1L0LJ

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 17
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0lJ00
1BCCJ 1NU1J 1BGYJ 2BCCJ 3BCCJ 1L0NJ 3L72J 3CXHI 4D6TJ 1BE3J 1NTMJ 3H1IJ 4U3FJ 3CX5I 1L0LJ 2FYUJ 3H1LJ 3H1KJ 5KLVJ 3L70J 4PD4I 1PP9J 1NTZJ 3H1JJ 1EZVI 3CWBJ 1P84I 1NTKJ 2IBZI 3TGUJ 1SQQJ 1SQBJ 1SQVJ 1SQXJ 3H1HJ 3L71J 3L74J 1SQPJ 3L73J 1KB9I 3L75J 1KYOI
chains in the Genus database with same CATH superfamily
3VMZA 3GF7A 1L4AA 3M0AA 1KB9E 2BCCJ 2Z4EA 4WY4A 2P1JA 4HJGH 5AVSB 5CCHC 3CC2P 3MZWB 4R4MA 3JC22 2QJYC 4OGQD 5CCGA 3P32A 4L73A 1NO4A 1SS1A 2H7HA 1U57A 1IC2A 1PPJD 2P2UA 4H0LB 2KOGA 1VF5B 1FS0E 1WRGA 5KLVJ 1DEEG 1KILA 2C0WA 2ZT9B 1HF9A 1GDTA 3H1IE 1AQTA 4K3AA 4EOTA 4XFJA 1EQ7A 2ZVNB 3H25A 1SQBD 1ZOYC 3PP5A 1SVFA 2OYIC 1VQKP 2RH0A 4LLHA 1VQ5P 3V2QA 1EDLA 2QRXA 2VRSA 3R2PA 1Y9BA 3PHLA 1SQBK 1NTMK 2KNCB 3TGUG 1QL1A 5CBOA 4W7ZA 1YQ4C 3L36A 5CCHD 3AE7C 1LP1B 3M9HA 3GLMA 5BU8B 3HD7A 1JY2N 3AEDC 2N9YB 1BE3J 2N9BA 3CCQP 4D6TD 4H44B 3JSVC 3G71P 1W2BO 4A7PA 3V6IA 1QVFO 2L5GB 4I7ZB 5APSA 4M3LA 2K37A 1Y47A 3H6PA 5L8RJ 2Y9ZA 2I1JA 3KHUA 1NHLA 5KLVD 1KILD 1T6AA 5AW2B 3RK2D 4BRYA 1S3JA 4AYCA 4O9BA 3RK2B 3H1JD 1N73A 1BCCE 1JCDA 1EZVI 5APXA 1L0LE 2KIKA 1J1DC 3B8EB 1VQ4P 2A45H 2K1AA 1NTZG 2XU6A 4I1LA 5AVUB 3H1LE 4OGQC 3H1HD 1LTJC 3A0BH 3AEFC 3H32A 2E5YA 2GA1A 2KZIA 1DD4A 1KZUB 3SFDC 5AW1B 3Q5PA 1MKMA 4I6MC 2M8RA 3V2PA 4D6TG 4ZKUA 1VPCA 2H8PD 1M1JB 1Q2NA 2QJPC 2Q3IA 3HUSC 1HGZA 2WSEH 3T97A 3QH9A 1EC5A 2E75D 1S4XA 2QVAA 1QVGO 1GMJA 3P8CE 1L0LD 3WUVA 2Y0CA 1OX3A 2YMKA 1T2KC 1L0LJ 1P84D 1YTZT 3O6QA 1PGQA 3TYYA 3H1LD 1PIXA 3VOPA 3VMYA 3H1JG 1G2CB 3A5TA 1ZMEC 3CMAP 2R5DA 4IL6X 2V7QH 3L71E 1YQ3C 2ZT9C 4H13D 5EFWB 1YI2P 2WSFH 4GIFA 1S72P 2W6JH 2J59M 1ZW0A 5C39A 2B89A 3B5NB 5AW0B 2R3SA 3CWBJ 3I56P 1SFCA 2HODB 1T3JA 2O01N 5KAIE 1E5WA 1YYCA 2R32A 1AFOA 3CWBG 1KD1Q 1SQPJ 3MUDC 4WY4B 1FJPA 2WSEJ 3RK2C 3S4RA 3L75J 2WPSA 2M5AA 5AW9B 2YO2A 1GD2E 3A0HE 3N4XA 3GHGA 4RESB 2YO3A 3LIEA 3LW5H 1X9VA 1BCCG 3CXHE 4AQRD 1JOCA 4DJGA 1IFMA 1OVVA 5B5EH 2AXTE 3T97B 1JEKA 2W90A 1M1JA 1RE4A 2FYUJ 4Y99B 3H1KD 2E76B 3D6ZA 1YJ9P 5KKZC 1EXJA 1L0LK 1OWAA 1S5LE 1KILC 1SQPE 2J5UA 3M0DA 3L73E 3S1KA 1FZCA 2JO1A 3TDKA 1R5LA 1SFCD 2GM4A 5AVRB 3JCUH 3II6A 3PLNA 1FU1A 5APYA 3CCJP 1K04A 3L37A 1N73B 1RY3A 1SQBJ 1KTMA 2WVRA 1ZR4A 4H0LD 4DOJA 1VL2A 1Z56A 3H1HJ 2BCCG 1USEA 2HLOA 2M3BA 4I2LC 1T8ZA 1PP9E 5AVYB 3HUSA 1CI6A 4LC1A 1QX8A 2IFNA 2WPQA 3L75D 3AE8C 4PV1C 1UIIA 4H13B 3OA7A 3L72J 2C9LY 3O8ZA 1M8OB 2PGDA 1LT1A 2V4HA 2KSJA 3L4FA 1YTZI 1NKNA 5AVWB 1M57D 2QA4P 5KLVG 1QL2A 3L72G 2KYVA 5CBNA 3CPWO 3V2RA 1NTKE 2AEMA 1JB0J 1HJBA 3AE2C 1FOSF 2W6AA 3CD6P 4IOIH 2N1TB 1KQLA 1FDOA 1FE6A 1LTAC 2K3RA 2ZFCA 2FYNB 1MFZA 3KQGA 4Y28J 5CJ0A 2I1KA 1KYOD 1NTME 3H1LG 1AVOA 2P10A 3HTKB 4UB8E 