2WPQA

Salmonella enterica sada 479-519 fused to gcn4 adaptors (sadak3, in- register fusion)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
99
structure length
99
Chain Sequence
b'MKQIEDKIEEILSKIYHIENEIARIKKLIFDTNEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSMKQIEDKIEEILSKIYHIENEIARIKKLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 48
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wpqA00
1HUCA 2W6AA 1GD2E 5AW3B 2E42A 2ZXEB 2XU6A 3V5BA 2YO3A 5AW7B 2WPQA 3L35A 3V4WA 3I5CA 3A2AA 1HBWA 5AVYB 1JNMA 2XV5A 4XE5B 1CZQA 2R5DA 3TK1A 3B8EB 4GKGA 1G2CB 2BASA 5AVTB 5AW1B 1X8YA 1GK6A 4GT1A 4I2LC 2KP8A 2QM7A 3OAKA 3UIAA 3VMXA 1FAVA 4C7NA 3VTPC 3M91A 1JUNA 1CI6A 1OWAA 1FOSE 3T97A 4I6MC 2W27A 3MGNA 2WWWA 3MD0A 3L36A 2VRSA 4JYBA 5APYA 4EOTA 5AVSB 4C46A 1S9KD 2Q7CA 3O8ZA 2P7JA 3NMDA 1A02J 2E43A 1H89A 4M3LA 1A02F 1T2KD 3HE5A 3L37A 2Z5HA 4AUWA 3V4QA 2YO2A 2C9NY 1NWQA 3SWFA 2YNYA 1J2JB 5AVXB 1MV8A 1GK4A 1YYCA 1GU5A 3NXSA 5AW9B 1DH3A 2ZFCA 3IR9A 5AVZB 4C7NB 3KDPB 3A3YB 5AVQB 1CI6B 1CSBA 1MUUA 2Q5UA 3LIEA 3P7KA 3A7OA 3VYIA 2WPRA 1H8AA 5APVA 4HYTB 2N9BA 4RESB 1SP4A 3P32A 4JYCA 4DZOA 1MFZA 2H7HA 3HE5B 2Q3IA 4AQRD 3KQGA 2IPPA 1GZLA 1NAFA 5AW0B 2WT7A 1KQLA 3M9HA 4B86A 5AVWB 3A5TA 3M9BA 5AVUB 5APSA 4LC1A 1S9KE 5APXA 5AW2B 3NFQA 2Z5IA 2WTYA 3HE4A 5APUA 3HE4B 5CMZA 3NTNA 5APTA 3VMYA 3M06A 1HJBA 2JJLA 3M0AA 5APQA 2R3CA 5AW5B 4AYCA 5AW4B 3HTKA 3TNUA 2C9LY 3M0DA 3TNUB 1OXZA 1H88A 3TYYA 2XZRA 3P8MC 5AVRB 3VMZA 5APWA 5AW8B 1FOSF 2P67A 3LIDA 5AVVB 1IO4A 2R32A 2WT7B 2QM8A 2WPSA 1GU4A 1HWTC 1SLQA 2R5BA 5AW6B 2P2UA 1T2KC 4KHXA 3VN0A 1GTWA
chains in the Genus database with same CATH superfamily
1FZCC 4H44D 3CWBG 2E42A 2XU6A 3H1IE 3Q5RA 3A2AA 1FE6A 2NPSC 2YKPA 3B8EB 1RE4A 3L4FA 3H25A 3BCCD 3TGUJ 2KLUA 1QVFO 3IN6A 1ZW0A 3RL0g 2VRSA 1L0LE 3MIWA 1Z56A 1RF1C 2KOGA 5KLVE 3A0HH 3H32B 1VQLP 2E43A 1YITP 1FS0E 2E76C 1UIIA 1URQB 1WT6A 4IOIH 1JY2O 2YNYA 2FYZA 5B5EE 1HH0A 1KZUB 3PLNA 1BSNA 1PPJE 3OJAB 3H1IJ 1JB0J 3A7OA 4H0LD 2B9BA 1YBKA 4IFFA 5KKZC 5KAIH 1KB9I 1KQLA 5B66H 1L0LJ 3A5TA 5KLVJ 3RK3B 1E79H 1KB9H 2WTYA 3GMAA 1DD4A 2FY8A 2R3CA 4HB1A 3K5BA 1PP9D 1JY3P 2A06E 3B5NA 1RE3C 4HKZH 2K3RA 1NU1K 3C8VA 3L70D 5KTBA 2XZRA 5AVVB 2CK3H 2QJKC 2BCCG 4YPCA 1JTHB 2OTLP 4HH2A 1FZBA 2KB7P 1XTCC 1H0TB 3Q5PA 2W6JH 2ZXEB 3Q5SA 2OGUA 3D71A 1EQ7A 2OYHA 4ZMDA 1SQBK 4H44B 4U3FD 4L74A 1JM0A 2P10A 2GUSA 4H13C 1KD1Q 3O8ZA 1EC5A 2K9JB 1R8EA 1ZR2A 3AE7C 2K1AA 4IFMA 2QRXA 5K5GB 2JKVA 3A0BH 3SWFA 1DEBA 3OW2O 1GU5A 3PHLA 1AVYA 1RHZB 3PRJA 1OVUA 1S5LX 1SQVJ 1G1JA 1RH5B 3HUSC 1KFMA 2FYNB 2E5TA 1LTJA 4OVNF 1VQKP 2G3AA 3D6YA 3H1LE 1L0NJ 4IL6H 3AE4C 1FC2C 2WSEJ 1NAYA 4C7RA 1OIPA 1W2BO 3HTKA 1GW4A 3U1CA 3L75D 1PIXA 2E74B 3WMM0 2WPSA 1GDTA 1GTWA 1U57A 1N86A 3TGUD 4BXLA 3V5BA 1OZHA 3PP5A 1JY2P 2IFMA 3L74G 3R2PA 3MUDC 3U59A 1JO5A 1JCCA 3UIAA 1LWUB 1NU1E 2FYUG 1HF9A 1BGYJ 3SFEC 3L71E 1BCCE 2MJZA 3NMDA 1A02J 1N73B 1Q90D 2N1TA 1JMMA 1VPCA 3HE5A 3WUUA 1K04A 5CCHC 3H1ID 3VMAA 2AEMA 4K3AA 2O01H 1U7JA 2M3EA 2J58A 2ZVNB 5TISE 1SQBE 3AE1C 1URQC 1X22A 4WVZA 1HGZA 5KLVD 1NU1J 3G71P 1NAFA 2FKWB 1NVOA 5KJ7C 2QJPB 2WPVB 1BCCJ 1YHQP 5AW2B 5TJHA 3L73E 2IBZG 1RF0A 3WU2E 5CBNA 2PGDA 2GA1A 3CL3D 1OXZA 4EI2A 3P8MC 2FXOA 3RK3C 1SQBJ 2R32A 1J1EB 4TT3H 1SLQA 2A06G 3E7KA 5M1BA 3WUVA 1GL2B 4XE5B 3CWBE 3L73J 2BASA 5CCGC 5AW1B 3AEDC 2KS1A 1JY3N 4LGDE 2WVRA 5APYA 1VQ5P 1S9KD 1DEEG 1PGJA 3M0DC 4IFDK 1RQUA 1T2KD 2Z5HA 3H1HG 3CD6P 4H44C 4OWFA 1SQVD 3NXSA 1CW5A 1SQQK 2ZFCA 3D70A 2GM4A 3A3YB 1IFNA 2C0WA 3KPEA 1OW8A 2H8PD 2DW3A 3CWBJ 3P32A 1L0ND 4UB6E 3IFMA 4NPFX 2QJYB 2WQYC 3B5ND 1N7SB 2KIKA 1U7MA 3O6QB 5APTA 1LT9B 4YTPC 1OVVA 2FYNC 5AW5B 3EWKA 2V7QJ 1NTZJ 2D2CD 3ABVC 4XA4A 3BASA 3H1LG 1H88A 1X0TA 1ZRTE 1GU4A 3FX0A 2KXPB 2J59M 1KQFB 4O9BA 2W6AA 3CC7P 2SPZA 1LTTC 2BCCE 4BWNA 1FZGA 2E74C 3H6PA 4PD4E 1BGYD 1NJIQ 5L8RJ 2Y9ZA 1NTKG 3VMXA 2JWDA 4NPDA 1FAVA 1SQXJ 2B87B 4I6MC 2WITA 2PRRA 5C39A 1VQOP 2P7JA 1A02F 1KILB 4RJTA 1LWUC 2M5AA 3CCEP 2HPCB 1VQ4P 3N7NA 4A7PA 2BCCJ 2Y0DA 2OYOA 3FWLA 1P84E 1PGPA 2I1KA 1JY2N 3T97B 3CCQP 1N73C 1M57D 3LIEA 1FZCA 1BCCD 1EDIA 5H2FH 3AE6C 3CCSP 