4U3FJ

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
total genus 22
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4u3fJ00
3L74J 2BCCJ 1NTKJ 3L75J 1KYOI 1L0NJ 1BGYJ 1KB9I 3TGUJ 3L71J 1NTZJ 1P84I 3L73J 3L70J 3H1IJ 1SQVJ 4D6TJ 4PD4I 1NTMJ 1NU1J 3CX5I 1SQXJ 2IBZI 3H1KJ 1SQPJ 1L0LJ 5KLVJ 1SQQJ 3CXHI 3H1LJ 1BCCJ 1PP9J 4U3FJ 3H1JJ 2FYUJ 1SQBJ 3BCCJ 3CWBJ 3H1HJ 1BE3J 1EZVI 3L72J
chains in the Genus database with same CATH superfamily
1KQGB 1HWTC 2WSEH 1Y9BA 2Y9YA 3H1LE 4H44C 5TJHA 2KLVA 1NTZK 1RQUA 1JY2O 4N6JA 3B8EB 5K5GB 1LTAC 2FYUD 5M1BA 3RK2B 1SQPJ 3CX5H 1RE3C 1NTME 2OYIC 4HJGH 4H44B 1S3JA 5TISH 1SQBE 2WSFJ 1M57D 3IFMA 2L5GB 2WVRA 3S4RA 3H1KJ 3HE5A 2OYIB 5EFWB 3E7KA 3TNUB 3U1CA 3MUDC 1LT9C 1OW7A 4BXLA 3I56P 1L2PA 1OIPA 3RK3D 1JY3P 3R2PA 1EXIA 3M0DC 3A0BE 2KB7P 2ZVNB 2B88A 1KILE 2OYHC 1SQQJ 1P84D 1LT9B 4NPFX 3BCCJ 2QM7A 1BGYG 3HD7A 4GIFA 1KTMA 4MN4C 2WSCJ 1KYOH 1QGKB 1KFNA 1KFMA 2OYHB 1SS1A 3WUUA 3IF4A 2LXCB 4B86A 1BCCG 2E5YA 4EYYQ 2AEFA 2Q3EA 3R4YA 3M91A 1ZRTD 1PP9E 1AV1A 1Q2NA 1EXJA 1LTGC 1KQSO 2R5DA 1M1KQ 2Q3IA 2HYNA 3CCRP 5AVTB 3CCJP 4UB6E 5KJ7D 1BDDA 2XV5A 1AFOA 2FBWC 1H0TB 3L36A 1DD4A 2ZT9D 4BRYA 1Z56A 1RF1A 5AW4B 1GD2E 5APUA 1CI6A 2OTJP 1KORA 1LNQA 1EDIA 1W2BO 3L74J 1QVFO 1L0LE 2AXTH 3V6IA 1DH3A 3B5NA 1EDLA 2AEMA 1NTMJ 2KNCA 4L73A 2IPPA 2JR8A 1SQBJ 4DT0A 1R5LA 1ZXGA 1OMIA 2H89C 2P10A 4C7RA 2HODB 1KZUB 1LTTC 1KN7A 1GL2A 2IBZI 3L70E 2H8PD 5AVWB 1FOSE 4H13C 1GK6A 1BDCA 3AE7C 1URQC 4N78E 1NGMB 1OZHA 1HJBA 5APVA 3MZWB 1DIPA 1FZGA 1VQ4P 3RL0C 4PD4I 5AW0B 3TF5A 1SQPK 2WSFH 1T6AA 1GU5A 4H13B 4K3AA 1JY3O 4JPZB 3CWBG 2B9BA 4DCKA 1URQB 1PGOA 1EZVI 5GTIE 3FWLA 3AE3C 3AEBC 3RL0B 2E74C 3OW2O 3V4WA 1P84H 2ZT9C 3PLNA 3WMM0 5CCHA 2WITA 2A06G 4JF7A 1PP9J 2IZ0A 3L71G 4DOJA 3VMXA 2E74B 1VL2A 3FX0A 1S9KE 1SQVE 3A7OA 5B5EH 3L37A 2K88A 1OVVA 3V5BA 4I1LA 2M5AA 2FXOA 3VP9A 5CBNA 2C9LY 3H6PA 2IYOA 3L75E 2C0XA 4ZMDA 2KP8A 2I1JA 3HD7D 1L0LJ 2W27A 4WWIA 3V2NA 2ZYGA 2N1TC 3SSUA 5BVZA 2OTKE 1HGVA 4LC1A 3FGAD 2YIUC 1HH0A 1YBKA 3GMAA 1D7MA 1RY3A 3IR9A 1J2JB 3W67A 1N7LA 4JYBA 2QEXP 2N1TB 1S5LX 1M7LA 5AVYB 3VOPA 3HE4A 2YIUB 3AEFC 2KK7A 1N7SB 2Y0CA 1EDKA 3L70J 2P1JA 3LW5H 2V7QJ 1L4AB 1YYCA 2IBZE 3VYIA 2KS1A 1BE3G 1K73Q 1NTZD 2KIKA 3IAOA 1XTGB 4EIJA 1OX3A 1FE6A 4IFFA 1JO5A 4PD4E 2FFDC 2A45H 3G71P 1SQBK 2YNYA 5AVSB 1SLQA 4DJGA 1JY2P 3M9BA 2E75C 3B5ND 4I2LC 4U7JA 1SQXE 5E79E 2YKOA 2QVAA 3H1JE 1FAVA 4NPDA 2D2CD 1KQFB 3RBXA 1LTIC 2FFDB 3Q5SA 3HE5B 2KUBA 2Q6QA 1KB9D 4AYCA 4XA4A 2E75B 3JCUE 1VPCA 2QSIA 1NU1E 3L71D 4NPEA 1ZLLA 3L72J 3KZIH 2QIWA 3VTPC 3H1HE 3KQGA 3K5BA 3L35A 1SQVJ 3BRVB 5AW1B 3Q5PA 2HPCB 2JDIH 5KAFE 3CCEP 1E79H 1GK4A 3AE4C 1NKNA 1Q7YQ 2RMZA 1MZ9A 1KC8Q 5KJ7A 3L75J 1DEBA 2GA1A 3MTUE 3H1KG 2BCCD 3H32A 4WY4D 2QJYC 3B71A 1RF1C 1DD3A 3CL3D 2V4HA 