1L0LJ

Structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title The Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Famoxadone: The Role of Aromatic-Aromatic Interaction in Inhibition
pubmed doi rcsb
total genus 17
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1l0lJ00
1KYOI 1EZVI 1NTZJ 3L72J 3L75J 4D6TJ 1KB9I 3H1KJ 3H1LJ 3L74J 2BCCJ 2FYUJ 1P84I 3TGUJ 1L0NJ 3H1HJ 3L71J 1SQPJ 1NTKJ 3CXHI 1SQQJ 1BE3J 1SQBJ 2IBZI 4PD4I 3CWBJ 1NU1J 1NTMJ 1BCCJ 1SQXJ 1L0LJ 5KLVJ 3H1IJ 1BGYJ 3L70J 3L73J 3CX5I 1PP9J 3BCCJ 1SQVJ 4U3FJ 3H1JJ
chains in the Genus database with same CATH superfamily
3CWBE 1EZVG 1G1IA 1KC8Q 1LTIC 4PD4D 1GK6A 2O1KA 2FBWC 3H1HJ 5APTA 2Y9YA 2ZXEB 2M3EA 4OGQB 2QIWA 4OGQC 1IFIA 3IFMA 5AVQB 1VQLP 1URQC 2YO2A 3PH0A 5GTIH 1JY2N 3Q5RA 1H88A 1KFNA 5TISE 1T6AA 5M1BA 1NWQA 2KS1B 2FYZA 4I1LA 1CI6A 1PP9E 3AEDC 1VQOP 1KQLA 1SQXG 3MD0A 3GMAA 2Q9IA 3GW6A 1JY2O 2BCCG 1NTMD 2WT7A 3H1HG 1AA0A 2XU6A 4C46A 5TJHA 3QH9A 3CPWO 1NTKK 4PD4I 1NU1J 3IN6A 2W6AA 3SWYA 5KAIH 2NPSB 1G2CB 3RL0D 1PPJD 5AW5B 3OA7A 2NPSC 4Z1MH 1Q82Q 3D71A 3TGUJ 5BU8B 4L73A 2FYUD 1RF1B 2J58A 1RQUA 1FE6A 1HBWA 1IFJA 1RF1C 3AE2C 1DEEG 5KLVE 3HD7B 2PFXA 4AUWA 4WWIA 3TYYA 5KAIE 4PV1D 3CCLP 1Q81Q 3AE1C 1LT9C 5CCGA 3E1RA 4DCKA 1EDJA 3L73D 1VDFA 3BCCD 1DIPA 1L4AD 1GDTA 3H1LJ 3VMYA 1L0NJ 3I56P 1LP1B 4BXLA 1EZVD 1JTHB 2V4HA 3CWBJ 4H44B 4N78D 1VQ8P 3CC7P 3D6ZA 3L75G 5CBNA 4H44C 3SWFA 2B88A 4ASVA 2IZ0A 3A0BH 2H88C 4GIFA 3OJAB 2OYIB 1A02F 1GL2B 1D7MA 2OYIC 4UB6H 1N73C 1GL2C 3WUUA 1ZV8A 4EIJA 4JYBA 1QX8A 3R2PA 3VYIA 4GDOA 1N86A 1MUUA 3V4WA 2YXQB 1SQVG 4JBZA 3O6QB 1PP9J 3CCRP 5KJ7D 1SQXD 2CPSA 2XNXA 4XA4A 2E43A 4RJTA 1PPJE 4UB6E 3S4RA 4I2LC 1VQ4P 2BCCD 2KI7B 4IL6E 2R32A 4LC1A 2FYUE 5AVUB 3AE5C 2N1TD 4H0LC 1FDOA 2WVRA 1EZVI 2KS1A 3PJSK 2W6JH 1VL2A 3A5TA 2SPZA 2PP6A 2BEQD 1USDA 3KQGA 2Q6QA 1M1KQ 2ZFCA 3G9RA 1HJBA 5DJTB 3L73E 1DD3A 3FXEA 3BCCE 1RF0A 1S1CX 1KILD 1J1EB 5AVRB 1L2PA 2G3AA 3OAKA 1EZVE 2FXOA 2H43A 1J1EC 5KLVJ 1JUNA 2YNYA 1IFPA 5KKZC 2OTLP 4I7ZC 3H32B 2KLUA 1YHQP 1N7SB 3M9QA 5AVZB 1KN7A 2J59M 1N7SC 2AEMA 2CPBA 1USEA 1FZBA 1R8EA 2M5AA 2E74B 5H2FH 1JB0J 3HD7A 3L75D 4H13B 2YKOA 1RE4A 1SQPK 1OIPA 3RK2C 3I5CA 4YXDC 1RE3A 1SQBK 5L8RJ 2W27A 2QJYC 4DZOA 1GD2E 3AE4C 3CX5D 4K35A 4LLHA 1ZR4A 2BCCE 3WU2H 4W7ZA 1NTMJ 4QMAA 1P84D 3N4XA 1QVFO 1JNMA 3CXHD 5AW6B 1SQVD 2YIUB 2ZVOB 1Q2NA 4R4LA 2HPCB 1M56D 1KQSO 2YIUC 5CCHA 1NTKD 4HH2A 3KHUA 2WT7B 2AXTE 2ZT9D 1SFCD 4UB8E 4DOJA 4JYCA 2L5GB 2KUBA 5CJ4A 4ZKUA 5APWA 2FYUJ 1WRGA 1KILE 2KYVA 3AEBC 3RK3B 1HJ0A 2MJZA 1W2BO 2MKVA 2JJLA 3M91A 5KLIB 3VP9A 4L76A 2OARA 3MHVA 1NTZK 4GKGA 4DJGA 1X8YA 1J1DB 5B66E 1ZRTD 2JDIH 2WWWA 3AE3C 3CCMP 2E76D 5AW0B 2JP3A 3B5NB 4JQ0D 2Q3EA 2WMMA 3L73J 3BCCJ 2NRGA 1EDKA 4HYTB 3NXSA 4KJMA 3SFDC 3CXHI 2HLOA 2R3CA 5C39A 3B71A 2PAJA 5CCGC 