1L0LJ

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 17
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0lJ00
4D6TJ 1SQXJ 3L74J 3L71J 1NTZJ 3H1KJ 3CWBJ 5KLVJ 1L0NJ 3H1HJ 3CX5I 4PD4I 3BCCJ 1SQPJ 3H1JJ 2BCCJ 1P84I 3CXHI 1BE3J 3TGUJ 1BCCJ 1SQBJ 1NTMJ 1KYOI 1NU1J 1PP9J 3L73J 3L75J 1EZVI 2IBZI 3L70J 1NTKJ 4U3FJ 1SQQJ 3H1IJ 3H1LJ 2FYUJ 3L72J 1BGYJ 1KB9I 1L0LJ 1SQVJ
chains in the Genus database with same CATH superfamily
2KB7P 1VQ4P 2RMZA 3CI9A 4H13D 4U7JA 4W7ZA 1YYCA 1KZUB 2IFMA 3PHLA 1GL2C 1NU1G 2K88A 4Y99B 1S1CX 3CCVP 4H13B 1L0ND 1FC2C 4XFJA 2KLVA 3CWBE 3USSA 4C7RA 1FU1A 1SQXK 3M9QA 2ZJSE 1LNQA 1LT1A 1BSNA 5KLVD 3SFEC 3GHGA 1J1DC 1X9VA 1PGOA 3HD7A 3H6PA 4LC1A 5CJ0A 5E79H 5KJ7A 3CCMP 3FGAD 3L75D 1USDA 1IO4A 1NJIQ 2FFDB 3Q3DA 4ASWA 1VQKP 1LT9A 3HD7D 3L70D 2YMYA 3CXHE 1SQPK 5KLVG 1L4AA 2G3AA 2WSCH 2E74D 5H2FE 2ZXEB 2I1JA 2OYOA 1Q2NA 1EDIA 3IF4A 2QA4P 2FYZA 1A02F 5GTIE 2BASA 3P32A 1YQ3C 1ZLLA 3AEAC 3W68A 1BE3G 1PFIA 3IAOA 1OW8A 3QWOC 1RY3A 2ZVOB 1IK7A 1URQB 3S1KA 1NOHA 4D6TJ 3U1CA 1W2EA 3MP7B 3CXHH 1L2PA 2A45H 2R5BA 1J1EC 1XTGB 5KLVE 1JY2N 4XE5B 3AE2C 5CCHA 4BWNA 3VMZA 2N1TA 4RO0A 2GM4A 4I2LC 1S9KD 1QL2A 3I55P 1Y9BA 4N3YB 1KTMA 1GL2B 1KQFB 3TGUD 1NYHA 1FZCA 4H13C 1T2KD 3CMEP 1QLED 5APUA 1N73C 1BE3J 2YIUB 2M3EA 3C1LA 3V2RA 5KLVK 2L91A 3LW5J 1S72P 1BCCJ 1BDCA 1LT9C 3CWBG 4I7ZB 2OYHC 2LXCB 5C39A 3VP9A 1U57A 3SSUA 2FYUE 3H1JE 1SQBE 1D7MA 4KT0J 3I5CA 5KAIH 1KQSO 3MTUE 3RL0D 2PGDA 1USEA 1N2DC 3H1HG 3RK2D 2WT7B 2KNCA 2WPSA 4PD4E 1KB9I 1N7LA 3CCRP 2BCCE 2LKMA 3MD0A 1FZBA 3FXDA 4AYCA 1YIJP 1LTJA 2O01J 3HE5A 3L72D 3PLNA 1H0TB 3VYIA 1DEBA 3U1AA 2AXTH 3L71J 1NTZE 2ZFCA 1X22A 1NTZJ 2ZVNB 1BE3D 1SFCC 2AEFA 1E5WA 5APXA 5AW3B 1M90Q 3TDKA 1QGKB 1S3JA 1L0LD 4K3AA 1FDIA 1L0NJ 1LTJB 1URQC 2K9JB 2ZYDA 4WY4C 3VTPC 2AEJA 1ZN5A 2JO1A 3S9OA 1J1EB 2ZT9D 1M1KQ 3GG2A 3Q5SA 2CPBA 1N8RQ 2Q9IA 1NH4A 4N78D 1SQPD 3M0DC 1AVYA 2GA1A 2R32A 3HTKA 4GDOA 3CLQA 3L71G 3SWFA 1UIXA 1YJNP 1R5LA 4OGQC 2E75D 3RBZA 1HUCA 1NTZD 1RE4C 1NAFA 2YIUC 3WUUA 1WRGA 2KXPB 1VF5D 3OA7A 1L0NG 5AVQB 5TISE 2E76B 2KS1B 1L0LE 2NPSA 1Q82Q 3B5ND 1YTZI 2KZIA 3AEBC 2QM7A 3H1JD 1VQOP 2KNCB 4R4MA 3D71A 2ZXXA 2HPCA 3NTNA 2XDJA 4D6TD 2OYIA 1EZVD 1N7SC 3RK2C 5AVTB 5TJHA 3NMDA 2J59M 3H1KD 3E1RA 2IBZG 1MFZA 2PRRA 2HYNA 1L0LK 5AVVB 2FXMA 1SFCB 3P8CD 4W80A 1SLQA 1EZVG 2HLOA 4GT1A 2N1TD 3KDPB 3TGUJ 1S9KE 1S4XA 3B4SA 5AVZB 1NTMJ 3V2QA 2YO2A 1N7SD 3JC22 3G9RA 1YHQP 3PJSK 1DEEG 2OARA 2PAJA 1NAYA 1NTKE 3A0HE 1GL2D 3AEGC 5KLIC 1CZQA 1SQPE 2QVAA 3MHVA 1FZCC 1JMBA 3CC4P 3L71E 2B87A 2WZ7A 1KB9D 2GUSA 2GUVA 4H0LC 1AV1A 2HODB 1LWUB 3TGUG 1Q86Q 4PV1D 5APSA 2E75C 4HH2A 4RKUJ 5KJ7C 3WU2E 1FS0E 2BCCD 3C9IA 1LTTC 3S4RA 4K35A 2HPCB 1M1JA 2B88A 5GTHE 1MZ9A 3IR9A 2E74B 3CXHI 1MFTA 4IFMA 1H0TA 2QIWA 1N7SB 2I8DA 4DT0A 