2XNXA 2OTJP 4ZKUA 2RN0A 2OTKE 4GDOA 4EIJA 4D6TE 1M1JC 2Z5IA 3GHGC 1KFNA 1SQQE 2JJLA 2L5GB 3AE9C 1AQ5A 1IJDB 1RF1A 2R44A 1SQBD 3B5NB 1SQPG 2QJPC 4ZKPA 5AVRB 5AW8B 1M90Q 3AEAC 1SS1A 1JEKA 3VN0A 1HUCA 2D2CB 1MKMA 1RQVA 2O1KA 4UB8H 2QIWA 1SVFA 5AW7B 3I5CA 3CX5E 2KSJA 3BVHA 4GKGA 1J1EC 2IYOA 1X8YA 3L74E 1CI6A 1S5LH 1ZMEC 4I1LA 4WY4B 3D6ZA 2JR8A 2FYUE 3I55P 2H43A 1GL2C 1RE3A 1AVOA 1VQ7P 1MZ9A 2C9NY 4R4MA 1M7LA 3R4YA 1KMIZ 3CWBD 3CXHI 1YTZT 3CMEP 1LTAC 3CXHH 2AXTH 1LT1A 3L74J 1YJ9P 1MFZA 1GMJA 1VF5D 3L72J 3RL0D 5AW0B 5E79H 2XNDH 2WT7A 2ZT9D 3F5HA 5APSA 2FYUJ 1NTZD 2LR2A 2Q3EA 3NFQA 1KYOI 5APUA 3VMYA 1IFDA 2MKVA 3V2NA 1ZP0C 1KYOH 2E75D 3HTKB 2IBZE 1T8ZA 3TNUA 2Y0CA 4JF7A 2QJYC 1N7SC 1QX8A 3FXEA 1NTKK 3LIDA 3RK2D 1HWTC 1E5WA 3M9QA 1K9MQ 1LT9C 2LKMA 5KAFH 2ITAA 3VP8A 3CLQA 2YO3A 1AA0A 3HUSA 1SQXD 2ZVOB 3TK1A 1G2CA 1JCDA 4K35A 4GT1A 4C7NA 3OA7A 4GIFA 1HGVA 2WSCJ 2HODA 3L70G 1N7LA 1Q86Q 3WU2H 2BCCD 2OYIB 5GTIE 1NWQA 3E1RA 4PD4D 2RMZA 5AVXB 1GK4A 1YYCA 3TSIA 1J1DB 2Z4EA 3H1HE 5BVZA 3KDPB 3GF7A 3Q1MA 2WZ7A 3C1LA 2M3BA 1KILC 1QGKB 2WSFH 2KSEA 1IK7A 1LTIC 3MUDA 1SQPK 1M56D 4BRYB 4CPGA 5KLIC 3MP7B 5APXA 1P84D 1KC8Q 1PFIA 2AXCA 5APQA 1VF5B 1ZN5A 2ZT9B 1DX7A 4OGQD 2R3SA 1YQ3C 3BRTB 3V2QA 2FFDB 4D6TG 5CCHA 3SWYA 1FOSF 3E1IA 2JO1A 3JCUH 1SQQG 2P2UA 4H0LB 2E75B 2HG5D 4GODA 2I8DA 1LNQA 1T3JA 3H32A 3CPWO 1WMKA 3V4WA 2WPQA 1URQA 5CHXA 3RK2B 1RY3A 1CZQA 2R5DA 2KK7A 5CBOA 3L75G 5KJ7A 3HD7D 2AEFA 1OVRA 3L36A 1NTKE 2IYPA 1X79B 3PJSK 1EZVD 3CX5D 3H1LJ 1LP1B 2JDIH 2Y9YA 4LLHA 3G6EP 4WY4C 3L74D 2HR3A 1Q82Q 3A0HE 2JP3A 1BE3G 3L72D 1LTGC 5APVA 2I1JA 2FYUD 4U7JA 3MHVA 1M8OB 2XKMA 5GTHE 3MZWB 1WRGA 4B86A 1L4AA 3PH0A 1SFCD 2C0XA 2RKLA 4RKUJ 5CMZA 2B89A 3SSUA 1DIPA 1Q81Q 5AW4B 1L0LD 5KAIE 2PAJA 3M0DA 5B66E 3MTUE 2P67A 3L71J 3FWNA 2R5BA 1SQPE 4KHXA 3RK3E 1PPJD 1PZQA 4OGQB 3RBZA 1FBMA 3V2RA 3GF3A 2A45G 2IBZD 1OMIA 4KJMA 1KV4A 1GK6A 1PL5A 2QM7A 1AJYA 3B71A 2KZJA 1H89A 3B4SA 3KZIE 3HD7B 2A06D 2M5AB 1VQMP 3ITKA 2ZYGA 3IR9A 1EZVI 3CX5I 2OYIC 3A0BE 4DJGA 4AQRD 3CX5H 1J1DC 2YXQB 1VQ6P 2YXRB 5AVUB 1ZOYC 1OFCX 3WUTA 3FXDA 1SQVG 2K9YA 1NTMG 3F89A 1EDLA 1ZR4A 1SFCB 1LWUA 3H1JG 2M8RA 1LJ2A 4IL6E 3JC22 1L0NG 2O3JA 2Q1KA 1RF0C 1VF5C 2P1JA 5AW3B 1N73A 2ZT9C 2FFDC 3VP9A 3JSVC 4W7ZA 5DJTB 1Y47A 4H0LC 3TDKA 2E75C 3AE8C 2KP8A 1N8RQ 2ZYAA 1QLED 2IZ1A 5B5EH 2H88C 2W27A 3RGUA 1M1JA 3H1LD 3GHGA 2Q7CA 3RK2C 2IBZI 3L70E 1ZXGA 2H89C 3L37A 4AUWA 2IFNA 2JWAA 3S4RA 4L75A 1BGYG 1VQPP 1S2EA 2YKQA 3VYIA 2Q3IA 4DOJA 4HJGH 4U3FE 1DD3A 1X9VA 2W83C 2L91A 1Q2NA 3HE4A 5CCHD 3NTNA 3M06A 1NU1D 2CPBA 3CMAP 3L71D 3U1AA 2WSSH 3TNUB 1GL2A 4I7ZB 3SFDC 4PV1D 4JBZA 2NPSA 1IO4A 1GW3A 3CCRP 3LW5J 1HTLC 4Y99B 3RBXA 2ZJSE 3AEEC 1FJKA 2YMYA 3TF5A 1NH4A 1JNMA 3HUSB 1ZLLA 1VQNP 1G2CB 2WSEH 1XTGB 1G1IA 3QWOC 1EXJA 1S1CX 1QEXA 3MGNA 4OGQC 2HODB 2KUBA 3L75E 4C46A 3RK3D 3L73D 1Y8AA 3KHUA 1HVVA 3P8CE 4XFJA 4D6TJ 2N1TD 1N7SA 3AE3C 1SQQJ 2OYHB 2QG4A 4ZNCA 3O6QA 3GG2A 3KXDA 1BDCA 1LT9A 1MUUA 1EXIA 3EFGA 3H1KG 2Q9IA 1L4AD 2V4HA 1SQVK 4Z1MH 1PV3A 1NGMB 3HD7C 2UWJE 1BE3E 1NTMK 4WB4A 1GZLA 1D7MA 3CCMP 4LC1A 1L0NK 2HYNA 3S1KA 2CPSA 2LXCB 3BCCG 2KZIA 1QL2A 5EFWB 3I56P 2LXBA 3W68A 2KNCA 1LTJB 2O1JA 2B87A 4ASVA 1NHLA 2QVAA 1BE3J 4PV1B 4WWIA 2E5YA 1KILA 2KYVA 1NTZG 1SFCC 1IC2A 3G3ZA 2HPCA 1Y9BA 2HFED 2YIUB 5GTHH 2FXMA 4JPZB 3T97A 3VOPA 2QA4P 5TISH 1USEA 1T3UA 2QSIA 3HRNA 1FJPA 3PTZA 3CC2P 2O01N 1J2JB 1PP9G 2E74D 1SQXG 2W90A 4ASWA 1KORA 1ZRTD 1USDA 2Q5UA 3P7KA 3BRVB 4DCKA 2K88A 2N1TB 1SP4A 1KILE 2J5UA 1RE4C 3HE5B 3AE2C 3ZDMA 1KQSO 3M9HA 1L4AB 3KYQA 1S9KE 1ZV8A 5H2FE 2W6BA 1VQ8P 3V6IA 4AYCA 2WMMA 4U3FG 1IFPA 3GW6A 1IK9A 4TLFA 1SQVE 5BU8B 3TYYA 3KZIH 1AV1A 1NTME 3AEBC 1T2KC 3H1JE 4WY4A 1GD2E 1L0NE 4I7ZC 2OARA 3RL0B 3L35A 1Q7YQ 4GOFA 5AVYB 1NKNA 3H1HJ 2ZYDA 2Y0EA 3USSA 4Y99C 3CI9A 2G8YA 4I2LC 3EFFK 2P58A 3EQ2A 3M91A 1OWAA 2V7QH 2NRGA 4UB8E 4JYBA 2IDBA 4PJ0E 4D6TD 4N78E 4N3YB 3B5NC 4M3LA 1SQQD 4JQ0D 1NTMJ 2GUVA 2B88A 5CJ0A 3Q3DA 1S5LE 3IAOA 3H1JJ 4UB6H 5AW9B 2KS1B 2D2CC 4W80A 3Q2YA 1FZEA 1MFTA 1YJWP 1IZNB 1TU3F 1LGHB 1K73Q 1BGYE 4JYCA 1YIJP 1FDOA 2QEXP 4N6JA 2OYHC 3TGUG 4EYYQ 3P8CD 