1ZN5A 2WPQA 2FYUG 1K05A 4ZNCA 3Q5SA 2ZXXA 1KB9I 3AEGC 2QRXA 2XNDH 2RH0A 1IFDA 1PGOA 5AVSB 3CX5E 2WZ7A 4KT0J 1KQFB 2E75D 3IAOA 1VQMP 3SSUA 1Q90D 2O3JA 4NPFX 1P84E 3FXDA 2IDBA 1SP4A 3CXHE 4M3LA 1SQVE 1S3JA 2FXPA 2NZ2A 3L72D 3H1IG 3NFQA 1NTKE 1EDLA 2A06G 1RHZB 1SVFA 4OGQD 4WY4A 2DW3A 1GU4A 3O8ZA 4GODA 2BCCJ 3V2PA 1U7JA 1URQD 3CMEP 1LJ2A 2QM8A 1FOSF 1UIXA 3TSIA 1IK9A 3G6EP 1ZOYC 1U7MA 5APYA 5DJUB 4IFFA 2KZIA 2WPVB 5KAFH 2LR2A 2WSFJ 3MIWA 3H1KE 1JOCA 1OX3A 3IR9A 1H0TB 2P1JA 1ZRTE 1E5WA 4PJ0H 3QWOC 1HGZA 3VMXA 3PHLA 4LGDE 1NU1K 3WMM0 1KD1Q 3KYQA 1AVYA 2WPSA 2O01N 1BCCG 1NOHA 2HPCA 1OW7A 3H1JG 2HODA 1JMMA 3CCVP 5KAFE 2P7JA 2W90A 1QL2A 2N9BA 1M7LA 2WSEJ 1SQQG 2NPSD 4CPGA 5GTIE 4OVNF 4PJ0E 2B87A 1RF0C 4OWFA 5CHXA 1H89A 1S4XA 5EFWB 4HJGH 3BRVB 1GU5A 3AE8C 3CI9A 3L70E 1QLED 2VRSA 3P8MC 3L75J 1VQKP 1IJDB 3V5BA 3M9BA 3L72E 3HUSB 2G8YA 1L0NK 3CL3D 2M5AB 1S5LX 1FDMA 1SQBD 5AW4B 3A3YB 3B5NA 1PV3A 3M0DA 2JKVA 2V7QJ 3G71P 3SFEC 1QEXA 3HD7C 3V2QA 1BDCA 3W67A 3GLMA 3Q2YA 3AE9C 1RE4C 1S72P 2KSEA 2PGDA 3KPEA 3RL0B 4HB1A 1SS1A 1SQVJ 4ASWA 4H44D 3H1ID 1RE3C 2IBZD 2E42A 1SLQA 2Y0CA 2A06D 1K9MQ 1WMKA 1NTKJ 1EXIA 2QG4A 1ZXGA 2FKWB 2ITAA 1EC5A 4JF7A 3PP5A 1NVOA 3CCSP 1GL2D 1VQ5P 3H6PA 3B8EB 1YQ3C 1BSHA 4HKZH 1FZGA 1LTSC 4ZMDA 2H89C 1LWUB 4PV1B 3V4QA 4MN4C 4C7NB 1HUCA 4RKUJ 1Z56A 3MUDA 5AVVB 5BVZA 5CCHC 5AW8B 2I1JA 1X9VA 5BU5A 2O01H 2Z5IA 1HGVA 3Q5PA 3CLQA 5B5EH 2A45G 4AQRD 4YXWH 3PRJA 2XDJA 1VF5B 3F5HA 1VF5C 4GOEA 3TF5A 3L74G 3A0BE 1NO4A 1BCCD 4H0LD 2OTKE 1NTKG 2M8RA 3CCUP 2K9JB 3H1JD 1S9KD 1LGHB 3L37A 2J5UA 3RBZA 1MKMA 4WB4A 1MZ9A 1SQPE 1SQQD 2OTJP 1T2KC 3G4SP 1H0TA 3R4YA 5B5EE 1SQBE 5KLVK 3CCJP 1PIXA 3CCEP 2C0XA 1AV1A 2W83C 4AYCA 1X79B 1NJIQ 3HTKB 2WSCH 2BASA 3H1KG 5K5GB 5CMZA 1L0LD 3U1AA 3H1IE 3L72J 4GOFA 2IBZE 1NHLA 1TU3F 4EOTA 3A7OA 1IO4A 3SWKA 5AW7B 2A06E 2YXRB 1N7SD 3U1CA 1ZMEC 3T97A 2R44A 1OXZA 2Q7CA 1NYHA 2K88A 3JSVC 1KYOH 2Q1KA 3RL0g 1M1JB 4NPEA 2OYOA 4RO0A 3V2NA 5AVTB 1R5LA 1RY3A 2HG5D 3RBXA 4TLFA 2RN0A 4K3AA 3HUSA 3LW5H 3RK2D 1YYCA 2QJPB 1NAYA 3KDPB 3E1IA 2R5BA 3C1LA 1NTMK 2QEXP 4WY4B 3GHGB 1AVOA 4WY4C 1S5LH 1Y9BA 2E74C 3JC22 3L70G 1OWAA 3BVHA 3L71D 3VN0A 3MTUE 3M0AA 4H13C 5GTHH 1M90Q 3L72G 4Y28J 3GF3A 3FWNA 3HRNA 1XTGB 1BCCE 3LIEA 1G1JA 3GF7A 2I8DA 3USSA 3H1JE 1S9KE 1JM0A 3ITKA 3MZWB 2IX7C 2Q5UA 2Z5HA 5H2FE 4ZKPA 1SQQE 1YTZT 4D6TG 3D70A 1S5LE 2POHA 1N8RQ 4I6MC 1FZEA 3L35A 1T3JA 1S2EA 4C7RA 5GTHE 1LWUA 3L74D 3LIDA 1YJWP 2HODB 4C7NA 3VP8A 1ZLLA 1GW3A 2ZYAA 1PGQA 1L4AA 1L0LE 1RH5B 4U3FD 4R4MA 3S1KA 3WUVA 5AVWB 1A02J 2B87B 1VQNP 3WU2E 1LTAC 1CSBA 2ZYDA 1SQBJ 1CZQA 1ZW0A 4NPDA 3RK3C 1MV8A 2WQYC 3CMAP 1BDDA 5APVA 1IFMA 1AFOA 2K9JA 3H1KD 5KLIC 1T3UA 1AQTA 2ZT9B 1SFCB 2D2CB 2QJKB 3BRTB 1BE3D 3H1IJ 3CD6P 1J1DC 2C0WA 3CX5I 5CCGD 2D2CC 2P67A 2JWDA 2XV5A 3B5NC 1W5CE 1IK7A 