2WPQA

Salmonella enterica sada 479-519 fused to gcn4 adaptors (sadak3, in- register fusion)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
99
structure length
99
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIFDTNEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 48
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wpqA00
1CZQA 4B86A 1GZLA 5AVTB 3VYIA 1H88A 3MD0A 2N9BA 3A2AA 3IR9A 3M9BA 1HBWA 2E42A 4JYBA 5AVZB 3V5BA 3A7OA 2ZXEB 3TNUB 3UIAA 2WPSA 1GU4A 2WPQA 5AW8B 2C9NY 1CI6B 3VTPC 3VMYA 3KDPB 1NWQA 4LC1A 3T97A 2WT7A 1T2KD 2Q5UA 1JNMA 5APUA 1CSBA 3LIEA 4GKGA 2P67A 5AW1B 2Q7CA 1KQLA 2Q3IA 1OXZA 3I5CA 3LIDA 1H89A 3M0DA 3VMXA 1A02F 2W27A 5AW0B 5APQA 2QM8A 3HTKA 2JJLA 4C7NB 5AW7B 5APXA 3NTNA 3HE5B 3M0AA 2YNYA 3M06A 2R3CA 1SLQA 1G2CB 5AVSB 3HE4A 1JUNA 4KHXA 1OWAA 2XZRA 1GK4A 1DH3A 2VRSA 2YO3A 5AVYB 2R32A 3VN0A 1NAFA 2XU6A 3TK1A 4M3LA 1FAVA 1MUUA 5APTA 5AW2B 5AVXB 1T2KC 5AVRB 3P32A 3MGNA 3M9HA 1FOSE 3TYYA 4HYTB 3NMDA 2H7HA 3L37A 2WT7B 1S9KD 3L35A 3VMZA 3P8MC 5AW3B 4GT1A 5AW9B 2P7JA 3OAKA 1MFZA 5AVQB 5AW4B 3O8ZA 5AVUB 2YO2A 2QM7A 3L36A 1HUCA 1J2JB 5CMZA 1SP4A 2XV5A 3V4WA 3P7KA 1HJBA 2R5BA 4RESB 5AVVB 2IPPA 5AW6B 2Z5IA 4DZOA 1GU5A 3TNUA 3SWFA 2E43A 2BASA 1GK6A 1X8YA 1CI6A 3HE4B 5AVWB 3M91A 5AW5B 1MV8A 1IO4A 4AYCA 2WTYA 4XE5B 3NXSA 4I6MC 2W6AA 1FOSF 5APSA 5APWA 4AQRD 1GTWA 2ZFCA 2C9LY 2P2UA 3B8EB 1A02J 4AUWA 1GD2E 2R5DA 5APVA 4EOTA 4I2LC 5APYA 1H8AA 4C46A 3A5TA 1YYCA 4C7NA 2Z5HA 1S9KE 3HE5A 4JYCA 3V4QA 3NFQA 2WWWA 1HWTC 3KQGA 2WPRA 3A3YB 2KP8A
chains in the Genus database with same CATH superfamily
3M9QA 1L4AD 1VF5B 2WSCH 3H1JE 2ZXEB 2QJYC 4UB8H 1Q86Q 5CBNA 1DD3A 4PV1D 1OFCX 1M56D 2FYNB 3P8CE 5E79E 2OARA 3LIDA 1NHLA 3JCUE 2NPSA 3HE5B 1URQC 1BGYG 4PD4E 5KJ7D 3CC2P 3L71J 2BCCJ 5AVRB 3BASA 3L37A 1Q2NA 2FBWC 3A0HE 1ZW0A 3L71E 2BCCE 1QLED 2K9JA 3GW6A 2HPCB 1GK6A 1NTKJ 4PD4I 1FZCB 2ZAEB 4I6MC 2A45G 4H13C 1NTZK 1NTKE 1RF1A 2A45H 1NTZG 4D6TG 1YTZI 2FYUD 1AQ5A 5KTBA 3CPWO 3H1KD 2WPRA 2Q3EA 4N6JA 1L2PA 1NU1K 1IFJA 1KILB 2QIWA 5AVZB 4YXWH 3VMYA 3L70G 2HLOA 1FDOA 1CSBA 2P67A 1RQUA 1GW4A 3I56P 4NPEA 1L4AC 1G1IA 1U57A 2BEZF 1OWAA 3H1LJ 4BRYB 3IFMA 3CWBD 1T6AA 2BEQD 4A7PA 1PP9D 3EFFK 4M3LA 2ZVNB 3P32A 2NPSD 3H1LE 4PV1C 4WWIA 2QJPC 2J58A 2XNDH 1NH4A 3AEEC 3L36A 3G9RA 3FWLA 3KPEA 4UB8E 2WMMA 5AVVB 1YQ4C 3KXDA 2YIUC 3SWFA 1X8YA 1IFMA 3TDKA 5KJ7C 3RK3C 4AYCA 3TSIA 1KN7A 4JQ0D 1JCDA 1SQBK 1GL2B 3S1KA 3HRNA 3II6A 4WBAA 1USEA 3GHGA 3BVHA 1OW6A 2E75B 1X0TA 3H1LD 1ZR4A 2HODB 2KB7P 3CXHD 1KYOH 3H1HG 4DJGA 3I5CA 1H89A 1RHZB 3AE1C 1J1DB 2FFDB 1J1EC 4I7ZB 5CCHD 1JOCA 1N73B 2R32A 4BXLA 1EZVG 3TK1A 1AVYA 3TYYA 2H88C 3WU2E 2H7HA 1FZBA 3BCCG 2H89C 1BGYD 1QVFO 3AEAC 3L70J 1SQQK 4RESB 3CCRP 2OTJP 2BASA 2L91A 5AW5B 2QRXA 3L70E 2A45I 3OW2O 2ZT9B 3CCMP 3PRJA 2IZ0A 2NPSC 3A0BH 2OQQA 5APYA 1YYCA 1JB0J 2MKVA 5GTIH 3HE5A 2PAJA 2N1TB 5M1BA 1N8RQ 1ZRTD 1LTBC 3QH9A 1BSNA 2G8YA 1ZOYC 1PFIA 1HBWA 3N7NA 1DIPA 1FU1A 1BCCJ 2V7QH 1NTZD 4D6TD 3SFDC 1PGQA 2G3AA 2Q7CA 2KUBA 1UIIA 2AEFA 4TT3H 1BCCE 2OYHC 3B5NA 2D2CB 2O01H 2ZYAA 2K9JB 1M1JB 3S4RA 3NTNA 1JM0A 3M0AA 3SSUA 2HPCA 1EDLA 1KFNA 1JUNA 1NU1D 3RL0D 1JY3N 1MFTA 1SFCB 1DD4A 2YO3A 1KV4A 1VQOP 4L75A 4R4LA 1RF1B 4KT0J 1OZHA 5B66H 3QWOC 2OTLP 3L72G 1VQ5P 4HKZH 3O8ZA 1R5LA 1KILA 3H1JG 5DJUB 3G4SP 5CCHC 1KYOE 1XTCC 4XE5B 3NXSA 1PPJG 1RE4A 1VQ6P 4W7YA 1VF5D 2I1JA 1KB9H 1AV1A 1NOHA 2GA1A 1HGVA 4BRYA 1PGJA 1LT9B 3AEFC 4Y99C 5AVTB 5KLVG 2RKLA 3MD0A 2OYIB 1U7MA 3BCCJ 4KJMA 3CX5D 2WZ7A 1JTHB 1EZVE 1KYOI 1GU4A 1KQFB 4U3FJ 2B88A 3FGAD 2ITAA 3BCCE 4BWNA 5APUA 1FJKA 1SQBD 4GOEA 2P58A 1JY2O 3L74D 4U3FE 3L71G 3M0DA 3CC4P 1A02F 1EXIA 2LXCB 1YJNP 1KC8Q 2AEJA 2KS1B 4KHXA 4EIJA 3A0BE 1Q90D 1NTKK 3L73D 5B5EH 3H1HD 2XU6A 5GTIE 3B5ND 3HUSB 1NTKG 1GL2A 4N3YB 3AEDC 2V7QJ 1WT6A 4GT1A 3GHGC 5AVUB 3CCLP 1IZNB 3OA7A 4LLHA 1IJDB 2O01J 4DZOA 1EZVD 1VQ7P 3RBZA 2NZ2A 1M1KQ 3V2NA 4OVNF 3RL0B 2P2UA 3H1ID 3W67A 1M57D 2R3SA 1KILD 1EDJA 2GUVA 2Q9IA 1OIPA 1N7SB 5CCGA 3CI9A 2FFDA 1HWTC 1SQQD 2YKPA 5KAFH 2XNXA 2W8ZA 4RO0A 3WUVA 1N73A 1K9MQ 3L72J 2E42A 3MIWA 5B66E 1N86A 3PHLA 2QEXP 4XA4A 2OTKE 