2WPQA

Salmonella enterica sada 479-519 fused to gcn4 adaptors (sadak3, in- register fusion)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
99
structure length
99
Chain Sequence
MKQIEDKIEEILSKIYHIENEIARIKKLIFDTNEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSMKQIEDKIEEILSKIYHIENEIARIKKLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 48
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wpqA00
3M9HA 2Q3IA 5AW7B 3M06A 3M0AA 2E43A 3NFQA 1JUNA 2R5BA 5APTA 2R5DA 3HE4B 3MD0A 4C7NA 2E42A 2P7JA 5AW6B 2H7HA 3P8MC 2VRSA 1S9KE 1GU5A 1FOSE 3NTNA 1H88A 3V4QA 5APXA 4EOTA 4LC1A 1YYCA 4C46A 3A7OA 1MUUA 1HBWA 5AVXB 1T2KC 3L37A 1T2KD 3L35A 3VMZA 4DZOA 1J2JB 4RESB 4B86A 1OWAA 2KP8A 3HTKA 2Q5UA 4C7NB 5APSA 2WPSA 1CI6A 1NAFA 3A2AA 2W27A 1CSBA 3MGNA 4XE5B 3M91A 1H8AA 3SWFA 2YO2A 2BASA 1HWTC 2WPQA 3A5TA 2C9LY 2XZRA 3O8ZA 5AW2B 3VMYA 3VTPC 1KQLA 3LIDA 3I5CA 1GZLA 3TNUB 1CZQA 3HE5B 5AW0B 2WTYA 3L36A 1OXZA 1CI6B 3M0DA 2P67A 4M3LA 3V4WA 5AW9B 4AUWA 2ZXEB 1MV8A 1GU4A 5APWA 1S9KD 2P2UA 5AW1B 2R3CA 4GT1A 5AVZB 2YNYA 1G2CB 1DH3A 2C9NY 4JYCA 3KDPB 3NMDA 2WWWA 2WT7A 1HUCA 3TYYA 5APUA 3V5BA 4HYTB 1FAVA 3M9BA 1IO4A 1A02J 3P7KA 2Q7CA 1NWQA 1GK6A 5AW8B 3HE4A 3A3YB 3VN0A 5AVSB 4I2LC 2Z5HA 2Z5IA 2ZFCA 3NXSA 2N9BA 5APVA 3VMXA 4JYBA 5AVUB 3T97A 5CMZA 5AVRB 1H89A 1A02F 4AYCA 1GTWA 3OAKA 5APQA 1SLQA 5AVQB 2QM7A 3IR9A 5APYA 4I6MC 5AVTB 2W6AA 1GK4A 2WPRA 3P32A 4GKGA 2YO3A 5AVVB 3TK1A 1GD2E 1FOSF 5AVWB 1X8YA 5AW3B 4AQRD 3VYIA 3UIAA 1MFZA 1JNMA 4KHXA 2JJLA 2QM8A 1HJBA 5AVYB 2IPPA 2XU6A 3B8EB 2R32A 2XV5A 3TNUA 2WT7B 3HE5A 5AW4B 5AW5B 3KQGA 1SP4A 3LIEA
chains in the Genus database with same CATH superfamily
2YIUB 3GF7A 3BRVB 1KFNA 1QL2A 3CXHH 1SQPJ 5APXA 4C46A 1T2KD 3L37A 3HD7D 4UB8H 2LXBA 3CC7P 1N7SC 1JB0J 3H1KD 1JMMA 3RK3E 1FZFA 2Y9YA 3M0DC 1M1KQ 2OYHB 4OGQC 1YQ4C 1S9KD 2AXTH 2R3CA 4GDOA 2YNYA 3CMEP 1Q2NA 2JDIH 2N1TA 1NU1D 3GHGB 3V5BA 3B5NA 5KLIC 3H1JD 1J1DC 4N6JA 3HD7B 3L73D 3HE4A 5CJ0A 2P58A 4JYBA 4A7PA 1QVGO 1BGYG 4H13D 4I6MC 5CCHA 4LLHA 3F5HA 1GL2D 3Q5PA 1X0TA 4WWIA 1SQQE 2HFED 1NOHA 1EDJA 2JJLA 1S4XA 2BEQD 3L70G 3Q3DA 1YIJP 2WT7B 2O01N 1EXJA 1PL5A 5KAIH 2CK3H 4KT0J 2WSEH 1LWUB 5TISH 2Q3IA 2WZ7A 1FS0E 1IK9A 1LNQA 1M1JB 1OW7A 1G2CA 3BATA 1GU5A 1FE6A 1KILD 4U3FD 5E79H 2Q1KA 1LP1A 2YKOA 3AEAC 3FWLA 1N2DC 1NTKG 3VMZA 2KP8A 1QL1A 3RBXA 1FZEA 3GLMA 1GL2B 1RE3A 1P84I 1YTZI 2Q9IA 3A5TA 3CWBD 2IBZE 1FU1A 2FYUE 3CX5I 4WY4D 3S9OA 2E5YA 4GT1A 3R2PA 1KQFB 2E75B 2O1JA 2AXTE 1PIXA 3GW6A 3B71A 1KILB 1LT9C 5KAFH 1NWQA 3AEFC 3CCUP 5AVSB 1JY3P 2IZ1A 5CHXA 2O3JA 3Q5RA 2E74D 1BE3J 3TSIA 2ZT9C 4MN4C 3CXHI 5KJ7A 2IDBA 2W90A 2YO3A 2R44A 1W2BO 1YITP 3A0BE 4AQRD 4GOFA 1MFZA 2WSCJ 1AVYA 1OMIA 4KHXA 3I56P 1BGYE 4L75A 5KAIE 2IBZI 4K3AA 2O1KA 2O01J 1GW3A 3NFQA 5TISE 1OVUA 3G9RA 1NAYA 3L70J 1JTHA 2L5GB 1GMJA 1VPCA 1H88A 1GDTA 1SQPD 2E74B 4LC1A 2B87B 5E79E 2HPCB 1J2JB 2KIKA 1CW5A 1OWAA 1YQ3C 1FZCB 4NPEA 2OYHA 3AEBC 1JY2O 4XE5B 2WSFH 3V2RA 3RL0B 1NTKJ 1JM0A 3VMYA 2JO1A 3GHGA 2WMMA 1SQXK 1NTME 3L36A 3H1KG 3CPWO 1LTGC 3RGUA 4YXDC 5KLVE 4EYYQ 1RQUA 5APWA 3HD7A 1DH3A 3GF3A 1VQNP 1HUCA 1RF1A 1URQD 1FAVA 4DJGA 1ZOYC 3V6IA 1SQVJ 2Q7CA 3V2NA 2H88C 2QJYB 3TGUE 1NVOA 2P1JA 3HTKB 4C7RA 4OWFA 1RE4C 3EFGA 1NU1G 1PP9D 2Z5IA 4PD4I 3H1JG 1FBMA 3L73G 1P84D 2PRRA 3P32A 3FXDA 3AE3C 1VQ9P 1LWUA 1X8YA 3L74E 3CCJP 2ZXXA 2DW3A 3VYIA 3CX5D 3RK2C 2RH0A 1KTMA 5BU5A 1OFCX 1NTZD 2Y0DA 3H32B 1T3JA 3VP8A 4HJGH 2LXCB 2HODB 2FYNC 3AE5C 2KZJA 2L91A 4NPFX 2H89C 3D71A 3G4SP 1T2KC 1YJWP 1DEEG 4IFDK 1X79B 1IFPA 1L0LD 4OH8B 1QLED 3CXHD 3ABVC 4U3FG 1SQQK 3FWNA 1TU3F 3W68A 2A45G 3AE7C 2POHA 3FX0A 1BCCJ 1CZQA 2OTKE 1OXZA 2ZXEB 1MV8A 1JY2N 2V4HA 1FJKA 3PTZA 4EDFA 1QGKB 3CWBG 1Y47A 2OGUA 1VF5D 1OVRA 2YKQA 2M5AB 3B5ND 4N78D 1FDIA 2KI7B 1M1JC 3FXEA 1PPJE 2ZYGA 1H89A 1BE3D 4H13C 1J1EB 2BCCD 5CCHD 2IYPA 2FYUK 1GL2C 3H1JJ 3L73J 5BU8B 4KJMA 1SFCC 1JNMA 1NU1E 2FFDB 1KB9H 2B87A 2HPCA 3HUSC 3HE4B 2KZIA 3L72E 4HKZH 4PD4D 1VQ7P 1WMKA 2ZAEB 1Y9BA 2ZYAA 1NYHA 4WVZA 2W27A 1SQPG 5M1BA 5KKZB 3MUDA 3Q5SA 2K9YA 2XZRA 1GZLA 4U3FJ 1FZAA 4Y99C 5CBOA 2G8YA 4WY4C 4N3YB 2D2CD 2A06D 1G2CB 1FDMA 