1L0LJ

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
b'APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0lJ00
1L0NJ 1KB9I 3CXHI 1BGYJ 1SQQJ 3L72J 3TGUJ 1EZVI 1SQPJ 5KLVJ 3L75J 3H1KJ 4D6TJ 3CX5I 3H1JJ 4U3FJ 3L70J 3L74J 1BCCJ 2FYUJ 1BE3J 1SQBJ 4PD4I 1SQXJ 1NTMJ 3H1IJ 1NU1J 3BCCJ 1PP9J 2IBZI 3H1LJ 3L73J 1SQVJ 2BCCJ 3L71J 1KYOI 1L0LJ 1NTZJ 3CWBJ 1NTKJ 3H1HJ 1P84I
chains in the Genus database with same CATH superfamily
1SQQG 2QM8A 4JPZB 1DX7A 4OGQB 4ASVA 2KZJA 1PP9D 2E74D 1PP9G 3FGAD 5H2FE 3B4SA 2B88A 3KZIE 2KNCA 2PRRA 4OVNF 1VPCA 4WY4A 3VP8A 3ZDMA 5CCHA 2J5UA 1LTSC 3HUSC 1Q2NA 1M1JB 4EDFA 4N78D 3C8VA 5KKZC 5DJTB 2C9LY 3S9OA 1SQQJ 1IFDA 3L70D 4GOEA 3L70G 1LTGC 2M5AA 5APYA 1EDIA 3AE1C 2HR3A 1PP9J 1SFCA 3CWBG 2E75D 1QL2A 3R2PA 5KLVD 3PH0A 5KLVG 4ZKPA 3W68A 4GT1A 3B5NA 2KNCB 3V6IA 4PV1B 2IBZD 4WY4B 2AEFA 4ZNCA 4H0LC 1USDA 2KXPB 4HB1A 1MV8A 3RL0B 4L75A 3VP9A 3GG2A 3I56P 3CCQP 1OW6A 3L70J 4R4MA 3A5TA 3Q5RA 1VQMP 2Q7CA 2BCCD 3TK1A 5AVZB 2N9YB 1ZN5A 2NRGA 3F5HA 2Y0CA 1ZLLA 4WBAA 3M9BA 1SQPE 1LGHB 1JMMA 4IL6X 3BRVB 1S72P 3MTUE 1CW5A 1DH3A 5KLVJ 5GTIE 3CX5I 3A0BH 1LTJA 5CCGA 2N1TC 2D2CC 1NTKE 4BXLA 1VQLP 1ZP0C 1NH4A 3TYYA 2N1TD 2Y9YA 3B5NB 1USEA 2W6AA 1MZ9A 1IFMA 2FKWB 4LLHA 1YITP 3SWFA 3HD7A 1SQBK 1OMIA 1L0LD 4K3AA 5AVSB 5AW1B 3S1KA 1JO5A 1RF0A 1DEEG 1N86A 5DJUB 1LTTC 3MIWA 4U3FD 4U3FG 3D6YA 3JSVC 1GZLA 3P7KA 2P1JA 1AQ5A 2FYUK 4C7NB 2N9BA 1L0NE 1KILB 1LTJB 3H1HG 3AE8C 2KP8A 1RQUA 1X8YA 2ITAA 3B8EB 3EFFK 2IBZE 2IPPA 2OQQA 3L4FA 3PLNA 1E79H 5GTHH 2W83C 1FU1A 3HUSA 1FDIA 1QVGO 1KV4A 1MKMA 1UIIA 2GM4A 3HD7B 1VQPP 3FXEA 5CHXA 3G9RA 1N73B 2R32A 1LP1A 2QA4P 1Q82Q 4HYTB 2IYPA 4U3FJ 3I5CA 5E79H 1NTZE 1URQC 3CCMP 3D6ZA 1URQD 3CLQA 1N8RQ 1ZR4A 1ZXGA 1EZVG 3H1HJ 2ZT9C 1GU4A 1OWAA 4L74A 2I1JA 1HWTC 5C39A 3L75G 2C0XA 1VQ4P 2ZT9D 2QSIA 4L76A 2FY8A 2WSCJ 1FBMA 3M0DC 1NTMD 3HTKA 3T97B 3MP7B 2WT7B 3CX5E 1LTIC 2ZYGA 2I1KA 3GF3A 1GDTA 4QMAA 4C46A 3Q3DA 1P84E 1LJ2A 2B89A 1HH0A 1HJ0A 2Q3IA 2WVRA 2KS1B 1OVUA 3L75J 4KJMA 2K1AA 1NU1E 1G2CB 3MGNA 2WQYC 3KPEA 2HODA 1KYOH 2ZJSE 2O01N 4IFMA 4H0LB 4AQRD 1U57A 5APWA 2YO2A 1BE3E 3O8ZA 3H1KD 1NHLA 1KQGB 3H1LE 1MFTA 2WSCH 4XA4A 3IAOA 3G3ZA 3RK3E 1SQBG 1AFOA 2A45G 2WSEJ 2ZXXA 3U1AA 1VQ6P 3E7KA 3GHGC 3PHLA 1SQQK 1ZRTD 1ZV8A 1ZW0A 1M1KQ 5KJ7D 2B87B 3AE4C 3EFGA 1L4AB 1R8EA 1G1IA 1BGYE 3L72E 1NTKK 2D2CB 2HODB 1J1EC 5CBNA 2FYNC 2BEQD 3VN0A 1N7SC 1NTME 1QVFO 1OIPA 2RN0A 2QJKC 1JUNA 2K88A 2JEEA 2OGUA 2G8YA 1N7SD 2XKMA 1H88A 2M0BA 2YO3A 3G71P 2K9JB 1LWUB 3F89A 2OYOA 2H8PD 3NMDA 1YBKA 4PV1D 4CPGA 4IFFA 4D6TG 1L2PA 2ZYDA 1SQVE 3RK2C 3C1LA 2WSEH 1URQA 3RK2D 3CCUP 1LNQA 1KFMA 3IR9A 4N3YB 4H44B 1FZCC 1HBWA 5KLVK 3M0DA 2KZIA 2E5TA 3AEBC 1N7LA 2PFXA 1S9KE 4Y99B 2Y9ZA 1SLQA 3CMEP 2M8RA 4MN4C 3A0HE 4JF7A 2OTLP 4PJ0H 1FE6A 2V7QJ 