4IL6X

Structure of sr-substituted photosystem ii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
molecule tags Electron transport
total genus 14
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4il6X00
2QJYC 1S5LX 4H13B 2K9YA 4OGQB 5L8RJ 2WSFJ 5KKZC 2E74B 2WSCJ 1VF5B 4H0LB 3LW5J 1ZRTE 2WSEJ 4IL6X 2QJKC 2FYNC 2ZT9B 1JB0J 2QSIA 2D2CB 2O01J 4KT0J 2WPVB 2YIUC 3C8VA 2E75B 2QIWA 4I7ZB 2E76B 4H44B 4Y28J 1Q90D 2QJPC 5KLIC 4RKUJ 4PV1B
chains in the Genus database with same CATH superfamily
4H13B 4JQ0D 1DEBA 1MFTA 4U3FG 1QEXA 2W6BA 3HD7C 2JR8A 2FY8A 1SQQE 3LW5H 1N73A 3KZIH 1N8RQ 3D6YA 1KTMA 3CD6P 1JOCA 1LT9A 1ZLLA 2AXTE 1VQOP 1X22A 3L75E 3IFMA 1N7SC 2GUVA 1P84D 4PV1D 3FXDA 4LGDE 3E1RA 2WSEH 5K5GB 2PRRA 2OYHA 2D2CD 1PP9G 4W80A 1M90Q 2ZVNB 2O1KA 2GUSA 2B89A 1JY3P 3CCQP 1KILE 1S4XA 1OW6A 2V7QH 1GL2A 4CPGA 4OGQD 1EXIA 1OZHA 3L73G 4C46A 1U7MA 4EDFA 1BE3G 1VDFA 1M8OB 4BRYA 2HG5D 1KQGB 3PH0A 4GT1A 3GG2A 5B66E 3Q5PA 2CPSA 2E76C 1FZCB 3AECC 3A0BE 2KUBA 2P1JA 1BCCJ 1JB0J 1KC8Q 1PPJD 5CCGD 3L70G 1FBMA 1PV3A 3H1LJ 2OTLP 2OYIB 3IF4A 3LIDA 1JY3O 1GDTA 1KYOE 3L74D 5GTIH 2WZ7A 1KORA 3KPEA 3A0HE 1PP9E 3V6IA 1Q86Q 1BGYG 2WPSA 3L75D 2C9LY 1JY2P 3P8MC 3B5NB 2O01N 1NU1G 1FDMA 5TISE 1K73Q 3SWYA 1T6AA 2YKQA 2K3RA 2Q5UA 1IZNB 3B4SA 1RE4A 3HD7D 1T2KC 2HPCB 2Y9YA 2A45H 1PFIA 1SQXJ 1YITP 2QSIA 3L71E 3L70E 1USEA 5BVZA 4QMAA 1LP1B 3OJAB 1N7SD 3G6EP 5CCHC 2Q3IA 5APSA 1JO5A 2R5DA 3AE8C 4RESB 1SQPK 1NJIQ 2GA1A 1HGZA 4OVNF 5AVYB 3GF3A 1KFMA 2AXTH 4TLFA 3HE5A 2YXQB 2W90A 3AE4C 2I1KA 2KP8A 1LWUB 4ASWA 2IBZE 3MIWA 1AV1A 3D70A 3VP8A 2XKMA 1SP4A 4NPDA 1NAFA 3GMAA 4WVZA 1LT9B 1J1DB 2XDJA 2J58A 2E76D 3EQ2A 3CCJP 5KJ7C 3E1IA 5KKZB 4PD4I 1X79B 1HWTC 1URQA 3GHGC 1VQ9P 1QX8A 1SFCA 1PGOA 2OARA 1A02F 5B66H 3CWBE 1S9KE 3O6QB 4D6TE 1SQVJ 3WUUA 1LTGC 3A0BH 2FYUJ 4XA4A 2W8ZA 3AE2C 4AYCA 2FYNC 3L71D 5KLIB 1LTAC 3S1KA 2BCCJ 1LNQA 2QJPC 3FX0A 1OW7A 1KYOH 2KZJA 1GZLA 2ZT9B 1T3UA 2O01H 1L0LJ 3W67A 4HYTB 2BCCD 1ZW0A 1K9MQ 2FFDB 1GU5A 1RQUA 3VOPA 1T2KD 1D7MA 3C9IA 2IBZD 4Y99B 5TISH 2OYOA 3M0AA 1GMJA 5KTBA 2N1TB 2PGDA 3TYYA 1PL5A 5GTHE 3WUTA 1ZXGA 3MGNA 5CCHD 3H1KJ 2Q9IA 3H1IG 1CW5A 3USSA 4XE5B 1FZAA 2YIUB 5AVRB 2NZ2A 5DJUB 3MUDC 2Y0EA 3C8VA 5APVA 3CWBD 3SWFA 1JMMA 5APXA 1S9KD 4D6TD 1LTJC 4LC1A 1PGQA 4U7JA 3OA7A 1KB9D 1SQBJ 3L72G 4L73A 3IAOA 1OMIA 4H44B 1NWQA 1X0TA 5KJ7D 4OWFA 2E75C 2NPSB 3AEBC 1OIPA 3H1JJ 2E74B 4WBAA 3D71A 1LTBC 4I1LA 2P67A 3L36A 1SQXK 1OVVA 1P84I 3HE4A 1CI6A 1T8ZA 2KS1B 1FZCA 1L4AB 3H1IE 1NTMD 3CX5E 3MZWB 2QJKC 2J59M 5KLVD 4BWNA 1RF1A 1RHZB 3LIEA 3TGUJ 2A06G 3O8ZA 4JF7A 2IX7C 3NMDA 2L5GB 1M1JA 1KZUB 2OYIA 4EI2A 3PJSK 2K9YA 1KFNA 2L91A 3Q1MA 3CMEP 1SQPE 3LW5J 3M0DA 1LTSC 1SFCB 1JCCA 1Q82Q 2W83C 2A45I 5EFWB 3RL0B 1NTKD 2XNXA 3HRNA 1EDKA 2WSEJ 1MZ9A 1WMKA 2KXPB 1EQ7A 1FZEA 2PP6A 3EFGA 3VMAA 3H1HD 5H2FE 2I1JA 2R3CA 3AEEC 3HD7A 1Z56A 1A02J 3RK3B 2DW3A 2Q1KA 2V7QJ 4HKZH 1BCCG 5AW0B 2W6JH 2HLOA 1PGJA 3I56P 3G3ZA 2E5TA 4C7RA 5E79E 5KAIE 1NU1K 3RL0g 1K8AQ 4RJTA 2WMMA 5GTHH 4WB4A 3H1LG 4AQRD 1LP1A 2A06E 3MP7B 1NH4A 2LKMA 2QJYC 1QVFO 