1YJ9P 3AE2C 4HYTB 1N7LA 1EC5A 3M9BA 1QX8A 1SQVD 2IZ0A 2XNXA 3CWBJ 4K35A 1LTJA 4IOIH 2QRXA 1G1JA 5AVUB 5CMZA 4O9BA 5KJ7D 2ZYDA 2QJKB 2MJZA 1NTMK 1PP9G 2C0WA 3TK1A 1S72P 3CD6P 5KLVK 3H32A 3D6ZA 2HODA 3UIAA 1ZMEC 1BDCA 2K1AA 4R4LA 4H0LC 1M90Q 1KB9E 1Q7YQ 4YPCA 1IC2A 3MD0A 3OA7A 3ZDMA 1R8EA 3IF4A 1NTZG 1EDKA 1SQBE 1PGQA 4C7NB 1RF0C 1S5LH 4I1LA 1VQLP 3M91A 2H43A 2OYIC 1L0LG 1IK7A 3H1LD 4ZKPA 1BCCD 2M5AA 2P67A 1D7MA 1JTHB 2QIWA 4ZNCA 5B66E 1SQPE 1DD4A 1URQC 2KK7A 3M9QA 2E5TA 2OYOA 3R4YA 1KB9I 3H25A 1HGZA 2K9JB 2KLVA 1EZVI 3IR9A 4EIJA 2FFDA 2CPBA 3L75D 1BE3G 3T97B 2IX7C 2YXRB 2QJPC 2BCCG 1N73C 2QM8A 1PP9J 2XV5A 2QE7H 1RF1B 4CPGA 3Q2YA 2ITAA 3AE6C 1LTBC 2R5BA 1JCCA 1VQ4P 2Y0CA 3A0BH 1FOSE 1RH5B 1JY3O 1PGOA 3CC2P 2G3AA 1AQ5A 1AA0A 3AE9C 1NTZJ 1NAFA 1WT6A 1S5LE 2E75D 1NU1K 1X22A 2C9LY 1OX3A 2O01H 5AW0B 2E76D 4I7ZC 4YTPC 2P2UA 2JP3A 1L0LJ 4Z1MH 2N1TC 3KDPB 1VF5C 1L4AB 3P8CE 3TYYA 1OVVA 1M8OB 1KYOD 2NPSD 3KPEA 3B5NC 3BCCD 2A06G 2OTJP 2GUSA 2OARA 1BDDA 1ZRTD 2QG4A 3MIWA 4L76A 1SQVG 5AVQB 2V7QJ 2QVAA 4GKGA 4HH2A 3AEEC 3OW2O 2E76B 4BWNA 1OZHA 5KKZC 2PFXA 1X9VA 3L71D 1HJBA 2AXCA 3TNUA 1M7LA 3HE5A 4N78E 4I2LC 2NPSB 2BCCJ 1ZXGA 1JCDA 3AE8C 4C7NA 1EDLA 3P8MC 5GTIH 3RL0D 1VQ5P 2MKVA 1AFOA 1EZVD 4H44B 2PP6A 3SFEC 1EDIA 2ZVNB 5AW2B 3CCRP 1SQXD 1KQLA 1ZR2A 5CCGA 3VMAA 2J58A 3CCEP 3L70E 5AW1B 2D2CC 3H1LG 1USEA 1BCCG 2K9JA 1AQTA 1T6AA 1L0NJ 3AEGC 1IO4A 1SQBK 1KQSO 3RK3D 1ZLLA 1LT1A 2N9BA 3VMXA 1VQ6P 2YMKA 3T97A 1NTKE 3F89A 3S1KA 3AE1C 5KJ7C 3H1IJ 3PLNA 2R3SA 1S1CX 2K88A 2YIUC 4PV1B 1R5LA 1SQPK 4UB6E 3L75G 3O6QB 1DD3A 1SQVE 2ZVOB 4L74A 3RK3B 2VRSA 1LTJB 1IZNB 5GTIE 3B4SA 2FKWB 4OGQD 5L8RJ 1OIPA 1KMIZ 3BASA 1SQQD 2RN0A 2OYHC 4IL6X 2P10A 2YO2A 3VP9A 1IFJA 4YXWH 4RKUJ 1Z56A 1L4AA 3I5CA 2KNCB 2WSSH 3GHGC 3MP7B 2FBWC 1N7SB 3HD7C 3QWOC 5AVZB 2QEXP 4D6TJ 3N4XA 4JYCA 3D6YA 2B88A 4OGQB 1KORA 3IFMA 5AW8B 3H1LJ 4IFMA 1SFCA 3CCVP 3CCLP 1E5WA 2ZFCA 2WSFJ 2RMZA 1A02F 2LKMA 3BCCG 2IBZD 5KLIB 3FGAD 2FYUD 1J1DB 1BCCE 5GTHH 2KYVA 1BSNA 1N8RQ 1Q81Q 2A45H 1LWUC 1AV1A 2NPSA 2M3BA 3H1KE 1NH4A 2W83C 3M9HA 3M0AA 2WVRA 3L71G 3PHLA 3L75J 3V2PA 1S9KE 2UWJE 4XFJA 1VL2A 1KV4A 1Y8AA 3H1JE 3L73E 1PZQA 3JCUH 2KSJA 2E75C 1AVOA 2WPQA 1EZVG 2KSEA 4EI2A 1KILC 3V2QA 2E76C 1CI6B 3V4WA 2GM4A 1IFDA 4ZKUA 1W2EA 2K3RA 1L0ND 2FXMA 2SPZA 3VOPA 3VN0A 1N86A 3SSUA 1M56D 3EQ2A 3CCSP 1GTWA 1QVFO 1LT9B 1FZGA 4IL6H 5B66H 1NTMD 1KILE 4U3FE 1WRGA 2J59M 2WPRA 3H1ID 3O6QA 5KLVD 5GTHE 1R5SA 3KZIH 3BCCJ 3N7NA 3CMAP 2ZT9B 1HJ0A 1KYOE 4R4MA 1RF0A 2E74C 3G3ZA 3TGUD 3WUTA 3KQGA 1YJNP 3JC22 3PJSK 2E43A 3CWBE 2OYIA 4WBAA 2LR2A 1JEKA 1W5CE 4ASVA 1FZCC 1OW6A 1UIIA 1NTKK 1MFTA 3RL0C 3JSVC 3L71J 1MUUA 3L74D 2KNCA 2H8PD 1T8ZA 1N7SA 1HH0A 3MUDC 3G71P 3JCUE 2BASA 3A0HH 1SQQG 3LIDA 3TNUB 5CCGD 1SQVK 3HE5B 3RL0g 1LGHB 3M0DA 3WU2H 2QJYC 4D6TD 2KS1A 4QMAA 3H1HJ 3PP5A 1SQXJ 2HYNA 1Q86Q 1N73A 2W8ZA 3LW5J 2Z5HA 5APVA 2QA4P 3PRJA 1NGMB 4AYCA 5AVTB 3K5BA 4IL6E 4BXLA 1ZR4A 2AEMA 4HB1A 3GMAA 1XTCC 2KUBA 5H2FH 4Y28J 2IBZG 2M8RA 3KZIE 2FYUG 4W7YA 2IPPA 1ZW0A 1MZ9A 1SP4A 3LIEA 3IAOA 1U7MA 5AW7B 1PPJD 3M06A 1JUNA 4U7JA 1IFNA 1IJDB 3TF5A 3RK2B 2JWDA 4BRYB 2V7QH 3A7OA 2XDJA 3ITKA 4DCKA 3USSA 1CI6A 2FYNB 2M0BA 4LGDE 2IYOA 2I1JA 1K8AQ 1PP9E 1M57D 1OW8A 1L4AD 3A0HE 5DJTB 1P84E 3W67A 5KTBA 2ZJSE 3L72D 3WU2E 2FY8A 1SQQJ 3OJAB 2WWWA 1FC2C 2WSCH 3CX5E 1L2PA 1J1EC 1LT9A 1KQGB 3P7KA 3H6PA 3AE4C 1GK6A 3II6A 1NTZE 3L4FA 5C39A 3CCMP 1SFCD 2JEEA 2OTLP 3NXSA 5B5EE 3U1CA 1JOCA 1L0NG 2HLOA 3OAKA 2FXPA 4PD4H 2FFDC 1AJYA 3U59A 1LTTC 1L0LE 5H2FE 1NTMG 3CXHE 3SFDC 4H13B 2JR8A 5KLVG 3H1IG 1K04A 4UB8E 1E79H 2AEFA 4DOJA 1KC8Q 2FYUJ 5CCHC 2JWAA 3CLQA 2FXOA 4H44D 3KYQA 1U7JA 1SFCB 1EXIA 3NTNA 3TGUG 3MZWB 4UB6H 3L35A 4RESB 1NJIQ 3HUSB 1LTSC 1LTIC 3E7KA 1HWTC 3L74G 2NRGA 1KB9D 1BE3E 2WQYC 1VQKP 2BCCE 2WTYA 1H0TB 3CL3D 3SWKA 1PFIA 3WUUA 4PJ0H 2W6BA 5CBNA 1RE3C 1SQBD 3BRTB 4Y99B 1DEBA 1JY3N 3H1HD 1UIXA 2K37A 1BGYJ 1A02J 4WY4B 2QJKC 4D6TG 2GUVA 2WSEJ 2YXQB 1RE4A 1G1IA 2PGDA 1HVVA 3HRNA 2J5UA 4PV1D 2QSIA 5AVRB 4H0LD 2PAJA 2QM7A 4RJTA 1PV3A 3AECC 1GK4A 4PD4E 1VQPP 4ZMDA 1FOSF 1PGJA 1U57A 1FDOA 2GA1A 4JBZA 2YKPA 3PH0A 