1JMBA 2JWDA 4H44D 1LTTC 1MV8A 2FY8A 2NZ2A 3G3ZA 1KQSO 2FXMA 2IBZI 2E75B 3GHGC 3K5BA 2H43A 3I55P 2WSCJ 2KSEA 1MUUA 2IX7C 2P67A 2RKLA 2YIUB 3E1RA 4U3FE 1BGYG 1KILB 1QEXA 3E1IA 3HD7B 2D2CD 3AE4C 3L73D 3NTNA 3MUDA 1X0TA 1NGMB 3ITKA 5APUA 3Q5SA 1N8RQ 1BGYJ 1NYHA 1K73Q 2PFXA 5AVZB 3VYIA 1PGPA 1SQVE 1USDA 4ASWA 3IN6A 2Y0EA 1VF5C 1NJIQ 4TLFA 4NPEA 3CCEP 2KP8A 4H0LC 3CCLP 1SQQE 3ABVC 3FX0A 4HYTB 3Q1MA 1VQLP 1AQ5A 2WITA 1RF1B 1Q81Q 4PD4I 3AE6C 1PZQA 3L70D 2PRRA 3VTPC 2QSIA 1Q82Q 2WPVB 2OGUA 2O01J 1JY3O 1R5SA 2AEJA 2AXTH 5AVQB 2R44A 3M9QA 2J58A 4PV1B 5GTHH 1SQVD 3BRTB 5B5EE 2JP3A 2WSFJ 3FXEA 3RL0C 5KLVE 1KC8Q 2HPCA 2FXOA 2Z5HA 3A0HH 3G9RA 1A02F 1KYOE 2O01H 3AEEC 2OARA 1M90Q 3MD0A 1L4AC 2P58A 1RQVA 2ZJSE 2E75C 2A06G 1JY3P 2SPZA 3AECC 2IYOA 3PRJA 4C46A 2OTJP 4U3FD 3L74G 1HGVA 2MJZA 3C8VA 2R3CA 1SQXE 1JTHB 5AW4B 4EIJA 5KAIH 5APVA 3BRVB 5KJ7C 1RE3C 1FAVA 2HODA 4OGQB 5AW3B 1M7LA 1HH0A 3B5NA 2CPSA 5M1BA 1VQNP 3S9OA 1RHZB 1IK7A 3GMAA 3UIAA 1AA0A 1XTCC 2JWAA 4XE5B 3IF4A 1N7SD 3H1JJ 3P8CD 4IL6H 1P84E 3O6QB 1MZ9A 1LTGC 3E7KA 5DJTB 1RF0C 3G4SP 1H89A 2QJKB 2WSCH 3MHVA 2YIUC 1YITP 1JMMA 1SQXJ 4WBAA 1JY3N 2KS1A 5KLIC 1HUCA 3L70E 3TNUA 2QEXP 1FJKA 1FZFA 1RF1A 1NKZB 1L4AD 1X22A 1KB9I 3L73J 2BEQD 2WQYC 3HD7D 1BSHA 4WY4D 5AVXB 1DIPA 1BCCJ 3H1KE 3V4WA 1NH4A 1PPJE 3CI9A 1JNMA 1BGYD 3CCVP 3HE4A 3L73G 2PAJA 4CPGA 3BASA 1FC2C 2UWJE 3H1IJ 5CCGC 3SFEC 1GTWA 3M91A 1RE3A 3NFQA 4EI2A 1A02J 1FZGA 4PD4E 3AEAC 1R8EA 2B9BA 1S5LH 2AEFA 2KXPB 1N7SC 1K05A 2CK3H 1PGOA 5APTA 4H13C 2IBZG 4OWFA 3U1AA 2I8DA 1GL2A 5AVVB 1LJ2A 2A45I 3H1HG 2GUSA 3L71G 2ZYGA 2P7JA 4WB4A 4YXDC 1JY2O 1LWUA 1NTKJ 4OVNF 2GUVA 2IZ0A 1KQGB 3FWLA 1TU3F 5KTBA 2QIWA 2WTYA 3KPEA 3G6EP 2ZYDA 4RJTA 2A45G 1GL2C 5APQA 1SQBG 2RMZA 1SQVG 4RKUJ 2OQQA 2YMYA 3SWYA 1RH5B 4HH2A 1KV4A 4GOEA 3TSIA 5CCGD 4WWIA 1LNQA 1ZN5A 1NTMD 1LT9A 4U3FJ 2E76C 2HFED 1KORA 2K9YA 2IBZD 3CCSP 3HRNA 2YNYA 3L75E 1ZV8A 2FYUD 2NPSC 3H1LJ 1RQUA 3VP8A 4Z1MH 2QJPB 1FZEA 3HUSB 3IAOA 4EDFA 1GU4A 2E42A 5AVTB 2C0XA 3IR9A 1U7MA 3H1KG 1IO4A 1VQ6P 2KB7P 2FYZA 3PJSK 3TGUJ 1NOHA 2Q7CA 1FZAA 2POHA 3D6YA 2HG5D 1OW7A 3VMAA 5KLIB 2D2CC 1VQPP 1H8AA 4W7YA 1EDKA 2Q5UA 3HE4B 5CMZA 3AE5C 1NTZE 4WVZA 1RF1C 3VN0A 2NPSA 3B5NC 3U59A 1BE3G 1SLQA 3L74D 1NU1K 1OW6A 3BCCJ 2IPPA 1NU1D 1U7JA 3CX5E 5TISE 4IFDK 4PV1D 2HYNA 2W8ZA 4OH8B 1VQMP 1DEBA 1IFDA 3H1HE 3M9BA 5CCHA 2LXBA 3BCCG 2OYHC 2D2CB 3CC7P 1S1CX 3CWBE 2B87B 2WPRA 3ZDMA 2ZXXA 1WT6A 2QE7H 1EZVG 1GZLA 3KYQA 4UB6H 4DT0A 1S9KD 1NTZD 2AXCA 1OFCX 4GODA 5DJUB 3WMM0 1NTZJ 1SQQK 4YXWH 4ZNCA 3AEGC 3PH0A 4PD4H 4DZOA 3CMEP 3KDPB 4U7JA 3CX5D 3I5CA 4HKZH 3L70G 1FDIA 1SQQD 4TT3H 3B71A 3N7NA 4JYCA 2OYHB 1JO5A 2E76D 3W67A 3CCRP 5TISH 1SQXK 1NU1G 4JF7A 2E74C 4R4LA 4C7RA 1LTJB 4Y99C 2M0BA 1G2CA 2M3EA 3BCCD 1KILE 2NPSB 1ZXGA 1J1EC 2Q1KA 