1VQPP 2IYOA 1P84I 2K37A 3A0HH 2A45I 3M0DC 3II6A 3L71E 3HTKA 5KJ7A 2Q3IA 2KSJA 1SQXK 1NU1E 1SQPG 3IF4A 3KZIH 3ZDMA 3H25A 1SQBG 3EFFK 5E79H 2AXCA 2B9BA 3TGUE 5AVXB 2N1TA 3P8CD 1LTJA 2M0BA 1JCCA 1PZQA 3L70D 4GT1A 4RESB 2OQQA 1KB9H 3C8VA 3HE5B 1M1JA 3L74E 1KORA 2B89A 2IBZG 3MUDC 1BCCJ 3AEFC 1YJ9P 2CK3H 1JO5A 3TNUA 3H1JJ 3RK3E 1FC2C 3C9IA 1K04A 3A2AA 3GHGA 1LTTC 4U3FE 1KILA 4IL6X 4D6TD 5AW1B 1SQQJ 1HWTC 2W6BA 1HTLC 1Y47A 3EWKA 3VOPA 3HE4B 1KMIZ 1ZP0C 5TISH 3NMDA 1JY3P 3N7NA 2YMYA 2KOGA 1PL5A 1L0LJ 1NTZG 2FFDA 1Q86Q 1BE3E 2Y9ZA 1YBKA 1MFZA 1URQB 1DEBA 3AE7C 1N2DC 2P10A 1PGJA 1EDIA 1YJNP 1OMIA 1HVVA 2JEEA 2YKQA 3TK1A 2BEZF 3M06A 2OGUA 1FOSE 2K9YA 5CBOA 1FAVA 1VQ9P 2I1KA 3BATA 1AJYA 2FY8A 3M9HA 4L75A 2PRRA 1YTZI 4JPZB 2Y0EA 4YTPC 5AW3B 3T97B 2P2UA 2IYPA 3P8CE 5APQA 1X22A 1VQ6P 1SQVK 2Y0DA 1ZR2A 1KQGB 3MP7B 2FYNB 3L71J 1L0LG 3HD7D 1SQPD 1LTGC 1OW6A 2FYNC 4PD4H 1SFCA 2YMKA 3F89A 3HUSC 3EQ2A 3B4SA 3FX0A 1BGYD 4EYYQ 3Q1MA 4W7YA 4EI2A 4D6TE 2OYHA 1FZCA 2UWJE 4W80A 1M57D 3KXDA 3PTZA 1NKNA 2AEFA 2ZAEB 3K5BA 1NKZB 3RL0C 4N3YB 3L74J 4PD4E 1LT9B 3AEAC 2K3RA 2KP8A 5CCHD 2N9YB 5AVYB 2KNCB 4U7JA 4U3FJ 3AE6C 4BRYA 3L71G 1QGKB 1NU1G 1HH0A 3P7KA 1LWUC 4PV1C 1W2EA 3HE5A 3VMZA 1KZUB 1IFNA 2IFNA 1VF5D 1BSNA 1OVVA 2R5DA 1L4AB 1R5SA 3TGUG 1OVRA 3L36A 1LNQA 1EQ7A 1L4AC 3H1KJ 2LXBA 2ZVNB 1N73B 1NTZD 3CC2P 3EFGA 1JEKA 1LT1A 1VQ7P 1YIJP 1KYOD 1BE3J 1T2KD 1K73Q 4IL6H 4Y99B 3S9OA 4WVZA 4B86A 1NTME 1OFCX 3HE4A 4Y99C 5CJ0A 1GZLA 4IFDK 1CW5A 1MFTA 3W68A 2QE7H 4IOIH 4DT0A 4U3FG 2IBZI 2ZYGA 3V6IA 3WUTA 3I55P 3H1LG 3U59A 2K1AA 1L0NG 1FU1A 2YKPA 5APUA 1VPCA 1BGYE 3GG2A 1URQA 2XKMA 3CWBG 2P58A 3BASA 3H1HD 1LTBC 4H0LB 1KV4A 3PLNA 3L70J 3Q3DA 1GTWA 5KJ7C 5APSA 3CCQP 4YPCA 1DH3A 1K8AQ 2KK7A 1BE3G 5KTBA 2N1TB 2GUSA 1IC2A 1LTJB 1JY3N 2N1TC 4XE5B 2KXPB 1LTJC 1KYOI 1GK4A 3OW2O 4WY4D 4D6TJ 2E74D 1YITP 2C9NY 1PP9G 2E5TA 5KKZB 4I7ZB 1UIIA 2O1JA 4H13D 1M1JC 1IZNB 4KHXA 4N78E 3TNUB 1NH4A 3FGAD 4OH8B 4BWNA 2XZRA 2NPSA 1JY2P 2QJPC 1JY3O 1G2CA 1KILB 1PFIA 3GHGC 1NTZE 1KILC 1KYOE 1RF1A 2AEJA 3ABVC 1NU1D 3TDKA 5APXA 1RQVA 3AECC 1XTCC 3RK2B 2WPRA 1YQ4C 3TGUD 2FYUK 1LT9A 1FJPA 4L74A 2QJYB 2FFDB 1FZAA 2ZJSE 2IPPA 2QSIA 2WSFH 2R3SA 4IFMA 2FFDC 2HYNA 2KNCA 1SQXE 2AXTH 4TT3H 2LXCB 4UB8H 4WBAA 3AEEC 2H8PD 5KLVG 2LKMA 1LP1A 3E7KA 3H1HE 1QVGO 1JTHA 2FXMA 1OZHA 1CI6B 3RK3D 1DD4A 2JR8A 1GW4A 1X0TA 2O01J 3H1LD 1SQPJ 1JCDA 2KB7P 2JWAA 2OYIA 1KFMA 1N73A 1L0ND 1GL2A 1E79H 2WITA 4A7PA 1DX7A 1KB9D 2WSEH 5B66H 2M3BA 1BGYJ 2D2CD 5AW2B 3CWBD 3MGNA 1YI2P 1PGPA 1U57A 3B5ND 2KLVA 1OVUA 1M8OB 4XFJA 1QL1A 2C9LY 1GMJA 2RKLA 3JCUH 2ZT9C 1SFCC 2E5YA 2WSSH 2QJKC 3O6QA 3CC4P 3FWLA 2RMZA 1FZFA 4N6JA 1N7LA 3VMAA 1NTMG 2OYHB 1FZCB 2GUVA 2Z4EA 5AW9B 1AQ5A 1NGMB 2OYHC 2YO3A 1FZCC 3CX5H 2IZ1A 1FBMA 2HR3A 2V7QH 3D6YA 1Q7YQ 2WSCJ 1FJKA 1PP9D 1FDIA 1OW8A 3UIAA 1T8ZA 1P84H 2QM7A 2GM4A 2A45H 3L75E 3P32A 3CXHH 1J2JB 1BGYG 3JCUE 3RGUA 2E76B 1PPJG 3L4FA 2H7HA 1SQQK 3V2RA 2E76C 4BRYB 1Y8AA 4O9BA 3G3ZA 3A0HE 1WT6A 2KIKA 2QA4P 2L91A 2W8ZA 1NTZJ 1KTMA 2JO1A 1HF9A 1EXJA 1JMBA 2IFMA 3NTNA 4EDFA 2GA1A 3KZIE 2QVAA 1L0LK 2KZJA 1H8AA 5E79E 3LW5J 3VTPC 2WTYA 3H32A 1FS0E 2E75B 1N7SA 3L73G 3H1LE 3BCCG 1NAFA 1L0NE 2E75C 2HFED 1SQXJ 1KB9E 5KLVD