2KLUA 5AVYB 2R32A 4BRYA 1ZN5A 1L0NE 2OQQA 3E1IA 5CJ4A 5AVWB 1NTMJ 4JF7A 2HR3A 5APTA 5KLVJ 2YMYA 1VQ8P 2A06E 2KOGA 4EOTA 1PPJG 4GOEA 4H0LB 2I8DA 3H1IE 4DZOA 1FJPA 4B86A 2XNDH 1IFMA 1FZBA 2WPSA 3TGUJ 2Z4EA 3CCQP 1N7SD 1CSBA 3C1LA 2IFMA 1KD1Q 1S3JA 5KAFE 1ZV8A 3O8ZA 5CCGC 3D70A 3WMM0 5AW9B 1JO5A 3L74J 2OYIB 1K05A 2JKVA 4TLFA 2C9NY 1RHZB 2WT7A 1YBKA 3RBZA 4PJ0E 3L72G 1M1JA 3AEDC 2WPVB 1KZUB 4NPDA 1URQB 1YTZT 1SLQA 2W6AA 1JY2P 5K5GB 1RF1C 3C9IA 1GL2A 3G6EP 4D6TE 5AW3B 3P8CD 5BVZA 1QEXA 1LTAC 3BVHA 2KS1B 3MHVA 1YHQP 3H1LE 1NTZK 2Q3EA 2QJPB 3HUSA 1N73B 1K73Q 5AW6B 2H7HA 1NHLA 1BSHA 2KB7P 1VQMP 3WUVA 3E1RA 3V4QA 1KILA 2Q6QA 1RQVA 1YYCA 3S4RA 1KYOH 4DT0A 1Q90D 2N1TD 1L0LK 3H1KJ 3MGNA 1H0TA 4W80A 1DIPA 1K9MQ 4WB4A 1RY3A 4IFFA 3VTPC 4W7ZA 1L4AC 2WITA 1Q82Q 1USDA 2I1KA 4WY4A 3KXDA 3L75E 5EFWB 2KXPB 3GG2A 3NMDA 1S5LX 1NU1J 3C8VA 5APUA 2W6JH 3EWKA 1BGYD 4I7ZB 3TDKA 3A3YB 2IFNA 2N1TB 1SQBG 2FYZA 1VF5B 1KFMA 3H1HG 3L72J 5DJUB 5APQA 1SQXG 2ZT9D 3B5NB 4GIFA 1NKNA 2Y0EA 4JQ0D 3L70D 5AVVB 1HF9A 1GD2E 1FZCA 2NPSC 1GW4A 4OVNF 3I55P 1EQ7A 3KHUA 2XU6A 4L73A 5TJHA 2NZ2A 1LJ2A 3Q1MA 3LW5H 2M3EA 2B89A 2R5DA 4H44C 1NTKD 2E42A 1HGVA 2P7JA 2XKMA 1S2EA 1HBWA 5AVXB 1NO4A 3HTKA 2Q5UA 4RO0A 5APSA 3A2AA 3BCCE 3U1AA 4XA4A 2Y9ZA 1YI2P 1XTGB 3CC4P 1H8AA 3SWFA 1ZRTE 1LP1B 4TT3H 1NKZB 1L0NK 4M3LA 3CI9A 4AUWA 1DX7A 1JMBA 1GU4A 1VQOP 4GODA 1IFIA 2HG5D 2C0XA 2CPSA 2B9BA 3IN6A 3L71E 3MTUE 1URQA 2RKLA 2AEJA 1T3UA 1HTLC 2D2CB 1P84H 4PV1C 1SVFA 2A45I 1VDFA 4JPZB 5APYA 2BEZF 3QH9A 3CX5H 1PGPA 1SQBJ 3SWYA 4ASWA 1KYOI 1KN7A 1MKMA 1EZVE 2N9YB 3RK2D 5B5EH 3RK3C 1LTJC 3B8EB 5AW4B 1SS1A 3EFFK 3H1HE 5AW5B 1SQXE 1ZP0C
chains in the Genus database with same CATH topology
3BRVB 1KFNA 4DOJA 2HPCA 5CCHC 3CLQA 3HUSC 3HE4B 1QL2A 3KYQA 1SFCB 3RK3B 2VRSA 1LTJB 3NTNA 5APXA 2FKWB 4C46A 1T2KD 3L37A 3HD7D 3L35A 3BASA 4RESB 3HUSB 1LTSC 1LTIC 1N7SC 2OYHC 2W27A 1JMMA 3MUDA 1FZFA 2YO2A 1HWTC 3VP9A 1IFJA 2XZRA 1Z56A 1L4AA 3I5CA 1GZLA 1FZAA 3GHGC 4Y99C 2WTYA 3M0DC 1N7SB 2OYHB 4WY4C 3HD7C 4N3YB 1S9KD 2R3CA 5AVZB 2YNYA 3N4XA 3CL3D 1G2CB 4JYCA 1PFIA 1FDMA 2N1TA 2W6BA 1RE3C 3BRTB 3GHGB 3V5BA 4HYTB 4Y99B 1DEBA 1N7LA 3M9BA 1JY3N 3B5NA 1A02J 1J1DC 4N6JA 4WY4B 3HD7B 3IFMA 2GUVA 5AW8B 3HE4A 2XNXA 4IFMA 1SFCA 1RE4A 5CJ0A 1E5WA 1G1IA 1LTJA 1HVVA 2ZFCA 3HRNA 1G1JA 4JYBA 5AVUB 5CMZA 5AVRB 1A02F 2PAJA 2LKMA 2QM7A 4O9BA 5KJ7D 4I6MC 1GK4A 1J1DB 5CCHA 2MJZA 2KYVA 1NTMK 4LLHA 2C0WA 3TK1A 2A45H 1LWUC 2NPSA 1GL2D 5KLVK 1FOSF 3H32A 2M3BA 2HFED 2HODA 3UIAA 1NOHA 2YKPA 2JJLA 1NH4A 5AVYB 2R32A 2WT7B 1ZN5A 3E1IA 5CJ4A 5AVWB 2WSEH 1LWUB 3M9HA 2Q3IA 2WZ7A 3M0AA 1IK9A 4JF7A 5APTA 1IC2A 1M1JB 2YMYA 3MD0A 1G2CA 3BATA 3OA7A 3V2PA 1S9KE 1GU5A 1KILD 2KOGA 4EOTA 2YKOA 1N2DC 3VMZA 4DZOA 1FJPA 4B86A 2KP8A 1IFMA 4C7NB 1QL1A 1FZBA 1RF0C 1FZEA 2WPSA 2Z4EA 1N7SD 1CSBA 1GL2B 2IFMA 4I1LA 1RE3A 1YTZI 3M91A 2H43A 2KSJA 2OYIC 2Q9IA 2WPQA 3A5TA 1ZV8A 3O8ZA 4ZKPA 1KILC 5CCGC 3V2QA 3WMM0 1CI6B 1FU1A 2P67A 3V4WA 5AW9B 4WY4D 2GM4A 1IFDA 1JO5A 4ZKUA 4GT1A 3R2PA 2OYIB 2O1JA 1W2EA 2C9NY 1JTHB 2WT7A 1KILB 1URQC 1LT9C 2FXMA 3M9QA 3VOPA 1NWQA 1M1JA 3VN0A 1N86A 5AVSB 1JY3P 1HGZA 5CHXA 3EQ2A 1KZUB 2KLVA 1GTWA 1URQB 1YTZT 1LT9B 3TSIA 1FZGA 1SLQA 3IR9A 5KJ7A 2W6AA 4EIJA 1WRGA 2J59M 2FFDA 2WPRA 1JY2P 2CPBA 2YO3A 1RF1C 3C9IA 1GL2A 3N7NA 5AW3B 4AQRD 2IX7C 3P8CD 5BVZA 1N73C 1MFZA 4KHXA 2QM8A 1LTAC 3BVHA 2XV5A 1RF0A 1RF1B 3G3ZA 3KQGA 2O1KA 1GW3A 2E43A 3NFQA 1NTZK 1LTBC 2R5BA 1JCCA 2OYIA 4WBAA 3HUSA 1N73B 1JTHA 1FZCC 5AW6B 2H7HA 1NHLA 2L5GB 2KB7P 1FOSE 1VPCA 1NTKK 1H88A 1GDTA 3V4QA 1KILA 1JY3O 3RL0C 4LC1A 1YYCA 1MUUA 2HPCB 1AQ5A 1J2JB 1CW5A 1OWAA 2H8PD 2N1TD 1FZCB 1NAFA 1T8ZA 1L0LK 1N7SA 2OYHA 1JY2O 1WT6A 1HH0A 3MGNA 4W80A 4XE5B 2WSFH 3V2RA 3RL0B 1NU1K 2BASA 4WB4A 1RY3A 2C9LY 4IFFA 3VMYA 3VTPC 4W7ZA 1L4AC 3LIDA 2WITA 2O01H 3TNUB 3GHGA 1SQVK 5CCGD 1SQXK 3HE5B 5AW0B 1LGHB 3L36A 1LTGC 3M0DA 2I1KA 4WY4A 5APWA 3HD7A 2P2UA 1DH3A 2N1TC 3KDPB 3NMDA 1L4AB 3P8CE 1HUCA 3TYYA 1RF1A 5APUA 1URQD 2NPSD 3KPEA 1FAVA 3B5NC 3PP5A 2Q7CA 3V2NA 2HYNA 3A3YB 2P1JA 3HTKB 4C7RA 1N73A 1RE4C 3EFGA 2GUSA 2Z5HA 2Z5IA 2IFNA 2N1TB 2OARA 2FYZA 