1XTGB 1HBWA 3CX5D 4A7PA 1FDOA 1QVGO 2PAJA 3WU2E 1ZP0C 3V4QA 1FOSF 2E75D 3R4YA 2B87B 1L0NJ 5CMZA 3WUVA 1LWUA 1KILC 1SQPD 2WSFH 2B88A 1SVFA 1ZRTE 2KZIA 1K05A 1M7LA 1GK4A 2CK3H 4HJGH 1M57D 3SFEC 4XFJA 2WT7B 3NTNA 4GIFA 4PV1B 1L0ND 1K04A 1GK6A 2Q3EA 5L8RJ 1NYHA 1SQXG 1AA0A 1IFDA 2SPZA 3TDKA 1BCCE 2IFNA 2D2CB 1MFZA 1EZVD 1YJWP 1KD1Q 3O6QA 2P2UA 2K37A 1IO4A 4R4MA 2UWJE 2Y9ZA 3CX5H 4OGQB 1IFMA 5AW5B 1HJ0A 3BCCJ 1Q2NA 1IJDB 4NPEA 5TJHA 2YMYA 3HE4B 1SQBK 1NTZD 1CI6B 2YO3A 1VQPP 3CXHE 1AVOA 3G4SP 3L74J 3SSUA 1LJ2A 4U3FE 2JKVA 5AVQB 1RF1B 1N73C 3BCCD 3E7KA 2IPPA 3L75J 2FFDA 1GW4A 3BRVB 1M1JB 1S5LX 1KV4A 1ZRTD 2JWDA 1SQQD 4IL6X 3SFDC 3A7OA 4IFFA 2LXBA 4H0LC 2W27A 2FXMA 2N1TA 1YI2P 2IDBA 2OYHC 4I7ZC 3W68A 1SQVG 4RKUJ 3PLNA 1FC2C 2BEZF 2WWWA 2RMZA 3HUSB 1VL2A 2FYUG 1IC2A 1RY3A 2ZXXA 2ZVOB 2FKWB 3GW6A 5E79H 5APWA 5KAIH 3L73E 1GL2C 1BE3E 3S4RA 5B5EE 1JMBA 1VQ7P 1KILD 3HD7B 3KYQA 4ASVA 2N9YB 2QEXP 2ITAA 3EFFK 4M3LA 2KSEA 1U57A 3WU2H 1QLED 2JWAA 5AVWB 1N86A 1DD3A 5KJ7A 2E43A 1L0LG 2H8PD 4IFMA 3I55P 2HYNA 3A5TA 1HVVA 1N7SB 3CXHD 4NPFX 3GHGA 2NPSA 1H8AA 1L2PA 4MN4C 1E79H 3H6PA 2YMKA 4W7ZA 3TF5A 4U3FD 2LR2A 2Q7CA 2O01J 4Z1MH 1VF5C 3A2AA 1SS1A 1S1CX 3AE5C 2HODA 1KB9I 1YBKA 2V4HA 3JCUE 1BGYE 3H1KG 2KS1A 3RK2C 1YJNP 1S72P 3VN0A 1L4AA 1KYOD 2H43A 1JTHB 1NU1E 2QM7A 2KSJA 2E76B 3KXDA 2IYPA 1PP9D 1DH3A 4JPZB 1T3JA 4DOJA 2AEFA 1RE4C 2WSCJ 2R3SA 3L71J 1NOHA 1SQBG 2M0BA 3L73D 1XTCC 1YTZI 2YXRB 1BE3D 3P7KA 2H7HA 3CXHH 3QH9A 4N3YB 2IZ1A 1FZFA 3H1JG 1AQTA 3OAKA 4H0LD 1VQ8P 1DEEG 1KQLA 3L70D 3V2QA 1DX7A 1IFPA 2PFXA 2KNCB 1ZOYC 3H1KE 2OTKE 2Z5IA 2W6AA 4ZNCA 2RH0A 1H88A 1GL2D 3VP9A 1LTJA 5AW8B 3A0HH 3TGUG 1YQ3C 2KLUA 4DJGA 2Y0DA 4GOEA 1LTTC 3FXEA 1EXJA 3P8CE 1BGYD 2BEQD 3AEDC 3KQGA 3N4XA 3VMZA 1W2EA 1NU1D 2ZAEB 1URQC 1SQBE 3CWBJ 2Z4EA 4D6TJ 2JJLA 1JM0A 1RQVA 2WTYA 5B5EH 1MKMA 2B87A 3V2RA 3AE6C 2FBWC 1HGVA 3TNUA 1VF5D 2J5UA 1HH0A 2ZYDA 3ZDMA 3CX5I 1IK9A 2B9BA 2WT7A 5AVVB 3RK2D 1LTIC 1R5LA 2WPRA 4C7NB 3R2PA 4WY4C 1J1EC 3B71A 1PIXA 4EIJA 2YKOA 2HR3A 1S3JA 1OWAA 5AVUB 3IR9A 2QVAA 2QG4A 3JCUH 2Z5HA 4OH8B 1X8YA 3GHGB 1NTMJ 5KLVJ 1NKNA 5C39A 4DT0A 2ZFCA 2RKLA 3GF7A 1BDDA 1VQ5P 2HODB 1RF0C 2ZXEB 2Q6QA 3P8CD 5AVZB 3AEFC 1EZVI 1OFCX 2FYNB 4AUWA 5CCGA 2M3EA 4H13C 1G2CB 3CCEP 3WMM0 3I5CA 2QJPB 1YJ9P 3CMAP 4R4LA 1W5CE 1YTZT 1HJBA 2POHA 1NTKJ 1CSBA 3TK1A 2ZYAA 4ZMDA 1JY3N 4HB1A 2C0XA 2LXCB 1S5LE 1BSNA 3Q5RA 5AW9B 4WWIA 3CCMP 3VTPC 3PHLA 3L72E 1NAYA 3U59A 2O3JA 3H1HJ 4IL6E 1Q90D 3L37A 3H32A 3HUSA 2P58A 2A45G 2KK7A 4RO0A 1PPJG 4UB6E 1URQD 1VPCA 3FGAD 3H25A 4KHXA 1AJYA 1KILA 1HUCA 3QWOC 2E42A 1AFOA 3L74G 1P84E 2G3AA 1SQVK 1EDLA 1RE3C 1Y8AA 1FZCC 3ABVC 2FYUK 1X9VA 1LTJB 5DJTB 2R5BA 3L75G 2XZRA 3BATA 1N7SA 3KDPB 1KQFB 3HTKB 3RGUA 2AEJA 2OGUA 3V5BA 4WY4D 1SQPJ 1FDIA 3MTUE 3H1ID 1JY2N 2OYIC 5CHXA 3T97B 3ITKA 3K5BA 3PP5A 5AW1B 3AEAC 2KYVA 3TSIA 2E75B 3M0DC 2KLVA 1OVRA 3JC22 4B86A 1Q81Q 1L0LK 3AEGC 1W2BO 1IFIA 4GKGA 3CXHI 1JTHA 3TNUB 3B5NC 1FU1A 5KAFE 3L72D 5AVSB 2JEEA 3GLMA 5AVXB 3P32A 2QRXA 4K35A 2JO1A 1MV8A 1N2DC 3RBZA 1Y47A 1MUUA 2QJKB 4TT3H 