1DD3A 1BSNA 4IFFA 3P8MC 4C7NA 1AV1A 2PP6A 2K9JA 1OMIA 3R4YA 3V2NA 3L72D 5KJ7D 2FFDA 1EXIA 5APWA 5KLVK 1AJYA 3FWNA 1L2PA 4KHXA 2L91A 1IJDB 3Q2YA 1EDIA 4IL6E 3VMXA 2WT7B 2HPCB 3BATA 5AW7B 1VF5D 3RL0D 3M06A 1KB9H 5KKZB 2ZAEB 1YHQP 2XNDH 1L0NE 4NPFX 1L0LG 1VQ8P 1J1EB 1W5CE 2W6BA 1E79H 1PP9J 3AE1C 1JCCA 1N7LA 2JEEA 3B5ND 3GW6A 1N7SB 3CWBD 3A0BE 1SQXG 1HVVA 4XA4A 1T2KD 1D7MA 3L72E 1NTZK 1G1JA 1SQQJ 1VQ9P 5CHXA 2OYIB 4B86A 2N1TD 3TF5A 1HJ0A 1VDFA 3HD7C 4GOFA 1M56D 1BCCD 3CC4P 4AUWA 1NTMG 4N78E 4UB6E 1OVRA 3NMDA 1GW3A 1N2DC 1L0NJ 2XKMA 2XV5A 3RBXA 3A2AA 5KJ7A 5B66E 1SFCC 3L75G 3CXHI 2MKVA 2OYIA 1NTMJ 3OAKA 2FFDB 1L0NG 4JQ0D 3V5BA 2A06D 1DH3A 3CX5H 2LXCB 1GL2B 1CI6B 3QWOC 3Q5RA 3C9IA 3GG2A 3A3YB 2W27A 3CCUP 2ZYAA 3KZIH 2QJKC 4ASVA 3OW2O 3Q3DA 1AVYA 1OZHA 1ZRTE 1OVUA 2Y0DA 2O1JA 2YKPA 3MGNA 1NTKD 3RK3E 3CXHD 3WUTA 3OJAB 2FFDC 1FZCB 1BE3E 3L71J 2E74B 1LGHB 2K9JB 1N73C 2OYOA 2LR2A 2KLUA 2E74D 1WMKA 4C7NB 2O1KA 1GU5A 4U3FG 1M1JC 1RE4C 1LTJA 2B87A 2XZRA 2BCCD 4HB1A 3EFGA 5AW6B 1YJWP 5BU5A 2KUBA 1JTHA 1JY2P 1QGKB 3FGAD 3H1ID 5TJHA 3USSA 5GTIE 1PGJA 1PPJG 3WUUA 3GHGB 2OYHA 1FZCC 3WU2H 5KAFH 1MFTA 1QLED 1KB9D 1L4AB 2DW3A 1XTGB 3H1KJ 2C9NY 3A7OA 1HBWA 3EFFK 4JYBA 3SSUA 4BXLA 1PP9D 1IFIA 1IFJA 1FZBA 1KFMA 4L75A 3W68A 2QM8A 1KMIZ 1S2EA 3RGUA 1H88A 3RBZA 2BCCE 2FYUE 1OW8A 2Q6QA 3B4SA 2IBZE 2QG4A 2QJYB 3CCMP 4GDOA 4I7ZC 3TGUD 1EDJA 1J1DB 1SQPD 2IZ1A 2JDIH 3AE9C 1K9MQ 1SQPK 5BVZA 2YXRB 2B88A 1NTKK 2M5AB 1IZNB 1KFNA 5E79H 5H2FE 3IFMA 1S9KE 4ZMDA 1LTIC 1W2EA 2V7QJ 1FBMA 1SQBE 2KK7A 4RO0A 3RK3D 1BE3D 3MP7B 3P7KA 1LT9B 1N86A 3H1JE 1X8YA 3HE5A 4PJ0E 3SWKA 2KI7B 3TK1A 5GTHE 3CX5I 1JM0A 3JCUE 1FOSE 3KZIE 3L74E 4QMAA 1CZQA 1NU1E 5H2FH 1OXZA 2JKVA 3L70J 5AW8B 1SP4A 4D6TE 4W80A 1NWQA 2Z5IA 3FXDA 1Q7YQ 2E43A 1S5LX 3GF3A 1LT9C 1LWUB 1URQB 1NAFA 3C1LA 3CXHH 3EQ2A 2OTKE 4L74A 3V4QA 1URQD 3HTKA 1P84H 3M0DC 5B66H 3BVHA 4BRYB 2FKWB 4JPZB 2G3AA 2ITAA 2N1TA 1KN7A 5E79E 1Q90D 2ZT9D 5AW5B 2WZ7A 3L74J 3D70A 1NAYA 2E5TA 3F5HA 1YBKA 1NU1J 2RN0A 4DCKA 2G8YA 2H88C 2OTLP 1L0NK 3TGUE 1L0ND 2KLVA 1FDMA 2W83C 3AE3C 2R5BA 3H32B 1PL5A 4D6TJ 4EYYQ 5GTIH 1DX7A 1BDCA 1GK4A 2XDJA 1UIXA 4IFMA 2JR8A 1YIJP 4KJMA 2Q9IA 4N6JA 2WWWA 1NVOA 1N7SA 2BASA 1GW4A 2KNCA 3BCCE 1HWTC 2FYNC 3TNUB 1SQVK 1KYOH 2BEZF 3RK3C 3KXDA 3RL0g 1BDDA 1LTSC 2LKMA 2FXPA 3LW5J 4N3YB 3MTUE 4NPDA 2YXQB 2Y9YA 5KAFE 3WU2E 1URQA 1PP9G 1PV3A 3RK3B 3VP9A 2WT7A 4GT1A 1CSBA 1SQXD 3L71D 4BWNA 1RF0A 2IFMA 1CW5A 1J2JB 2K88A 2YKQA 1LP1A 1VQOP 1IFPA 1SQQG 2XNXA 1GK6A 2WSSH 1Q86Q 2Q3EA 1KYOI 2JJLA 3H1IG 3L35A 4GKGA 1KQFB 5K5GB 1SQPG 4KT0J 3EWKA 1IFNA 4YPCA 2KS1B 3HE5B 4K35A 1VQ7P 3F89A 1ZLLA 3PTZA 4L76A 2YKOA 4PJ0H 1EZVD 1HTLC 2QM7A 3AEBC 5CJ4A 1JUNA 4JBZA 2KZJA 1URQC 4YTPC 2O3JA 2WMMA 3U1CA 1M1KQ 1ZRTD 3CL3D 4MN4C 1GL2D 4N78D 3NXSA 1OIPA 2IDBA 2HR3A 4WY4C 1G1IA 2FYUG 3SWFA 2H89C 1X79B 1IK9A 3D71A 1K8AQ 1H0TA 2IYPA 4H44C 1PFIA 1T3UA 1LWUC 1Y8AA 2A06E 1BGYE 1SFCB 1P84I 1YJNP 1SQVJ 3MIWA 4LGDE 3RL0B 4UB8H 2ZVOB 1EZVE 4ZKPA 1ZR2A 2NRGA 1H0TB 2FYUK 2FBWC 1NTKG 2NPSD 2N1TC 3CLQA 3LIDA 2ZXEB 4PD4D 1LTBC 2CPBA 1ZP0C