1EQ7A 1VF5C 3H6PA 2P1JA 3L72E 1KQLA 4NPDA 4H0LB 1JY3P 3F5HA 4GDOA 1BDDA 4EI2A 1PIXA 1E79H 1PL5A 2WSFH 3PJSK 3M06A 1R5SA 2R3CA 1SLQA 2M3BA 4K3AA 2VRSA 2FYNC 1PPJE 1Z56A 2WVRA 3G6EP 5KLVJ 2KNCB 2HR3A 1RF0C 2P7JA 2N1TA 3OAKA 2FY8A 2IYPA 2KZIA 2QSIA 4WB4A 2QM7A 4N78D 2KSEA 5KLVE 2HG5D 1NKNA 2JDIH 3B71A 1GL2D 4DOJA 2WQYC 3HE4B 1SQXG 2B9BA 1IFPA 3V2RA 1KB9I 3L72D 1GTWA 1NTMJ 1KFMA 3BRTB 2PRRA 4I2LC 2E75D 3H1JD 3B5NB 1M1JA 1FZCC 2O1JA 1NTME 3HD7B 4B86A 2C0WA 1SFCA 2SPZA 1BE3G 3A2AA 3CCSP 5CBOA 3P8CD 1L0LJ 2JP3A 5CCGD 2O1KA 1NGMB 5AW1B 1IC2A 1KILC 3I55P 3MZWB 1OX3A 4PD4D 1L0LE 1QL1A 5AW0B 3TGUJ 1HJ0A 2LXBA 5AW7B 5AVSB 5L8RJ 2K88A 1LTAC 1IFNA 4CPGA 3TGUE 2A06E 3L71D 1PV3A 2BCCD 3M9HA 3NMDA 3PLNA 5KAFE 4HJGH 3P8MC 3K5BA 2ZT9D 1LP1B 1L0NG 1LT9A 2C0XA 2OYIA 1EXJA 2R5BA 3Q5SA 1X79B 1G2CA 1JTHA 4JPZB 5DJTB 2WSCJ 3MUDA 1NTKD 2E43A 5CJ0A 2N1TD 2RN0A 3CMEP 4AQRD 3M0DC 2ZFCA 2MJZA 4I1LA 5APVA 1LTJB 5TJHA 1BCCG 4YTPC 2KS1A 4JYCA 4U7JA 2KYVA 2FYZA 3KQGA 1SQVG 2E74B 1UIXA 2N9BA 1GL2C 1RQVA 2Y0DA 1FDMA 1TU3F 2WPSA 3HUSA 5AW8B 2D2CD 2E76B 2OGUA 1NWQA 3IF4A 3U59A 3EFGA 4DCKA 3CCUP 1S72P 1RH5B 3ITKA 4NPFX 2NRGA 2ZYDA 5BVZA 3CCEP 2I1KA 1SFCD 1SQXJ 1OXZA 2E75C 2KSJA 1BDCA 1W5CE 1GDTA 1W2EA 5CHXA 4TLFA 4H44B 1SQXE 1LTGC 3RL0g 1YITP 2W83C 3F89A 2CPBA 1LWUB 5CCGC 1J1DC 2FFDC 1BE3J 1FS0E 4I7ZC 4W80A 2JO1A 1N7SA 3L35A 5AW3B 1N73C 4C7RA 1Q7YQ 4OWFA 1BE3E 4W7ZA 1LTIC 1P84H 3HTKB 2IPPA 5GTHH 1S1CX 1SQPG 1S3JA 1FOSF 3L75G 1KQGB 1EDIA 5BU5A 3AE8C 3B8EB 4U3FG 4C46A 2ZT9C 3V4QA 3NFQA 4L73A 1GMJA 1D7MA 1PGOA 1H88A 1OW7A 3FWNA 3E1IA 3MHVA 3D6YA 3W68A 2N1TC 1L0NJ 5KKZB 2KNCA 3GLMA 1T2KD 1YI2P 2GM4A 1EDKA 2Q3IA 2QE7H 1L0NE 2YKOA 1KZUB 2KLVA 3HE4A 1N7LA 1QL2A 5AVYB 3FXDA 2D2CC 1W2BO 1M1JC 1NAFA 5AW2B 3MGNA 1SQVJ 1FJPA 2DW3A 2WT7B 1SFCC 3VMZA 3L4FA 5AVQB 1FBMA 4OH8B 2P10A 3HD7A 3L70D 1OVRA 1SQVE 2W90A 3S9OA 1RF1C 1NO4A 2PFXA 1Q82Q 3RK2B 1XTGB 2YXRB 1N7SD 3JC22 1GW3A 4JF7A 4WVZA 1JY2P 3G3ZA 2YMKA 2XDJA 1H8AA 3C9IA 2Z5HA 1OW8A 1IK7A 3A3YB 2AXCA 2KP8A 2O01N 2JEEA 4H0LD 3TNUB 2ZVOB 1FZFA 1BCCD 2FKWB 1WMKA 1ZR2A 2QJKB 3U1CA 1LT9C 2OYIC 1RE3A 2KIKA 2V4HA 1SQPJ 5KLVK 1P84E 4EYYQ 5GTHE 1LP1A 1YIJP 3MUDC 2J59M 2W27A 3L75J 1SQPE 2WSEH 4JBZA 1G2CB 1NAYA 2K1AA 1ZLLA 2KOGA 1OVUA 2FYUG 3L75E 2CPSA 3B4SA 5E79H 2WSSH 3WUUA 1KORA 1T2KC 3H1KG 1LTJA 1NTMK 3E7KA 4HYTB 3T97B 2K37A 1P84I 4WY4B 3EWKA 1VQNP 2RH0A 2B87B 1NTMG 1KYOD 1S4XA 1LTTC 3HUSC 4L76A 2OYOA 1GU5A 1Y8AA 3GF3A 2M8RA 3D71A 3HD7D 2C9LY 2R44A 3AE9C 1L0LG 3CWBG 3CC7P 4ZMDA 1YJ9P 1H0TA 1PP9G 3U1AA 3RL0C 4MN4C 2IBZI 1R8EA 1CZQA 3CMAP 2YXQB 3BCCD 1LT1A 4O9BA 3TGUG 1IFIA 1LWUA 1N7SC 3GMAA 2WPQA 2A06G 4U3FD 2C9NY 1CI6B 1HTLC 3BATA 3KDPB 1JNMA 1FC2C 2UWJE 3AE6C 2N9YB 3R4YA 1VQ4P 3ZDMA 1QX8A 3C8VA 3VMXA 3HTKA 3O6QB 5H2FH 1M8OB 2Q6QA 3ABVC 1LGHB 2WITA 4H0LC 1G1JA 3EQ2A 2KI7B 1ZN5A 5KLIB 1FAVA 1MUUA 1SS1A 5APTA 3D70A 1JCCA 2KXPB 2HFED 3RK3E 3CCVP 2W6JH 3AE3C 3CD6P 5CMZA 2ZJSE 1VQKP 1X22A 2IDBA 5AW6B 1KB9E 1EC5A 2Y9YA 5AVWB 4UB6H 2WSEJ 3USSA 4OGQB 3CXHH 5BU8B 2ZXXA 2L5GB 1Y9BA 2E74D 3AEBC 1S5LH 3Q2YA 1ZP0C 1S5LX 1SQXK 2FYUJ 4XFJA 1S9KE 2E76D 2QJYB 3H1KJ 3WUTA 4L74A 3R2PA 4K35A 1AFOA 3VYIA 3PTZA 3CL3D 2FYUE 2M5AB 3B5NC 3IN6A 3H1KE 3MP7B 3VTPC 5CJ4A 3C1LA 3AE4C 3HD7C 5KAIH 2WT7A 3RK3D 1URQB 4H44D 3GF7A 3V6IA 3RGUA 5B5EE 3CCJP 3IAOA 1PPJD 5APQA 1QVGO 1KB9D 4C7NB 4RJTA 3Q5PA 3Q3DA 3AECC 2YNYA 1S2EA 1JY3O 2QG4A 2LR2A 3V2PA 3CWBJ 1HGZA 1T8ZA 1PP9J 2OYHA 1DX7A 1N2DC 1PGPA 2FXOA 2H8PD 5KLVD 3CWBE 1S9KD 1Q81Q 1PP9E 1MFZA 2YO2A 5TISH 1RE4C 4IL6H 4H13B 4IL6X 3KHUA 3TNUA 3V2QA 3VOPA 3CLQA 3WU2H 1RE3C 2W6BA 1MV8A 2JWAA 1L0NK 5APWA 1NTMD 1A02J 1GD2E 1NU1G 1VQLP 3JSVC 5H2FE 5CCHA 4ASVA 4ASWA 2B89A 4IFFA 1OVVA 2K9YA 1RY3A 2WSFJ 1GZLA 2GUSA 1VQPP 3IR9A 3M9BA 1LTJC 2FXMA 2Y9ZA 1T3JA 3RBXA 2J5UA 3UIAA 3D6ZA 1L0LD 1VQ8P 1M90Q 3T97A 1JEKA 1YBKA 4WY4A 2E74C 1L4AB 1SQVK 2B87A 1VL2A 1JY2N 3AEGC 1MZ9A 4UB6E 2E76C 3TGUD 2JJLA 1VDFA 2A06D 3CXHE 1QGKB 4PV1B 2QJPB 3PH0A 2IYOA 1S5LE 3AE5C 1NJIQ 1VQ9P 3VN0A 1NKZB 4QMAA 3FX0A 3Q1MA 3GG2A 4H44C 1K73Q 2YIUB 3RK2D 4GODA 3E1RA 1H0TB 3RK3B 1BGYJ 1HUCA 3KZIH 1LWUC 1SP4A 