5AVWB 1GL2D 3CXHE 2FXPA 2AXTE 1JOCA 1EZVG 1LTBC 2NPSD 3M0AA 1NTZK 5E79E 4PD4I 3L72G 1BE3D 1IFIA 4OH8B 2AEJA 4PD4H 1NTKJ 1JMBA 5CCGA 5AW6B 1KQGB 2E76D 1JTHA 4GOEA 1VL2A 2KLVA 2POHA 1H0TA 1KYOE 3H1IG 3C9IA 2JEEA 3LW5H 2IZ0A 1LTJC 4WBAA 2OYIA 1NO4A 1EDJA 1L0LG 1S72P 3OAKA 1KB9E 5KLVG 3VTPC 5KAFE 1P84I 1SQXK 4PV1C 3MD0A 5AVSB 5BU5A 1M1JB 1N7SD 1P84H 2K9JA 3GHGB 4EDFA 1W5CE 1PPJG 3N4XA 2YIUC 4BRYA 1L2PA 1DH3A 5AVZB 1KN7A 1CSBA 1FU1A 2ZAEB 2WPRA 1H8AA 3IF4A 4L73A 2N9BA 4RESB 2YMKA 3H1KE 4DZOA 2FFDA 2N9YB 1SQPJ 4R4LA 2PP6A 3HE4B 4YXDC 2N1TC 1FZCB 3BCCE 1OX3A 4H13D 1L4AC 1KILD 2NPSB 4MN4C 1W2EA 2QM8A 3CC4P 3CCUP 3V2PA 3S9OA 3H1HD 3H1KJ 2M0BA 4IL6X 1T6AA 1RF1B 5CJ4A 4RO0A 1HBWA 1S3JA 1FZFA 2XV5A 1R5SA 2E76B 3JCUE 3CCLP 1LP1A 1NTZE 1K8AQ 3AECC 2WSFJ 3AEGC 2KI7B 1JUNA 1YJNP 1NTMD 2IX7C 3G9RA 4EOTA 1KTMA 1VQ9P 3RL0C 2YKOA 3BCCJ 1PGQA 3H1JD 4L76A 1BSHA 2YO2A 3GLMA 4KT0J 5KKZB 3FGAD 1IFJA 4QMAA 3CCJP 5AVQB 1CI6B 1PP9E 1PGOA 1SQXE 4HYTB 4N78D 2PFXA 3KQGA 2WSCH 2IPPA 1OW7A 1YQ4C 2A45I 3M9BA 4Y28J 2FYUK 2QJKB 2A45H 1M1KQ 1YI2P 1HJBA 1NKZB 1NTKD 4WY4D 2KNCB 3VMZA 3BATA 1BDDA 3AE5C 3CCVP 1PP9J 1L0LK 2WT7B 5KLVK 4YXWH 2OQQA 3CXHD 3L70J 1AQTA 4H13B 1QL1A 1AFOA 1FZAA 1IFMA 2BEQD 3HD7A 1N2DC 1NU1G 1JY3O 2XDJA 5AVTB 3QH9A 3L71G 4DT0A 5GTIH 1R5LA 1URQD 1BCCG 5KLIB 1FOSE 2WWWA 1FDMA 1S4XA 1KYOD 5KJ7D 3AEFC 4U3FJ 2O01J 3V4QA 2BEZF 1MV8A 1SQBG 1K05A 4C7NB 1KB9D 1NYHA 2Q6QA 1SQPD 1UIXA 2W8ZA 5DJUB 2RH0A 2ZXXA 1NOHA 2H7HA 1SFCA 3L73G 3SWKA 2HLOA 1YTZI 4W7YA 1EDKA 3G4SP 2QE7H 3TGUE 1VDFA 1FDIA 2NZ2A 4NPEA 5CCGD 3W67A 4PJ0H 1EZVE 2C9LY 2K37A 1QVGO 3H1KD 3II6A 5APWA 1HJ0A 1LTSC 3L75J 3L72E 2FBWC 1OW6A
chains in the Genus database with same CATH topology
4WY4A 2W6AA 1GD2E 1FZCC 1LTTC 1FBMA 2E42A 1FZGA 2OARA 2XU6A 3RL0B 3H6PA 3L35A 3V2RA 3A2AA 5AVYB 2NPSC 2YKPA 2A45G 1NKNA 3B8EB 1RE4A 3L4FA 4Y99C 3CI9A 4I2LC 1GK6A 3VMXA 2QM7A 1FAVA 3M91A 3EQ2A 1OWAA 4I6MC 2WITA 2VRSA 4JYBA 3MIWA 1Z56A 1RF1C 4N78E 2KOGA 4N3YB 2P7JA 3H32B 2E43A 1H89A 3B5NC 4M3LA 1A02F 1KILB 1URQB 2GUVA 3HD7B 1WT6A 1LWUC 5CJ0A 1JY2O 2YNYA 2FYZA 2HPCB 1HH0A 3N7NA 5AW9B 1KZUB 3IR9A 4W80A 2I1KA 1JY2N 3OJAB 1N73C 3LIEA 1FZEA 3A7OA 1LGHB 1FZCA 2OYIC 4IFFA 4JYCA 4AQRD 1J1DC 2XNXA 4N6JA 2OYHC 1KQLA 4ZKUA 3P8CD 5AVWB 3A5TA 1GL2D 4EIJA 5AVUB 3RK3B 1JOCA 1M1JC 2Z5IA 1LTBC 2NPSD 2WTYA 3GHGC 1KFNA 2L5GB 2JJLA 1AQ5A 3M0AA 2R3CA 1IJDB 1RF1A 1JY3P 1NTZK 1RE3C 3B5NA 3B5NB 1NU1K 1ZR4A 4ZKPA 1SFCB 1IFIA 1LWUA 2XZRA 4OH8B 5AVRB 2M8RA 5KTBA 5AW8B 5AVVB 5CCGA 5AW6B 1JTHA 1RF0C 1JTHB 4HH2A 1FZBA 3VN0A 2KLVA 2KB7P 2POHA 1XTCC 1HUCA 2O1KA 2P1JA 5AW3B 1N73A 3C9IA 1SVFA 2ZXEB 2JEEA 5AW7B 3LW5H 3I5CA 1LTJC 4WBAA 2OYIA 2FFDC 2KSJA 1NO4A 3VP9A 3BVHA 4GKGA 1J1EC 4W7ZA 1EQ7A 1X8YA 2OYHA 2KP8A 3OAKA 1SQBK 3VTPC 1CI6A 1SQXK 4I1LA 2W27A 3MD0A 2GUSA 1M1JA 5AVSB 5BU5A 1M1JB 1N7SD 4WY4B 3GHGA 2Q7CA 3O8ZA 3GHGB 3RK2C 2H43A 1ZR2A 1GL2C 3L37A 4IFMA 1RE3A 4AUWA 1MZ9A 3N4XA 2C9NY 3SWFA 1DEBA 1M7LA 2IFNA 1GU5A 1DH3A 1YTZT 5AVZB 1LTAC 1CSBA 1FU1A 2YKQA 3VYIA 1G1JA 2WPRA 1H8AA 3HUSC 1KFMA 2N9BA 4RESB 4DZOA 1MFZA 1LTJA 2Q3IA 2FFDA 4DOJA 3RL0D 5AW0B 2WT7A 1X9VA 5APSA 3NFQA 3HE4A 5CCHD 5APUA 2PP6A 3HE4B 3NTNA 3VMYA 3M06A 2CPBA 1IFDA 2N1TC 3V2NA 4C7RA 3HTKA 1GW4A 3U1AA 3HTKB 3U1CA 1FZCB 1T8ZA 3TNUA 3TNUB 1GL2A 4JF7A 1L4AC 2NPSA 1N7SC 1KILD 2NPSB 1IO4A 1GW3A 3WMM0 1NTKK 3LIDA 3RK2D 1W2EA 1HWTC 2QM8A 2WPSA 1GDTA 1E5WA 1HTLC 3M9QA 4Y99B 1LT9C 1GTWA 2LKMA 3V2PA 1FJKA 1N86A 3VP8A 3V5BA 2YMYA 3CLQA 2YO3A 1RF1B 3PP5A 1JY2P 5CJ4A 2IFMA 1NH4A 3HUSA 3R2PA 1FZFA 1JNMA 1HBWA 3HUSB 2XV5A 1ZLLA 3TK1A 1G2CA 3U59A 1G2CB 2WSEH 1JCDA 1JO5A 1XTGB 1JCCA 1G1IA 4GT1A 3UIAA 1LWUB 4C7NA 3OA7A 1JUNA 4GIFA 2IX7C 1HGVA 3MGNA 2HODA 1N7LA 2HODB 4EOTA 3RL0C 2YKOA 4C46A 2MJZA 3NMDA 3RK3D 1A02J 1N73B 2N1TA 1JMMA 1VPCA 3HE5A 1HVVA 2OYIB 2YO2A 5CCHC 3P8CE 1NWQA 2N1TD 1N7SA 5AVXB 1GK4A 1YYCA 3TSIA 1J1DB 2Z4EA 1IFJA 2OYHB 5BVZA 2O01H 3KDPB 5AVQB 1CI6B 1LT9A 2J58A 2WZ7A 1MUUA 3EFGA 2M3BA 2Q9IA 1L4AD 1KILC 1SQVK 1URQC 2WSFH 3HD7C 4HYTB 4N78D 1HGZA 1LTIC 1NTMK 3KQGA 3MUDA 4WB4A 2WSCH 2IPPA 1GZLA 1NAFA 1SQPK 2FKWB 5KJ7C 2A45I 3M9BA 