4U3FJ

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 22
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4u3fJ00
1SQVJ 3BCCJ 4D6TJ 1NTZJ 3L70J 1BE3J 3L71J 3L75J 2FYUJ 1KB9I 1BGYJ 1SQXJ 3H1IJ 3L72J 1NTKJ 1SQQJ 3CWBJ 2IBZI 1PP9J 3H1HJ 4U3FJ 4PD4I 2BCCJ 1KYOI 3CX5I 3H1LJ 1NTMJ 3L73J 3CXHI 1BCCJ 1P84I 1SQBJ 3TGUJ 1NU1J 1EZVI 3H1JJ 3L74J 1L0NJ 1SQPJ 3H1KJ 5KLVJ 1L0LJ
chains in the Genus database with same CATH superfamily
3V2QA 3OW2O 2AXCA 1KQSO 1N7SB 4IL6X 3M9HA 3V5BA 5TISH 1L4AB 1PGJA 1LWUB 4D6TG 3L37A 5KJ7D 3P8CD 5GTHH 1KB9I 2IFMA 1L4AC 3I55P 1BGYJ 5KLVG 1GZLA 5APVA 2MKVA 4U3FE 3S4RA 1H89A 4GODA 2FYUK 1NTMD 2Q3IA 2R5DA 1SQQJ 2WSCJ 3AEGC 1YYCA 1VF5C 2YIUC 3TGUE 3CC4P 3D70A 3O8ZA 1KFMA 4YTPC 5B5EE 2CPSA 1JO5A 3H1ID 2N1TC 3Q3DA 3A5TA 1H0TB 3U1AA 1DX7A 1XTGB 1SQVD 1YIJP 1DEBA 1P84I 2QJKB 2W90A 2K9YA 2M5AA 1NTZE 3H1LE 3QWOC 1VQOP 3CCEP 5K5GB 1PFIA 4C46A 1YJ9P 2K9JA 1MV8A 1RHZB 1U7MA 1PPJE 2FYUG 2R3SA 2QEXP 3TNUA 1H88A 2A06D 1OXZA 1FBMA 4GOFA 1LT9B 2RH0A 1CZQA 1ZV8A 1E5WA 5KLVJ 4N78E 1IFNA 1YTZT 1URQC 1BDCA 1N7SA 3L70J 1PZQA 1LTJB 3SFEC 3Q1MA 2HPCA 3L73E 1YQ4C 2AEMA 4JBZA 4C7NB 4XFJA 4ZNCA 3L72J 3HUSB 3VOPA 2Y9ZA 1GL2D 2KP8A 4Y99C 4YXDC 2E76D 1YI2P 1L2PA 5E79H 2KIKA 1J1EB 1N2DC 1KILA 3PP5A 2GM4A 1KB9E 1M1JC 1GW4A 1HH0A 1NKNA 1NU1G 3BCCG 3AEEC 3MIWA 4PJ0E 3L75E 4IL6H 3BCCD 1R5SA 5APTA 2OYHB 4XA4A 1A02J 1SQPD 2A45H 2A06G 3AE5C 3FXEA 5CBNA 1BE3G 2D2CD 2QG4A 1BSNA 2H88C 1Y9BA 2PGDA 2Q6QA 4IOIH 2NRGA 1JTHA 1L0LJ 3L4FA 3VP9A 2O1JA 3JCUH 1HVVA 2OTLP 3G4SP 1G2CA 3B5NA 4AQRD 1HF9A 1PIXA 2E75C 2KB7P 3Q5SA 1SQXD 2XU6A 1X79B 4PD4H 5AW6B 3H1HG 2GUVA 2KS1B 2E75B 4TT3H 1EZVE 1S9KE 2GA1A 2BCCE 2M8RA 4WY4B 1FZCC 3NMDA 2E74C 4GIFA 3HTKB 1VQ4P 1NU1K 1YJWP 1T3UA 1BCCG 2WPVB 2W83C 1T2KD 1KQLA 1W2BO 1QGKB 1SQQE 3M0AA 3SFDC 1URQA 2HODA 3H1LG 3LW5J 5EFWB 1AVYA 4H0LB 4O9BA 3TGUG 2IBZD 2BCCJ 2Q1KA 4N78D 3RK3B 1SQVK 1LT9C 2M3EA 1SFCB 2XDJA 4R4LA 1EDIA 1JCCA 2YNYA 3UIAA 1LTGC 3AE4C 2WT7B 2Q9IA 1FDIA 2B9BA 4EDFA 2HLOA 3VN0A 3GLMA 3AEBC 4WB4A 2K9JB 4DOJA 2JDIH 2HG5D 2R32A 1VDFA 2IBZE 2OGUA 1FZCA 3TK1A 1NTZK 1AV1A 1FJPA 2E74D 3AE6C 1KB9H 3AEFC 4ZKPA 5CBOA 3MZWB 3BRVB 1FJKA 1SQQD 3EWKA 4NPDA 4OGQC 1ZR2A 2KK7A 2WPSA 4IL6E 2XZRA 3KXDA 5AW5B 3SWYA 5KLVK 2BEZF 3G71P 1WT6A 1VQNP 1FDMA 3F89A 2E75D 5CCHA 3CC2P 3E1IA 4U3FG 1EDLA 1RQVA 2AEJA 3A0HE 1KQGB 5AW0B 1GW3A 1W2EA 3CWBE 3L71D 1N86A 2JR8A 3TYYA 3L71G 2KI7B 2WQYC 3A2AA 3CXHD 3I56P 1EQ7A 1ZXGA 1ZRTE 3G6EP 3L73J 1HJ0A 1NTKG 1BE3E 2WSSH 3L35A 4IFMA 5AVYB 1PP9D 3HD7D 1KFNA 1VPCA 3HUSA 3H1JJ 3IR9A 1IFIA 3H1HE 1M1JB 2G8YA 2K88A 2E76C 2ZJSE 3A7OA 2KXPB 2IYOA 1GL2C 3EFFK 1YJNP 1ZOYC 2E5TA 4L76A 4JPZB 4K3AA 3S9OA 4GOEA 2B89A 2OQQA 2I1JA 2SPZA 3CXHE 3D6ZA 1KYOE 3G3ZA 1GDTA 1PL5A 5AVQB 1URQD 3WU2H 1SQXJ 1OVUA 5B66E 