4LGDE 3FXEA 3VP9A 3CX5H 3P7KA 3CXHI 1JO5A 5KAIE 1SQBG 3H25A 1BGYE 1CI6A 3L74G 2M0BA 3PP5A 2WTYA 2M3EA 2W6AA 4YPCA 1DEEG 4GIFA 1FZGA 5C39A 1PZQA 2YMYA 4AUWA 4YXDC 1SQPK 1YJWP 4EOTA 3O6QA 3L73G 2POHA 3TF5A 1USDA 1ZRTE 5TISE 1NTZJ 4D6TJ 4IL6E 3LIEA 1J1EB 3Q5RA 1SQXD 1K8AQ 1U7JA 1KMIZ 1NTZE 2IBZG 4D6TE 5KKZC 1ZMEC 3SWKA 3H32B 1IK9A 2RMZA 1NU1J 3H1IG 1GK4A 4WY4D 2CK3H 4IFDK 3SWYA 2IFMA 3BRVB 4DT0A 1SQQG 1FZEA 5AVXB 1FZAA 1NU1E 1BE3D 4ZKPA 4R4MA 5AW9B 1E5WA 2QVAA 1JMMA 3MTUE 2XV5A 4EDFA 1KD1Q 2NPSB 2M5AA 2Z5IA 2XKMA 3LW5H 2I8DA 1RF0A 3M91A 1JMBA 1URQA 2AXTH 4PJ0H 2WPVB 3RK2C 2R5DA 4C7NA 3VP8A 2KLUA 1NYHA 1M7LA 1OMIA 2ZYGA 3SFEC 2YKQA 2O3JA 2Y0EA 3V5BA 3A7OA 1FZCA 2OYHB 1L0ND 4LC1A 1HF9A 1K04A 1NVOA 3KZIE 1T3UA 2Q5UA 4Y28J 1SQBJ 3CX5E 4GKGA 3L74J 2QM8A 5APXA 1SQBE 2QJKC 4GOFA 3L74E 2XZRA 2JR8A 3L73J 2IX7C 3H1HJ 1AA0A 1SQVD 1DEBA 3L73E 3CX5I 1FE6A 1FDIA 1K05A 4ZKUA 3H1HE 4OGQD 1J2JB 2FYUK 2AEMA 2Z4EA 2FXPA 3KYQA 1YHQP 1AQTA 4WY4C 3JCUH 1AJYA 3G71P 1L4AA 2QA4P 2PP6A 4HB1A 4Y99B 4PD4H 3H1IJ 5EFWB 3AE2C 3WMM0 2IBZE 1ZXGA 2K3RA 1SQQJ 3N4XA 1URQD 2BCCG 2JWDA 3H1IE 2Q1KA 1KILE 1BSHA 2HYNA 3A0HH 1L0LK 1P84D 4JYBA 4IOIH 2KZJA 1SQQE 3LW5J 4IFMA 4Z1MH 3AE7C 1EZVI 1YTZT 1SQPD 4ZNCA 2KK7A 5KJ7A 1LTSC 3VMAA 1VQMP 2IZ1A 3L75D 1KQSO 1LNQA 2AXTE 1IFDA 1DH3A 1Y47A 4PJ0E 1VPCA 2JKVA 3GHGB 2LKMA 4H13D 1SVFA 2IBZD 1FOSE 2HODA 4RKUJ 5K5GB 1CW5A 1KTMA 1HVVA 5AW4B 1LJ2A 1MKMA 5KLIC 1QEXA 2Y0CA 3CCQP 1X9VA 1YQ3C 3V4WA 1HJBA 1WRGA 2PGDA 4HH2A 4N78E 3OJAB 1IO4A 2E5TA 5APSA 2H43A 3H1LG 1ZV8A 2IFNA 3H1JJ 4OGQC 3H32A 2WWWA 2E5YA 1AVOA 1HH0A 3A5TA
chains in the Genus database with same CATH topology
1HGVA 3M9QA 1GZLA 5AVTB 1LT9B 4Y99C 1H88A 2GUSA 1L4AD 3MD0A 2OYIB 2WSCH 3IR9A 3M9BA 1LTJC 2FXMA 1T3JA 3E1IA 2WZ7A 1JTHB 2ZXEB 3UIAA 1GU4A 2N1TC 3T97A 1T2KD 2GM4A 4WY4A 5APUA 1FJKA 1L4AB 1SQVK 2Q3IA 1JY2O 3P8CE 1JY2N 2OARA 2YKOA 1MZ9A 3LIDA 1KZUB 1NHLA 3M0DA 1A02F 2NPSA 2JJLA 2KLVA 1VDFA 3HE5B 1URQC 3HE4A 4KHXA 1N7LA 1QL2A 4EIJA 5AVYB 1NTKK 5KJ7D 3VN0A 1NKZB 1M1JC 1NAFA 2XU6A 3B5ND 3HUSB 5AW2B 5AVRB 1GL2A 3MGNA 4N3YB 1FJPA 3BASA 3L37A 2WT7B 1WT6A 3RK2D 1SFCC 3VMZA 4GT1A 3L4FA 5AVQB 3GHGC 1FBMA 4OH8B 3RK3B 5AVUB 3HD7A 1HUCA 1LWUC 1SP4A 4LGDE 3OA7A 4LLHA 3VP9A 3P7KA 1IJDB 1RF1C 1JO5A 1NO4A 4DZOA 3RK2B 1XTGB 2HPCB 1GK6A 1CI6A 1FZCB 3PP5A 1N7SD 2WTYA 3V2NA 1GW3A 4I6MC 2A45G 2W6AA 3RL0B 4GIFA 4JF7A 1NTZK 1FZGA 2P2UA 1JY2P 2YMYA 3G3ZA 1RF1A 4AUWA 2A45H 1SQPK 2XDJA 4EOTA 1KILD 1H8AA 2GUVA 3C9IA 2Q9IA 1YTZI 1N7SB 2Z5HA 5CCGA 3CI9A 1AQ5A 2POHA 2FFDA 1HWTC 5KTBA 2WPRA 2YKPA 3A3YB 2KP8A 4N6JA 2XNXA 1N73A 2JEEA 1NU1K 1IFJA 1KILB 2E42A 5AVZB 3MIWA 3TNUB 1FZFA 1N86A 4XA4A 3VMYA 2FKWB 2HLOA 1ZR2A 1EQ7A 3U1CA 1LT9C 2OYIC 1RE3A 1CSBA 3H6PA 3LIEA 2P1JA 5KLVK 1J1EB 2P67A 1KQLA 1JY3P 1GW4A 2J59M 2W27A 2WSFH 3H32B 2WSEH 3M06A 2R3CA 1SLQA 1IK9A 1G2CB 2M3BA 1L4AC 1G1IA 1OWAA 1GK4A 3IFMA 2VRSA 4WY4D 4IFDK 3SWYA 1ZLLA 2KOGA 2IFMA 1Z56A 2CPSA 3BRVB 4M3LA 1T2KC 1FZEA 5AVXB 1FZAA 3P32A 2NPSD 1LTJA 1NTMK 4HYTB 2J58A 4ZKPA 1NH4A 1RF0C 4WY4B 5AW9B 2P7JA 1E5WA 2N1TA 3OAKA 4WB4A 1JMMA 2QM7A 3L36A 4N78D 1LTTC 3KPEA 3MTUE 2XV5A 3HUSC 2HG5D 1NKNA 2NPSB 5AVVB 2Z5IA 2XKMA 1GU5A 3LW5H 3SWFA 1GL2D 4DOJA 1X8YA 1IFMA 3HE4B 5KJ7C 1RF0A 3M91A 3RK3C 2M8RA 4AYCA 1URQA 3TSIA 3V2RA 3HD7D 1GTWA 1KFMA 2C9LY 1JCDA 3BRTB 1SQBK 3RK2C 2R5DA 1GL2B 4I2LC 1FZCC 3B5NB 1M1JA 4C7NA 3VP8A 2O1JA 3HRNA 1M7LA 3U1AA 3II6A 3RL0C 4WBAA 3HD7B 1CZQA 4B86A 2C0WA 1SFCA 3GHGA 3BVHA 3A2AA 2YKQA 4O9BA 1IFIA 3V5BA 1LWUA 3A7OA 1N7SC 2C9NY 2WPQA 1FZCA 2OYHB 3P8CD 1CI6B 1HTLC 3BATA 3KDPB 4LC1A 5CCGD 1ZR4A 1T3UA 2Q5UA 2HODB 1JNMA 2O1KA 2KB7P 4GKGA 5AW1B 1IC2A 1KILC 3I5CA 1H89A 1QL1A 3VMXA 5AW0B 2QM8A 3HTKA 5AW7B 5APXA 1J1DB 2FFDB 5AVSB 1J1EC 2XZRA 1LGHB 5CCHD 2WITA 1LTAC 1IFNA 1G1JA 3EQ2A 1JOCA 1N73B 2IX7C 1ZN5A 2R32A 3TK1A 1FAVA 1MUUA 5APTA 3M9HA 1DEBA 3TYYA 1JCCA 3NMDA 2HFED 2H7HA 1FZBA 3P8MC 4ZKUA 1J2JB 2FYUK 1LT9A 5CMZA 2C0XA 2Z4EA 2OYIA 1SQQK 2R5BA 4RESB 3KYQA 5AW6B 1X79B 1G2CA 1JTHA 3MUDA 2E43A 2BASA 5CJ0A 4WY4C 5AVWB 5AW5B 2A45I 2N1TD 5BU8B 1L4AA 4AQRD 2PP6A 2L5GB 3M0DC 2ZFCA 