4LC1A 1L0NK 2FYUK 2HYNA 5APXA 5AW2B 2CPSA 1RF0A 2A45H 1HJBA 1PFIA 1NKZB 1QL2A 5APQA 1ZN5A 4WY4D 1DX7A 3CL3D 3BRTB 3V2QA 1OXZA 1LTJB 2O1JA 2FFDB 5CCHA 3SWYA 3P8MC 3VMZA 1FOSF 3BATA 3RK3C 3E1IA 2R32A 1L0LK 1J1EB 2WT7B 1SLQA 5KLVK 2P2UA 1NHLA 2HG5D 1T3JA 3H32A 1KILA 1QL1A 2KYVA 3V4WA 1FZAA 1IFMA 2WPQA 1AFOA 1URQA 5CHXA 3RK2B 1RY3A 3HD7A 1N2DC 1SFCC 1GL2B 1IC2A 4XE5B 1CZQA 2R5DA 1JY3O 3G3ZA 2XDJA 2BASA 5CCGC 2HPCA 5AVTB 5AW1B 2HFED 1URQD 5KJ7A 2FXMA 3HD7D 1FOSE 3T97A 3VOPA 1JY3N 4LGDE 2WWWA 1FDMA 3L36A 5APYA 1S9KD 1X79B 5KJ7D 3M0DC 4IFDK 1T3UA 1T2KD 3HRNA 2Z5HA 1FJPA 3V4QA 1J2JB 1MV8A 3NXSA 1CW5A 1SQQK 2ZFCA 4C7NB 4LLHA 2GM4A 4WY4C 3A3YB 1IFNA 2C0WA 3KPEA 2Q5UA 3P7KA 3BRVB 2H8PD 1LTGC 1NOHA 5APVA 2N1TB 1SP4A 2I1JA 3P32A 3IFMA 2H7HA 1RE4C 3HE5B 1SFCA 2XKMA 2HLOA 1WRGA 1YTZI 3M9HA 4B86A 1L4AA 3B5ND 1L4AB 3KYQA 1N7SB 1S9KE 4W7YA 1SFCD 2C0XA 5CMZA 5APTA 1VDFA 1LT9B 5CCGD 1ZV8A 2W6BA 5AW5B 4AYCA 5AW4B 2C9LY 2PAJA 3M0DA 4XA4A 1IK9A 3BASA 1H88A 5BU8B 3II6A 3TYYA 3MTUE 5APWA 2P67A 1LTSC 1GU4A 2R5BA 2J59M 1T2KC 4KHXA 4O9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUC A;  2W6A A;  1GD2 E;  5AW3 B;  2E42 A;  2ZXE B;  2XU6 A;  3V5B A;  2YO3 A;  5AW7 B;  2WPQ A;  3L35 A;  3V4W A;  3I5C A;  3A2A A;  1HBW A;  5AVY B;  1JNM A;  2XV5 A;  4XE5 B;  1CZQ A;  2R5D A;  3TK1 A;  3B8E B;  4GKG A;  1G2C B;  2BAS A;  5AVT B;  5AW1 B;  1X8Y A;  1GK6 A;  4GT1 A;  4I2L C;  2KP8 A;  2QM7 A;  3OAK A;  3UIA A;  3VMX A;  1FAV A;  4C7N A;  3VTP C;  3M91 A;  1JUN A;  1CI6 A;  1OWA A;  1FOS E;  3T97 A;  4I6M C;  2W27 A;  3MGN A;  2WWW A;  3MD0 A;  3L36 A;  2VRS A;  4JYB A;  5APY A;  4EOT A;  5AVS B;  4C46 A;  1S9K D;  2Q7C A;  3O8Z A;  2P7J A;  3NMD A;  1A02 J;  2E43 A;  1H89 A;  4M3L A;  1A02 F;  1T2K D;  3HE5 A;  3L37 A;  2Z5H A;  4AUW A;  3V4Q A;  2YO2 A;  2C9N Y;  1NWQ A;  3SWF A;  2YNY A;  1J2J B;  5AVX B;  1MV8 A;  1GK4 A;  1YYC A;  1GU5 A;  3NXS A;  5AW9 B;  1DH3 A;  2ZFC A;  3IR9 A;  5AVZ B;  4C7N B;  3KDP B;  3A3Y B;  5AVQ B;  1CI6 B;  1CSB A;  1MUU A;  2Q5U A;  3LIE A;  3P7K A;  3A7O A;  3VYI A;  2WPR A;  1H8A A;  5APV A;  4HYT B;  2N9B A;  4RES B;  1SP4 A;  3P32 A;  4JYC A;  4DZO A;  1MFZ A;  2H7H A;  3HE5 B;  2Q3I A;  4AQR D;  3KQG A;  2IPP A;  1GZL A;  1NAF A;  5AW0 B;  2WT7 A;  1KQL A;  3M9H A;  4B86 A;  5AVW B;  3A5T A;  3M9B A;  5AVU B;  5APS A;  4LC1 A;  1S9K E;  5APX A;  5AW2 B;  3NFQ A;  2Z5I A;  2WTY A;  3HE4 A;  5APU A;  3HE4 B;  5CMZ A;  3NTN A;  5APT A;  3VMY A;  3M06 A;  1HJB A;  2JJL A;  3M0A A;  5APQ A;  2R3C A;  5AW5 B;  4AYC A;  5AW4 B;  3HTK A;  3TNU A;  2C9L Y;  3M0D A;  3TNU B;  1OXZ A;  1H88 A;  3TYY A;  2XZR A;  3P8M C;  5AVR B;  3VMZ A;  5APW A;  5AW8 B;  1FOS F;  2P67 A;  3LID A;  5AVV B;  1IO4 A;  2R32 A;  2WT7 B;  2QM8 A;  2WPS A;  1GU4 A;  1HWT C;  1SLQ A;  2R5B A;  5AW6 B;  2P2U A;  1T2K C;  4KHX A;  3VN0 A;  1GTW A; 
#chains in the Genus database with same CATH topology
 1FZC C;  4H44 D;  3CWB G;  2E42 A;  2XU6 A;  3H1I E;  3Q5R A;  3A2A A;  1FE6 A;  2NPS C;  2YKP A;  3B8E B;  1RE4 A;  3L4F A;  3H25 A;  3BCC D;  3TGU J;  2KLU A;  1QVF O;  3IN6 A;  1ZW0 A;  3RL0 g;  2VRS A;  1L0L E;  3MIW A;  1Z56 A;  1RF1 C;  2KOG A;  5KLV E;  3A0H H;  3H32 B;  1VQL P;  2E43 A;  1YIT P;  1FS0 E;  2E76 C;  1UII A;  1URQ B;  1WT6 A;  4IOI H;  1JY2 O;  2YNY A;  2FYZ A;  5B5E E;  1HH0 A;  1KZU B;  3PLN A;  1BSN A;  1PPJ E;  3OJA B;  3H1I J;  1JB0 J;  3A7O A;  4H0L D;  2B9B A;  1YBK A;  4IFF A;  5KKZ C;  5KAI H;  1KB9 I;  1KQL A;  5B66 H;  1L0L J;  3A5T A;  5KLV J;  3RK3 B;  1E79 H;  1KB9 H;  2WTY A;  3GMA A;  1DD4 A;  2FY8 A;  2R3C A;  4HB1 A;  3K5B A;  1PP9 D;  1JY3 P;  2A06 E;  3B5N A;  1RE3 C;  4HKZ H;  2K3R A;  1NU1 K;  3C8V A;  3L70 D;  5KTB A;  2XZR A;  5AVV B;  2CK3 H;  2QJK C;  2BCC G;  4YPC A;  1JTH B;  2OTL P;  4HH2 A;  1FZB A;  2KB7 P;  1XTC C;  1H0T B;  3Q5P A;  2W6J H;  2ZXE B;  3Q5S A;  2OGU A;  3D71 A;  1EQ7 A;  2OYH A;  4ZMD A;  1SQB K;  4H44 B;  4U3F D;  4L74 A;  1JM0 A;  2P10 A;  2GUS A;  4H13 C;  1KD1 Q;  3O8Z A;  1EC5 A;  2K9J B;  1R8E A;  1ZR2 A;  3AE7 C;  2K1A A;  4IFM