4IL6X

Structure of sr-substituted photosystem ii
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
40
structure length
40
Chain Sequence
b'TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
molecule tags Electron transport
publication title Structure of Sr-substituted photosystem II at 2.1 A resolution and its implications in the mechanism of water oxidation
pubmed doi rcsb
total genus 14
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2012-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4il6X00
2WSCJ 2E74B 4H13B 2ZT9B 2K9YA 2QIWA 2WSEJ 2E76B 4Y28J 2WSFJ 2WPVB 4PV1B 2QSIA 2FYNC 4RKUJ 2D2CB 5KKZC 2QJYC 5L8RJ 3C8VA 2QJPC 4KT0J 2YIUC 1S5LX 2E75B 4I7ZB 3LW5J 4H44B 1ZRTE 2QJKC 1VF5B 4IL6X 1JB0J 4H0LB 5KLIC 4OGQB 2O01J 1Q90D
chains in the Genus database with same CATH superfamily
1VL2A 4HKZH 1RHZB 1Q7YQ 3AEBC 3AE5C 5AVZB 1J1EB 2A06D 3USSA 2A06G 4O9BA 1GL2A 3KQGA 4PD4E 1NTZE 1X0TA 2E5TA 2FYUG 4Y28J 3D6ZA 1OVRA 1BCCJ 2Q3EA 2YO2A 3AE6C 3B8EB 1H0TA 1NU1J 2FYNC 3V2PA 1ZV8A 5GTHE 1CI6B 4PD4H 2QJKB 1N73A 2WTYA 2HPCA 2WSSH 2XZRA 3SWFA 3VOPA 3C8VA 3EFGA 3CCRP 2Q3IA 2KI7B 2ZXXA 1LTJC 4OGQC 4H0LC 3GF3A 2IX7C 5APXA 1N2DC 1BE3E 3KXDA 3L75E 1P84E 3CLQA 3HD7A 4GOEA 2PAJA 1EZVE 3S1KA 2Q1KA 3CWBE 3H1JG 1IK7A 1JOCA 3AEEC 3H1JD 1P84H 4EIJA 5KLVG 2H43A 4JBZA 5TJHA 1A02F 2E74B 2GUVA 2IBZG 1SQBG 1SQXG 1SQVJ 1BCCD 2N1TC 3EFFK 3ZDMA 5AW0B 2I1KA 1P84D 5H2FH 1KC8Q 2W83C 5KJ7A 3F5HA 2JKVA 1ZR2A 2YMYA 1UIXA 4JF7A 1AQ5A 4YXWH 5CCGC 3HTKA 3B5NC 3CX5E 4D6TG 2E74C 1MFTA 1YJ9P 4D6TD 3II6A 3L70G 3TNUB 1OW6A 1JY2N 2Y0CA 3L72J 1VPCA 2N1TB 2KLUA 2IBZE 4RJTA 2OYIA 3MD0A 3D70A 3TSIA 1A02J 4GODA 2FFDA 1J1DC 1NVOA 2R5DA 1P84I 3F89A 2P1JA 3SFEC 1CZQA 2HYNA 1SQPE 3L73J 1VQ4P 4PD4D 2P7JA 1KB9E 3OA7A 4IL6X 4LGDE 4UB8H 4JYCA 5AVQB 5AW1B 5AW7B 3G4SP 2OYHC 3CC4P 1HJBA 3H1HG 3LW5H 2ZT9D 1PP9G 2AXTE 1R5LA 3AEAC 1OX3A 2KZIA 1NTMD 3BASA 3RGUA 2PP6A 3M9HA 3VYIA 3E1RA 1AQTA 5AVXB 1GMJA 2P67A 5GTHH 1VQOP 1S9KD 4OH8B 2NPSB 1KQLA 2OTKE 2FXMA 3G3ZA 4L75A 5CCHD 4WY4A 2OYIB 3A0BH 4BXLA 1GZLA 3CCMP 1T2KC 2IFMA 5APTA 2N9BA 3FX0A 1JNMA 3CCEP 1ZLLA 3GG2A 1GU5A 1K8AQ 5TISE 4EOTA 4MN4C 3C1LA 2WT7A 1Q82Q 2ZYGA 3PP5A 3HD7B 3H1IJ 3H32B 4U3FJ 2OQQA 4BWNA 1M7LA 1QVGO 4OWFA 2KP8A 3M9QA 3JSVC 4H13D 3JCUE 3H1JE 4Y99B 3MP7B 3BCCJ 5C39A 3CMAP 1PPJD 1BE3J 2R44A 2ZAEB 2KLVA 4GT1A 3BRTB 1BGYG 1T8ZA 1YTZI 2JWAA 1YJNP 3H32A 1BGYD 3L75D 1OVVA 1H88A 3BCCD 1JY3O 4K35A 2H8PD 2O1KA 5KLVE 1USDA 3TDKA 5H2FE 1RE4C 1SQBD 1L0NJ 1TU3F 5KKZC 1JMMA 1SQBE 2PRRA 3NMDA 2P58A 3RK2B 2JDIH 1BGYE 1JTHB 4I7ZC 4R4LA 1L0ND 1SQXK 4N6JA 2HODB 3VMYA 2Y0EA 4YTPC 5CCGD 4H44C 3RBZA 3V2RA 1KFMA 2YO3A 2QRXA 1JCDA 1LWUA 1CI6A 1NO4A 3KZIH 2A06E 3L74E 4XA4A 3OJAB 3RK2C 2W8ZA 1JCCA 1GL2D 1KILC 1NTMK 2JR8A 4YXDC 1U7JA 3CD6P 1FAVA 1N86A 2NZ2A 2LR2A 1NTKD 2WQYC 3GW6A 2AXTH 4L74A 3LW5J 1FE6A 2FKWB 1JTHA 3P7KA 3AE9C 1EQ7A 1U7MA 3FWLA 3PH0A 3VP8A 1ZRTD 3K5BA 1IFJA 3L73G 4CPGA 1WMKA 4LC1A 3FWNA 5E79H 1BSHA 1BSNA 4TT3H 4BRYB 3M0DC 1KZUB 2O01J 4OGQD 4WVZA 1NTME 3RK3D 1M57D 1X79B 2H89C 1IFIA 4ASWA 5E79E 4EI2A 1S72P 2KK7A 5KTBA 5BU8B 