chains in the Genus database with same CATH topology
1KYOI 1EZVI 1NTZJ 3L72J 3L75J 4D6TJ 1KB9I 3H1KJ 3H1LJ 3L74J 2BCCJ 2FYUJ 1P84I 3TGUJ 1L0NJ 3H1HJ 3L71J 1SQPJ 1NTKJ 3CXHI 1SQQJ 1BE3J 1SQBJ 2IBZI 4PD4I 3CWBJ 1NU1J 1NTMJ 1BCCJ 1SQXJ 1L0LJ 5KLVJ 3H1IJ 1BGYJ 3L70J 3L73J 3CX5I 1PP9J 3BCCJ 1SQVJ 4U3FJ 3H1JJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  1EZV I;  1NTZ J;  3L72 J;  3L75 J;  4D6T J;  1KB9 I;  3H1K J;  3H1L J;  3L74 J;  2BCC J;  2FYU J;  1P84 I;  3TGU J;  1L0N J;  3H1H J;  3L71 J;  1SQP J;  1NTK J;  3CXH I;  1SQQ J;  1BE3 J;  1SQB J;  2IBZ I;  4PD4 I;  3CWB J;  1NU1 J;  1NTM J;  1BCC J;  1SQX J;  1L0L J;  5KLV J;  3H1I J;  1BGY J;  3L70 J;  3L73 J;  3CX5 I;  1PP9 J;  3BCC J;  1SQV J;  4U3F J;  3H1J J; 
#chains in the Genus database with same CATH topology
 3CWB E;  1EZV G;  1G1I A;  1KC8 Q;  1LTI C;  4PD4 D;  1GK6 A;  2O1K A;  2FBW C;  3H1H J;  5APT A;  2Y9Y A;  2ZXE B;  2M3E A;  4OGQ B;  2QIW A;  4OGQ C;  1IFI A;  3IFM A;  5AVQ B;  1VQL P;  1URQ C;  2YO2 A;  3PH0 A;  5GTI H;  1JY2 N;  3Q5R A;  1H88 A;  1KFN A;  5TIS E;  1T6A A;  5M1B A;  1NWQ A;  2KS1 B;  2FYZ A;  4I1L A;  1CI6 A;  1PP9 E;  3AED C;  1VQO P;  1KQL A;  1SQX G;  3MD0 A;  3GMA A;  2Q9I A;  3GW6 A;  1JY2 O;  2BCC G;  1NTM D;  2WT7 A;  3H1H G;  1AA0 A;  2XU6 A;  4C46 A;  5TJH A;  3QH9 A;  3CPW O;  1NTK K;  4PD4 I;  1NU1 J;  3IN6 A;  2W6A A;  3SWY A;  5KAI H;  2NPS B;  1G2C B;  3RL0 D;  1PPJ D;  5AW5 B;  3OA7 A;  2NPS C;  4Z1M H;  1Q82 Q;  3D71 A;  3TGU J;  5BU8 B;  4L73 A;  2FYU D;  1RF1 B;  2J58 A;  1RQU A;  1FE6 A;  1HBW A;  1IFJ A;  1RF1 C;  3AE2 C;  1DEE G;  5KLV E;  3HD7 B;  2PFX A;  4AUW A;  4WWI A;  3TYY A;  5KAI E;  4PV1 D;  3CCL P;  1Q81 Q;  3AE1 C;  1LT9 C;  5CCG A;  3E1R A;  4DCK A;  1EDJ A;  3L73 D;  1VDF A;  3BCC D;  1DIP A;  1L4A D;  1GDT A;  3H1L J;  3VMY A;  1L0N J;  3I56 P;  1LP1 B;  4BXL A;  1EZV D;  1JTH B;  2V4H A;  3CWB J;  4H44 B;  4N78 D;  1VQ8 P;  3CC7 P;  3D6Z A;  3L75 G;  5CBN A;  4H44 C;  3SWF A;  2B88 A;  4ASV A;  2IZ0 A;  3A0B H;  2H88 C;  4GIF A;  3OJA B;  2OYI B;  1A02 F;  1GL2 B;  1D7M A;  2OYI C;  4UB6 H;  1N73 C;  1GL2 C;  3WUU A;  1ZV8 A;  4EIJ A;  4JYB A;  1QX8 A;  3R2P A;  3VYI A;  4GDO A;  1N86 A;  1MUU A;  3V4W A;  2YXQ B;  1SQV G;  4JBZ A;  3O6Q B;  1PP9 J;  3CCR P;  5KJ7 D;  1SQX D;  2CPS A;  2XNX A;  4XA4 A;  2E43 A;  4RJT A;  1PPJ E;  4UB6 E;  