4D6TJ 1W2EA 3L71E 3RBZA 2NZ2A 4PD4I 3H1IG 2H89C 5AVXB 2A45H 2AXTH 3R4YA 1NO4A 4NPEA 2QE7H 2J58A 1EXIA 1CI6B 1T3UA 4GOFA 4TT3H 2JDIH 1PPJE 1S5LX 3H1JD 2FXPA 2LXCB 1NYHA 5APVA 1J1DB 3QWOC 1QL1A 1KQSO 3WU2E 1GL2B 2YMKA 2OYHC 4AYCA 3AE6C 2QVAA 5AW8B 5B66E 1M7LA 4JQ0D 2YNYA 1L0LK 4BRYA 3GHGA 1S3JA 1SQPD 1SQPG 3TDKA 4O9BA 2V7QH 1GK4A 2E74C 3ITKA 2W6JH 1K04A 1VL2A 2XNXA 1VF5C 1NTKD 1VF5D 1NTKG 3V2PA 1RE4C 1FAVA 5H2FH 3GF7A 3Q5PA 1N7SA 2WPVB 3KZIH 1OFCX 1FOSE 4R4LA 3NXSA 3SFEC 3TSIA 2POHA 2QJYC 2KSEA 2E5YA 1SQPJ 1BCCD 4BRYB 1IFPA 3E1IA 3P32A 3OAKA 3P8CE 1YYCA 2E75C 1L0ND 1NTKJ 1L0NG 3H1JE 4PD4E 1BDDA 3L74E 2XNDH 3BVHA 2FFDC 2Y0DA 2PGDA 1FZCA 1SQXE 2IDBA 1KN7A 2IBZG 3VMXA 2FYNB 1HGZA 2GA1A 1NTMK 3KHUA 3CCSP 2JP3A 1H89A 3K5BA 1GTWA 1KILE 4I2LC 1K05A 2W6BA 1EDKA 2BCCG 3BASA 4B86A 1NTZD 2M5AB 1JY3P 2SPZA 1L0NJ 1FOSF 5KLIC 4DOJA 1SFCB 2NPSC 2JR8A 5CBOA 1JCDA 2NPSD 5GTIH 3JCUE 1XTGB 3CPWO 1U7JA 1QX8A 3CX5D 1KB9I 2Q9IA 2OYHA 3FXDA 1JY2P 1PL5A 2QJPC 4DJGA 3GMAA 3A3YB 1YJWP 1E5WA 4IL6E 1P84D 1GMJA 2BCCJ 1L0LG 1A02F 2W27A 2FXOA 2PAJA 1NTZJ 2WSFJ 1HTLC 4NPDA 1BCCE 3M06A 3BRTB 1HF9A 1YQ3C 1NU1D 3PJSK 3AECC 2LKMA 1KYOI 1RE4A 1JY3N 3GLMA 1VQOP 3M91A 5EFWB 3CCEP 3WUVA 4H13D 1NWQA 1BE3D 4I7ZC 3RK3C 2P7JA 1KTMA 3H1LD 1K73Q 4ZMDA 3CWBE 1ZMEC 3RK3D 3OA7A 4H44D 4UB6E 2K37A 1JY3O 1L0LJ 3HE4A 1HJBA 3AEEC 3CXHI 2YIUC 3MD0A 2IZ1A 2KOGA 5KAFE 1KZUB 1M56D 3JC22 1VQNP 1NU1J 3PTZA 3FWNA 4YXDC 1DEBA 1Q86Q 1BGYD 2WSFH 3L72D 1BGYG 5KAIE 3L72G 1T3JA 3L36A 1IZNB 2FFDA 1AVOA 1EZVI 2QG4A 3AE3C 2E42A 1FS0E 1RF1C 1NTMG 4DT0A 1KQFB 3RBXA 1PZQA 2P58A 1LT9C 4EYYQ 2E76C 1JTHA 4HJGH 3HUSB 3V5BA 2E76D 3CX5H 1LTAC 3UIAA 1PGOA 4C7RA 1OX3A 5KKZB 2QJYB 4Y28J 1KB9E 2WMMA 1LP1B 1SQVD 4GIFA 2ZXEB 1GW3A 3H32A 1P84H 2YKQA 1FZEA 4UB8E 2KB7P 3G4SP 1SP4A 1BGYJ 3L72J 4RJTA 1BDCA 2AEMA 1EDLA 2CK3H 5B5EE 4K35A 2NPSA 3VOPA 1YTZI 2MKVA 1SQXK 2N1TA 2BASA 1NTMJ 4WVZA 5AW3B 3PP5A 1Z56A 2BEZF 4OGQC 1Q7YQ 1S9KD 1CSBA 3HTKB 4OGQD 1LTBC 1PV3A 5TISE 3H1KG 3HE5A 1JTHB 4KHXA 1AA0A 1JOCA 1X0TA 3CC2P 1YJNP 3II6A 4GODA 3KYQA 2Q3EA 3L71D 4ZKUA 2Z4EA 1SQVJ 1WMKA 2A45I 2JO1A 3B71A 4EIJA 1NAYA 2J59M 1M1JC 1PPJD 1SQPK 2B9BA 2WSSH 5KJ7C 1T8ZA 2GUSA 2KI7B 1PFIA 1GD2E 3CXHE 3O6QA 2QRXA 3L35A 1NVOA 5BU5A 3TNUA 3AE5C 2N1TB 1DD3A 1OW7A 3OJAB 3H1KJ 3BCCE 1NGMB 3CI9A 2R5BA 2FYZA 1QGKB 3AEDC 5BVZA 2WTYA 1EZVE 2KSJA 3L71J 4PV1C 3CMAP 3CC4P 1AVYA 1ZR2A 1LT1A 4WY4D 2P67A 5CCHC 1KMIZ 3CCLP 1KC8Q 3RL0C 5CCHD 3RL0D 1FJKA 2HPCA 2A06D 3M9QA 2K3RA 1QEXA 2Y0EA 2LR2A 3O6QB 1Y8AA 1J2JB 1L0NK 2IFNA 1T6AA 1ZOYC 3TNUB 1M90Q 2HLOA 1RF1A 5AW6B 1LT9A 3Q5SA 2OYIC 1IFJA 3CL3D 1Q90D 3BATA 4DCKA 1PGQA 2RMZA 3AEFC 3A0HH 2Q6QA 3G6EP 3B5ND 3AEAC 3USSA 2XU6A 2M3BA 3P8CD 2AXCA 1NTZK 2HPCB 1URQB 2HFED 1SQBE 1RE3C 4PD4D 4RKUJ 3H1JG 3L74D 3L74G 2ZT9B 