3L74E 4H13D 2YKPA 4N78E 3IN6A 1QL1A 3G9RA 1KYOI 1NO4A 1NTZJ 1USDA 1VQKP 2M5AB 2KI7B 1GU4A 3H1LE 1G1JA 2KOGA 1OW8A 3VMXA 3SWKA 1AQ5A 3Q3DA 1ZV8A 1RH5B 3M9QA 1NVOA 4IFDK 1GTWA 2BASA 1WRGA 2A06D 3C1LA 1VQMP 4K3AA 3CCUP 2KNCA 1ZR2A 4EOTA 1SQQJ 3BVHA 5AW3B 1S5LH 1LWUC 5AW6B 2XU6A 3M9HA 1NTMK 1OX3A 5KLVK 3NXSA 4IL6H 3CCLP 5BU8B 2C0WA 3NFQA 3MD0A 1ZMEC 1LT9C 1J1DC 2FXPA 1EDIA 2RN0A 5KKZC 4O9BA 4UB6H 1DD4A 1LGHB 2K9JB 2OQQA 1Q7YQ 3L71G 1SQXE 1E5WA 4KT0J 2IYOA 5H2FH 2QJYB 1R5SA 2K1AA 5CCHA 1QL2A 3H32B 1P84H 3M9BA 4LLHA 1NTKK 4N78D 2YNYA 1NHLA 3FWLA 1BCCD 3AE1C 2BCCG 2IBZI 3CCRP 1EDJA 3F89A 5KLIC 1KILB 4IOIH 3H1LD 1WT6A 2I8DA 2IBZG 4JYCA 4C7NA 4U3FJ 2P10A 3B5ND 3L35A 1IFNA 4L74A 3V2PA 5AW4B 2ZT9C 2K88A 1FE6A 1J2JB 2FFDC 1IFJA 1FOSE 2MKVA 3V2NA 1PZQA 4I2LC 4Y99C 5KAFH 1U7JA 3CWBG 5AVTB 1PP9J 4D6TG 1YYCA 1QGKB 2N1TC 5AW2B 1JY2O 1SQVE 4GOFA 1N7LA 2FYUE 4EYYQ 1SQXD 3L73J 1NGMB 1G2CA 1VQLP 1BE3J 2ZYGA 1AVYA 2YIUC 2OTJP 3CCSP 3KHUA 3II6A 2BCCE 1YQ4C 3N7NA 1FAVA 1L0NK 2H89C 1VQ6P 1N73B 5APTA 3L70J 3F5HA 1L0LE 1S2EA 4L76A 4H44C 4ZKUA 3CC7P 1PGPA 1BDCA 1NTMG 5AW7B 4H0LB 5KLVG 2NPSC 1FJKA 2HFED 2E74C 4ZKPA 3B8EB 2QM8A 2OYHB 4I7ZB 1VQ4P 2QE7H 1HF9A 2XNDH 1YHQP 1BGYJ 3JSVC 1NTZK 4Y28J 2N9BA 3CI9A 3Q5SA 3BRTB 1ZN5A 1NU1J 1GL2B 3MUDA 2P7JA 4L75A 1KB9E 2VRSA 4PJ0E 1L4AC 4BRYB 3BASA 4WY4A 1BSHA 3HTKA 3D6ZA 1NTKG 2NRGA 1SQVD 3UIAA 1VQNP 2FYUD 2WSSH 5APUA 1CZQA 3T97A 1JUNA 1FZBA 1SQQK 2ZT9D 2KIKA 4PD4E 4YXWH 2E5YA 3H1HG 1SFCC 2IFMA 3V4WA 1H0TA 4KJMA 2AXCA 3RL0C 1NTME 1VF5B 3H1JE 2G8YA 3CCVP 1H89A 4JBZA 5KLVE 1RF0A 1L0LD 2FXOA 1FZGA 3OW2O 1JCDA 2N1TD 3RK2B 3VYIA 4UB8E 4YTPC 4N6JA 2WSCH 4DCKA 3RK3C 1Y9BA 4BXLA 1FS0E 4GODA 2JP3A 3TGUE 2M5AA 3S9OA 1NTKE 1SQPG 3M91A 3H1KD 2CPBA 1M56D 1NKZB 3KZIE 2O1JA 4W7YA 2MJZA 5M1BA 3M06A 4H44D 3H1HE 1L0NG 3AE3C 2NPSD 2JDIH 2FYZA 3RK3E 2E74D 4I6MC 1GW3A 3VMYA 1EZVG 1SQBD 2XV5A 4PD4D 2QIWA 3AE9C 3HE5B 2WVRA 1OXZA 3U1CA 2QA4P 2AEMA 1RE3A 1SLQA 1GD2E 2YO2A 3CL3D 2R44A 5CBOA 2WSFJ 2ZJSE 4PV1C 3H1JD 2K9JA 1L4AD 1KN7A 1UIXA 5BU5A 3L4FA 2GM4A 3MHVA 1NTZG 2D2CC 1R8EA 2WQYC 1URQB 1KB9H 4PJ0H 3PRJA 2KB7P 3G71P 4OGQC 3BCCG 1ZR4A 1SFCD 1M1KQ 3TGUD 3AE7C 5CJ4A 3EWKA 1L0NE 1UIIA 3RL0D 3H1IJ 3CC2P 3B5NA 3Q2YA 1SQQG 1IK7A 2IZ0A 2WPQA 1DIPA 1G1IA 5GTIE 1LT1A 3PTZA 1KQSO 1TU3F 3RBXA 4PD4H 4YPCA 5CJ0A 5CCGC 1EZVE 2Y0CA 4HH2A 1RF1C 3FWNA 4WY4B 4YXDC 1J1EB 2M3BA 4JYBA 2HPCA 1EC5A 2H88C 3RK3D 1M1JC 3CPWO 1HTLC 3L72J 1FJPA 1JEKA 2WPVB 5CBNA 4UB8H 1NTZE 5APYA 1H0TB 3CLQA 1JNMA 4GDOA 4DZOA 2WITA 1OVUA 5APQA 2C9NY 3HUSC 2M8RA 3CC4P 1PPJE 2R32A 1KMIZ 3BCCE 3A3YB 1YIJP 3U1AA
chains in the Genus database with same CATH topology
