4U3FJ

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 22
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4u3fJ00
1L0NJ 3L73J 1NTZJ 2BCCJ 1NTMJ 1KB9I 3L75J 1SQPJ 3H1LJ 1BE3J 3BCCJ 5KLVJ 3L72J 1SQXJ 1EZVI 4PD4I 4D6TJ 1BCCJ 1NU1J 1SQVJ 3CX5I 4U3FJ 1NTKJ 2FYUJ 3L71J 3H1KJ 3H1HJ 1L0LJ 3TGUJ 3H1IJ 3CWBJ 1SQBJ 3L70J 1BGYJ 3CXHI 1KYOI 1PP9J 3L74J 1P84I 3H1JJ 1SQQJ 2IBZI
chains in the Genus database with same CATH superfamily
3AEDC 1T2KD 1ZR4A 3HD7D 2FYUK 3VP9A 1EZVG 1N73B 3CD6P 2O01J 2YMYA 1NTKG 3L71G 4HKZH 1SFCD 4EYYQ 3U1AA 2KSEA 2W6AA 4AUWA 1JOCA 1FZEA 1P84I 4GODA 2P10A 1UIIA 1YTZI 3RK2D 3L73D 3CX5E 1LP1B 4C7RA 4I1LA 1IJDB 3WUVA 3D70A 1SQXK 1NWQA 4JYBA 1RY3A 4IL6H 4C46A 1MFZA 2K37A 5AVSB 5AW7B 4A7PA 2V7QH 1VQKP 2JDIH 1G2CB 1EZVI 3G3ZA 3VN0A 3A0BE 5C39A 2Y9ZA 2ZVNB 3AE9C 2RN0A 1AVOA 3VMXA 1QVFO 4YXDC 2E43A 4BRYA 3L73G 1AQ5A 1LJ2A 3L72J 3AEFC 4OVNF 1FZBA 2KP8A 2O1JA 3H1KJ 1YI2P 2XV5A 2KI7B 1KQGB 3CCLP 3G4SP 1PPJE 3UIAA 2KS1A 3GF3A 2KUBA 1JY3O 5APSA 3USSA 1LT9B 1J2JB 4OGQD 5B66E 3NXSA 4NPDA 1Q82Q 2O3JA 1XTGB 1ZN5A 4N78D 2A06E 5TISH 1BE3J 1PGOA 3RL0g 2W8ZA 5AVUB 1ZMEC 1A02J 3SSUA 2D2CD 1S5LH 3SFEC 3MGNA 1BSNA 3RL0B 1YBKA 1JCCA 5APQA 3HUSB 1URQC 2IPPA 2WSFJ 1Q7YQ 3L74J 2WSEH 2WVRA 5AVXB 3CMEP 2JJLA 5CBOA 3FXDA 4WB4A 2P58A 2IYOA 5KKZC 1T2KC 4UB6H 4MN4C 3HD7C 3A3YB 2PRRA 1L4AD 2W90A 1RF1C 2OYHB 3CX5D 1RE3A 1SFCC 1QX8A 2JKVA 1HH0A 3H1LE 3W68A 2P1JA 2KB7P 1PP9D 3V4WA 2ZT9D 3L4FA 3BRTB 2FFDC 3RK2C 1N7LA 1H88A 1S1CX 1UIXA 4AYCA 1YJWP 4WVZA 2M0BA 1Z56A 3GLMA 4L76A 2N1TB 2XDJA 1LTJA 1K8AQ 2Y0EA 3AE3C 1PP9G 1JY3P 2IBZE 1Q2NA 3L35A 5KJ7D 1RF0C 3H6PA 2LXCB 3P8CE 4RKUJ 2XNDH 1R5SA 1VQ5P 2FYNC 4PJ0E 3CXHD 1URQA 3AE5C 2H8PD 1EXJA 3IN6A 3M9BA 1CI6B 1LWUA 1PPJD 3V4QA 3L75D 1NH4A 1K05A 5CCGD 2JEEA 1Y8AA 1U7MA 4RO0A 1K73Q 3EWKA 4H13B 3V2QA 3CLQA 2M5AA 3KDPB 3HD7A 1BCCE 1DD4A 1FJPA 4DOJA 1RF1A 1MFTA 4UB6E 1L0LJ 1L0LG 3KQGA 2YO2A 3LW5J 4I7ZB 3FXEA 3O6QB 4GT1A 4KHXA 3T97B 1PPJG 3L75J 3L75G 4OGQC 2W6BA 3TGUD 1L2PA 2GUVA 4I6MC 1NYHA 4JF7A 3F5HA 4QMAA 1FBMA 1USDA 4GKGA 4ASWA 2D2CC 3CCSP 1J1EC 3VMAA 3Q3DA 4R4MA 1YHQP 2KIKA 5KAFH 1W2EA 1PGPA 5KLIB 3M06A 3ZDMA 5CJ4A 3Q5PA 5KTBA 1H0TA 4YTPC 1IZNB 2WMMA 3H1LD 1KQFB 3TGUJ 3CC7P 5AVVB 3TGUG 2HODB 4IOIH 3CXHI 1LT1A 1FZCC 2J5UA 3AE8C 1EC5A 1L4AC 5AVZB 2V7QJ 1DX7A 2E74B 1SQVE 4HYTB 4BWNA 3C9IA 1VQ6P 2KSJA 2ZT9C 5AW0B 1M8OB 3V2NA 3H1LG 1SQVK 5M1BA 4N3YB 3HE4B 1NU1E 4L75A 1NO4A 3F89A 3S1KA 3P8CD 1NTZK 1M1JC 3E1IA 1MUUA 4DCKA 1FOSF 1N7SB 5GTIH 1YYCA 2IYPA 1JMBA 3P8MC 1IFDA 3VMZA 3PP5A 1BSHA 2K9JB 1AVYA 3OAKA 2KXPB 5KJ7C 3CL3D 3HTKA 3E1RA 1GL2B 4WBAA 1JY2P 3B5NA 1VQ7P 5AVQB 3A2AA 4HH2A 4KJMA 1VQOP 2QJKB 5CCGC 5APWA 3QWOC 1HJBA 3BVHA 1VQ8P 1R5LA 2QIWA 3KXDA 3Q1MA 1KC8Q 2Z5IA 1SQBJ 4ASVA 1L4AA 3U59A 1IC2A 4LLHA 5APUA 