A;  2QRX A;  5K5G B;  2JKV A;  3A0B H;  3SWF A;  1DEB A;  3OW2 O;  1GU5 A;  3PHL A;  1AVY A;  1RHZ B;  3PRJ A;  1OVU A;  1S5L X;  1SQV J;  1G1J A;  1RH5 B;  3HUS C;  1KFM A;  2FYN B;  2E5T A;  1LTJ A;  4OVN F;  1VQK P;  2G3A A;  3D6Y A;  3H1L E;  1L0N J;  4IL6 H;  3AE4 C;  1FC2 C;  2WSE J;  1NAY A;  4C7R A;  1OIP A;  1W2B O;  3HTK A;  1GW4 A;  3U1C A;  3L75 D;  1PIX A;  2E74 B;  3WMM 0;  2WPS A;  1GDT A;  1GTW A;  1U57 A;  1N86 A;  3TGU D;  4BXL A;  3V5B A;  1OZH A;  3PP5 A;  1JY2 P;  2IFM A;  3L74 G;  3R2P A;  3MUD C;  3U59 A;  1JO5 A;  1JCC A;  3UIA A;  1LWU B;  1NU1 E;  2FYU G;  1HF9 A;  1BGY J;  3SFE C;  3L71 E;  1BCC E;  2MJZ A;  3NMD A;  1A02 J;  1N73 B;  1Q90 D;  2N1T A;  1JMM A;  1VPC A;  3HE5 A;  3WUU A;  1K04 A;  5CCH C;  3H1I D;  3VMA A;  2AEM A;  4K3A A;  2O01 H;  1U7J A;  2M3E A;  2J58 A;  2ZVN B;  5TIS E;  1SQB E;  3AE1 C;  1URQ C;  1X22 A;  4WVZ A;  1HGZ A;  5KLV D;  1NU1 J;  3G71 P;  1NAF A;  2FKW B;  1NVO A;  5KJ7 C;  2QJP B;  2WPV B;  1BCC J;  1YHQ P;  5AW2 B;  5TJH A;  3L73 E;  2IBZ G;  1RF0 A;  3WU2 E;  5CBN A;  2PGD A;  2GA1 A;  3CL3 D;  1OXZ A;  4EI2 A;  3P8M C;  2FXO A;  3RK3 C;  1SQB J;  2R32 A;  1J1E B;  4TT3 H;  1SLQ A;  2A06 G;  3E7K A;  5M1B A;  3WUV A;  1GL2 B;  4XE5 B;  3CWB E;  3L73 J;  2BAS A;  5CCG C;  5AW1 B;  3AED C;  2KS1 A;  1JY3 N;  4LGD E;  2WVR A;  5APY A;  1VQ5 P;  1S9K D;  1DEE G;  1PGJ A;  3M0D C;  4IFD K;  1RQU A;  1T2K D;  2Z5H A;  3H1H G;  3CD6 P;  4H44 C;  4OWF A;  1SQV D;  3NXS A;  1CW5 A;  1SQQ K;  2ZFC A;  3D70 A;  2GM4 A;  3A3Y B;  1IFN A;  2C0W A;  3KPE A;  1OW8 A;  2H8P D;  2DW3 A;  3CWB J;  3P32 A;  1L0N D;  4UB6 E;  3IFM A;  4NPF X;  2QJY B;  2WQY C;  3B5N D;  1N7S B;  2KIK A;  1U7M A;  3O6Q B;  5APT A;  1LT9 B;  4YTP C;  1OVV A;  2FYN C;  5AW5 B;  3EWK A;  2V7Q J;  1NTZ J;  2D2C D;  3ABV C;  4XA4 A;  3BAS A;  3H1L G;  1H88 A;  1X0T A;  1ZRT E;  1GU4 A;  3FX0 A;  2KXP B;  2J59 M;  1KQF B;  4O9B A;  2W6A A;  3CC7 P;  2SPZ A;  1LTT C;  2BCC E;  4BWN A;  1FZG A;  2E74 C;  3H6P A;  4PD4 E;  1BGY D;  1NJI Q;  5L8R J;  2Y9Z A;  1NTK G;  3VMX A;  2JWD A;  4NPD A;  1FAV A;  1SQX J;  2B87 B;  4I6M C;  2WIT A;  2PRR A;  5C39 A;  1VQO P;  2P7J A;  1A02 F;  1KIL B;  4RJT A;  1LWU C;  2M5A A;  3CCE P;  2HPC B;  1VQ4 P;  3N7N A;  4A7P A;  2BCC J;  2Y0D A;  2OYO A;  3FWL A;  1P84 E;  1PGP A;  2I1K A;  1JY2 N;  3T97 B;  3CCQ P;  1N73 C;  1M57 D;  3LIE A;  1FZC A;  1BCC D;  1EDI A;  5H2F H;  3AE6 C;  3CCS P;  2XNX A;  2OTJ P;  4ZKU A;  2RN0 A;  2OTK E;  4GDO A;  4EIJ A;  4D6T E;  1M1J C;  2Z5I A;  3GHG C;  1KFN A;  1SQQ E;  2JJL A;  2L5G B;  3AE9 C;  1AQ5 A;  1IJD B;  1RF1 A;  2R44 A;  1SQB D;  3B5N B;  1SQP G;  2QJP C;  4ZKP A;  5AVR B;  5AW8 B;  1M90 Q;  3AEA C;  1SS1 A;  1JEK A;  3VN0 A;  1HUC A;  2D2C B;  1MKM A;  1RQV A;  2O1K A;  4UB8 H;  2QIW A;  1SVF A;  5AW7 B;  3I5C A;  3CX5 E;  2KSJ A;  3BVH A;  4GKG A;  1J1E C;  2IYO A;  1X8Y A;  3L74 E;  1CI6 A;  1S5L H;  1ZME C;  4I1L A;  4WY4 B;  3D6Z A;  2JR8 A;  2FYU E;  3I55 P;  2H43 A;  1GL2 C;  1RE3 A;  1AVO A;  1VQ7 P;  1MZ9 A;  2C9N Y;  4R4M A;  1M7L A;  3R4Y A;  1KMI Z;  3CWB D;  3CXH I;  1YTZ T;  3CME P;  1LTA C;  3CXH H;  2AXT H;  1LT1 A;  3L74 J;  1YJ9 P;  1MFZ A;  1GMJ A;  1VF5 D;  3L72 J;  3RL0 D;  5AW0 B;  5E79 H;  2XND H;  2WT7 A;  2ZT9 D;  3F5H A;  5APS A;  2FYU J;  1NTZ D;  2LR2 A;  2Q3E A;  3NFQ A;  1KYO I;  5APU A;  3VMY A;  1IFD A;  2MKV A;  3V2N A;  1ZP0 C;  1KYO H;  2E75 D;  3HTK B;  2IBZ E;  1T8Z A;  3TNU A;  2Y0C A;  4JF7 A;  2QJY C;  1N7S C;  1QX8 A;  3FXE A;  1NTK K;  3LID A;  3RK2 D;  1HWT C;  1E5W A;  3M9Q A;  1K9M Q;  1LT9 C;  2LKM A;  5KAF H;  2ITA A;  3VP8 A;  3CLQ A;  2YO3 A;  1AA0 A;  3HUS A;  1SQX D;  2ZVO B;  3TK1 A;  1G2C A;  1JCD A;  4K35 A;  4GT1 A;  4C7N A;  3OA7 A;  4GIF A;  1HGV A;  2WSC J;  2HOD A;  3L70 G;  1N7L A;  1Q86 Q;  3WU2 H;  2BCC D;  2OYI B;  5GTI E;  1NWQ A;  3E1R A;  4PD4 D;  2RMZ A;  5AVX B;  1GK4 A;  1YYC A;  3TSI A;  1J1D B;  2Z4E A;  3H1H E;  5BVZ A;  3KDP B;  3GF7 A;  3Q1M A;  2WZ7 A;  3C1L A;  2M3B A;  1KIL C;  1QGK B;  2WSF H;  