3CI9A 4OVNF 5H2FE 1SQQG 4IFMA 3ITKA 1SP4A 2WMMA 2IX7C 3I5CA 4D6TJ 3CCLP 2QJYB 1RF1B 1BSHA 1CW5A 3B5NC 1LTBC 1CI6B 2W90A 5KLVG 2E76C 1BE3D 1YTZI 1U7JA 2KSEA 4HKZH 1USEA 1YTZT 1NTKK 2YKPA 4CPGA 4H0LC 2Y0DA 5CCGD 1YI2P 2WPQA 2KNCB 2E76B 2NZ2A 1QVGO 1GL2C 1X8YA 1SQXJ 2W8ZA 2MJZA 4L74A 3H1JJ 3GLMA 3CC7P 4H0LB 4U3FE 3G6EP 3AE5C 2WSSH 1HTLC 1GL2B 3L74E 1NU1J 5KAIE 3H1LG 1KD1Q 2Z4EA 3H1HJ 1OWAA 1Q81Q 3U59A 1HJ0A 1PPJD 1KB9H 1NO4A 1NTMG 1SQPD 2GUSA 3CC2P 1IZNB 1RF0A 5CCHC 2IFMA 3P7KA 2AXCA 1VF5D 5CJ0A 4GDOA 3Q3DA 2A45G 2ITAA 5APWA 3H1KD 1YITP 2WPRA 3WUTA 2WQYC 4L75A 1W5CE 2KLUA 2P7JA 1J1EC 2I1KA 1IFDA 3CXHI 3II6A 1VQPP 1VQ5P 5CHXA 3M9QA 5CMZA 5BU5A 1SQVK 5KLIC 4UB8E 1SQQD 4IL6E 1BGYE 2XNXA 1J1EB 3CX5I 3BCCD 1JMMA 3H1IE 1U57A 2YO2A 2M5AB 1JOCA 2O1JA 1JM0A 1BCCE 5KLIB 5GTHH 3OJAB 2KYVA 3GHGA 2O01N 2W6BA 1VQKP 5AVZB 4ZNCA 5KLVD 1KQLA 1PGQA 2PGDA 1QEXA 2QA4P 1RQVA 5APQA 2JWDA 2J58A 2KSJA 2J5UA 4QMAA 4HB1A 2YMKA 3OAKA 1YQ4C 1NAFA 3P8MC 1OW6A 3HE4B 4GT1A 1PGJA 4U3FJ 1JTHA 4HYTB 1HBWA 4GKGA 1Y8AA 2N9BA 3FXDA 2LR2A 1SFCD 2XDJA 1KYOI 4RJTA 3HTKA 1JY3N 2LXBA 4XFJA 5CJ4A 1NTKE 1T2KD 2NRGA 4JQ0D 1H88A 3H1LD 1RHZB 3RK3C 1L0LG 3SFDC 2KS1B 3QWOC 2LKMA 1L0NK 5E79H 1NTMD 3RK3B 4XE5B 3EQ2A 1SQXK 2M3EA 1SQBD 3JCUH 1UIXA 4KHXA 1NTZG 2Q5UA 3USSA 1OXZA 1NU1K 1Q86Q 1G1IA 2FYUK 1VDFA 4PJ0E 3CXHE 1IK9A 2RN0A 1FZFA 5AW7B 1KILD 3IN6A 5KJ7C 1BGYJ 1ZP0C 3CWBE 4WY4A 3H1IJ 1M1JC 3TGUE 3O6QA 1ZN5A 2BASA 1VQ8P 2PAJA 1MV8A 3CX5E 3MD0A 1BCCJ 1NOHA 1HF9A 3FXEA 1E5WA 2A06E 5KKZC 5TISE 3MP7B 1JEKA 1M1JB 1LP1B 2WT7B 1AQTA 3L72E 2ZT9B 2HFED 1PP9D 5B66H 2WSCH 2CPBA 4OWFA 1VQ7P 3CCMP 3L73E 3H32B 3C9IA 2WPVB 3MUDA 1UIIA 3P8CE 2E5TA 1M90Q 3KPEA 2RKLA 1SQVG 3M0DA 1N86A 3CLQA 4OGQD 1PFIA 2ZYDA 5CCGA 3D71A 2R44A 3A0HH 4PV1D 1K9MQ 4HH2A 1NAYA 1NYHA 1WMKA 2BCCG 2I8DA 1NTKJ 1HVVA 1KYOE 3JSVC 1BSNA 3M0AA 1FZBA 1P84I 2Z5HA 1IFMA 5AVRB 1JCDA 1L0LD 2QJKC 1GDTA 2R3CA 3HUSA 1T8ZA 2ZYAA 2OTLP 3V2PA 2ZFCA 3A2AA 2E43A 1PZQA 3PHLA 1AVOA 3D70A 2WPSA 3MIWA 3TDKA 2QJKB 4D6TE 3RBZA 2QRXA 2ZJSE 4I7ZC 2KXPB 3VP8A 2O1KA 2XNDH 3L70D 1G2CA 1EDJA 4I7ZB 2K9JA 4BWNA 1L0NE 4N78D 1TU3F 1RF0C 2P67A 1QL2A 5AW8B 1DEEG 2WSEJ 3T97A 3CWBJ 1CSBA 4YXDC 4ASVA 1IFJA 1GZLA 1EZVE 2AXTE 5AW3B 1LTSC 3TGUJ 3VN0A 4EI2A 3SWKA 3A0BH 2Q1KA 1SQXG 2NPSD 3H25A 3F89A 3H1JG 3AE8C 1QLED 4GOFA 3O8ZA 2XU6A 3HD7C 5AW9B 2FYUE 3A5TA 2POHA 3L73J 3EFFK 1NU1G 3L4FA 5APXA 4IL6H 1PPJG 1LJ2A 1SQPG 1ZW0A 2WWWA 1OVUA 1XTCC 3H1HG 1IFNA 3HD7B 1URQA 1S9KD 1SQVD 2G3AA 4WVZA 3GHGC 3PRJA 3V2QA 2M0BA 2JWAA 3GF7A 2A45I 2M8RA 3BVHA 1Q82Q 1JUNA 4N3YB 2OYOA 5BU8B 4UB6H 4H44D 3RK3E 1GMJA 3L75D 2K9YA 3BASA 4OH8B 1K05A 2M3BA 1X9VA 3GHGB 3EFGA 1LT1A 1M8OB 4W7YA 2VRSA 4RKUJ 5APTA 1ZMEC 1KV4A 1P84E 3HRNA 1SFCA 3I55P 3KHUA 1LTJA 2GUVA 1JY2N 1USDA 3BCCG 1NHLA 3GF3A 