chains in the Genus database with same CATH topology
1BCCJ 1NU1J 1BGYJ 2BCCJ 3BCCJ 1L0NJ 3L72J 3CXHI 4D6TJ 1BE3J 1NTMJ 3H1IJ 4U3FJ 3CX5I 1L0LJ 2FYUJ 3H1LJ 3H1KJ 5KLVJ 3L70J 4PD4I 1PP9J 1NTZJ 3H1JJ 1EZVI 3CWBJ 1P84I 1NTKJ 2IBZI 3TGUJ 1SQQJ 1SQBJ 1SQVJ 1SQXJ 3H1HJ 3L71J 3L74J 1SQPJ 3L73J 1KB9I 3L75J 1KYOI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCC J;  1NU1 J;  1BGY J;  2BCC J;  3BCC J;  1L0N J;  3L72 J;  3CXH I;  4D6T J;  1BE3 J;  1NTM J;  3H1I J;  4U3F J;  3CX5 I;  1L0L J;  2FYU J;  3H1L J;  3H1K J;  5KLV J;  3L70 J;  4PD4 I;  1PP9 J;  1NTZ J;  3H1J J;  1EZV I;  3CWB J;  1P84 I;  1NTK J;  2IBZ I;  3TGU J;  1SQQ J;  1SQB J;  1SQV J;  1SQX J;  3H1H J;  3L71 J;  3L74 J;  1SQP J;  3L73 J;  1KB9 I;  3L75 J;  1KYO I; 
#chains in the Genus database with same CATH topology
 3VMZ A;  3GF7 A;  1L4A A;  3M0A A;  1KB9 E;  2BCC J;  2Z4E A;  4WY4 A;  2P1J A;  4HJG H;  5AVS B;  5CCH C;  3CC2 P;  3MZW B;  4R4M A;  3JC2 2;  2QJY C;  4OGQ D;  5CCG A;  3P32 A;  4L73 A;  1NO4 A;  1SS1 A;  2H7H A;  1U57 A;  1IC2 A;  1PPJ D;  2P2U A;  4H0L B;  2KOG A;  1VF5 B;  1FS0 E;  1WRG A;  5KLV J;  1DEE G;  1KIL A;  2C0W A;  2ZT9 B;  1HF9 A;  1GDT A;  3H1I E;  1AQT A;  4K3A A;  4EOT A;  4XFJ A;  1EQ7 A;  2ZVN B;  3H25 A;  1SQB D;  1ZOY C;  3PP5 A;  1SVF A;  2OYI C;  1VQK P;  2RH0 A;  4LLH A;  1VQ5 P;  3V2Q A;  1EDL A;  2QRX A;  2VRS A;  3R2P A;  1Y9B A;  3PHL A;  1SQB K;  1NTM K;  2KNC B;  3TGU G;  1QL1 A;  5CBO A;  4W7Z A;  1YQ4 C;  3L36 A;  5CCH D;  3AE7 C;  1LP1 B;  3M9H A;  3GLM A;  5BU8 B;  3HD7 A;  1JY2 N;  3AED C;  2N9Y B;  1BE3 J;  2N9B A;  3CCQ P;  4D6T D;  4H44 B;  3JSV C;  3G71 P;  1W2B O;  4A7P A;  3V6I A;  1QVF O;  2L5G B;  4I7Z B;  5APS A;  4M3L A;  2K37 A;  1Y47 A;  3H6P A;  5L8R J;  2Y9Z A;  2I1J A;  3KHU A;  1NHL A;  5KLV D;  1KIL D;  1T6A A;  5AW2 B;  3RK2 D;  4BRY A;  1S3J A;  4AYC A;  4O9B A;  3RK2 B;  3H1J D;  1N73 A;  1BCC E;  1JCD A;  1EZV I;  5APX A;  1L0L E;  2KIK A;  1J1D C;  3B8E B;  1VQ4 P;  2A45 H;  2K1A A;  1NTZ G;  2XU6 A;  4I1L A;  5AVU B;  3H1L E;  4OGQ C;  3H1H D;  1LTJ C;  3A0B H;  3AEF C;  3H32 A;  2E5Y A;  2GA1 A;  2KZI A;  1DD4 A;  1KZU B;  3SFD C;  5AW1 B;  3Q5P A;  1MKM A;  4I6M C;  2M8R A;  3V2P A;  4D6T G;  4ZKU A;  1VPC A;  2H8P D;  1M1J B;  1Q2N A;  2QJP C;  2Q3I A;  3HUS C;  1HGZ A;  2WSE H;  3T97 A;  3QH9 A;  1EC5 A;  2E75 D;  1S4X A;  2QVA A;  1QVG O;  1GMJ A;  3P8C E;  1L0L D;  3WUV A;  2Y0C A;  1OX3 A;  2YMK A;  1T2K C;  