2KSE A;  1IK7 A;  1LTI C;  3MUD A;  1SQP K;  1M56 D;  4BRY B;  4CPG A;  5KLI C;  3MP7 B;  5APX A;  1P84 D;  1KC8 Q;  1PFI A;  2AXC A;  5APQ A;  1VF5 B;  1ZN5 A;  2ZT9 B;  1DX7 A;  4OGQ D;  2R3S A;  1YQ3 C;  3BRT B;  3V2Q A;  2FFD B;  4D6T G;  5CCH A;  3SWY A;  1FOS F;  3E1I A;  2JO1 A;  3JCU H;  1SQQ G;  2P2U A;  4H0L B;  2E75 B;  2HG5 D;  4GOD A;  2I8D A;  1LNQ A;  1T3J A;  3H32 A;  3CPW O;  1WMK A;  3V4W A;  2WPQ A;  1URQ A;  5CHX A;  3RK2 B;  1RY3 A;  1CZQ A;  2R5D A;  2KK7 A;  5CBO A;  3L75 G;  5KJ7 A;  3HD7 D;  2AEF A;  1OVR A;  3L36 A;  1NTK E;  2IYP A;  1X79 B;  3PJS K;  1EZV D;  3CX5 D;  3H1L J;  1LP1 B;  2JDI H;  2Y9Y A;  4LLH A;  3G6E P;  4WY4 C;  3L74 D;  2HR3 A;  1Q82 Q;  3A0H E;  2JP3 A;  1BE3 G;  3L72 D;  1LTG C;  5APV A;  2I1J A;  2FYU D;  4U7J A;  3MHV A;  1M8O B;  2XKM A;  5GTH E;  3MZW B;  1WRG A;  4B86 A;  1L4A A;  3PH0 A;  1SFC D;  2C0X A;  2RKL A;  4RKU J;  5CMZ A;  2B89 A;  3SSU A;  1DIP A;  1Q81 Q;  5AW4 B;  1L0L D;  5KAI E;  2PAJ A;  3M0D A;  5B66 E;  3MTU E;  2P67 A;  3L71 J;  3FWN A;  2R5B A;  1SQP E;  4KHX A;  3RK3 E;  1PPJ D;  1PZQ A;  4OGQ B;  3RBZ A;  1FBM A;  3V2R A;  3GF3 A;  2A45 G;  2IBZ D;  1OMI A;  4KJM A;  1KV4 A;  1GK6 A;  1PL5 A;  2QM7 A;  1AJY A;  3B71 A;  2KZJ A;  1H89 A;  3B4S A;  3KZI E;  3HD7 B;  2A06 D;  2M5A B;  1VQM P;  3ITK A;  2ZYG A;  3IR9 A;  1EZV I;  3CX5 I;  2OYI C;  3A0B E;  4DJG A;  4AQR D;  3CX5 H;  1J1D C;  2YXQ B;  1VQ6 P;  2YXR B;  5AVU B;  1ZOY C;  1OFC X;  3WUT A;  3FXD A;  1SQV G;  2K9Y A;  1NTM G;  3F89 A;  1EDL A;  1ZR4 A;  1SFC B;  1LWU A;  3H1J G;  2M8R A;  1LJ2 A;  4IL6 E;  3JC2 2;  1L0N G;  2O3J A;  2Q1K A;  1RF0 C;  1VF5 C;  2P1J A;  5AW3 B;  1N73 A;  2ZT9 C;  2FFD C;  3VP9 A;  3JSV C;  4W7Z A;  5DJT B;  1Y47 A;  4H0L C;  3TDK A;  2E75 C;  3AE8 C;  2KP8 A;  1N8R Q;  2ZYA A;  1QLE D;  2IZ1 A;  5B5E H;  2H88 C;  2W27 A;  3RGU A;  1M1J A;  3H1L D;  3GHG A;  2Q7C A;  3RK2 C;  2IBZ I;  3L70 E;  1ZXG A;  2H89 C;  3L37 A;  4AUW A;  2IFN A;  2JWA A;  3S4R A;  4L75 A;  1BGY G;  1VQP P;  1S2E A;  2YKQ A;  3VYI A;  2Q3I A;  4DOJ A;  4HJG H;  4U3F E;  1DD3 A;  1X9V A;  2W83 C;  2L91 A;  1Q2N A;  3HE4 A;  5CCH D;  3NTN A;  3M06 A;  1NU1 D;  2CPB A;  3CMA P;  3L71 D;  3U1A A;  2WSS H;  3TNU B;  1GL2 A;  4I7Z B;  3SFD C;  4PV1 D;  4JBZ A;  2NPS A;  1IO4 A;  1GW3 A;  3CCR P;  3LW5 J;  1HTL C;  4Y99 B;  3RBX A;  2ZJS E;  3AEE C;  1FJK A;  2YMY A;  3TF5 A;  1NH4 A;  1JNM A;  3HUS B;  1ZLL A;  1VQN P;  1G2C B;  2WSE H;  1XTG B;  1G1I A;  3QWO C;  1EXJ A;  1S1C X;  1QEX A;  3MGN A;  4OGQ C;  2HOD B;  2KUB A;  3L75 E;  4C46 A;  3RK3 D;  3L73 D;  1Y8A A;  3KHU A;  1HVV A;  3P8C E;  4XFJ A;  4D6T J;  2N1T D;  1N7S A;  3AE3 C;  1SQQ J;  2OYH B;  2QG4 A;  4ZNC A;  3O6Q A;  3GG2 A;  3KXD A;  1BDC A;  1LT9 A;  1MUU A;  1EXI A;  3EFG A;  3H1K G;  2Q9I A;  1L4A D;  2V4H A;  1SQV K;  4Z1M H;  1PV3 A;  1NGM B;  3HD7 C;  2UWJ E;  1BE3 E;  1NTM K;  4WB4 A;  1GZL A;  1D7M A;  3CCM P;  4LC1 A;  1L0N K;  2HYN A;  3S1K A;  2CPS A;  2LXC B;  3BCC G;  2KZI A;  1QL2 A;  5EFW B;  3I56 P;  2LXB A;  3W68 A;  2KNC A;  1LTJ B;  2O1J A;  2B87 A;  4ASV A;  1NHL A;  2QVA A;  1BE3 J;  4PV1 B;  4WWI A;  2E5Y A;  1KIL A;  2KYV A;  1NTZ G;  1SFC C;  1IC2 A;  3G3Z A;  2HPC A;  1Y9B A;  2HFE D;  2YIU B;  5GTH H;  2FXM A;  4JPZ B;  3T97 A;  3VOP A;  2QA4 P;  5TIS H;  1USE A;  1T3U A;  2QSI A;  3HRN A;  1FJP A;  3PTZ A;  3CC2 P;  2O01 N;  1J2J B;  1PP9 G;  2E74 D;  1SQX G;  2W90 A;  4ASW A;  1KOR A;  1ZRT D;  1USD A;  2Q5U A;  3P7K A;  3BRV B;  4DCK A;  2K88 A;  2N1T B;  1SP4 A;  1KIL E;  2J5U A;  1RE4 C;  3HE5 B;  3AE2 C;  3ZDM A;  1KQS O;  3M9H A;  1L4A B;  3KYQ A;  1S9K E;  1ZV8 A;  5H2F E;  2W6B A;  1VQ8 P;  3V6I A;  4AYC A;  2WMM A;  4U3F G;  1IFP A;  3GW6 A;  1IK9 A;  4TLF A;  1SQV E;  5BU8 B;  3TYY A;  3KZI H;  1AV1 A;  1NTM E;  3AEB C;  1T2K C;  3H1J E;  4WY4 A;  1GD2 E;  1L0N E;  4I7Z C;  2OAR A;  3RL0 B;  3L35 A;  1Q7Y Q;  4GOF A;  5AVY B;  1NKN A;  3H1H J;  2ZYD A;  2Y0E A;  3USS A;  4Y99 C;  3CI9 A;  2G8Y A;  4I2L C;  3EFF K;  2P58 A;  3EQ2 A;  3M91 