3C8VA 2QJKC 3VMXA 4H44C 1LP1A 1JCDA 3LW5H 3H32B 5KKZB 1SFCA 3WU2H 3GW6A 1KYOH 2M5AA 3JCUE 3G6EP 1NGMB 1KB9E 5AVWB 3AE9C 1SFCD 1CW5A 1KC8Q 1RH5B 1WT6A 5GTHH 2WTYA 3H1JG 3M9HA 2FYUK 2IX7C 2WQYC 3BCCG 2KSEA 1KN7A 1GU4A 1DH3A 1G2CA 1WMKA 2A45G 3FWLA 5CCHD 1PZQA 3WUTA 3L74E 5M1BA 1KYOE 1QL1A 2R5DA 3JCUH 2E5TA 1K04A 1KV4A 3B5NB 4OVNF 2FXOA 2UWJE 1BGYE 1PV3A 1AVOA 1NTKG 1RE4A 2P58A 3L70G 3TNUA 3I56P 3CD6P 1VF5B 2QM8A 3OJAB 2D2CD 1SQVG 3H1JJ 1BSHA 2E75B 1NTME 2Q5UA 2FFDC 1KFMA 2QSIA 1EZVE 3D70A 2W83C 1JTHB 1LTIC 1HTLC 5APWA 5AW9B 2KK7A 1VQ8P 5AVUB 2C9NY 1VQNP 5AW4B 2XKMA 1GU5A 3N4XA 4BRYA 1JUNA 1NWQA 1R8EA 2ZT9B 2ZYAA 2FYNB 2WSFH 1URQA 2M5AB 1YJWP 3L73D 1LTGC 4ZKPA 2Z5IA 3KZIE 4C7NB 3TF5A 2WSCJ 4I1LA 1P84D 1RF0C 2AEMA 4KHXA 3V5BA 1DX7A 3NXSA 3Q2YA 2P10A 4OWFA 1JEKA 4A7PA 1KILD 4L75A 2WWWA 2CPSA 2QJYB 1PP9G 1SQVK 3AE4C 1BCCD 4YXWH 4JPZB 2QEXP 4LGDE 2WSEJ 4IFDK 1AFOA 3KZIH 5KTBA 4W7YA 1FJKA 4GOFA 5AVXB 1N73B 1FDMA 3M06A 3PTZA 1VQ7P 2A06G 2NZ2A 4XA4A 3TNUB 1VL2A 2Q1KA 3H1LD 5L8RJ 2OTJP 3KPEA 1NKNA 3ZDMA 3RBXA 2V4HA 1P84E 3FX0A 2OYHA 3L75J 2YNYA 2JEEA 1JTHA 2YXQB 3EQ2A 5CJ4A 1QVGO 3OW2O 1Q90D 2NPSB 2Q6QA 4O9BA 1L0LJ 1IC2A 1JY3O 4ZNCA 2QE7H 2KLUA 2RKLA 3H1KE 5B5EE 1G1IA 3EWKA 2W90A 1L4AD 2JR8A 1KILB 2KUBA 2SPZA 2ZT9C 3KXDA 1FZGA 1P84H 1IFNA 3AE1C 3KYQA 1IFIA 1CI6B 3V2NA 1FOSE 4JYBA 3H1LE 1RF1A 4AUWA 3IN6A 1LTJC 4NPFX 3AE5C 2WSSH 3H1HJ 2FYUG 2ITAA 5KAIE 1JCCA 1OMIA 2BCCJ 3L74D 3CC7P 4IFFA 1NTKD 2QJPC 3CWBD 1EXIA 5AVYB 3P7KA 1NKZB 1X79B 3GMAA 1HGVA 1SQBJ 3D6YA 1QX8A 4OGQB 4R4LA 3CC2P 5GTIH 2JDIH 5CHXA 2FY8A 2L5GB 3P8CE 1H88A 5BU5A 2YXRB 4U3FJ 2D2CB 2E76C 1SQQJ 1OZHA 1GW4A 1N86A 2FYUJ 4Z1MH 3GF3A 5APVA 2KZJA 2OYIC 3CXHD 1OWAA 1R5SA 1PGQA 4AQRD 4L74A 2W27A 1MV8A 1SQVD 3HE4B 3SWYA 2Y0EA 3AEFC 2Q7CA 2M3BA 1MUUA 4Y28J 2NPSC 3VMAA 4BXLA 1OW7A 5AW0B 1RQUA 2WMMA 2YO3A 3TSIA 3V4QA 2A06D 2IZ1A 3H1IE 4DCKA 1HJBA 1KILC 4TLFA 1CI6A 1K05A 3B8EB 3KQGA 4HYTB 2XZRA 4MN4C 4UB6E 1SQBD 1M56D 1N7SA 1T3JA 1FZEA 3E7KA 2YMKA 2Q3IA 2PP6A 1FZAA 3RK3B 2Y0CA 3M0AA 4OGQD 5AVSB 3WUVA 3N7NA 2XNXA 1NTMK 4GIFA 3MUDA 4JF7A 4PD4H 3VMYA 2VRSA 4CPGA 5KLIB 3A3YB 3CPWO 5KAFE 5CBOA 1VQLP 2KIKA 1DD3A 4OH8B 4UB8E 2WSFJ 4YXDC 2ZYGA 3L72J 1BGYJ 4JQ0D 5DJTB 1NTZK 3GLMA 1AQ5A 4H0LB 3G4SP 2Q3EA 2IBZE 1NVOA 3TYYA 1NU1D 5APTA 1VQPP 4WVZA 3MZWB 3L74J 4PV1B 3W67A 2IDBA 1EDKA 1HGZA 3CX5D 1PP9E 3R4YA 1L4AB 1ZV8A 1RHZB 2IYOA 2W6BA 5KAFH 3T97A 4UB8H 1L0NK 1YQ4C 1SQQE 2NPSD 2Y0DA 3BRVB 1NTKK 2E74C 2OGUA 3A0HH 3HRNA 1LP1B 2AXCA 1SQVE 2G8YA 2RH0A 2WVRA 3FWNA 3HUSC 2QJKB 1DD4A 3B71A 4H44B 4KJMA 5CBNA 2H7HA 2HFED 3AE8C 5CCGC 1IFJA 3SFDC 1PPJE 2Y9YA 1KYOI 2IPPA 2N1TB 1GK6A 1VQ9P 1RF0A 5CCGD 2MJZA 2JP3A 1NTMD 1OIPA 5CMZA 4LLHA 5AW5B 4I6MC 4ZKUA 4C7NA 1UIIA 1NO4A 2KSJA 1BCCE 5H2FH 1U7JA 1YI2P 2WPVB 3CCQP 