1EZVG 1RE3C 1RQUA 2GUSA 2KLVA 2KNCB 2Q5UA 1RY3A 3V6IA 5KJ7A 1WRGA 1L0NE 3HRNA 1RF0C 1SQQG 3M0DC 3IN6A 4GKGA 1KD1Q 1VQLP 3QH9A 1VQ5P 5AW1B 1NTMJ 1VQMP 1CW5A 2ZVOB 1SFCA 3VMAA 1HTLC 1L0LK 4ASWA 1JB0J 1QVFO 1NVOA 2H7HA 2V7QH 1EZVI 3MUDA 1KC8Q 1MFTA 5KKZC 1SQVE 3A0HH 1VF5D 2WWWA 1NJIQ 1W5CE 1PV3A 1HUCA 1SFCC 2K37A 2RMZA 3LIEA 4I1LA 3VP8A 4UB6E 2IX7C 3RBZA 1L0ND 2HPCB 1R5LA 3TGUD 3T97B 4I6MC 1K8AQ 5CCHD 1IFPA 2A45I 5KJ7C 5BVZA 1L0LD 1JCDA 2ZT9D 3AECC 3MD0A 5KAIH 2BCCG 5KAFH 1K9MQ 1NTKK 3MHVA 3PHLA 1SQBK 1J1DC 4TLFA 3Q5RA 2K3RA 2N1TA 1OVVA 3VMYA 3RL0D 4YPCA 1N8RQ 1J1DB 1E79H 4PD4I 4Y99B 4HH2A 1OMIA 1KN7A 1KQFB 3RL0B 1JM0A 2I1KA 2FXPA 1QLED 3CCRP 1KYOH 2Q7CA 1JY3N 3M9BA 3V2PA 1EDKA 1NU1J 3RBXA 3BVHA 3O6QA 1USEA 1JY2O 1NAFA 1Q2NA 1BE3D 2J59M 2KNCA 4L75A 5AW4B 4BRYB 1BGYG 1NOHA 1NTMK 1SQPE 2POHA 1FZEA 4RKUJ 1LTTC 4H13C 5CMZA 3U59A 3CCVP 2OTJP 1AA0A 1YBKA 2FYUD 1MZ9A 3CX5H 1LTSC 2YO2A 2ZVNB 1SQBG 3H1KD 3M91A 4H13B 4W80A 3WUVA 1G1JA 2H8PD 2NPSA 1DD4A 1L0NG 1U57A 1VQ6P 5DJUB 1SP4A 2IYPA 2P10A 3C8VA 3GHGA 3NFQA 3USSA 2YKQA 1M1JA 4HB1A 4DT0A 1GTWA 2YMKA 3TNUB 1QX8A 2IZ1A 3RK3C 1Y8AA 2C9NY 1BDDA 1FC2C 1SQXE 1LTJA 1R8EA 1OW7A 2FYUE 4H44B 4RESB 1S72P 5AVWB 3C1LA 4N6JA 5DJTB 1M57D 3M9QA 5APQA 1KZUB 2W8ZA 1U7JA 1L0NK 2WPRA 3PH0A 1VF5B 4H44C 4WBAA 2WITA 5KAIE 4L74A 1LNQA 3RGUA 4D6TE 1OW6A 1SQPJ 3H1KJ 3W67A 1NAYA 1KILD 4L73A 5KLVE 2OTKE 2R5BA 4EYYQ 3L75G 4JYCA 2P1JA 5CCGD 2RKLA 1M90Q 1A02F 2C9LY 1RE4C 2QE7H 3CC7P 4C7RA 1LWUA 2JP3A 1T6AA 4LC1A 5APXA 1TU3F 3AE2C 3MTUE 3CCJP 2JO1A 4NPFX 3HD7B 4HKZH 5AW7B 1Q7YQ 3H1IJ 1N73A 1OWAA 2ZXEB 1M7LA 1NTZG 1URQB 2HODB 3CWBJ 2H43A 2CPBA 2FFDB 1OW8A 5CJ4A 2QM8A 1EDJA 1YITP 1BCCD 2QIWA 3AEDC 3CLQA 3CX5E 3H32A 4LLHA 2ZFCA 1Z56A 5CJ0A 5TISE 2B88A 3B5NC 3RK2C 1DH3A 2NPSB 3CXHI 2YKOA 2KS1A 1ZW0A 1RF1B 1KMIZ 2NPSC 2H89C 3L73G 3L70D 1YQ3C 2HFED 3B71A 1RF1C 4EOTA 1SVFA 1IJDB 1SQVJ 3H1JG 3HE5A 1AFOA 1GK4A 2WSFJ 2XNDH 1BCCE 3H6PA 1VQ9P 1FU1A 2JKVA 1KORA 2ZYAA 3FWNA 2ZXXA 3L74G 1NTME 2OARA 4EI2A 2YO3A 3V2RA 5AW2B 3RK2D 1JMMA 2WVRA 3II6A 2W27A 3TDKA 3V2NA 2G3AA 3FX0A 2R3CA 1VQPP 2UWJE 1KYOD 1HGVA 2VRSA 1SQXG 3P8CE 3CI9A 2QA4P 2N1TB 1NGMB 1T3JA 2FYZA 1SS1A 2KSJA 5TJHA 2IPPA 2QJKC 3LIDA 5KTBA 1PPJD 1SQQK 1AQTA 2IBZG 1IK9A 1X0TA 1RF0A 5GTHE 4RO0A 5KKZB 1NHLA 2WSEJ 3BRTB 3CD6P 3H1LD 3NXSA 1FS0E 2HYNA 1LT9A 1G2CB 3CMEP 2KZJA 4PV1B 2L5GB 3SWFA 1BSHA 1ZRTD 1KTMA 3G9RA 1JY3O 1NTKE 1NU1D 3JSVC 5CHXA 1L0LG 2WSEH 3CX5D 1IZNB 3FWLA 4H44D 3MGNA 3L71J 4I2LC 4I7ZB 4UB8H 5M1BA 3VMXA 3P7KA 3KHUA 1KV4A 2NZ2A 3CWBD 1WMKA 3F5HA 3L71E 3P32A 1VL2A 1S5LX 4GDOA 3CCMP 4OVNF 2OYHA 2WMMA 1NTKJ 2L91A 1J1EC 2BASA 3OAKA 3A0BH 4GT1A 3RK3D 4WY4D 1X9VA 1NWQA 2O01N 2Q3EA 2WSCH 1JNMA 3HE5B 1FOSE 4UB6H 2NPSD 2OYHC 1SQBD 1S3JA 2N9BA 3GF7A 3H1KG 3H32B 3PLNA 1D7MA 