2QJYC 4YTPC 1ZOYC 4H13B 1OW8A 2YMKA 4H0LB 1FDOA 2G3AA 2P10A 3D70A 2QJKC 3Q3DA 4OGQC 1Y9BA 2E74C 2O01J 3ABVC 4Z1MH 3D6YA 1GMJA 1VF5C 3GF7A 1ZP0C 1KORA 1KTMA 4I7ZB 3GMAA 1S1CX 2ZT9C 3AE5C 1HF9A 1YQ3C 2E75D 2JP3A 3AE7C 2E76D 1PL5A 3R4YA 1KQFB 1EXJA 3AEFC 3EWKA 4Y28J 1S5LX 3S9OA 2BEQD 3AEDC 3Q5SA 2K9YA 4PV1D 3Q1MA 1FDIA 3Q2YA 1IK7A 3LW5J 1ZRTE 2MKVA 4H13C 4IL6X 1DIPA 1K05A 3T97B 3SFDC 2NZ2A 1TU3F 4H0LC 3AEAC 3C8VA 2E75B 2D2CD 2E76B 5M1BA 3SFEC 1RQVA 4XFJA 4H44D 1MKMA 2IDBA 4R4LA 4I7ZC 3AE6C 1ZMEC 4YXDC 3D6ZA 4RKUJ 2BEZF 1KILE 2FBWC 4PV1B 3AEGC 2FXPA 1K04A 1OW6A 1VL2A 5L8RJ 3AE3C 5KKZC 4U7JA 1NYHA 2H88C 2WSCJ 3AE2C 1EXIA 4OGQD 3RK3E 1DD4A 2WSEJ 2E74D 2OQQA 1NGMB 2FYNC 1VF5D 3Q5RA 2QSIA 2J5UA 1WMKA 2D2CB 3IAOA 2ZT9D 4KT0J 2WPVB 2YIUC 1OMIA 2QIWA 4H44B 3AE9C 3GLMA 1KQGB 3O6QA 1Q90D 2QJPC 1YQ4C 3Q5PA 1OW7A 2E75C 2E76C 2JO1A 3AEEC 4GDOA 4R4MA 3AEBC 3AECC 4TT3H 4OGQB 2WSFJ 2E74B 2H89C 3B71A 2V7QJ 4H13D 4PV1C 1VF5B 3D71A 3AE8C 1U57A 1PIXA 2G8YA 2ZT9B 1JB0J 4H0LD 3AE1C 1UIXA 1HJ0A 3IN6A 1DD3A 3FGAD 3G9RA 1KMIZ 3GF3A 3RL0g 3H25A 2D2CC 1AJYA 1R8EA 1PV3A 5KLIC 3AE4C 4H44C 2WQYC 1RQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  1S5L X;  4H13 B;  2K9Y A;  4OGQ B;  5L8R J;  2WSF J;  5KKZ C;  2E74 B;  2WSC J;  1VF5 B;  4H0L B;  3LW5 J;  1ZRT E;  2WSE J;  4IL6 X;  2QJK C;  2FYN C;  2ZT9 B;  1JB0 J;  2QSI A;  2D2C B;  2O01 J;  4KT0 J;  2WPV B;  2YIU C;  3C8V A;  2E75 B;  2QIW A;  4I7Z B;  2E76 B;  4H44 B;  4Y28 J;  1Q90 D;  2QJP C;  5KLI C;  4RKU J;  4PV1 B; 
#chains in the Genus database with same CATH topology
 4H13 B;  4JQ0 D;  1DEB A;  1MFT A;  4U3F G;  1QEX A;  2W6B A;  3HD7 C;  2JR8 A;  2FY8 A;  1SQQ E;  3LW5 H;  1N73 A;  3KZI H;  1N8R Q;  3D6Y A;  1KTM A;  3CD6 P;  1JOC A;  1LT9 A;  1ZLL A;  2AXT E;  1VQO P;  1X22 A;  3L75 E;  3IFM A;  1N7S C;  2GUV A;  1P84 D;  4PV1 D;  3FXD A;  4LGD E;  3E1R A;  2WSE H;  5K5G B;  2PRR A;  2OYH A;  2D2C D;  1PP9 G;  4W80 A;  1M90 Q;  2ZVN B;  2O1K A;  2GUS A;  2B89 A;  1JY3 P;  3CCQ P;  1KIL E;  1S4X A;  1OW6 A;  2V7Q H;  1GL2 A;  4CPG A;  4OGQ D;  1EXI A;  1OZH A;  3L73 G;  4C46 A;  1U7M A;  4EDF A;  1BE3 G;  1VDF A;  1M8O B;  4BRY A;  2HG5 D;  1KQG B;  3PH0 A;  4GT1 A;  3GG2 A;  5B66 E;  3Q5P A;  2CPS A;  2E76 C;  1FZC B;  3AEC C;  3A0B E;  2KUB A;  2P1J A;  1BCC J;  1JB0 J;  1KC8 Q;  1PPJ D;  5CCG D;  3L70 G;  1FBM A;  1PV3 A;  3H1L J;  2OTL P;  2OYI B;  3IF4 A;  3LID A;  1JY3 O;  1GDT A;  1KYO E;  3L74 D;  5GTI H;  2WZ7 A;  1KOR A;  3KPE A;  3A0H E;  1PP9 E;  3V6I A;  1Q86 Q;  1BGY G;  2WPS A;  3L75 D;  2C9L Y;  1JY2 P;  3P8M C;  3B5N B;  2O01 N;  1NU1 G;  1FDM A;  5TIS E;  1K73 Q;  3SWY A;  1T6A A;  2YKQ A;  2K3R A;  2Q5U A;  1IZN B;  3B4S A;  1RE4 A;  3HD7 D;  1T2K C;  2HPC B;  2Y9Y A;  2A45 H;  1PFI A;  1SQX J;  1YIT P;  2QSI A;  3L71 E;  3L70 E;  1USE A;  5BVZ A;  4QMA A;  1LP1 B;  3OJA B;  1N7S D;  3G6E P;  5CCH C;  2Q3I A;  5APS A;  1JO5 A;  2R5D A;  3AE8 C;  4RES B;  1SQP K;  1NJI Q;  2GA1 A;  1HGZ A;  4OVN F;  5AVY B;  3GF3 A;  1KFM A;  2AXT H;  4TLF A;  3HE5 A;  2YXQ B;  2W90 A;  3AE4 C;  2I1K A;  2KP8 A;  1LWU B;  4ASW A;  2IBZ E;  3MIW A;  1AV1 A;  3D70 A;  3VP8 A;  2XKM A;  1SP4 A;  4NPD A;  1NAF A;  3GMA A;  4WVZ A;  1LT9 B;  1J1D B;  2XDJ A;  2J58 A;  2E76 D;  3EQ2 A;  3CCJ P;  5KJ7 C;  3E1I A;  5KKZ B;  4PD4 I;  1X79 B;  1HWT C;  1URQ A;  3GHG C;  1VQ9 P;  1QX8 A;  1SFC A;  1PGO A;  2OAR A;  1A02 F;  5B66 H;  3CWB E;  