3M06A 4IOIH 2O01J 2W6JH 1ZR2A 4BRYB 2O3JA 4O9BA 1K8AQ 3M9HA 3GW6A 5APYA 1JTHB 2XKMA 2D2CC 1ZRTE 4ZKUA 1EC5A 1FJPA 4GODA 2IBZD 2G8YA 1L0NJ 3B5NB 4C7NA 1RH5B 3ZDMA 4AUWA 3MHVA 1W2EA 1PL5A 2FXMA 2OQQA 2D2CB 3BRTB 1FZCA 1N8RQ 1IC2A 3AECC 2R5BA 4PD4D 2V7QH 4KT0J 1FZAA 1YJ9P 1X0TA 2Z5IA 1N7SA 1SQXD 5APSA 1KILA 1HUCA 3H1JD 1PIXA 1LWUA 3NFQA 1L4AA 1VQLP 4PJ0H 2FYUJ 1YQ3C 3WUVA 3L74G 2JP3A 5GTIH 2YO3A 1NU1D 1N73A 3BATA 4WY4C 1H8AA 2H88C 3H1HD 1SQBG 3AEDC 1FDIA 1U7MA 1IFPA 4WY4B 1NKZB 3KYQA 3O6QB 1FU1A 1FDOA 1M56D 2FFDA 4IFDK 2FKWB 3S9OA 1JMBA 1S5LE 3SFEC 2B87A 2C0WA 3KDPB 5AVXB 1VQOP 3F5HA 1J1DC 1KMIZ 4LLHA 5CCGC 2HPCA 2R3SA 1QL1A 3KZIE 2FXPA 3VMAA 2W83C 1NH4A 1KB9I 3CCVP 1J1DB 4DZOA 3CMEP 3H1IG 1FBMA 3E1IA 1MUUA 4H13D 2IFNA 1PGPA 1R5SA 1OFCX 3HUSC 1URQD 2ZXEB 1PP9G 2BEZF 5KLVJ 5KTBA 3G4SP 1WRGA 3RL0D 3NTNA 2E42A 4EDFA 1FDMA 2O01H 3HUSB 1Q90D 2K37A 2B89A 1T3JA 1RE4A 3A3YB 3EWKA 3AEAC 3NXSA 2FYZA 3G3ZA 2E74D 1CZQA 1H89A 1ZOYC 3PH0A 5DJUB 1FJKA 4M3LA 1VF5C 1JNMA 1LGHB 3WU2E 1S4XA 4I6MC 2J59M 2IYPA 1YHQP 1WT6A 2ZAEB 4WB4A 3CC4P 4U3FD 1MFTA 4PD4H 3CMAP 3H1LJ 3C8VA 5L8RJ 3L74D 1IK7A 1G2CB 1NTKG 1VF5B 2NPSA 1IFIA 3LW5J 2PRRA 3SWYA 1VQ6P 3U1AA 2K9JB 3QH9A 2Q7CA 2FY8A 1FC2C 3RGUA 1OW8A 4YPCA 2ZVOB 4WBAA 2N9YB 3T97B 3AE9C 4R4MA 5AVUB 5C39A 1MKMA 3L70G 2N1TD 2KOGA 3ABVC 5KAFH 2SPZA 1NTZE 2CPSA 3N4XA 4RESB 1N7SD 2Q9IA 1FZEA 2Y0EA 1ZR4A 3NMDA 4EOTA 1L4AD 4W80A 4TT3H 3CD6P 1VQ9P 3AE1C 2HLOA 3C1LA 4A7PA 1S1CX 2YMYA 1RE3A 1EQ7A 1BGYD 2P58A 2OYIA 1YIJP 2MKVA 2W6AA 2RH0A 3TNUA 3H1ID 3TGUG 2KZIA 2QJPC 3CCQP 1KB9E 2H43A 1BCCD 5AW5B 1FOSF 1SFCC 1X22A 3L71E 3VMYA 5H2FH 1R8EA 1LTJC 3CCSP 1T2KC 3L72G 5KKZB 2Y9ZA 2QJPB 1LT9A 1GTWA 4RO0A 3L73G 1Y47A 5CBOA 1SFCB 2K3RA 2E75D 2JKVA 3V2RA 3JC22 4KJMA 1LTJB 1SQQK 2OYHA 1N2DC 4R4LA 1NWQA 1DX7A 1K04A 3L75G 1PV3A 3TSIA 1YJNP 3PJSK 1T3UA 1AVYA 4LGDE 2BCCE 2K1AA 5AVVB 1G1JA 2YXRB 5KLVK 3UIAA 1FZCC 1NTKD 1IO4A 4JBZA 3LIDA 4W7ZA 3PP5A 4C7NB 2YXQB 3B4SA 3AEEC 3PTZA 4JYCA 4AQRD 5GTHE 1H0TA 2ZXXA 1N7SC 1SVFA 1KILC 1FZCB 3SWFA 1LWUC 5KAIH 1L4AC 3LIEA 3KXDA 4D6TG 4Z1MH 2H7HA 1KILB 1N73C 2P2UA 2IBZG 1BE3E 1NTZJ 4IL6X 3Q2YA 3Q5RA 3FWNA 1LWUB 2GM4A 4Y99C 3AEGC 1HGZA 1YJWP 4TLFA 1AQ5A 2PFXA 2C9NY 1S2EA 3Q1MA 2UWJE 1L0NG 2YKQA 1N73B 1GW4A 3CXHD 1NTMK 4Y99B 3AE2C 1NJIQ 2HODA 3TYYA 2R32A 1EZVG 3CWBD 1S5LH 3RL0g 3D6YA 2IDBA 4OGQC 3TGUD 1MFZA 3TK1A 1A02F 3CX5D 5AVQB 3L71J 2E76D 2WZ7A 4PV1C 5DJTB 1S72P 2A06D 4UB8H 4Y28J 3GG2A 3V4QA 4GOEA 2KZJA 3OA7A 2FYUG 4H0LD 2WTYA 4OGQB 3L72D 2B87B 2CK3H 1PPJE 2JEEA 4L76A 2AEJA 3CPWO 3L73D 1SQPE 1FS0E 3E1RA 4PV1B 1GL2D 3P8CD 3AE6C 3RK2D 3MGNA 5AW2B 1OVRA 1IJDB 1JB0J 2HG5D 2IZ1A 1VQNP 3H1KE 1JCCA 2FYNC 2HR3A 2BCCJ 1AA0A 3D6ZA 1NVOA 1M1JA 2JO1A 1LP1A 2WT7A 1GU4A 1KYOD 2OARA 1AJYA 1RE4C 2KI7B 2QM8A 2FYNB 1SQQE 5CCHD 3G9RA 3WU2H 4ZKPA 3BCCE 2JJLA 4YXWH 2BEQD 5B66E 3P32A 4D6TD 5B5EE 1A02J 1BE3J 2NPSC 3HTKB 5KLVE 1VQMP 2OGUA 2QE7H 3S1KA 2L91A 3VMZA 1L0LK 3A0HE 4ASWA 2NPSB 2N1TA 1L0ND 3N7NA 4C46A 2QG4A 1X79B 2DW3A 4YTPC 3W68A 1ZV8A 4K35A 1EZVD 3CCUP 5AW6B 4U3FG 1QX8A 3RK2C 2XZRA 3CXHH 2PP6A 1GW3A