1GL2B 3H1LJ 4AYCA 1UIIA 1H0TA 3E7KA 1N7SC 3L70E 1RF1A 4N3YB 2FFDC 1JY2N 1PP9G 3KYQA 2PFXA 1PPJG 1QL2A 3B8EB 3OA7A 2W6AA 4PD4D 1K04A 1HGZA 1LJ2A 4K35A 1VQ8P 2R44A 3I5CA 1GL2A 1LGHB 1NTZJ 3CWBG 3A3YB 2M3BA 4U7JA 4JQ0D 1G1IA 1USDA 1L4AA 3KDPB 3NTNA 5APSA 3CCUP 5AW8B 2D2CB 2O3JA 4OH8B 3V4WA 4A7PA 1Q86Q 5AVUB 1S2EA 2K1AA 5AVZB 1NTMG 1IFMA 2AXTE 5CCGC 4W7YA 1ZN5A 1EXIA 2N9YB 3V4QA 1X8YA 2BCCD 4H0LC 1CI6B 2E74B 1GK6A 2QJYC 1LWUC 2J58A 4U3FJ 2OYIC 1LTBC 3H25A 3BASA 3H1JD 1LP1B 2IDBA 1NKZB 3K5BA 1NU1E 1SQVG 4PD4E 3Q2YA 4PV1C 3VMZA 3D6YA 1IO4A 3CPWO 3TSIA 2E43A 5CCHC 4PV1D 2CK3H 2YIUB 4M3LA 3L74J 3WUTA 4R4MA 1JOCA 3L75D 1S5LH 3AE8C 3ITKA 4H0LD 3CCLP 4QMAA 1KB9D 4ASVA 2LKMA 5B5EH 4OWFA 2QSIA 1AVOA 3H1IE 2QJPB 3KZIE 2YMYA 2ITAA 2JJLA 3L75J 4EIJA 2Z4EA 1AJYA 2P2UA 2QJPC 2FYNB 1RE4A 4WY4A 1IFJA 4BRYA 2Y0CA 3C9IA 5AW3B 3O6QB 2KSEA 1EZVD 1S9KD 1PGPA 4ZMDA 2KOGA 2MJZA 3P8MC 1MKMA 3L70G 3H1KE 5APUA 2DW3A 2O01J 1UIXA 3B5NB 1JY2P 2V7QJ 3L73D 3EFGA 1QEXA 1N73C 2E42A 3U1CA 3PTZA 3CXHH 5AW9B 1MFZA 1N7SD 2B87B 2LR2A 1MUUA 1QL1A 4KJMA 4LGDE 3RK2B 1SQBJ 3R2PA 1IC2A 2AXTH 1IK7A 4HYTB 3BCCE 1L0NJ 1DIPA 1PP9E 2HR3A 2XNXA 4WY4C 1JTHB 1FZCB 2A45G 2IFNA 1BGYD 2LXCB 1J2JB 2O1KA 2C0XA 3GW6A 4D6TJ 2E76B 2XV5A 4BXLA 4RJTA 4KT0J 1ZMEC 2JEEA 4Z1MH 1OIPA 2ZT9C 3OJAB 4PJ0H 3AE7C 1T8ZA 3AEAC 3KPEA 2V4HA 4Y28J 5KLIB 2WT7A 2WSFH 1HWTC 1Q82Q 3VTPC 4BWNA 5KLIC 4U3FD 3N4XA 1VQKP 3IF4A 1S5LE 1GU4A 5H2FE 1PP9J 2Y0EA 3CL3D 1OVRA 3H1HJ 1LT1A 2OYOA 3JCUE 4DZOA 3MP7B 1ZR4A 1GU5A 1BGYE 1SQPG 2QM7A 2YXRB 3KZIH 1FAVA 3CX5I 1FZGA 3N7NA 2RN0A 3WUUA 5AVXB 4C7NA 2OYIA 3CCSP 3AE9C 1BCCJ 3RL0g 1FZAA 2QJYB 3SSUA 1SQXK 3HD7A 3AE1C 4OGQB 1GMJA 3IFMA 3LW5H 1H8AA 1AQ5A 2WTYA 1EXJA 2J5UA 2Z5IA 3H1IG 5E79E 3HE4A 4I7ZC 1YHQP 2P67A 4MN4C 5BU5A 1FZBA 1JEKA 5APWA 1LP1A 3TF5A 3L72G 5L8RJ 3Q5PA 2ZYDA 1LTAC 3GHGC 4KHXA 2JWAA 2M0BA 4JYBA 5BU8B 1XTCC 1FE6A 3GHGB 3AE3C 2W6BA 5AVTB 1GD2E 3EQ2A 4DCKA 2Z5HA 1RH5B 2PRRA 3L72D 2XKMA 1T2KC 1M8OB 3L74E 1LTIC 1Q90D 1P84H 3HD7C 1KYOI 1KILE 2YXQB 5CCGA 5GTIH 1FDOA 2E5YA 2LXBA 3WMM0 1YTZI 2FXMA 3B5ND 4XE5B 3B4SA 3PJSK 3W68A 1JY3P 2KYVA 2ZT9B 4W7ZA 1N73B 4H13D 3GF3A 5AVVB 2P58A 1S1CX 5H2FH 3ZDMA 3HE4B 2FY8A 4DJGA 3R4YA 1CSBA 1RE3A 2D2CC 1K05A 3ABVC 3L74D 1SLQA 1QVGO 5AVRB 1ZP0C 2M5AB 4OGQD 2FYUJ 2B87A 2JWDA 3M0DA 4WWIA 3CCQP 1FOSF 1FZFA 2FXOA 1Q81Q 5APYA 2WZ7A 4ZKUA 1KILC 1L0LE 1Y47A 2IBZI 2QRXA 5C39A 3SWKA 1P84D 1KILB 2Y9YA 3T97A 4UB8E 1PGOA 2OYIB 3CMAP 2KUBA 5KLVD 1HJBA 4AUWA 1JUNA 2P7JA 3MUDC 2A06E 4D6TD 3PRJA 3WU2E 3HTKA 3E1RA 2YKPA 1EC5A 3GG2A 2PAJA 2KZIA 2IZ0A 1NTZD 1SFCD 3A0BE 1NYHA 3FXDA 3M06A 3VYIA 2QVAA 3BCCJ 1NH4A 3D71A 3H1JE 3HUSC 2KLUA 5AVSB 3L72E 1P84E 3S1KA 1SQBE 3L36A 2ZAEB 2AEFA 5GTIE 1DEEG 1BE3J 2PP6A 2WPQA 3BATA 3RK3E 1S4XA 4JF7A 1IFDA 1OFCX 1OZHA 2N1TD 5KAFE 1PGQA 1X22A 4WVZA 2W6JH 3JC22 1ZLLA 2FYNC 4B86A 3IAOA 3GMAA 1CI6A 1DD3A 1LTJC 1OX3A 2BEQD 1JMBA 4CPGA 4YXWH 1M1KQ 1L4AD 1NTKD 1K73Q 3KQGA 1SQPK 2FBWC 4IFDK 1NO4A 4NPEA 2FKWB 2I8DA 3H1HD 1N7LA 4IFFA 2Y0DA 4HJGH 1M56D 5B66H 2O01H 2ZYGA 1HBWA 2FFDA 1VQ7P 3FGAD 3RL0C 3TGUJ 2C0WA