1PPJG 4IOIH 3BASA 3ITKA 1SQXJ 3O6QA 2HR3A 4L76A 1LJ2A 3B5NC 1K73Q 1PGJA 5B5EH 3A0BH 2WPRA 3CX5H 1VF5C 3LIEA 2E76D 2FFDA 1PPJD 1ZXGA 3CCJP 2JWAA 4PV1C 1G1JA 3BCCJ 2XV5A 1ZW0A 1SQPJ 2IFNA 1HF9A 1LWUA 1M1JB 2H43A 1L4AC 1KILE 2K3RA 1YBKA 4D6TE 2V7QJ 4M3LA 3BVHA 4HJGH 3H25A 2QG4A 1RQVA 3A0BE 1YTZT 1NU1J 1SS1A 1IZNB 2YKOA 3V6IA 3HUSB 3L72E 1EZVI 2FYNC 1FOSF 2K9JA 4QMAA 5DJUB 1PL5A 1KYOD 2Z5HA 1OXZA 3PH0A 5AW6B 2KP8A 1W2BO 3CCLP 3IFMA 1VQMP 2P1JA 1RE3C 3F5HA 3H32A 1SQPG 2N1TC 1JOCA 1FBMA 3A2AA 3OAKA 1CSBA 3M9BA 5APQA 1FAVA 5AW8B 1EDJA 2FYUD 1FE6A 3G71P 2JKVA 2QJYC 4WWIA 1JNMA 4HB1A 5AW7B 3H1HD 1JY3P 1JY2P 1AA0A 2QRXA 1AQTA 1KMIZ 2M8RA 3GHGC 3P8MC 2H89C 3L71D 3L36A 4WBAA 3HD7C 4Y99C 3VOPA 2FKWB 2XU6A 1S5LH 1GD2E 3CX5I 3RK3E 1VQ5P 2WSEH 2CK3H 4NPEA 5K5GB 1Q7YQ 2Y9ZA 3CL3D 1OVUA 2IYPA 2B87B 4D6TG 1J1DB 3L37A 1T6AA 2POHA 3V2PA 1K8AQ 4TT3H 1PP9J 1IJDB 2H8PD 3T97B 3WMM0 4U3FE 4ZMDA 1QEXA 2RN0A 1FJPA 1GK4A 1X0TA 5APYA 2J58A 2KYVA 3HUSA 2R44A 1Y8AA 2R3CA 3KHUA 5BU8B 4YPCA 2E5YA 4B86A 1ZR4A 2O3JA 3M91A 3RL0g 5CCGA 1K9MQ 1YJ9P 3BATA 5KLVJ 1BCCG 2KOGA 3K5BA 2YKQA 3CWBJ 1URQD 3L75G 2P67A 4GKGA 1ZP0C 4YTPC 4H0LD 1PIXA 4ASVA 1OW6A 4IL6E 2QJPB 1L0LG 5CCHC 2J5UA 2R3SA 2FXPA 1IFMA 1L0NE 3O6QB 3A5TA 3GHGB 2AXTE 1VQ6P 3HD7B 3CCSP 1GL2A 1G2CB 3H1KG 1JO5A 3EFFK 2OTLP 1SP4A 1Y47A 1NTZG 1LT9B 1OVRA 2B89A 4I7ZC 2D2CC 1DIPA 2OYHB 1W5CE 1ZMEC 1XTCC 2V7QH 4IL6H 3RGUA 3PRJA 2BCCG 1KD1Q 2M0BA 3L75E 3BCCE 3AEEC 3VN0A 2C0XA 2DW3A 1KFNA 2K9YA 4IL6X 2B9BA 1SQQD 3Q5RA 1IFDA 1SQBG 2Z4EA 3MGNA 1EXJA 2E43A 3H1KJ 1GTWA 2XNDH 3L73E 3LIDA 1GMJA 2A45I 4DZOA 2O01H 1FZFA 1VPCA 4U3FG 4EOTA 1SQQG 2C0WA 1GDTA 2P7JA 4N78E 5E79E 3Q5PA 1IK9A 1IFPA 1KILA 1KORA 3AE3C 1KQLA 3FXEA 4WB4A 4EDFA 1M8OB 2K1AA 3E1IA 4WY4B 3RK3C 3H1HE 1RF1C 1E79H 2N9BA 4DOJA 4RJTA 1GZLA 1NHLA 3NFQA 3AE7C 3TGUE 1H89A 4JYCA 2YKPA 1Z56A 1EQ7A 3HTKB 3M0DA 2HODA 3SWKA 2IZ0A 3QH9A 1BE3E 1HJ0A 5KJ7D 1KB9H 3MUDC 2WT7A 1M7LA 1OFCX 1AJYA 2E42A 3H1ID 1JM0A 4HKZH 2KI7B 1JMMA 4C46A 3II6A 3AEDC 2KS1A 1LTBC 1NTMG 2WITA 3AE6C 3CCEP 2W6AA 5B66E 3BCCD 1HBWA 1KQGB 2MKVA 2JJLA 2WPQA 1EC5A 3H1IG 1QVFO 3F89A 1S2EA 1T8ZA 3G3ZA 3L72G 1BGYG 3L70E 3L4FA 4PD4I 3RK2B 3RL0B 1N73A 3HE4A 1S5LX 1VDFA 1ZRTD 2O01N 4RESB 1P84I 1HWTC 1S5LE 3L74G 5AW2B 2W6JH 1GW3A 1U7MA 2FBWC 1SQBK 3MIWA 1LGHB 1MKMA 1OX3A 3CMAP 1EDLA 5B66H 1ZOYC 1NU1E 5BVZA 2O1JA 4H44D 1SVFA 4GODA 1ZR2A 1YITP 1RF1B 3ABVC 1T3UA 1FDOA 1PP9D 1A02J 3H1IJ 1T2KC 3H1LJ 4DJGA 1SQQK 3CCUP 1HH0A 1J2JB 5AVRB 2O1KA 3L35A 3UIAA 1HVVA 1OVVA 1FZCB 3BRTB 4EI2A 2I1KA 2LXBA 1ZRTE 1NU1K 2BEQD 2H88C 2HG5D 2K37A 3B5NA 3JSVC 1SQXD 3L73G 1LWUC 3PP5A 4JBZA 4L73A 4NPDA 4UB6H 3TK1A 3Q1MA 2OYIB 1M57D 3GF7A 2JWDA 3O8ZA 1M1JC 2N9YB 2OQQA 1JY3N 3EFGA 3V4WA 3H1LG 3D6ZA 1H8AA 1PGPA 2OTKE 4N6JA 5AW1B 4PJ0H 4U3FD 1SQXG 1LTAC 3AECC 5EFWB 2C9LY 1BGYD 1JY2O 2A06E 3HE5B 4PD4D 3U59A 2LR2A 3RL0C 1X8YA 3RK3D 2IBZD 4BRYB 3A7OA 4EYYQ 1JB0J 1RE3A 1TU3F 2P2UA 2BEZF 3L73J 3VP8A 4WY4D 5KKZC 5TISH 1BDDA 2IBZI 2NRGA 2ZAEB 1NTKJ 2PFXA 3CX5E 3L70J 3R2PA 4GOEA 1Q81Q 1SQXE 4WY4A 4PJ0E 4EIJA 1SQVJ 2W8ZA 1LTSC