3S4R A;  4I2L C;  1VQ4 P;  2BCC D;  2KI7 B;  4IL6 E;  2R32 A;  4LC1 A;  2FYU E;  5AVU B;  3AE5 C;  2N1T D;  4H0L C;  1FDO A;  2WVR A;  1EZV I;  2KS1 A;  3PJS K;  2W6J H;  1VL2 A;  3A5T A;  2SPZ A;  2PP6 A;  2BEQ D;  1USD A;  3KQG A;  2Q6Q A;  1M1K Q;  2ZFC A;  3G9R A;  1HJB A;  5DJT B;  3L73 E;  1DD3 A;  3FXE A;  3BCC E;  1RF0 A;  1S1C X;  1KIL D;  1J1E B;  5AVR B;  1L2P A;  2G3A A;  3OAK A;  1EZV E;  2FXO A;  2H43 A;  1J1E C;  5KLV J;  1JUN A;  2YNY A;  1IFP A;  5KKZ C;  2OTL P;  4I7Z C;  3H32 B;  2KLU A;  1YHQ P;  1N7S B;  3M9Q A;  5AVZ B;  1KN7 A;  2J59 M;  1N7S C;  2AEM A;  2CPB A;  1USE A;  1FZB A;  1R8E A;  2M5A A;  2E74 B;  5H2F H;  1JB0 J;  3HD7 A;  3L75 D;  4H13 B;  2YKO A;  1RE4 A;  1SQP K;  1OIP A;  3RK2 C;  3I5C A;  4YXD C;  1RE3 A;  1SQB K;  5L8R J;  2W27 A;  2QJY C;  4DZO A;  1GD2 E;  3AE4 C;  3CX5 D;  4K35 A;  4LLH A;  1ZR4 A;  2BCC E;  3WU2 H;  4W7Z A;  1NTM J;  4QMA A;  1P84 D;  3N4X A;  1QVF O;  1JNM A;  3CXH D;  5AW6 B;  1SQV D;  2YIU B;  2ZVO B;  1Q2N A;  4R4L A;  2HPC B;  1M56 D;  1KQS O;  2YIU C;  5CCH A;  1NTK D;  4HH2 A;  3KHU A;  2WT7 B;  2AXT E;  2ZT9 D;  1SFC D;  4UB8 E;  4DOJ A;  4JYC A;  2L5G B;  2KUB A;  5CJ4 A;  4ZKU A;  5APW A;  2FYU J;  1WRG A;  1KIL E;  2KYV A;  3AEB C;  3RK3 B;  1HJ0 A;  2MJZ A;  1W2B O;  2MKV A;  2JJL A;  3M91 A;  5KLI B;  3VP9 A;  4L76 A;  2OAR A;  3MHV A;  1NTZ K;  4GKG A;  4DJG A;  1X8Y A;  1J1D B;  5B66 E;  1ZRT D;  2JDI H;  2WWW A;  3AE3 C;  3CCM P;  2E76 D;  5AW0 B;  2JP3 A;  3B5N B;  4JQ0 D;  2Q3E A;  2WMM A;  3L73 J;  3BCC J;  2NRG A;  1EDK A;  4HYT B;  3NXS A;  4KJM A;  3SFD C;  3CXH I;  2HLO A;  2R3C A;  5C39 A;  3B71 A;  2PAJ A;  5CCG C;  1ZN5 A;  2WPQ A;  2FYU G;  1K05 A;  4ZNC A;  3Q5S A;  2ZXX A;  1KB9 I;  3AEG C;  2QRX A;  2XND H;  2RH0 A;  1IFD A;  1PGO A;  5AVS B;  3CX5 E;  2WZ7 A;  4KT0 J;  1KQF B;  2E75 D;  3IAO A;  1VQM P;  3SSU A;  1Q90 D;  2O3J A;  4NPF X;  1P84 E;  3FXD A;  2IDB A;  1SP4 A;  3CXH E;  4M3L A;  1SQV E;  1S3J A;  2FXP A;  2NZ2 A;  3L72 D;  3H1I G;  3NFQ A;  1NTK E;  1EDL A;  2A06 G;  1RHZ B;  1SVF A;  4OGQ D;  4WY4 A;  2DW3 A;  1GU4 A;  3O8Z A;  4GOD A;  2BCC J;  3V2P A;  1U7J A;  1URQ D;  3CME P;  1LJ2 A;  2QM8 A;  1FOS F;  1UIX A;  3TSI A;  1IK9 A;  3G6E P;  1ZOY C;  1U7M A;  5APY A;  5DJU B;  4IFF A;  2KZI A;  2WPV B;  5KAF H;  2LR2 A;  2WSF J;  3MIW A;  3H1K E;  1JOC A;  1OX3 A;  3IR9 A;  1H0T B;  2P1J A;  1ZRT E;  1E5W A;  4PJ0 H;  3QWO C;  1HGZ A;  3VMX A;  3PHL A;  4LGD E;  1NU1 K;  3WMM 0;  1KD1 Q;  3KYQ A;  1AVY A;  2WPS A;  2O01 N;  1BCC G;  1NOH A;  2HPC A;  1OW7 A;  3H1J G;  2HOD A;  1JMM A;  3CCV P;  5KAF E;  2P7J A;  2W90 A;  1QL2 A;  2N9B A;  1M7L A;  2WSE J;  1SQQ G;  2NPS D;  4CPG A;  5GTI E;  4OVN F;  4PJ0 E;  2B87 A;  1RF0 C;  4OWF A;  5CHX