1S9K E;  3O6Q B;  4D6T E;  1SQV J;  3WUU A;  1LTG C;  3A0B H;  2FYU J;  4XA4 A;  2W8Z A;  3AE2 C;  4AYC A;  2FYN C;  3L71 D;  5KLI B;  1LTA C;  3S1K A;  2BCC J;  1LNQ A;  2QJP C;  3FX0 A;  1OW7 A;  1KYO H;  2KZJ A;  1GZL A;  2ZT9 B;  1T3U A;  2O01 H;  1L0L J;  3W67 A;  4HYT B;  2BCC D;  1ZW0 A;  1K9M Q;  2FFD B;  1GU5 A;  1RQU A;  3VOP A;  1T2K D;  1D7M A;  3C9I A;  2IBZ D;  4Y99 B;  5TIS H;  2OYO A;  3M0A A;  1GMJ A;  5KTB A;  2N1T B;  2PGD A;  3TYY A;  1PL5 A;  5GTH E;  3WUT A;  1ZXG A;  3MGN A;  5CCH D;  3H1K J;  2Q9I A;  3H1I G;  1CW5 A;  3USS A;  4XE5 B;  1FZA A;  2YIU B;  5AVR B;  2NZ2 A;  5DJU B;  3MUD C;  2Y0E A;  3C8V A;  5APV A;  3CWB D;  3SWF A;  1JMM A;  5APX A;  1S9K D;  4D6T D;  1LTJ C;  4LC1 A;  1PGQ A;  4U7J A;  3OA7 A;  1KB9 D;  1SQB J;  3L72 G;  4L73 A;  3IAO A;  1OMI A;  4H44 B;  1NWQ A;  1X0T A;  5KJ7 D;  4OWF A;  2E75 C;  2NPS B;  3AEB C;  1OIP A;  3H1J J;  2E74 B;  4WBA A;  3D71 A;  1LTB C;  4I1L A;  2P67 A;  3L36 A;  1SQX K;  1OVV A;  1P84 I;  3HE4 A;  1CI6 A;  1T8Z A;  2KS1 B;  1FZC A;  1L4A B;  3H1I E;  1NTM D;  3CX5 E;  3MZW B;  2QJK C;  2J59 M;  5KLV D;  4BWN A;  1RF1 A;  1RHZ B;  3LIE A;  3TGU J;  2A06 G;  3O8Z A;  4JF7 A;  2IX7 C;  3NMD A;  2L5G B;  1M1J A;  1KZU B;  2OYI A;  4EI2 A;  3PJS K;  2K9Y A;  1KFN A;  2L91 A;  3Q1M A;  3CME P;  1SQP E;  3LW5 J;  3M0D A;  1LTS C;  1SFC B;  1JCC A;  1Q82 Q;  2W83 C;  2A45 I;  5EFW B;  3RL0 B;  1NTK D;  2XNX A;  3HRN A;  1EDK A;  2WSE J;  1MZ9 A;  1WMK A;  2KXP B;  1EQ7 A;  1FZE A;  2PP6 A;  3EFG A;  3VMA A;  3H1H D;  5H2F E;  2I1J A;  2R3C A;  3AEE C;  3HD7 A;  1Z56 A;  1A02 J;  3RK3 B;  2DW3 A;  2Q1K A;  2V7Q J;  4HKZ H;  1BCC G;  5AW0 B;  2W6J H;  2HLO A;  1PGJ A;  3I56 P;  3G3Z A;  2E5T A;  4C7R A;  5E79 E;  5KAI E;  1NU1 K;  3RL0 g;  1K8A Q;  4RJT A;  2WMM A;  5GTH H;  4WB4 A;  3H1L G;  4AQR D;  1LP1 A;  2A06 E;  3MP7 B;  1NH4 A;  2LKM A;  2QJY C;  1QVF O;  1XTG B;  1HBW A;  3CX5 D;  4A7P A;  1FDO A;  1QVG O;  2PAJ A;  3WU2 E;  1ZP0 C;  3V4Q A;  1FOS F;  2E75 D;  3R4Y A;  2B87 B;  1L0N J;  5CMZ A;  3WUV A;  1LWU A;  1KIL C;  1SQP D;  2WSF H;  2B88 A;  1SVF A;  1ZRT E;  2KZI A;  1K05 A;  1M7L A;  1GK4 A;  2CK3 H;  4HJG H;  1M57 D;  3SFE C;  4XFJ A;  2WT7 B;  3NTN A;  4GIF A;  4PV1 B;  1L0N D;  1K04 A;  1GK6 A;  2Q3E A;  5L8R J;  1NYH A;  1SQX G;  1AA0 A;  1IFD A;  2SPZ A;  3TDK A;  1BCC E;  2IFN A;  2D2C B;  1MFZ A;  1EZV D;  1YJW P;  1KD1 Q;  3O6Q A;  2P2U A;  2K37 A;  1IO4 A;  4R4M A;  2UWJ E;  2Y9Z A;  3CX5 H;  4OGQ B;  1IFM A;  5AW5 B;  1HJ0 A;  3BCC J;  1Q2N A;  1IJD B;  4NPE A;  5TJH A;  2YMY A;  3HE4 B;  1SQB K;  1NTZ D;  1CI6 B;  2YO3 A;  1VQP P;  3CXH E;  1AVO A;  3G4S P;  3L74 J;  3SSU A;  1LJ2 A;  4U3F E;  2JKV A;  5AVQ B;  1RF1 B;  1N73 C;  3BCC D;  3E7K A;  2IPP A;  3L75 J;  2FFD A;  1GW4 A;  3BRV B;  1M1J B;  1S5L X;  1KV4 A;  1ZRT D;  2JWD A;  1SQQ D;  4IL6 X;  3SFD C;  3A7O A;  4IFF A;  2LXB A;  4H0L C;  2W27 A;  2FXM A;  2N1T A;  1YI2 P;  2IDB A;  2OYH C;  4I7Z C;  3W68 A;  1SQV G;  4RKU J;  3PLN