5APVA 1KFMA 4AYCA 3MIWA 5APQA 5AVQB 1FBMA 3B5NB 4GIFA 5AVTB 1ZR4A 1NKNA 3P32A 4GKGA 5AVVB 4HH2A 1GD2E 1FZCA 2NPSC 1LWUA 1XTCC 1GW4A 1X8YA 1EQ7A 2M8RA 3VYIA 1X9VA 4W7YA 3RK2C 1HJBA 2IPPA 2XU6A 3TNUA 5BU5A 1M7LA 3HE5A 1MZ9A 4N78E 1SP4A 2NPSB 3LIEA 4I2LC 3H32B 5AW7B 1T3JA 3VP8A 3M06A 1JUNA 3LW5H 1IFNA 1IJDB 1JCDA 2HODB 2R5DA 4C7NA 2E42A 1HGVA 2P7JA 3RK2B 3P8MC 2XKMA 3RL0D 3A7OA 1HBWA 5AVXB 2XDJA 1T2KC 1NO4A 4IFDK 1X79B 1AFOA 4OH8B 3HTKA 2Q5UA 5APSA 1CI6A 3A2AA 3U1AA 4LGDE 2PP6A 1SQQK 4XA4A 2I1JA 1XTGB 1H8AA 3SWFA 2A45G 1NKZB 5AW2B 2POHA 1L0NK 1KQLA 1L4AD 1ZR2A 1CZQA 5CCGA 1OXZA 4M3LA 3CI9A 4AUWA 2J58A 2ZXEB 1MV8A 1DX7A 5KTBA 1GU4A 1JY2N 5AW1B 1FJKA 1IFIA 2HG5D 3OJAB 2C0XA 2WWWA 2CPSA 2WSCH 2YKQA 3MTUE 1URQA 1J1EC 1LT9A 3B5ND 1IO4A 4N78D 1SQBK 3P7KA 1T3UA 3H6PA 1M1JC 1GK6A 3II6A 1HTLC 3L4FA 1SFCD 2JEEA 3RK3D 1ZLLA 3NXSA 3U1CA 2N9BA 1JOCA 3VMXA 1SVFA 3T97A 1H89A 2A45I 2HLOA 1VDFA 1J1EB 3OAKA 5KJ7C 5APYA 2FFDC 5CCHD 3SWYA 2FYUK 3U59A 1LTTC 1GL2C 5BU8B 1SFCC 1JNMA 1SQPK 3RK2D 3RK3C 1LTJC 3B8EB 2FFDB 5AW4B 5AW5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9H A;  2Q3I A;  5AW7 B;  3M06 A;  3M0A A;  2E43 A;  3NFQ A;  1JUN A;  2R5B A;  5APT A;  2R5D A;  3HE4 B;  3MD0 A;  4C7N A;  2E42 A;  2P7J A;  5AW6 B;  2H7H A;  3P8M C;  2VRS A;  1S9K E;  1GU5 A;  1FOS E;  3NTN A;  1H88 A;  3V4Q A;  5APX A;  4EOT A;  4LC1 A;  1YYC A;  4C46 A;  3A7O A;  1MUU A;  1HBW A;  5AVX B;  1T2K C;  3L37 A;  1T2K D;  3L35 A;  3VMZ A;  4DZO A;  1J2J B;  4RES B;  4B86 A;  1OWA A;  2KP8 A;  3HTK A;  2Q5U A;  4C7N B;  5APS A;  2WPS A;  1CI6 A;  1NAF A;  3A2A A;  2W27 A;  1CSB A;  3MGN A;  4XE5 B;  3M91 A;  1H8A A;  3SWF A;  2YO2 A;  2BAS A;  1HWT C;  2WPQ A;  3A5T A;  2C9L Y;  2XZR A;  3O8Z A;  5AW2 B;  3VMY A;  3VTP C;  1KQL A;  3LID A;  3I5C A;  1GZL A;  3TNU B;  1CZQ A;  3HE5 B;  5AW0 B;  2WTY A;  3L36 A;  1OXZ A;  1CI6 B;  3M0D A;  2P67 A;  4M3L A;  3V4W A;  5AW9 B;  4AUW A;  2ZXE B;  1MV8 A;  1GU4 A;  5APW A;  1S9K D;  2P2U A;  5AW1 B;  2R3C A;  4GT1 A;  5AVZ B;  2YNY A;  1G2C B;  1DH3 A;  2C9N Y;  4JYC A;  3KDP B;  3NMD A;  2WWW A;  2WT7 A;  1HUC A;  3TYY A;  5APU A;  3V5B A;  4HYT B;  1FAV A;  3M9B A;  1IO4 A;  1A02 J;  3P7K A;  2Q7C A;  1NWQ A;  1GK6 A;  5AW8 B;  3HE4 A;  3A3Y B;  3VN0 A;  5AVS B;  4I2L C;  2Z5H A;  2Z5I A;  2ZFC A;  3NXS A;  2N9B A;  5APV A;  3VMX A;  4JYB A;  5AVU B;  3T97 A;  5CMZ A;  5AVR B;  1H89 A;  1A02 F;  4AYC A;  1GTW A;  3OAK A;  5APQ A;  1SLQ A;  5AVQ B;  2QM7 A;  3IR9 A;  5APY A;  4I6M C;  5AVT B;  2W6A A;  1GK4 A;  2WPR A;  3P32 A;  4GKG A;  2YO3 A;  5AVV B;  3TK1 A;  1GD2 E;  1FOS F;  5AVW B;  1X8Y A;  5AW3 B;  4AQR D;  3VYI A;  3UIA A;  1MFZ A;  1JNM A;  4KHX A;  2JJL A;  2QM8 A;  1HJB A;  5AVY B;  2IPP A;  2XU6 A;  3B8E B;  2R32 A;  2XV5 A;  3TNU A;  2WT7 B;  3HE5 A;  5AW4 B;  5AW5 B;  3KQG A;  1SP4 A;  3LIE A; 
#chains in the Genus database with same CATH topology
 2YIU B;  3GF7 A;  3BRV B;  1KFN A;  1QL2 A;  3CXH H;  1SQP J;  5APX A;  4C46 A;  1T2K D;  3L37 A;  3HD7 D;  4UB8 H;  2LXB A;  3CC7 P;  1N7S C;  1JB0 J;  3H1K D;  1JMM A;  3RK3 E;  1FZF A;  2Y9Y A;  3M0D C;  1M1K Q;  2OYH B;  4OGQ C;  1YQ4 C;  1S9K D;  2AXT H;  2R3C A;  4GDO A;  2YNY A;  3CME P;  1Q2N A;  2JDI H;  2N1T A;  1NU1 D;  3GHG B;  3V5B A;  3B5N A;  5KLI C;  3H1J D;  1J1D C;  4N6J A;  3HD7 B;  3L73 D;  3HE4 A;  5CJ0 A;  2P58 A;  4JYB A;  4A7P A;  1QVG O;  1BGY G;  4H13 D;  4I6M C;  5CCH A;  4LLH A;  3F5H A;  1GL2 D;  3Q5P A;  1X0T A;  4WWI A;  1SQQ E;  2HFE D;  1NOH A;  1EDJ A;  2JJL A;  1S4X A;  2BEQ D;  3L70 G;  3Q3D A;  1YIJ P;  2WT7 B;  2O01 N;  1EXJ A;  1PL5 A;  5KAI H;  2CK3 H;  4KT0 J;  2WSE H;  1LWU B;  5TIS H;  2Q3I A;  2WZ7 A;  1FS0 E;  1IK9 A;  1LNQ A;  1M1J B;  1OW7 A;  1G2C A;  3BAT A;  1GU5 A;  1FE6 A;  1KIL D;  4U3F D;  5E79 H;  2Q1K A;  1LP1 A;  2YKO A;  3AEA C;  3FWL A;  1N2D C;  1NTK G;  3VMZ A;  2KP8 A;  1QL1 A;  3RBX A;  1FZE A;  3GLM A;  1GL2 B;  1RE3 A;  1P84 I;  1YTZ I;  2Q9I A;  3A5T A;  3CWB D;  2IBZ E;  1FU1 A;  2FYU E;  3CX5 I;  4WY4 D;  3S9O A;  2E5Y A;  4GT1 A;  3R2P