3V2QA 4JYCA 1YI2P 1SQXD 1SQXG 3LIEA 2ZAEB 1VQKP 3TGUE 2R3SA 2I8DA 3U1CA 2OTJP 3WU2H 2FYUE 4KT0J 3A2AA 1KILC 1JCCA 1KILD 5CCGD 5AVRB 1TU3F 1S5LE 1WRGA 5B66H 1M1JA 1OVVA 1SVFA 5KJ7A 3EWKA 3RGUA 3H1JJ 3M0AA 3L74J 3NFQA 3H6PA 2A06E 1A02J 1SQXJ 3H25A 3CC7P 3HD7D 1NU1K 1N73C 5APSA 5CJ4A 1R5SA 4D6TE 1KFNA 4M3LA 3IFMA 5KTBA 3ABVC 1OW8A 1YHQP 3L73E 4XE5B 3Q1MA 2KIKA 1BSHA 4HH2A 1MUUA 1Y47A 4EI2A 4L73A 3AEGC 3RL0g 1BCCG 5CMZA 3HRNA 3GHGB 1FZFA 1PGJA 4TLFA 2L91A 2HYNA 2WPRA 3FX0A 5AW5B 1GK6A 1FC2C 1S1CX 3L37A 3MHVA 3H1IE 2ZFCA 3VYIA 4PD4H 1NKZB 1G1JA 4EOTA 1KD1Q 1J1EB 3LIDA 1N7SB 2IBZI 2OYIA 4I1LA 2QJKB 3CWBD 1H0TA 1FZGA 4RO0A 3FWLA 2ZVOB 3CD6P 1NOHA 2KLUA 1RHZB 1BCCJ 1RH5B 1JMBA 4H0LD 1VQ9P 1SQVK 1NTZG 3RK2B 1IFNA 4W80A 1IO4A 1RE3A 4GKGA 4AUWA 1FZCB 3SWYA 1SQQE 1R5LA 5TJHA 1JEKA 3CWBJ 1IFIA 1XTCC 3JCUH 3A0BE 4W7ZA 4C7NA 4OH8B 2OYIB 2K9YA 1L4AC 1T2KC 1H0TB 2XDJA 1L4AD 1KILA 1PP9E 1T2KD 1M8OB 3D70A 3C9IA 2D2CD 2JWAA 1KB9D 2CPBA 5APQA 1IK9A 1S4XA 2KLVA 2Z5HA 1DIPA 3E1RA 1P84I 4IL6H 2IZ0A 3KXDA 1VDFA 1LWUC 2W90A 3AE7C 3N4XA 1RY3A 1OVRA 2PP6A 4A7PA 1NU1G 3MUDC 4N78E 1S2EA 1N73A 5AVTB 1HGVA 2MJZA 2C9NY 3L70E 1Q81Q 1OZHA 4H13C 3U59A 2ZVNB 1BE3G 3VMZA 2R44A 1JM0A 4IOIH 1KYOD 4H44C 3H1LG 2CPSA 2OYHB 3KQGA 3H1HD 4HKZH 5AW4B 5KLVE 2YXQB 3M9HA 2YXRB 3T97A 5GTHE 4UB6H 5AW7B 1HVVA 2WT7A 4NPFX 4Y99C 2FXMA 2IFMA 4JYBA 1JY2N 2RH0A 4WWIA 1WT6A 1JNMA 3V2RA 5KAFH 3CXHD 2E74B 3MZWB 3S4RA 2WPSA 1VF5B 5E79E 1D7MA 5CJ0A 1JY2O 3P8MC 2GUVA 3I55P 2BCCE 1NAFA 4W7YA 5KAIH 3Q2YA 1HUCA 1BE3J 2W8ZA 3BCCD 5K5GB 3BCCG 3WMM0 2O1JA 3H1LJ 2KS1A 2Z5IA 1EZVD 4LGDE 1G2CA 4I6MC 3L75D 4YXWH 1YQ4C 1J1DC 2KYVA 3QH9A 1NKNA 3HE4B 3D71A 1GL2C 2JKVA 1BSNA 1YIJP 4RESB 1GL2D 1SQVG 1KB9H 3A7OA 2R5DA 1DD4A 5AVYB 1K9MQ 2O01J 3SFDC 2Q5UA 2E75B 1KQLA 2LXBA 4UB8H 3WUUA 2QEXP 1L0LE 3GW6A 1EC5A 2FFDB 3CCJP 1FDOA 3BCCJ 5APTA 5B5EH 1Y9BA 1W2BO 3AE2C 5AW9B 5AVUB 4U3FE 2B87A 1YTZT 2UWJE 1L4AA 3OW2O 2P10A 1VQ8P 1KYOE 5TISH 5BU8B 2G3AA 2JJLA 1SS1A 3H1HE 2E43A 2YKPA 3L71G 4YPCA 1IC2A 1FDMA 1W5CE 1AV1A 2K9JA 1LWUA 3H32B 1PPJG 4ASWA 1SQBD 1AJYA 2WITA 5KLIB 1M57D 2FBWC 5M1BA 3MUDA 2YMYA 2WWWA 1U7MA 2NPSB 3IF4A 3CXHH 1EXJA 1YJ9P 2QIWA 3PRJA 2O01H 2O1KA 2O3JA 4GDOA 3TGUD 3TGUG 2ZYAA 2FYUD 2FYUG 1JB0J 3KDPB 2OARA 3HE5B 2QJPB 4BWNA 1AQTA 3L75E 1IK7A 5APXA 4WY4C 2Q1KA 4N6JA 2AEJA 2IX7C 1FZAA 3V4WA 1QLED 3LW5J 2R3CA 1EDJA 1SQBJ 3CCVP 4XFJA 3V2NA 2A06G 5AVWB 1H8AA 3NTNA 4YTPC 2H7HA 2C0WA 2RKLA 4D6TD 1CZQA 1X9VA 5AVVB 3TGUJ 2XV5A 4U7JA 1GW4A 2FYUJ 1CI6A 4H13B 4OWFA 4WB4A 2L5GB 3L73D 3VMYA 2V4HA 3L73G 1X79B 3VMAA 2DW3A 1N2DC 2JWDA 4I7ZB 1SFCC 3RK3B 1PIXA 4JBZA 1OXZA 2H43A 1SFCD 2WZ7A 2M3EA 4LC1A 1MFZA 3AE9C 1GU5A 3B5NC 1GL2A 4DZOA 2YIUB 3SWKA 1FZBA 1IJDB 4PJ0E 3H1KE 3V4QA 2QM7A 1RQVA 2KK7A 1EQ7A 2AXTE 3LW5H 5AVQB 3H1ID 5AW2B 1K8AQ 3L73J 1RF1B 5APUA 3W67A 1ZRTE 3SSUA 1LT9B 3VTPC 2E76B 2YKOA 2KUBA 2P2UA 3TF5A 1LTJC 5CCGC 2HG5D 5L8RJ 2H88C 1UIXA 3CCRP 5AW0B 2XZRA 1S5LH 1X22A 1VQ7P 3WUTA 1KORA 3HD7C 3H1IJ 2WPQA 3N7NA 4Z1MH 1PGPA 2IYOA 2OTKE 3EQ2A 2VRSA 4IFDK 1FJPA 3IN6A 1RF0C 1NJIQ 1VQ5P 1SQQD