chains in the Genus database with same CATH topology
4D6TJ 1SQXJ 3L74J 3L71J 1NTZJ 3H1KJ 3CWBJ 5KLVJ 1L0NJ 3H1HJ 3CX5I 4PD4I 3BCCJ 1SQPJ 3H1JJ 2BCCJ 1P84I 3CXHI 1BE3J 3TGUJ 1BCCJ 1SQBJ 1NTMJ 1KYOI 1NU1J 1PP9J 3L73J 3L75J 1EZVI 2IBZI 3L70J 1NTKJ 4U3FJ 1SQQJ 3H1IJ 3H1LJ 2FYUJ 3L72J 1BGYJ 1KB9I 1L0LJ 1SQVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T J;  1SQX J;  3L74 J;  3L71 J;  1NTZ J;  3H1K J;  3CWB J;  5KLV J;  1L0N J;  3H1H J;  3CX5 I;  4PD4 I;  3BCC J;  1SQP J;  3H1J J;  2BCC J;  1P84 I;  3CXH I;  1BE3 J;  3TGU J;  1BCC J;  1SQB J;  1NTM J;  1KYO I;  1NU1 J;  1PP9 J;  3L73 J;  3L75 J;  1EZV I;  2IBZ I;  3L70 J;  1NTK J;  4U3F J;  1SQQ J;  3H1I J;  3H1L J;  2FYU J;  3L72 J;  1BGY J;  1KB9 I;  1L0L J;  1SQV J; 
#chains in the Genus database with same CATH topology
 2KB7 P;  1VQ4 P;  2RMZ A;  3CI9 A;  4H13 D;  4U7J A;  4W7Z A;  1YYC A;  1KZU B;  2IFM A;  3PHL A;  1GL2 C;  1NU1 G;  2K88 A;  4Y99 B;  1S1C X;  3CCV P;  4H13 B;  1L0N D;  1FC2 C;  4XFJ A;  2KLV A;  3CWB E;  3USS A;  4C7R A;  1FU1 A;  1SQX K;  3M9Q A;  2ZJS E;  1LNQ A;  1LT1 A;  1BSN A;  5KLV D;  3SFE C;  3GHG A;  1J1D C;  1X9V A;  1PGO A;  3HD7 A;  3H6P A;  4LC1 A;  5CJ0 A;  5E79 H;  5KJ7 A;  3CCM P;  3FGA D;  3L75 D;  1USD A;  1IO4 A;  1NJI Q;  2FFD B;  3Q3D A;  4ASW A;  1VQK P;  1LT9 A;  3HD7 D;  3L70 D;  2YMY A;  3CXH E;  1SQP K;  5KLV G;  1L4A A;  2G3A A;  2WSC H;  2E74 D;  5H2F E;  2ZXE B;  2I1J A;  2OYO A;  1Q2N A;  1EDI A;  3IF4 A;  2QA4 P;  2FYZ A;  1A02 F;  5GTI E;  2BAS A;  3P32 A;  1YQ3 C;  1ZLL A;  3AEA C;  3W68 A;  1BE3 G;  1PFI A;  3IAO A;  1OW8 A;  3QWO C;  1RY3 A;  2ZVO B;  1IK7 A;  1URQ B;  3S1K A;  1NOH A;  4D6T J;  3U1C A;  1W2E A;  3MP7 B;  3CXH H;  1L2P A;  2A45 H;  2R5B A;  1J1E C;  1XTG B;  5KLV E;  1JY2 N;  4XE5 B;  3AE2 C;  5CCH A;  4BWN A;  3VMZ A;  2N1T A;  4RO0 A;  2GM4 A;  4I2L C;  1S9K D;  1QL2 A;  3I55 P;  1Y9B A;  4N3Y B;  1KTM A;  1GL2 B;  1KQF B;  3TGU D;  1NYH A;  1FZC A;  4H13 C;  1T2K D;  3CME P;  1QLE D;  5APU A;  1N73 C;  1BE3 J;  2YIU B;  2M3E A;  3C1L A;  3V2R A;  5KLV K;  2L91 A;  3LW5 J;  1S72 P;  1BCC J;  1BDC A;  1LT9 C;  3CWB G;  4I7Z B;  2OYH C;  2LXC B;  5C39 A;  3VP9 A;  1U57 A;  3SSU A;  2FYU E;  3H1J E;  1SQB E;  1D7M A;  4KT0 J;  3I5C A;  5KAI H;  1KQS O;  3MTU E;  3RL0 D;  2PGD A;  1USE A;  1N2D C;  3H1H G;  3RK2 D;  2WT7 B;  2KNC A;  2WPS A;  4PD4 E;  1KB9 I;  1N7L A;  3CCR P;  2BCC E;  2LKM A;  3MD0 A;  1FZB A;  3FXD A;  