2NPSC 4Y99B 2MJZA 4I1LA 5APVA 1LTJB 3WMM0 5APYA 1YYCA 1SQXK 1S9KE 3HE5A 4JYCA 2PAJA 2N1TB 2KYVA 2FYZA 3KQGA 1LTBC 3N4XA 1URQD 3R2PA 1AFOA 3VYIA 3CL3D 2HYNA 2N9BA 1GL2C 1PFIA 1HBWA 1L0LK 3B5NC 4JYBA 1FDMA 2WPSA 3HUSA 3N7NA 5AW8B 1FU1A 3VTPC 5CJ4A 4IFMA 1NWQA 3U59A 3EFGA 3HD7C 2WT7A 3RK3D 1URQB 1YTZT 5BVZA 5KJ7A 2Q7CA 2I1KA 1SFCD 1OXZA 2KSJA 1LTSC 2OYHC 3B5NA 2O01H 5APQA 1M1JB 4C7NB 1GDTA 1W2EA 3NTNA 3M0AA 5CHXA 2YNYA 2HPCA 1JY3O 1KFNA 1JUNA 3RL0D 1IFDA 1JY3N 1LTGC 1DH3A 3V2PA 1SFCB 2YO3A 1HGZA 1VPCA 3GHGB 2LKMA 1T8ZA 2OYHA 2CPBA 1LWUB 1DX7A 1N2DC 5CCGC 1SVFA 2H8PD 1J1DC 2FFDC 1FOSE 1RF1B 2HODA 1S9KD 4W80A 1N7SA 3L35A 1CW5A 5AW3B 1HVVA 1MFZA 1N73C 4C7RA 5AW4B 3O8ZA 2YO2A 1RE4C 4W7ZA 1LTIC 1X9VA 3V4WA 1HJBA 1KILA 1WRGA 2IPPA 3HTKB 4HH2A 3TNUA 3V2QA 3VOPA 5CCHC 3CLQA 1RE3C 4N78E 2W6BA 3OJAB 1XTCC 1MV8A 1IO4A 4XE5B 3NXSA 1FOSF 5APSA 1L0NK 1RE4A 5APWA 4W7YA 5BU5A 3B8EB 1A02J 1GD2E 2H43A 2I1JA 1ZV8A 5CCHA 2IFNA 4C46A 4IFFA 3V4QA 3H32A 3NFQA 2WWWA 1HH0A 1NOHA 3A5TA 1RY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZQ A;  4B86 A;  1GZL A;  5AVT B;  3VYI A;  1H88 A;  3MD0 A;  2N9B A;  3A2A A;  3IR9 A;  3M9B A;  1HBW A;  2E42 A;  4JYB A;  5AVZ B;  3V5B A;  3A7O A;  2ZXE B;  3TNU B;  3UIA A;  2WPS A;  1GU4 A;  2WPQ A;  5AW8 B;  2C9N Y;  1CI6 B;  3VTP C;  3VMY A;  3KDP B;  1NWQ A;  4LC1 A;  3T97 A;  2WT7 A;  1T2K D;  2Q5U A;  1JNM A;  5APU A;  1CSB A;  3LIE A;  4GKG A;  2P67 A;  5AW1 B;  2Q7C A;  1KQL A;  2Q3I A;  1OXZ A;  3I5C A;  3LID A;  1H89 A;  3M0D A;  3VMX A;  1A02 F;  2W27 A;  5AW0 B;  5APQ A;  2QM8 A;  3HTK A;  2JJL A;  4C7N B;  5AW7 B;  5APX A;  3NTN A;  3HE5 B;  3M0A A;  2YNY A;  3M06 A;  2R3C A;  1SLQ A;  1G2C B;  5AVS B;  3HE4 A;  1JUN A;  4KHX A;  1OWA A;  2XZR A;  1GK4 A;  1DH3 A;  2VRS A;  2YO3 A;  5AVY B;  2R32 A;  3VN0 A;  1NAF A;  2XU6 A;  3TK1 A;  4M3L A;  1FAV A;  1MUU A;  5APT A;  5AW2 B;  5AVX B;  1T2K C;  5AVR B;  3P32 A;  3MGN A;  3M9H A;  1FOS E;  3TYY A;  4HYT B;  3NMD A;  2H7H A;  3L37 A;  2WT7 B;  1S9K D;  3L35 A;  3VMZ A;  3P8M C;  5AW3 B;  4GT1 A;  5AW9 B;  2P7J A;  3OAK A;  1MFZ A;  5AVQ B;  5AW4 B;  3O8Z A;  5AVU B;  2YO2 A;  2QM7 A;  3L36 A;  1HUC A;  1J2J B;  5CMZ A;  1SP4 A;  2XV5 A;  3V4W A;  3P7K A;  1HJB A;  2R5B A;  4RES B;  5AVV B;  2IPP A;  5AW6 B;  2Z5I A;  4DZO A;  1GU5 A;  3TNU A;  3SWF A;  2E43 A;  2BAS A;  1GK6 A;  1X8Y A;  1CI6 A;  3HE4 B;  5AVW B;  3M91 A;  5AW5 B;  1MV8 A;  1IO4 A;  4AYC A;  2WTY A;  4XE5 B;  3NXS A;  4I6M C;  2W6A A;  1FOS F;  5APS A;  5APW A;  4AQR D;  1GTW A;  2ZFC A;  2C9L Y;  2P2U A;  3B8E B;  1A02 J;  4AUW A;  1GD2 E;  2R5D A;  5APV A;  4EOT A;  4I2L C;  5APY A;  1H8A A;  4C46 A;  3A5T A;  1YYC A;  4C7N A;  2Z5H A;  1S9K E;  3HE5 A;  4JYC A;  3V4Q A;  3NFQ A;  2WWW A;  1HWT C;  3KQG A;  2WPR A;  3A3Y B;  2KP8 A; 
#chains in the Genus database with same CATH topology
 3M9Q A;  1L4A D;  1VF5 B;  2WSC H;  3H1J E;  2ZXE B;  2QJY C;  4UB8 H;  1Q86 Q;  5CBN A;  1DD3 A;  4PV1 D;  1OFC X;  1M56 D;  2FYN B;  3P8C E;  5E79 E;  2OAR A;  3LID A;  1NHL A;  3JCU E;  2NPS A;  3HE5 B;  1URQ C;  1BGY G;  4PD4 E;  5KJ7 D;  3CC2 P;  3L71 J;  2BCC J;  5AVR B;  3BAS A;  3L37 A;  1Q2N A;  2FBW C;  3A0H E;  1ZW0 A;  3L71 E;  2BCC E;  1QLE D;  2K9J A;  3GW6 A;  2HPC B;  1GK6 A;  1NTK J;  4PD4 I;  1FZC B;  2ZAE B;  4I6M C;  2A45 G;  4H13 C;  1NTZ K;  1NTK E;  1RF1 A;  2A45 H;  1NTZ G;  4D6T G;  1YTZ I;  2FYU D;  1AQ5 A;  5KTB A;  3CPW O;  3H1K D;  2WPR A;  2Q3E A;  4N6J A;  1L2P A;  1NU1 K;  1IFJ A;  1KIL B;  2QIW A;  5AVZ B;  4YXW H;  3VMY A;  3L70 G;  2HLO A;  1FDO A;  1CSB A;  2P67 A;  1RQU A;  1GW4 A;  3I56 P;  4NPE A;  1L4A C;  1G1I A;  1U57 A;  2BEZ F;  1OWA A;  3H1L J;  4BRY B;  3IFM A;  3CWB D;  1T6A A;  2BEQ D;  4A7P A;  1PP9 D;  3EFF K;  4M3L A;  2ZVN B;  3P32 A;  2NPS D;  3H1L E;  4PV1 C;  4WWI A;  2QJP C;  2J58 A;  2XND H;  1NH4 A;  3AEE C;  3L36 A;  3G9R A;  3FWL A;  3KPE A;  4UB8 E;  2WMM A;  5AVV B;  1YQ4 C;  3KXD A;  2YIU C;  3SWF A;  1X8Y A;  1IFM A;  3TDK A;  5KJ7 C;  3RK3 C;  4AYC A;  3TSI A;  1KN7 A;  4JQ0 