3OA7A

Structure of the c-terminal domain of cnm67, a core component of the spindle pole body of saccharomyces cerevisiae
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
195
structure length
193
Chain Sequence
GPLKPEEHEDILNKLLDPELAQSERTEALQQLRVNYGSFVSEYNDLTKSHNTLSKELDNLRSRFGNLEGNTSERITIKNILQSRPDISAEECNFLMVEQIDSANLTTLQNTVKEIVLAVGIPYPKLRRKIPLLAIKLKYENIMLSNFAQRLHRQVYEMNLKKFTDQAYYDFMSTRRMDSIDHHLERCLDHLYD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Head morphogenesis protein, Chaotic nuclear migration protei
publication title Structure-function analysis of the C-terminal domain of CNM67, a core component of the Saccharomyces cerevisiae spindle pole body.
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Structural protein
total genus 62
structure length 193
sequence length 195
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11778 SID Septation initiation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.400 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3oa7A00
3OA7A 1NOHA 4IFFA 3MTUE 1NO4A
chains in the Genus database with same CATH superfamily
4H0LB 3O6QB 1YTZT 1J1EC 2FYUE 3CMAP 3CMEP 3QWOC 1PPJD 1N73C 5H2FH 3L72J 3CXHH 1PGOA 2B88A 1LTAC 1VF5C 1XTGB 4H13C 1GD2E 1NWQA 1NTME 1L0NG 3VMXA 1LWUA 4WWIA 2P10A 2DW3A 2L5GB 1ZN5A 2FXMA 1SVFA 1BGYE 1IFPA 1DEEG 1QVGO 3KXDA 2BCCE 3A0BH 3L70J 1OX3A 4AQRD 1M57D 1OW6A 2P1JA 1Q7YQ 2NPSD 3FGAD 1NVOA 5GTHH 1U57A 2UWJE 1RQUA 4KJMA 3EQ2A 1L4AA 2HFED 1NU1G 4ZKUA 1KN7A 1J1EB 1GK4A 1G1IA 3SWKA 3VP9A 1JY2N 1BE3E 3MHVA 3L72G 1JY2P 2Y0DA 3WUVA 1MV8A 3H1IG 2W8ZA 2K37A 1NJIQ 1H89A 1LTTC 1CZQA 1EDIA 2FYUJ 3U1AA 1VF5B 1FJKA 4H13B 2IDBA 2YKPA 3H1LE 1KILA 3RL0g 1Q2NA 3TGUD 1SFCC 2RN0A 3U59A 1AQTA 1EC5A 3V2NA 4BRYB 2OYIA 4M3LA 1U7JA 1LTSC 3A3YB 2WITA 1LP1B 1EZVG 1KB9D 1NTMJ 1OFCX 4QMAA 5CBOA 1IZNB 1GL2C 3P8CE 5KAIE 2B89A 3CPWO 3L70G 3HD7C 3M9QA 1BGYJ 1QL1A 1SQPJ 4XE5B 3HE5A 1OVVA 1YQ3C 1QVFO 3WUTA 2YNYA 5H2FE 3R2PA 2WPRA 3CXHE 1YHQP 2YO3A 2WZ7A 5TJHA 2AXCA 3Q5PA 1USDA 1L0ND 1HH0A 2HG5D 4PJ0H 5KKZC 5TISH 2CPSA 2KYVA 2D2CD 2FYUG 4OWFA 1BE3J 1ZR4A 1VQPP 3FWLA 3PH0A 1SFCB 3RGUA 2FXPA 2IBZE 1Q81Q 4OGQC 1LTBC 3MZWB 5CJ4A 2K9JA 1PP9E 3VP8A 1WRGA 1NTMG 3H1LJ 3FXEA 3TSIA 5AW2B 3Q2YA 3B5NA 1GL2B 1Z56A 2KOGA 4WY4C 3RBZA 1BSNA 3H1HE 1J2JB 4H44D 1BGYG 1NU1D 3H1JE 1W5CE 1SQPG 2QSIA 1K73Q 3FXDA 2LR2A 1FDOA 3RK3C 1SQVE 3AE6C 3L72D 3C1LA 3H1ID 3SWYA 1JO5A 2PFXA 5APSA 5CCGC 2G8YA 4DCKA 1BDCA 3IR9A 1KILD 1SS1A 2Z5IA 4MN4C 1FZCC 1JNMA 2G3AA 5KKZB 3MUDA 1N7SC 2FKWB 3PRJA 2P58A 2E75C 4ZNCA 3CCMP 1EZVD 1BE3G 2QE7H 4HB1A 4OGQB 4PD4D 3RL0C 1LTIC 3L70D 4GDOA 4IL6X 3H1LG 2HODA 4K3AA 2WSFH 3HE4B 1GU5A 5AVTB 2CPBA 1IFNA 3CCJP 2ZT9C 1T3UA 2KLUA 5AW4B 1YJWP 2K1AA 1PP9J 1FS0E 1KYOI 1HJ0A 1P84H 4GIFA 4Y99C 4EDFA 2E5YA 2N1TD 1FOSE 3IF4A 3CC4P 4IFDK 2OARA 3RK3B 3H1HJ 3HD7D 1SQQE 3SFDC 1KQSO 2WWWA 1PFIA 1SQQK 5TISE 2E76D 1EDJA 2FYUD 3USSA 1X8YA 5CHXA 5DJTB 1E79H 5APQA 1M56D 2WPSA 1SQVJ 2WT7A 4U3FE 1FZCB 2WTYA 1VPCA 5KLIB 2W83C 3BATA 1GW3A 5AW0B 1DIPA 2A45G 5KTBA 1Y47A 1N7SB 1YIJP 1NTMD 3B5ND 4KT0J 1KFMA 5CJ0A 4PV1C 1OXZA 2IBZI 3SSUA 4GODA 1URQD 3AE3C 3RL0B 2QM7A 1BGYD 1L0LE 5AVWB 1BCCE 1SQPD 3V2QA 3S1KA 2N9BA 2E74C 2NRGA 1G1JA 4YXDC 3BASA 5CCHC 2ZT9B 3GMAA 1EXIA 1JCCA 4W7YA 1N8RQ 1PP9G 2KZIA 4TT3H 3H1KE 2KSEA 2R5BA 3LW5J 2WVRA 4Y99B 2LXBA 2K3RA 1LNQA 1PGQA 2FFDA 3H1HG 3GHGC 5KLVE 5AVZB 4BXLA 3CX5H 3RK2D 1JUNA 1NTKE 2YKOA 1X0TA 1JY3O 1NTKK 1QLED 3L74E 3Q3DA 3PHLA 3IFMA 1K8AQ 1LT9A 2Y9ZA 1SQXE 1BE3D 1M90Q 1SQVG 1SQXK 1VQMP 1SQQJ 2PP6A 1OW8A 1Q90D 3G3ZA 1RE4C 1K05A 1NAYA 1VQLP 1T2KD 1FZAA 3H1LD 5BU8B 1AV1A 4U3FJ 4K35A 3UIAA 4PV1B 1IK7A 1N86A 1KC8Q 2YIUC 3AEGC 1YBKA 1K9MQ 3L75E 2E74B 3JCUH 5AW3B 4CPGA 3BRTB 3P8CD 2NPSB 2Y9YA 1CW5A 3E7KA 3L71E 4WB4A 1SQBK 3M0AA 1L0LJ 1ZV8A 1NHLA 1BCCJ 3BCCE 2KIKA 2KP8A 