1KB9D 5DJUB 1SQPD 3CC2P 1NKNA 1FJPA 1SQXE 3H1LJ 4XFJA 1KTMA 3A3YB 2FYUJ 2HG5D 2QSIA 2YKPA 3N4XA 3KDPB 1AVOA 1JO5A 1K05A 1NTKJ 2XDJA 1EDIA 5GTIE 1GTWA 3H1LD 2P2UA 4D6TE 3H1LG 2Q7CA 1PV3A 4M3LA 5KLVK 3CX5D 1NYHA 1PIXA 2YNYA 3BCCG 3VP9A 1YQ4C 3A7OA 3FXDA 2KNCB 2RKLA 1YJWP 1SQQJ 1BCCE 1PGQA 5KLVJ 1RE4A 2B9BA 1N73B 1M8OB 4H44D 1LT9A 1M90Q 4UB6E 2J59M 2FYNB 1KYOE 3B4SA 3L75J 5KJ7D 2JEEA 1HTLC 1GW4A 2CK3H 1RE3A 2YIUB 3CCUP 1L4AD 1PFIA 1D7MA 1WRGA 1SVFA 2AEFA 3CWBD 1KILA 2KS1A 3KZIE 2HLOA 3OW2O 1EZVD 1JY2P 3O8ZA 4UB6H 2XKMA 2E76B 3B71A 1QLED 2FYUD 1DEBA 3L36A 3O6QA 2A45I 3GF7A 4U3FD 1Z56A 3L71G 1IFDA 1SFCC 4WB4A 2O1JA 2M8RA 1K73Q 2LKMA 5CHXA 5CCHA 5APUA 4AQRD 4Z1MH 3VMAA 5AW8B 2W27A 4DOJA 1DD3A 5L8RJ 1NTZJ 2KNCA 3L70J 1FU1A 2HR3A 1N7SD 1EXJA 3IAOA 1LJ2A 3G9RA 2E42A 2AEMA 1KQSO 2WITA 4BRYA 1M1JA 2C0XA 1Q2NA 1FZCA 4IL6H 1NTZD 4DCKA 1NAFA 4R4MA 1NTZG 4RESB 4WBAA 1SS1A 3WMM0 3H6PA 2K9JB 3U59A 1NGMB 1HBWA 3H1HJ 1VQ7P 1PP9J 1K04A 4ZKUA 5KAIH 5CCHC 1FZCB 1XTCC 1PL5A 1LTGC 2IFNA 1EDKA 1FDIA 1J2JB 1L0LE 1NU1D 1M1JB 1VF5C 3RL0B 1NKZB 1EDJA 5KAIE 3CCJP 1VQKP 1LWUB 3NTNA 3S4RA 3CXHH 1OFCX 3H1ID 3LIDA 4DJGA 1DH3A 2Q6QA 3H1IG 5AVSB 1AA0A 2N9YB 2D2CB 2NPSD 4LLHA 3S9OA 4KHXA 1KB9H 3HRNA 2OARA 1M1JC 3IF4A 2QE7H 4UB8E 3CXHE 5AW6B 2MKVA 4OVNF 3RK3B 3RL0C 1T6AA 3TYYA 2XV5A 2ZVOB 2ZYAA 1GK4A 4I6MC 2V4HA 3V2QA 1BGYJ 1KYOH 3Q5SA 4ZKPA 1FDOA 1NTKG 1URQD 2FY8A 1QEXA 1W2EA 1SQVG 1SQBJ 3RK3C 3B5ND 3H1HD 1HGVA 1SQVD 3V2NA 4N78D 4C7NB 1SQQG 3MUDC 1SFCA 3TGUE 1SQQD 1M1KQ 2WWWA 2BASA 2O3JA 2BCCE 3A0BE 3H1KE 4WY4D 1SQPJ 1ZN5A 1M56D 1ZW0A 2N1TD 3HD7C 3L73E 1VQMP 2W90A 1QVFO 1X8YA 2YXQB 4EDFA 1LTAC 1GD2E 3L72D 4PV1D 1IC2A 1KORA 1LT9C 2WPVB 1SQPG 3KYQA 3LIEA 1G2CA 1LTIC 2ZXEB 4ASVA 2B89A 3Q3DA 4RKUJ 3PTZA 1X22A 3A2AA 3L4FA 2QM8A 4A7PA 3L71J 3H25A 5KKZB 2JWDA 1NTKK 3OAKA 4H0LD 1PPJG 1EXIA 3PJSK 2FYUK 5EFWB 1PZQA 1S4XA 2B87B 3MGNA 1PGJA 2G8YA 2POHA 1K9MQ 1HVVA 1S2EA 4U7JA 3V4WA 3Q1MA 2Q9IA 5CJ0A 3G71P 3RBXA 3O6QB 2Q5UA 3CCLP 1Y9BA 1KQGB 4JYBA 2E75C 1KILB 2KS1B 4GKGA 1NTMG 1ZP0C 1U57A 2FYZA 1N7LA 2XNXA 2YMKA 2YKOA 3EQ2A 2A45G 2KYVA 2Y9YA 3MHVA 3GMAA 3NFQA 2QEXP 3L70E 3AEGC 1Y8AA 1DEEG 1GK6A 1RH5B 3AE4C 2YKQA 3HTKB 2V7QJ 3R2PA 2HFED 4W7YA 1X9VA 5KJ7C 1SQVK 4PD4I 1EDLA 3L71D 3M9BA 1PGPA 2O01H 2QJYC 2YXRB 1YI2P 3Q5RA 3D71A 3Q2YA 2OTJP 1GW3A 1J1EC 1SQQE 1MKMA 1USEA 2FFDB 1KN7A 3H1HE 3WU2E 1FOSE 1LTJA 2KZJA 4RO0A 1HH0A 4JPZB 3R4YA 2DW3A 3TGUJ 2E75D 1QX8A 3HE4A 1JUNA 2W6JH 1MV8A 1G2CB 1NH4A 2IYOA 2R3SA 2RN0A 2WSCJ 2D2CC 3AE8C 3IFMA 1RQVA 3P8CE 2K1AA 1LTTC 4N3YB 2WSFJ 2BEQD 3L35A 4GOFA 5GTIH 1H8AA 3BVHA 2OTLP 4JQ0D 1N8RQ 1CW5A 1KB9I 1L0LG 1YTZT 1JY3P 2M3EA 1L0LD 3RL0g 2L5GB 3L74J 1HWTC 3C9IA 2QVAA 4L73A 1BDDA 2K3RA 1MUUA 3KHUA 1LTBC 4W7ZA 3WUTA 4B86A 5AW4B 1LP1A 2B88A 2YIUC 4AYCA 1L0LJ 1FS0E 4PJ0H 2A45H 1KILE 3SWYA 3M06A 3M0DA 1MZ9A 4PV1C 5BVZA 3CX5I 3MZWB 2FBWC 1OXZA 2E76C 3B5NB 1OZHA 1L4AA 3CMEP 1DIPA 4PJ0E 1KILD 1SFCB 2QJPB 1OW8A 2I1JA 4L76A 3RK2D 2L91A 2IZ1A 2WSEH 2ZYDA 1RF1B 3VTPC 5CMZA 2P10A 5BU5A 5CBOA 3B5NA 2PGDA 5APYA 1VQ8P 1SLQA 1PP9E 3ABVC 4U3FG 5AW2B 2WPRA 5AVTB 