chains in the Genus database with same CATH topology
1L0NJ 1KB9I 3CXHI 1BGYJ 1SQQJ 3L72J 3TGUJ 1EZVI 1SQPJ 5KLVJ 3L75J 3H1KJ 4D6TJ 3CX5I 3H1JJ 4U3FJ 3L70J 3L74J 1BCCJ 2FYUJ 1BE3J 1SQBJ 4PD4I 1SQXJ 1NTMJ 3H1IJ 1NU1J 3BCCJ 1PP9J 2IBZI 3H1LJ 3L73J 1SQVJ 2BCCJ 3L71J 1KYOI 1L0LJ 1NTZJ 3CWBJ 1NTKJ 3H1HJ 1P84I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N J;  1KB9 I;  3CXH I;  1BGY J;  1SQQ J;  3L72 J;  3TGU J;  1EZV I;  1SQP J;  5KLV J;  3L75 J;  3H1K J;  4D6T J;  3CX5 I;  3H1J J;  4U3F J;  3L70 J;  3L74 J;  1BCC J;  2FYU J;  1BE3 J;  1SQB J;  4PD4 I;  1SQX J;  1NTM J;  3H1I J;  1NU1 J;  3BCC J;  1PP9 J;  2IBZ I;  3H1L J;  3L73 J;  1SQV J;  2BCC J;  3L71 J;  1KYO I;  1L0L J;  1NTZ J;  3CWB J;  1NTK J;  3H1H J;  1P84 I; 
#chains in the Genus database with same CATH topology
 1SQQ G;  2QM8 A;  4JPZ B;  1DX7 A;  4OGQ B;  4ASV A;  2KZJ A;  1PP9 D;  2E74 D;  1PP9 G;  3FGA D;  5H2F E;  3B4S A;  2B88 A;  3KZI E;  2KNC A;  2PRR A;  4OVN F;  1VPC A;  4WY4 A;  3VP8 A;  3ZDM A;  5CCH A;  2J5U A;  1LTS C;  3HUS C;  1Q2N A;  1M1J B;  4EDF A;  4N78 D;  3C8V A;  5KKZ C;  5DJT B;  2C9L Y;  3S9O A;  1SQQ J;  1IFD A;  3L70 D;  4GOE A;  3L70 G;  1LTG C;  2M5A A;  5APY A;  1EDI A;  3AE1 C;  2HR3 A;  1PP9 J;  1SFC A;  3CWB G;  2E75 D;  1QL2 A;  3R2P A;  5KLV D;  3PH0 A;  5KLV G;  4ZKP A;  3W68 A;  4GT1 A;  3B5N A;  2KNC B;  3V6I A;  4PV1 B;  2IBZ D;  4WY4 B;  2AEF A;  4ZNC A;  4H0L C;  1USD A;  2KXP B;  4HB1 A;  1MV8 A;  3RL0 B;  4L75 A;  3VP9 A;  3GG2 A;  3I56 P;  3CCQ P;  1OW6 A;  3L70 J;  4R4M A;  3A5T A;  3Q5R A;  1VQM P;  2Q7C A;  2BCC D;  3TK1 A;  5AVZ B;  2N9Y B;  1ZN5 A;  2NRG A;  3F5H A;  2Y0C A;  1ZLL A;  4WBA A;  3M9B A;  1SQP E;  1LGH B;  1JMM A;  4IL6 X;  3BRV B;  1S72 P;  3MTU E;  1CW5 A;  1DH3 A;  5KLV J;  5GTI E;  3CX5 I;  3A0B H;  1LTJ A;  5CCG A;  2N1T C;  2D2C C;  1NTK E;  4BXL A;  1VQL P;  1ZP0 C;  1NH4 A;  3TYY A;  2N1T D;  2Y9Y A;  3B5N B;  1USE A;  2W6A A;  1MZ9 A;  1IFM A;  2FKW B;  4LLH A;  1YIT P;  3SWF A;  3HD7 A;  1SQB K;  1OMI A;  1L0L D;  4K3A A;  5AVS B;  5AW1 B;  3S1K A;  1JO5 A;  1RF0 A;  1DEE G;  1N86 A;  5DJU B;  1LTT C;  3MIW A;  4U3F D;  4U3F G;  3D6Y A;  3JSV C;  1GZL A;  3P7K A;  2P1J A;  1AQ5 A;  2FYU K;  4C7N B;  2N9B A;  1L0N E;  1KIL B;  1LTJ B;  3H1H G;  3AE8 C;  2KP8 A;  1RQU A;  1X8Y A;  2ITA A;  3B8E B;  3EFF K;  2IBZ E;  2IPP A;  2OQQ A;  3L4F A;  3PLN A;  1E79 H;  5GTH H;  2W83 C;  1FU1 A;  3HUS A;  1FDI A;  1QVG O;  