1KYOH 1ZMEC 1NTZK 1FE6A 4I2LC 2QA4P 1RF1A 3FX0A 1M1JC 2QVAA 3H1KJ 3GHGB 1LWUC 3CXHD 2W90A 1EDKA 1GDTA 2C0WA 2Q9IA 3GW6A 3IAOA 2YMKA 2OYHA 4O9BA 3D6YA 5KLVJ 3CD6P 2K9YA 1NTKJ 5KAFE 3T97B 2KI7B 3L74J 4ASVA 1QX8A 5GTIH 2HPCB 2VRSA 1JTHB 4UB6H 1T8ZA 2IBZD 3GG2A 4LC1A 1N73A 2YKQA 2YIUB 1X22A 3AE1C 4RKUJ 1PP9D 3EWKA 1L4AC 3CC7P 1PIXA 4C7NB 3M06A 3V4WA 2P7JA 1CI6A 4GOEA 5B5EH 2WSCH 3ITKA 1OZHA 2OGUA 3P32A 3TF5A 3H1HD 2H89C 1GZLA 1EQ7A 3CX5E 1L0LG 1S5LX 3L75J 2J59M 3TK1A 1N7LA 2WSEJ 5BVZA 2KK7A 1M1JB 3AE9C 3L71J 2IX7C 1SQVD 1MFZA 3H1KG 1LWUB 3RK3E 3BCCJ 4EOTA 2XNDH 4YXWH 2R3SA 4H0LD 2OYIC 1L2PA 2JDIH 1MFTA 1H0TB 3R4YA 5AVUB 5KLVG 3PJSK 2XDJA 2A06E 2WMMA 2Z4EA 3KDPB 2YXQB 2IPPA 2POHA 3AEEC 1RHZB 1E5WA 4RJTA 3OAKA 3JCUE 4I7ZC 3HRNA 2E5TA 4JBZA 1L4AB 1P84I 1KYOE 3O8ZA 1R5LA 1OIPA 4JF7A 4JPZB 1AVYA 4DJGA 1KB9H 1IC2A 5K5GB 3QH9A 1JY3N 3HUSC 2IYOA 1HUCA 2BCCJ 3CWBE 1LJ2A 1RY3A 5AVSB 1FC2C 2N9YB 1LTJA 1VQNP 2L91A 3L71G 3OW2O 2N1TA 2PAJA 3GF3A 1SQQD 2QJYB 3BCCG 2JWDA 4JQ0D 1PPJE 1KZUB 1S9KD 1S72P 1G2CA 3HD7A 4I6MC 5APUA 2OYIB 2FBWC 2Q7CA 1YTZI 3G6EP 1VL2A 2Q3EA 4U3FD 4L74A 4D6TE 4AYCA 5L8RJ 3A0BE 1VF5D 3TNUA 4H13D 3D6ZA 3K5BA 1X79B 2KNCA 3HE5B 4JYBA 5B5EE 5GTHE 4I7ZB 3AEFC 1RF0A 1IFIA 3MD0A 5AVRB 3LIDA 1L0LD 1BCCD 1URQA 3WMM0 1S4XA 5APTA 2I1KA 2Q3IA 1IO4A 3L73E 4NPEA 3HUSB 2BCCG 3CX5I 3H1KD 1D7MA 1YITP 3MUDC 2WSSH 1R5SA 2QJPB 1FAVA 1EDLA 1IFJA 2KB7P 2V7QH 3CWBJ 5KLVD 5C39A 1GK6A 1NTKD 3CI9A 4WY4A 3NMDA 5KLIC 2M5AB 2IFMA 1KQGB 1IK9A 2XU6A 5KJ7C 4AUWA 2ZJSE 3TDKA 1RE3A 2RMZA 5AVVB 3D70A 3A2AA 5APVA 1AJYA 3II6A 1KQFB 4HKZH 2KUBA 1VQKP 2QIWA 1OVUA 1M1KQ 1QGKB 4D6TJ 1KFNA 1NKNA 1HWTC 2A06G 1SFCD 4A7PA 5AVXB 1FZCA 3H32A 3G9RA 3C9IA 2KLVA 1ZR2A 1OVRA 1N7SA 1FZBA 4PD4H 3GF7A 5M1BA 2H88C 2P67A 4NPFX 2OTLP 3L71D 1GL2D 1FDIA 1YJNP 4HJGH 1AA0A 1M7LA 3BCCD 4EI2A 3I55P 3H1JJ 4PJ0E 1S5LH 4I1LA 2ZXEB 1UIIA 3L73J 1JMBA 3D71A 2FY8A 3CCQP 3M0DA 2Q1KA 5APXA 1L0NK 1OW7A 2HODB 4IFMA 1IFMA 2B87A 4ZMDA 2C9NY 3W68A 1LTGC 2KSJA 2M0BA 1A02F 1GMJA 1HGZA 4D6TG 2K88A 2WPVB 1BDDA 2GM4A 4DOJA 5B66H 2NPSC 2IBZG 2FFDC 2JEEA 3SFEC 2BCCD 4OGQD 2KS1A 2WPQA 4KHXA 3H6PA 1FJPA 3AEBC 3ZDMA 1NU1E 2JJLA 3TYYA 1NU1K 1XTCC 1GW4A 2R44A 2J58A 2O3JA 1OWAA 3CX5D 3SWFA 4WY4D 1SP4A 2WT7B 2JO1A 3N7NA 4TLFA 4ZKPA 3H1JG 3VTPC 3HTKB 1ZXGA 1IJDB 5AW8B 1PGJA 1X9VA 1ZP0C 3Q5SA 3L73G 3H1IE 2C0XA 4XFJA 1VQ8P 1VQ5P 5CCHA 3RK3D 2W6JH 2ZYDA 1KILE 3GLMA 3CCLP 2SPZA 1H8AA 5CCGD 3O6QA 2MKVA 2XZRA 1KMIZ 3NXSA 2A06D 3GHGA 4RESB 2W27A 1N7SD 4IOIH 2WQYC 5AW5B 3M91A 2E75D 4C7RA 2I8DA 4ASWA 2E42A 2ZVNB 1P84E 1RF1C 1WMKA 3KZIH 2AEJA 1KB9I 2FYZA 1N2DC 3ABVC 2ITAA 1AFOA 2FFDB 1SQBE 1VQ4P 1T3JA 2BASA 3RL0D 3Q5RA 2OYOA 1KYOD 2R32A 5CMZA 1NTZE 3CCSP 2AXTH 2IZ0A 2ZT9D 2OYHC 2QM8A 3C8VA 2KZJA 1LT1A 3CCUP 1K04A 1UIXA 4L76A 3MTUE 2Q5UA 2HR3A 1PL5A 2V7QJ 1ZW0A 2NZ2A 2D2CC 3AEDC 2W6AA 2FYUK 1RQVA 3NFQA 3F5HA 1SQQG 2OTKE 3OA7A 1ZLLA 2O1JA 3H1IJ 2A45H 1SQXJ 4D6TD 4W80A 4YPCA 3IN6A 1M1JA 2AEFA 4UB8H 4U3FG 5B66E 1NTMK 4YTPC 2ZAEB 2CK3H 1YYCA 3M9BA 2WSFJ 4H44C 1RF1B 3CLQA 4IL6H 3V6IA 2J5UA 1H0TA 1SQPE 4PV1D 1AQ5A 1SQPK 2W6BA 1HGVA 3E1IA 3AE5C 2JWAA 4OVNF 1NO4A 3H1JD 3I56P 4WBAA 4BRYA 1BCCG 3CCEP 5EFWB 1KTMA 2E74D 3L73D 5CCHD 1LP1A 2OYHB 1AVOA 1SQBJ 2M3BA 1CSBA 3M9HA 1FZFA 1ZRTE 1KILC 2QJYC 4EIJA 1NTZJ 2R3CA 3OJAB 5AW6B 3MGNA 2KXPB 3BVHA 1S2EA 2D2CB 1NAFA 3CL3D 1N73B 3AEAC 1NTKG 2MJZA 2XV5A 3L74G 2O01H 2QEXP 4R4LA 2YXRB 1SQXG 3AECC 1ZOYC 3KZIE 1CI6B 1EZVI 2ZVOB 2GA1A 3V2PA 4N78E 2IFNA 4PD4I 1YQ4C 2BEQD 4H44B 4Z1MH 1LTJC 2AXTE 2ZYGA 2B9BA 2N1TC 1SFCA 1SLQA 2R5DA 3V4QA 1DD3A 1JY3P 1VQ9P 3N4XA 2GUSA 3L75G 1MKMA 2M8RA 2QJPC 3LW5H 3H25A 2E76C 1SQBG 3VMZA 1WT6A 1H88A 1GL2A 1QL2A 1KILB 2YO2A 1U7MA 1NTZG 4W7ZA 1LGHB 2QJKC 1KQLA 4GT1A 3G4SP 4XA4A 4N6JA 2ZFCA 3CCVP 5GTIE 4UB8E 1Q86Q 1RF0C 3B5NC 3HUSA 4UB6E 1PV3A 1GU4A 3WUUA 