1AFOA 2HLOA 2GM4A 1VPCA 4JYCA 2BEQD 1Q86Q 1HJ0A 1QEXA 2YKOA 2FY8A 2L91A 3H1IJ 2NPSB 2KLUA 1L0NJ 4EDFA 5KLVE 4K35A 2JWAA 2B89A 1M1JA 4JQ0D 3CX5H 3H1KE 3JCUE 2E42A 3EQ2A 3D71A 2PGDA 1FE6A 1T6AA 2PFXA 5K5GB 4PV1B 3RBZA 2K88A 4JPZB 4U3FD 2Y0DA 1SLQA 1HWTC 2N9YB 2Q3IA 2N1TD 1S2EA 4U7JA 2OGUA 4Y99C 3A0BH 3FX0A 3CC2P 3L70E 1NU1D 1BE3E 1KZUB 1URQD 3WMM0 5KAIE 4U3FJ 4WY4B 4U3FG 5GTHE 1JY3N 1LTTC 2Q6QA 4H13D 3L74E 1VQNP 3OJAB 3RK3B 3BCCE 2XZRA 3A7OA 2WZ7A 3B8EB 2HPCB 1N73A 1NU1G 2K3RA 1FDIA 3AEGC 3RGUA 3WU2E 1NTKJ 3L71J 1JNMA 4TT3H 3IAOA 5E79H 2UWJE 1LT9C 5B66H 1VQ9P 1FZFA 4AQRD 2DW3A 2BCCJ 2BCCG 1SQPJ 1FS0E 1SQPG 2WQYC 1EDJA 1SQXE 1QL1A 3NTNA 1QVGO 2GA1A 1NAYA 1NHLA 1SQQD 1BDCA 1VF5B 2OTJP 1LP1A 2WPSA 3GG2A 1QGKB 3RL0C 1KILB 2AXCA 1DH3A 3TF5A 2OYIB 3H1JE 3HUSC 1X0TA 2R5DA 3TDKA 2YNYA 1G2CA 2WSCH 2C0WA 3JC22 3M9HA 1Q90D 3PHLA 1W2BO 5KLVD 3PH0A 3IFMA 1SQQJ 1SQQG 2KNCB 3K5BA 3L73J 5AW9B 3CC4P 1OIPA 5CCHD 3SWFA 2E74D 1IFIA 1RE3C 4H44B 2WT7B 2Q7CA 2PAJA 3MUDA 3P7KA 3HE5B 1J1DB 2RH0A 2V4HA 5CBNA 2A45H 2J58A 5KLVG 2K9YA 2B87B 3L70D 2QVAA 3I56P 1DD3A 2H89C 1VQMP 1LT9A 1E5WA 1OW7A 5CHXA 1NTMD 1PGJA 3N4XA 3MIWA 5E79E 2QJYC 5APXA 2N1TC 4JBZA 1FAVA 1M1KQ 1AQTA 1LTJC 2FYUD 3VYIA 2M3BA 4PJ0H 3G6EP 3RK3E 3H32B 3V6IA 3B5ND 3HUSA 3H1HE 3BCCD 3L70G 1GK4A 2KOGA 3I55P 1LWUC 2JO1A 1NTMG 2XKMA 3SWKA 4H13C 1TU3F 1JMMA 3II6A 2R44A 1JY2N 4B86A 1NGMB 2FYUG 2WPRA 1SQXD 3CWBE 2OYHA 1DEEG 3CCVP 3TSIA 2IZ1A 4C7NB 3BCCG 1KFNA 3H1JD 5APVA 2YKQA 2FXOA 2IFMA 1KMIZ 3CCUP 2NZ2A 3FWLA 2P67A 1NAFA 3TNUB 2FYZA 1SQXG 1S3JA 2G3AA 2YKPA 3ITKA 1GZLA 2N1TA 3H25A 3RBXA 1PP9J 3H1JG 3VMYA 4NPFX 1FDMA 1LTGC 4D6TE 1CI6A 5CCHC 2ZJSE 3L36A 1PL5A 2E74C 1M90Q 1ZV8A 3ABVC 2QJPC 3IF4A 4L73A 1FZAA 1KQSO 1EDLA 1KB9E 1N2DC 2OTLP 2WPQA 1K9MQ 2R3SA 3CX5I 2ZAEB 3SFDC 2A06D 3O6QA 3T97A 3B71A 1OVRA 3RK3D 1YQ4C 3Q5RA 5KKZB 2Q5UA 1LGHB 1RE4A 2O01H 2WTYA 1SQBK 5BU8B 2N9BA 4OWFA 1Y9BA 1SFCB 2AEJA 4EOTA 2Y9YA 2E75B 5EFWB 3B5NC 2JWDA 1T8ZA 2A06G 3CWBD 4DZOA 2CPSA 1VF5D 2FFDB 4H0LB 4Z1MH 1YIJP 1PIXA 2HODA 1L0NK 4RESB 1YQ3C 1JEKA 1GU4A 3MHVA 3U1CA 5AW2B 2QG4A 2WSCJ 5CCHA 4EI2A 3M0AA 1PZQA 5B5EE 1OVVA 2XU6A 2ZXEB 3LIEA 3CWBG 4IFFA 3MZWB 1BGYE 5H2FE 2O1KA 1P84E 1M56D 1U7JA 1NTZE 4HJGH 3PJSK 3H1LJ 1SVFA 3HE4A 4K3AA 2IBZD 1AV1A 3JCUH 1JM0A 2ZVOB 1FOSE 3O8ZA 4D6TD 1N7SA 2M3EA 2A45G 2K9JA 4XA4A 3S4RA 4W7ZA 1EZVE 4PD4H 4ZNCA 1HF9A 1GL2A 4ZKUA 1IFNA 1EDIA 2LXBA 1KB9D 1GD2E 4HB1A 4OGQB 2IZ0A 5AVTB 4Y28J 1BCCD 2IBZG 4M3LA 2KYVA 1ZOYC 2HR3A 4L74A 2W83C 1NTKK 5CMZA 2CPBA 1G1JA 3RL0D 2IDBA 3GMAA 5KAIH 1J1EB 2YIUB 5GTHH 3MTUE 2WSFH 3IR9A 1KYOH 2WSEJ 1T3UA 2A45I 1HVVA 2MJZA 1ZXGA 2YO3A 1GU5A 1JTHB 3BATA 2J59M 1BCCG 3RK3C 3WU2H 4UB8E 1OZHA 2B88A 2NPSA 1FZCB 3EFFK 1DIPA 1KORA 1XTCC 1N73C 1GK6A 5AVWB 1L4AB 1NKNA 4GIFA 2IBZI 