A;  1FC2 C;  2BEZ F;  2WWW A;  2RMZ A;  3HUS B;  1VL2 A;  2FYU G;  1IC2 A;  1RY3 A;  2ZXX A;  2ZVO B;  2FKW B;  3GW6 A;  5E79 H;  5APW A;  5KAI H;  3L73 E;  1GL2 C;  1BE3 E;  3S4R A;  5B5E E;  1JMB A;  1VQ7 P;  1KIL D;  3HD7 B;  3KYQ A;  4ASV A;  2N9Y B;  2QEX P;  2ITA A;  3EFF K;  4M3L A;  2KSE A;  1U57 A;  3WU2 H;  1QLE D;  2JWA A;  5AVW B;  1N86 A;  1DD3 A;  5KJ7 A;  2E43 A;  1L0L G;  2H8P D;  4IFM A;  3I55 P;  2HYN A;  3A5T A;  1HVV A;  1N7S B;  3CXH D;  4NPF X;  3GHG A;  2NPS A;  1H8A A;  1L2P A;  4MN4 C;  1E79 H;  3H6P A;  2YMK A;  4W7Z A;  3TF5 A;  4U3F D;  2LR2 A;  2Q7C A;  2O01 J;  4Z1M H;  1VF5 C;  3A2A A;  1SS1 A;  1S1C X;  3AE5 C;  2HOD A;  1KB9 I;  1YBK A;  2V4H A;  3JCU E;  1BGY E;  3H1K G;  2KS1 A;  3RK2 C;  1YJN P;  1S72 P;  3VN0 A;  1L4A A;  1KYO D;  2H43 A;  1JTH B;  1NU1 E;  2QM7 A;  2KSJ A;  2E76 B;  3KXD A;  2IYP A;  1PP9 D;  1DH3 A;  4JPZ B;  1T3J A;  4DOJ A;  2AEF A;  1RE4 C;  2WSC J;  2R3S A;  3L71 J;  1NOH A;  1SQB G;  2M0B A;  3L73 D;  1XTC C;  1YTZ I;  2YXR B;  1BE3 D;  3P7K A;  2H7H A;  3CXH H;  3QH9 A;  4N3Y B;  2IZ1 A;  1FZF A;  3H1J G;  1AQT A;  3OAK A;  4H0L D;  1VQ8 P;  1DEE G;  1KQL A;  3L70 D;  3V2Q A;  1DX7 A;  1IFP A;  2PFX A;  2KNC B;  1ZOY C;  3H1K E;  2OTK E;  2Z5I A;  2W6A A;  4ZNC A;  2RH0 A;  1H88 A;  1GL2 D;  3VP9 A;  1LTJ A;  5AW8 B;  3A0H H;  3TGU G;  1YQ3 C;  2KLU A;  4DJG A;  2Y0D A;  4GOE A;  1LTT C;  3FXE A;  1EXJ A;  3P8C E;  1BGY D;  2BEQ D;  3AED C;  3KQG A;  3N4X A;  3VMZ A;  1W2E A;  1NU1 D;  2ZAE B;  1URQ C;  1SQB E;  3CWB J;  2Z4E A;  4D6T J;  2JJL A;  1JM0 A;  1RQV A;  2WTY A;  5B5E H;  1MKM A;  2B87 A;  3V2R A;  3AE6 C;  2FBW C;  1HGV A;  3TNU A;  1VF5 D;  2J5U A;  1HH0 A;  2ZYD A;  3ZDM A;  3CX5 I;  1IK9 A;  2B9B A;  2WT7 A;  5AVV B;  3RK2 D;  1LTI C;  1R5L A;  2WPR A;  4C7N B;  3R2P A;  4WY4 C;  1J1E C;  3B71 A;  1PIX A;  4EIJ A;  2YKO A;  2HR3 A;  1S3J A;  1OWA A;  5AVU B;  3IR9 A;  2QVA A;  2QG4 A;  3JCU H;  2Z5H A;  4OH8 B;  1X8Y A;  3GHG B;  1NTM J;  5KLV J;  1NKN A;  5C39 A;  4DT0 A;  2ZFC A;  2RKL A;  3GF7 A;  1BDD A;  1VQ5 P;  2HOD B;  1RF0 C;  2ZXE B;  2Q6Q A;  3P8C D;  5AVZ B;  3AEF C;  1EZV I;  1OFC X;  2FYN B;  4AUW A;  5CCG A;  2M3E A;  4H13 C;  1G2C B;  3CCE P;  3WMM 0;  3I5C A;  2QJP B;  1YJ9 P;  3CMA P;  4R4L A;  1W5C E;  1YTZ T;  1HJB A;  2POH A;  1NTK J;  1CSB A;  3TK1 A;  2ZYA A;  4ZMD A;  1JY3 N;  4HB1 A;  2C0X A;  2LXC B;  1S5L E;  1BSN A;  3Q5R A;  5AW9 B;  4WWI A;  3CCM P;  3VTP C;  3PHL A;  3L72 E;  1NAY A;  3U59 A;  2O3J A;  3H1H J;  4IL6 E;  1Q90 D;  3L37 A;  3H32 A;  3HUS A;  2P58 A;  2A45 G;  2KK7 A;  4RO0 A;  1PPJ G;  4UB6 E;  1URQ D;  1VPC A;  3FGA D;  3H25 A;  4KHX A;  1AJY A;  1KIL A;  1HUC A;  3QWO C;  2E42 A;  1AFO A;  3L74 G;  1P84 E;  2G3A A;  1SQV K;  1EDL A;  1RE3 C;  1Y8A A;  1FZC C;  3ABV C;  2FYU K;  1X9V A;  1LTJ B;  5DJT B;  2R5B A;  3L75 G;  2XZR A;  3BAT A;  1N7S A;  3KDP B;  1KQF B;  3HTK B;  3RGU A;  2AEJ A;  2OGU A;  3V5B A;  4WY4 D;  1SQP J;  1FDI A;  3MTU E;  3H1I D;  1JY2 