A;  1KQF B;  2E75 B;  2O1J A;  2AXT E;  1PIX A;  3GW6 A;  3B71 A;  1KIL B;  1LT9 C;  5KAF H;  1NWQ A;  3AEF C;  3CCU P;  5AVS B;  1JY3 P;  2IZ1 A;  5CHX A;  2O3J A;  3Q5R A;  2E74 D;  1BE3 J;  3TSI A;  2ZT9 C;  4MN4 C;  3CXH I;  5KJ7 A;  2IDB A;  2W90 A;  2YO3 A;  2R44 A;  1W2B O;  1YIT P;  3A0B E;  4AQR D;  4GOF A;  1MFZ A;  2WSC J;  1AVY A;  1OMI A;  4KHX A;  3I56 P;  1BGY E;  4L75 A;  5KAI E;  2IBZ I;  4K3A A;  2O1K A;  2O01 J;  1GW3 A;  3NFQ A;  5TIS E;  1OVU A;  3G9R A;  1NAY A;  3L70 J;  1JTH A;  2L5G B;  1GMJ A;  1VPC A;  1H88 A;  1GDT A;  1SQP D;  2E74 B;  4LC1 A;  2B87 B;  5E79 E;  2HPC B;  1J2J B;  2KIK A;  1CW5 A;  1OWA A;  1YQ3 C;  1FZC B;  4NPE A;  2OYH A;  3AEB C;  1JY2 O;  4XE5 B;  2WSF H;  3V2R A;  3RL0 B;  1NTK J;  1JM0 A;  3VMY A;  2JO1 A;  3GHG A;  2WMM A;  1SQX K;  1NTM E;  3L36 A;  3H1K G;  3CPW O;  1LTG C;  3RGU A;  4YXD C;  5KLV E;  4EYY Q;  1RQU A;  5APW A;  3HD7 A;  1DH3 A;  3GF3 A;  1VQN P;  1HUC A;  1RF1 A;  1URQ D;  1FAV A;  4DJG A;  1ZOY C;  3V6I A;  1SQV J;  2Q7C A;  3V2N A;  2H88 C;  2QJY B;  3TGU E;  1NVO A;  2P1J A;  3HTK B;  4C7R A;  4OWF A;  1RE4 C;  3EFG A;  1NU1 G;  1PP9 D;  2Z5I A;  4PD4 I;  3H1J G;  1FBM A;  3L73 G;  1P84 D;  2PRR A;  3P32 A;  3FXD A;  3AE3 C;  1VQ9 P;  1LWU A;  1X8Y A;  3L74 E;  3CCJ P;  2ZXX A;  2DW3 A;  3VYI A;  3CX5 D;  3RK2 C;  2RH0 A;  1KTM A;  5BU5 A;  1OFC X;  1NTZ D;  2Y0D A;  3H32 B;  1T3J A;  3VP8 A;  4HJG H;  2LXC B;  2HOD B;  2FYN C;  3AE5 C;  2KZJ A;  2L91 A;  4NPF X;  2H89 C;  3D71 A;  3G4S P;  1T2K C;  1YJW P;  1DEE G;  4IFD K;  1X79 B;  1IFP A;  1L0L D;  4OH8 B;  1QLE D;  3CXH D;  3ABV C;  4U3F G;  1SQQ K;  3FWN A;  1TU3 F;  3W68 A;  2A45 G;  3AE7 C;  2POH A;  3FX0 A;  1BCC J;  1CZQ A;  2OTK E;  1OXZ A;  2ZXE B;  1MV8 A;  1JY2 N;  2V4H A;  1FJK A;  3PTZ A;  4EDF A;  1QGK B;  3CWB G;  1Y47 A;  2OGU A;  1VF5 D;  1OVR A;  2YKQ A;  2M5A B;  3B5N D;  4N78 D;  1FDI A;  2KI7 B;  1M1J C;  3FXE A;  1PPJ E;  2ZYG A;  1H89 A;  1BE3 D;  4H13 C;  1J1E B;  2BCC D;  5CCH D;  2IYP A;  2FYU K;  1GL2 C;  3H1J J;  3L73 J;  5BU8 B;  4KJM A;  1SFC C;  1JNM A;  1NU1 E;  2FFD B;  1KB9 H;  2B87 A;  2HPC A;  3HUS C;  3HE4 B;  2KZI A;  3L72 E;  4HKZ H;  4PD4 D;  1VQ7 P;  1WMK A;  2ZAE B;  1Y9B A;  2ZYA A;  1NYH A;  4WVZ A;  2W27 A;  1SQP G;  5M1B A;  5KKZ B;  3MUD A;  3Q5S A;  2K9Y A;  2XZR A;  1GZL A;  4U3F J;  1FZA A;  4Y99 C;  5CBO A;  2G8Y A;  4WY4 C;  4N3Y B;  2D2C D;  2A06 D;  1G2C B;  1FDM A;  1YJ9 P;  3AE2 C;  4HYT B;  1N7L A;  1EC5 A;  3M9B A;  1QX8 A;  1SQV D;  2IZ0 A;  2XNX A;  3CWB J;  4K35 A;  1LTJ A;  4IOI H;  2QRX A;  1G1J A;  5AVU B;  5CMZ A;  4O9B A;  5KJ7 D;  2ZYD A;  2QJK B;  2MJZ A;  1NTM K;  1PP9 G;  2C0W A;  3TK1 A;  1S72 P;  3CD6 P;  5KLV K;  3H32 A;  3D6Z A;  2HOD A;  3UIA A;  1ZME C;  1BDC A;  2K1A A;  4R4L A;  4H0L C;  1M90 Q;  1KB9 E;  1Q7Y Q;  4YPC A;  1IC2 A;  3MD0 A;  3OA7 A;  3ZDM A;  1R8E A;  3IF4 A;  1NTZ G;  1EDK A;  1SQB E;  1PGQ A;  4C7N B;  1RF0 C;  1S5L H;  4I1L A;  1VQL P;  3M91 A;  2H43 A;  2OYI C;  1L0L G;  1IK7 A;  3H1L D;  4ZKP A;  1BCC D;  2M5A A;  2P67 A;  1D7M A;  1JTH B;  2QIW A;  4ZNC A;  5B66 E;  1SQP E;  1DD4 A;  1URQ C;  2KK7 A;  3M9Q A;  2E5T A;  2OYO A;  3R4Y A;  1KB9 I;  3H25 A;  1HGZ A;  2K9J B;  2KLV A;  1EZV I;  3IR9 A;  4EIJ A;  2FFD A;  2CPB A;  3L75 D;  1BE3 G;  3T97 B;  2IX7 C;  2YXR B;  2QJP C;  2BCC G;  1N73 C;  2QM8 A;  1PP9 J;  2XV5 A;  2QE7 H;  1RF1 B;  4CPG A;  3Q2Y A;  2ITA A;  3AE6 C;  1LTB C;  2R5B A;  1JCC A;  1VQ4 P;  2Y0C A;  3A0B H;  1FOS E;  1RH5 B;  1JY3 O;  1PGO A;  3CC2 P;  2G3A A;  1AQ5 A;  1AA0 A;  3AE9 C;  1NTZ J;  1NAF A;  1WT6 A;  1S5L E;  2E75 D;  1NU1 K;  1X22 A;  2C9L Y;  1OX3 A;  2O01 H;  5AW0 B;  2E76 D;  4I7Z C;  4YTP C;  2P2U A;  2JP3 A;  1L0L J;  4Z1M H;  2N1T C;  3KDP B;  1VF5 C;  1L4A B;  3P8C E;  3TYY A;  1OVV A;  1M8O B;  1KYO D;  2NPS D;  3KPE A;  3B5N C;  3BCC D;  2A06 G;  2OTJ P;  2GUS A;  2OAR A;  1BDD A;  1ZRT D;  2QG4 A;  3MIW A;  4L76 A;  1SQV G;  5AVQ B;  2V7Q J;  2QVA A;  4GKG A;  4HH2 A;  3AEE C;  3OW2 O;  2E76 B;  4BWN A;  