1L0L J;  1P84 D;  1YTZ T;  3O6Q A;  1PGQ A;  3TYY A;  3H1L D;  1PIX A;  3VOP A;  3VMY A;  3H1J G;  1G2C B;  3A5T A;  1ZME C;  3CMA P;  2R5D A;  4IL6 X;  2V7Q H;  3L71 E;  1YQ3 C;  2ZT9 C;  4H13 D;  5EFW B;  1YI2 P;  2WSF H;  4GIF A;  1S72 P;  2W6J H;  2J59 M;  1ZW0 A;  5C39 A;  2B89 A;  3B5N B;  5AW0 B;  2R3S A;  3CWB J;  3I56 P;  1SFC A;  2HOD B;  1T3J A;  2O01 N;  5KAI E;  1E5W A;  1YYC A;  2R32 A;  1AFO A;  3CWB G;  1KD1 Q;  1SQP J;  3MUD C;  4WY4 B;  1FJP A;  2WSE J;  3RK2 C;  3S4R A;  3L75 J;  2WPS A;  2M5A A;  5AW9 B;  2YO2 A;  1GD2 E;  3A0H E;  3N4X A;  3GHG A;  4RES B;  2YO3 A;  3LIE A;  3LW5 H;  1X9V A;  1BCC G;  3CXH E;  4AQR D;  1JOC A;  4DJG A;  1IFM A;  1OVV A;  5B5E H;  2AXT E;  3T97 B;  1JEK A;  2W90 A;  1M1J A;  1RE4 A;  2FYU J;  4Y99 B;  3H1K D;  2E76 B;  3D6Z A;  1YJ9 P;  5KKZ C;  1EXJ A;  1L0L K;  1OWA A;  1S5L E;  1KIL C;  1SQP E;  2J5U A;  3M0D A;  3L73 E;  3S1K A;  1FZC A;  2JO1 A;  3TDK A;  1R5L A;  1SFC D;  2GM4 A;  5AVR B;  3JCU H;  3II6 A;  3PLN A;  1FU1 A;  5APY A;  3CCJ P;  1K04 A;  3L37 A;  1N73 B;  1RY3 A;  1SQB J;  1KTM A;  2WVR A;  1ZR4 A;  4H0L D;  4DOJ A;  1VL2 A;  1Z56 A;  3H1H J;  2BCC G;  1USE A;  2HLO A;  2M3B A;  4I2L C;  1T8Z A;  1PP9 E;  5AVY B;  3HUS A;  1CI6 A;  4LC1 A;  1QX8 A;  2IFN A;  2WPQ A;  3L75 D;  3AE8 C;  4PV1 C;  1UII A;  4H13 B;  3OA7 A;  3L72 J;  2C9L Y;  3O8Z A;  1M8O B;  2PGD A;  1LT1 A;  2V4H A;  2KSJ A;  3L4F A;  1YTZ I;  1NKN A;  5AVW B;  1M57 D;  2QA4 P;  5KLV G;  1QL2 A;  3L72 G;  2KYV A;  5CBN A;  3CPW O;  3V2R A;  1NTK E;  2AEM A;  1JB0 J;  1HJB A;  3AE2 C;  1FOS F;  2W6A A;  3CD6 P;  4IOI H;  2N1T B;  1KQL A;  1FDO A;  1FE6 A;  1LTA C;  2K3R A;  2ZFC A;  2FYN B;  1MFZ A;  3KQG A;  4Y28 J;  5CJ0 A;  2I1K A;  1KYO D;  1NTM E;  3H1L G;  1AVO A;  2P10 A;  3HTK B;  4UB8 E;  1JMB A;  2JWD A;  4H44 D;  1LTT C;  1MV8 A;  2FY8 A;  2NZ2 A;  3G3Z A;  1KQS O;  2FXM A;  2IBZ I;  2E75 B;  3GHG C;  3K5B A;  2H43 A;  3I55 P;  2WSC J;  2KSE A;  1MUU A;  2IX7 C;  2P67 A;  2RKL A;  2YIU B;  3E1R A;  4U3F E;  1BGY G;  1KIL B;  1QEX A;  3E1I A;  3HD7 B;  2D2C D;  3AE4 C;  3L73 D;  3NTN A;  3MUD A;  1X0T A;  1NGM B;  3ITK A;  5APU A;  3Q5S A;  1N8R Q;  1BGY J;  1NYH A;  1K73 Q;  2PFX A;  5AVZ B;  3VYI A;  1PGP A;  1SQV E;  1USD A;  4ASW A;  3IN6 A;  2Y0E A;  1VF5 C;  1NJI Q;  4TLF A;  4NPE A;  3CCE P;  2KP8 A;  4H0L C;  3CCL P;  1SQQ E;  3ABV C;  3FX0 A;  4HYT B;  3Q1M A;  1VQL P;  1AQ5 A;  2WIT A;  1RF1 B;  1Q81 Q;  4PD4 I;  3AE6 C;  1PZQ A;  3L70 D;  2PRR A;  3VTP C;  2QSI A;  1Q82 Q;  2WPV B;  2OGU A;  2O01 J;  1JY3 O;  1R5S A;  2AEJ A;  2AXT H;  5AVQ B;  2R44 A;  3M9Q A;  2J58 A;  4PV1 B;  5GTH H;  1SQV D;  3BRT B;  5B5E E;  2JP3 A;  2WSF J;  3FXE A;  3RL0 C;  5KLV E;  1KC8 Q;  2HPC