N;  2OYI C;  5CHX A;  3T97 B;  3ITK A;  3K5B A;  3PP5 A;  5AW1 B;  3AEA C;  2KYV A;  3TSI A;  2E75 B;  3M0D C;  2KLV A;  1OVR A;  3JC2 2;  4B86 A;  1Q81 Q;  1L0L K;  3AEG C;  1W2B O;  1IFI A;  4GKG A;  3CXH I;  1JTH A;  3TNU B;  3B5N C;  1FU1 A;  5KAF E;  3L72 D;  5AVS B;  2JEE A;  3GLM A;  5AVX B;  3P32 A;  2QRX A;  4K35 A;  2JO1 A;  1MV8 A;  1N2D C;  3RBZ A;  1Y47 A;  1MUU A;  2QJK B;  4TT3 H;  3L74 E;  4H13 D;  2YKP A;  4N78 E;  3IN6 A;  1QL1 A;  3G9R A;  1KYO I;  1NO4 A;  1NTZ J;  1USD A;  1VQK P;  2M5A B;  2KI7 B;  1GU4 A;  3H1L E;  1G1J A;  2KOG A;  1OW8 A;  3VMX A;  3SWK A;  1AQ5 A;  3Q3D A;  1ZV8 A;  1RH5 B;  3M9Q A;  1NVO A;  4IFD K;  1GTW A;  2BAS A;  1WRG A;  2A06 D;  3C1L A;  1VQM P;  4K3A A;  3CCU P;  2KNC A;  1ZR2 A;  4EOT A;  1SQQ J;  3BVH A;  5AW3 B;  1S5L H;  1LWU C;  5AW6 B;  2XU6 A;  3M9H A;  1NTM K;  1OX3 A;  5KLV K;  3NXS A;  4IL6 H;  3CCL P;  5BU8 B;  2C0W A;  3NFQ A;  3MD0 A;  1ZME C;  1LT9 C;  1J1D C;  2FXP A;  1EDI A;  2RN0 A;  5KKZ C;  4O9B A;  4UB6 H;  1DD4 A;  1LGH B;  2K9J B;  2OQQ A;  1Q7Y Q;  3L71 G;  1SQX E;  1E5W A;  4KT0 J;  2IYO A;  5H2F H;  2QJY B;  1R5S A;  2K1A A;  5CCH A;  1QL2 A;  3H32 B;  1P84 H;  3M9B A;  4LLH A;  1NTK K;  4N78 D;  2YNY A;  1NHL A;  3FWL A;  1BCC D;  3AE1 C;  2BCC G;  2IBZ I;  3CCR P;  1EDJ A;  3F89 A;  5KLI C;  1KIL B;  4IOI H;  3H1L D;  1WT6 A;  2I8D A;  2IBZ G;  4JYC A;  4C7N A;  4U3F J;  2P10 A;  3B5N D;  3L35 A;  1IFN A;  4L74 A;  3V2P A;  5AW4 B;  2ZT9 C;  2K88 A;  1FE6 A;  1J2J B;  2FFD C;  1IFJ A;  1FOS E;  2MKV A;  3V2N A;  1PZQ A;  4I2L C;  4Y99 C;  5KAF H;  1U7J A;  3CWB G;  5AVT B;  1PP9 J;  4D6T G;  1YYC A;  1QGK B;  2N1T C;  5AW2 B;  1JY2 O;  1SQV E;  4GOF A;  1N7L A;  2FYU E;  4EYY Q;  1SQX D;  3L73 J;  1NGM B;  1G2C A;  1VQL P;  1BE3 J;  2ZYG A;  1AVY A;  2YIU C;  2OTJ P;  3CCS P;  3KHU A;  3II6 A;  2BCC E;  1YQ4 C;  3N7N A;  1FAV A;  1L0N K;  2H89 C;  1VQ6 P;  1N73 B;  5APT A;  3L70 J;  3F5H A;  1L0L E;  1S2E A;  4L76 A;  4H44 C;  4ZKU A;  3CC7 P;  1PGP A;  1BDC A;  1NTM G;  5AW7 B;  4H0L B;  5KLV G;  2NPS C;  1FJK A;  2HFE D;  2E74 C;  4ZKP A;  3B8E B;  2QM8 A;  2OYH B;  4I7Z B;  1VQ4 P;  2QE7 H;  1HF9 A;  2XND H;  1YHQ P;  1BGY J;  3JSV C;  1NTZ K;  4Y28 J;  2N9B A;  3CI9 A;  3Q5S A;  3BRT B;  1ZN5 A;  1NU1 J;  1GL2 B;  3MUD A;  2P7J A;  4L75 A;  1KB9 E;  2VRS A;  4PJ0 E;  1L4A C;  4BRY B;  3BAS A;  4WY4 A;  1BSH A;  3HTK A;  3D6Z A;  1NTK G;  2NRG A;  1SQV D;  3UIA A;  1VQN P;  2FYU D;  2WSS H;  5APU A;  1CZQ A;  3T97 A;  1JUN A;  1FZB A;  1SQQ K;  2ZT9 D;  2KIK A;  4PD4 E;  4YXW H;  2E5Y A;  3H1H G;  1SFC C;  2IFM A;  3V4W A;  1H0T A;  4KJM A;  2AXC A;  3RL0 C;  1NTM E;  1VF5 B;  3H1J E;  2G8Y A;  3CCV P;  1H89 A;  4JBZ A;  5KLV E;  1RF0 A;  1L0L D;  2FXO A;  1FZG A;  3OW2 O;  1JCD A;  2N1T D;  3RK2 B;  3VYI A;  4UB8 E;  4YTP C;  4N6J A;  2WSC H;  4DCK A;  3RK3 C;  1Y9B A;  4BXL A;  1FS0 E;  4GOD A;  2JP3 A;  3TGU E;  2M5A A;  3S9O A;  1NTK E;  1SQP G;  3M91 A;  3H1K D;  2CPB A;  1M56 D;  1NKZ B;  3KZI E;  