4AYC A;  1YIJ P;  1LTJ A;  2O01 J;  3HE5 A;  3L72 D;  3PLN A;  1H0T B;  3VYI A;  1DEB A;  3U1A A;  2AXT H;  3L71 J;  1NTZ E;  2ZFC A;  1X22 A;  1NTZ J;  2ZVN B;  1BE3 D;  1SFC C;  2AEF A;  1E5W A;  5APX A;  5AW3 B;  1M90 Q;  3TDK A;  1QGK B;  1S3J A;  1L0L D;  4K3A A;  1FDI A;  1L0N J;  1LTJ B;  1URQ C;  2K9J B;  2ZYD A;  4WY4 C;  3VTP C;  2AEJ A;  1ZN5 A;  2JO1 A;  3S9O A;  1J1E B;  2ZT9 D;  1M1K Q;  3GG2 A;  3Q5S A;  2CPB A;  1N8R Q;  2Q9I A;  1NH4 A;  4N78 D;  1SQP D;  3M0D C;  1AVY A;  2GA1 A;  2R32 A;  3HTK A;  4GDO A;  3CLQ A;  3L71 G;  3SWF A;  1UIX A;  1YJN P;  1R5L A;  4OGQ C;  2E75 D;  3RBZ A;  1HUC A;  1NTZ D;  1RE4 C;  1NAF A;  2YIU C;  3WUU A;  1WRG A;  2KXP B;  1VF5 D;  3OA7 A;  1L0N G;  5AVQ B;  5TIS E;  2E76 B;  2KS1 B;  1L0L E;  2NPS A;  1Q82 Q;  3B5N D;  1YTZ I;  2KZI A;  3AEB C;  2QM7 A;  3H1J D;  1VQO P;  2KNC B;  4R4M A;  3D71 A;  2ZXX A;  2HPC A;  3NTN A;  2XDJ A;  4D6T D;  2OYI A;  1EZV D;  1N7S C;  3RK2 C;  5AVT B;  5TJH A;  3NMD A;  2J59 M;  3H1K D;  3E1R A;  2IBZ G;  1MFZ A;  2PRR A;  2HYN A;  1L0L K;  5AVV B;  2FXM A;  1SFC B;  3P8C D;  4W80 A;  1SLQ A;  1EZV G;  2HLO A;  4GT1 A;  2N1T D;  3KDP B;  3TGU J;  1S9K E;  1S4X A;  3B4S A;  5AVZ B;  1NTM J;  3V2Q A;  2YO2 A;  1N7S D;  3JC2 2;  3G9R A;  1YHQ P;  3PJS K;  1DEE G;  2OAR A;  2PAJ A;  1NAY A;  1NTK E;  3A0H E;  1GL2 D;  3AEG C;  5KLI C;  1CZQ A;  1SQP E;  2QVA A;  3MHV A;  1FZC C;  1JMB A;  3CC4 P;  3L71 E;  2B87 A;  2WZ7 A;  1KB9 D;  2GUS A;  2GUV A;  4H0L C;  1AV1 A;  2HOD B;  1LWU B;  3TGU G;  1Q86 Q;  4PV1 D;  5APS A;  2E75 C;  4HH2 A;  4RKU J;  5KJ7 C;  3WU2 E;  1FS0 E;  2BCC D;  3C9I A;  1LTT C;  3S4R A;  4K35 A;  2HPC B;  1M1J A;  2B88 A;  5GTH E;  1MZ9 A;  3IR9 A;  2E74 B;  3CXH I;  1MFT A;  4IFM A;  1H0T A;  2QIW A;  1N7S B;  2I8D A;  4DT0 A;  3C8V A;  2QJK C;  3VMX A;  4H44 C;  1LP1 A;  1JCD A;  3LW5 H;  3H32 B;  5KKZ B;  1SFC A;  3WU2 H;  3GW6 A;  1KYO H;  2M5A A;  3JCU E;  3G6E P;  1NGM B;  1KB9 E;  5AVW B;  3AE9 C;  1SFC D;  1CW5 A;  1KC8 Q;  1RH5 B;  1WT6 A;  5GTH H;  2WTY A;  3H1J G;  3M9H A;  2FYU K;  2IX7 C;  2WQY C;  3BCC G;  2KSE A;  1KN7 A;  1GU4 A;  1DH3 A;  1G2C A;  1WMK A;  2A45 G;  3FWL A;  5CCH D;  1PZQ A;  3WUT A;  3L74 E;  5M1B A;  1KYO E;  1QL1 A;  2R5D A;  3JCU H;  2E5T A;  1K04 A;  1KV4 A;  3B5N B;  4OVN F;  2FXO A;  2UWJ E;  1BGY E;  1PV3 A;  1AVO A;  1NTK G;  1RE4 A;  2P58 A;  3L70 G;  3TNU A;  3I56 P;  3CD6 P;  1VF5 B;  2QM8 A;  3OJA B;  2D2C D;  1SQV G;  3H1J J;  1BSH A;  2E75 B;  1NTM E;  2Q5U A;  2FFD C;  1KFM A;  2QSI A;  1EZV E;  3D70 A;  2W83 C;  1JTH B;  1LTI C;  1HTL C;  5APW A;  5AW9 B;  2KK7 A;  1VQ8 P;  5AVU B;  2C9N Y;  1VQN P;  5AW4 B;  2XKM A;  1GU5 A;  3N4X A;  4BRY A;  1JUN A;  1NWQ A;  1R8E A;  