chains in the Genus database with same CATH topology
1SQVJ 3BCCJ 4D6TJ 1NTZJ 3L70J 1BE3J 3L71J 3L75J 2FYUJ 1KB9I 1BGYJ 1SQXJ 3H1IJ 3L72J 1NTKJ 1SQQJ 3CWBJ 2IBZI 1PP9J 3H1HJ 4U3FJ 4PD4I 2BCCJ 1KYOI 3CX5I 3H1LJ 1NTMJ 3L73J 3CXHI 1BCCJ 1P84I 1SQBJ 3TGUJ 1NU1J 1EZVI 3H1JJ 3L74J 1L0NJ 1SQPJ 3H1KJ 5KLVJ 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQV J;  3BCC J;  4D6T J;  1NTZ J;  3L70 J;  1BE3 J;  3L71 J;  3L75 J;  2FYU J;  1KB9 I;  1BGY J;  1SQX J;  3H1I J;  3L72 J;  1NTK J;  1SQQ J;  3CWB J;  2IBZ I;  1PP9 J;  3H1H J;  4U3F J;  4PD4 I;  2BCC J;  1KYO I;  3CX5 I;  3H1L J;  1NTM J;  3L73 J;  3CXH I;  1BCC J;  1P84 I;  1SQB J;  3TGU J;  1NU1 J;  1EZV I;  3H1J J;  3L74 J;  1L0N J;  1SQP J;  3H1K J;  5KLV J;  1L0L J; 
#chains in the Genus database with same CATH topology
 3V2Q A;  3OW2 O;  2AXC A;  1KQS O;  1N7S B;  4IL6 X;  3M9H A;  3V5B A;  5TIS H;  1L4A B;  1PGJ A;  1LWU B;  4D6T G;  3L37 A;  5KJ7 D;  3P8C D;  5GTH H;  1KB9 I;  2IFM A;  1L4A C;  3I55 P;  1BGY J;  5KLV G;  1GZL A;  5APV A;  2MKV A;  4U3F E;  3S4R A;  1H89 A;  4GOD A;  2FYU K;  1NTM D;  2Q3I A;  2R5D A;  1SQQ J;  2WSC J;  3AEG C;  1YYC A;  1VF5 C;  2YIU C;  3TGU E;  3CC4 P;  3D70 A;  3O8Z A;  1KFM A;  4YTP C;  5B5E E;  2CPS A;  1JO5 A;  3H1I D;  2N1T C;  3Q3D A;  3A5T A;  1H0T B;  3U1A A;  1DX7 A;  1XTG B;  1SQV D;  1YIJ P;  1DEB A;  1P84 I;  2QJK B;  2W90 A;  2K9Y A;  2M5A A;  1NTZ E;  3H1L E;  3QWO C;  1VQO P;  3CCE P;  5K5G B;  1PFI A;  4C46 A;  1YJ9 P;  2K9J A;  1MV8 A;  1RHZ B;  1U7M A;  1PPJ E;  2FYU G;  2R3S A;  2QEX P;  3TNU A;  1H88 A;  2A06 D;  1OXZ A;  1FBM A;  4GOF A;  1LT9 B;  2RH0 A;  1CZQ A;  1ZV8 A;  1E5W A;  5KLV J;  4N78 E;  1IFN A;  1YTZ T;  1URQ C;  1BDC A;  1N7S A;  3L70 J;  1PZQ A;  1LTJ B;  3SFE C;  3Q1M A;  2HPC A;  3L73 E;  1YQ4 C;  2AEM A;  4JBZ A;  4C7N B;  4XFJ A;  4ZNC A;  3L72 J;  3HUS B;  3VOP A;  2Y9Z A;  1GL2 D;  2KP8 A;  4Y99 C;  4YXD C;  2E76 D;  1YI2 P;  1L2P A;  5E79 H;  2KIK A;  1J1E B;  1N2D C;  1KIL A;  3PP5 A;  2GM4 A;  1KB9 E;  1M1J C;  1GW4 A;  1HH0 A;  1NKN A;  1NU1 G;  3BCC G;  3AEE C;  3MIW A;  4PJ0 E;  3L75 E;  4IL6 H;  3BCC D;  1R5S A;  5APT A;  2OYH B;  4XA4 A;  1A02 J;  1SQP D;  2A45 H;  2A06 G;  3AE5 C;  3FXE A;  5CBN A;  1BE3 G;  2D2C D;  2QG4 A;  1BSN A;  2H88 C;  1Y9B A;  2PGD A;  2Q6Q A;  4IOI H;  2NRG A;  1JTH A;  1L0L J;  3L4F A;  3VP9 A;  2O1J A;  3JCU H;  1HVV A;  2OTL P;  3G4S P;  1G2C A;  3B5N A;  4AQR D;  1HF9 