D;  1JCD A;  1SQB K;  1GL2 B;  3S1K A;  3HRN A;  3II6 A;  4WBA A;  1USE A;  3GHG A;  3BVH A;  1OW6 A;  2E75 B;  1X0T A;  3H1L D;  1ZR4 A;  2HOD B;  2KB7 P;  3CXH D;  1KYO H;  3H1H G;  4DJG A;  3I5C A;  1H89 A;  1RHZ B;  3AE1 C;  1J1D B;  2FFD B;  1J1E C;  4I7Z B;  5CCH D;  1JOC A;  1N73 B;  2R32 A;  4BXL A;  1EZV G;  3TK1 A;  1AVY A;  3TYY A;  2H88 C;  3WU2 E;  2H7H A;  1FZB A;  3BCC G;  2H89 C;  1BGY D;  1QVF O;  3AEA C;  3L70 J;  1SQQ K;  4RES B;  3CCR P;  2OTJ P;  2BAS A;  2L91 A;  5AW5 B;  2QRX A;  3L70 E;  2A45 I;  3OW2 O;  2ZT9 B;  3CCM P;  3PRJ A;  2IZ0 A;  2NPS C;  3A0B H;  2OQQ A;  5APY A;  1YYC A;  1JB0 J;  2MKV A;  5GTI H;  3HE5 A;  2PAJ A;  2N1T B;  5M1B A;  1N8R Q;  1ZRT D;  1LTB C;  3QH9 A;  1BSN A;  2G8Y A;  1ZOY C;  1PFI A;  1HBW A;  3N7N A;  1DIP A;  1FU1 A;  1BCC J;  2V7Q H;  1NTZ D;  4D6T D;  3SFD C;  1PGQ A;  2G3A A;  2Q7C A;  2KUB A;  1UII A;  2AEF A;  4TT3 H;  1BCC E;  2OYH C;  3B5N A;  2D2C B;  2O01 H;  2ZYA A;  2K9J B;  1M1J B;  3S4R A;  3NTN A;  1JM0 A;  3M0A A;  3SSU A;  2HPC A;  1EDL A;  1KFN A;  1JUN A;  1NU1 D;  3RL0 D;  1JY3 N;  1MFT A;  1SFC B;  1DD4 A;  2YO3 A;  1KV4 A;  1VQO P;  4L75 A;  4R4L A;  1RF1 B;  4KT0 J;  1OZH A;  5B66 H;  3QWO C;  2OTL P;  3L72 G;  1VQ5 P;  4HKZ H;  3O8Z A;  1R5L A;  1KIL A;  3H1J G;  5DJU B;  3G4S P;  5CCH C;  1KYO E;  1XTC C;  4XE5 B;  3NXS A;  1PPJ G;  1RE4 A;  1VQ6 P;  4W7Y A;  1VF5 D;  2I1J A;  1KB9 H;  1AV1 A;  1NOH A;  2GA1 A;  1HGV A;  4BRY A;  1PGJ A;  1LT9 B;  3AEF C;  4Y99 C;  5AVT B;  5KLV G;  2RKL A;  3MD0 A;  2OYI B;  1U7M A;  3BCC J;  4KJM A;  3CX5 D;  2WZ7 A;  1JTH B;  1EZV E;  1KYO I;  1GU4 A;  1KQF B;  4U3F J;  2B88 A;  3FGA D;  2ITA A;  3BCC E;  4BWN A;  5APU A;  1FJK A;  1SQB D;  4GOE A;  2P58 A;  1JY2 O;  3L74 D;  4U3F E;  3L71 G;  3M0D A;  3CC4 P;  1A02 F;  1EXI A;  2LXC B;  1YJN P;  1KC8 Q;  2AEJ A;  2KS1 B;  4KHX A;  4EIJ A;  3A0B E;  1Q90 D;  1NTK K;  3L73 D;  5B5E H;  3H1H D;  2XU6 A;  5GTI E;  3B5N D;  3HUS B;  1NTK G;  1GL2 A;  4N3Y B;  3AED C;  2V7Q J;  1WT6 A;  4GT1 A;  3GHG C;  5AVU B;  3CCL P;  1IZN B;  3OA7 A;  4LLH A;  1IJD B;  2O01 J;  4DZO A;  1EZV D;  1VQ7 P;  3RBZ A;  2NZ2 A;  1M1K Q;  3V2N A;  4OVN F;  3RL0 B;  2P2U A;  3H1I D;  3W67 A;  1M57 D;  2R3S A;  1KIL D;  1EDJ A;  2GUV A;  2Q9I A;  1OIP A;  1N7S B;  5CCG A;  3CI9 A;  2FFD A;  1HWT C;  1SQQ D;  2YKP A;  5KAF H;  2XNX A;  2W8Z A;  4RO0 A;  3WUV A;  1N73 A;  1K9M Q;  3L72 J;  2E42 A;  3MIW A;  5B66 E;  1N86 A;  3PHL A;  2QEX P;  4XA4 A;  2OTK E;  1EQ7 A;  1VF5 C;  3H6P A;  2P1J A;  3L72 E;  1KQL A;  4NPD A;  4H0L B;  1JY3 P;  3F5H A;  4GDO A;  1BDD A;  4EI2 A;  1PIX A;  1E79 H;  1PL5 A;  2WSF H;  3PJS K;  3M06 A;  1R5S A;  2R3C A;  1SLQ A;  2M3B A;  4K3A A;  2VRS A;  2FYN C;  1PPJ E;  1Z56 A;  2WVR A;  3G6E P;  5KLV J;  2KNC B;  2HR3 A;  1RF0 C;  2P7J A;  2N1T A;  3OAK A;  2FY8 A;  2IYP A;  2KZI A;  2QSI A;  4WB4 A;  2QM7 A;  4N78 D;  2KSE A;  5KLV E;  2HG5 D;  1NKN A;  2JDI H;  3B71 A;  1GL2 D;  4DOJ A;  2WQY C;  3HE4 B;  1SQX G;  2B9B A;  1IFP A;  3V2R A;  1KB9 I;  3L72 D;  1GTW A;  1NTM J;  1KFM A;  3BRT B;  2PRR A;  4I2L C;  2E75 D;  3H1J D;  3B5N B;  1M1J A;  1FZC C;  2O1J A;  1NTM E;  3HD7 B;  4B86 A;  2C0W A;  1SFC A;  2SPZ A;  1BE3 G;  3A2A A;  3CCS P;  5CBO A;  3P8C D;  1L0L J;  2JP3 A;  5CCG D;  2O1K A;  1NGM B;  5AW1 B;  1IC2 A;  1KIL C;  3I55 P;  3MZW B;  1OX3 A;  4PD4 D;  1L0L E;  1QL1 A;  5AW0 B;  3TGU J;  1HJ0 A;  2LXB A;  5AW7 B;  5AVS B;  5L8R J;  2K88 A;  1LTA C;  1IFN A;  4CPG A;  3TGU E;  2A06 E;  3L71 D;  1PV3 A;  2BCC D;  3M9H A;  3NMD A;  3PLN A;  5KAF E;  4HJG H;  3P8M C;  3K5B A;  2ZT9 D;  1LP1 B;  1L0N G;  1LT9 A;  2C0X A;  2OYI A;  1EXJ A;  2R5B A;  3Q5S A;  1X79 B;  1G2C A;  1JTH A;  4JPZ B;  5DJT B;  2WSC J;  3MUD A;  1NTK D;  2E43 A;  5CJ0 A;  2N1T D;  2RN0 A;  3CME P;  4AQR D;  3M0D C;  2ZFC A;  2MJZ A;  4I1L A;  5APV A;  1LTJ B;  5TJH A;  1BCC G;  4YTP C;  2KS1 A;  4JYC A;  4U7J A;  2KYV A;  2FYZ A;  3KQG A;  1SQV G;  2E74 B;  1UIX A;  2N9B A;  1GL2 C;  1RQV A;  2Y0D A;  1FDM A;  