A;  1OWA A;  2V7Q H;  2NRG A;  4UB8 E;  4JYB A;  2IDB A;  4PJ0 E;  4D6T D;  4N78 E;  4N3Y B;  3B5N C;  4M3L A;  1SQQ D;  4JQ0 D;  1NTM J;  2GUV A;  2B88 A;  5CJ0 A;  3Q3D A;  1S5L E;  3IAO A;  3H1J J;  4UB6 H;  5AW9 B;  2KS1 B;  2D2C C;  4W80 A;  3Q2Y A;  1FZE A;  1MFT A;  1YJW P;  1IZN B;  1TU3 F;  1LGH B;  1K73 Q;  1BGY E;  4JYC A;  1YIJ P;  1FDO A;  2QEX P;  4N6J A;  2OYH C;  3TGU G;  4EYY Q;  3P8C D;  5AVW B;  1GL2 D;  3CXH E;  2FXP A;  2AXT E;  1JOC A;  1EZV G;  1LTB C;  2NPS D;  3M0A A;  1NTZ K;  5E79 E;  4PD4 I;  3L72 G;  1BE3 D;  1IFI A;  4OH8 B;  2AEJ A;  4PD4 H;  1NTK J;  1JMB A;  5CCG A;  5AW6 B;  1KQG B;  2E76 D;  1JTH A;  4GOE A;  1VL2 A;  2KLV A;  2POH A;  1H0T A;  1KYO E;  3H1I G;  3C9I A;  2JEE A;  3LW5 H;  2IZ0 A;  1LTJ C;  4WBA A;  2OYI A;  1NO4 A;  1EDJ A;  1L0L G;  1S72 P;  3OAK A;  1KB9 E;  5KLV G;  3VTP C;  5KAF E;  1P84 I;  1SQX K;  4PV1 C;  3MD0 A;  5AVS B;  5BU5 A;  1M1J B;  1N7S D;  1P84 H;  2K9J A;  3GHG B;  4EDF A;  1W5C E;  1PPJ G;  3N4X A;  2YIU C;  4BRY A;  1L2P A;  1DH3 A;  5AVZ B;  1KN7 A;  1CSB A;  1FU1 A;  2ZAE B;  2WPR A;  1H8A A;  3IF4 A;  4L73 A;  2N9B A;  4RES B;  2YMK A;  3H1K E;  4DZO A;  2FFD A;  2N9Y B;  1SQP J;  4R4L A;  2PP6 A;  3HE4 B;  4YXD C;  2N1T C;  1FZC B;  3BCC E;  1OX3 A;  4H13 D;  1L4A C;  1KIL D;  2NPS B;  4MN4 C;  1W2E A;  2QM8 A;  3CC4 P;  3CCU P;  3V2P A;  3S9O A;  3H1H D;  3H1K J;  2M0B A;  4IL6 X;  1T6A A;  1RF1 B;  5CJ4 A;  4RO0 A;  1HBW A;  1S3J A;  1FZF A;  2XV5 A;  1R5S A;  2E76 B;  3JCU E;  3CCL P;  1LP1 A;  1NTZ E;  1K8A Q;  3AEC C;  2WSF J;  3AEG C;  2KI7 B;  1JUN A;  1YJN P;  1NTM D;  2IX7 C;  3G9R A;  4EOT A;  1KTM A;  1VQ9 P;  3RL0 C;  2YKO A;  3BCC J;  1PGQ A;  3H1J D;  4L76 A;  1BSH A;  2YO2 A;  3GLM A;  4KT0 J;  5KKZ B;  3FGA D;  1IFJ A;  4QMA A;  3CCJ P;  5AVQ B;  1CI6 B;  1PP9 E;  1PGO A;  1SQX E;  4HYT B;  4N78 D;  2PFX A;  3KQG A;  2WSC H;  2IPP A;  1OW7 A;  1YQ4 C;  2A45 I;  3M9B A;  4Y28 J;  2FYU K;  2QJK B;  2A45 H;  1M1K Q;  1YI2 P;  1HJB A;  1NKZ B;  1NTK D;  4WY4 D;  2KNC B;  3VMZ A;  3BAT A;  1BDD A;  3AE5 C;  3CCV P;  1PP9 J;  1L0L K;  2WT7 B;  5KLV K;  4YXW H;  2OQQ A;  3CXH D;  3L70 J;  1AQT A;  4H13 B;  1QL1 A;  1AFO A;  1FZA A;  1IFM A;  2BEQ D;  3HD7 A;  1N2D C;  1NU1 G;  1JY3 O;  2XDJ A;  5AVT B;  3QH9 A;  3L71 G;  4DT0 A;  5GTI H;  1R5L A;  1URQ D;  1BCC G;  5KLI B;  1FOS E;  2WWW A;  1FDM A;  1S4X A;  1KYO D;  5KJ7 D;  3AEF C;  4U3F J;  2O01 J;  3V4Q A;  2BEZ F;  1MV8 A;  1SQB G;  1K05 A;  4C7N B;  1KB9 D;  1NYH A;  2Q6Q A;  1SQP D;  1UIX A;  2W8Z A;  5DJU B;  2RH0 A;  2ZXX A;  1NOH A;  2H7H A;  1SFC A;  3L73 G;  3SWK A;  2HLO A;  1YTZ I;  4W7Y A;  1EDK A;  3G4S P;  2QE7 H;  3TGU E;  1VDF A;  1FDI A;  2NZ2 A;  4NPE A;  5CCG D;  3W67 A;  4PJ0 H;  1EZV E;  2C9L Y;  2K37 A;  1QVG O;  3H1K D;  3II6 A;  5APW A;  1HJ0 A;  1LTS C;  3L75 J;  3L72 E;  2FBW C;  1OW6 A; 
#chains in the Genus database with same CATH homology
 4WY4 A;  2W6A A;  1GD2 E;  1FZC C;  1LTT C;  1FBM A;  2E42 A;  1FZG A;  2OAR A;  2XU6 A;  3RL0 B;  3H6P A;  3L35 A;  3V2R A;  3A2A A;  5AVY B;  2NPS C;  2YKP A;  2A45 G;  1NKN A;  3B8E B;  1RE4 A;  3L4F A;  4Y99 C;  3CI9 A;  4I2L C;  1GK6 A;  3VMX A;  2QM7 A;  1FAV A;  3M91 A;  3EQ2 A;  1OWA A;  4I6M C;  2WIT A;  2VRS A;  4JYB A;  3MIW A;  1Z56 A;  1RF1 C;  4N78 E;  2KOG A;  4N3Y B;  2P7J A;  3H32 B;  2E43 A;  1H89 A;  3B5N C;  4M3L A;  1A02 F;  1KIL B;  1URQ B;  2GUV A;  3HD7 B;  1WT6 A;  1LWU C;  5CJ0 A;  1JY2 O;  2YNY A;  2FYZ A;  2HPC B;  1HH0 A;  3N7N A;  5AW9 B;  1KZU B;  3IR9 A;  4W80 A;  2I1K A;  1JY2 N;  3OJA B;  1N73 C;  3LIE A;  1FZE A;  3A7O A;  1LGH B;  1FZC A;  2OYI C;  4IFF A;  4JYC A;  4AQR D;  1J1D C;  2XNX A;  4N6J A;  2OYH C;  1KQL A;  4ZKU A;  3P8C D;  5AVW B;  3A5T A;  1GL2 D;  4EIJ A;  5AVU B;  3RK3 B;  1JOC A;  1M1J C;  2Z5I A;  1LTB C;  2NPS D;  2WTY A;  3GHG C;  1KFN A;  2L5G B;  2JJL A;  1AQ5 A;  3M0A A;  2R3C A;  1IJD B;  1RF1 A;  1JY3 P;  1NTZ K;  1RE3 C;  3B5N A;  3B5N B;  1NU1 K;  1ZR4 A;  4ZKP A;  1SFC B;  1IFI A;  1LWU A;  2XZR A;  4OH8 B;  