A;  2FXO A;  2Z5H A;  3A0H H;  3G9R A;  1A02 F;  1KYO E;  2O01 H;  3AEE C;  2OAR A;  1M90 Q;  3MD0 A;  1L4A C;  2P58 A;  1RQV A;  2ZJS E;  2E75 C;  2A06 G;  1JY3 P;  2SPZ A;  3AEC C;  2IYO A;  3PRJ A;  4C46 A;  2OTJ P;  4U3F D;  3L74 G;  1HGV A;  2MJZ A;  3C8V A;  2R3C A;  1SQX E;  1JTH B;  5AW4 B;  4EIJ A;  5KAI H;  5APV A;  3BRV B;  5KJ7 C;  1RE3 C;  1FAV A;  2HOD A;  4OGQ B;  5AW3 B;  1M7L A;  1HH0 A;  3B5N A;  2CPS A;  5M1B A;  1VQN P;  3S9O A;  1RHZ B;  1IK7 A;  3GMA A;  3UIA A;  1AA0 A;  1XTC C;  2JWA A;  4XE5 B;  3IF4 A;  1N7S D;  3H1J J;  3P8C D;  4IL6 H;  1P84 E;  3O6Q B;  1MZ9 A;  1LTG C;  3E7K A;  5DJT B;  1RF0 C;  3G4S P;  1H89 A;  2QJK B;  2WSC H;  3MHV A;  2YIU C;  1YIT P;  1JMM A;  1SQX J;  4WBA A;  1JY3 N;  2KS1 A;  5KLI C;  1HUC A;  3L70 E;  3TNU A;  2QEX P;  1FJK A;  1FZF A;  1RF1 A;  1NKZ B;  1L4A D;  1X22 A;  1KB9 I;  3L73 J;  2BEQ D;  2WQY C;  3HD7 D;  1BSH A;  4WY4 D;  5AVX B;  1DIP A;  1BCC J;  3H1K E;  3V4W A;  1NH4 A;  1PPJ E;  3CI9 A;  1JNM A;  1BGY D;  3CCV P;  3HE4 A;  3L73 G;  2PAJ A;  4CPG A;  3BAS A;  1FC2 C;  2UWJ E;  3H1I J;  5CCG C;  3SFE C;  1GTW A;  3M91 A;  1RE3 A;  3NFQ A;  4EI2 A;  1A02 J;  1FZG A;  4PD4 E;  3AEA C;  1R8E A;  2B9B A;  1S5L H;  2AEF A;  2KXP B;  1N7S C;  1K05 A;  2CK3 H;  1PGO A;  5APT A;  4H13 C;  2IBZ G;  4OWF A;  3U1A A;  2I8D A;  1GL2 A;  5AVV B;  1LJ2 A;  2A45 I;  3H1H G;  2GUS A;  3L71 G;  2ZYG A;  2P7J A;  4WB4 A;  4YXD C;  1JY2 O;  1LWU A;  1NTK J;  4OVN F;  2GUV A;  2IZ0 A;  1KQG B;  3FWL A;  1TU3 F;  5KTB A;  2QIW A;  2WTY A;  3KPE A;  3G6E P;  2ZYD A;  4RJT A;  2A45 G;  1GL2 C;  5APQ A;  1SQB G;  2RMZ A;  1SQV G;  4RKU J;  2OQQ A;  2YMY A;  3SWY A;  1RH5 B;  4HH2 A;  1KV4 A;  4GOE A;  3TSI A;  5CCG D;  4WWI A;  1LNQ A;  1ZN5 A;  1NTM D;  1LT9 A;  4U3F J;  2E76 C;  2HFE D;  1KOR A;  2K9Y A;  2IBZ D;  3CCS P;  3HRN A;  2YNY A;  3L75 E;  1ZV8 A;  2FYU D;  2NPS C;  3H1L J;  1RQU A;  3VP8 A;  4Z1M H;  2QJP B;  1FZE A;  3HUS B;  3IAO A;  4EDF A;  1GU4 A;  2E42 A;  5AVT B;  2C0X A;  3IR9 A;  1U7M A;  3H1K G;  1IO4 A;  1VQ6 P;  2KB7 P;  2FYZ A;  3PJS K;  3TGU J;  1NOH A;  2Q7C A;  1FZA A;  2POH A;  3D6Y A;  2HG5 D;  1OW7 A;  3VMA A;  5KLI B;  2D2C C;  1VQP P;  1H8A A;  4W7Y A;  1EDK A;  2Q5U A;  3HE4 B;  5CMZ A;  3AE5 C;  1NTZ E;  4WVZ A;  1RF1 C;  3VN0 A;  2NPS A;  3B5N C;  3U59 A;  1BE3 G;  1SLQ A;  3L74 D;  1NU1 K;  1OW6 A;  3BCC J;  2IPP A;  1NU1 D;  1U7J A;  3CX5 E;  5TIS E;  4IFD K;  4PV1 D;  2HYN A;  2W8Z A;  4OH8 B;  1VQM P;  1DEB A;  1IFD A;  3H1H E;  3M9B A;  5CCH A;  2LXB A;  3BCC G;  2OYH C;  2D2C B;  3CC7 P;  1S1C X;  3CWB E;  2B87 B;  2WPR A;  3ZDM A;  2ZXX A;  1WT6 A;  2QE7 H;  1EZV G;  1GZL A;  3KYQ A;  4UB6 H;  4DT0 A;  1S9K D;  1NTZ D;  2AXC A;  1OFC