A;  1PIX A;  2E75 C;  2KB7 P;  3Q5S A;  1SQX D;  2XU6 A;  1X79 B;  4PD4 H;  5AW6 B;  3H1H G;  2GUV A;  2KS1 B;  2E75 B;  4TT3 H;  1EZV E;  1S9K E;  2GA1 A;  2BCC E;  2M8R A;  4WY4 B;  1FZC C;  3NMD A;  2E74 C;  4GIF A;  3HTK B;  1VQ4 P;  1NU1 K;  1YJW P;  1T3U A;  1BCC G;  2WPV B;  2W83 C;  1T2K D;  1KQL A;  1W2B O;  1QGK B;  1SQQ E;  3M0A A;  3SFD C;  1URQ A;  2HOD A;  3H1L G;  3LW5 J;  5EFW B;  1AVY A;  4H0L B;  4O9B A;  3TGU G;  2IBZ D;  2BCC J;  2Q1K A;  4N78 D;  3RK3 B;  1SQV K;  1LT9 C;  2M3E A;  1SFC B;  2XDJ A;  4R4L A;  1EDI A;  1JCC A;  2YNY A;  3UIA A;  1LTG C;  3AE4 C;  2WT7 B;  2Q9I A;  1FDI A;  2B9B A;  4EDF A;  2HLO A;  3VN0 A;  3GLM A;  3AEB C;  4WB4 A;  2K9J B;  4DOJ A;  2JDI H;  2HG5 D;  2R32 A;  1VDF A;  2IBZ E;  2OGU A;  1FZC A;  3TK1 A;  1NTZ K;  1AV1 A;  1FJP A;  2E74 D;  3AE6 C;  1KB9 H;  3AEF C;  4ZKP A;  5CBO A;  3MZW B;  3BRV B;  1FJK A;  1SQQ D;  3EWK A;  4NPD A;  4OGQ C;  1ZR2 A;  2KK7 A;  2WPS A;  4IL6 E;  2XZR A;  3KXD A;  5AW5 B;  3SWY A;  5KLV K;  2BEZ F;  3G71 P;  1WT6 A;  1VQN P;  1FDM A;  3F89 A;  2E75 D;  5CCH A;  3CC2 P;  3E1I A;  4U3F G;  1EDL A;  1RQV A;  2AEJ A;  3A0H E;  1KQG B;  5AW0 B;  1GW3 A;  1W2E A;  3CWB E;  3L71 D;  1N86 A;  2JR8 A;  3TYY A;  3L71 G;  2KI7 B;  2WQY C;  3A2A A;  3CXH D;  3I56 P;  1EQ7 A;  1ZXG A;  1ZRT E;  3G6E P;  3L73 J;  1HJ0 A;  1NTK G;  1BE3 E;  2WSS H;  3L35 A;  4IFM A;  5AVY B;  1PP9 D;  3HD7 D;  1KFN A;  1VPC A;  3HUS A;  3H1J J;  3IR9 A;  1IFI A;  3H1H E;  1M1J B;  2G8Y A;  2K88 A;  2E76 C;  2ZJS E;  3A7O A;  2KXP B;  2IYO A;  1GL2 C;  3EFF K;  1YJN P;  1ZOY C;  2E5T A;  4L76 A;  4JPZ B;  4K3A A;  3S9O A;  4GOE A;  2B89 A;  2OQQ A;  2I1J A;  2SPZ A;  3CXH E;  3D6Z A;  1KYO E;  3G3Z A;  1GDT A;  1PL5 A;  5AVQ B;  1URQ D;  3WU2 H;  1SQX J;  1OVU A;  5B66 E;  1EZV G;  1RE3 C;  1RQU A;  2GUS A;  2KLV A;  2KNC B;  2Q5U A;  1RY3 A;  3V6I A;  5KJ7 A;  1WRG A;  1L0N E;  3HRN A;  1RF0 C;  1SQQ G;  3M0D C;  3IN6 A;  4GKG A;  1KD1 Q;  1VQL P;  3QH9 A;  1VQ5 P;  5AW1 B;  1NTM J;  1VQM P;  1CW5 A;  2ZVO B;  1SFC A;  3VMA A;  1HTL C;  1L0L K;  4ASW A;  1JB0 J;  1QVF O;  1NVO A;  2H7H A;  2V7Q H;  1EZV I;  3MUD A;  1KC8 Q;  1MFT A;  5KKZ C;  1SQV E;  3A0H H;  1VF5 D;  2WWW A;  1NJI Q;  1W5C E;  1PV3 A;  1HUC A;  1SFC C;  2K37 A;  2RMZ A;  3LIE A;  4I1L A;  3VP8 A;  4UB6 E;  2IX7 C;  3RBZ A;  1L0N D;  2HPC B;  1R5L A;  3TGU D;  3T97 B;  4I6M C;  1K8A Q;  5CCH D;  1IFP A;  2A45 I;  5KJ7 C;  5BVZ A;  1L0L D;  1JCD A;  2ZT9 D;  3AEC C;  3MD0 A;  5KAI H;  2BCC G;  5KAF H;  1K9M Q;  1NTK K;  3MHV A;  3PHL A;  1SQB K;  1J1D C;  4TLF A;  3Q5R A;  2K3R A;  2N1T A;  1OVV A;  3VMY A;  3RL0 D;  4YPC A;  1N8R Q;  1J1D B;  1E79 H;  4PD4 I;  4Y99 B;  4HH2 A;  1OMI A;  1KN7 A;  1KQF B;  