3L73E 3CCQP 2ZYAA 3L72E 2I1KA 1YTZT 2H88C 2ZT9B 1VF5C 1SQVD 2OYIC 2RMZA 1GW3A 1S9KE 4IFDK 2OQQA 1BGYD 3M91A 1P84D 1GTWA 1WMKA 4PD4E 1EXIA 1NTZD 5BVZA 1LTBC 1VQLP 5AW3B 1FZGA 3NFQA 4IFMA 1IK7A 2AEFA 4OH8B 1IO4A 1GMJA 4TLFA 1SP4A 4KT0J 1SQVG 4WY4A 1KFMA 3R2PA 1N8RQ 3BASA 1BGYG 1KYOE 1NTZG 2FBWC 3KZIE 4LGDE 3MUDC 1WT6A 2HPCA 3AE1C 3GHGB 1NU1J 2PP6A 2WITA 2I8DA 2KZIA 1X22A 2Q1KA 1IFJA 2P2UA 1M7LA 2VRSA 1KILA 1EQ7A 2E75D 2OYIA 4NPEA 5AW1B 2E76B 2OYOA 4H0LD 3A0HE 1ZR2A 1FDOA 3EFGA 3VOPA 3L72D 1CZQA 1PP9E 1H89A 2KNCA 1DEBA 2QM8A 3S9OA 3CCJP 1RHZB 3KHUA 1VQPP 3H1KD 4Y99B 2OYHC 1BDDA 1S72P 1T3JA 1RQVA 2WWWA 2ITAA 4O9BA 2O01N 2WT7A 3M9QA 1S9KD 3HE5A 4DJGA 4PD4D 4BRYB 3D6ZA 1NKZB 2AXTH 3L72G 5KLVJ 2B87A 1X79B 3CMAP 3M0DA 1N86A 1JCDA 1OWAA 1KN7A 3H1KG 3QH9A 1BE3D 1L0LE 4ZMDA 5AVYB 3CXHE 1N7SD 5TJHA 3L75E 4W7YA 1PGQA 2QEXP 3CCMP 2K1AA 3HRNA 2KS1B 1G1IA 3L74D 1MZ9A 1KYOD 1NVOA 1L0LK 1GL2D 1AJYA 2IFNA 2YXQB 3H32A 3G9RA 1OW6A 1USEA 3L70J 2B9BA 2HFED 3PLNA 1NOHA 1NTMJ 1BE3G 1KB9H 3V2RA 1JB0J 4EIJA 2OTKE 1IK9A 2KK7A 2FYUJ 3TGUE 4YPCA 3L74G 2NRGA 4C7NA 1VQ4P 4IL6E 1KILE 4I7ZC 3BCCJ 2QA4P 1M57D 1OW8A 4PD4I 1QLED 2NPSD 3W67A 1RE4C 3Q5SA 3TNUA 1RH5B 3V2PA 2AXTE 1YITP 3KYQA 2E75C 1LNQA 2KLVA 1SQXJ 1ZLLA 1VDFA 4W80A 2Z4EA 5KLIC 2LR2A 1X9VA 4H0LC 2HYNA 3L37A 3Q2YA 4PV1D 1KYOI 5APTA 3H1JJ 5L8RJ 3AE4C 4RJTA 1WRGA 1QL2A 3V5BA 2OARA 2C9NY 3TYYA 2QJYB 5B5EH 2W6JH 1HTLC 1CW5A 1KD1Q 1PFIA 3BRVB 1FU1A 2ZYDA 1LTJB 1ZRTE 2BEZF 2SPZA 3A5TA 2CK3H 5H2FH 3P32A 1P84H 3AECC 2QSIA 3WUUA 5TISE 1OVUA 1L0LD 2YXRB 3CCRP 1S5LE 4WY4D 4I2LC 1URQB 2KZJA 1ZP0C 1D7MA 5DJTB 5BU5A 1LWUB 2GUSA 2R5BA 3CI9A 3KPEA 1KV4A 1SQBE 3VP8A 3AE6C 3GF7A 3PRJA 3H1HD 1W5CE 3OA7A 2M5AB 3NMDA 1N7SC 3HD7B 1ZW0A 1RF1B 4WWIA 1SFCA 3H1IE 2E5TA 1JO5A 2H43A 1GL2C 1HUCA 1JY2O 1L0NE 1LTIC 5DJUB 5AW4B 2FFDA 4N6JA 2W27A 2HG5D 2QJKC 3RK2B 4IL6X 1S4XA 1KILD 3C8VA 2ZFCA 2WPVB 3H1HJ 3H1HG 4GDOA 1MKMA 2YIUC 2E76D 4DT0A 5AW5B 1GW4A 1CSBA 4BXLA 3PTZA 2QRXA 3LIDA 5APYA 1H0TB 4UB8H 1RF0A 3CWBJ 2Q9IA 3AEAC 1YJ9P 2Z5HA 3WUTA 2FYNB 1IFPA 2NPSC 4H44D 1LTSC 1VL2A 3AEEC 2L5GB 1YJNP 4U3FE 2QJPB 1IFMA 1HGVA 2JP3A 1FJKA 1KTMA 3TK1A 4YXWH 2IX7C 2AEMA 3G71P 1ZRTD 4PV1C 1FC2C 3C1LA 1LTAC 5AW6B 1NTKE 3L71E 3E7KA 2ZXXA 1S5LX 3FGAD 2G8YA 1K04A 2FXPA 2BCCE 1SQPE 3N7NA 1NU1K 5AVRB 3I5CA 1SQBD 1Q81Q 4D6TJ 4D6TG 3HTKB 2D2CB 3D6YA 1RQUA 2Y0CA 3AE7C 2R32A 3B5NB 4WY4C 1SQPK 2ZYGA 3CCEP 3KZIH 5KAFE 1JTHA 3OW2O 2MKVA 3H1ID 1OX3A 3R4YA 2WSSH 3VTPC 3MD0A 3MP7B 1BCCJ 1HGZA 2P7JA 1L0ND 2POHA 3GHGC 1FZCA 3B4SA 1SQBG 2YMKA 1EDKA 2FKWB 1SQQE 1NJIQ 3GW6A 3SWYA 1HBWA 2QM7A 1X8YA 4LC1A 1H8AA 2C0XA 4XFJA 2H7HA 1SQQK 4XE5B 3H1IG 4CPGA 1PV3A 2M8RA 1R8EA 1L0NG 1KILC 1KB9I 1OXZA 2E76C 5CJ0A 3A0HH 2QE7H 1M1JB 4GOFA 4GOEA 1AA0A 2Q3EA 5KLVK 1SS1A 1U57A 5GTIE 4R4LA 2XNXA 3AEBC 5KJ7A 2R3CA 1JUNA 1SQVJ 2BASA 2C9LY 4ZKPA 2FXMA 1OMIA 4H44C 2JR8A 1BGYJ 3AE2C 5CCGA 1MV8A 2E5YA 1EZVD 1NTME 1NTZJ 1OFCX 1NTKD 3L71D 3FWNA 1J1DC 3JSVC 2LKMA 1KQLA 3GHGA 1Y47A 1A02F 2I1JA 2RKLA 5AW8B 2FYUE 2BCCD 4N78E 1SQPD 3CPWO 1NTMK 3M0DC 1GDTA 1E79H 3LW5H 3CXHH