X;  4GOD A;  5DJU B;  3WMM 0;  1NTZ J;  1SQQ K;  4YXW H;  4ZNC A;  3AEG C;  3PH0 A;  4PD4 H;  4DZO A;  3CME P;  3KDP B;  4U7J A;  3CX5 D;  3I5C A;  4HKZ H;  3L70 G;  1FDI A;  1SQQ D;  4TT3 H;  3B71 A;  3N7N A;  4JYC A;  2OYH B;  1JO5 A;  2E76 D;  3W67 A;  3CCR P;  5TIS H;  1SQX K;  1NU1 G;  4JF7 A;  2E74 C;  4R4L A;  4C7R A;  1LTJ B;  4Y99 C;  2M0B A;  1G2C A;  2M3E A;  3BCC D;  1KIL E;  2NPS B;  1ZXG A;  1J1E C;  2Q1K A;  1DD3 A;  1BSN A;  4IFF A;  3P8M C;  4C7N A;  1AV1 A;  2PP6 A;  2K9J A;  1OMI A;  3R4Y A;  3V2N A;  3L72 D;  5KJ7 D;  2FFD A;  1EXI A;  5APW A;  5KLV K;  1AJY A;  3FWN A;  1L2P A;  4KHX A;  2L91 A;  1IJD B;  3Q2Y A;  1EDI A;  4IL6 E;  3VMX A;  2WT7 B;  2HPC B;  3BAT A;  5AW7 B;  1VF5 D;  3RL0 D;  3M06 A;  1KB9 H;  5KKZ B;  2ZAE B;  1YHQ P;  2XND H;  1L0N E;  4NPF X;  1L0L G;  1VQ8 P;  1J1E B;  1W5C E;  2W6B A;  1E79 H;  1PP9 J;  3AE1 C;  1JCC A;  1N7L A;  2JEE A;  3B5N D;  3GW6 A;  1N7S B;  3CWB D;  3A0B E;  1SQX G;  1HVV A;  4XA4 A;  1T2K D;  1D7M A;  3L72 E;  1NTZ K;  1G1J A;  1SQQ J;  1VQ9 P;  5CHX A;  2OYI B;  4B86 A;  2N1T D;  3TF5 A;  1HJ0 A;  1VDF A;  3HD7 C;  4GOF A;  1M56 D;  1BCC D;  3CC4 P;  4AUW A;  1NTM G;  4N78 E;  4UB6 E;  1OVR A;  3NMD A;  1GW3 A;  1N2D C;  1L0N J;  2XKM A;  2XV5 A;  3RBX A;  3A2A A;  5KJ7 A;  5B66 E;  1SFC C;  3L75 G;  3CXH I;  2MKV A;  2OYI A;  1NTM J;  3OAK A;  2FFD B;  1L0N G;  4JQ0 D;  3V5B A;  2A06 D;  1DH3 A;  3CX5 H;  2LXC B;  1GL2 B;  1CI6 B;  3QWO C;  3Q5R A;  3C9I A;  3GG2 A;  3A3Y B;  2W27 A;  3CCU P;  2ZYA A;  3KZI H;  2QJK C;  4ASV A;  3OW2 O;  3Q3D A;  1AVY A;  1OZH A;  1ZRT E;  1OVU A;  2Y0D A;  2O1J A;  2YKP A;  3MGN A;  1NTK D;  3RK3 E;  3CXH D;  3WUT A;  3OJA B;  2FFD C;  1FZC B;  1BE3 E;  3L71 J;  2E74 B;  1LGH B;  2K9J B;  1N73 C;  2OYO A;  2LR2 A;  2KLU A;  2E74 D;  1WMK A;  4C7N B;  2O1K A;  1GU5 A;  4U3F G;  1M1J C;  1RE4 C;  1LTJ A;  2B87 A;  2XZR A;  2BCC D;  4HB1 A;  3EFG A;  5AW6 B;  1YJW P;  5BU5 A;  2KUB A;  1JTH A;  1JY2 P;  1QGK B;  3FGA D;  3H1I D;  5TJH A;  3USS A;  5GTI E;  1PGJ A;  1PPJ G;  3WUU A;  3GHG B;  2OYH A;  1FZC C;  3WU2 H;  5KAF H;  1MFT A;  1QLE D;  1KB9 D;  1L4A B;  2DW3 A;  1XTG B;  3H1K J;  2C9N Y;  3A7O A;  1HBW A;  3EFF K;  4JYB A;  3SSU A;  4BXL A;  1PP9 D;  1IFI A;  1IFJ A;  1FZB A;  1KFM A;  4L75 A;  3W68 A;  2QM8 A;  1KMI Z;  1S2E A;  3RGU A;  1H88 A;  3RBZ A;  2BCC E;  2FYU E;  1OW8 A;  2Q6Q A;  3B4S A;  2IBZ E;  2QG4 A;  2QJY B;  3CCM P;  4GDO A;  4I7Z C;  3TGU D;  1EDJ A;  1J1D B;  1SQP D;  2IZ1 A;  2JDI H;  3AE9 C;  1K9M Q;  1SQP K;  5BVZ A;  2YXR B;  2B88 A;  1NTK K;  2M5A B;  1IZN B;  1KFN A;  5E79 H;  5H2F E;  3IFM A;  1S9K E;  4ZMD A;  1LTI C;  1W2E A;  2V7Q J;  1FBM A;  1SQB E;  2KK7 A;  4RO0 A;  3RK3 D;  1BE3 