chains in the Genus database with same CATH topology
3L74J 2BCCJ 1NTKJ 3L75J 1KYOI 1L0NJ 1BGYJ 1KB9I 3TGUJ 3L71J 1NTZJ 1P84I 3L73J 3L70J 3H1IJ 1SQVJ 4D6TJ 4PD4I 1NTMJ 1NU1J 3CX5I 1SQXJ 2IBZI 3H1KJ 1SQPJ 1L0LJ 5KLVJ 1SQQJ 3CXHI 3H1LJ 1BCCJ 1PP9J 4U3FJ 3H1JJ 2FYUJ 1SQBJ 3BCCJ 3CWBJ 3H1HJ 1BE3J 1EZVI 3L72J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 J;  2BCC J;  1NTK J;  3L75 J;  1KYO I;  1L0N J;  1BGY J;  1KB9 I;  3TGU J;  3L71 J;  1NTZ J;  1P84 I;  3L73 J;  3L70 J;  3H1I J;  1SQV J;  4D6T J;  4PD4 I;  1NTM J;  1NU1 J;  3CX5 I;  1SQX J;  2IBZ I;  3H1K J;  1SQP J;  1L0L J;  5KLV J;  1SQQ J;  3CXH I;  3H1L J;  1BCC J;  1PP9 J;  4U3F J;  3H1J J;  2FYU J;  1SQB J;  3BCC J;  3CWB J;  3H1H J;  1BE3 J;  1EZV I;  3L72 J; 
#chains in the Genus database with same CATH topology
 1KQG B;  1HWT C;  2WSE H;  1Y9B A;  2Y9Y A;  3H1L E;  4H44 C;  5TJH A;  2KLV A;  1NTZ K;  1RQU A;  1JY2 O;  4N6J A;  3B8E B;  5K5G B;  1LTA C;  2FYU D;  5M1B A;  3RK2 B;  1SQP J;  3CX5 H;  1RE3 C;  1NTM E;  2OYI C;  4HJG H;  4H44 B;  1S3J A;  5TIS H;  1SQB E;  2WSF J;  1M57 D;  3IFM A;  2L5G B;  2WVR A;  3S4R A;  3H1K J;  3HE5 A;  2OYI B;  5EFW B;  3E7K A;  3TNU B;  3U1C A;  3MUD C;  1LT9 C;  1OW7 A;  4BXL A;  3I56 P;  1L2P A;  1OIP A;  3RK3 D;  1JY3 P;  3R2P A;  1EXI A;  3M0D C;  3A0B E;  2KB7 P;  2ZVN B;  2B88 A;  1KIL E;  2OYH C;  1SQQ J;  1P84 D;  1LT9 B;  4NPF X;  3BCC J;  2QM7 A;  1BGY G;  3HD7 A;  4GIF A;  1KTM A;  4MN4 C;  2WSC J;  1KYO H;  1QGK B;  1KFN A;  1KFM A;  2OYH B;  1SS1 A;  3WUU A;  3IF4 A;  2LXC B;  4B86 A;  1BCC G;  2E5Y A;  4EYY Q;  2AEF A;  2Q3E A;  3R4Y A;  3M91 A;  1ZRT D;  1PP9 E;  1AV1 A;  1Q2N A;  1EXJ A;  1LTG C;  1KQS O;  2R5D A;  1M1K Q;  2Q3I A;  2HYN A;  3CCR P;  5AVT B;  3CCJ P;  4UB6 E;  5KJ7 D;  1BDD A;  2XV5 A;  1AFO A;  2FBW C;  1H0T B;  3L36 A;  1DD4 A;  2ZT9 D;  4BRY A;  1Z56 A;  1RF1 A;  5AW4 B;  1GD2 E;  5APU A;  1CI6 A;  2OTJ P;  1KOR A;  1LNQ A;  1EDI A;  1W2B O;  3L74 J;  1QVF O;  1L0L E;  2AXT H;  3V6I A;  1DH3 A;  3B5N A;  1EDL A;  2AEM A;  1NTM J;  2KNC A;  4L73 A;  2IPP A;  2JR8 A;  1SQB J;  4DT0 A;  1R5L A;  1ZXG A;  1OMI A;  2H89 C;  2P10 A;  4C7R A;  2HOD B;  1KZU B;  1LTT C;  1KN7 A;  1GL2 A;  2IBZ I;  3L70 E;  2H8P D;  5AVW B;  1FOS E;  4H13 C;  1GK6 A;  1BDC A;  3AE7 C;  1URQ C;  4N78 E;  1NGM B;  1OZH A;  1HJB A;  5APV A;  3MZW B;  1DIP A;  1FZG A;  1VQ4 P;  3RL0 C;  4PD4 I;  5AW0 B;  3TF5 A;  1SQP K;  2WSF H;  1T6A