2GM4A 3D6YA 5B5EH 2C9LY 1BDCA 1N7SA 1YBKA 2WVRA 4HYTB 3AECC 4IFMA 2Z5IA 1RF0A 2G3AA 3H1KJ 2CPBA 4IL6E 3RL0D 1QL2A 4NPDA 5CJ4A 1RF0C 2B87A 2NPSC 4KT0J 1KYOD 1RQUA 5APVA 2FXPA 2I8DA 2H7HA 2M5AA 2OYIC 3AEDC 3PHLA 3M91A 4W80A 5AW9B 1IFNA 1YQ3C 1VF5D 1VF5B 2BCCJ 3IR9A 5B66H 3P32A 3U1CA 2Y9ZA 1VQPP 1IJDB 1R5SA 2KXPB 1IZNB 3CWBJ 4IOIH 3CCSP 1JMBA 3VMXA 2W6AA 3L37A 1JEKA 4HJGH 3NXSA 1KQFB 2K37A 2WPSA 2BCCD 1JM0A 3TGUG 3V4QA 3CPWO 1KD1Q 2BCCG 2M0BA 1N7SB 3SSUA 4ZMDA 3A0HE 3BRVB 3TGUD 3JC22 4N78E 2Z4EA 1FZEA 1YIJP 2QIWA 1IO4A 1E5WA 1URQB 2NPSA 2KSJA 2WSEJ 3MUDA 3T97A 2C9NY 2WZ7A 1FBMA 2J5UA 1EZVG 2XU6A 3L70D 1S1CX 5CBNA 2KSEA 1LTSC 4XE5B 5AVRB 3UIAA 2FFDC 1DD4A 1N7SC 2ZT9C 1ZXGA 2IYPA 2MJZA 3AE3C 1URQA 1Y47A 2D2CD 3T97B 1CSBA 5AW3B 1NOHA 5KAFH 1YITP 3VN0A 2R3CA 4I7ZB 2JJLA 1LNQA 1NU1K 1SFCD 3SWKA 5APSA 1ZRTE 2J58A 1EZVI 1PP9D 4GIFA 4HB1A 2N1TA 3KPEA 3V5BA 1HJ0A 1NU1E 1LT9B 3Q5PA 3WU2H 3TNUA 2KIKA 1KYOI 1OMIA 5B5EE 1LTJB 2R32A 4OGQB 1LT1A 2Z5HA 1LGHB 3AE1C 4IFDK 2FXOA 1L2PA 2ITAA 2K9YA 2RMZA 3L74D 1GU4A 3MTUE 3HE4B 1OW7A 2ZFCA 2E43A 1VQ9P 1SQPK 1NU1G 2IDBA 1RE3C 2ZJSE 1R8EA 1VQLP 2K9JA 1NWQA 3PLNA 1HGZA 1QL1A 1SQBK 5B66E 2LXBA 4KJMA 2AXCA 2QJPC 3H1KG 2KUBA 1AVYA 1W2BO 3H1KD 1FDMA 5KLIB 1S5LX 2E75B 5APQA 5M1BA 3L75G 1VQ5P 1NAYA 1T3UA 5AVUB 2QG4A 3A5TA 2V7QH 5K5GB 3M0AA 1JB0J 1L4AB 3GLMA 3P8CD 4DT0A 3HUSC 2KB7P 5KLIC 1GDTA 1DX7A 1IFPA 1Q86Q 1WT6A 3CXHD 2LXCB 3FXEA 1E79H 1OIPA 1JY3N 2E5YA 3RK3E 1L0NG 1FZAA 5AVWB 1GL2B 1JY2O 2M3BA 3H1IE 1SP4A 4AUWA 1AJYA 2OYHB 4IFFA 1N73C 1XTGB 1S5LH 3V6IA 1SQQK 5DJTB 3TF5A 1S9KE 2VRSA 4I1LA 3I55P 1GL2C 2ZVNB 3BATA 1FOSF 2WMMA 3HD7D 1HF9A 1G1JA 3L71E 2IBZI 4WY4C 4Y99C 2CPSA 1S3JA 1G1IA 3GHGA 5TISH 3CC7P 2OGUA 2QJKC 1NTZK 2SPZA 3AEFC 2K88A 2O01N 3U1AA 1KV4A 1URQC 2IPPA 3JCUH 2QA4P 4C7NA 4DZOA 4H0LB 4WY4B 2WT7B 1ZOYC 1FZFA 2OYHA 2OYOA 1BCCG 2IBZD 1OWAA 2R5BA 2IZ0A 3W67A 4H13B 2ZT9B 3CX5H 3GHGB 2JO1A 2RH0A 1PGOA 3VMZA 1ZR4A 4U3FE 4PV1B 3N7NA 1T3JA 2FYUE 1W5CE 2H88C 3CXHI 3IN6A 3P8MC 1UIIA 1NTKE 3EWKA 2C0WA 2E76D 2KOGA 3HE5B 3ITKA 4H13C 3CCVP 1RF1A 1FZCC 4TLFA 3GHGC 1IK9A 1YHQP 1RF1C 2WSCH 3E7KA 2GUSA 3AE2C 4QMAA 1T2KD 1FC2C 3E1IA 4I2LC 2WSFH 4H44B 1LWUC 3HE5A 3QWOC 5KAFE 3L72E 2AEJA 1L0NE 1BE3G 1MFZA 2PFXA 3FGAD 3H1JJ 4K3AA 1BE3D 3SFDC 4HH2A 2UWJE 3CCQP 1KMIZ 1KFNA 3WUUA 5AVVB 1J1DB 3AE7C 3CWBG 2GA1A 2M5AB 1NHLA 3L73D 4ZNCA 1SQXJ 3H1LE 4C7RA 2WPQA 2W6BA 4NPFX 3W68A 1S5LE 4YPCA 5KLVD 3PRJA 1SQVE 3BCCE 1FZGA 3CI9A 4NPEA 3L72G 1FJKA 3TK1A 1LP1B 1L0NK 1SQXD 1H89A 3HUSA 2NRGA 4D6TJ 3L74G 1PPJE 2BEZF 1ZMEC 1NJIQ 1VDFA 1RY3A 1VQNP 1VQ6P 1AFOA 1FZBA 4EYYQ 3G6EP 1L4AC 1AV1A 2E74D 3HUSB 1QGKB 2XNDH 3QH9A 5AVYB 1Q81Q 3WUVA 2JP3A 3MIWA 2Y0DA 3A0HH 1NTMJ 3I5CA 4GDOA 1L0LK 1OVUA 3CL3D 1EC5A 5AW5B 2QM7A 5APWA 1H0TB 4C46A 1IFMA 2HPCB 4WWIA 5CCGA 1HUCA 3I56P 2HODA 1Q90D 2QJYB 1YYCA
chains in the Genus database with same CATH topology