1KV4 A;  1MKM A;  1UII A;  2GM4 A;  3HD7 B;  1VQP P;  3FXE A;  5CHX A;  3G9R A;  1N73 B;  2R32 A;  1LP1 A;  2QA4 P;  1Q82 Q;  4HYT B;  2IYP A;  4U3F J;  3I5C A;  5E79 H;  1NTZ E;  1URQ C;  3CCM P;  3D6Z A;  1URQ D;  3CLQ A;  1N8R Q;  1ZR4 A;  1ZXG A;  1EZV G;  3H1H J;  2ZT9 C;  1GU4 A;  1OWA A;  4L74 A;  2I1J A;  1HWT C;  5C39 A;  3L75 G;  2C0X A;  1VQ4 P;  2ZT9 D;  2QSI A;  4L76 A;  2FY8 A;  2WSC J;  1FBM A;  3M0D C;  1NTM D;  3HTK A;  3T97 B;  3MP7 B;  2WT7 B;  3CX5 E;  1LTI C;  2ZYG A;  2I1K A;  3GF3 A;  1GDT A;  4QMA A;  4C46 A;  3Q3D A;  1P84 E;  1LJ2 A;  2B89 A;  1HH0 A;  1HJ0 A;  2Q3I A;  2WVR A;  2KS1 B;  1OVU A;  3L75 J;  4KJM A;  2K1A A;  1NU1 E;  1G2C B;  3MGN A;  2WQY C;  3KPE A;  2HOD A;  1KYO H;  2ZJS E;  2O01 N;  4IFM A;  4H0L B;  4AQR D;  1U57 A;  5APW A;  2YO2 A;  1BE3 E;  3O8Z A;  3H1K D;  1NHL A;  1KQG B;  3H1L E;  1MFT A;  2WSC H;  4XA4 A;  3IAO A;  3G3Z A;  3RK3 E;  1SQB G;  1AFO A;  2A45 G;  2WSE J;  2ZXX A;  3U1A A;  1VQ6 P;  3E7K A;  3GHG C;  3PHL A;  1SQQ K;  1ZRT D;  1ZV8 A;  1ZW0 A;  1M1K Q;  5KJ7 D;  2B87 B;  3AE4 C;  3EFG A;  1L4A B;  1R8E A;  1G1I A;  1BGY E;  3L72 E;  1NTK K;  2D2C B;  2HOD B;  1J1E C;  5CBN A;  2FYN C;  2BEQ D;  3VN0 A;  1N7S C;  1NTM E;  1QVF O;  1OIP A;  2RN0 A;  2QJK C;  1JUN A;  2K88 A;  2JEE A;  2OGU A;  2G8Y A;  1N7S D;  2XKM A;  1H88 A;  2M0B A;  2YO3 A;  3G71 P;  2K9J B;  1LWU B;  3F89 A;  2OYO A;  2H8P D;  3NMD A;  1YBK A;  4PV1 D;  4CPG A;  4IFF A;  4D6T G;  1L2P A;  2ZYD A;  1SQV E;  3RK2 C;  3C1L A;  2WSE H;  1URQ A;  3RK2 D;  3CCU P;  1LNQ A;  1KFM A;  3IR9 A;  4N3Y B;  4H44 B;  1FZC C;  1HBW A;  5KLV K;  3M0D A;  2KZI A;  2E5T A;  3AEB C;  1N7L A;  2PFX A;  1S9K E;  4Y99 B;  2Y9Z A;  1SLQ A;  3CME P;  2M8R A;  4MN4 C;  3A0H E;  4JF7 A;  2OTL P;  4PJ0 H;  1FE6 A;  2V7Q J;  4D6T J;  1W2E A;  3L71 E;  3RBZ A;  2NZ2 A;  4PD4 I;  3H1I G;  2H89 C;  5AVX B;  2A45 H;  2AXT H;  3R4Y A;  1NO4 A;  4NPE A;  2QE7 H;  2J58 A;  1EXI A;  1CI6 B;  1T3U A;  4GOF A;  4TT3 H;  2JDI H;  1PPJ E;  1S5L X;  3H1J D;  2FXP A;  2LXC B;  1NYH A;  5APV A;  1J1D B;  3QWO C;  1QL1 A;  1KQS O;  3WU2 E;  1GL2 B;  2YMK A;  2OYH C;  4AYC A;  3AE6 C;  2QVA A;  5AW8 B;  5B66 E;  1M7L A;  4JQ0 D;  2YNY A;  1L0L K;  4BRY A;  3GHG A;  1S3J A;  1SQP D;  1SQP G;  3TDK A;  4O9B A;  2V7Q H;  1GK4 A;  2E74 C;  3ITK A;  2W6J H;  1K04 A;  1VL2 A;  2XNX A;  1VF5 C;  1NTK D;  1VF5 D;  1NTK G;  3V2P A;  1RE4 C;  1FAV A;  5H2F H;  3GF7 A;  3Q5P A;  1N7S A;  2WPV B;  3KZI H;  1OFC X;  1FOS E;  4R4L A;  3NXS A;  3SFE C;  3TSI A;  2POH A;  2QJY C;  2KSE A;  2E5Y A;  1SQP J;  1BCC D;  4BRY B;  1IFP A;  3E1I A;  3P32 A;  3OAK A;  3P8C E;  1YYC A;  2E75 C;  1L0N D;  1NTK J;  1L0N G;  3H1J E;  4PD4 E;  1BDD A;  3L74 E;  