2OQQA 2QG4A 4HH2A 1HVVA 2Z5HA 1URQC 2ZXXA 3CC2P 4IL6E 1T6AA 2I1JA 1HF9A 4GOFA 1FBMA 3CCRP 3JC22 3AE2C 2P2UA 2OTJP 2M5AA 1HTLC 3MP7B 3A7OA 2YMYA 4R4MA 1LTJB 3NTNA 3S9OA 2IZ1A 1KORA 4IFFA 3WU2H 2BEZF 2LKMA 4EYYQ 2N1TB 3KYQA 5AW9B 5BU5A 1L4AD 3EFFK 4L73A 1J1DC 1USEA 1G2CB 3HD7B 2RH0A 2H7HA 3RK2C 2AEMA 1RE3C 2E76B 3V2RA 2H8PD 3HE4A 2RKLA 3LIEA 4OH8B 1JCDA 2Q6QA 3A5TA 2HLOA 1MZ9A 2FYNC 1SQVK 3L74D 4NPDA 1DD4A 4LLHA 2K9JB 2QJKB 3TNUB 4LGDE 5DJUB 1SQXD 2KNCB 1T2KC 1KV4A 3B5NB 2XKMA 2M3EA 2Y0CA 3F89A 3P8MC 2C9LY 5APWA 2PRRA 1DX7A 3TGUE 1TU3F 3VOPA 1URQB 3U1CA 2LXCB 3A0HH 2V4HA 1KD1Q 5AVQB 3VMYA 5CCGA 4L75A 1RH5B 2O1KA 4GKGA 2HYNA 5AW7B 1PZQA 1KB9E 1FZGA 1JM0A 4HYTB 2QRXA 1IFDA 1P84D 2GUVA 3PTZA 3L75D 5KJ7A 3BRVB 1JB0J 2WSCJ 1VQOP 3VMAA 1SQBD 3L35A 4BWNA 1BSHA 3M0DC 4WY4B 1J1DB 1NTZD 4B86A 3RK2B 1A02J 1M8OB 1Y9BA 2WSEH 1W2BO 3CWBG 5E79H 5APYA 1OMIA 3MIWA 3L4FA 3CXHI 1JMMA 1L0NE 2FYNB 3L36A 1VQ6P 2A45I 4JYCA 1S9KE 3KQGA 1FU1A 1MUUA 2XNXA 1R8EA 2JP3A 1PPJG 3W67A 3P7KA 2O01J 3H32B 3HTKA 4RO0A 1YJ9P 1JY2O 2E75B 4Y28J 1DEBA 1NH4A 1DH3A 2JR8A 3WU2E 3TGUJ 1FZEA 5KAFH 3AE4C 3AE7C 1HBWA 3I5CA 2H43A 5AW1B 1NOHA 2O01N 1L0LK 1VQ7P 1LT9C 3KHUA 3B71A 3B8EB 1Y8AA 1Q82Q 1S3JA 2JKVA 3L72E 4H0LC 1ZRTD 1PGPA 3KPEA 2B87B 2NPSA 1S1CX 5CBNA 4DZOA 1W2EA 2FXOA 5KLVK 1HJBA 2E43A 5AVYB 3PLNA 3V5BA 3A0HE 1NYHA 3PP5A 4U7JA 3G71P 3JSVC 3Q1MA 1EZVE 1L0NJ 3AE8C 2KS1B 3RBXA 2PGDA 5KJ7D 1QEXA 1YI2P 3FWNA 4PD4E 1VDFA 3L70E 3VYIA 4N78D 1EXJA 4WVZA 3TGUG 2ZYAA 3S4RA 3T97A 4DT0A 3E1RA 1JOCA 1NKZB 1RE4A 4C46A 1S5LE 1NGMB 1JEKA 3VN0A 2Y0EA 1FOSF 1LT9B 2HPCA 1JTHA 3CWBD 4N3YB 5E79E 5KAIH 2IYPA 3L37A 3B4SA 1GTWA 1FDMA 3EFGA 1NU1J 4C7NA
chains in the Genus database with same CATH topology
1FAVA 1OXZA 4N78E 1IFJA 2KB7P 1YTZT 2IFNA 1J1EC 1URQD 3RL0B 2QM7A 1GK6A 5AVWB 1LTJC 3V2QA 1N73C 3CI9A 4WY4A 2N9BA 3NMDA 2IFMA 1G1JA 3BASA 5CCHC 1IK9A 2N1TC 2XU6A 5KJ7C 4AUWA 1SFCA 1JCCA 4W7YA 1LTAC 1RE3A 1SLQA 1XTGB 2R5DA 3V4QA 1GD2E 1JY3P 3N4XA 5AVVB 2R5BA 1NWQA 2GUSA 3A2AA 5APVA 2M8RA 4Y99B 3II6A 3LW5H 3VMXA 1LWUA 2L5GB 3VMZA 1WT6A 1ZN5A 1H88A 2FFDA 1GL2A 1QL2A 1KILB 2FXMA 2YO2A 1SVFA 3GHGC 4W7ZA 5AVZB 3RK2D 1KFNA 1NKNA 1JUNA 1HWTC 1LGHB 2YKOA 1SFCD 1JY3O 1NTKK 1KQLA 4GT1A 5AVXB 1FZCA 4XA4A 4N6JA 3H32A 3IFMA 3C9IA 2ZFCA 2KLVA 1LT9A 1ZR2A 1N7SA 1FZBA 1RF0C 1SQXK 3B5NC 4AQRD 3HUSA 2PP6A 2P67A 2P1JA 1GU4A 3G3ZA 2NPSD 4HH2A 1RE4C 1GL2D 1HVVA 2Z5HA 1URQC 1T2KD 1M7LA 1FZAA 5BU8B 2I1JA 3EQ2A 1L4AA 4I1LA 2HFED 2ZXEB 1FBMA 3UIAA 4ZKUA 1N86A 2P2UA 1J1EB 1GK4A 1G1IA 1HTLC 3A7OA 2YMYA 3VP9A 1JY2N 1LTJB 3M0DA 3NTNA 4IFFA 1JY2P 5APXA 5AW3B 1MV8A 2LKMA 1L0NK 3BRTB 3P8CD 2NPSB 1CW5A 2N1TB 1H89A 1LTTC 1CZQA 3KYQA 5AW9B 4WB4A 5BU5A 1L4AD 2HODB 1SQBK 3U1AA 3M0AA 1FJKA 4IFMA 1J1DC 1ZV8A 2YKPA 1G2CB 1NHLA 3HD7B 2H7HA 1IFMA 3RK2C 2KP8A 1NTZK 1KILA 2C9NY 4I2LC 1RF1A 1SFCC 1RE3C 1LTGC 3V2RA 2H8PD 3U59A 3HE4A 3LIEA 3V2NA 1M1JC 2KSJA 1JCDA 4OH8B 2OYIA 4M3LA 1A02F 1LTSC 1HGZA 3A5TA 2HLOA 3A3YB 3GHGB 1LWUC 2WITA 1MZ9A 1SQVK 2GM4A 1GDTA 2C0WA 4LLHA 4DOJA 2NPSC 3TNUB 2FFDC 2JEEA 1GL2C 4LGDE 3P8CE 2Q9IA 2WPQA 4KHXA 3H6PA 1T2KC 2OYHA 4O9BA 1FJPA 3HD7C 3B5NB 3M9QA 2XKMA 1QL1A 3P8MC 2JJLA 3TYYA 2C9LY 5APWA 1DX7A 1NU1K 4XE5B 1XTCC 1GW4A 3HE5A 3VOPA 2J58A 1URQB 1OWAA 3SWFA 4WY4D 1SP4A 3U1CA 2WT7B 3N7NA 5AVQB 3VMYA 4ZKPA 5CCGA 2YNYA 2O1KA 3VTPC 4GKGA 2HYNA 5AW7B 3HTKB 3R2PA 2VRSA 2WPRA 1IJDB 2HPCB 1JTHB 5AW8B 1FZGA 1T8ZA 4LC1A 1X9VA 1N73A 2YKQA 2YO3A 2C0XA 4HYTB 2WZ7A 1L4AC 1IFDA 2GUVA 5CCHA 3RK3D 4C7NB 3M06A 5KJ7A 3BRVB 1HH0A 2HG5D 3V4WA 2P7JA 1CI6A 1H8AA 3L35A 2WSCH 2CPSA 2KYVA 5CCGD 3P32A 3M0DC 1GZLA 4WY4B 1J1DB 1EQ7A 2XZRA 4B86A 3NXSA 1ZR4A 3RK2B 2J59M 1A02J 3TK1A 1N7LA 3GHGA 1SFCB 4RESB 5BVZA 2W27A 1N7SD 2WSEH 1LTBC 5AW5B 5CJ4A 1M1JB 3M91A 4C7RA 2IX7C 2E42A 5APYA 1MFZA 3MIWA 3VP8A 1RF1C 1LWUB 3L4FA 