chains in the Genus database with same CATH topology
1L0NJ 3L73J 1NTZJ 2BCCJ 1NTMJ 1KB9I 3L75J 1SQPJ 3H1LJ 1BE3J 3BCCJ 5KLVJ 3L72J 1SQXJ 1EZVI 4PD4I 4D6TJ 1BCCJ 1NU1J 1SQVJ 3CX5I 4U3FJ 1NTKJ 2FYUJ 3L71J 3H1KJ 3H1HJ 1L0LJ 3TGUJ 3H1IJ 3CWBJ 1SQBJ 3L70J 1BGYJ 3CXHI 1KYOI 1PP9J 3L74J 1P84I 3H1JJ 1SQQJ 2IBZI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N J;  3L73 J;  1NTZ J;  2BCC J;  1NTM J;  1KB9 I;  3L75 J;  1SQP J;  3H1L J;  1BE3 J;  3BCC J;  5KLV J;  3L72 J;  1SQX J;  1EZV I;  4PD4 I;  4D6T J;  1BCC J;  1NU1 J;  1SQV J;  3CX5 I;  4U3F J;  1NTK J;  2FYU J;  3L71 J;  3H1K J;  3H1H J;  1L0L J;  3TGU J;  3H1I J;  3CWB J;  1SQB J;  3L70 J;  1BGY J;  3CXH I;  1KYO I;  1PP9 J;  3L74 J;  1P84 I;  3H1J J;  1SQQ J;  2IBZ I; 
#chains in the Genus database with same CATH topology
 3AED C;  1T2K D;  1ZR4 A;  3HD7 D;  2FYU K;  3VP9 A;  1EZV G;  1N73 B;  3CD6 P;  2O01 J;  2YMY A;  1NTK G;  3L71 G;  4HKZ H;  1SFC D;  4EYY Q;  3U1A A;  2KSE A;  2W6A A;  4AUW A;  1JOC A;  1FZE A;  1P84 I;  4GOD A;  2P10 A;  1UII A;  1YTZ I;  3RK2 D;  3L73 D;  3CX5 E;  1LP1 B;  4C7R A;  4I1L A;  1IJD B;  3WUV A;  3D70 A;  1SQX K;  1NWQ A;  4JYB A;  1RY3 A;  4IL6 H;  4C46 A;  1MFZ A;  2K37 A;  5AVS B;  5AW7 B;  4A7P A;  2V7Q H;  1VQK P;  2JDI H;  1G2C B;  1EZV I;  3G3Z A;  3VN0 A;  3A0B E;  5C39 A;  2Y9Z A;  2ZVN B;  3AE9 C;  2RN0 A;  1AVO A;  3VMX A;  1QVF O;  4YXD C;  2E43 A;  4BRY A;  3L73 G;  1AQ5 A;  1LJ2 A;  3L72 J;  3AEF C;  4OVN F;  1FZB A;  2KP8 A;  2O1J A;  3H1K J;  1YI2 P;  2XV5 A;  2KI7 B;  1KQG B;  3CCL P;  3G4S P;  1PPJ E;  3UIA A;  2KS1 A;  3GF3 A;  2KUB A;  1JY3 O;  5APS A;  3USS A;  1LT9 B;  1J2J B;  4OGQ D;  5B66 E;  3NXS A;  4NPD A;  1Q82 Q;  2O3J A;  1XTG B;  1ZN5 A;  4N78 D;  2A06 E;  5TIS H;  1BE3 J;  1PGO A;  3RL0 g;  2W8Z A;  5AVU B;  1ZME C;  1A02 J;  3SSU A;  2D2C D;  1S5L H;  3SFE C;  3MGN A;  1BSN A;  3RL0 B;  1YBK A;  1JCC A;  5APQ A;  3HUS B;  1URQ C;  2IPP A;  2WSF J;  1Q7Y Q;  3L74 J;  2WSE H;  2WVR A;  5AVX B;  3CME P;  2JJL A;  5CBO A;  3FXD A;  4WB4 A;  2P58 A;  2IYO A;  5KKZ C;  1T2K C;  4UB6 H;  4MN4 C;  3HD7 C;  3A3Y B;  2PRR A;  1L4A D;  2W90 A;  1RF1 C;  2OYH B;  3CX5 D;  1RE3 A;  1SFC C;  1QX8 A;  2JKV A;  1HH0 A;  3H1L E;  3W68 A;  2P1J A;  2KB7 P;  1PP9 D;  3V4W A;  2ZT9 D;  3L4F A;  3BRT B;  2FFD C;  3RK2 C;  1N7L A;  1H88 A;  1S1C X;  1UIX A;  4AYC A;  1YJW P;  4WVZ A;  2M0B A;  1Z56 A;  3GLM A;  4L76 A;  2N1T B;  2XDJ A;  1LTJ A;  