73 D;  2PFX A;  2YKP A;  2FXM A;  1KQS O;  3CX5 H;  4I7Z C;  1VQ4 P;  1NYH A;  3CX5 D;  2HOD A;  1JM0 A;  1NTK G;  5KJ7 D;  3P7K A;  2K9J B;  1E79 H;  3P32 A;  2Q3E A;  3VN0 A;  3B5N B;  1H89 A;  2FYZ A;  4I6M C;  5AVR B;  1VPC A;  5EFW B;  2CPS A;  3VP9 A;  3BVH A;  2NZ2 A;  1JY3 N;  1VQ6 P;  1SQQ G;  2Q6Q A;  3L35 A;  3H1H J;  1OX3 A;  2WSE J;  2NPS D;  4IFM A;  5AW9 B;  1EZV E;  1ZN5 A;  1RQV A;  4WB4 A;  3Q5S A;  1L0N K;  3HE5 B;  4W7Z A;  1MFZ A;  4WY4 D;  1HBW A;  4BRY B;  3GHG A;  1A02 J;  3KDP B;  4XE5 B;  1FZC A;  3H1L J;  2WSS H;  2LXB A;  1AFO A;  2Y9Y A;  2AXC A;  1M1J A;  3M9Q A;  1L4A A;  1SP4 A;  2IX7 C;  2YXQ B;  1Q81 Q;  4PD4 H;  2FXP A;  4PD4 D;  4GIF A;  1BCC J;  5KJ7 A;  4Z1M H;  4AUW A;  4D6T G;  4RJT A;  5KLV J;  1EZV D;  1S4X A;  4OH8 B;  4EI2 A;  1S1C X;  3R4Y A;  1DD4 A;  1L0N D;  1FJP A;  4RES B;  3V6I A;  1U57 A;  1T3U A;  1USE A;  3RK3 B;  5CCH D;  1KZU B;  2NPS A;  1SQP E;  1S5L E;  4XA4 A;  2XZR A;  4C7N A;  1VQL P;  4Y99 B;  1VQK P;  1NH4 A;  2IYO A;  1PGQ A;  5APS A;  3G3Z A;  2L5G B;  5APQ A;  1NTK K;  3M91 A;  1LTJ A;  4OGQ D;  3M9B A;  1AQ5 A;  1SFC B;  2QJP B;  4Y28 J;  2FYU J;  4C46 A;  2BAS A;  4WY4 A;  3H1I J;  1G2C A;  3GW6 A;  2R3S A;  3N4X A;  1OWA A;  3G71 P;  4UB6 H;  2FY8 A;  3TNU A;  1PPJ E;  2QJK B;  1QVG O;  5KKZ C;  1N7S C;  1KYO H;  1KYO D;  3CWB J;  2C9N Y;  1W5C E;  1SQQ E;  2FYN B;  3VYI A;  2DW3 A;  3BCC J;  3A0B H;  2NRG A;  1S5L H;  1Y9B A;  2WSF J;  4H13 C;  3AEA C;  4PV1 C;  2KI7 B;  3D6Z A;  2E76 C;  1OW8 A;  2H7H A;  1NTK D;  1YJ9 P;  2YNY A;  2HYN A;  1LT9 B;  3MIW A;  1IFN A;  3RK2 B;  2AEM A;  1BE3 G;  2O3J A;  2QIW A;  2FFD C;  1MZ9 A;  4QMA A;  2GM4 A;  2M5A B;  1VQM P;  1W2E A;  4N78 E;  3HUS B;  4O9B A;  3FX0 A;  2FXO A;  1M1J B;  1L4A B;  1NKN A;  3CCS P;  3LID A;  3G9R A;  1VQN P;  2IFN A;  2R5D A;  3KHU A;  3AEC C;  3M0D C;  2Y0D A;  2E75 D;  1CZQ A;  2YMY A;  1AV1 A;  1L0L E;  1OXZ A;  3NXS A;  1LNQ A;  1YQ4 C;  1PP9 E;  4YPC A;  2K1A A;  3AE4 C;  1TU3 F;  3B4S A;  1KIL D;  2LXC B;  2XNX A;  1HJB A;  5AVV B;  1T2K D;  1EQ7 A;  4D6T D;  1FU1 A;  2QJY C;  3KZI E;  1S72 P;  1MV8 A;  2XDJ A;  1P84 E;  2NPS B;  4ZMD A;  3MTU E;  4H44 C;  1PFI A;  1EDK A;  2B87 A;  2JR8 A;  4PJ0 E;  1LTJ B;  3VMZ A;  4WY4 B;  2HFE D;  2IFM A;  3H1H G;  3HD7 C;  1QLE D;  3OJA B;  1U7J A;  5TJH A;  1SQP J;  5AVW B;  2HPC B;  3AE9 C;  2G8Y A;  2OTL P;  3WUT A;  2OAR A;  2ZXE B;  1JY3 P;  5TIS E;  2QA4 P;  5AVY B;  1BE3 E;  1KB9 E;  3H1L G;  