1OZH A;  5KKZ C;  2PFX A;  1X9V A;  3L71 D;  1HJB A;  2AXC A;  3TNU A;  1M7L A;  3HE5 A;  4N78 E;  4I2L C;  2NPS B;  2BCC J;  1ZXG A;  1JCD A;  3AE8 C;  4C7N A;  1EDL A;  3P8M C;  5GTI H;  3RL0 D;  1VQ5 P;  2MKV A;  1AFO A;  1EZV D;  4H44 B;  2PP6 A;  3SFE C;  1EDI A;  2ZVN B;  5AW2 B;  3CCR P;  1SQX D;  1KQL A;  1ZR2 A;  5CCG A;  3VMA A;  2J58 A;  3CCE P;  3L70 E;  5AW1 B;  2D2C C;  3H1L G;  1USE A;  1BCC G;  2K9J A;  1AQT A;  1T6A A;  1L0N J;  3AEG C;  1IO4 A;  1SQB K;  1KQS O;  3RK3 D;  1ZLL A;  1LT1 A;  2N9B A;  3VMX A;  1VQ6 P;  2YMK A;  3T97 A;  1NTK E;  3F89 A;  3S1K A;  3AE1 C;  5KJ7 C;  3H1I J;  3PLN A;  2R3S A;  1S1C X;  2K88 A;  2YIU C;  4PV1 B;  1R5L A;  1SQP K;  4UB6 E;  3L75 G;  3O6Q B;  1DD3 A;  1SQV E;  2ZVO B;  4L74 A;  3RK3 B;  2VRS A;  1LTJ B;  1IZN B;  5GTI E;  3B4S A;  2FKW B;  4OGQ D;  5L8R J;  1OIP A;  1KMI Z;  3BAS A;  1SQQ D;  2RN0 A;  2OYH C;  4IL6 X;  2P10 A;  2YO2 A;  3VP9 A;  1IFJ A;  4YXW H;  4RKU J;  1Z56 A;  1L4A A;  3I5C A;  2KNC B;  2WSS H;  3GHG C;  3MP7 B;  2FBW C;  1N7S B;  3HD7 C;  3QWO C;  5AVZ B;  2QEX P;  4D6T J;  3N4X A;  4JYC A;  3D6Y A;  2B88 A;  4OGQ B;  1KOR A;  3IFM A;  5AW8 B;  3H1L J;  4IFM A;  1SFC A;  3CCV P;  3CCL P;  1E5W A;  2ZFC A;  2WSF J;  2RMZ A;  1A02 F;  2LKM A;  3BCC G;  2IBZ D;  5KLI B;  3FGA D;  2FYU D;  1J1D B;  1BCC E;  5GTH H;  2KYV A;  1BSN A;  1N8R Q;  1Q81 Q;  2A45 H;  1LWU C;  1AV1 A;  2NPS A;  2M3B A;  3H1K E;  1NH4 A;  2W83 C;  3M9H A;  3M0A A;  2WVR A;  3L71 G;  3PHL A;  3L75 J;  3V2P A;  1S9K E;  2UWJ E;  4XFJ A;  1VL2 A;  1KV4 A;  1Y8A A;  3H1J E;  3L73 E;  1PZQ A;  3JCU H;  2KSJ A;  2E75 C;  1AVO A;  2WPQ A;  1EZV G;  2KSE A;  4EI2 A;  1KIL C;  3V2Q A;  2E76 C;  1CI6 B;  3V4W A;  2GM4 A;  1IFD A;  4ZKU A;  1W2E A;  2K3R A;  1L0N D;  2FXM A;  2SPZ A;  3VOP A;  3VN0 A;  1N86 A;  3SSU A;  1M56 D;  3EQ2 A;  3CCS P;  1GTW A;  1QVF O;  1LT9 B;  1FZG A;  4IL6 H;  5B66 H;  1NTM D;  1KIL E;  4U3F E;  1WRG A;  2J59 M;  2WPR A;  3H1I D;  3O6Q A;  5KLV D;  5GTH E;  1R5S A;  3KZI H;  3BCC J;  3N7N A;  3CMA P;  2ZT9 B;  1HJ0 A;  1KYO E;  4R4M A;  1RF0 A;  2E74 C;  3G3Z A;  3TGU D;  3WUT A;  3KQG A;  1YJN P;  3JC2 2;  3PJS K;  2E43 A;  3CWB E;  2OYI A;  4WBA A;  2LR2 A;  1JEK A;  1W5C E;  4ASV A;  1FZC C;  1OW6 A;  1UII A;  1NTK K;  1MFT A;  3RL0 C;  3JSV C;  3L71 J;  1MUU A;  3L74 D;  2KNC A;  2H8P D;  1T8Z A;  1N7S A;  1HH0 A;  3MUD C;  3G71 P;  3JCU E;  2BAS A;  3A0H H;  1SQQ G;  3LID A;  3TNU B;  5CCG D;  1SQV K;  3HE5 B;  3RL0 g;  1LGH B;  3M0D A;  3WU2 H;  2QJY C;  4D6T D;  2KS1 A;  4QMA A;  3H1H J;  3PP5 A;  1SQX J;  2HYN A;  1Q86 Q;  1N73 A;  2W8Z A;  3LW5 J;  2Z5H A;  5APV A;  2QA4 P;  3PRJ A;  1NGM B;  4AYC A;  5AVT B;  3K5B A;  4IL6 E;  4BXL A;  1ZR4 A;  2AEM A;  4HB1 A;  3GMA A;  1XTC C;  2KUB A;  5H2F H;  4Y28 J;  2IBZ G;  2M8R A;  3KZI E;  2FYU G;  4W7Y A;  2IPP A;  1ZW0 A;  1MZ9 A;  1SP4 A;  3LIE A;  3IAO A;  1U7M A;  5AW7 B;  1PPJ D;  3M06 A;  1JUN A;  4U7J A;  1IFN A;  1IJD B;  3TF5 A;  3RK2 B;  2JWD A;  4BRY B;  2V7Q H;  3A7O A;  2XDJ A;  3ITK A;  4DCK A;  3USS A;  1CI6 A;  2FYN B;  2M0B A;  4LGD E;  2IYO A;  2I1J A;  1K8A Q;  1PP9 E;  1M57 D;  1OW8 A;  1L4A D;  3A0H E;  5DJT B;  1P84 E;  3W67 A;  5KTB A;  2ZJS E;  3L72 D;  3WU2 E;  2FY8 A;  1SQQ J;  3OJA B;  2WWW A;  1FC2 C;  2WSC H;  3CX5 E;  1L2P A;  1J1E C;  1LT9 A;  1KQG B;  3P7K A;  3H6P A;  3AE4 C;  1GK6 A;  3II6 A;  1NTZ E;  3L4F A;  5C39 A;  3CCM P;  1SFC D;  2JEE A;  2OTL P;  3NXS A;  5B5E E;  3U1C A;  1JOC A;  1L0N G;  2HLO A;  3OAK A;  2FXP A;  4PD4 H;  2FFD C;  1AJY A;  3U59 A;  1LTT C;  1L0L E;  5H2F E;  1NTM G;  3CXH E;  3SFD C;  4H13 B;  2JR8 A;  5KLV G;  3H1I G;  1K04 A;  4UB8 E;  1E79 H;  2AEF A;  4DOJ A;  1KC8 Q;  2FYU J;  5CCH C;  2JWA A;  3CLQ A;  2FXO A;  4H44 D;  3KYQ A;  1U7J A;  1SFC B;  1EXI A;  3NTN A;  3TGU G;  3MZW B;  4UB6 H;  3L35 A;  4RES B;  1NJI Q;  3HUS B;  1LTS C;  1LTI C;  3E7K A;  1HWT C;  3L74 G;  2NRG A;  1KB9 D;  1BE3 E;  2WQY C;  1VQK P;  2BCC E;  2WTY A;  1H0T B;  3CL3 D;  3SWK A;  1PFI A;  3WUU A;  4PJ0 