A;  1GU5 A;  4H13 B;  4K3A A;  1JY3 O;  4JPZ B;  3CWB G;  2B9B A;  4DCK A;  1URQ B;  1PGO A;  1EZV I;  5GTI E;  3FWL A;  3AE3 C;  3AEB C;  3RL0 B;  2E74 C;  3OW2 O;  3V4W A;  1P84 H;  2ZT9 C;  3PLN A;  3WMM 0;  5CCH A;  2WIT A;  2A06 G;  4JF7 A;  1PP9 J;  2IZ0 A;  3L71 G;  4DOJ A;  3VMX A;  2E74 B;  1VL2 A;  3FX0 A;  1S9K E;  1SQV E;  3A7O A;  5B5E H;  3L37 A;  2K88 A;  1OVV A;  3V5B A;  4I1L A;  2M5A A;  2FXO A;  3VP9 A;  5CBN A;  2C9L Y;  3H6P A;  2IYO A;  3L75 E;  2C0X A;  4ZMD A;  2KP8 A;  2I1J A;  3HD7 D;  1L0L J;  2W27 A;  4WWI A;  3V2N A;  2ZYG A;  2N1T C;  3SSU A;  5BVZ A;  2OTK E;  1HGV A;  4LC1 A;  3FGA D;  2YIU C;  1HH0 A;  1YBK A;  3GMA A;  1D7M A;  1RY3 A;  3IR9 A;  1J2J B;  3W67 A;  1N7L A;  4JYB A;  2QEX P;  2N1T B;  1S5L X;  1M7L A;  5AVY B;  3VOP A;  3HE4 A;  2YIU B;  3AEF C;  2KK7 A;  1N7S B;  2Y0C A;  1EDK A;  3L70 J;  2P1J A;  3LW5 H;  2V7Q J;  1L4A B;  1YYC A;  2IBZ E;  3VYI A;  2KS1 A;  1BE3 G;  1K73 Q;  1NTZ D;  2KIK A;  3IAO A;  1XTG B;  4EIJ A;  1OX3 A;  1FE6 A;  4IFF A;  1JO5 A;  4PD4 E;  2FFD C;  2A45 H;  3G71 P;  1SQB K;  2YNY A;  5AVS B;  1SLQ A;  4DJG A;  1JY2 P;  3M9B A;  2E75 C;  3B5N D;  4I2L C;  4U7J A;  1SQX E;  5E79 E;  2YKO A;  2QVA A;  3H1J E;  1FAV A;  4NPD A;  2D2C D;  1KQF B;  3RBX A;  1LTI C;  2FFD B;  3Q5S A;  3HE5 B;  2KUB A;  2Q6Q A;  1KB9 D;  4AYC A;  4XA4 A;  2E75 B;  3JCU E;  1VPC A;  2QSI A;  1NU1 E;  3L71 D;  4NPE A;  1ZLL A;  3L72 J;  3KZI H;  2QIW A;  3VTP C;  3H1H E;  3KQG A;  3K5B A;  3L35 A;  1SQV J;  3BRV B;  5AW1 B;  3Q5P A;  2HPC B;  2JDI H;  5KAF E;  3CCE P;  1E79 H;  1GK4 A;  3AE4 C;  1NKN A;  1Q7Y Q;  2RMZ A;  1MZ9 A;  1KC8 Q;  5KJ7 A;  3L75 J;  1DEB A;  2GA1 A;  3MTU E;  3H1K G;  2BCC D;  3H32 A;  4WY4 D;  2QJY C;  3B71 A;  1RF1 C;  1DD3 A;  3CL3 D;  2V4H A;  3CI9 A;  4OVN F;  5H2F E;  1SQQ G;  4IFM A;  3ITK A;  1SP4 A;  2WMM A;  2IX7 C;  3I5C A;  4D6T J;  3CCL P;  2QJY B;  1RF1 B;  1BSH A;  1CW5 A;  3B5N C;  1LTB C;  1CI6 B;  2W90 A;  5KLV G;  2E76 C;  1BE3 D;  1YTZ I;  1U7J A;  2KSE A;  4HKZ H;  1USE A;  1YTZ T;  1NTK K;  2YKP A;  4CPG A;  4H0L C;  2Y0D A;  5CCG D;  1YI2 P;  2WPQ A;  2KNC B;  2E76 B;  2NZ2 A;  1QVG O;  1GL2 C;  1X8Y A;  1SQX J;  2W8Z A;  2MJZ A;  4L74 A;  3H1J J;  3GLM A;  3CC7 P;  4H0L B;  4U3F E;  3G6E P;  3AE5 C;  2WSS H;  1HTL C;  1GL2 B;  3L74 E;  1NU1 J;  5KAI E;  3H1L G;  1KD1 Q;  2Z4E A;  3H1H J;  1OWA A;  1Q81 Q;  3U59 A;  1HJ0 A;  1PPJ D;  1KB9 H;  1NO4 A;  1NTM G;  1SQP D;  2GUS A;  3CC2 P;  1IZN B;  1RF0 A;  5CCH C;  2IFM A;  3P7K A;  2AXC A;  1VF5 D;  5CJ0 A;  4GDO A;  3Q3D A;  2A45 G;  2ITA A;  5APW A;  3H1K D;  1YIT P;  2WPR A;  3WUT A;  2WQY C;  4L75 A;  1W5C E;  2KLU A;  2P7J A;  1J1E C;  2I1K A;  1IFD A;  3CXH I;  3II6 A;  1VQP