2ZT9 B;  2ZYA A;  2FYN B;  2WSF H;  1URQ A;  2M5A B;  1YJW P;  3L73 D;  1LTG C;  4ZKP A;  2Z5I A;  3KZI E;  4C7N B;  3TF5 A;  2WSC J;  4I1L A;  1P84 D;  1RF0 C;  2AEM A;  4KHX A;  3V5B A;  1DX7 A;  3NXS A;  3Q2Y A;  2P10 A;  4OWF A;  1JEK A;  4A7P A;  1KIL D;  4L75 A;  2WWW A;  2CPS A;  2QJY B;  1PP9 G;  1SQV K;  3AE4 C;  1BCC D;  4YXW H;  4JPZ B;  2QEX P;  4LGD E;  2WSE J;  4IFD K;  1AFO A;  3KZI H;  5KTB A;  4W7Y A;  1FJK A;  4GOF A;  5AVX B;  1N73 B;  1FDM A;  3M06 A;  3PTZ A;  1VQ7 P;  2A06 G;  2NZ2 A;  4XA4 A;  3TNU B;  1VL2 A;  2Q1K A;  3H1L D;  5L8R J;  2OTJ P;  3KPE A;  1NKN A;  3ZDM A;  3RBX A;  2V4H A;  1P84 E;  3FX0 A;  2OYH A;  3L75 J;  2YNY A;  2JEE A;  1JTH A;  2YXQ B;  3EQ2 A;  5CJ4 A;  1QVG O;  3OW2 O;  1Q90 D;  2NPS B;  2Q6Q A;  4O9B A;  1L0L J;  1IC2 A;  1JY3 O;  4ZNC A;  2QE7 H;  2KLU A;  2RKL A;  3H1K E;  5B5E E;  1G1I A;  3EWK A;  2W90 A;  1L4A D;  2JR8 A;  1KIL B;  2KUB A;  2SPZ A;  2ZT9 C;  3KXD A;  1FZG A;  1P84 H;  1IFN A;  3AE1 C;  3KYQ A;  1IFI A;  1CI6 B;  3V2N A;  1FOS E;  4JYB A;  3H1L E;  1RF1 A;  4AUW A;  3IN6 A;  1LTJ C;  4NPF X;  3AE5 C;  2WSS H;  3H1H J;  2FYU G;  2ITA A;  5KAI E;  1JCC A;  1OMI A;  2BCC J;  3L74 D;  3CC7 P;  4IFF A;  1NTK D;  2QJP C;  3CWB D;  1EXI A;  5AVY B;  3P7K A;  1NKZ B;  1X79 B;  3GMA A;  1HGV A;  1SQB J;  3D6Y A;  1QX8 A;  4OGQ B;  4R4L A;  3CC2 P;  5GTI H;  2JDI H;  5CHX A;  2FY8 A;  2L5G B;  3P8C E;  1H88 A;  5BU5 A;  2YXR B;  4U3F J;  2D2C B;  2E76 C;  1SQQ J;  1OZH A;  1GW4 A;  1N86 A;  2FYU J;  4Z1M H;  3GF3 A;  5APV A;  2KZJ A;  2OYI C;  3CXH D;  1OWA A;  1R5S A;  1PGQ A;  4AQR D;  4L74 A;  2W27 A;  1MV8 A;  1SQV D;  3HE4 B;  3SWY A;  2Y0E A;  3AEF C;  2Q7C A;  2M3B A;  1MUU A;  4Y28 J;  2NPS C;  3VMA A;  4BXL A;  1OW7 A;  5AW0 B;  1RQU A;  2WMM A;  2YO3 A;  3TSI A;  3V4Q A;  2A06 D;  2IZ1 A;  3H1I E;  4DCK A;  1HJB A;  1KIL C;  4TLF A;  1CI6 A;  1K05 A;  3B8E B;  3KQG A;  4HYT B;  2XZR A;  4MN4 C;  4UB6 E;  1SQB D;  1M56 D;  1N7S A;  1T3J A;  1FZE A;  3E7K A;  2YMK A;  2Q3I A;  2PP6 A;  1FZA A;  3RK3 B;  2Y0C A;  3M0A A;  4OGQ D;  5AVS B;  3WUV A;  3N7N A;  2XNX A;  1NTM K;  4GIF A;  3MUD A;  4JF7 A;  4PD4 H;  3VMY A;  2VRS A;  4CPG A;  5KLI B;  3A3Y B;  3CPW O;  5KAF E;  5CBO A;  1VQL P;  2KIK A;  1DD3 A;  4OH8 B;  4UB8 E;  2WSF J;  4YXD C;  2ZYG A;  3L72 J;  1BGY J;  4JQ0 D;  5DJT B;  1NTZ K;  3GLM A;  1AQ5 A;  4H0L B;  3G4S P;  2Q3E A;  2IBZ E;  1NVO A;  3TYY A;  1NU1 D;  5APT A;  1VQP P;  4WVZ A;  3MZW B;  3L74 J;  4PV1 B;  3W67 A;  2IDB A;  1EDK A;  1HGZ A;  3CX5 D;  1PP9 E;  3R4Y A;  1L4A B;  1ZV8 A;  1RHZ B;  2IYO A;  2W6B A;  5KAF H;  3T97 A;  4UB8 H;  1L0N K;  1YQ4 C;  1SQQ E;  2NPS D;  2Y0D A;  3BRV B;  1NTK K;  2E74 C;  2OGU A;  3A0H H;  3HRN A;  1LP1 