1WRGA 4EOTA 1JMMA 3TSIA 2FYZA 3L36A 1N2DC 5AW2B 2A45I 2OYIC 3B5NA 4JYCA 1AFOA 1S9KE 2FFDB 1GL2B 1Z56A 3KQGA 2KOGA 1FU1A 1T3JA 1MUUA 2BASA 4WY4C 3RL0D 2XNXA 5AVUB 2R32A 1J2JB 5CMZA 3P7KA 2XDJA 3H32B 2Z4EA 3KDPB 3HTKA 2QM8A 2OYHC 2IPPA 2POHA 1JY2O 3RK3C 1DEBA 1NH4A 1DH3A 3MTUE 1E5WA 2Q5UA 3OAKA 3HRNA 3SWYA 1JO5A 1FZEA 5APSA 5CCGC 1HBWA 1L4AB 3I5CA 2H43A 3IR9A 5AW1B 1KILD 1NOHA 2W6AA 2FYUK 3NFQA 3O8ZA 2Z5IA 1L0LK 3OA7A 1FZCC 1JNMA 1ZLLA 2O1JA 3MUDA 4JF7A 1LT9C 1N7SC 1IC2A 1JY3N 2A45H 3HUSC 2FKWB 1HUCA 3B8EB 4W80A 1M1JA 1RY3A 5AVSB 1NTMK 1LTJA 3KPEA 3RL0C 1LTIC 1YYCA 2NPSA 2N1TA 2PAJA 3M9BA 1RF1B 3CLQA 4DZOA 1W2EA 2HODA 2WSFH 3HE4B 5KLVK 1KZUB 1S9KD 1GU5A 5AVTB 1G2CA 2CPBA 1IFNA 3HD7A 4I6MC 5APUA 1HJBA 2OYIB 1AQ5A 1SQPK 2W6BA 1HGVA 2E43A 1T3UA 3E1IA 5AVYB 2Q7CA 3V5BA 5AW4B 1YTZI 3PP5A 1NO4A 4WBAA 4GIFA 4Y99C 4AYCA 5CCHD 2OYHB 2N1TD 2M3BA 3M9HA 1CSBA 5KJ7D 1FZFA 1FOSE 3TNUA 4IFDK 2OARA 3RK3B 1KILC 1VDFA 4EIJA 3HD7D 3VYIA 1X79B 4N78D 2WWWA 3HE5B 4JYBA 2R3CA 1SQQK 3OJAB 5AW6B 1PFIA 1RF0A 3MGNA 1IFIA 3MD0A 5AVRB 1X8YA 3BVHA 3LIDA 5CHXA 3T97A 1NAFA 3CL3D 1JOCA 1NKZB 1RE4A 5APQA 4C46A 1URQA 2WPSA 3WMM0 1N73B 2WT7A 1FZCB 3VN0A 2WTYA 1VPCA 1FOSF 5APTA 2MJZA 2I1KA 3BATA 1GW3A 5AW0B 2XV5A 2A45G 1LT9B 2Q3IA 2O01H 5KTBA 2HPCA 1IO4A 1N7SB 1JTHA 4N3YB 3HUSB 3L37A 1GTWA 3B5ND 1CI6B 1FDMA 1KFMA 5CJ0A 3EFGA 3V2PA 4C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA7 A;  1NOH A;  4IFF A;  3MTU E;  1NO4 A; 
#chains in the Genus database with same CATH topology
 4H0L B;  3O6Q B;  1YTZ T;  1J1E C;  2FYU E;  3CMA P;  3CME P;  3QWO C;  1PPJ D;  1N73 C;  5H2F H;  3L72 J;  3CXH H;  1PGO A;  2B88 A;  1LTA C;  1VF5 C;  1XTG B;  4H13 C;  1GD2 E;  1NWQ A;  1NTM E;  1L0N G;  3VMX A;  1LWU A;  4WWI A;  2P10 A;  2DW3 A;  2L5G B;  1ZN5 A;  2FXM A;  1SVF A;  1BGY E;  1IFP A;  1DEE G;  1QVG O;  3KXD A;  2BCC E;  3A0B H;  3L70 J;  1OX3 A;  4AQR D;  1M57 D;  1OW6 A;  2P1J A;  1Q7Y Q;  2NPS D;  3FGA D;  1NVO A;  5GTH H;  1U57 A;  2UWJ E;  1RQU A;  4KJM A;  3EQ2 A;  1L4A A;  2HFE D;  1NU1 G;  4ZKU A;  1KN7 A;  1J1E B;  1GK4 A;  1G1I A;  3SWK A;  3VP9 A;  1JY2 N;  1BE3 E;  3MHV A;  3L72 G;  1JY2 P;  2Y0D A;  3WUV A;  1MV8 A;  3H1I G;  2W8Z A;  2K37 A;  1NJI Q;  1H89 A;  1LTT C;  1CZQ A;  1EDI A;  2FYU J;  3U1A A;  1VF5 B;  1FJK A;  4H13 B;  2IDB A;  2YKP A;  3H1L E;  1KIL A;  3RL0 g;  1Q2N A;  3TGU D;  1SFC C;  2RN0 A;  3U59 A;  1AQT A;  1EC5 A;  3V2N A;  4BRY B;  2OYI A;  4M3L A;  1U7J A;  1LTS C;  3A3Y B;  2WIT A;  1LP1 B;  1EZV G;  1KB9 D;  1NTM J;  1OFC X;  4QMA A;  5CBO A;  1IZN B;  1GL2 C;  3P8C E;  5KAI E;  2B89 A;  3CPW O;  3L70 G;  3HD7 C;  3M9Q A;  1BGY J;  1QL1 A;  1SQP J;  4XE5 B;  3HE5 A;  1OVV A;  1YQ3 C;  1QVF O;  3WUT A;  2YNY A;  5H2F E;  3R2P A;  2WPR A;  3CXH E;  1YHQ P;  2YO3 A;  2WZ7 A;  5TJH A;  2AXC A;  3Q5P A;  1USD A;  1L0N D;  1HH0 A;  2HG5 D;  4PJ0 H;  5KKZ C;  5TIS H;  2CPS A;  2KYV A;  2D2C D;  2FYU G;  4OWF A;  1BE3 J;  1ZR4 A;  1VQP P;  3FWL A;  3PH0 A;  1SFC B;  3RGU A;  2FXP A;  2IBZ E;  1Q81 Q;  4OGQ C;  1LTB C;  3MZW B;  5CJ4 A;  2K9J A;  1PP9 E;  3VP8 A;  1WRG A;  1NTM G;  3H1L J;  3FXE A;  3TSI A;  5AW2 B;  3Q2Y A;  3B5N A;  1GL2 B;  1Z56 A;  2KOG A;  4WY4 C;  3RBZ A;  1BSN A;  3H1H E;  1J2J B;  4H44 D;  1BGY G;  1NU1 D;  3H1J E;  1W5C E;  1SQP G;  2QSI A;  1K73 Q;  3FXD A;  2LR2 A;  1FDO A;  3RK3 C;  1SQV E;  3AE6 C;  3L72 D;  3C1L A;  3H1I D;  3SWY A;  1JO5 A;  2PFX A;  5APS A;  5CCG C;  2G8Y A;  4DCK A;  1BDC A;  3IR9 A;  1KIL D;  1SS1 A;  2Z5I A;  4MN4 C;  1FZC C;  1JNM A;  2G3A A;  5KKZ B;  3MUD A;  1N7S C;  2FKW B;  3PRJ A;  2P58 A;  2E75 C;  4ZNC A;  3CCM P;  1EZV D;  1BE3 G;  2QE7 H;  4HB1 A;  4OGQ B;  4PD4 D;  3RL0 C;  1LTI C;  3L70 D;  4GDO A;  4IL6 X;  3H1L G;  2HOD A;  4K3A A;  2WSF H;  3HE4 B;  1GU5 