1K8A Q;  2Y0E A;  3AE3 C;  1PP9 G;  1JY3 P;  2IBZ E;  1Q2N A;  3L35 A;  5KJ7 D;  1RF0 C;  3H6P A;  2LXC B;  3P8C E;  4RKU J;  2XND H;  1R5S A;  1VQ5 P;  2FYN C;  4PJ0 E;  3CXH D;  1URQ A;  3AE5 C;  2H8P D;  1EXJ A;  3IN6 A;  3M9B A;  1CI6 B;  1LWU A;  1PPJ D;  3V4Q A;  3L75 D;  1NH4 A;  1K05 A;  5CCG D;  2JEE A;  1Y8A A;  1U7M A;  4RO0 A;  1K73 Q;  3EWK A;  4H13 B;  3V2Q A;  3CLQ A;  2M5A A;  3KDP B;  3HD7 A;  1BCC E;  1DD4 A;  1FJP A;  4DOJ A;  1RF1 A;  1MFT A;  4UB6 E;  1L0L J;  1L0L G;  3KQG A;  2YO2 A;  3LW5 J;  4I7Z B;  3FXE A;  3O6Q B;  4GT1 A;  4KHX A;  3T97 B;  1PPJ G;  3L75 J;  3L75 G;  4OGQ C;  2W6B A;  3TGU D;  1L2P A;  2GUV A;  4I6M C;  1NYH A;  4JF7 A;  3F5H A;  4QMA A;  1FBM A;  1USD A;  4GKG A;  4ASW A;  2D2C C;  3CCS P;  1J1E C;  3VMA A;  3Q3D A;  4R4M A;  1YHQ P;  2KIK A;  5KAF H;  1W2E A;  1PGP A;  5KLI B;  3M06 A;  3ZDM A;  5CJ4 A;  3Q5P A;  5KTB A;  1H0T A;  4YTP C;  1IZN B;  2WMM A;  3H1L D;  1KQF B;  3TGU J;  3CC7 P;  5AVV B;  3TGU G;  2HOD B;  4IOI H;  3CXH I;  1LT1 A;  1FZC C;  2J5U A;  3AE8 C;  1EC5 A;  1L4A C;  5AVZ B;  2V7Q J;  1DX7 A;  2E74 B;  1SQV E;  4HYT B;  4BWN A;  3C9I A;  1VQ6 P;  2KSJ A;  2ZT9 C;  5AW0 B;  1M8O B;  3V2N A;  3H1L G;  1SQV K;  5M1B A;  4N3Y B;  3HE4 B;  1NU1 E;  4L75 A;  1NO4 A;  3F89 A;  3S1K A;  3P8C D;  1NTZ K;  1M1J C;  3E1I A;  1MUU A;  4DCK A;  1FOS F;  1N7S B;  5GTI H;  1YYC A;  2IYP A;  1JMB A;  3P8M C;  1IFD A;  3VMZ A;  3PP5 A;  1BSH A;  2K9J B;  1AVY A;  3OAK A;  2KXP B;  5KJ7 C;  3CL3 D;  3HTK A;  3E1R A;  1GL2 B;  4WBA A;  1JY2 P;  3B5N A;  1VQ7 P;  5AVQ B;  3A2A A;  4HH2 A;  4KJM A;  1VQO P;  2QJK B;  5CCG C;  5APW A;  3QWO C;  1HJB A;  3BVH A;  1VQ8 P;  1R5L A;  2QIW A;  3KXD A;  3Q1M A;  1KC8 Q;  2Z5I A;  1SQB J;  4ASV A;  1L4A A;  3U59 A;  1IC2 A;  4LLH A;  5APU A;  1AFO A;  2HLO A;  2GM4 A;  1VPC A;  4JYC A;  2BEQ D;  1Q86 Q;  1HJ0 A;  1QEX A;  2YKO A;  2FY8 A;  2L91 A;  3H1I J;  2NPS B;  2KLU A;  1L0N J;  4EDF A;  5KLV E;  4K35 A;  2JWA A;  2B89 A;  1M1J A;  4JQ0 D;  3CX5 H;  3H1K E;  3JCU E;  2E42 A;  3EQ2 A;  3D71 A;  2PGD A;  1FE6 A;  1T6A A;  2PFX A;  5K5G B;  4PV1 B;  3RBZ A;  2K88 A;  4JPZ B;  4U3F D;  2Y0D A;  1SLQ A;  1HWT C;  2N9Y B;  2Q3I A;  2N1T D;  1S2E A;  4U7J A;  2OGU A;  4Y99 C;  3A0B H;  3FX0 A;  3CC2 P;  3L70 E;  1NU1 D;  1BE3 E;  1KZU B;  1URQ D;  3WMM 0;  5KAI E;  4U3F J;  4WY4 B;  4U3F G;  5GTH E;  1JY3 N;  1LTT C;  2Q6Q A;  4H13 D;  3L74 E;  1VQN P;  3OJA B;  3RK3 B;  3BCC E;  2XZR A;  3A7O A;  2WZ7 A;  3B8E B;  2HPC B;  1N73 A;  1NU1 G;  2K3R A;  1FDI A;  3AEG C;  3RGU A;  3WU2 E;  1NTK J;  3L71 J;  1JNM A;  4TT3 H;  3IAO A;  5E79 H;  2UWJ E;  1LT9 C;  5B66 H;  1VQ9 P;  1FZF A;  4AQR D;  2DW3 A;  2BCC J;  2BCC G;  1SQP J;  1FS0 E;  1SQP