2E75C 1VL2A 2H89C 3AE1C 3AE5C 3AEBC 1ZP0C 1U57A 2K9YA 2YMKA 4Y28J 3GMAA 1OW7A 3D6ZA 3AEGC 2IDBA 3AE4C 4XFJA 1R8EA 1KTMA 2V7QJ 3AE6C 2QSIA 2FYNC 1K05A 2QJYC 3Q5RA 3D71A 3Q2YA 3C8VA 2QJPC 4OGQC 4H0LC 1PV3A 3GF3A 1S5LX 2E75B 1MKMA 5M1BA 1NYHA 1PIXA 1YQ4C 3R4YA 1JB0J 3GLMA 4H44D 2E75D 1IK7A 5KLIC 3AEEC 3RK3E 2WSCJ 2E74B 2D2CC 3AE8C 1RQVA 3B71A 2E76B 3O6QA 2WSFJ 2BEQD 1AJYA 3GF7A 1UIXA 3RL0g 2E74C 4Z1MH 1OW6A 1DD3A 4OGQD 5L8RJ 1EXJA 1HF9A 3D70A 2YIUC 3IAOA 3G9RA 1KILE 3SFEC 4PV1C 2FBWC 2E76C 2QJKC 4R4MA 3AEFC 4IL6X 1DIPA 1OW8A 2ZT9D 3AEAC 4H0LB 1NGMB 1ZOYC 2P10A 1K04A 1GMJA 4H13B 1PL5A 2ZT9B 1FDIA 1VF5C 2JO1A 3ABVC 3D6YA 4PV1B 2H88C 3AECC 3IN6A 4H13C 3EWKA 2D2CB 2E76D 2G3AA 3S9OA 2OQQA 1KQGB 2MKVA 4H13D 1RQUA 4KT0J 2FXPA 3AE2C 3Q5SA 1FDOA 3AEDC 4H44B 1ZMEC 1YQ3C 1VF5D 1VF5B 3FGAD 3SFDC 1KMIZ 3AE7C 1KQFB 1TU3F 5KKZC 2QIWA 2WSEJ 4I7ZC 4R4LA 4PV1D 2J5UA 1KORA 4YTPC 2WPVB 4H44C 1S1CX 2BEZF 1DD4A 3Q3DA 4RKUJ 2ZT9C 3AE3C 2D2CD 3T97B 4YXDC 3H25A 2E74D 2NZ2A 2WQYC 1EXIA 4H0LD 4I7ZB 3LW5J 3AE9C 1ZRTE 2JP3A 2G8YA 1HJ0A 1WMKA 4GDOA 4U7JA 3Q1MA 3Q5PA 1OMIA 4TT3H 1Y9BA 4OGQB 2O01J 1Q90D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC J;  2E74 B;  4H13 B;  2ZT9 B;  2K9Y A;  2QIW A;  2WSE J;  2E76 B;  4Y28 J;  2WSF J;  2WPV B;  4PV1 B;  2QSI A;  2FYN C;  4RKU J;  2D2C B;  5KKZ C;  2QJY C;  5L8R J;  3C8V A;  2QJP C;  4KT0 J;  2YIU C;  1S5L X;  2E75 B;  4I7Z B;  3LW5 J;  4H44 B;  1ZRT E;  2QJK C;  1VF5 B;  4IL6 X;  1JB0 J;  4H0L B;  5KLI C;  4OGQ B;  2O01 J;  1Q90 D; 
#chains in the Genus database with same CATH topology
 1VL2 A;  4HKZ H;  1RHZ B;  1Q7Y Q;  3AEB C;  3AE5 C;  5AVZ B;  1J1E B;  2A06 D;  3USS A;  2A06 G;  4O9B A;  1GL2 A;  3KQG A;  4PD4 E;  1NTZ E;  1X0T A;  2E5T A;  2FYU G;  4Y28 J;  3D6Z A;  1OVR A;  1BCC J;  2Q3E A;  2YO2 A;  3AE6 C;  3B8E B;  1H0T A;  1NU1 J;  2FYN C;  3V2P A;  1ZV8 A;  5GTH E;  1CI6 B;  4PD4 H;  2QJK B;  1N73 A;  2WTY A;  2HPC A;  2WSS H;  2XZR A;  3SWF A;  3VOP A;  3C8V A;  3EFG A;  3CCR P;  2Q3I A;  2KI7 B;  2ZXX A;  1LTJ C;  4OGQ C;  4H0L C;  3GF3 A;  2IX7 C;  5APX A;  1N2D C;  1BE3 E;  3KXD A;  3L75 E;  1P84 E;  3CLQ A;  3HD7 A;  4GOE A;  2PAJ A;  1EZV E;  3S1K A;  2Q1K A;  3CWB E;  3H1J G;  1IK7 A;  1JOC A;  3AEE C;  3H1J D;  1P84 H;  4EIJ A;  5KLV G;  2H43 A;  4JBZ A;  5TJH A;  1A02 F;  2E74 B;  2GUV A;  2IBZ G;  1SQB G;  1SQX G;  1SQV J;  1BCC D;  2N1T C;  3EFF K;  3ZDM A;  5AW0 B;  2I1K A;  1P84 D;  5H2F H;  1KC8 Q;  2W83 C;  5KJ7 A;  3F5H A;  2JKV A;  1ZR2 A;  2YMY A;  1UIX A;  4JF7 A;  1AQ5 A;  4YXW H;  5CCG C;  3HTK A;  3B5N C;  3CX5 E;  4D6T G;  2E74 C;  1MFT A;  1YJ9 P;  4D6T D;  3II6 A;  3L70 G;  3TNU B;  1OW6 A;  1JY2 N;  2Y0C A;  3L72 J;  1VPC A;  2N1T B;  2KLU A;  2IBZ E;  4RJT A;  2OYI A;  3MD0 A;  3D70 A;  3TSI A;  1A02 J;  4GOD A;  2FFD A;  1J1D C;  1NVO A;  2R5D A;  1P84 I;  3F89 A;  2P1J A;  3SFE C;  1CZQ A;  2HYN A;  1SQP E;  3L73 J;  1VQ4 P;  4PD4 D;  2P7J A;  1KB9 E;  3OA7 A;  4IL6 X;  4LGD E;  4UB8 H;  4JYC A;  5AVQ B;  5AW1 B;  5AW7 B;  3G4S P;  2OYH C;  3CC4 P;  1HJB A;  3H1H G;  3LW5 H;  2ZT9 D;  1PP9 G;  2AXT E;  1R5L A;  3AEA C;  1OX3 A;  2KZI A;  1NTM D;  3BAS A;  3RGU A;  2PP6 A;  3M9H A;  3VYI A;  3E1R A;  1AQT A;  5AVX B;  1GMJ A;  2P67 A;  5GTH H;  1VQO P;  1S9K