A;  5AVT B;  2CPB A;  1IFN A;  3CCJ P;  2ZT9 C;  1T3U A;  2KLU A;  5AW4 B;  1YJW P;  2K1A A;  1PP9 J;  1FS0 E;  1KYO I;  1HJ0 A;  1P84 H;  4GIF A;  4Y99 C;  4EDF A;  2E5Y A;  2N1T D;  1FOS E;  3IF4 A;  3CC4 P;  4IFD K;  2OAR A;  3RK3 B;  3H1H J;  3HD7 D;  1SQQ E;  3SFD C;  1KQS O;  2WWW A;  1PFI A;  1SQQ K;  5TIS E;  2E76 D;  1EDJ A;  2FYU D;  3USS A;  1X8Y A;  5CHX A;  5DJT B;  1E79 H;  5APQ A;  1M56 D;  2WPS A;  1SQV J;  2WT7 A;  4U3F E;  1FZC B;  2WTY A;  1VPC A;  5KLI B;  2W83 C;  3BAT A;  1GW3 A;  5AW0 B;  1DIP A;  2A45 G;  5KTB A;  1Y47 A;  1N7S B;  1YIJ P;  1NTM D;  3B5N D;  4KT0 J;  1KFM A;  5CJ0 A;  4PV1 C;  1OXZ A;  2IBZ I;  3SSU A;  4GOD A;  1URQ D;  3AE3 C;  3RL0 B;  2QM7 A;  1BGY D;  1L0L E;  5AVW B;  1BCC E;  1SQP D;  3V2Q A;  3S1K A;  2N9B A;  2E74 C;  2NRG A;  1G1J A;  4YXD C;  3BAS A;  5CCH C;  2ZT9 B;  3GMA A;  1EXI A;  1JCC A;  4W7Y A;  1N8R Q;  1PP9 G;  2KZI A;  4TT3 H;  3H1K E;  2KSE A;  2R5B A;  3LW5 J;  2WVR A;  4Y99 B;  2LXB A;  2K3R A;  1LNQ A;  1PGQ A;  2FFD A;  3H1H G;  3GHG C;  5KLV E;  5AVZ B;  4BXL A;  3CX5 H;  3RK2 D;  1JUN A;  1NTK E;  2YKO A;  1X0T A;  1JY3 O;  1NTK K;  1QLE D;  3L74 E;  3Q3D A;  3PHL A;  3IFM A;  1K8A Q;  1LT9 A;  2Y9Z A;  1SQX E;  1BE3 D;  1M90 Q;  1SQV G;  1SQX K;  1VQM P;  1SQQ J;  2PP6 A;  1OW8 A;  1Q90 D;  3G3Z A;  1RE4 C;  1K05 A;  1NAY A;  1VQL P;  1T2K D;  1FZA A;  3H1L D;  5BU8 B;  1AV1 A;  4U3F J;  4K35 A;  3UIA A;  4PV1 B;  1IK7 A;  1N86 A;  1KC8 Q;  2YIU C;  3AEG C;  1YBK A;  1K9M Q;  3L75 E;  2E74 B;  3JCU H;  5AW3 B;  4CPG A;  3BRT B;  3P8C D;  2NPS B;  2Y9Y A;  1CW5 A;  3E7K A;  3L71 E;  4WB4 A;  1SQB K;  3M0A A;  1L0L J;  1ZV8 A;  1NHL A;  1BCC J;  3BCC E;  2KIK A;  2KP8 A;  1KYO H;  1ZME C;  1NTZ K;  1FE6 A;  4I2L C;  2QA4 P;  1RF1 A;  3FX0 A;  1M1J C;  2QVA A;  3H1K J;  3GHG B;  1LWU C;  3CXH D;  2W90 A;  1EDK A;  1GDT A;  2C0W A;  2Q9I A;  3GW6 A;  3IAO A;  2YMK A;  2OYH A;  4O9B A;  3D6Y A;  5KLV J;  3CD6 P;  2K9Y A;  1NTK J;  5KAF E;  3T97 B;  2KI7 B;  3L74 J;  4ASV A;  1QX8 A;  5GTI H;  2HPC B;  2VRS A;  1JTH B;  4UB6 H;  1T8Z A;  2IBZ D;  3GG2 A;  4LC1 A;  1N73 A;  2YKQ A;  2YIU B;  1X22 A;  3AE1 C;  4RKU J;  1PP9 D;  3EWK A;  1L4A C;  3CC7 P;  1PIX A;  4C7N B;  3M06 A;  3V4W A;  2P7J A;  1CI6 A;  4GOE A;  5B5E H;  2WSC H;  3ITK A;  1OZH A;  2OGU A;  3P32 A;  3TF5 A;  3H1H D;  2H89 C;  1GZL A;  1EQ7 A;  3CX5 E;  1L0L G;  1S5L X;  3L75 J;  2J59 M;  3TK1 A;  1N7L A;  2WSE J;  5BVZ A;  2KK7 A;  1M1J B;  3AE9 C;  3L71 J;  2IX7 C;  1SQV D;  1MFZ A;  3H1K G;  1LWU B;  3RK3 E;  3BCC J;  4EOT A;  2XND H;  4YXW H;  2R3S A;  4H0L D;  2OYI C;  1L2P A;  2JDI H;  1MFT A;  1H0T B;  3R4Y A;  5AVU B;  5KLV G;  3PJS K;  2XDJ A;  2A06 E;  2WMM A;  2Z4E A;  3KDP B;  2YXQ B;  2IPP A;  2POH A;  3AEE C;  1RHZ B;  1E5W A;  4RJT A;  3OAK A;  3JCU E;  4I7Z C;  3HRN A;  2E5T A;  4JBZ A;  1L4A B;  1P84 I;  1KYO E;  3O8Z A;  1R5L A;  1OIP A;  4JF7 A;  4JPZ B;  1AVY A;  4DJG A;  1KB9 H;  1IC2 A;  5K5G B;  3QH9 A;  1JY3 N;  3HUS C;  2IYO A;  1HUC A;  2BCC J;  3CWB E;  1LJ2 A;  1RY3 A;  5AVS B;  1FC2 C;  2N9Y B;  1LTJ A;  1VQN P;  2L91 A;  3L71 G;  3OW2 O;  2N1T A;  2PAJ A;  3GF3 A;  1SQQ D;  2QJY B;  3BCC G;  2JWD A;  4JQ0 D;  1PPJ E;  1KZU B;  1S9K D;  1S72 P;  1G2C A;  3HD7 A;  4I6M C;  5APU A;  2OYI B;  2FBW C;  2Q7C A;  1YTZ I;  3G6E P;  1VL2 A;  2Q3E A;  4U3F D;  4L74 A;  4D6T E;  4AYC A;  5L8R J;  3A0B E;  1VF5 D;  3TNU A;  4H13 D;  3D6Z A;  3K5B A;  1X79 B;  2KNC A;  3HE5 B;  4JYB A;  5B5E E;  5GTH E;  4I7Z B;  3AEF C;  1RF0 A;  1IFI A;  3MD0 A;  5AVR B;  3LID A;  1L0L D;  1BCC D;  1URQ A;  3WMM 0;  1S4X A;  5APT A;  2I1K A;  2Q3I A;  1IO4 A;  3L73 E;  4NPE A;  3HUS B;  2BCC G;  3CX5 I;  3H1K D;  1D7M A;  1YIT P;  3MUD C;  2WSS H;  1R5S A;  2QJP B;  1FAV