2XND H;  3BVH A;  2FFD C;  2Y0D A;  2PGD A;  1FZC A;  1SQX E;  2IDB A;  1KN7 A;  2IBZ G;  3VMX A;  2FYN B;  1HGZ A;  2GA1 A;  1NTM K;  3KHU A;  3CCS P;  2JP3 A;  1H89 A;  3K5B A;  1GTW A;  1KIL E;  4I2L C;  1K05 A;  2W6B A;  1EDK A;  2BCC G;  3BAS A;  4B86 A;  1NTZ D;  2M5A B;  1JY3 P;  2SPZ A;  1L0N J;  1FOS F;  5KLI C;  4DOJ A;  1SFC B;  2NPS C;  2JR8 A;  5CBO A;  1JCD A;  2NPS D;  5GTI H;  3JCU E;  1XTG B;  3CPW O;  1U7J A;  1QX8 A;  3CX5 D;  1KB9 I;  2Q9I A;  2OYH A;  3FXD A;  1JY2 P;  1PL5 A;  2QJP C;  4DJG A;  3GMA A;  3A3Y B;  1YJW P;  1E5W A;  4IL6 E;  1P84 D;  1GMJ A;  2BCC J;  1L0L G;  1A02 F;  2W27 A;  2FXO A;  2PAJ A;  1NTZ J;  2WSF J;  1HTL C;  4NPD A;  1BCC E;  3M06 A;  3BRT B;  1HF9 A;  1YQ3 C;  1NU1 D;  3PJS K;  3AEC C;  2LKM A;  1KYO I;  1RE4 A;  1JY3 N;  3GLM A;  1VQO P;  3M91 A;  5EFW B;  3CCE P;  3WUV A;  4H13 D;  1NWQ A;  1BE3 D;  4I7Z C;  3RK3 C;  2P7J A;  1KTM A;  3H1L D;  1K73 Q;  4ZMD A;  3CWB E;  1ZME C;  3RK3 D;  3OA7 A;  4H44 D;  4UB6 E;  2K37 A;  1JY3 O;  1L0L J;  3HE4 A;  1HJB A;  3AEE C;  3CXH I;  2YIU C;  3MD0 A;  2IZ1 A;  2KOG A;  5KAF E;  1KZU B;  1M56 D;  3JC2 2;  1VQN P;  1NU1 J;  3PTZ A;  3FWN A;  4YXD C;  1DEB A;  1Q86 Q;  1BGY D;  2WSF H;  3L72 D;  1BGY G;  5KAI E;  3L72 G;  1T3J A;  3L36 A;  1IZN B;  2FFD A;  1AVO A;  1EZV I;  2QG4 A;  3AE3 C;  2E42 A;  1FS0 E;  1RF1 C;  1NTM G;  4DT0 A;  1KQF B;  3RBX A;  1PZQ A;  2P58 A;  1LT9 C;  4EYY Q;  2E76 C;  1JTH A;  4HJG H;  3HUS B;  3V5B A;  2E76 D;  3CX5 H;  1LTA C;  3UIA A;  1PGO A;  4C7R A;  1OX3 A;  5KKZ B;  2QJY B;  4Y28 J;  1KB9 E;  2WMM A;  1LP1 B;  1SQV D;  4GIF A;  2ZXE B;  1GW3 A;  3H32 A;  1P84 H;  2YKQ A;  1FZE A;  4UB8 E;  2KB7 P;  3G4S P;  1SP4 A;  1BGY J;  3L72 J;  4RJT A;  1BDC A;  2AEM A;  1EDL A;  2CK3 H;  5B5E E;  4K35 A;  2NPS A;  3VOP A;  1YTZ I;  2MKV A;  1SQX K;  2N1T A;  2BAS A;  1NTM J;  4WVZ A;  5AW3 B;  3PP5 A;  1Z56 A;  2BEZ F;  4OGQ C;  1Q7Y Q;  1S9K D;  1CSB A;  3HTK B;  4OGQ D;  1LTB C;  1PV3 A;  5TIS E;  3H1K G;  3HE5 A;  1JTH B;  4KHX A;  1AA0 A;  1JOC A;  1X0T A;  3CC2 P;  1YJN P;  3II6 A;  4GOD A;  3KYQ A;  2Q3E A;  3L71 D;  4ZKU A;  2Z4E A;  1SQV J;  1WMK A;  2A45 I;  2JO1 A;  3B71 A;  4EIJ A;  1NAY A;  2J59 M;  1M1J C;  1PPJ D;  1SQP K;  2B9B A;  2WSS H;  5KJ7 C;  1T8Z A;  2GUS A;  2KI7 B;  1PFI A;  1GD2 E;  3CXH E;  3O6Q A;  2QRX A;  3L35 A;  1NVO A;  5BU5 A;  3TNU A;  3AE5 C;  2N1T B;  1DD3 A;  1OW7 A;  3OJA B;  3H1K J;  3BCC E;  1NGM B;  3CI9 A;  2R5B A;  2FYZ A;  1QGK B;  3AED C;  5BVZ A;  2WTY A;  1EZV E;  2KSJ A;  3L71 J;  4PV1 C;  3CMA P;  3CC4 P;  1AVY A;  1ZR2 A;  1LT1 A;  4WY4 D;  2P67 A;  5CCH C;  1KMI Z;  3CCL P;  1KC8 Q;  3RL0 C;  5CCH D;  3RL0 D;  1FJK A;  2HPC A;  2A06 D;  3M9Q A;  2K3R A;  1QEX