1JUN A;  1GTW A;  3KZI H;  2KXP B;  4W7Y A;  3ITK A;  3RL0 B;  1NVO A;  3L75 E;  2YMK A;  2I8D A;  3TYY A;  1BCC G;  2KB7 P;  1VF5 B;  1SQQ J;  3AE2 C;  4U7J A;  1VQ5 P;  2P10 A;  1H0T B;  5KLV G;  2Z4E A;  5AVX B;  3A0H E;  5B5E H;  3MP7 B;  5E79 E;  1DEB A;  4OGQ B;  1ZR2 A;  2N1T C;  1BE3 D;  3TSI A;  1KB9 H;  1VQO P;  1KB9 D;  3JC2 2;  3G4S P;  3CCJ P;  1ZW0 A;  4DCK A;  1NOH A;  1PGP A;  1Y47 A;  1RE3 C;  3W68 A;  2FYU G;  3H1K J;  1FZA A;  3H1I G;  3FXE A;  4JF7 A;  4KHX A;  2H88 C;  3CX5 I;  2OYI B;  3W67 A;  3VMY A;  2O01 N;  3USS A;  3CWB G;  1Q90 D;  1ZXG A;  1GMJ A;  3BCC G;  2K9J A;  2A06 G;  3B5N A;  1S9K D;  1Q2N A;  1L0L J;  5APU A;  1PP9 J;  1XTG B;  1K73 Q;  2C0X A;  3E1R A;  1FJK A;  4WBA A;  2E74 D;  3LW5 J;  3Q3D A;  1GK6 A;  1ZR4 A;  4HYT B;  1SQV E;  3CC4 P;  3OA7 A;  1JY2 N;  1Q82 Q;  2KSJ A;  1BCC E;  5AW5 B;  2WTY A;  3WUV A;  3M9H A;  2ZYD A;  3H1H D;  2WSE H;  4WVZ A;  1N7S D;  5KLV E;  2E75 B;  1WMK A;  4ZKU A;  1BDD A;  4I1L A;  4IL6 X;  3L36 A;  1NU1 E;  3CLQ A;  2K3R A;  1KIL B;  1MFT A;  4RKU J;  1EZV I;  2KP8 A;  3K5B A;  3H1L D;  4H13 D;  5L8R J;  3Q5P A;  2RN0 A;  2FBW C;  1S3J A;  3MGN A;  1X0T A;  3HTK B;  2FYU E;  1QEX A;  4AYC A;  1KFM A;  2M3B A;  3H1I E;  1FDO A;  3L75 J;  1RF1 B;  2SPZ A;  4EDF A;  3CC2 P;  1NTZ E;  1IK7 A;  5APX A;  5KLV D;  1LWU C;  4JBZ A;  1YQ3 C;  3CWB E;  2R3C A;  4EYY Q;  5AW3 B;  3BCC E;  2IBZ E;  1ZRT E;  1SQB E;  1N7S A;  1KYO I;  1HGV A;  4A7P A;  2ZT9 D;  1SQP G;  4I7Z B;  2WPV B;  1EC5 A;  2WVR A;  3EFG A;  1BSN A;  2L91 A;  1FDI A;  2FYU D;  3VTP C;  2OTJ P;  2WQY C;  3H1I D;  2H43 A;  3CPW O;  2RMZ A;  3CXH E;  3CC7 P;  1DX7 A;  2BEZ F;  3C1L A;  3P8C E;  3O6Q A;  2Q5U A;  4ASV A;  1PPJ G;  3UIA A;  3L37 A;  2KS1 B;  5DJU B;  1Q7Y Q;  3II6 A;  1RE4 C;  1LT9 A;  5CBN A;  3BCC D;  2A06 D;  1R5L A;  2JWD A;  4H44 D;  2WSF H;  2ZJS E;  2YKO A;  5H2F H;  3QH9 A;  4UB8 E;  3VMX A;  3HD7 D;  3NTN A;  2M5A A;  4K35 A;  4L76 A;  2W8Z A;  2M3E A;  1NTM E;  2CK3 H;  2KOG A;  3MUD C;  2Y9Z A;  1GU5 A;  3ABV C;  5B66 E;  3HUS A;  1G1J A;  1SQX E;  1SQV J;  2AXT E;  4YTP C;  2B89 A;  4LLH A;  3H1K G;  1OW6 A;  1QGK B;  2YKQ A;  2AEF A;  1X22 A;  1NKZ B;  2G3A A;  4UB8 H;  3RL0 D;  3AE5 C;  1AA0 A;  2ZAE B;  3H6P A;  1KQL A;  1DH3 A;  2M0B A;  3CCV P;  1NU1 J;  3EQ2 A;  1JOC A;  1VF5 D;  5GTH E;  2E74 B;  1EDL A;  2WPS A;  1SQP K;  2O01 J;  2IYP A;  2AXT H;  1E5W A;  5AW1 B;  1L0L G;  1N73 C;  2N1T D;  1PP9 G;  1YIT P;  3HD7 A;  