3RL0 B;  1JM0 A;  2I1K A;  2FXP A;  1QLE D;  3CCR P;  1KYO H;  2Q7C A;  1JY3 N;  3M9B A;  3V2P A;  1EDK A;  1NU1 J;  3RBX A;  3BVH A;  3O6Q A;  1USE A;  1JY2 O;  1NAF A;  1Q2N A;  1BE3 D;  2J59 M;  2KNC A;  4L75 A;  5AW4 B;  4BRY B;  1BGY G;  1NOH A;  1NTM K;  1SQP E;  2POH A;  1FZE A;  4RKU J;  1LTT C;  4H13 C;  5CMZ A;  3U59 A;  3CCV P;  2OTJ P;  1AA0 A;  1YBK A;  2FYU D;  1MZ9 A;  3CX5 H;  1LTS C;  2YO2 A;  2ZVN B;  1SQB G;  3H1K D;  3M91 A;  4H13 B;  4W80 A;  3WUV A;  1G1J A;  2H8P D;  2NPS A;  1DD4 A;  1L0N G;  1U57 A;  1VQ6 P;  5DJU B;  1SP4 A;  2IYP A;  2P10 A;  3C8V A;  3GHG A;  3NFQ A;  3USS A;  2YKQ A;  1M1J A;  4HB1 A;  4DT0 A;  1GTW A;  2YMK A;  3TNU B;  1QX8 A;  2IZ1 A;  3RK3 C;  1Y8A A;  2C9N Y;  1BDD A;  1FC2 C;  1SQX E;  1LTJ A;  1R8E A;  1OW7 A;  2FYU E;  4H44 B;  4RES B;  1S72 P;  5AVW B;  3C1L A;  4N6J A;  5DJT B;  1M57 D;  3M9Q A;  5APQ A;  1KZU B;  2W8Z A;  1U7J A;  1L0N K;  2WPR A;  3PH0 A;  1VF5 B;  4H44 C;  4WBA A;  2WIT A;  5KAI E;  4L74 A;  1LNQ A;  3RGU A;  4D6T E;  1OW6 A;  1SQP J;  3H1K J;  3W67 A;  1NAY A;  1KIL D;  4L73 A;  5KLV E;  2OTK E;  2R5B A;  4EYY Q;  3L75 G;  4JYC A;  2P1J A;  5CCG D;  2RKL A;  1M90 Q;  1A02 F;  2C9L Y;  1RE4 C;  2QE7 H;  3CC7 P;  4C7R A;  1LWU A;  2JP3 A;  1T6A A;  4LC1 A;  5APX A;  1TU3 F;  3AE2 C;  3MTU E;  3CCJ P;  2JO1 A;  4NPF X;  3HD7 B;  4HKZ H;  5AW7 B;  1Q7Y Q;  3H1I J;  1N73 A;  1OWA A;  2ZXE B;  1M7L A;  1NTZ G;  1URQ B;  2HOD B;  3CWB J;  2H43 A;  2CPB A;  2FFD B;  1OW8 A;  5CJ4 A;  2QM8 A;  1EDJ A;  1YIT P;  1BCC D;  2QIW A;  3AED C;  3CLQ A;  3CX5 E;  3H32 A;  4LLH A;  2ZFC A;  1Z56 A;  5CJ0 A;  5TIS E;  2B88 A;  3B5N C;  3RK2 C;  1DH3 A;  2NPS B;  3CXH I;  2YKO A;  2KS1 A;  1ZW0 A;  1RF1 B;  1KMI Z;  2NPS C;  2H89 C;  3L73 G;  3L70 D;  1YQ3 C;  2HFE D;  3B71 A;  1RF1 C;  4EOT A;  1SVF A;  1IJD B;  1SQV J;  3H1J G;  3HE5 A;  1AFO A;  1GK4 A;  2WSF J;  2XND H;  1BCC E;  3H6P A;  1VQ9 P;  1FU1 A;  2JKV A;  1KOR A;  2ZYA A;  3FWN A;  2ZXX A;  3L74 G;  1NTM E;  2OAR A;  4EI2 A;  2YO3 A;  3V2R A;  5AW2 B;  3RK2 D;  1JMM A;  2WVR A;  3II6 A;  2W27 A;  3TDK A;  3V2N A;  2G3A A;  3FX0 A;  2R3C A;  1VQP P;  2UWJ E;  1KYO D;  1HGV A;  2VRS A;  1SQX G;  3P8C E;  3CI9 A;  2QA4 P;  2N1T B;  1NGM B;  1T3J A;  2FYZ A;  1SS1 A;  2KSJ A;  5TJH A;  2IPP A;  2QJK C;  3LID A;  5KTB A;  1PPJ D;  1SQQ K;  1AQT A;  2IBZ G;  1IK9 A;  1X0T A;  1RF0 A;  5GTH E;  4RO0 A;  5KKZ B;  1NHL A;  2WSE J;  3BRT B;  3CD6 P;  3H1L D;  3NXS A;  1FS0 E;  2HYN A;  1LT9 A;  1G2C B;  3CME P;  2KZJ A;  4PV1 B;  2L5G B;  3SWF A;  1BSH A;  1ZRT D;  1KTM A;  3G9R A;  1JY3 O;  1NTK E;  1NU1 D;  3JSV C;  5CHX A;  1L0L G;  2WSE H;  3CX5 D;  1IZN B;  3FWL A;  4H44 D;  3MGN A;  3L71 J;  4I2L C;  4I7Z B;  