P;  1VQ5 P;  5CHX A;  3M9Q A;  5CMZ A;  5BU5 A;  1SQV K;  5KLI C;  4UB8 E;  1SQQ D;  4IL6 E;  1BGY E;  2XNX A;  1J1E B;  3CX5 I;  3BCC D;  1JMM A;  3H1I E;  1U57 A;  2YO2 A;  2M5A B;  1JOC A;  2O1J A;  1JM0 A;  1BCC E;  5KLI B;  5GTH H;  3OJA B;  2KYV A;  3GHG A;  2O01 N;  2W6B A;  1VQK P;  5AVZ B;  4ZNC A;  5KLV D;  1KQL A;  1PGQ A;  2PGD A;  1QEX A;  2QA4 P;  1RQV A;  5APQ A;  2JWD A;  2J58 A;  2KSJ A;  2J5U A;  4QMA A;  4HB1 A;  2YMK A;  3OAK A;  1YQ4 C;  1NAF A;  3P8M C;  1OW6 A;  3HE4 B;  4GT1 A;  1PGJ A;  4U3F J;  1JTH A;  4HYT B;  1HBW A;  4GKG A;  1Y8A A;  2N9B A;  3FXD A;  2LR2 A;  1SFC D;  2XDJ A;  1KYO I;  4RJT A;  3HTK A;  1JY3 N;  2LXB A;  4XFJ A;  5CJ4 A;  1NTK E;  1T2K D;  2NRG A;  4JQ0 D;  1H88 A;  3H1L D;  1RHZ B;  3RK3 C;  1L0L G;  3SFD C;  2KS1 B;  3QWO C;  2LKM A;  1L0N K;  5E79 H;  1NTM D;  3RK3 B;  4XE5 B;  3EQ2 A;  1SQX K;  2M3E A;  1SQB D;  3JCU H;  1UIX A;  4KHX A;  1NTZ G;  2Q5U A;  3USS A;  1OXZ A;  1NU1 K;  1Q86 Q;  1G1I A;  2FYU K;  1VDF A;  4PJ0 E;  3CXH E;  1IK9 A;  2RN0 A;  1FZF A;  5AW7 B;  1KIL D;  3IN6 A;  5KJ7 C;  1BGY J;  1ZP0 C;  3CWB E;  4WY4 A;  3H1I J;  1M1J C;  3TGU E;  3O6Q A;  1ZN5 A;  2BAS A;  1VQ8 P;  2PAJ A;  1MV8 A;  3CX5 E;  3MD0 A;  1BCC J;  1NOH A;  1HF9 A;  3FXE A;  1E5W A;  2A06 E;  5KKZ C;  5TIS E;  3MP7 B;  1JEK A;  1M1J B;  1LP1 B;  2WT7 B;  1AQT A;  3L72 E;  2ZT9 B;  2HFE D;  1PP9 D;  5B66 H;  2WSC H;  2CPB A;  4OWF A;  1VQ7 P;  3CCM P;  3L73 E;  3H32 B;  3C9I A;  2WPV B;  3MUD A;  1UII A;  3P8C E;  2E5T A;  1M90 Q;  3KPE A;  2RKL A;  1SQV G;  3M0D A;  1N86 A;  3CLQ A;  4OGQ D;  1PFI A;  2ZYD A;  5CCG A;  3D71 A;  2R44 A;  3A0H H;  4PV1 D;  1K9M Q;  4HH2 A;  1NAY A;  1NYH A;  1WMK A;  2BCC G;  2I8D A;  1NTK J;  1HVV A;  1KYO E;  3JSV C;  1BSN A;  3M0A A;  1FZB A;  1P84 I;  2Z5H A;  1IFM A;  5AVR B;  1JCD A;  1L0L D;  2QJK C;  1GDT A;  2R3C A;  3HUS A;  1T8Z A;  2ZYA A;  2OTL P;  3V2P A;  2ZFC A;  3A2A A;  2E43 A;  1PZQ A;  3PHL A;  1AVO A;  3D70 A;  2WPS A;  3MIW A;  3TDK A;  2QJK B;  4D6T E;  3RBZ A;  2QRX A;  2ZJS E;  4I7Z C;  2KXP B;  3VP8 A;  2O1K A;  2XND H;  3L70 D;  1G2C A;  1EDJ A;  4I7Z B;  2K9J A;  4BWN A;  1L0N E;  4N78 D;  1TU3 F;  1RF0 C;  2P67 A;  1QL2 A;  5AW8 B;  1DEE G;  2WSE J;  3T97 A;  3CWB J;  1CSB A;  4YXD C;  4ASV A;  1IFJ A;  1GZL A;  1EZV E;  2AXT E;  5AW3 B;  1LTS C;  3TGU J;  3VN0 A;  4EI2 A;  3SWK A;  3A0B H;  2Q1K A;  1SQX G;  2NPS D;  3H25 A;  3F89 A;  3H1J G;  3AE8 C;  1QLE D;  4GOF A;  3O8Z A;  2XU6 A;  3HD7 C;  5AW9 B;  2FYU E;  3A5T A;  2POH A;  3L73 J;  3EFF K;  1NU1 G;  3L4F A;  5APX A;  4IL6 H;  1PPJ G;  1LJ2 A;  1SQP G;  1ZW0 A;  2WWW A;  1OVU A;  1XTC C;  3H1H G;  1IFN A;  3HD7 B;  1URQ A;  1S9K D;  1SQV D;  2G3A A;  4WVZ A;  3GHG C;  