D;  3MP7 B;  3P7K A;  1LT9 B;  1N86 A;  3H1J E;  1X8Y A;  3HE5 A;  4PJ0 E;  3SWK A;  2KI7 B;  3TK1 A;  5GTH E;  3CX5 I;  1JM0 A;  3JCU E;  1FOS E;  3KZI E;  3L74 E;  4QMA A;  1CZQ A;  1NU1 E;  5H2F H;  1OXZ A;  2JKV A;  3L70 J;  5AW8 B;  1SP4 A;  4D6T E;  4W80 A;  1NWQ A;  2Z5I A;  3FXD A;  1Q7Y Q;  2E43 A;  1S5L X;  3GF3 A;  1LT9 C;  1LWU B;  1URQ B;  1NAF A;  3C1L A;  3CXH H;  3EQ2 A;  2OTK E;  4L74 A;  3V4Q A;  1URQ D;  3HTK A;  1P84 H;  3M0D C;  5B66 H;  3BVH A;  4BRY B;  2FKW B;  4JPZ B;  2G3A A;  2ITA A;  2N1T A;  1KN7 A;  5E79 E;  1Q90 D;  2ZT9 D;  5AW5 B;  2WZ7 A;  3L74 J;  3D70 A;  1NAY A;  2E5T A;  3F5H A;  1YBK A;  1NU1 J;  2RN0 A;  4DCK A;  2G8Y A;  2H88 C;  2OTL P;  1L0N K;  3TGU E;  1L0N D;  2KLV A;  1FDM A;  2W83 C;  3AE3 C;  2R5B A;  3H32 B;  1PL5 A;  4D6T J;  4EYY Q;  5GTI H;  1DX7 A;  1BDC A;  1GK4 A;  2XDJ A;  1UIX A;  4IFM A;  2JR8 A;  1YIJ P;  4KJM A;  2Q9I A;  4N6J A;  2WWW A;  1NVO A;  1N7S A;  2BAS A;  1GW4 A;  2KNC A;  3BCC E;  1HWT C;  2FYN C;  3TNU B;  1SQV K;  1KYO H;  2BEZ F;  3RK3 C;  3KXD A;  3RL0 g;  1BDD A;  1LTS C;  2LKM A;  2FXP A;  3LW5 J;  4N3Y B;  3MTU E;  4NPD A;  2YXQ B;  2Y9Y A;  5KAF E;  3WU2 E;  1URQ A;  1PP9 G;  1PV3 A;  3RK3 B;  3VP9 A;  2WT7 A;  4GT1 A;  1CSB A;  1SQX D;  3L71 D;  4BWN A;  1RF0 A;  2IFM A;  1CW5 A;  1J2J B;  2K88 A;  2YKQ A;  1LP1 A;  1VQO P;  1IFP A;  1SQQ G;  2XNX A;  1GK6 A;  2WSS H;  1Q86 Q;  2Q3E A;  1KYO I;  2JJL A;  3H1I G;  3L35 A;  4GKG A;  1KQF B;  5K5G B;  1SQP G;  4KT0 J;  3EWK A;  1IFN A;  4YPC A;  2KS1 B;  3HE5 B;  4K35 A;  1VQ7 P;  3F89 A;  1ZLL A;  3PTZ A;  4L76 A;  2YKO A;  4PJ0 H;  1EZV D;  1HTL C;  2QM7 A;  3AEB C;  5CJ4 A;  1JUN A;  4JBZ A;  2KZJ A;  1URQ C;  4YTP C;  2O3J A;  2WMM A;  3U1C A;  1M1K Q;  1ZRT D;  3CL3 D;  4MN4 C;  1GL2 D;  4N78 D;  3NXS A;  1OIP A;  2IDB A;  2HR3 A;  4WY4 C;  1G1I A;  2FYU G;  3SWF A;  2H89 C;  1X79 B;  1IK9 A;  3D71 A;  1K8A Q;  1H0T A;  2IYP A;  4H44 C;  1PFI A;  1T3U A;  1LWU C;  1Y8A A;  2A06 E;  1BGY E;  1SFC B;  1P84 I;  1YJN P;  1SQV J;  3MIW A;  4LGD E;  3RL0 B;  4UB8 H;  2ZVO B;  1EZV E;  4ZKP A;  1ZR2 A;  2NRG A;  1H0T B;  2FYU K;  2FBW C;  1NTK G;  2NPS D;  2N1T C;  3CLQ A;  3LID A;  2ZXE B;  4PD4 D;  1LTB C;  2CPB A;  1ZP0 C; 
#chains in the Genus database with same CATH homology
 1BCC J;  1NU1 J;  1BGY J;  2BCC J;  3BCC J;  1L0N J;  3L72 J;  3CXH I;  4D6T J;  1BE3 J;  1NTM J;  3H1I J;  4U3F J;  3CX5 I;  1L0L J;  2FYU J;  3H1L J;  3H1K J;  5KLV J;  3L70 J;  4PD4 I;  1PP9 J;  1NTZ J;  3H1J J;  1EZV I;  3CWB J;  1P84 I;  1NTK J;  2IBZ I;  3TGU J;  1SQQ J;  1SQB J;  1SQV J;  1SQX J;  3H1H J;  3L71 J;  3L74 J;  1SQP J;  3L73 J;  1KB9 I;  3L75 J;  1KYO I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...