D;  4OH8 B;  2NPS B;  1KQL A;  2OTK E;  2FXM A;  3G3Z A;  4L75 A;  5CCH D;  4WY4 A;  2OYI B;  3A0B H;  4BXL A;  1GZL A;  3CCM P;  1T2K C;  2IFM A;  5APT A;  2N9B A;  3FX0 A;  1JNM A;  3CCE P;  1ZLL A;  3GG2 A;  1GU5 A;  1K8A Q;  5TIS E;  4EOT A;  4MN4 C;  3C1L A;  2WT7 A;  1Q82 Q;  2ZYG A;  3PP5 A;  3HD7 B;  3H1I J;  3H32 B;  4U3F J;  2OQQ A;  4BWN A;  1M7L A;  1QVG O;  4OWF A;  2KP8 A;  3M9Q A;  3JSV C;  4H13 D;  3JCU E;  3H1J E;  4Y99 B;  3MP7 B;  3BCC J;  5C39 A;  3CMA P;  1PPJ D;  1BE3 J;  2R44 A;  2ZAE B;  2KLV A;  4GT1 A;  3BRT B;  1BGY G;  1T8Z A;  1YTZ I;  2JWA A;  1YJN P;  3H32 A;  1BGY D;  3L75 D;  1OVV A;  1H88 A;  3BCC D;  1JY3 O;  4K35 A;  2H8P D;  2O1K A;  5KLV E;  1USD A;  3TDK A;  5H2F E;  1RE4 C;  1SQB D;  1L0N J;  1TU3 F;  5KKZ C;  1JMM A;  1SQB E;  2PRR A;  3NMD A;  2P58 A;  3RK2 B;  2JDI H;  1BGY E;  1JTH B;  4I7Z C;  4R4L A;  1L0N D;  1SQX K;  4N6J A;  2HOD B;  3VMY A;  2Y0E A;  4YTP C;  5CCG D;  4H44 C;  3RBZ A;  3V2R A;  1KFM A;  2YO3 A;  2QRX A;  1JCD A;  1LWU A;  1CI6 A;  1NO4 A;  3KZI H;  2A06 E;  3L74 E;  4XA4 A;  3OJA B;  3RK2 C;  2W8Z A;  1JCC A;  1GL2 D;  1KIL C;  1NTM K;  2JR8 A;  4YXD C;  1U7J A;  3CD6 P;  1FAV A;  1N86 A;  2NZ2 A;  2LR2 A;  1NTK D;  2WQY C;  3GW6 A;  2AXT H;  4L74 A;  3LW5 J;  1FE6 A;  2FKW B;  1JTH A;  3P7K A;  3AE9 C;  1EQ7 A;  1U7M A;  3FWL A;  3PH0 A;  3VP8 A;  1ZRT D;  3K5B A;  1IFJ A;  3L73 G;  4CPG A;  1WMK A;  4LC1 A;  3FWN A;  5E79 H;  1BSH A;  1BSN A;  4TT3 H;  4BRY B;  3M0D C;  1KZU B;  2O01 J;  4OGQ D;  4WVZ A;  1NTM E;  3RK3 D;  1M57 D;  1X79 B;  2H89 C;  1IFI A;  4ASW A;  5E79 E;  4EI2 A;  1S72 P;  2KK7 A;  5KTB A;  5BU8 B;  1KB9 D;  5DJU B;  1SQP D;  3CC2 P;  1NKN A;  1FJP A;  1SQX E;  3H1L J;  4XFJ A;  1KTM A;  3A3Y B;  2FYU J;  2HG5 D;  2QSI A;  2YKP A;  3N4X A;  3KDP B;  1AVO A;  1JO5 A;  1K05 A;  1NTK J;  2XDJ A;  1EDI A;  5GTI E;  1GTW A;  3H1L D;  2P2U A;  4D6T E;  3H1L G;  2Q7C A;  1PV3 A;  4M3L A;  5KLV K;  3CX5 D;  1NYH A;  1PIX A;  2YNY A;  3BCC G;  3VP9 A;  1YQ4 C;  3A7O A;  3FXD A;  2KNC B;  2RKL A;  1YJW P;  1SQQ J;  1BCC E;  1PGQ A;  5KLV J;  1RE4 A;  2B9B A;  1N73 B;  1M8O B;  4H44 D;  1LT9 A;  1M90 Q;  4UB6 E;  2J59 M;  2FYN B;  1KYO E;  3B4S A;  3L75 J;  5KJ7 D;  2JEE A;  1HTL C;  1GW4 A;  2CK3 H;  1RE3 A;  2YIU B;  3CCU P;  1L4A D;  1PFI A;  1D7M A;  1WRG A;  1SVF A;  2AEF A;  3CWB D;  1KIL A;  2KS1 A;  3KZI E;  2HLO A;  3OW2 O;  1EZV D;  1JY2 P;  3O8Z A;  4UB6 H;  2XKM A;  2E76 B;  3B71 A;  1QLE D;  2FYU D;  1DEB A;  3L36 A;  3O6Q A;  2A45 I;  3GF7 A;  4U3F D;  1Z56 A;  3L71 G;  1IFD A;  1SFC C;  4WB4 A;  2O1J A;  2M8R A;  1K73 Q;  2LKM A;  5CHX A;  5CCH A;  5APU A;  4AQR D;  4Z1M H;  3VMA A;  5AW8 B;  2W27 A;  4DOJ A;  1DD3 A;  5L8R J;  1NTZ J;  2KNC A;  3L70 J;  1FU1 A;  2HR3 A;  1N7S D;  1EXJ A;  3IAO A;  1LJ2 A;  3G9R A;  2E42 A;  2AEM A;  1KQS O;  2WIT A;  4BRY A;  1M1J A;  2C0X A;  1Q2N A;  1FZC A;  4IL6 H;  1NTZ D;  4DCK A;  1NAF A;  4R4M A;  1NTZ G;  4RES B;  4WBA A;  1SS1 A;  3WMM 0;  3H6P A;  2K9J B;  3U59 A;  1NGM B;  1HBW A;  3H1H