4H0L C;  3VP8 A;  3TF5 A;  1J1D C;  1HTL C;  5KKZ B;  3B8E B;  1NAY A;  3L70 J;  2LR2 A;  1N7S B;  2BCC E;  1T8Z A;  1NTZ J;  2K88 A;  1QVF O;  2WSC J;  2HPC A;  2ITA A;  1PGO A;  1SQQ K;  4KJM A;  2Q7C A;  4HB1 A;  1P84 I;  5KAF E;  2OGU A;  2JEE A;  4H13 B;  4L75 A;  1AVY A;  3O6Q B;  1S2E A;  1SQB J;  1JY2 P;  2HG5 D;  3T97 A;  1SQP D;  3ZDM A;  2JDI H;  3I55 P;  3FWN A;  3CMA P;  2GUS A;  3S9O A;  2C0W A;  1H0T A;  3JCU E;  2FFD B;  5CCH A;  1PPJ D;  3PLN A;  1QL2 A;  4WWI A;  3PJS K;  3SWY A;  1LTA C;  2WMM A;  1KB9 I;  3H1K E;  1WRG A;  2MKV A;  3L75 G;  1RQU A;  1SQQ D;  5AW2 B;  1M57 D;  1J2J B;  3L71 J;  1FOS F;  1FC2 C;  5DJT B;  4TT3 H;  1YJN P;  1RE3 A;  1JY3 O;  4TLF A; 
#chains in the Genus database with same CATH homology
 1RQV A;  2D2C C;  2E75 B;  2D2C D;  1WMK A;  3Q5S A;  3AE8 C;  2BEQ D;  1NGM B;  4H0L C;  4IL6 X;  4H0L D;  1UIX A;  2YIU C;  4KT0 J;  3C8V A;  2QJY C;  3AE7 C;  3AEF C;  2JO1 A;  5KLI C;  1Y9B A;  4R4L A;  2WSF J;  4RKU J;  1AJY A;  1PIX A;  1ZP0 C;  2D2C B;  4H44 C;  4H44 D;  4H13 C;  3AEA C;  1KIL E;  4GDO A;  4H13 D;  2V7Q J;  5L8R J;  3D70 A;  4PV1 C;  1PL5 A;  1JB0 J;  3Q5P A;  2WSC J;  4H0L B;  3D6Z A;  3IN6 A;  1K04 A;  2E76 C;  1OW8 A;  1OMI A;  3AE3 C;  1S5L X;  1ZME C;  1MKM A;  2FBW C;  2H88 C;  3AE1 C;  1EXJ A;  2FXP A;  3GF3 A;  4YXD C;  1K05 A;  3H25 A;  1KTM A;  1ZOY C;  4H44 B;  4H13 B;  1R8E A;  1FDO A;  4Z1M H;  1KOR A;  1HJ0 A;  2E74 C;  1DIP A;  3AEB C;  2IDB A;  1Q90 D;  2QIW A;  3AE9 C;  2G8Y A;  3ABV C;  2QSI A;  2JP3 A;  1KQF B;  3GF7 A;  1IK7 A;  1GMJ A;  3AE6 C;  4PV1 D;  4YTP C;  4R4M A;  2ZT9 C;  3D71 A;  1S1C X;  2E76 D;  3GMA A;  3R4Y A;  1DD4 A;  1YQ3 C;  1VF5 C;  3FGA D;  3AED C;  4I7Z C;  1U57 A;  1NYH A;  3Q1M A;  1OW6 A;  2QJP C;  2H89 C;  3S9O A;  3RL0 g;  3D6Y A;  4PV1 B;  1VL2 A;  1ZRT E;  2G3A A;  2E74 D;  5M1B A;  2YMK A;  2E76 B;  3RK3 E;  1EXI A;  3LW5 J;  3AE5 C;  3Q3D A;  3SFD C;  2QJK C;  3G9R A;  2OQQ A;  1HF9 A;  1VF5 B;  3Q2Y A;  2ZT9 D;  3AE2 C;  4OGQ C;  3AEG C;  4OGQ D;  4I7Z B;  2MKV A;  3AEC C;  1KMI Z;  2K9Y A;  2WPV B;  1OW7 A;  3EWK A;  2E75 C;  3AEE C;  1RQU A;  2E75 D;  3B71 A;  4U7J A;  4Y28 J;  3IAO A;  1FDI A;  2P10 A;  1KQG B;  3Q5R A;  1VF5 D;  2WQY C;  1PV3 A;  2NZ2 A;  2FYN C;  2E74 B;  1DD3 A;  3T97 B;  2J5U A;  4TT3 H;  1YQ4 C;  4XFJ A;  2BEZ F;  3AE4 C;  1TU3 F;  5KKZ C;  2O01 J;  2WSE J;  3O6Q A;  3SFE C;  2ZT9 B;  4OGQ B;  3GLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...