1TU3 F;  2WPS A;  3HUS A;  5AW8 B;  2D2C D;  2E76 B;  2OGU A;  1NWQ A;  3IF4 A;  3U59 A;  3EFG A;  4DCK A;  3CCU P;  1S72 P;  1RH5 B;  3ITK A;  4NPF X;  2NRG A;  2ZYD A;  5BVZ A;  3CCE P;  2I1K A;  1SFC D;  1SQX J;  1OXZ A;  2E75 C;  2KSJ A;  1BDC A;  1W5C E;  1GDT A;  1W2E A;  5CHX A;  4TLF A;  4H44 B;  1SQX E;  1LTG C;  3RL0 g;  1YIT P;  2W83 C;  3F89 A;  2CPB A;  1LWU B;  5CCG C;  1J1D C;  2FFD C;  1BE3 J;  1FS0 E;  4I7Z C;  4W80 A;  2JO1 A;  1N7S A;  3L35 A;  5AW3 B;  1N73 C;  4C7R A;  1Q7Y Q;  4OWF A;  1BE3 E;  4W7Z A;  1LTI C;  1P84 H;  3HTK B;  2IPP A;  5GTH H;  1S1C X;  1SQP G;  1S3J A;  1FOS F;  3L75 G;  1KQG B;  1EDI A;  5BU5 A;  3AE8 C;  3B8E B;  4U3F G;  4C46 A;  2ZT9 C;  3V4Q A;  3NFQ A;  4L73 A;  1GMJ A;  1D7M A;  1PGO A;  1H88 A;  1OW7 A;  3FWN A;  3E1I A;  3MHV A;  3D6Y A;  3W68 A;  2N1T C;  1L0N J;  5KKZ B;  2KNC A;  3GLM A;  1T2K D;  1YI2 P;  2GM4 A;  1EDK A;  2Q3I A;  2QE7 H;  1L0N E;  2YKO A;  1KZU B;  2KLV A;  3HE4 A;  1N7L A;  1QL2 A;  5AVY B;  3FXD A;  2D2C C;  1W2B O;  1M1J C;  1NAF A;  5AW2 B;  3MGN A;  1SQV J;  1FJP A;  2DW3 A;  2WT7 B;  1SFC C;  3VMZ A;  3L4F A;  5AVQ B;  1FBM A;  4OH8 B;  2P10 A;  3HD7 A;  3L70 D;  1OVR A;  1SQV E;  2W90 A;  3S9O A;  1RF1 C;  1NO4 A;  2PFX A;  1Q82 Q;  3RK2 B;  1XTG B;  2YXR B;  1N7S D;  3JC2 2;  1GW3 A;  4JF7 A;  4WVZ A;  1JY2 P;  3G3Z A;  2YMK A;  2XDJ A;  1H8A A;  3C9I A;  2Z5H A;  1OW8 A;  1IK7 A;  3A3Y B;  2AXC A;  2KP8 A;  2O01 N;  2JEE A;  4H0L D;  3TNU B;  2ZVO B;  1FZF A;  1BCC D;  2FKW B;  1WMK A;  1ZR2 A;  2QJK B;  3U1C A;  1LT9 C;  2OYI C;  1RE3 A;  2KIK A;  2V4H A;  1SQP J;  5KLV K;  1P84 E;  4EYY Q;  5GTH E;  1LP1 A;  1YIJ P;  3MUD C;  2J59 M;  2W27 A;  3L75 J;  1SQP E;  2WSE H;  4JBZ A;  1G2C B;  1NAY A;  2K1A A;  1ZLL A;  2KOG A;  1OVU A;  2FYU G;  3L75 E;  2CPS A;  3B4S A;  5E79 H;  2WSS H;  3WUU A;  1KOR A;  1T2K C;  3H1K G;  1LTJ A;  1NTM K;  3E7K A;  4HYT B;  3T97 B;  2K37 A;  1P84 I;  4WY4 B;  3EWK A;  1VQN P;  2RH0 A;  2B87 B;  1NTM G;  1KYO D;  1S4X A;  1LTT C;  3HUS C;  4L76 A;  2OYO A;  1GU5 A;  1Y8A A;  3GF3 A;  2M8R A;  3D71 A;  3HD7 D;  2C9L Y;  2R44 A;  3AE9 C;  1L0L G;  3CWB G;  3CC7 P;  4ZMD A;  1YJ9 P;  1H0T A;  1PP9 G;  3U1A A;  3RL0 C;  4MN4 C;  2IBZ I;  1R8E A;  1CZQ A;  3CMA P;  2YXQ B;  3BCC D;  1LT1 A;  4O9B A;  3TGU G;  1IFI A;  1LWU A;  1N7S C;  3GMA A;  2WPQ A;  2A06 G;  4U3F D;  2C9N Y;  1CI6 B;  1HTL C;  3BAT A;  3KDP B;  1JNM A;  1FC2 C;  2UWJ E;  3AE6 C;  2N9Y B;  3R4Y A;  1VQ4 P;  3ZDM A;  1QX8 A;  3C8V A;  3VMX A;  3HTK A;  3O6Q B;  5H2F H;  1M8O B;  2Q6Q A;  3ABV C;  1LGH B;  2WIT A;  4H0L C;  1G1J A;  3EQ2 A;  2KI7 B;  1ZN5 A;  5KLI B;  1FAV A;  1MUU A;  1SS1 A;  5APT A;  3D70 A;  1JCC A;  2KXP B;  2HFE D;  3RK3 E;  3CCV P;  2W6J H;  3AE3 C;  3CD6 P;  5CMZ A;  2ZJS E;  1VQK P;  1X22 A;  2IDB A;  5AW6 B;  1KB9 E;  1EC5 A;  2Y9Y A;  5AVW B;  4UB6 H;  2WSE J;  3USS A;  4OGQ B;  3CXH H;  5BU8 B;  2ZXX A;  2L5G B;  1Y9B A;  2E74 D;  3AEB C;  1S5L H;  3Q2Y A;  1ZP0 C;  1S5L X;  1SQX K;  2FYU J;  4XFJ A;  1S9K E;  2E76 D;  2QJY B;  3H1K J;  3WUT A;  4L74 A;  3R2P A;  4K35 A;  1AFO A;  3VYI A;  3PTZ A;  3CL3 D;  2FYU E;  2M5A B;  3B5N C;  3IN6 A;  3H1K E;  3MP7 B;  3VTP C;  5CJ4 A;  3C1L A;  3AE4 C;  3HD7 C;  5KAI H;  2WT7 A;  3RK3 D;  1URQ B;  4H44 D;  3GF7 A;  3V6I A;  3RGU A;  5B5E E;  3CCJ P;  3IAO A;  1PPJ D;  5APQ A;  1QVG O;  1KB9 D;  4C7N B;  4RJT A;  3Q5P A;  3Q3D A;  3AEC C;  2YNY A;  1S2E A;  1JY3 O;  2QG4 A;  2LR2 A;  3V2P A;  3CWB J;  1HGZ A;  1T8Z A;  1PP9 J;  2OYH A;  1DX7 A;  1N2D C;  1PGP A;  2FXO A;  2H8P D;  5KLV D;  3CWB E;  1S9K D;  1Q81 Q;  1PP9 E;  1MFZ A;  2YO2 A;  5TIS H;  1RE4 C;  4IL6 H;  4H13 B;  4IL6 X;  3KHU A;  3TNU A;  3V2Q A;  3VOP A;  3CLQ A;  3WU2 H;  1RE3 C;  2W6B A;  1MV8 A;  2JWA A;  1L0N K;  5APW A;  1NTM D;  1A02 J;  1GD2 E;  1NU1 G;  1VQL P;  3JSV C;  5H2F E;  5CCH A;  4ASV A;  4ASW A;  2B89 A;  4IFF A;  1OVV A;  2K9Y A;  1RY3 A;  2WSF J;  1GZL A;  2GUS A;  1VQP P;  3IR9 A;  3M9B A;  1LTJ C;  2FXM A;  2Y9Z A;  1T3J A;  3RBX