A;  2Y0E A;  2LR2 A;  3O6Q B;  1Y8A A;  1J2J B;  1L0N K;  2IFN A;  1T6A A;  1ZOY C;  3TNU B;  1M90 Q;  2HLO A;  1RF1 A;  5AW6 B;  1LT9 A;  3Q5S A;  2OYI C;  1IFJ A;  3CL3 D;  1Q90 D;  3BAT A;  4DCK A;  1PGQ A;  2RMZ A;  3AEF C;  3A0H H;  2Q6Q A;  3G6E P;  3B5N D;  3AEA C;  3USS A;  2XU6 A;  2M3B A;  3P8C D;  2AXC A;  1NTZ K;  2HPC B;  1URQ B;  2HFE D;  1SQB E;  1RE3 C;  4PD4 D;  4RKU J;  3H1J G;  3L74 D;  3L74 G;  2ZT9 B;  3V2Q A;  4JYC A;  1YI2 P;  1SQX D;  1SQX G;  3LIE A;  2ZAE B;  1VQK P;  3TGU E;  2R3S A;  2I8D A;  3U1C A;  2OTJ P;  3WU2 H;  2FYU E;  4KT0 J;  3A2A A;  1KIL C;  1JCC A;  1KIL D;  5CCG D;  5AVR B;  1TU3 F;  1S5L E;  1WRG A;  5B66 H;  1M1J A;  1OVV A;  1SVF A;  5KJ7 A;  3EWK A;  3RGU A;  3H1J J;  3M0A A;  3L74 J;  3NFQ A;  3H6P A;  2A06 E;  1A02 J;  1SQX J;  3H25 A;  3CC7 P;  3HD7 D;  1NU1 K;  1N73 C;  5APS A;  5CJ4 A;  1R5S A;  4D6T E;  1KFN A;  4M3L A;  3IFM A;  5KTB A;  3ABV C;  1OW8 A;  1YHQ P;  3L73 E;  4XE5 B;  3Q1M A;  2KIK A;  1BSH A;  4HH2 A;  1MUU A;  1Y47 A;  4EI2 A;  4L73 A;  3AEG C;  3RL0 g;  1BCC G;  5CMZ A;  3HRN A;  3GHG B;  1FZF A;  1PGJ A;  4TLF A;  2L91 A;  2HYN A;  2WPR A;  3FX0 A;  5AW5 B;  1GK6 A;  1FC2 C;  1S1C X;  3L37 A;  3MHV A;  3H1I E;  2ZFC A;  3VYI A;  4PD4 H;  1NKZ B;  1G1J A;  4EOT A;  1KD1 Q;  1J1E B;  3LID A;  1N7S B;  2IBZ I;  2OYI A;  4I1L A;  2QJK B;  3CWB D;  1H0T A;  1FZG A;  4RO0 A;  3FWL A;  2ZVO B;  3CD6 P;  1NOH A;  2KLU A;  1RHZ B;  1BCC J;  1RH5 B;  1JMB A;  4H0L D;  1VQ9 P;  1SQV K;  1NTZ G;  3RK2 B;  1IFN A;  4W80 A;  1IO4 A;  1RE3 A;  4GKG A;  4AUW A;  1FZC B;  3SWY A;  1SQQ E;  1R5L A;  5TJH A;  1JEK A;  3CWB J;  1IFI A;  1XTC C;  3JCU H;  3A0B E;  4W7Z A;  4C7N A;  4OH8 B;  2OYI B;  2K9Y A;  1L4A C;  1T2K C;  1H0T B;  2XDJ A;  1L4A D;  1KIL A;  1PP9 E;  1T2K D;  1M8O B;  3D70 A;  3C9I A;  2D2C D;  2JWA A;  1KB9 D;  2CPB A;  5APQ A;  1IK9 A;  1S4X A;  2KLV A;  2Z5H A;  1DIP A;  3E1R A;  1P84 I;  4IL6 H;  2IZ0 A;  3KXD A;  1VDF A;  1LWU C;  2W90 A;  3AE7 C;  3N4X A;  1RY3 A;  1OVR A;  2PP6 A;  4A7P A;  1NU1 G;  3MUD C;  4N78 E;  1S2E A;  1N73 A;  5AVT B;  1HGV A;  2MJZ A;  2C9N Y;  3L70 E;  1Q81 Q;  1OZH A;  4H13 C;  3U59 A;  2ZVN B;  1BE3 G;  3VMZ A;  2R44 A;  1JM0 A;  4IOI H;  1KYO D;  4H44 C;  3H1L G;  2CPS A;  2OYH B;  3KQG A;  3H1H D;  4HKZ H;  5AW4 B;  5KLV E;  2YXQ B;  3M9H A;  2YXR B;  3T97 A;  5GTH E;  4UB6 H;  5AW7 B;  1HVV A;  2WT7 A;  4NPF X;  4Y99 C;  2FXM A;  2IFM A;  4JYB A;  1JY2 N;  2RH0 A;  4WWI A;  1WT6 A;  1JNM A;  3V2R A;  5KAF H;  3CXH D;  2E74 B;  3MZW B;  3S4R A;  2WPS A;  1VF5 B;  5E79 E;  1D7M A;  5CJ0 A;  1JY2 O;  3P8M C;  2GUV A;  3I55 P;  2BCC E;  1NAF A;  4W7Y A;  5KAI H;  3Q2Y A;  1HUC A;  1BE3 J;  2W8Z A;  3BCC D;  5K5G B;  3BCC