G;  2WQY C;  1EDJ A;  1SQX E;  1QL1 A;  3NTN A;  1QVG O;  2GA1 A;  1NAY A;  1NHL A;  1SQQ D;  1BDC A;  1VF5 B;  2OTJ P;  1LP1 A;  2WPS A;  3GG2 A;  1QGK B;  3RL0 C;  1KIL B;  2AXC A;  1DH3 A;  3TF5 A;  2OYI B;  3H1J E;  3HUS C;  1X0T A;  2R5D A;  3TDK A;  2YNY A;  1G2C A;  2WSC H;  2C0W A;  3JC2 2;  3M9H A;  1Q90 D;  3PHL A;  1W2B O;  5KLV D;  3PH0 A;  3IFM A;  1SQQ J;  1SQQ G;  2KNC B;  3K5B A;  3L73 J;  5AW9 B;  3CC4 P;  1OIP A;  5CCH D;  3SWF A;  2E74 D;  1IFI A;  1RE3 C;  4H44 B;  2WT7 B;  2Q7C A;  2PAJ A;  3MUD A;  3P7K A;  3HE5 B;  1J1D B;  2RH0 A;  2V4H A;  5CBN A;  2A45 H;  2J58 A;  5KLV G;  2K9Y A;  2B87 B;  3L70 D;  2QVA A;  3I56 P;  1DD3 A;  2H89 C;  1VQM P;  1LT9 A;  1E5W A;  1OW7 A;  5CHX A;  1NTM D;  1PGJ A;  3N4X A;  3MIW A;  5E79 E;  2QJY C;  5APX A;  2N1T C;  4JBZ A;  1FAV A;  1M1K Q;  1AQT A;  1LTJ C;  2FYU D;  3VYI A;  2M3B A;  4PJ0 H;  3G6E P;  3RK3 E;  3H32 B;  3V6I A;  3B5N D;  3HUS A;  3H1H E;  3BCC D;  3L70 G;  1GK4 A;  2KOG A;  3I55 P;  1LWU C;  2JO1 A;  1NTM G;  2XKM A;  3SWK A;  4H13 C;  1TU3 F;  1JMM A;  3II6 A;  2R44 A;  1JY2 N;  4B86 A;  1NGM B;  2FYU G;  2WPR A;  1SQX D;  3CWB E;  2OYH A;  1DEE G;  3CCV P;  3TSI A;  2IZ1 A;  4C7N B;  3BCC G;  1KFN A;  3H1J D;  5APV A;  2YKQ A;  2FXO A;  2IFM A;  1KMI Z;  3CCU P;  2NZ2 A;  3FWL A;  2P67 A;  1NAF A;  3TNU B;  2FYZ A;  1SQX G;  1S3J A;  2G3A A;  2YKP A;  3ITK A;  1GZL A;  2N1T A;  3H25 A;  3RBX A;  1PP9 J;  3H1J G;  3VMY A;  4NPF X;  1FDM A;  1LTG C;  4D6T E;  1CI6 A;  5CCH C;  2ZJS E;  3L36 A;  1PL5 A;  2E74 C;  1M90 Q;  1ZV8 A;  3ABV C;  2QJP C;  3IF4 A;  4L73 A;  1FZA A;  1KQS O;  1EDL A;  1KB9 E;  1N2D C;  2OTL P;  2WPQ A;  1K9M Q;  2R3S A;  3CX5 I;  2ZAE B;  3SFD C;  2A06 D;  3O6Q A;  3T97 A;  3B71 A;  1OVR A;  3RK3 D;  1YQ4 C;  3Q5R A;  5KKZ B;  2Q5U A;  1LGH B;  1RE4 A;  2O01 H;  2WTY A;  1SQB K;  5BU8 B;  2N9B A;  4OWF A;  1Y9B A;  1SFC B;  2AEJ A;  4EOT A;  2Y9Y A;  2E75 B;  5EFW B;  3B5N C;  2JWD A;  1T8Z A;  2A06 G;  3CWB D;  4DZO A;  2CPS A;  1VF5 D;  2FFD B;  4H0L B;  4Z1M H;  1YIJ P;  1PIX A;  2HOD A;  1L0N K;  4RES B;  1YQ3 C;  1JEK A;  1GU4 A;  3MHV A;  3U1C A;  5AW2 B;  2QG4 A;  2WSC J;  5CCH A;  4EI2 A;  3M0A A;  1PZQ A;  5B5E E;  1OVV A;  2XU6 A;  2ZXE B;  3LIE A;  3CWB G;  4IFF A;  3MZW B;  1BGY E;  5H2F E;  2O1K A;  1P84 E;  1M56 D;  1U7J A;  1NTZ E;  4HJG H;  3PJS K;  3H1L J;  1SVF A;  3HE4 A;  4K3A A;  2IBZ D;  1AV1 A;  3JCU H;  1JM0 A;  2ZVO B;  1FOS E;  3O8Z A;  4D6T D;  1N7S A;  2M3E A;  2A45 G;  2K9J A;  4XA4 A;  3S4R A;  4W7Z A;  1EZV E;  4PD4 H;  4ZNC A;  1HF9 A;  1GL2 A;  4ZKU A;  1IFN A;  1EDI A;  2LXB A;  1KB9 D;  1GD2 E;  4HB1 A;  4OGQ B;  2IZ0 A;  5AVT B;  4Y28 J;  1BCC D;  2IBZ G;  4M3L A;  2KYV A;  1ZOY C;  2HR3 