4UB8 H;  5M1B A;  3VMX A;  3P7K A;  3KHU A;  1KV4 A;  2NZ2 A;  3CWB D;  1WMK A;  3F5H A;  3L71 E;  3P32 A;  1VL2 A;  1S5L X;  4GDO A;  3CCM P;  4OVN F;  2OYH A;  2WMM A;  1NTK J;  2L91 A;  1J1E C;  2BAS A;  3OAK A;  3A0B H;  4GT1 A;  3RK3 D;  4WY4 D;  1X9V A;  1NWQ A;  2O01 N;  2Q3E A;  2WSC H;  1JNM A;  3HE5 B;  1FOS E;  4UB6 H;  2NPS D;  2OYH C;  1SQB D;  1S3J A;  2N9B A;  3GF7 A;  3H1K G;  3H32 B;  3PLN A;  1D7M A;  1GL2 B;  3H1L J;  4AYC A;  1UII A;  1H0T A;  3E7K A;  1N7S C;  3L70 E;  1RF1 A;  4N3Y B;  2FFD C;  1JY2 N;  1PP9 G;  3KYQ A;  2PFX A;  1PPJ G;  1QL2 A;  3B8E B;  3OA7 A;  2W6A A;  4PD4 D;  1K04 A;  1HGZ A;  1LJ2 A;  4K35 A;  1VQ8 P;  2R44 A;  3I5C A;  1GL2 A;  1LGH B;  1NTZ J;  3CWB G;  3A3Y B;  2M3B A;  4U7J A;  4JQ0 D;  1G1I A;  1USD A;  1L4A A;  3KDP B;  3NTN A;  5APS A;  3CCU P;  5AW8 B;  2D2C B;  2O3J A;  4OH8 B;  3V4W A;  4A7P A;  1Q86 Q;  5AVU B;  1S2E A;  2K1A A;  5AVZ B;  1NTM G;  1IFM A;  2AXT E;  5CCG C;  4W7Y A;  1ZN5 A;  1EXI A;  2N9Y B;  3V4Q A;  1X8Y A;  2BCC D;  4H0L C;  1CI6 B;  2E74 B;  1GK6 A;  2QJY C;  1LWU C;  2J58 A;  4U3F J;  2OYI C;  1LTB C;  3H25 A;  3BAS A;  3H1J D;  1LP1 B;  2IDB A;  1NKZ B;  3K5B A;  1NU1 E;  1SQV G;  4PD4 E;  3Q2Y A;  4PV1 C;  3VMZ A;  3D6Y A;  1IO4 A;  3CPW O;  3TSI A;  2E43 A;  5CCH C;  4PV1 D;  2CK3 H;  2YIU B;  4M3L A;  3L74 J;  3WUT A;  4R4M A;  1JOC A;  3L75 D;  1S5L H;  3AE8 C;  3ITK A;  4H0L D;  3CCL P;  4QMA A;  1KB9 D;  4ASV A;  2LKM A;  5B5E H;  4OWF A;  2QSI A;  1AVO A;  3H1I E;  2QJP B;  3KZI E;  2YMY A;  2ITA A;  2JJL A;  3L75 J;  4EIJ A;  2Z4E A;  1AJY A;  2P2U A;  2QJP C;  2FYN B;  1RE4 A;  4WY4 A;  1IFJ A;  4BRY A;  2Y0C A;  3C9I A;  5AW3 B;  3O6Q B;  2KSE A;  1EZV D;  1S9K D;  1PGP A;  4ZMD A;  2KOG A;  2MJZ A;  3P8M C;  1MKM A;  3L70 G;  3H1K E;  5APU A;  2DW3 A;  2O01 J;  1UIX A;  3B5N B;  1JY2 P;  2V7Q J;  3L73 D;  3EFG A;  1QEX A;  1N73 C;  2E42 A;  3U1C A;  3PTZ A;  3CXH H;  5AW9 B;  1MFZ A;  1N7S D;  2B87 B;  2LR2 A;  1MUU A;  1QL1 A;  4KJM A;  4LGD E;  3RK2 B;  1SQB J;  3R2P A;  1IC2 A;  2AXT H;  1IK7 A;  4HYT B;  3BCC E;  1L0N J;  1DIP A;  1PP9 E;  2HR3 A;  2XNX A;  4WY4 C;  1JTH B;  1FZC B;  2A45 G;  2IFN A;  1BGY D;  2LXC B;  1J2J B;  2O1K A;  2C0X A;  3GW6 A;  4D6T J;  2E76 B;  2XV5 A;  4BXL A;  4RJT A;  4KT0 J;  1ZME C;  2JEE A;  4Z1M H;  1OIP A;  2ZT9 C;  3OJA B;  4PJ0 H;  3AE7 C;  1T8Z A;  3AEA C;  3KPE A;  2V4H A;  4Y28 J;  5KLI B;  2WT7 A;  2WSF H;  1HWT C;  1Q82 Q;  3VTP C;  4BWN A;  5KLI C;  4U3F D;  3N4X A;  1VQK P;  3IF4 A;  1S5L E;  1GU4 A;  5H2F E;  1PP9 J;  2Y0E A;  3CL3 D;  1OVR A;  3H1H J;  1LT1 A;  2OYO A;  3JCU E;  4DZO A;  3MP7 B;  1ZR4 A;  1GU5 A;  1BGY E;  1SQP G;  2QM7 A;  2YXR B;  3KZI H;  1FAV A;  3CX5 I;  1FZG A;  