H;  2W6B A;  5CBN A;  1RE3 C;  1SQB D;  3BRT B;  4Y99 B;  1DEB A;  1JY3 N;  3H1H D;  1UIX A;  2K37 A;  1BGY J;  1A02 J;  4WY4 B;  2QJK C;  4D6T G;  2GUV A;  2WSE J;  2YXQ B;  1RE4 A;  1G1I A;  2PGD A;  1HVV A;  3HRN A;  2J5U A;  4PV1 D;  2QSI A;  5AVR B;  4H0L D;  2PAJ A;  2QM7 A;  4RJT A;  1PV3 A;  3AEC C;  1GK4 A;  4PD4 E;  1VQP P;  4ZMD A;  1FOS F;  1PGJ A;  1U57 A;  1FDO A;  2GA1 A;  4JBZ A;  2YKP A;  3PH0 A;  2KLU A;  5AVY B;  2R32 A;  4BRY A;  1ZN5 A;  1L0N E;  2OQQ A;  3E1I A;  5CJ4 A;  5AVW B;  1NTM J;  4JF7 A;  2HR3 A;  5APT A;  5KLV J;  2YMY A;  1VQ8 P;  2A06 E;  2KOG A;  4EOT A;  1PPJ G;  4GOE A;  4H0L B;  2I8D A;  3H1I E;  4DZO A;  1FJP A;  4B86 A;  2XND H;  1IFM A;  1FZB A;  2WPS A;  3TGU J;  2Z4E A;  3CCQ P;  1N7S D;  1CSB A;  3C1L A;  2IFM A;  1KD1 Q;  1S3J A;  5KAF E;  1ZV8 A;  3O8Z A;  5CCG C;  3D70 A;  3WMM 0;  5AW9 B;  1JO5 A;  3L74 J;  2OYI B;  1K05 A;  2JKV A;  4TLF A;  2C9N Y;  1RHZ B;  2WT7 A;  1YBK A;  3RBZ A;  4PJ0 E;  3L72 G;  1M1J A;  3AED C;  2WPV B;  1KZU B;  4NPD A;  1URQ B;  1YTZ T;  1SLQ A;  2W6A A;  1JY2 P;  5K5G B;  1RF1 C;  3C9I A;  1GL2 A;  3G6E P;  4D6T E;  5AW3 B;  3P8C D;  5BVZ A;  1QEX A;  1LTA C;  3BVH A;  2KS1 B;  3MHV A;  1YHQ P;  3H1L E;  1NTZ K;  2Q3E A;  2QJP B;  3HUS A;  1N73 B;  1K73 Q;  5AW6 B;  2H7H A;  1NHL A;  1BSH A;  2KB7 P;  1VQM P;  3WUV A;  3E1R A;  3V4Q A;  1KIL A;  2Q6Q A;  1RQV A;  1YYC A;  3S4R A;  1KYO H;  4DT0 A;  1Q90 D;  2N1T D;  1L0L K;  3H1K J;  3MGN A;  1H0T A;  4W80 A;  1DIP A;  1K9M Q;  4WB4 A;  1RY3 A;  4IFF A;  3VTP C;  4W7Z A;  1L4A C;  2WIT A;  1Q82 Q;  1USD A;  2I1K A;  4WY4 A;  3KXD A;  3L75 E;  5EFW B;  2KXP B;  3GG2 A;  3NMD A;  1S5L X;  1NU1 J;  3C8V A;  5APU A;  2W6J H;  3EWK A;  1BGY D;  4I7Z B;  3TDK A;  3A3Y B;  2IFN A;  2N1T B;  1SQB G;  2FYZ A;  1VF5 B;  1KFM A;  3H1H G;  3L72 J;  5DJU B;  5APQ A;  1SQX G;  2ZT9 D;  3B5N B;  4GIF A;  1NKN A;  2Y0E A;  4JQ0 D;  3L70 D;  5AVV B;  1HF9 A;  1GD2 E;  1FZC A;  2NPS C;  1GW4 A;  4OVN F;  3I55 P;  1EQ7 A;  3KHU A;  2XU6 A;  4L73 A;  5TJH A;  2NZ2 A;  1LJ2 A;  3Q1M A;  3LW5 H;  2M3E A;  2B89 A;  2R5D A;  4H44 C;  1NTK D;  2E42 A;  1HGV A;  2P7J A;  2XKM A;  1S2E A;  1HBW A;  5AVX B;  1NO4 A;  3HTK A;  2Q5U A;  4RO0 A;  5APS A;  3A2A A;  3BCC E;  3U1A A;  4XA4 A;  2Y9Z A;  1YI2 P;  1XTG B;  3CC4 P;  1H8A A;  3SWF A;  1ZRT E;  1LP1 B;  4TT3 H;  1NKZ B;  1L0N K;  4M3L A;  3CI9 A;  4AUW A;  1DX7 A;  1JMB A;  1GU4 A;  1VQO P;  4GOD A;  1IFI A;  2HG5 D;  2C0X A;  2CPS A;  2B9B A;  3IN6 A;  3L71 E;  3MTU E;  1URQ A;  2RKL A;  2AEJ A;  1T3U A;  1HTL C;  2D2C B;  1P84 H;  4PV1 C;  1SVF A;  2A45 I;  1VDF A;  4JPZ B;  5APY A;  2BEZ F;  3QH9 A;  3CX5 H;  1PGP A;  1SQB J;  3SWY A;  4ASW A;  1KYO I;  1KN7 A;  1MKM A;  1EZV E;  2N9Y B;  3RK2 D;  5B5E H;  3RK3 C;  1LTJ C;  3B8E B;  5AW4 B;  1SS1 A;  3EFF K;  3H1H E;  5AW5 B;  1SQX E;  1ZP0 C; 
#chains in the Genus database with same CATH homology
 3BRV B;  1KFN A;  4DOJ A;  2HPC A;  5CCH C;  3CLQ A;  3HUS C;  3HE4 B;  1QL2 A;  3KYQ A;  1SFC B;  3RK3 B;  2VRS A;  1LTJ B;  3NTN A;  5APX A;  2FKW B;  4C46 A;  1T2K D;  3L37 A;  3HD7 D;  3L35 A;  3BAS A;  4RES B;  3HUS B;  1LTS C;  1LTI C;  1N7S C;  2OYH C;  2W27 A;  1JMM A;  3MUD A;  1FZF A;  2YO2 A;  1HWT C;  3VP9 A;  1IFJ A;  2XZR A;  1Z56 A;  1L4A A;  3I5C A;  1GZL A;  1FZA A;  3GHG C;  4Y99 C;  2WTY A;  3M0D C;  1N7S B;  2OYH B;  4WY4 C;  3HD7 C;  4N3Y B;  1S9K D;  2R3C A;  5AVZ B;  2YNY A;  3N4X A;  3CL3 D;  1G2C B;  4JYC A;  1PFI A;  1FDM A;  2N1T A;  2W6B A;  1RE3 C;  3BRT B;  3GHG B;  3V5B A;  4HYT B;  4Y99 B;  1DEB A;  1N7L A;  3M9B A;  1JY3 N;  3B5N A;  1A02 J;  1J1D C;  4N6J A;  4WY4 B;  3HD7 B;  3IFM A;  2GUV A;  5AW8 B;  3HE4 A;  2XNX A;  4IFM A;  1SFC A;  1RE4 A;  5CJ0 A;  1E5W A;  1G1I A;  1LTJ A;  1HVV A;  2ZFC A;  3HRN A;  1G1J A;  4JYB A;  5AVU B;  5CMZ A;  5AVR B;  1A02 F;  2PAJ A;  2LKM A;  2QM7 A;  4O9B A;  5KJ7 D;  4I6M C;  1GK4 A;  1J1D B;  5CCH A;  2MJZ A;  2KYV A;  1NTM K;  4LLH A;  2C0W A;  3TK1 A;  2A45 H;  1LWU C;  2NPS A;  1GL2 D;  5KLV K;  