A;  4L74 A;  2W83 C;  1NTK K;  5CMZ A;  2CPB A;  1G1J A;  3RL0 D;  2IDB A;  3GMA A;  5KAI H;  1J1E B;  2YIU B;  5GTH H;  3MTU E;  2WSF H;  3IR9 A;  1KYO H;  2WSE J;  1T3U A;  2A45 I;  1HVV A;  2MJZ A;  1ZXG A;  2YO3 A;  1GU5 A;  1JTH B;  3BAT A;  2J59 M;  1BCC G;  3RK3 C;  3WU2 H;  4UB8 E;  1OZH A;  2B88 A;  2NPS A;  1FZC B;  3EFF K;  1DIP A;  1KOR A;  1XTC C;  1N73 C;  1GK6 A;  5AVW B;  1L4A B;  1NKN A;  4GIF A;  2IBZ I;  3L73 E;  3CCQ P;  2ZYA A;  3L72 E;  2I1K A;  1YTZ T;  2H88 C;  2ZT9 B;  1VF5 C;  1SQV D;  2OYI C;  2RMZ A;  1GW3 A;  1S9K E;  4IFD K;  2OQQ A;  1BGY D;  3M91 A;  1P84 D;  1GTW A;  1WMK A;  4PD4 E;  1EXI A;  1NTZ D;  5BVZ A;  1LTB C;  1VQL P;  5AW3 B;  1FZG A;  3NFQ A;  4IFM A;  1IK7 A;  2AEF A;  4OH8 B;  1IO4 A;  1GMJ A;  4TLF A;  1SP4 A;  4KT0 J;  1SQV G;  4WY4 A;  1KFM A;  3R2P A;  1N8R Q;  3BAS A;  1BGY G;  1KYO E;  1NTZ G;  2FBW C;  3KZI E;  4LGD E;  3MUD C;  1WT6 A;  2HPC A;  3AE1 C;  3GHG B;  1NU1 J;  2PP6 A;  2WIT A;  2I8D A;  2KZI A;  1X22 A;  2Q1K A;  1IFJ A;  2P2U A;  1M7L A;  2VRS A;  1KIL A;  1EQ7 A;  2E75 D;  2OYI A;  4NPE A;  5AW1 B;  2E76 B;  2OYO A;  4H0L D;  3A0H E;  1ZR2 A;  1FDO A;  3EFG A;  3VOP A;  3L72 D;  1CZQ A;  1PP9 E;  1H89 A;  2KNC A;  1DEB A;  2QM8 A;  3S9O A;  3CCJ P;  1RHZ B;  3KHU A;  1VQP P;  3H1K D;  4Y99 B;  2OYH C;  1BDD A;  1S72 P;  1T3J A;  1RQV A;  2WWW A;  2ITA A;  4O9B A;  2O01 N;  2WT7 A;  3M9Q A;  1S9K D;  3HE5 A;  4DJG A;  4PD4 D;  4BRY B;  3D6Z A;  1NKZ B;  2AXT H;  3L72 G;  5KLV J;  2B87 A;  1X79 B;  3CMA P;  3M0D A;  1N86 A;  1JCD A;  1OWA A;  1KN7 A;  3H1K G;  3QH9 A;  1BE3 D;  1L0L E;  4ZMD A;  5AVY B;  3CXH E;  1N7S D;  5TJH A;  3L75 E;  4W7Y A;  1PGQ A;  2QEX P;  3CCM P;  2K1A A;  3HRN A;  2KS1 B;  1G1I A;  3L74 D;  1MZ9 A;  1KYO D;  1NVO A;  1L0L K;  1GL2 D;  1AJY A;  2IFN A;  2YXQ B;  3H32 A;  3G9R A;  1OW6 A;  1USE A;  3L70 J;  2B9B A;  2HFE D;  3PLN A;  1NOH A;  1NTM J;  1BE3 G;  1KB9 H;  3V2R A;  1JB0 J;  4EIJ A;  2OTK E;  1IK9 A;  2KK7 A;  2FYU J;  3TGU E;  4YPC A;  3L74 G;  2NRG A;  4C7N A;  1VQ4 P;  4IL6 E;  1KIL E;  4I7Z C;  3BCC J;  2QA4 P;  1M57 D;  1OW8 A;  4PD4 I;  1QLE D;  2NPS D;  3W67 A;  1RE4 C;  3Q5S A;  3TNU A;  1RH5 B;  3V2P A;  2AXT E;  1YIT P;  3KYQ A;  2E75 C;  1LNQ A;  2KLV A;  1SQX J;  1ZLL A;  1VDF A;  4W80 A;  2Z4E A;  5KLI C;  2LR2 A;  1X9V A;  4H0L C;  2HYN A;  3L37 A;  3Q2Y A;  4PV1 D;  1KYO I;  5APT A;  3H1J J;  5L8R J;  3AE4 C;  4RJT A;  1WRG A;  1QL2 A;  3V5B A;  2OAR A;  2C9N Y;  3TYY A;  2QJY B;  5B5E H;  2W6J H;  1HTL C;  1CW5 A;  1KD1 Q;  1PFI A;  3BRV B;  1FU1 A;  2ZYD A;  1LTJ B;  1ZRT E;  2BEZ F;  2SPZ A;  3A5T A;  2CK3 H;  5H2F H;  3P32 A;  1P84 H;  3AEC C;  2QSI A;  3WUU A;  5TIS E;  1OVU A;  1L0L D;  2YXR B;  3CCR