3PRJ A;  3V2Q A;  2M0B A;  2JWA A;  3GF7 A;  2A45 I;  2M8R A;  3BVH A;  1Q82 Q;  1JUN A;  4N3Y B;  2OYO A;  5BU8 B;  4UB6 H;  4H44 D;  3RK3 E;  1GMJ A;  3L75 D;  2K9Y A;  3BAS A;  4OH8 B;  1K05 A;  2M3B A;  1X9V A;  3GHG B;  3EFG A;  1LT1 A;  1M8O B;  4W7Y A;  2VRS A;  4RKU J;  5APT A;  1ZME C;  1KV4 A;  1P84 E;  3HRN A;  1SFC A;  3I55 P;  3KHU A;  1LTJ A;  2GUV A;  1JY2 N;  1USD A;  3BCC G;  1NHL A;  3GF3 A;  3M06 A;  4IOI H;  2O01 J;  2W6J H;  1ZR2 A;  4BRY B;  2O3J A;  4O9B A;  1K8A Q;  3M9H A;  3GW6 A;  5APY A;  1JTH B;  2XKM A;  2D2C C;  1ZRT E;  4ZKU A;  1EC5 A;  1FJP A;  4GOD A;  2IBZ D;  2G8Y A;  1L0N J;  3B5N B;  4C7N A;  1RH5 B;  3ZDM A;  4AUW A;  3MHV A;  1W2E A;  1PL5 A;  2FXM A;  2OQQ A;  2D2C B;  3BRT B;  1FZC A;  1N8R Q;  1IC2 A;  3AEC C;  2R5B A;  4PD4 D;  2V7Q H;  4KT0 J;  1FZA A;  1YJ9 P;  1X0T A;  2Z5I A;  1N7S A;  1SQX D;  5APS A;  1KIL A;  1HUC A;  3H1J D;  1PIX A;  1LWU A;  3NFQ A;  1L4A A;  1VQL P;  4PJ0 H;  2FYU J;  1YQ3 C;  3WUV A;  3L74 G;  2JP3 A;  5GTI H;  2YO3 A;  1NU1 D;  1N73 A;  3BAT A;  4WY4 C;  1H8A A;  2H88 C;  3H1H D;  1SQB G;  3AED C;  1FDI A;  1U7M A;  1IFP A;  4WY4 B;  1NKZ B;  3KYQ A;  3O6Q B;  1FU1 A;  1FDO A;  1M56 D;  2FFD A;  4IFD K;  2FKW B;  3S9O A;  1JMB A;  1S5L E;  3SFE C;  2B87 A;  2C0W A;  3KDP B;  5AVX B;  1VQO P;  3F5H A;  1J1D C;  1KMI Z;  4LLH A;  5CCG C;  2HPC A;  2R3S A;  1QL1 A;  3KZI E;  2FXP A;  3VMA A;  2W83 C;  1NH4 A;  1KB9 I;  3CCV P;  1J1D B;  4DZO A;  3CME P;  3H1I G;  1FBM A;  3E1I A;  1MUU A;  4H13 D;  2IFN A;  1PGP A;  1R5S A;  1OFC X;  3HUS C;  1URQ D;  2ZXE B;  1PP9 G;  2BEZ F;  5KLV J;  5KTB A;  3G4S P;  1WRG A;  3RL0 D;  3NTN A;  2E42 A;  4EDF A;  1FDM A;  2O01 H;  3HUS B;  1Q90 D;  2K37 A;  2B89 A;  1T3J A;  1RE4 A;  3A3Y B;  3EWK A;  3AEA C;  3NXS A;  2FYZ A;  3G3Z A;  2E74 D;  1CZQ A;  1H89 A;  1ZOY C;  3PH0 A;  5DJU B;  1FJK A;  4M3L A;  1VF5 C;  1JNM A;  1LGH B;  3WU2 E;  1S4X A;  4I6M C;  2J59 M;  2IYP A;  1YHQ P;  1WT6 A;  2ZAE B;  4WB4 A;  3CC4 P;  4U3F D;  1MFT A;  4PD4 H;  3CMA P;  3H1L J;  3C8V A;  5L8R J;  3L74 D;  1IK7 A;  1G2C B;  1NTK G;  1VF5 B;  2NPS A;  1IFI A;  3LW5 J;  2PRR A;  3SWY A;  1VQ6 P;  3U1A A;  2K9J B;  3QH9 A;  2Q7C A;  2FY8 A;  1FC2 C;  3RGU A;  1OW8 A;  4YPC A;  2ZVO B;  4WBA A;  2N9Y B;  3T97 B;  3AE9 C;  4R4M A;  5AVU B;  5C39 A;  1MKM A;  3L70 G;  2N1T D;  2KOG A;  3ABV C;  5KAF H;  2SPZ A;  1NTZ E;  2CPS A;  3N4X A;  4RES B;  1N7S D;  2Q9I A;  1FZE A;  2Y0E A;  1ZR4 A;  3NMD A;  4EOT A;  1L4A D;  4W80 A;  4TT3 H;  3CD6 P;  1VQ9 P;  3AE1 C;  2HLO A;  3C1L A;  4A7P A;  1S1C X;  2YMY A;  1RE3 A;  1EQ7 A;  1BGY D;  2P58 A;  2OYI A;  1YIJ P;  2MKV A;  2W6A A;  2RH0 A;  3TNU A;  3H1I D;  3TGU G;  2KZI A;  2QJP C;  3CCQ P;  1KB9 