5AVR B;  2M8R A;  5KTB A;  5AW8 B;  5AVV B;  5CCG A;  5AW6 B;  1JTH A;  1RF0 C;  1JTH B;  4HH2 A;  1FZB A;  3VN0 A;  2KLV A;  2KB7 P;  2POH A;  1XTC C;  1HUC A;  2O1K A;  2P1J A;  5AW3 B;  1N73 A;  3C9I A;  1SVF A;  2ZXE B;  2JEE A;  5AW7 B;  3LW5 H;  3I5C A;  1LTJ C;  4WBA A;  2OYI A;  2FFD C;  2KSJ A;  1NO4 A;  3VP9 A;  3BVH A;  4GKG A;  1J1E C;  4W7Z A;  1EQ7 A;  1X8Y A;  2OYH A;  2KP8 A;  3OAK A;  1SQB K;  3VTP C;  1CI6 A;  1SQX K;  4I1L A;  2W27 A;  3MD0 A;  2GUS A;  1M1J A;  5AVS B;  5BU5 A;  1M1J B;  1N7S D;  4WY4 B;  3GHG A;  2Q7C A;  3O8Z A;  3GHG B;  3RK2 C;  2H43 A;  1ZR2 A;  1GL2 C;  3L37 A;  4IFM A;  1RE3 A;  4AUW A;  1MZ9 A;  3N4X A;  2C9N Y;  3SWF A;  1DEB A;  1M7L A;  2IFN A;  1GU5 A;  1DH3 A;  1YTZ T;  5AVZ B;  1LTA C;  1CSB A;  1FU1 A;  2YKQ A;  3VYI A;  1G1J A;  2WPR A;  1H8A A;  3HUS C;  1KFM A;  2N9B A;  4RES B;  4DZO A;  1MFZ A;  1LTJ A;  2Q3I A;  2FFD A;  4DOJ A;  3RL0 D;  5AW0 B;  2WT7 A;  1X9V A;  5APS A;  3NFQ A;  3HE4 A;  5CCH D;  5APU A;  2PP6 A;  3HE4 B;  3NTN A;  3VMY A;  3M06 A;  2CPB A;  1IFD A;  2N1T C;  3V2N A;  4C7R A;  3HTK A;  1GW4 A;  3U1A A;  3HTK B;  3U1C A;  1FZC B;  1T8Z A;  3TNU A;  3TNU B;  1GL2 A;  4JF7 A;  1L4A C;  2NPS A;  1N7S C;  1KIL D;  2NPS B;  1IO4 A;  1GW3 A;  3WMM 0;  1NTK K;  3LID A;  3RK2 D;  1W2E A;  1HWT C;  2QM8 A;  2WPS A;  1GDT A;  1E5W A;  1HTL C;  3M9Q A;  4Y99 B;  1LT9 C;  1GTW A;  2LKM A;  3V2P A;  1FJK A;  1N86 A;  3VP8 A;  3V5B A;  2YMY A;  3CLQ A;  2YO3 A;  1RF1 B;  3PP5 A;  1JY2 P;  5CJ4 A;  2IFM A;  1NH4 A;  3HUS A;  3R2P A;  1FZF A;  1JNM A;  1HBW A;  3HUS B;  2XV5 A;  1ZLL A;  3TK1 A;  1G2C A;  3U59 A;  1G2C B;  2WSE H;  1JCD A;  1JO5 A;  1XTG B;  1JCC A;  1G1I A;  4GT1 A;  3UIA A;  1LWU B;  4C7N A;  3OA7 A;  1JUN A;  4GIF A;  2IX7 C;  1HGV A;  3MGN A;  2HOD A;  1N7L A;  2HOD B;  4EOT A;  3RL0 C;  2YKO A;  4C46 A;  2MJZ A;  3NMD A;  3RK3 D;  1A02 J;  1N73 B;  2N1T A;  1JMM A;  1VPC A;  3HE5 A;  1HVV A;  2OYI B;  2YO2 A;  5CCH C;  3P8C E;  1NWQ A;  2N1T D;  1N7S A;  5AVX B;  1GK4 A;  1YYC A;  3TSI A;  1J1D B;  2Z4E A;  1IFJ A;  2OYH B;  5BVZ A;  2O01 H;  3KDP B;  5AVQ B;  1CI6 B;  1LT9 A;  2J58 A;  2WZ7 A;  1MUU A;  3EFG A;  2M3B A;  2Q9I A;  1L4A D;  1KIL C;  1SQV K;  1URQ C;  2WSF H;  3HD7 C;  4HYT B;  4N78 D;  1HGZ A;  1LTI C;  1NTM K;  3KQG A;  3MUD A;  4WB4 A;  2WSC H;  2IPP A;  1GZL A;  1NAF A;  1SQP K;  2FKW B;  5KJ7 C;  2A45 I;  3M9B A;  4LC1 A;  1L0N K;  2FYU K;  2HYN A;  5APX A;  5AW2 B;  2CPS A;  1RF0 A;  2A45 H;  1HJB A;  1PFI A;  1NKZ B;  1QL2 A;  5APQ A;  1ZN5 A;  4WY4 D;  1DX7 A;  3CL3 D;  3BRT B;  3V2Q A;  1OXZ A;  1LTJ B;  2O1J A;  2FFD B;  5CCH A;  3SWY A;  3P8M C;  3VMZ A;  1FOS F;  3BAT A;  3RK3 C;  3E1I A;  2R32 A;  1L0L K;  1J1E B;  2WT7 B;  1SLQ A;  5KLV K;  2P2U A;  1NHL A;  2HG5 D;  1T3J A;  3H32 A;  1KIL A;  1QL1 A;  2KYV A;  3V4W A;  1FZA A;  1IFM A;  2WPQ A;  1AFO A;  1URQ A;  5CHX A;  3RK2 B;  1RY3 A;  3HD7 A;  1N2D C;  1SFC C;  1GL2 B;  1IC2 A;  4XE5 B;  1CZQ A;  2R5D A;  1JY3 O;  3G3Z A;  2XDJ A;  2BAS A;  5CCG C;  2HPC A;  5AVT B;  5AW1 B;  2HFE D;  1URQ D;  5KJ7 A;  2FXM A;  3HD7 D;  1FOS E;  3T97 A;  3VOP A;  1JY3 N;  4LGD E;  2WWW A;  1FDM A;  3L36 A;  5APY A;  1S9K D;  1X79 B;  5KJ7 D;  3M0D C;  4IFD K;  1T3U A;  1T2K D;  3HRN A;  2Z5H A;  1FJP A;  3V4Q A;  1J2J B;  1MV8 A;  3NXS A;  1CW5 A;  1SQQ K;  2ZFC A;  4C7N B;  4LLH A;  2GM4 A;  4WY4 C;  3A3Y B;  1IFN A;  2C0W A;  3KPE A;  2Q5U A;  3P7K A;  3BRV B;  2H8P D;  1LTG C;  1NOH A;  5APV A;  2N1T B;  1SP4 A;  2I1J A;  3P32 A;  3IFM A;  2H7H A;  1RE4 C;  3HE5 B;  1SFC A;  2XKM A;  2HLO A;  1WRG A;  1YTZ I;  3M9H A;  4B86 A;  1L4A A;  3B5N D;  1L4A B;  3KYQ A;  1N7S B;  1S9K E;  4W7Y A;  1SFC D;  2C0X A;  5CMZ A;  5APT A;  1VDF A;  1LT9 B;  5CCG D;  1ZV8 A;  2W6B A;  5AW5 B;  4AYC A;  5AW4 B;  2C9L Y;  2PAJ A;  3M0D A;  4XA4 A;  1IK9 A;  3BAS A;  1H88 A;  5BU8 B;  3II6 A;  3TYY A;  3MTU E;  5APW A;  2P67 A;  1LTS C;  1GU4 A;  2R5B A;  2J59 M;  1T2K C;  4KHX A;  4O9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...