P;  1S5L E;  4WY4 D;  4I2L C;  1URQ B;  2KZJ A;  1ZP0 C;  1D7M A;  5DJT B;  5BU5 A;  1LWU B;  2GUS A;  2R5B A;  3CI9 A;  3KPE A;  1KV4 A;  1SQB E;  3VP8 A;  3AE6 C;  3GF7 A;  3PRJ A;  3H1H D;  1W5C E;  3OA7 A;  2M5A B;  3NMD A;  1N7S C;  3HD7 B;  1ZW0 A;  1RF1 B;  4WWI A;  1SFC A;  3H1I E;  2E5T A;  1JO5 A;  2H43 A;  1GL2 C;  1HUC A;  1JY2 O;  1L0N E;  1LTI C;  5DJU B;  5AW4 B;  2FFD A;  4N6J A;  2W27 A;  2HG5 D;  2QJK C;  3RK2 B;  4IL6 X;  1S4X A;  1KIL D;  3C8V A;  2ZFC A;  2WPV B;  3H1H J;  3H1H G;  4GDO A;  1MKM A;  2YIU C;  2E76 D;  4DT0 A;  5AW5 B;  1GW4 A;  1CSB A;  4BXL A;  3PTZ A;  2QRX A;  3LID A;  5APY A;  1H0T B;  4UB8 H;  1RF0 A;  3CWB J;  2Q9I A;  3AEA C;  1YJ9 P;  2Z5H A;  3WUT A;  2FYN B;  1IFP A;  2NPS C;  4H44 D;  1LTS C;  1VL2 A;  3AEE C;  2L5G B;  1YJN P;  4U3F E;  2QJP B;  1IFM A;  1HGV A;  2JP3 A;  1FJK A;  1KTM A;  3TK1 A;  4YXW H;  2IX7 C;  2AEM A;  3G71 P;  1ZRT D;  4PV1 C;  1FC2 C;  3C1L A;  1LTA C;  5AW6 B;  1NTK E;  3L71 E;  3E7K A;  2ZXX A;  1S5L X;  3FGA D;  2G8Y A;  1K04 A;  2FXP A;  2BCC E;  1SQP E;  3N7N A;  1NU1 K;  5AVR B;  3I5C A;  1SQB D;  1Q81 Q;  4D6T J;  4D6T G;  3HTK B;  2D2C B;  3D6Y A;  1RQU A;  2Y0C A;  3AE7 C;  2R32 A;  3B5N B;  4WY4 C;  1SQP K;  2ZYG A;  3CCE P;  3KZI H;  5KAF E;  1JTH A;  3OW2 O;  2MKV A;  3H1I D;  1OX3 A;  3R4Y A;  2WSS H;  3VTP C;  3MD0 A;  3MP7 B;  1BCC J;  1HGZ A;  2P7J A;  1L0N D;  2POH A;  3GHG C;  1FZC A;  3B4S A;  1SQB G;  2YMK A;  1EDK A;  2FKW B;  1SQQ E;  1NJI Q;  3GW6 A;  3SWY A;  1HBW A;  2QM7 A;  1X8Y A;  4LC1 A;  1H8A A;  2C0X A;  4XFJ A;  2H7H A;  1SQQ K;  4XE5 B;  3H1I G;  4CPG A;  1PV3 A;  2M8R A;  1R8E A;  1L0N G;  1KIL C;  1KB9 I;  1OXZ A;  2E76 C;  5CJ0 A;  3A0H H;  2QE7 H;  1M1J B;  4GOF A;  4GOE A;  1AA0 A;  2Q3E A;  5KLV K;  1SS1 A;  1U57 A;  5GTI E;  4R4L A;  2XNX A;  3AEB C;  5KJ7 A;  2R3C A;  1JUN A;  1SQV J;  2BAS A;  2C9L Y;  4ZKP A;  2FXM A;  1OMI A;  4H44 C;  2JR8 A;  1BGY J;  3AE2 C;  5CCG A;  1MV8 A;  2E5Y A;  1EZV D;  1NTM E;  1NTZ J;  1OFC X;  1NTK D;  3L71 D;  3FWN A;  1J1D C;  3JSV C;  2LKM A;  1KQL A;  3GHG A;  1Y47 A;  1A02 F;  2I1J A;  2RKL A;  5AW8 B;  2FYU E;  2BCC D;  4N78 E;  1SQP D;  3CPW O;  1NTM K;  3M0D C;  1GDT A;  1E79 H;  3LW5 H;  3CXH H; 
#chains in the Genus database with same CATH homology
 1L0N J;  3L73 J;  1NTZ J;  2BCC J;  1NTM J;  1KB9 I;  3L75 J;  1SQP J;  3H1L J;  1BE3 J;  3BCC J;  5KLV J;  3L72 J;  1SQX J;  1EZV I;  4PD4 I;  4D6T J;  1BCC J;  1NU1 J;  1SQV J;  3CX5 I;  4U3F J;  1NTK J;  2FYU J;  3L71 J;  3H1K J;  3H1H J;  1L0L J;  3TGU J;  3H1I J;  3CWB J;  1SQB J;  3L70 J;  1BGY J;  3CXH I;  1KYO I;  1PP9 J;  3L74 J;  1P84 I;  3H1J J;  1SQQ J;  2IBZ I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...