A;  1EDL A;  1IFJ A;  2KB7 P;  2V7Q H;  3CWB J;  5KLV D;  5C39 A;  1GK6 A;  1NTK D;  3CI9 A;  4WY4 A;  3NMD A;  5KLI C;  2M5A B;  2IFM A;  1KQG B;  1IK9 A;  2XU6 A;  5KJ7 C;  4AUW A;  2ZJS E;  3TDK A;  1RE3 A;  2RMZ A;  5AVV B;  3D70 A;  3A2A A;  5APV A;  1AJY A;  3II6 A;  1KQF B;  4HKZ H;  2KUB A;  1VQK P;  2QIW A;  1OVU A;  1M1K Q;  1QGK B;  4D6T J;  1KFN A;  1NKN A;  1HWT C;  2A06 G;  1SFC D;  4A7P A;  5AVX B;  1FZC A;  3H32 A;  3G9R A;  3C9I A;  2KLV A;  1ZR2 A;  1OVR A;  1N7S A;  1FZB A;  4PD4 H;  3GF7 A;  5M1B A;  2H88 C;  2P67 A;  4NPF X;  2OTL P;  3L71 D;  1GL2 D;  1FDI A;  1YJN P;  4HJG H;  1AA0 A;  1M7L A;  3BCC D;  4EI2 A;  3I55 P;  3H1J J;  4PJ0 E;  1S5L H;  4I1L A;  2ZXE B;  1UII A;  3L73 J;  1JMB A;  3D71 A;  2FY8 A;  3CCQ P;  3M0D A;  2Q1K A;  5APX A;  1L0N K;  1OW7 A;  2HOD B;  4IFM A;  1IFM A;  2B87 A;  4ZMD A;  2C9N Y;  3W68 A;  1LTG C;  2KSJ A;  2M0B A;  1A02 F;  1GMJ A;  1HGZ A;  4D6T G;  2K88 A;  2WPV B;  1BDD A;  2GM4 A;  4DOJ A;  5B66 H;  2NPS C;  2IBZ G;  2FFD C;  2JEE A;  3SFE C;  2BCC D;  4OGQ D;  2KS1 A;  2WPQ A;  4KHX A;  3H6P A;  1FJP A;  3AEB C;  3ZDM A;  1NU1 E;  2JJL A;  3TYY A;  1NU1 K;  1XTC C;  1GW4 A;  2R44 A;  2J58 A;  2O3J A;  1OWA A;  3CX5 D;  3SWF A;  4WY4 D;  1SP4 A;  2WT7 B;  2JO1 A;  3N7N A;  4TLF A;  4ZKP A;  3H1J G;  3VTP C;  3HTK B;  1ZXG A;  1IJD B;  5AW8 B;  1PGJ A;  1X9V A;  1ZP0 C;  3Q5S A;  3L73 G;  3H1I E;  2C0X A;  4XFJ A;  1VQ8 P;  1VQ5 P;  5CCH A;  3RK3 D;  2W6J H;  2ZYD A;  1KIL E;  3GLM A;  3CCL P;  2SPZ A;  1H8A A;  5CCG D;  3O6Q A;  2MKV A;  2XZR A;  1KMI Z;  3NXS A;  2A06 D;  3GHG A;  4RES B;  2W27 A;  1N7S D;  4IOI H;  2WQY C;  5AW5 B;  3M91 A;  2E75 D;  4C7R A;  2I8D A;  4ASW A;  2E42 A;  2ZVN B;  1P84 E;  1RF1 C;  1WMK A;  3KZI H;  2AEJ A;  1KB9 I;  2FYZ A;  1N2D C;  3ABV C;  2ITA A;  1AFO A;  2FFD B;  1SQB E;  1VQ4 P;  1T3J A;  2BAS A;  3RL0 D;  3Q5R A;  2OYO A;  1KYO D;  2R32 A;  5CMZ A;  1NTZ E;  3CCS P;  2AXT H;  2IZ0 A;  2ZT9 D;  2OYH C;  2QM8 A;  3C8V A;  2KZJ A;  1LT1 A;  3CCU P;  1K04 A;  1UIX A;  4L76 A;  3MTU E;  2Q5U A;  2HR3 A;  1PL5 A;  2V7Q J;  1ZW0 A;  2NZ2 A;  2D2C C;  3AED C;  2W6A A;  2FYU K;  1RQV A;  3NFQ A;  3F5H A;  1SQQ G;  2OTK E;  3OA7 A;  1ZLL A;  2O1J A;  3H1I J;  2A45 H;  1SQX J;  4D6T D;  4W80 A;  4YPC A;  3IN6 A;  1M1J A;  2AEF A;  4UB8 H;  4U3F G;  5B66 E;  1NTM K;  4YTP C;  2ZAE B;  2CK3 H;  1YYC A;  3M9B A;  2WSF J;  4H44 C;  1RF1 B;  3CLQ A;  4IL6 H;  3V6I A;  2J5U A;  1H0T A;  1SQP E;  4PV1 D;  1AQ5 A;  1SQP K;  2W6B A;  1HGV A;  3E1I A;  3AE5 C;  2JWA A;  4OVN F;  1NO4 A;  3H1J D;  3I56 P;  4WBA A;  4BRY A;  1BCC G;  3CCE P;  5EFW B;  1KTM A;  2E74 D;  3L73 D;  5CCH D;  1LP1 A;  2OYH B;  1AVO A;  1SQB J;  2M3B A;  1CSB A;  3M9H A;  1FZF A;  1ZRT E;  1KIL C;  2QJY C;  4EIJ A;  1NTZ J;  2R3C A;  3OJA B;  5AW6 B;  3MGN A;  2KXP B;  3BVH A;  1S2E A;  2D2C B;  1NAF A;  3CL3 D;  1N73 B;  3AEA C;  1NTK G;  2MJZ A;  2XV5 A;  3L74 G;  2O01 H;  2QEX P;  4R4L A;  2YXR B;  1SQX G;  3AEC C;  1ZOY C;  3KZI E;  1CI6 B;  1EZV I;  2ZVO B;  2GA1 A;  3V2P A;  4N78 E;  2IFN A;  4PD4 I;  1YQ4 C;  2BEQ D;  4H44 B;  4Z1M H;  1LTJ C;  2AXT E;  2ZYG A;  2B9B A;  2N1T C;  1SFC A;  1SLQ A;  2R5D A;  3V4Q A;  1DD3 A;  1JY3 P;  1VQ9 P;  3N4X A;  2GUS A;  3L75 G;  1MKM A;  2M8R A;  2QJP C;  3LW5 H;  3H25 A;  2E76 C;  1SQB G;  3VMZ A;  1WT6 A;  1H88 A;  1GL2 A;  1QL2 A;  1KIL B;  2YO2 A;  1U7M A;  1NTZ G;  4W7Z A;  1LGH B;  2QJK C;  1KQL A;  4GT1 A;  3G4S P;  4XA4 A;  4N6J A;  2ZFC A;  3CCV P;  5GTI E;  4UB8 E;  1Q86 Q;  1RF0 C;  3B5N C;  3HUS A;  4UB6 E;  1PV3 A;  1GU4 A;  3WUU A;  2OQQ A;  2QG4 A;  4HH2 A;  1HVV A;  2Z5H A;  1URQ C;  2ZXX A;  3CC2 P;  4IL6 E;  1T6A A;  2I1J A;  1HF9 A;  4GOF A;  1FBM A;  3CCR P;  3JC2 2;  3AE2 C;  2P2U A;  