A;  1H89 A;  1S4X A;  5EFW B;  4HJG H;  3BRV B;  1GU5 A;  3AE8 C;  3CI9 A;  3L70 E;  1QLE D;  2VRS A;  3P8M C;  3L75 J;  1VQK P;  1IJD B;  3V5B A;  3M9B A;  3L72 E;  3HUS B;  2G8Y A;  1L0N K;  3CL3 D;  2M5A B;  1S5L X;  1FDM A;  1SQB D;  5AW4 B;  3A3Y B;  3B5N A;  1PV3 A;  3M0D A;  2JKV A;  2V7Q J;  3G71 P;  3SFE C;  1QEX A;  3HD7 C;  3V2Q A;  1BDC A;  3W67 A;  3GLM A;  3Q2Y A;  3AE9 C;  1RE4 C;  1S72 P;  2KSE A;  2PGD A;  3KPE A;  3RL0 B;  4HB1 A;  1SS1 A;  1SQV J;  4ASW A;  4H44 D;  3H1I D;  1RE3 C;  2IBZ D;  2E42 A;  1SLQ A;  2Y0C A;  2A06 D;  1K9M Q;  1WMK A;  1NTK J;  1EXI A;  2QG4 A;  1ZXG A;  2FKW B;  2ITA A;  1EC5 A;  4JF7 A;  3PP5 A;  1NVO A;  3CCS P;  1GL2 D;  1VQ5 P;  3H6P A;  3B8E B;  1YQ3 C;  1BSH A;  4HKZ H;  1FZG A;  1LTS C;  4ZMD A;  2H89 C;  1LWU B;  4PV1 B;  3V4Q A;  4MN4 C;  4C7N B;  1HUC A;  4RKU J;  1Z56 A;  3MUD A;  5AVV B;  5BVZ A;  5CCH C;  5AW8 B;  2I1J A;  1X9V A;  5BU5 A;  2O01 H;  2Z5I A;  1HGV A;  3Q5P A;  3CLQ A;  5B5E H;  2A45 G;  4AQR D;  4YXW H;  3PRJ A;  2XDJ A;  1VF5 B;  3F5H A;  1VF5 C;  4GOE A;  3TF5 A;  3L74 G;  3A0B E;  1NO4 A;  1BCC D;  4H0L D;  2OTK E;  1NTK G;  2M8R A;  3CCU P;  2K9J B;  3H1J D;  1S9K D;  1LGH B;  3L37 A;  2J5U A;  3RBZ A;  1MKM A;  4WB4 A;  1MZ9 A;  1SQP E;  1SQQ D;  2OTJ P;  1T2K C;  3G4S P;  1H0T A;  3R4Y A;  5B5E E;  1SQB E;  5KLV K;  3CCJ P;  1PIX A;  3CCE P;  2C0X A;  1AV1 A;  2W83 C;  4AYC A;  1X79 B;  1NJI Q;  3HTK B;  2WSC H;  2BAS A;  3H1K G;  5K5G B;  5CMZ A;  1L0L D;  3U1A A;  3H1I E;  3L72 J;  4GOF A;  2IBZ E;  1NHL A;  1TU3 F;  4EOT A;  3A7O A;  1IO4 A;  3SWK A;  5AW7 B;  2A06 E;  2YXR B;  1N7S D;  3U1C A;  1ZME C;  3T97 A;  2R44 A;  1OXZ A;  2Q7C A;  1NYH A;  2K88 A;  3JSV C;  1KYO H;  2Q1K A;  3RL0 g;  1M1J B;  4NPE A;  2OYO A;  4RO0 A;  3V2N A;  5AVT B;  1R5L A;  1RY3 A;  2HG5 D;  3RBX A;  4TLF A;  2RN0 A;  4K3A A;  3HUS A;  3LW5 H;  3RK2 D;  1YYC A;  2QJP B;  1NAY A;  3KDP B;  3E1I A;  2R5B A;  3C1L A;  1NTM K;  2QEX P;  4WY4 B;  3GHG B;  1AVO A;  4WY4 C;  1S5L H;  1Y9B A;  2E74 C;  3JC2 2;  3L70 G;  1OWA A;  3BVH A;  3L71 D;  3VN0 A;  3MTU E;  3M0A A;  4H13 C;  5GTH H;  1M90 Q;  3L72 G;  4Y28 J;  3GF3 A;  3FWN A;  3HRN A;  1XTG B;  1BCC E;  3LIE A;  1G1J A;  3GF7 A;  2I8D A;  3USS A;  3H1J E;  1S9K E;  1JM0 A;  3ITK A;  3MZW B;  2IX7 C;  2Q5U A;  2Z5H A;  5H2F E;  4ZKP A;  1SQQ E;  1YTZ T;  4D6T G;  3D70 A;  1S5L E;  2POH A;  1N8R Q;  4I6M C;  1FZE A;  3L35 A;  1T3J A;  1S2E A;  4C7R A;  5GTH E;  1LWU A;  3L74 D;  3LID A;  1YJW P;  2HOD B;  4C7N A;  3VP8 A;  1ZLL A;  1GW3 A;  2ZYA A;  1PGQ A;  1L4A A;  1L0L E;  1RH5 B;  4U3F D;  4R4M A;  3S1K A;  3WUV A;  5AVW B;  1A02 J;  2B87 B;  1VQN P;  3WU2 E;  1LTA C;  1CSB A;  2ZYD A;  1SQB J;  1CZQ A;  1ZW0 A;  4NPD A;  3RK3 C;  