A;  2J5U A;  3UIA A;  3D6Z A;  1L0L D;  1VQ8 P;  1M90 Q;  3T97 A;  1JEK A;  1YBK A;  4WY4 A;  2E74 C;  1L4A B;  1SQV K;  2B87 A;  1VL2 A;  1JY2 N;  3AEG C;  1MZ9 A;  4UB6 E;  2E76 C;  3TGU D;  2JJL A;  1VDF A;  2A06 D;  3CXH E;  1QGK B;  4PV1 B;  2QJP B;  3PH0 A;  2IYO A;  1S5L E;  3AE5 C;  1NJI Q;  1VQ9 P;  3VN0 A;  1NKZ B;  4QMA A;  3FX0 A;  3Q1M A;  3GG2 A;  4H44 C;  1K73 Q;  2YIU B;  3RK2 D;  4GOD A;  3E1R A;  1H0T B;  3RK3 B;  1BGY J;  1HUC A;  3KZI H;  1LWU C;  1SP4 A;  4LGD E;  3FXE A;  3VP9 A;  3CX5 H;  3P7K A;  3CXH I;  1JO5 A;  5KAI E;  1SQB G;  3H25 A;  1BGY E;  1CI6 A;  3L74 G;  2M0B A;  3PP5 A;  2WTY A;  2M3E A;  2W6A A;  4YPC A;  1DEE G;  4GIF A;  1FZG A;  5C39 A;  1PZQ A;  2YMY A;  4AUW A;  4YXD C;  1SQP K;  1YJW P;  4EOT A;  3O6Q A;  3L73 G;  2POH A;  3TF5 A;  1USD A;  1ZRT E;  5TIS E;  1NTZ J;  4D6T J;  4IL6 E;  3LIE A;  1J1E B;  3Q5R A;  1SQX D;  1K8A Q;  1U7J A;  1KMI Z;  1NTZ E;  2IBZ G;  4D6T E;  5KKZ C;  1ZME C;  3SWK A;  3H32 B;  1IK9 A;  2RMZ A;  1NU1 J;  3H1I G;  1GK4 A;  4WY4 D;  2CK3 H;  4IFD K;  3SWY A;  2IFM A;  3BRV B;  4DT0 A;  1SQQ G;  1FZE A;  5AVX B;  1FZA A;  1NU1 E;  1BE3 D;  4ZKP A;  4R4M A;  5AW9 B;  1E5W A;  2QVA A;  1JMM A;  3MTU E;  2XV5 A;  4EDF A;  1KD1 Q;  2NPS B;  2M5A A;  2Z5I A;  2XKM A;  3LW5 H;  2I8D A;  1RF0 A;  3M91 A;  1JMB A;  1URQ A;  2AXT H;  4PJ0 H;  2WPV B;  3RK2 C;  2R5D A;  4C7N A;  3VP8 A;  2KLU A;  1NYH A;  1M7L A;  1OMI A;  2ZYG A;  3SFE C;  2YKQ A;  2O3J A;  2Y0E A;  3V5B A;  3A7O A;  1FZC A;  2OYH B;  1L0N D;  4LC1 A;  1HF9 A;  1K04 A;  1NVO A;  3KZI E;  1T3U A;  2Q5U A;  4Y28 J;  1SQB J;  3CX5 E;  4GKG A;  3L74 J;  2QM8 A;  5APX A;  1SQB E;  2QJK C;  4GOF A;  3L74 E;  2XZR A;  2JR8 A;  3L73 J;  2IX7 C;  3H1H J;  1AA0 A;  1SQV D;  1DEB A;  3L73 E;  3CX5 I;  1FE6 A;  1FDI A;  1K05 A;  4ZKU A;  3H1H E;  4OGQ D;  1J2J B;  2FYU K;  2AEM A;  2Z4E A;  2FXP A;  3KYQ A;  1YHQ P;  1AQT A;  4WY4 C;  3JCU H;  1AJY A;  3G71 P;  1L4A A;  2QA4 P;  2PP6 A;  4HB1 A;  4Y99 B;  4PD4 H;  3H1I J;  5EFW B;  3AE2 C;  3WMM 0;  2IBZ E;  1ZXG A;  2K3R A;  1SQQ J;  3N4X A;  1URQ D;  2BCC G;  2JWD A;  3H1I E;  2Q1K A;  1KIL E;  1BSH A;  2HYN A;  3A0H H;  1L0L K;  1P84 D;  4JYB A;  4IOI H;  2KZJ A;  1SQQ E;  3LW5 J;  4IFM A;  4Z1M H;  3AE7 C;  1EZV I;  1YTZ T;  1SQP D;  4ZNC A;  2KK7 A;  5KJ7 A;  1LTS C;  3VMA A;  1VQM P;  2IZ1 A;  3L75 D;  1KQS O;  1LNQ A;  2AXT E;  1IFD A;  1DH3 A;  1Y47 A;  4PJ0 E;  1VPC A;  2JKV A;  3GHG B;  2LKM A;  4H13 D;  1SVF A;  2IBZ D;  1FOS E;  2HOD A;  4RKU J;  5K5G B;  1CW5 A;  1KTM A;  1HVV A;  5AW4 B;  1LJ2 A;  1MKM A;  5KLI C;  1QEX A;  2Y0C A;  3CCQ P;  1X9V A;  1YQ3 C;  3V4W A;  1HJB A;  1WRG A;  2PGD A;  4HH2 A;  4N78 E;  3OJA B;  1IO4 A;  2E5T A;  5APS A;  2H43 A;  3H1L G;  1ZV8 A;  2IFN A;  3H1J J;  4OGQ C;  3H32 A;  2WWW A;  2E5Y A;  1AVO A;  1HH0 A;  3A5T A; 
#chains in the Genus database with same CATH homology
 1HGV A;  3M9Q A;  1GZL A;  5AVT B;  1LT9 B;  4Y99 C;  1H88 A;  2GUS A;  1L4A D;  3MD0 A;  2OYI B;  2WSC H;  3IR9 A;  3M9B A;  1LTJ C;  2FXM A;  1T3J A;  3E1I A;  2WZ7 A;  1JTH B;  2ZXE B;  3UIA A;  1GU4 A;  2N1T C;  3T97 A;  1T2K D;  2GM4 A;  4WY4 A;  5APU A;  1FJK A;  1L4A B;  1SQV K;  2Q3I A;  1JY2 O;  3P8C E;  1JY2 N;  2OAR A;  2YKO A;  1MZ9 A;  3LID A;  1KZU B;  1NHL A;  3M0D A;  1A02 F;  2NPS A;  2JJL A;  2KLV A;  1VDF A;  3HE5 B;  1URQ C;  3HE4 A;  4KHX A;  1N7L A;  1QL2 A;  4EIJ A;  5AVY B;  1NTK K;  5KJ7 D;  3VN0 A;  1NKZ B;  1M1J C;  1NAF A;  2XU6 A;  3B5N D;  3HUS B;  5AW2 B;  5AVR B;  1GL2 A;  3MGN A;  4N3Y B;  1FJP A;  3BAS A;  3L37 A;  2WT7 B;  1WT6 A;  3RK2 D;  1SFC C;  3VMZ A;  4GT1 A;  3L4F A;  5AVQ B;  3GHG C;  1FBM A;  4OH8 B;  3RK3 B;  5AVU B;  3HD7 A;  1HUC A;  1LWU C;  1SP4 A;  4LGD E;  3OA7 A;  4LLH A;  3VP9 A;  3P7K A;  1IJD B;  1RF1 C;  1JO5 A;  1NO4 A;  4DZO A;  3RK2 B;  1XTG B;  2HPC B;  1GK6 A;  1CI6 A;  1FZC B;  3PP5 A;  1N7S D;  2WTY A;  3V2N A;  1GW3 A;  4I6M C;  2A45 G;  2W6A A;  3RL0 B;  4GIF A;  4JF7 A;  1NTZ K;  1FZG A;  2P2U A;  1JY2 P;  2YMY A;  