B;  2AXC A;  1SQV E;  2G8Y A;  2RH0 A;  2WVR A;  3FWN A;  3HUS C;  2QJK B;  1DD4 A;  3B71 A;  4H44 B;  4KJM A;  5CBN A;  2H7H A;  2HFE D;  3AE8 C;  5CCG C;  1IFJ A;  3SFD C;  1PPJ E;  2Y9Y A;  1KYO I;  2IPP A;  2N1T B;  1GK6 A;  1VQ9 P;  1RF0 A;  5CCG D;  2MJZ A;  2JP3 A;  1NTM D;  1OIP A;  5CMZ A;  4LLH A;  5AW5 B;  4I6M C;  4ZKU A;  4C7N A;  1UII A;  1NO4 A;  2KSJ A;  1BCC E;  5H2F H;  1U7J A;  1YI2 P;  2WPV B;  3CCQ P;  1PPJ G;  4IOI H;  3BAS A;  3ITK A;  1SQX J;  3O6Q A;  2HR3 A;  4L76 A;  1LJ2 A;  3B5N C;  1K73 Q;  1PGJ A;  5B5E H;  3A0B H;  2WPR A;  3CX5 H;  1VF5 C;  3LIE A;  2E76 D;  2FFD A;  1PPJ D;  1ZXG A;  3CCJ P;  2JWA A;  4PV1 C;  1G1J A;  3BCC J;  2XV5 A;  1ZW0 A;  1SQP J;  2IFN A;  1HF9 A;  1LWU A;  1M1J B;  2H43 A;  1L4A C;  1KIL E;  2K3R A;  1YBK A;  4D6T E;  2V7Q J;  4M3L A;  3BVH A;  4HJG H;  3H25 A;  2QG4 A;  1RQV A;  3A0B E;  1YTZ T;  1NU1 J;  1SS1 A;  1IZN B;  2YKO A;  3V6I A;  3HUS B;  3L72 E;  1EZV I;  2FYN C;  1FOS F;  2K9J A;  4QMA A;  5DJU B;  1PL5 A;  1KYO D;  2Z5H A;  1OXZ A;  3PH0 A;  5AW6 B;  2KP8 A;  1W2B O;  3CCL P;  3IFM A;  1VQM P;  2P1J A;  1RE3 C;  3F5H A;  3H32 A;  1SQP G;  2N1T C;  1JOC A;  1FBM A;  3A2A A;  3OAK A;  1CSB A;  3M9B A;  5APQ A;  1FAV A;  5AW8 B;  1EDJ A;  2FYU D;  1FE6 A;  3G71 P;  2JKV A;  2QJY C;  4WWI A;  1JNM A;  4HB1 A;  5AW7 B;  3H1H D;  1JY3 P;  1JY2 P;  1AA0 A;  2QRX A;  1AQT A;  1KMI Z;  2M8R A;  3GHG C;  3P8M C;  2H89 C;  3L71 D;  3L36 A;  4WBA A;  3HD7 C;  4Y99 C;  3VOP A;  2FKW B;  2XU6 A;  1S5L H;  1GD2 E;  3CX5 I;  3RK3 E;  1VQ5 P;  2WSE H;  2CK3 H;  4NPE A;  5K5G B;  1Q7Y Q;  2Y9Z A;  3CL3 D;  1OVU A;  2IYP A;  2B87 B;  4D6T G;  1J1D B;  3L37 A;  1T6A A;  2POH A;  3V2P A;  1K8A Q;  4TT3 H;  1PP9 J;  1IJD B;  2H8P D;  3T97 B;  3WMM 0;  4U3F E;  4ZMD A;  1QEX A;  2RN0 A;  1FJP A;  1GK4 A;  1X0T A;  5APY A;  2J58 A;  2KYV A;  3HUS A;  2R44 A;  1Y8A A;  2R3C A;  3KHU A;  5BU8 B;  4YPC A;  2E5Y A;  4B86 A;  1ZR4 A;  2O3J A;  3M91 A;  3RL0 g;  5CCG A;  1K9M Q;  1YJ9 P;  3BAT A;  5KLV J;  1BCC G;  2KOG A;  3K5B A;  2YKQ A;  3CWB J;  1URQ D;  3L75 G;  2P67 A;  4GKG A;  1ZP0 C;  4YTP C;  4H0L D;  1PIX A;  4ASV A;  1OW6 A;  4IL6 E;  2QJP B;  1L0L G;  5CCH C;  2J5U A;  2R3S A;  2FXP A;  1IFM A;  1L0N E;  3O6Q B;  3A5T A;  3GHG B;  2AXT E;  1VQ6 P;  3HD7 B;  3CCS P;  1GL2 A;  1G2C B;  3H1K G;  1JO5 A;  3EFF K;  2OTL P;  1SP4 A;  1Y47 A;  1NTZ G;  1LT9 B;  1OVR A;  2B89 A;  4I7Z C;  2D2C C;  1DIP A;  2OYH B;  1W5C E;  1ZME C;  1XTC C;  2V7Q H;  4IL6 H;  3RGU A;  3PRJ A;  2BCC G;  1KD1 Q;  2M0B A;  3L75 E;  3BCC E;  3AEE C;  3VN0 A;  2C0X A;  2DW3 A;  1KFN A;  2K9Y A;  4IL6 X;  2B9B A;  1SQQ D;  3Q5R A;  1IFD A;  1SQB G;  2Z4E A;  3MGN A;  1EXJ A;  2E43 A;  3H1K J;  1GTW