1MV8 A;  2WQY C;  3CMA P;  1BDD A;  5APV A;  1IFM A;  1AFO A;  2K9J A;  3H1K D;  5KLI C;  1T3U A;  1AQT A;  2ZT9 B;  1SFC B;  2D2C B;  2QJK B;  3BRT B;  1BE3 D;  3H1I J;  3CD6 P;  1J1D C;  2C0W A;  3CX5 I;  5CCG D;  2D2C C;  2P67 A;  2JWD A;  2XV5 A;  3B5N C;  1W5C E;  1IK7 A;  1VQP P;  2IYO A;  1P84 I;  2K37 A;  3A0H H;  2A45 I;  3M0D C;  3II6 A;  3L71 E;  3HTK A;  5KJ7 A;  2Q3I A;  2KSJ A;  1SQX K;  1NU1 E;  1SQP G;  3IF4 A;  3KZI H;  3ZDM A;  3H25 A;  1SQB G;  3EFF K;  5E79 H;  2AXC A;  2B9B A;  3TGU E;  5AVX B;  2N1T A;  3P8C D;  1LTJ A;  2M0B A;  1JCC A;  1PZQ A;  3L70 D;  4GT1 A;  4RES B;  2OQQ A;  1KB9 H;  3C8V A;  3HE5 B;  1M1J A;  3L74 E;  1KOR A;  2B89 A;  2IBZ G;  3MUD C;  1BCC J;  3AEF C;  1YJ9 P;  2CK3 H;  1JO5 A;  3TNU A;  3H1J J;  3RK3 E;  1FC2 C;  3C9I A;  1K04 A;  3A2A A;  3GHG A;  1LTT C;  4U3F E;  1KIL A;  4IL6 X;  4D6T D;  5AW1 B;  1SQQ J;  1HWT C;  2W6B A;  1HTL C;  1Y47 A;  3EWK A;  3VOP A;  3HE4 B;  1KMI Z;  1ZP0 C;  5TIS H;  3NMD A;  1JY3 P;  3N7N A;  2YMY A;  2KOG A;  1PL5 A;  1L0L J;  1NTZ G;  2FFD A;  1Q86 Q;  1BE3 E;  2Y9Z A;  1YBK A;  1MFZ A;  1URQ B;  1DEB A;  3AE7 C;  1N2D C;  2P10 A;  1PGJ A;  1EDI A;  1YJN P;  1OMI A;  1HVV A;  2JEE A;  2YKQ A;  3TK1 A;  2BEZ F;  3M06 A;  2OGU A;  1FOS E;  2K9Y A;  5CBO A;  1FAV A;  1VQ9 P;  2I1K A;  3BAT A;  1AJY A;  2FY8 A;  3M9H A;  4L75 A;  2PRR A;  1YTZ I;  4JPZ B;  2Y0E A;  4YTP C;  5AW3 B;  3T97 B;  2P2U A;  2IYP A;  3P8C E;  5APQ A;  1X22 A;  1VQ6 P;  1SQV K;  2Y0D A;  1ZR2 A;  1KQG B;  3MP7 B;  2FYN B;  3L71 J;  1L0L G;  3HD7 D;  1SQP D;  1LTG C;  1OW6 A;  2FYN C;  4PD4 H;  1SFC A;  2YMK A;  3F89 A;  3HUS C;  3EQ2 A;  3B4S A;  3FX0 A;  1BGY D;  4EYY Q;  3Q1M A;  4W7Y A;  4EI2 A;  4D6T E;  2OYH A;  1FZC A;  2UWJ E;  4W80 A;  1M57 D;  3KXD A;  3PTZ A;  1NKN A;  2AEF A;  2ZAE B;  3K5B A;  1NKZ B;  3RL0 C;  4N3Y B;  3L74 J;  4PD4 E;  1LT9 B;  3AEA C;  2K3R A;  2KP8 A;  5CCH D;  2N9Y B;  5AVY B;  2KNC B;  4U7J A;  4U3F J;  3AE6 C;  4BRY A;  3L71 G;  1QGK B;  1NU1 G;  1HH0 A;  3P7K A;  1LWU C;  4PV1 C;  1W2E A;  3HE5 A;  3VMZ A;  1KZU B;  1IFN A;  2IFN A;  1VF5 D;  1BSN A;  1OVV A;  2R5D A;  1L4A B;  1R5S A;  3TGU G;  1OVR A;  3L36 A;  1LNQ A;  1EQ7 A;  1L4A C;  3H1K J;  2LXB A;  2ZVN B;  1N73 B;  1NTZ D;  3CC2 P;  3EFG A;  1JEK A;  1LT1 A;  1VQ7 P;  1YIJ P;  1KYO D;  1BE3 J;  1T2K D;  1K73 Q;  4IL6 H;  4Y99 B;  3S9O A;  4WVZ A;  4B86 A;  1NTM E;  1OFC X;  3HE4 A;  4Y99 C;  5CJ0 A;  1GZL A;  4IFD K;  1CW5 A;  1MFT A;  3W68 A;  2QE7 H;  4IOI H;  4DT0 A;  4U3F G;  2IBZ I;  2ZYG A;  3V6I A;  3WUT A;  3I55 P;  3H1L G;  3U59 A;  2K1A A;  1L0N G;  1FU1 A;  2YKP A;  5APU A;  1VPC A;  1BGY E;  3GG2 A;  1URQ A;  2XKM A;  3CWB G;  2P58 A;  3BAS A;  3H1H D;  1LTB C;  4H0L B;  1KV4 A;  3PLN