J;  1VQ7 P;  1PP9 J;  1K04 A;  4ZKU A;  5KAI H;  5CCH C;  1FZC B;  1XTC C;  1PL5 A;  1LTG C;  2IFN A;  1EDK A;  1FDI A;  1J2J B;  1L0L E;  1NU1 D;  1M1J B;  1VF5 C;  3RL0 B;  1NKZ B;  1EDJ A;  5KAI E;  3CCJ P;  1VQK P;  1LWU B;  3NTN A;  3S4R A;  3CXH H;  1OFC X;  3H1I D;  3LID A;  4DJG A;  1DH3 A;  2Q6Q A;  3H1I G;  5AVS B;  1AA0 A;  2N9Y B;  2D2C B;  2NPS D;  4LLH A;  3S9O A;  4KHX A;  1KB9 H;  3HRN A;  2OAR A;  1M1J C;  3IF4 A;  2QE7 H;  4UB8 E;  3CXH E;  5AW6 B;  2MKV A;  4OVN F;  3RK3 B;  3RL0 C;  1T6A A;  3TYY A;  2XV5 A;  2ZVO B;  2ZYA A;  1GK4 A;  4I6M C;  2V4H A;  3V2Q A;  1BGY J;  1KYO H;  3Q5S A;  4ZKP A;  1FDO A;  1NTK G;  1URQ D;  2FY8 A;  1QEX A;  1W2E A;  1SQV G;  1SQB J;  3RK3 C;  3B5N D;  3H1H D;  1HGV A;  1SQV D;  3V2N A;  4N78 D;  4C7N B;  1SQQ G;  3MUD C;  1SFC A;  3TGU E;  1SQQ D;  1M1K Q;  2WWW A;  2BAS A;  2O3J A;  2BCC E;  3A0B E;  3H1K E;  4WY4 D;  1SQP J;  1ZN5 A;  1M56 D;  1ZW0 A;  2N1T D;  3HD7 C;  3L73 E;  1VQM P;  2W90 A;  1QVF O;  1X8Y A;  2YXQ B;  4EDF A;  1LTA C;  1GD2 E;  3L72 D;  4PV1 D;  1IC2 A;  1KOR A;  1LT9 C;  2WPV B;  1SQP G;  3KYQ A;  3LIE A;  1G2C A;  1LTI C;  2ZXE B;  4ASV A;  2B89 A;  3Q3D A;  4RKU J;  3PTZ A;  1X22 A;  3A2A A;  3L4F A;  2QM8 A;  4A7P A;  3L71 J;  3H25 A;  5KKZ B;  2JWD A;  1NTK K;  3OAK A;  4H0L D;  1PPJ G;  1EXI A;  3PJS K;  2FYU K;  5EFW B;  1PZQ A;  1S4X A;  2B87 B;  3MGN A;  1PGJ A;  2G8Y A;  2POH A;  1K9M Q;  1HVV A;  1S2E A;  4U7J A;  3V4W A;  3Q1M A;  2Q9I A;  5CJ0 A;  3G71 P;  3RBX A;  3O6Q B;  2Q5U A;  3CCL P;  1Y9B A;  1KQG B;  4JYB A;  2E75 C;  1KIL B;  2KS1 B;  4GKG A;  1NTM G;  1ZP0 C;  1U57 A;  2FYZ A;  1N7L A;  2XNX A;  2YMK A;  2YKO A;  3EQ2 A;  2A45 G;  2KYV A;  2Y9Y A;  3MHV A;  3GMA A;  3NFQ A;  2QEX P;  3L70 E;  3AEG C;  1Y8A A;  1DEE G;  1GK6 A;  1RH5 B;  3AE4 C;  2YKQ A;  3HTK B;  2V7Q J;  3R2P A;  2HFE D;  4W7Y A;  1X9V A;  5KJ7 C;  1SQV K;  4PD4 I;  1EDL A;  3L71 D;  3M9B A;  1PGP A;  2O01 H;  2QJY C;  2YXR B;  1YI2 P;  3Q5R A;  3D71 A;  3Q2Y A;  2OTJ P;  1GW3 A;  1J1E C;  1SQQ E;  1MKM A;  1USE A;  2FFD B;  1KN7 A;  3H1H E;  3WU2 E;  1FOS E;  1LTJ A;  2KZJ A;  4RO0 A;  1HH0 A;  4JPZ B;  3R4Y A;  2DW3 A;  3TGU J;  2E75 D;  1QX8 A;  3HE4 A;  1JUN A;  2W6J H;  1MV8 A;  1G2C B;  1NH4 A;  2IYO A;  2R3S A;  2RN0 A;  2WSC J;  2D2C C;  3AE8 C;  3IFM A;  1RQV A;  3P8C E;  2K1A A;  1LTT C;  4N3Y B;  2WSF J;  2BEQ D;  3L35 A;  4GOF A;  5GTI H;  1H8A A;  3BVH A;  2OTL P;  4JQ0 D;  1N8R Q;  1CW5 A;  1KB9 I;  1L0L G;  1YTZ T;  1JY3 P;  2M3E A;  1L0L D;  3RL0 g;  2L5G B;  3L74 J;  1HWT C;  3C9I A;  2QVA A;  4L73 A;  1BDD A;  2K3R A;  1MUU A;  3KHU A;  1LTB C;  4W7Z A;  3WUT A;  4B86 A;  5AW4 B;  1LP1 A;  2B88 A;  2YIU C;  4AYC A;  1L0L J;  1FS0 E;  4PJ0 H;  2A45 H;  1KIL E;  3SWY A;  3M06 A;  3M0D A;  1MZ9 A;  4PV1 C;  5BVZ A;  3CX5 I;  3MZW B;  2FBW C;  1OXZ A;  2E76 C;  3B5N B;  1OZH A;  1L4A A;  3CME P;  1DIP A;  4PJ0 E;  1KIL D;  1SFC B;  2QJP B;  1OW8 A;  2I1J A;  4L76 A;  3RK2 D;  2L91 A;  2IZ1 A;  2WSE H;  2ZYD A;  1RF1 B;  3VTP C;  5CMZ A;  