2OTJ P;  2M5A A;  1HTL C;  3MP7 B;  3A7O A;  2YMY A;  4R4M A;  1LTJ B;  3NTN A;  3S9O A;  2IZ1 A;  1KOR A;  4IFF A;  3WU2 H;  2BEZ F;  2LKM A;  4EYY Q;  2N1T B;  3KYQ A;  5AW9 B;  5BU5 A;  1L4A D;  3EFF K;  4L73 A;  1J1D C;  1USE A;  1G2C B;  3HD7 B;  2RH0 A;  2H7H A;  3RK2 C;  2AEM A;  1RE3 C;  2E76 B;  3V2R A;  2H8P D;  3HE4 A;  2RKL A;  3LIE A;  4OH8 B;  1JCD A;  2Q6Q A;  3A5T A;  2HLO A;  1MZ9 A;  2FYN C;  1SQV K;  3L74 D;  4NPD A;  1DD4 A;  4LLH A;  2K9J B;  2QJK B;  3TNU B;  4LGD E;  5DJU B;  1SQX D;  2KNC B;  1T2K C;  1KV4 A;  3B5N B;  2XKM A;  2M3E A;  2Y0C A;  3F89 A;  3P8M C;  2C9L Y;  5APW A;  2PRR A;  1DX7 A;  3TGU E;  1TU3 F;  3VOP A;  1URQ B;  3U1C A;  2LXC B;  3A0H H;  2V4H A;  1KD1 Q;  5AVQ B;  3VMY A;  5CCG A;  4L75 A;  1RH5 B;  2O1K A;  4GKG A;  2HYN A;  5AW7 B;  1PZQ A;  1KB9 E;  1FZG A;  1JM0 A;  4HYT B;  2QRX A;  1IFD A;  1P84 D;  2GUV A;  3PTZ A;  3L75 D;  5KJ7 A;  3BRV B;  1JB0 J;  2WSC J;  1VQO P;  3VMA A;  1SQB D;  3L35 A;  4BWN A;  1BSH A;  3M0D C;  4WY4 B;  1J1D B;  1NTZ D;  4B86 A;  3RK2 B;  1A02 J;  1M8O B;  1Y9B A;  2WSE H;  1W2B O;  3CWB G;  5E79 H;  5APY A;  1OMI A;  3MIW A;  3L4F A;  3CXH I;  1JMM A;  1L0N E;  2FYN B;  3L36 A;  1VQ6 P;  2A45 I;  4JYC A;  1S9K E;  3KQG A;  1FU1 A;  1MUU A;  2XNX A;  1R8E A;  2JP3 A;  1PPJ G;  3W67 A;  3P7K A;  2O01 J;  3H32 B;  3HTK A;  4RO0 A;  1YJ9 P;  1JY2 O;  2E75 B;  4Y28 J;  1DEB A;  1NH4 A;  1DH3 A;  2JR8 A;  3WU2 E;  3TGU J;  1FZE A;  5KAF H;  3AE4 C;  3AE7 C;  1HBW A;  3I5C A;  2H43 A;  5AW1 B;  1NOH A;  2O01 N;  1L0L K;  1VQ7 P;  1LT9 C;  3KHU A;  3B71 A;  3B8E B;  1Y8A A;  1Q82 Q;  1S3J A;  2JKV A;  3L72 E;  4H0L C;  1ZRT D;  1PGP A;  3KPE A;  2B87 B;  2NPS A;  1S1C X;  5CBN A;  4DZO A;  1W2E A;  2FXO A;  5KLV K;  1HJB A;  2E43 A;  5AVY B;  3PLN A;  3V5B A;  3A0H E;  1NYH A;  3PP5 A;  4U7J A;  3G71 P;  3JSV C;  3Q1M A;  1EZV E;  1L0N J;  3AE8 C;  2KS1 B;  3RBX A;  2PGD A;  5KJ7 D;  1QEX A;  1YI2 P;  3FWN A;  4PD4 E;  1VDF A;  3L70 E;  3VYI A;  4N78 D;  1EXJ A;  4WVZ A;  3TGU G;  2ZYA A;  3S4R A;  3T97 A;  4DT0 A;  3E1R A;  1JOC A;  1NKZ B;  1RE4 A;  4C46 A;  1S5L E;  1NGM B;  1JEK A;  3VN0 A;  2Y0E A;  1FOS F;  1LT9 B;  2HPC A;  1JTH A;  3CWB D;  4N3Y B;  5E79 E;  5KAI H;  2IYP A;  3L37 A;  3B4S A;  1GTW A;  1FDM A;  3EFG A;  1NU1 J;  4C7N A; 
#chains in the Genus database with same CATH homology
 1FAV A;  1OXZ A;  4N78 E;  1IFJ A;  2KB7 P;  1YTZ T;  2IFN A;  1J1E C;  1URQ D;  3RL0 B;  2QM7 A;  1GK6 A;  5AVW B;  1LTJ C;  3V2Q A;  1N73 C;  3CI9 A;  4WY4 A;  2N9B A;  3NMD A;  2IFM A;  1G1J A;  3BAS A;  5CCH C;  1IK9 A;  2N1T C;  2XU6 A;  5KJ7 C;  4AUW A;  1SFC A;  1JCC A;  4W7Y A;  1LTA C;  1RE3 A;  1SLQ A;  1XTG B;  2R5D A;  3V4Q A;  1GD2 E;  1JY3 P;  3N4X A;  5AVV B;  2R5B A;  1NWQ A;  2GUS A;  3A2A A;  5APV A;  2M8R A;  4Y99 B;  3II6 A;  3LW5 H;  3VMX A;  1LWU A;  2L5G B;  3VMZ A;  1WT6 A;  1ZN5 A;  1H88 A;  2FFD A;  1GL2 A;  1QL2 A;  1KIL B;  2FXM A;  2YO2 A;  1SVF A;  3GHG C;  4W7Z A;  5AVZ B;  3RK2 D;  1KFN A;  1NKN A;  1JUN A;  1HWT C;  1LGH B;  2YKO A;  1SFC D;  1JY3 O;  1NTK K;  1KQL A;  4GT1 A;  5AVX B;  1FZC A;  4XA4 A;  4N6J A;  3H32 A;  3IFM A;  3C9I A;  2ZFC A;  2KLV A;  1LT9 A;  1ZR2 A;  1N7S A;  1FZB A;  1RF0 C;  1SQX K;  3B5N C;  4AQR D;  3HUS A;  2PP6 A;  2P67 A;  2P1J A;  1GU4 A;  3G3Z A;  2NPS D;  4HH2 A;  1RE4 C;  1GL2 D;  1HVV A;  2Z5H A;  1URQ C;  1T2K D;  1M7L A;  1FZA A;  5BU8 B;  2I1J A;  3EQ2 A;  1L4A A;  4I1L A;  2HFE D;  2ZXE B;  1FBM A;  3UIA A;  4ZKU A;  1N86 A;  2P2U A;  1J1E B;  1GK4 A;  1G1I A;  1HTL C;  3A7O A;  2YMY A;  3VP9 A;  1JY2 N;  1LTJ B;  3M0D A;  3NTN A;  4IFF A;  1JY2 P;  5APX A;  5AW3 B;  1MV8 A;  2LKM A;  1L0N K;  3BRT B;  3P8C D;  2NPS B;  1CW5 A;  2N1T B;  1H89 A;  1LTT C;  1CZQ A;  