G;  3WMM 0;  2O1J A;  3H1L J;  2KS1 A;  2Z5I A;  1EZV D;  4LGD E;  1G2C A;  4I6M C;  3L75 D;  4YXW H;  1YQ4 C;  1J1D C;  2KYV A;  3QH9 A;  1NKN A;  3HE4 B;  3D71 A;  1GL2 C;  2JKV A;  1BSN A;  1YIJ P;  4RES B;  1GL2 D;  1SQV G;  1KB9 H;  3A7O A;  2R5D A;  1DD4 A;  5AVY B;  1K9M Q;  2O01 J;  3SFD C;  2Q5U A;  2E75 B;  1KQL A;  2LXB A;  4UB8 H;  3WUU A;  2QEX P;  1L0L E;  3GW6 A;  1EC5 A;  2FFD B;  3CCJ P;  1FDO A;  3BCC J;  5APT A;  5B5E H;  1Y9B A;  1W2B O;  3AE2 C;  5AW9 B;  5AVU B;  4U3F E;  2B87 A;  1YTZ T;  2UWJ E;  1L4A A;  3OW2 O;  2P10 A;  1VQ8 P;  1KYO E;  5TIS H;  5BU8 B;  2G3A A;  2JJL A;  1SS1 A;  3H1H E;  2E43 A;  2YKP A;  3L71 G;  4YPC A;  1IC2 A;  1FDM A;  1W5C E;  1AV1 A;  2K9J A;  1LWU A;  3H32 B;  1PPJ G;  4ASW A;  1SQB D;  1AJY A;  2WIT A;  5KLI B;  1M57 D;  2FBW C;  5M1B A;  3MUD A;  2YMY A;  2WWW A;  1U7M A;  2NPS B;  3IF4 A;  3CXH H;  1EXJ A;  1YJ9 P;  2QIW A;  3PRJ A;  2O01 H;  2O1K A;  2O3J A;  4GDO A;  3TGU D;  3TGU G;  2ZYA A;  2FYU D;  2FYU G;  1JB0 J;  3KDP B;  2OAR A;  3HE5 B;  2QJP B;  4BWN A;  1AQT A;  3L75 E;  1IK7 A;  5APX A;  4WY4 C;  2Q1K A;  4N6J A;  2AEJ A;  2IX7 C;  1FZA A;  3V4W A;  1QLE D;  3LW5 J;  2R3C A;  1EDJ A;  1SQB J;  3CCV P;  4XFJ A;  3V2N A;  2A06 G;  5AVW B;  1H8A A;  3NTN A;  4YTP C;  2H7H A;  2C0W A;  2RKL A;  4D6T D;  1CZQ A;  1X9V A;  5AVV B;  3TGU J;  2XV5 A;  4U7J A;  1GW4 A;  2FYU J;  1CI6 A;  4H13 B;  4OWF A;  4WB4 A;  2L5G B;  3L73 D;  3VMY A;  2V4H A;  3L73 G;  1X79 B;  3VMA A;  2DW3 A;  1N2D C;  2JWD A;  4I7Z B;  1SFC C;  3RK3 B;  1PIX A;  4JBZ A;  1OXZ A;  2H43 A;  1SFC D;  2WZ7 A;  2M3E A;  4LC1 A;  1MFZ A;  3AE9 C;  1GU5 A;  3B5N C;  1GL2 A;  4DZO A;  2YIU B;  3SWK A;  1FZB A;  1IJD B;  4PJ0 E;  3H1K E;  3V4Q A;  2QM7 A;  1RQV A;  2KK7 A;  1EQ7 A;  2AXT E;  3LW5 H;  5AVQ B;  3H1I D;  5AW2 B;  1K8A Q;  3L73 J;  1RF1 B;  5APU A;  3W67 A;  1ZRT E;  3SSU A;  1LT9 B;  3VTP C;  2E76 B;  2YKO A;  2KUB A;  2P2U A;  3TF5 A;  1LTJ C;  5CCG C;  2HG5 D;  5L8R J;  2H88 C;  1UIX A;  3CCR P;  5AW0 B;  2XZR A;  1S5L H;  1X22 A;  1VQ7 P;  3WUT A;  1KOR A;  3HD7 C;  3H1I J;  2WPQ A;  3N7N A;  4Z1M H;  1PGP A;  2IYO A;  2OTK E;  3EQ2 A;  2VRS A;  4IFD K;  1FJP A;  3IN6 A;  1RF0 C;  1NJI Q;  1VQ5 P;  1SQQ D; 
#chains in the Genus database with same CATH homology
 1L0N J;  1KB9 I;  3CXH I;  1BGY J;  1SQQ J;  3L72 J;  3TGU J;  1EZV I;  1SQP J;  5KLV J;  3L75 J;  3H1K J;  4D6T J;  3CX5 I;  3H1J J;  4U3F J;  3L70 J;  3L74 J;  1BCC J;  2FYU J;  1BE3 J;  1SQB J;  4PD4 I;  1SQX J;  1NTM J;  3H1I J;  1NU1 J;  3BCC J;  1PP9 J;  2IBZ I;  3H1L J;  3L73 J;  1SQV J;  2BCC J;  3L71 J;  1KYO I;  1L0L J;  1NTZ J;  3CWB J;  1NTK J;  3H1H J;  1P84 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...