A;  2XND H;  3L73 E;  3LID A;  1GMJ A;  2A45 I;  4DZO A;  2O01 H;  1FZF A;  1VPC A;  4U3F G;  4EOT A;  1SQQ G;  2C0W A;  1GDT A;  2P7J A;  4N78 E;  5E79 E;  3Q5P A;  1IK9 A;  1IFP A;  1KIL A;  1KOR A;  3AE3 C;  1KQL A;  3FXE A;  4WB4 A;  4EDF A;  1M8O B;  2K1A A;  3E1I A;  4WY4 B;  3RK3 C;  3H1H E;  1RF1 C;  1E79 H;  2N9B A;  4DOJ A;  4RJT A;  1GZL A;  1NHL A;  3NFQ A;  3AE7 C;  3TGU E;  1H89 A;  4JYC A;  2YKP A;  1Z56 A;  1EQ7 A;  3HTK B;  3M0D A;  2HOD A;  3SWK A;  2IZ0 A;  3QH9 A;  1BE3 E;  1HJ0 A;  5KJ7 D;  1KB9 H;  3MUD C;  2WT7 A;  1M7L A;  1OFC X;  1AJY A;  2E42 A;  3H1I D;  1JM0 A;  4HKZ H;  2KI7 B;  1JMM A;  4C46 A;  3II6 A;  3AED C;  2KS1 A;  1LTB C;  1NTM G;  2WIT A;  3AE6 C;  3CCE P;  2W6A A;  5B66 E;  3BCC D;  1HBW A;  1KQG B;  2MKV A;  2JJL A;  2WPQ A;  1EC5 A;  3H1I G;  1QVF O;  3F89 A;  1S2E A;  1T8Z A;  3G3Z A;  3L72 G;  1BGY G;  3L70 E;  3L4F A;  4PD4 I;  3RK2 B;  3RL0 B;  1N73 A;  3HE4 A;  1S5L X;  1VDF A;  1ZRT D;  2O01 N;  4RES B;  1P84 I;  1HWT C;  1S5L E;  3L74 G;  5AW2 B;  2W6J H;  1GW3 A;  1U7M A;  2FBW C;  1SQB K;  3MIW A;  1LGH B;  1MKM A;  1OX3 A;  3CMA P;  1EDL A;  5B66 H;  1ZOY C;  1NU1 E;  5BVZ A;  2O1J A;  4H44 D;  1SVF A;  4GOD A;  1ZR2 A;  1YIT P;  1RF1 B;  3ABV C;  1T3U A;  1FDO A;  1PP9 D;  1A02 J;  3H1I J;  1T2K C;  3H1L J;  4DJG A;  1SQQ K;  3CCU P;  1HH0 A;  1J2J B;  5AVR B;  2O1K A;  3L35 A;  3UIA A;  1HVV A;  1OVV A;  1FZC B;  3BRT B;  4EI2 A;  2I1K A;  2LXB A;  1ZRT E;  1NU1 K;  2BEQ D;  2H88 C;  2HG5 D;  2K37 A;  3B5N A;  3JSV C;  1SQX D;  3L73 G;  1LWU C;  3PP5 A;  4JBZ A;  4L73 A;  4NPD A;  4UB6 H;  3TK1 A;  3Q1M A;  2OYI B;  1M57 D;  3GF7 A;  2JWD A;  3O8Z A;  1M1J C;  2N9Y B;  2OQQ A;  1JY3 N;  3EFG A;  3V4W A;  3H1L G;  3D6Z A;  1H8A A;  1PGP A;  2OTK E;  4N6J A;  5AW1 B;  4PJ0 H;  4U3F D;  1SQX G;  1LTA C;  3AEC C;  5EFW B;  2C9L Y;  1BGY D;  1JY2 O;  2A06 E;  3HE5 B;  4PD4 D;  3U59 A;  2LR2 A;  3RL0 C;  1X8Y A;  3RK3 D;  2IBZ D;  4BRY B;  3A7O A;  4EYY Q;  1JB0 J;  1RE3 A;  1TU3 F;  2P2U A;  2BEZ F;  3L73 J;  3VP8 A;  4WY4 D;  5KKZ C;  5TIS H;  1BDD A;  2IBZ I;  2NRG A;  2ZAE B;  1NTK J;  2PFX A;  3CX5 E;  3L70 J;  3R2P A;  4GOE A;  1Q81 Q;  1SQX E;  4WY4 A;  4PJ0 E;  4EIJ A;  1SQV J;  2W8Z A;  1LTS C; 
#chains in the Genus database with same CATH homology
 4D6T J;  1SQX J;  3L74 J;  3L71 J;  1NTZ J;  3H1K J;  3CWB J;  5KLV J;  1L0N J;  3H1H J;  3CX5 I;  4PD4 I;  3BCC J;  1SQP J;  3H1J J;  2BCC J;  1P84 I;  3CXH I;  1BE3 J;  3TGU J;  1BCC J;  1SQB J;  1NTM J;  1KYO I;  1NU1 J;  1PP9 J;  3L73 J;  3L75 J;  1EZV I;  2IBZ I;  3L70 J;  1NTK J;  4U3F J;  1SQQ J;  3H1I J;  3H1L J;  2FYU J;  3L72 J;  1BGY J;  1KB9 I;  1L0L J;  1SQV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...