A;  3L70 J;  3Q3D A;  1GTW A;  5KJ7 C;  5APS A;  3CCQ P;  4YPC A;  1DH3 A;  1K8A Q;  2KK7 A;  1BE3 G;  5KTB A;  2N1T B;  2GUS A;  1IC2 A;  1LTJ B;  1JY3 N;  2N1T C;  4XE5 B;  2KXP B;  1LTJ C;  1KYO I;  1GK4 A;  3OW2 O;  4WY4 D;  4D6T J;  2E74 D;  1YIT P;  2C9N Y;  1PP9 G;  2E5T A;  5KKZ B;  4I7Z B;  1UII A;  2O1J A;  4H13 D;  1M1J C;  1IZN B;  4KHX A;  4N78 E;  3TNU B;  1NH4 A;  3FGA D;  4OH8 B;  4BWN A;  2XZR A;  2NPS A;  1JY2 P;  2QJP C;  1JY3 O;  1G2C A;  1KIL B;  1PFI A;  3GHG C;  1NTZ E;  1KIL C;  1KYO E;  1RF1 A;  2AEJ A;  3ABV C;  1NU1 D;  3TDK A;  5APX A;  1RQV A;  3AEC C;  1XTC C;  3RK2 B;  2WPR A;  1YQ4 C;  3TGU D;  2FYU K;  1LT9 A;  1FJP A;  4L74 A;  2QJY B;  2FFD B;  1FZA A;  2ZJS E;  2IPP A;  2QSI A;  2WSF H;  2R3S A;  4IFM A;  2FFD C;  2HYN A;  2KNC A;  1SQX E;  2AXT H;  4TT3 H;  2LXC B;  4UB8 H;  4WBA A;  3AEE C;  2H8P D;  5KLV G;  2LKM A;  1LP1 A;  3E7K A;  3H1H E;  1QVG O;  1JTH A;  2FXM A;  1OZH A;  1CI6 B;  3RK3 D;  1DD4 A;  2JR8 A;  1GW4 A;  1X0T A;  2O01 J;  3H1L D;  1SQP J;  1JCD A;  2KB7 P;  2JWA A;  2OYI A;  1KFM A;  1N73 A;  1L0N D;  1GL2 A;  1E79 H;  2WIT A;  4A7P A;  1DX7 A;  1KB9 D;  2WSE H;  5B66 H;  2M3B A;  1BGY J;  2D2C D;  5AW2 B;  3CWB D;  3MGN A;  1YI2 P;  1PGP A;  1U57 A;  3B5N D;  2KLV A;  1OVU A;  1M8O B;  4XFJ A;  1QL1 A;  2C9L Y;  1GMJ A;  2RKL A;  3JCU H;  2ZT9 C;  1SFC C;  2E5Y A;  2WSS H;  2QJK C;  3O6Q A;  3CC4 P;  3FWL A;  2RMZ A;  1FZF A;  4N6J A;  1N7L A;  3VMA A;  1NTM G;  2OYH B;  1FZC B;  2GUV A;  2Z4E A;  5AW9 B;  1AQ5 A;  1NGM B;  2OYH C;  2YO3 A;  1FZC C;  3CX5 H;  2IZ1 A;  1FBM A;  2HR3 A;  2V7Q H;  3D6Y A;  1Q7Y Q;  2WSC J;  1FJK A;  1PP9 D;  1FDI A;  1OW8 A;  3UIA A;  1T8Z A;  1P84 H;  2QM7 A;  2GM4 A;  2A45 H;  3L75 E;  3P32 A;  3CXH H;  1J2J B;  1BGY G;  3JCU E;  3RGU A;  2E76 B;  1PPJ G;  3L4F A;  2H7H A;  1SQQ K;  3V2R A;  2E76 C;  4BRY B;  1Y8A A;  4O9B A;  3G3Z A;  3A0H E;  1WT6 A;  2KIK A;  2QA4 P;  2L91 A;  2W8Z A;  1NTZ J;  1KTM A;  2JO1 A;  1HF9 A;  1EXJ A;  1JMB A;  2IFM A;  3NTN A;  4EDF A;  2GA1 A;  3KZI E;  2QVA A;  1L0L K;  2KZJ A;  1H8A A;  5E79 E;  3LW5 J;  3VTP C;  2WTY A;  3H32 A;  1FS0 E;  2E75 B;  1N7S A;  3L73 G;  3H1L E;  3BCC G;  1NAF A;  1L0N E;  2E75 C;  2HFE D;  1SQX J;  1KB9 E;  5KLV D; 
#chains in the Genus database with same CATH homology
 1KYO I;  1EZV I;  1NTZ J;  3L72 J;  3L75 J;  4D6T J;  1KB9 I;  3H1K J;  3H1L J;  3L74 J;  2BCC J;  2FYU J;  1P84 I;  3TGU J;  1L0N J;  3H1H J;  3L71 J;  1SQP J;  1NTK J;  3CXH I;  1SQQ J;  1BE3 J;  1SQB J;  2IBZ I;  4PD4 I;  3CWB J;  1NU1 J;  1NTM J;  1BCC J;  1SQX J;  1L0L J;  5KLV J;  3H1I J;  1BGY J;  3L70 J;  3L73 J;  3CX5 I;  1PP9 J;  3BCC J;  1SQV J;  4U3F J;  3H1J J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...