3G3Z A;  1RF1 A;  4AUW A;  2A45 H;  1SQP K;  2XDJ A;  4EOT A;  1KIL D;  1H8A A;  2GUV A;  3C9I A;  2Q9I A;  1YTZ I;  1N7S B;  2Z5H A;  5CCG A;  3CI9 A;  1AQ5 A;  2POH A;  2FFD A;  1HWT C;  5KTB A;  2WPR A;  2YKP A;  3A3Y B;  2KP8 A;  4N6J A;  2XNX A;  1N73 A;  2JEE A;  1NU1 K;  1IFJ A;  1KIL B;  2E42 A;  5AVZ B;  3MIW A;  3TNU B;  1FZF A;  1N86 A;  4XA4 A;  3VMY A;  2FKW B;  2HLO A;  1ZR2 A;  1EQ7 A;  3U1C A;  1LT9 C;  2OYI C;  1RE3 A;  1CSB A;  3H6P A;  3LIE A;  2P1J A;  5KLV K;  1J1E B;  2P67 A;  1KQL A;  1JY3 P;  1GW4 A;  2J59 M;  2W27 A;  2WSF H;  3H32 B;  2WSE H;  3M06 A;  2R3C A;  1SLQ A;  1IK9 A;  1G2C B;  2M3B A;  1L4A C;  1G1I A;  1OWA A;  1GK4 A;  3IFM A;  2VRS A;  4WY4 D;  4IFD K;  3SWY A;  1ZLL A;  2KOG A;  2IFM A;  1Z56 A;  2CPS A;  3BRV B;  4M3L A;  1T2K C;  1FZE A;  5AVX B;  1FZA A;  3P32 A;  2NPS D;  1LTJ A;  1NTM K;  4HYT B;  2J58 A;  4ZKP A;  1NH4 A;  1RF0 C;  4WY4 B;  5AW9 B;  2P7J A;  1E5W A;  2N1T A;  3OAK A;  4WB4 A;  1JMM A;  2QM7 A;  3L36 A;  4N78 D;  1LTT C;  3KPE A;  3MTU E;  2XV5 A;  3HUS C;  2HG5 D;  1NKN A;  2NPS B;  5AVV B;  2Z5I A;  2XKM A;  1GU5 A;  3LW5 H;  3SWF A;  1GL2 D;  4DOJ A;  1X8Y A;  1IFM A;  3HE4 B;  5KJ7 C;  1RF0 A;  3M91 A;  3RK3 C;  2M8R A;  4AYC A;  1URQ A;  3TSI A;  3V2R A;  3HD7 D;  1GTW A;  1KFM A;  2C9L Y;  1JCD A;  3BRT B;  1SQB K;  3RK2 C;  2R5D A;  1GL2 B;  4I2L C;  1FZC C;  3B5N B;  1M1J A;  4C7N A;  3VP8 A;  2O1J A;  3HRN A;  1M7L A;  3U1A A;  3II6 A;  3RL0 C;  4WBA A;  3HD7 B;  1CZQ A;  4B86 A;  2C0W A;  1SFC A;  3GHG A;  3BVH A;  3A2A A;  2YKQ A;  4O9B A;  1IFI A;  3V5B A;  1LWU A;  3A7O A;  1N7S C;  2C9N Y;  2WPQ A;  1FZC A;  2OYH B;  3P8C D;  1CI6 B;  1HTL C;  3BAT A;  3KDP B;  4LC1 A;  5CCG D;  1ZR4 A;  1T3U A;  2Q5U A;  2HOD B;  1JNM A;  2O1K A;  2KB7 P;  4GKG A;  5AW1 B;  1IC2 A;  1KIL C;  3I5C A;  1H89 A;  1QL1 A;  3VMX A;  5AW0 B;  2QM8 A;  3HTK A;  5AW7 B;  5APX A;  1J1D B;  2FFD B;  5AVS B;  1J1E C;  2XZR A;  1LGH B;  5CCH D;  2WIT A;  1LTA C;  1IFN A;  1G1J A;  3EQ2 A;  1JOC A;  1N73 B;  2IX7 C;  1ZN5 A;  2R32 A;  3TK1 A;  1FAV A;  1MUU A;  5APT A;  3M9H A;  1DEB A;  3TYY A;  1JCC A;  3NMD A;  2HFE D;  2H7H A;  1FZB A;  3P8M C;  4ZKU A;  1J2J B;  2FYU K;  1LT9 A;  5CMZ A;  2C0X A;  2Z4E A;  2OYI A;  1SQQ K;  2R5B A;  4RES B;  3KYQ A;  5AW6 B;  1X79 B;  1G2C A;  1JTH A;  3MUD A;  2E43 A;  2BAS A;  5CJ0 A;  4WY4 C;  5AVW B;  5AW5 B;  2A45 I;  2N1T D;  5BU8 B;  1L4A A;  4AQR D;  2PP6 A;  2L5G B;  3M0D C;  2ZFC A;  2NPS C;  4Y99 B;  2MJZ A;  4I1L A;  5APV A;  1LTJ B;  3WMM 0;  5APY A;  1YYC A;  1SQX K;  1S9K E;  3HE5 A;  4JYC A;  2PAJ A;  2N1T B;  2KYV A;  2FYZ A;  3KQG A;  1LTB C;  3N4X A;  1URQ D;  3R2P A;  1AFO A;  3VYI A;  3CL3 D;  2HYN A;  2N9B A;  1GL2 C;  1PFI A;  1HBW A;  1L0L K;  3B5N C;  4JYB A;  1FDM A;  2WPS A;  3HUS A;  3N7N A;  5AW8 B;  1FU1 A;  3VTP C;  5CJ4 A;  4IFM A;  1NWQ A;  3U59 A;  3EFG A;  3HD7 C;  2WT7 A;  3RK3 D;  1URQ B;  1YTZ T;  5BVZ A;  5KJ7 A;  2Q7C A;  2I1K A;  1SFC D;  1OXZ A;  2KSJ A;  1LTS C;  2OYH C;  3B5N A;  2O01 H;  5APQ A;  1M1J B;  4C7N B;  1GDT A;  1W2E A;  3NTN A;  3M0A A;  5CHX A;  2YNY A;  2HPC A;  1JY3 O;  1KFN A;  1JUN A;  3RL0 D;  1IFD A;  1JY3 N;  1LTG C;  1DH3 A;  3V2P A;  1SFC B;  2YO3 A;  1HGZ A;  1VPC A;  3GHG B;  2LKM A;  1T8Z A;  2OYH A;  2CPB A;  1LWU B;  1DX7 A;  1N2D C;  5CCG C;  1SVF A;  2H8P D;  1J1D C;  2FFD C;  1FOS E;  1RF1 B;  2HOD A;  1S9K D;  4W80 A;  1N7S A;  3L35 A;  1CW5 A;  5AW3 B;  1HVV A;  1MFZ A;  1N73 C;  4C7R A;  5AW4 B;  3O8Z A;  2YO2 A;  1RE4 C;  4W7Z A;  1LTI C;  1X9V A;  3V4W A;  1HJB A;  1KIL A;  1WRG A;  2IPP A;  3HTK B;  4HH2 A;  3TNU A;  3V2Q A;  3VOP A;  5CCH C;  3CLQ A;  1RE3 C;  4N78 E;  2W6B A;  3OJA B;  1XTC C;  1MV8 A;  1IO4 A;  4XE5 B;  3NXS A;  1FOS F;  5APS A;  1L0N K;  1RE4 A;  5APW A;  4W7Y A;  5BU5 A;  3B8E B;  1A02 J;  1GD2 E;  2H43 A;  2I1J A;  1ZV8 A;  5CCH A;  2IFN A;  4C46 A;  4IFF A;  3V4Q A;  3H32 A;  3NFQ A;  2WWW A;  1HH0 A;  1NOH A;  3A5T A;  1RY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...