2P10 A;  5BU5 A;  5CBO A;  3B5N A;  2PGD A;  5APY A;  1VQ8 P;  1SLQ A;  1PP9 E;  3ABV C;  4U3F G;  5AW2 B;  2WPR A;  5AVT B;  2GM4 A;  3D6Y A;  5B5E H;  2C9L Y;  1BDC A;  1N7S A;  1YBK A;  2WVR A;  4HYT B;  3AEC C;  4IFM A;  2Z5I A;  1RF0 A;  2G3A A;  3H1K J;  2CPB A;  4IL6 E;  3RL0 D;  1QL2 A;  4NPD A;  5CJ4 A;  1RF0 C;  2B87 A;  2NPS C;  4KT0 J;  1KYO D;  1RQU A;  5APV A;  2FXP A;  2I8D A;  2H7H A;  2M5A A;  2OYI C;  3AED C;  3PHL A;  3M91 A;  4W80 A;  5AW9 B;  1IFN A;  1YQ3 C;  1VF5 D;  1VF5 B;  2BCC J;  3IR9 A;  5B66 H;  3P32 A;  3U1C A;  2Y9Z A;  1VQP P;  1IJD B;  1R5S A;  2KXP B;  1IZN B;  3CWB J;  4IOI H;  3CCS P;  1JMB A;  3VMX A;  2W6A A;  3L37 A;  1JEK A;  4HJG H;  3NXS A;  1KQF B;  2K37 A;  2WPS A;  2BCC D;  1JM0 A;  3TGU G;  3V4Q A;  3CPW O;  1KD1 Q;  2BCC G;  2M0B A;  1N7S B;  3SSU A;  4ZMD A;  3A0H E;  3BRV B;  3TGU D;  3JC2 2;  4N78 E;  2Z4E A;  1FZE A;  1YIJ P;  2QIW A;  1IO4 A;  1E5W A;  1URQ B;  2NPS A;  2KSJ A;  2WSE J;  3MUD A;  3T97 A;  2C9N Y;  2WZ7 A;  1FBM A;  2J5U A;  1EZV G;  2XU6 A;  3L70 D;  1S1C X;  5CBN A;  2KSE A;  1LTS C;  4XE5 B;  5AVR B;  3UIA A;  2FFD C;  1DD4 A;  1N7S C;  2ZT9 C;  1ZXG A;  2IYP A;  2MJZ A;  3AE3 C;  1URQ A;  1Y47 A;  2D2C D;  3T97 B;  1CSB A;  5AW3 B;  1NOH A;  5KAF H;  1YIT P;  3VN0 A;  2R3C A;  4I7Z B;  2JJL A;  1LNQ A;  1NU1 K;  1SFC D;  3SWK A;  5APS A;  1ZRT E;  2J58 A;  1EZV I;  1PP9 D;  4GIF A;  4HB1 A;  2N1T A;  3KPE A;  3V5B A;  1HJ0 A;  1NU1 E;  1LT9 B;  3Q5P A;  3WU2 H;  3TNU A;  2KIK A;  1KYO I;  1OMI A;  5B5E E;  1LTJ B;  2R32 A;  4OGQ B;  1LT1 A;  2Z5H A;  1LGH B;  3AE1 C;  4IFD K;  2FXO A;  1L2P A;  2ITA A;  2K9Y A;  2RMZ A;  3L74 D;  1GU4 A;  3MTU E;  3HE4 B;  1OW7 A;  2ZFC A;  2E43 A;  1VQ9 P;  1SQP K;  1NU1 G;  2IDB A;  1RE3 C;  2ZJS E;  1R8E A;  1VQL P;  2K9J A;  1NWQ A;  3PLN A;  1HGZ A;  1QL1 A;  1SQB K;  5B66 E;  2LXB A;  4KJM A;  2AXC A;  2QJP C;  3H1K G;  2KUB A;  1AVY A;  1W2B O;  3H1K D;  1FDM A;  5KLI B;  1S5L X;  2E75 B;  5APQ A;  5M1B A;  3L75 G;  1VQ5 P;  1NAY A;  1T3U A;  5AVU B;  2QG4 A;  3A5T A;  2V7Q H;  5K5G B;  3M0A A;  1JB0 J;  1L4A B;  3GLM A;  3P8C D;  4DT0 A;  3HUS C;  2KB7 P;  5KLI C;  1GDT A;  1DX7 A;  1IFP A;  1Q86 Q;  1WT6 A;  3CXH D;  2LXC B;  3FXE A;  1E79 H;  1OIP A;  1JY3 N;  2E5Y A;  3RK3 E;  1L0N G;  1FZA A;  5AVW B;  1GL2 B;  1JY2 O;  2M3B A;  3H1I E;  1SP4 A;  4AUW A;  1AJY A;  2OYH B;  4IFF A;  1N73 C;  1XTG B;  1S5L H;  3V6I A;  1SQQ K;  5DJT B;  3TF5 A;  1S9K E;  2VRS A;  4I1L A;  3I55 P;  1GL2 C;  2ZVN B;  3BAT A;  1FOS F;  2WMM A;  3HD7 D;  1HF9 A;  1G1J A;  3L71 E;  2IBZ I;  4WY4 C;  4Y99 C;  2CPS A;  1S3J A;  1G1I A;  3GHG A;  5TIS H;  3CC7 P;  2OGU A;  2QJK C;  1NTZ K;  2SPZ A;  3AEF C;  2K88 A;  2O01 N;  3U1A A;  1KV4 A;  1URQ C;  2IPP A;  3JCU H;  2QA4 P;  4C7N A;  4DZO A;  4H0L B;  4WY4 B;  2WT7 B;  1ZOY C;  1FZF A;  2OYH A;  2OYO A;  1BCC G;  2IBZ D;  1OWA A;  2R5B A;  2IZ0 A;  3W67 A;  4H13 B;  2ZT9 B;  3CX5 H;  3GHG B;  2JO1 A;  2RH0 A;  1PGO A;  3VMZ A;  1ZR4 A;  4U3F E;  4PV1 B;  3N7N A;  1T3J A;  2FYU E;  