2O1J A;  4W7Y A;  2MJZ A;  5M1B A;  3M06 A;  4H44 D;  3H1H E;  1L0N G;  3AE3 C;  2NPS D;  2JDI H;  2FYZ A;  3RK3 E;  2E74 D;  4I6M C;  1GW3 A;  3VMY A;  1EZV G;  1SQB D;  2XV5 A;  4PD4 D;  2QIW A;  3AE9 C;  3HE5 B;  2WVR A;  1OXZ A;  3U1C A;  2QA4 P;  2AEM A;  1RE3 A;  1SLQ A;  1GD2 E;  2YO2 A;  3CL3 D;  2R44 A;  5CBO A;  2WSF J;  2ZJS E;  4PV1 C;  3H1J D;  2K9J A;  1L4A D;  1KN7 A;  1UIX A;  5BU5 A;  3L4F A;  2GM4 A;  3MHV A;  1NTZ G;  2D2C C;  1R8E A;  2WQY C;  1URQ B;  1KB9 H;  4PJ0 H;  3PRJ A;  2KB7 P;  3G71 P;  4OGQ C;  3BCC G;  1ZR4 A;  1SFC D;  1M1K Q;  3TGU D;  3AE7 C;  5CJ4 A;  3EWK A;  1L0N E;  1UII A;  3RL0 D;  3H1I J;  3CC2 P;  3B5N A;  3Q2Y A;  1SQQ G;  1IK7 A;  2IZ0 A;  2WPQ A;  1DIP A;  1G1I A;  5GTI E;  1LT1 A;  3PTZ A;  1KQS O;  1TU3 F;  3RBX A;  4PD4 H;  4YPC A;  5CJ0 A;  5CCG C;  1EZV E;  2Y0C A;  4HH2 A;  1RF1 C;  3FWN A;  4WY4 B;  4YXD C;  1J1E B;  2M3B A;  4JYB A;  2HPC A;  1EC5 A;  2H88 C;  3RK3 D;  1M1J C;  3CPW O;  1HTL C;  3L72 J;  1FJP A;  1JEK A;  2WPV B;  5CBN A;  4UB8 H;  1NTZ E;  5APY A;  1H0T B;  3CLQ A;  1JNM A;  4GDO A;  4DZO A;  2WIT A;  1OVU A;  5APQ A;  2C9N Y;  3HUS C;  2M8R A;  3CC4 P;  1PPJ E;  2R32 A;  1KMI Z;  3BCC E;  3A3Y B;  1YIJ P;  3U1A A; 
#chains in the Genus database with same CATH homology
 2QJY C;  4YTP C;  1ZOY C;  4H13 B;  1OW8 A;  2YMK A;  4H0L B;  1FDO A;  2G3A A;  2P10 A;  3D70 A;  2QJK C;  3Q3D A;  4OGQ C;  1Y9B A;  2E74 C;  2O01 J;  3ABV C;  4Z1M H;  3D6Y A;  1GMJ A;  1VF5 C;  3GF7 A;  1ZP0 C;  1KOR A;  1KTM A;  4I7Z B;  3GMA A;  1S1C X;  2ZT9 C;  3AE5 C;  1HF9 A;  1YQ3 C;  2E75 D;  2JP3 A;  3AE7 C;  2E76 D;  1PL5 A;  3R4Y A;  1KQF B;  1EXJ A;  3AEF C;  3EWK A;  4Y28 J;  1S5L X;  3S9O A;  2BEQ D;  3AED C;  3Q5S A;  2K9Y A;  4PV1 D;  3Q1M A;  1FDI A;  3Q2Y A;  1IK7 A;  3LW5 J;  1ZRT E;  2MKV A;  4H13 C;  4IL6 X;  1DIP A;  1K05 A;  3T97 B;  3SFD C;  2NZ2 A;  1TU3 F;  4H0L C;  3AEA C;  3C8V A;  2E75 B;  2D2C D;  2E76 B;  5M1B A;  3SFE C;  1RQV A;  4XFJ A;  4H44 D;  1MKM A;  2IDB A;  4R4L A;  4I7Z C;  3AE6 C;  1ZME C;  4YXD C;  3D6Z A;  4RKU J;  2BEZ F;  1KIL E;  2FBW C;  4PV1 B;  3AEG C;  2FXP A;  1K04 A;  1OW6 A;  1VL2 A;  5L8R J;  3AE3 C;  5KKZ C;  4U7J A;  1NYH A;  2H88 C;  2WSC J;  3AE2 C;  1EXI A;  4OGQ D;  3RK3 E;  1DD4 A;  2WSE J;  2E74 D;  2OQQ A;  1NGM B;  2FYN C;  1VF5 D;  3Q5R A;  2QSI A;  2J5U A;  1WMK A;  2D2C B;  3IAO A;  2ZT9 D;  4KT0 J;  2WPV B;  2YIU C;  1OMI A;  2QIW A;  4H44 B;  3AE9 C;  3GLM A;  1KQG B;  3O6Q A;  1Q90 D;  2QJP C;  1YQ4 C;  3Q5P A;  1OW7 A;  2E75 C;  2E76 C;  2JO1 A;  3AEE C;  4GDO A;  4R4M A;  3AEB C;  3AEC C;  4TT3 H;  4OGQ B;  2WSF J;  2E74 B;  2H89 C;  3B71 A;  2V7Q J;  4H13 D;  4PV1 C;  1VF5 B;  3D71 A;  3AE8 C;  1U57 A;  1PIX A;  2G8Y A;  2ZT9 B;  1JB0 J;  4H0L D;  3AE1 C;  1UIX A;  1HJ0 A;  3IN6 A;  1DD3 A;  3FGA D;  3G9R A;  1KMI Z;  3GF3 A;  3RL0 g;  3H25 A;  2D2C C;  1AJY A;  1R8E A;  1PV3 A;  5KLI C;  3AE4 C;  4H44 C;  2WQY C;  1RQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...