E;  2H43 A;  1BCC D;  5AW5 B;  1FOS F;  1SFC C;  1X22 A;  3L71 E;  3VMY A;  5H2F H;  1R8E A;  1LTJ C;  3CCS P;  1T2K C;  3L72 G;  5KKZ B;  2Y9Z A;  2QJP B;  1LT9 A;  1GTW A;  4RO0 A;  3L73 G;  1Y47 A;  5CBO A;  1SFC B;  2K3R A;  2E75 D;  2JKV A;  3V2R A;  3JC2 2;  4KJM A;  1LTJ B;  1SQQ K;  2OYH A;  1N2D C;  4R4L A;  1NWQ A;  1DX7 A;  1K04 A;  3L75 G;  1PV3 A;  3TSI A;  1YJN P;  3PJS K;  1T3U A;  1AVY A;  4LGD E;  2BCC E;  2K1A A;  5AVV B;  1G1J A;  2YXR B;  5KLV K;  3UIA A;  1FZC C;  1NTK D;  1IO4 A;  4JBZ A;  3LID A;  4W7Z A;  3PP5 A;  4C7N B;  2YXQ B;  3B4S A;  3AEE C;  3PTZ A;  4JYC A;  4AQR D;  5GTH E;  1H0T A;  2ZXX A;  1N7S C;  1SVF A;  1KIL C;  1FZC B;  3SWF A;  1LWU C;  5KAI H;  1L4A C;  3LIE A;  3KXD A;  4D6T G;  4Z1M H;  2H7H A;  1KIL B;  1N73 C;  2P2U A;  2IBZ G;  1BE3 E;  1NTZ J;  4IL6 X;  3Q2Y A;  3Q5R A;  3FWN A;  1LWU B;  2GM4 A;  4Y99 C;  3AEG C;  1HGZ A;  1YJW P;  4TLF A;  1AQ5 A;  2PFX A;  2C9N Y;  1S2E A;  3Q1M A;  2UWJ E;  1L0N G;  2YKQ A;  1N73 B;  1GW4 A;  3CXH D;  1NTM K;  4Y99 B;  3AE2 C;  1NJI Q;  2HOD A;  3TYY A;  2R32 A;  1EZV G;  3CWB D;  1S5L H;  3RL0 g;  3D6Y A;  2IDB A;  4OGQ C;  3TGU D;  1MFZ A;  3TK1 A;  1A02 F;  3CX5 D;  5AVQ B;  3L71 J;  2E76 D;  2WZ7 A;  4PV1 C;  5DJT B;  1S72 P;  2A06 D;  4UB8 H;  4Y28 J;  3GG2 A;  3V4Q A;  4GOE A;  2KZJ A;  3OA7 A;  2FYU G;  4H0L D;  2WTY A;  4OGQ B;  3L72 D;  2B87 B;  2CK3 H;  1PPJ E;  2JEE A;  4L76 A;  2AEJ A;  3CPW O;  3L73 D;  1SQP E;  1FS0 E;  3E1R A;  4PV1 B;  1GL2 D;  3P8C D;  3AE6 C;  3RK2 D;  3MGN A;  5AW2 B;  1OVR A;  1IJD B;  1JB0 J;  2HG5 D;  2IZ1 A;  1VQN P;  3H1K E;  1JCC A;  2FYN C;  2HR3 A;  2BCC J;  1AA0 A;  3D6Z A;  1NVO A;  1M1J A;  2JO1 A;  1LP1 A;  2WT7 A;  1GU4 A;  1KYO D;  2OAR A;  1AJY A;  1RE4 C;  2KI7 B;  2QM8 A;  2FYN B;  1SQQ E;  5CCH D;  3G9R A;  3WU2 H;  4ZKP A;  3BCC E;  2JJL A;  4YXW H;  2BEQ D;  5B66 E;  3P32 A;  4D6T D;  5B5E E;  1A02 J;  1BE3 J;  2NPS C;  3HTK B;  5KLV E;  1VQM P;  2OGU A;  2QE7 H;  3S1K A;  2L91 A;  3VMZ A;  1L0L K;  3A0H E;  4ASW A;  2NPS B;  2N1T A;  1L0N D;  3N7N A;  4C46 A;  2QG4 A;  1X79 B;  2DW3 A;  4YTP C;  3W68 A;  1ZV8 A;  4K35 A;  1EZV D;  3CCU P;  5AW6 B;  4U3F G;  1QX8 A;  3RK2 C;  2XZR A;  3CXH H;  2PP6 A;  1GW3 A; 
#chains in the Genus database with same CATH homology
 3L74 J;  2BCC J;  1NTK J;  3L75 J;  1KYO I;  1L0N J;  1BGY J;  1KB9 I;  3TGU J;  3L71 J;  1NTZ J;  1P84 I;  3L73 J;  3L70 J;  3H1I J;  1SQV J;  4D6T J;  4PD4 I;  1NTM J;  1NU1 J;  3CX5 I;  1SQX J;  2IBZ I;  3H1K J;  1SQP J;  1L0L J;  5KLV J;  1SQQ J;  3CXH I;  3H1L J;  1BCC J;  1PP9 J;  4U3F J;  3H1J J;  2FYU J;  1SQB J;  3BCC J;  3CWB J;  3H1H J;  1BE3 J;  1EZV I;  3L72 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...