1W5C E;  2H88 C;  3CXH I;  3IN6 A;  3P8M C;  1UII A;  1NTK E;  3EWK A;  2C0W A;  2E76 D;  2KOG A;  3HE5 B;  3ITK A;  4H13 C;  3CCV P;  1RF1 A;  1FZC C;  4TLF A;  3GHG C;  1IK9 A;  1YHQ P;  1RF1 C;  2WSC H;  3E7K A;  2GUS A;  3AE2 C;  4QMA A;  1T2K D;  1FC2 C;  3E1I A;  4I2L C;  2WSF H;  4H44 B;  1LWU C;  3HE5 A;  3QWO C;  5KAF E;  3L72 E;  2AEJ A;  1L0N E;  1BE3 G;  1MFZ A;  2PFX A;  3FGA D;  3H1J J;  4K3A A;  1BE3 D;  3SFD C;  4HH2 A;  2UWJ E;  3CCQ P;  1KMI Z;  1KFN A;  3WUU A;  5AVV B;  1J1D B;  3AE7 C;  3CWB G;  2GA1 A;  2M5A B;  1NHL A;  3L73 D;  4ZNC A;  1SQX J;  3H1L E;  4C7R A;  2WPQ A;  2W6B A;  4NPF X;  3W68 A;  1S5L E;  4YPC A;  5KLV D;  3PRJ A;  1SQV E;  3BCC E;  1FZG A;  3CI9 A;  4NPE A;  3L72 G;  1FJK A;  3TK1 A;  1LP1 B;  1L0N K;  1SQX D;  1H89 A;  3HUS A;  2NRG A;  4D6T J;  3L74 G;  1PPJ E;  2BEZ F;  1ZME C;  1NJI Q;  1VDF A;  1RY3 A;  1VQN P;  1VQ6 P;  1AFO A;  1FZB A;  4EYY Q;  3G6E P;  1L4A C;  1AV1 A;  2E74 D;  3HUS B;  1QGK B;  2XND H;  3QH9 A;  5AVY B;  1Q81 Q;  3WUV A;  2JP3 A;  3MIW A;  2Y0D A;  3A0H H;  1NTM J;  3I5C A;  4GDO A;  1L0L K;  1OVU A;  3CL3 D;  1EC5 A;  5AW5 B;  2QM7 A;  5APW A;  1H0T B;  4C46 A;  1IFM A;  2HPC B;  4WWI A;  5CCG A;  1HUC A;  3I56 P;  2HOD A;  1Q90 D;  2QJY B;  1YYC A; 
#chains in the Genus database with same CATH homology
 2E75 C;  1VL2 A;  2H89 C;  3AE1 C;  3AE5 C;  3AEB C;  1ZP0 C;  1U57 A;  2K9Y A;  2YMK A;  4Y28 J;  3GMA A;  1OW7 A;  3D6Z A;  3AEG C;  2IDB A;  3AE4 C;  4XFJ A;  1R8E A;  1KTM A;  2V7Q J;  3AE6 C;  2QSI A;  2FYN C;  1K05 A;  2QJY C;  3Q5R A;  3D71 A;  3Q2Y A;  3C8V A;  2QJP C;  4OGQ C;  4H0L C;  1PV3 A;  3GF3 A;  1S5L X;  2E75 B;  1MKM A;  5M1B A;  1NYH A;  1PIX A;  1YQ4 C;  3R4Y A;  1JB0 J;  3GLM A;  4H44 D;  2E75 D;  1IK7 A;  5KLI C;  3AEE C;  3RK3 E;  2WSC J;  2E74 B;  2D2C C;  3AE8 C;  1RQV A;  3B71 A;  2E76 B;  3O6Q A;  2WSF J;  2BEQ D;  1AJY A;  3GF7 A;  1UIX A;  3RL0 g;  2E74 C;  4Z1M H;  1OW6 A;  1DD3 A;  4OGQ D;  5L8R J;  1EXJ A;  1HF9 A;  3D70 A;  2YIU C;  3IAO A;  3G9R A;  1KIL E;  3SFE C;  4PV1 C;  2FBW C;  2E76 C;  2QJK C;  4R4M A;  3AEF C;  4IL6 X;  1DIP A;  1OW8 A;  2ZT9 D;  3AEA C;  4H0L B;  1NGM B;  1ZOY C;  2P10 A;  1K04 A;  1GMJ A;  4H13 B;  1PL5 A;  2ZT9 B;  1FDI A;  1VF5 C;  2JO1 A;  3ABV C;  3D6Y A;  4PV1 B;  2H88 C;  3AEC C;  3IN6 A;  4H13 C;  3EWK A;  2D2C B;  2E76 D;  2G3A A;  3S9O A;  2OQQ A;  1KQG B;  2MKV A;  4H13 D;  1RQU A;  4KT0 J;  2FXP A;  3AE2 C;  3Q5S A;  1FDO A;  3AED C;  4H44 B;  1ZME C;  1YQ3 C;  1VF5 D;  1VF5 B;  3FGA D;  3SFD C;  1KMI Z;  3AE7 C;  1KQF B;  1TU3 F;  5KKZ C;  2QIW A;  2WSE J;  4I7Z C;  4R4L A;  4PV1 D;  2J5U A;  1KOR A;  4YTP C;  2WPV B;  4H44 C;  1S1C X;  2BEZ F;  1DD4 A;  3Q3D A;  4RKU J;  2ZT9 C;  3AE3 C;  2D2C D;  3T97 B;  4YXD C;  3H25 A;  2E74 D;  2NZ2 A;  2WQY C;  1EXI A;  4H0L D;  4I7Z B;  3LW5 J;  3AE9 C;  1ZRT E;  2JP3 A;  2G8Y A;  1HJ0 A;  1WMK A;  4GDO A;  4U7J A;  3Q1M A;  3Q5P A;  1OMI A;  4TT3 H;  1Y9B A;  4OGQ B;  2O01 J;  1Q90 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...