3N7N A;  2RN0 A;  3WUU A;  5AVX B;  4C7N A;  2OYI A;  3CCS P;  3AE9 C;  1BCC J;  3RL0 g;  1FZA A;  2QJY B;  3SSU A;  1SQX K;  3HD7 A;  3AE1 C;  4OGQ B;  1GMJ A;  3IFM A;  3LW5 H;  1H8A A;  1AQ5 A;  2WTY A;  1EXJ A;  2J5U A;  2Z5I A;  3H1I G;  5E79 E;  3HE4 A;  4I7Z C;  1YHQ P;  2P67 A;  4MN4 C;  5BU5 A;  1FZB A;  1JEK A;  5APW A;  1LP1 A;  3TF5 A;  3L72 G;  5L8R J;  3Q5P A;  2ZYD A;  1LTA C;  3GHG C;  4KHX A;  2JWA A;  2M0B A;  4JYB A;  5BU8 B;  1XTC C;  1FE6 A;  3GHG B;  3AE3 C;  2W6B A;  5AVT B;  1GD2 E;  3EQ2 A;  4DCK A;  2Z5H A;  1RH5 B;  2PRR A;  3L72 D;  2XKM A;  1T2K C;  1M8O B;  3L74 E;  1LTI C;  1Q90 D;  1P84 H;  3HD7 C;  1KYO I;  1KIL E;  2YXQ B;  5CCG A;  5GTI H;  1FDO A;  2E5Y A;  2LXB A;  3WMM 0;  1YTZ I;  2FXM A;  3B5N D;  4XE5 B;  3B4S A;  3PJS K;  3W68 A;  1JY3 P;  2KYV A;  2ZT9 B;  4W7Z A;  1N73 B;  4H13 D;  3GF3 A;  5AVV B;  2P58 A;  1S1C X;  5H2F H;  3ZDM A;  3HE4 B;  2FY8 A;  4DJG A;  3R4Y A;  1CSB A;  1RE3 A;  2D2C C;  1K05 A;  3ABV C;  3L74 D;  1SLQ A;  1QVG O;  5AVR B;  1ZP0 C;  2M5A B;  4OGQ D;  2FYU J;  2B87 A;  2JWD A;  3M0D A;  4WWI A;  3CCQ P;  1FOS F;  1FZF A;  2FXO A;  1Q81 Q;  5APY A;  2WZ7 A;  4ZKU A;  1KIL C;  1L0L E;  1Y47 A;  2IBZ I;  2QRX A;  5C39 A;  3SWK A;  1P84 D;  1KIL B;  2Y9Y A;  3T97 A;  4UB8 E;  1PGO A;  2OYI B;  3CMA P;  2KUB A;  5KLV D;  1HJB A;  4AUW A;  1JUN A;  2P7J A;  3MUD C;  2A06 E;  4D6T D;  3PRJ A;  3WU2 E;  3HTK A;  3E1R A;  2YKP A;  1EC5 A;  3GG2 A;  2PAJ A;  2KZI A;  2IZ0 A;  1NTZ D;  1SFC D;  3A0B E;  1NYH A;  3FXD A;  3M06 A;  3VYI A;  2QVA A;  3BCC J;  1NH4 A;  3D71 A;  3H1J E;  3HUS C;  2KLU A;  5AVS B;  3L72 E;  1P84 E;  3S1K A;  1SQB E;  3L36 A;  2ZAE B;  2AEF A;  5GTI E;  1DEE G;  1BE3 J;  2PP6 A;  2WPQ A;  3BAT A;  3RK3 E;  1S4X A;  4JF7 A;  1IFD A;  1OFC X;  1OZH A;  2N1T D;  5KAF E;  1PGQ A;  1X22 A;  4WVZ A;  2W6J H;  3JC2 2;  1ZLL A;  2FYN C;  4B86 A;  3IAO A;  3GMA A;  1CI6 A;  1DD3 A;  1LTJ C;  1OX3 A;  2BEQ D;  1JMB A;  4CPG A;  4YXW H;  1M1K Q;  1L4A D;  1NTK D;  1K73 Q;  3KQG A;  1SQP K;  2FBW C;  4IFD K;  1NO4 A;  4NPE A;  2FKW B;  2I8D A;  3H1H D;  1N7L A;  4IFF A;  2Y0D A;  4HJG H;  1M56 D;  5B66 H;  2O01 H;  2ZYG A;  1HBW A;  2FFD A;  1VQ7 P;  3FGA D;  3RL0 C;  3TGU J;  2C0W A; 
#chains in the Genus database with same CATH homology
 1SQV J;  3BCC J;  4D6T J;  1NTZ J;  3L70 J;  1BE3 J;  3L71 J;  3L75 J;  2FYU J;  1KB9 I;  1BGY J;  1SQX J;  3H1I J;  3L72 J;  1NTK J;  1SQQ J;  3CWB J;  2IBZ I;  1PP9 J;  3H1H J;  4U3F J;  4PD4 I;  2BCC J;  1KYO I;  3CX5 I;  3H1L J;  1NTM J;  3L73 J;  3CXH I;  1BCC J;  1P84 I;  1SQB J;  3TGU J;  1NU1 J;  1EZV I;  3H1J J;  3L74 J;  1L0N J;  1SQP J;  3H1K J;  5KLV J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...