3KYQ A;  5AW9 B;  4WB4 A;  5BU5 A;  1L4A D;  2HOD B;  1SQB K;  3U1A A;  3M0A A;  1FJK A;  4IFM A;  1J1D C;  1ZV8 A;  2YKP A;  1G2C B;  1NHL A;  3HD7 B;  2H7H A;  1IFM A;  3RK2 C;  2KP8 A;  1NTZ K;  1KIL A;  2C9N Y;  4I2L C;  1RF1 A;  1SFC C;  1RE3 C;  1LTG C;  3V2R A;  2H8P D;  3U59 A;  3HE4 A;  3LIE A;  3V2N A;  1M1J C;  2KSJ A;  1JCD A;  4OH8 B;  2OYI A;  4M3L A;  1A02 F;  1LTS C;  1HGZ A;  3A5T A;  2HLO A;  3A3Y B;  3GHG B;  1LWU C;  2WIT A;  1MZ9 A;  1SQV K;  2GM4 A;  1GDT A;  2C0W A;  4LLH A;  4DOJ A;  2NPS C;  3TNU B;  2FFD C;  2JEE A;  1GL2 C;  4LGD E;  3P8C E;  2Q9I A;  2WPQ A;  4KHX A;  3H6P A;  1T2K C;  2OYH A;  4O9B A;  1FJP A;  3HD7 C;  3B5N B;  3M9Q A;  2XKM A;  1QL1 A;  3P8M C;  2JJL A;  3TYY A;  2C9L Y;  5APW A;  1DX7 A;  1NU1 K;  4XE5 B;  1XTC C;  1GW4 A;  3HE5 A;  3VOP A;  2J58 A;  1URQ B;  1OWA A;  3SWF A;  4WY4 D;  1SP4 A;  3U1C A;  2WT7 B;  3N7N A;  5AVQ B;  3VMY A;  4ZKP A;  5CCG A;  2YNY A;  2O1K A;  3VTP C;  4GKG A;  2HYN A;  5AW7 B;  3HTK B;  3R2P A;  2VRS A;  2WPR A;  1IJD B;  2HPC B;  1JTH B;  5AW8 B;  1FZG A;  1T8Z A;  4LC1 A;  1X9V A;  1N73 A;  2YKQ A;  2YO3 A;  2C0X A;  4HYT B;  2WZ7 A;  1L4A C;  1IFD A;  2GUV A;  5CCH A;  3RK3 D;  4C7N B;  3M06 A;  5KJ7 A;  3BRV B;  1HH0 A;  2HG5 D;  3V4W A;  2P7J A;  1CI6 A;  1H8A A;  3L35 A;  2WSC H;  2CPS A;  2KYV A;  5CCG D;  3P32 A;  3M0D C;  1GZL A;  4WY4 B;  1J1D B;  1EQ7 A;  2XZR A;  4B86 A;  3NXS A;  1ZR4 A;  3RK2 B;  2J59 M;  1A02 J;  3TK1 A;  1N7L A;  3GHG A;  1SFC B;  4RES B;  5BVZ A;  2W27 A;  1N7S D;  2WSE H;  1LTB C;  5AW5 B;  5CJ4 A;  1M1J B;  3M91 A;  4C7R A;  2IX7 C;  2E42 A;  5APY A;  1MFZ A;  3MIW A;  3VP8 A;  1RF1 C;  1LWU B;  3L4F A;  1WRG A;  4EOT A;  1JMM A;  3TSI A;  2FYZ A;  3L36 A;  1N2D C;  5AW2 B;  2A45 I;  2OYI C;  3B5N A;  4JYC A;  1AFO A;  1S9K E;  2FFD B;  1GL2 B;  1Z56 A;  3KQG A;  2KOG A;  1FU1 A;  1T3J A;  1MUU A;  2BAS A;  4WY4 C;  3RL0 D;  2XNX A;  5AVU B;  2R32 A;  1J2J B;  5CMZ A;  3P7K A;  2XDJ A;  3H32 B;  2Z4E A;  3KDP B;  3HTK A;  2QM8 A;  2OYH C;  2IPP A;  2POH A;  1JY2 O;  3RK3 C;  1DEB A;  1NH4 A;  1DH3 A;  3MTU E;  1E5W A;  2Q5U A;  3OAK A;  3HRN A;  3SWY A;  1JO5 A;  1FZE A;  5APS A;  5CCG C;  1HBW A;  1L4A B;  3I5C A;  2H43 A;  3IR9 A;  5AW1 B;  1KIL D;  1NOH A;  2W6A A;  2FYU K;  3NFQ A;  3O8Z A;  2Z5I A;  1L0L K;  3OA7 A;  1FZC C;  1JNM A;  1ZLL A;  2O1J A;  3MUD A;  4JF7 A;  1LT9 C;  1N7S C;  1IC2 A;  1JY3 N;  2A45 H;  3HUS C;  2FKW B;  1HUC A;  3B8E B;  4W80 A;  1M1J A;  1RY3 A;  5AVS B;  1NTM K;  1LTJ A;  3KPE A;  3RL0 C;  1LTI C;  1YYC A;  2NPS A;  2N1T A;  2PAJ A;  3M9B A;  1RF1 B;  3CLQ A;  4DZO A;  1W2E A;  2HOD A;  2WSF H;  3HE4 B;  5KLV K;  1KZU B;  1S9K D;  1GU5 A;  5AVT B;  1G2C A;  2CPB A;  1IFN A;  3HD7 A;  4I6M C;  5APU A;  1HJB A;  2OYI B;  1AQ5 A;  1SQP K;  2W6B A;  1HGV A;  2E43 A;  1T3U A;  3E1I A;  5AVY B;  2Q7C A;  3V5B A;  5AW4 B;  1YTZ I;  3PP5 A;  1NO4 A;  4WBA A;  4GIF A;  4Y99 C;  4AYC A;  5CCH D;  2OYH B;  2N1T D;  2M3B A;  3M9H A;  1CSB A;  5KJ7 D;  1FZF A;  1FOS E;  3TNU A;  4IFD K;  2OAR A;  3RK3 B;  1KIL C;  1VDF A;  4EIJ A;  3HD7 D;  3VYI A;  1X79 B;  4N78 D;  2WWW A;  3HE5 B;  4JYB A;  2R3C A;  1SQQ K;  3OJA B;  5AW6 B;  1PFI A;  1RF0 A;  3MGN A;  1IFI A;  3MD0 A;  5AVR B;  1X8Y A;  3BVH A;  3LID A;  5CHX A;  3T97 A;  1NAF A;  3CL3 D;  1JOC A;  1NKZ B;  1RE4 A;  5APQ A;  4C46 A;  1URQ A;  2WPS A;  3WMM 0;  1N73 B;  2WT7 A;  1FZC B;  3VN0 A;  2WTY A;  1VPC A;  1FOS F;  5APT A;  2MJZ A;  2I1K A;  3BAT A;  1GW3 A;  5AW0 B;  2XV5 A;  2A45 G;  1LT9 B;  2Q3I A;  2O01 H;  5KTB A;  2HPC A;  1IO4 A;  1N7S B;  1JTH A;  4N3Y B;  3HUS B;  3L37 A;  1GTW A;  3B5N D;  1CI6 B;  1FDM A;  1KFM A;  5CJ0 A;  3EFG A;  3V2P A;  4C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...