1FOS F;  3H32 A;  2M3B A;  2HFE D;  2HOD A;  3UIA A;  1NOH A;  2YKP A;  2JJL A;  1NH4 A;  5AVY B;  2R32 A;  2WT7 B;  1ZN5 A;  3E1I A;  5CJ4 A;  5AVW B;  2WSE H;  1LWU B;  3M9H A;  2Q3I A;  2WZ7 A;  3M0A A;  1IK9 A;  4JF7 A;  5APT A;  1IC2 A;  1M1J B;  2YMY A;  3MD0 A;  1G2C A;  3BAT A;  3OA7 A;  3V2P A;  1S9K E;  1GU5 A;  1KIL D;  2KOG A;  4EOT A;  2YKO A;  1N2D C;  3VMZ A;  4DZO A;  1FJP A;  4B86 A;  2KP8 A;  1IFM A;  4C7N B;  1QL1 A;  1FZB A;  1RF0 C;  1FZE A;  2WPS A;  2Z4E A;  1N7S D;  1CSB A;  1GL2 B;  2IFM A;  4I1L A;  1RE3 A;  1YTZ I;  3M91 A;  2H43 A;  2KSJ A;  2OYI C;  2Q9I A;  2WPQ A;  3A5T A;  1ZV8 A;  3O8Z A;  4ZKP A;  1KIL C;  5CCG C;  3V2Q A;  3WMM 0;  1CI6 B;  1FU1 A;  2P67 A;  3V4W A;  5AW9 B;  4WY4 D;  2GM4 A;  1IFD A;  1JO5 A;  4ZKU A;  4GT1 A;  3R2P A;  2OYI B;  2O1J A;  1W2E A;  2C9N Y;  1JTH B;  2WT7 A;  1KIL B;  1URQ C;  1LT9 C;  2FXM A;  3M9Q A;  3VOP A;  1NWQ A;  1M1J A;  3VN0 A;  1N86 A;  5AVS B;  1JY3 P;  1HGZ A;  5CHX A;  3EQ2 A;  1KZU B;  2KLV A;  1GTW A;  1URQ B;  1YTZ T;  1LT9 B;  3TSI A;  1FZG A;  1SLQ A;  3IR9 A;  5KJ7 A;  2W6A A;  4EIJ A;  1WRG A;  2J59 M;  2FFD A;  2WPR A;  1JY2 P;  2CPB A;  2YO3 A;  1RF1 C;  3C9I A;  1GL2 A;  3N7N A;  5AW3 B;  4AQR D;  2IX7 C;  3P8C D;  5BVZ A;  1N73 C;  1MFZ A;  4KHX A;  2QM8 A;  1LTA C;  3BVH A;  2XV5 A;  1RF0 A;  1RF1 B;  3G3Z A;  3KQG A;  2O1K A;  1GW3 A;  2E43 A;  3NFQ A;  1NTZ K;  1LTB C;  2R5B A;  1JCC A;  2OYI A;  4WBA A;  3HUS A;  1N73 B;  1JTH A;  1FZC C;  5AW6 B;  2H7H A;  1NHL A;  2L5G B;  2KB7 P;  1FOS E;  1VPC A;  1NTK K;  1H88 A;  1GDT A;  3V4Q A;  1KIL A;  1JY3 O;  3RL0 C;  4LC1 A;  1YYC A;  1MUU A;  2HPC B;  1AQ5 A;  1J2J B;  1CW5 A;  1OWA A;  2H8P D;  2N1T D;  1FZC B;  1NAF A;  1T8Z A;  1L0L K;  1N7S A;  2OYH A;  1JY2 O;  1WT6 A;  1HH0 A;  3MGN A;  4W80 A;  4XE5 B;  2WSF H;  3V2R A;  3RL0 B;  1NU1 K;  2BAS A;  4WB4 A;  1RY3 A;  2C9L Y;  4IFF A;  3VMY A;  3VTP C;  4W7Z A;  1L4A C;  3LID A;  2WIT A;  2O01 H;  3TNU B;  3GHG A;  1SQV K;  5CCG D;  1SQX K;  3HE5 B;  5AW0 B;  1LGH B;  3L36 A;  1LTG C;  3M0D A;  2I1K A;  4WY4 A;  5APW A;  3HD7 A;  2P2U A;  1DH3 A;  2N1T C;  3KDP B;  3NMD A;  1L4A B;  3P8C E;  1HUC A;  3TYY A;  1RF1 A;  5APU A;  1URQ D;  2NPS D;  3KPE A;  1FAV A;  3B5N C;  3PP5 A;  2Q7C A;  3V2N A;  2HYN A;  3A3Y B;  2P1J A;  3HTK B;  4C7R A;  1N73 A;  1RE4 C;  3EFG A;  2GUS A;  2Z5H A;  2Z5I A;  2IFN A;  2N1T B;  2OAR A;  2FYZ A;  5APV A;  1KFM A;  4AYC A;  3MIW A;  5APQ A;  5AVQ B;  1FBM A;  3B5N B;  4GIF A;  5AVT B;  1ZR4 A;  1NKN A;  3P32 A;  4GKG A;  5AVV B;  4HH2 A;  1GD2 E;  1FZC A;  2NPS C;  1LWU A;  1XTC C;  1GW4 A;  1X8Y A;  1EQ7 A;  2M8R A;  3VYI A;  1X9V A;  4W7Y A;  3RK2 C;  1HJB A;  2IPP A;  2XU6 A;  3TNU A;  5BU5 A;  1M7L A;  3HE5 A;  1MZ9 A;  4N78 E;  1SP4 A;  2NPS B;  3LIE A;  4I2L C;  3H32 B;  5AW7 B;  1T3J A;  3VP8 A;  3M06 A;  1JUN A;  3LW5 H;  1IFN A;  1IJD B;  1JCD A;  2HOD B;  2R5D A;  4C7N A;  2E42 A;  1HGV A;  2P7J A;  3RK2 B;  3P8M C;  2XKM A;  3RL0 D;  3A7O A;  1HBW A;  5AVX B;  2XDJ A;  1T2K C;  1NO4 A;  4IFD K;  1X79 B;  1AFO A;  4OH8 B;  3HTK A;  2Q5U A;  5APS A;  1CI6 A;  3A2A A;  3U1A A;  4LGD E;  2PP6 A;  1SQQ K;  4XA4 A;  2I1J A;  1XTG B;  1H8A A;  3SWF A;  2A45 G;  1NKZ B;  5AW2 B;  2POH A;  1L0N K;  1KQL A;  1L4A D;  1ZR2 A;  1CZQ A;  5CCG A;  1OXZ A;  4M3L A;  3CI9 A;  4AUW A;  2J58 A;  2ZXE B;  1MV8 A;  1DX7 A;  5KTB A;  1GU4 A;  1JY2 N;  5AW1 B;  1FJK A;  1IFI A;  2HG5 D;  3OJA B;  2C0X A;  2WWW A;  2CPS A;  2WSC H;  2YKQ A;  3MTU E;  1URQ A;  1J1E C;  1LT9 A;  3B5N D;  1IO4 A;  4N78 D;  1SQB K;  3P7K A;  1T3U A;  3H6P A;  1M1J C;  1GK6 A;  3II6 A;  1HTL C;  3L4F A;  1SFC D;  2JEE A;  3RK3 D;  1ZLL A;  3NXS A;  3U1C A;  2N9B A;  1JOC A;  3VMX A;  1SVF A;  3T97 A;  1H89 A;  2A45 I;  2HLO A;  1VDF A;  1J1E B;  3OAK A;  5KJ7 C;  5APY A;  2FFD C;  5CCH D;  3SWY A;  2FYU K;  3U59 A;  1LTT C;  1GL2 C;  5BU8 B;  1SFC C;  1JNM A;  1SQP K;  3RK2 D;  3RK3 C;  1LTJ C;  3B8E B;  2FFD B;  5AW4 B;  5AW5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...