4U3FJ

Cytochrome bc1 complex from chicken with designed inhibitor bound
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
61
structure length
61
Chain Sequence
ALLRQAYSALFRRTSTFALTVVLGAVLFERAFDQGADAIFEHLNEGKLWKHIKHKYEASEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational Design of Highly Potent and Slow-Binding Cytochrome bc1 Inhibitor as Fungicide by Computational Substitution Optimization
doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 22
structure length 61
sequence length 61
chains with identical sequence W
ec nomenclature
pdb deposition date 2014-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 4u3fJ00
1BGYJ 3L71J 2BCCJ 3L74J 1BE3J 1L0NJ 1NTMJ 1PP9J 1KYOI 3H1HJ 4U3FJ 1NU1J 2FYUJ 3H1JJ 1P84I 1SQPJ 1SQBJ 3CXHI 3H1LJ 3BCCJ 3CX5I 1NTKJ 1SQVJ 4PD4I 2IBZI 3L75J 1SQQJ 3CWBJ 4D6TJ 3L73J 3L72J 3H1IJ 1BCCJ 3H1KJ 1NTZJ 3L70J 5KLVJ 1EZVI 1KB9I 1L0LJ 1SQXJ 3TGUJ
chains in the Genus database with same CATH superfamily
4IOIH 1MUUA 3A0HE 3B8EB 1DEBA 1PV3A 5H2FH 3WUVA 3Q5RA 3AEDC 1Y47A 3ITKA 1BE3J 4U3FG 3FWLA 1N86A 4I6MC 1RF0A 1FBMA 2W6BA 2N1TC 2K1AA 3L72D 5CBOA 3L71D 1GK6A 3SSUA 2W90A 2ZYAA 2R44A 1XTCC 3VN0A 2JJLA 2V7QH 1AA0A 2ZT9D 1SQXD 3L72E 5CCHA 3H1KE 3N4XA 3U1CA 1M7LA 2WPVB 3SFDC 1W5CE 1CSBA 3VP8A 3Q3DA 2KP8A 1VF5C 1GL2C 1KYOH 3GG2A 1KILC 1JMBA 2K3RA 1U7MA 2K88A 2D2CD 3N7NA 1T2KD 1EXIA 3GHGA 1LNQA 3H1LE 3RL0B 1SQPE 4WY4B 1K9MQ 2IYOA 2POHA 2OYHC 4M3LA 4U7JA 3H1ID 2BCCG 1KB9D 1L0LJ 2Q6QA 2V4HA 3NTNA 4YPCA 2OYIC 1PGOA 2FYUD 2IPPA 1Y8AA 3V4QA 3USSA 4EDFA 1MFZA 2Q5UA 3L74J 2XDJA 5AW0B 3CCVP 2A45H 2WSCH 1H8AA 1X0TA 2W8ZA 2FYUG 1ZW0A 2FYZA 3WUTA 1FZAA 3L74D 4W80A 1URQD 1L4AC 1N7LA 3AE3C 5KJ7D 1NGMB 1P84I 3M9HA 3A7OA 1RQVA 1OW7A 3IF4A 4D6TG 2LR2A 1KFNA 1FC2C 1WMKA 3E1RA 2ZXXA 3KPEA 2Y0CA 4MN4C 4N78E 4OGQD 4WY4A 1M90Q 2OARA 4DT0A 2QJPC 1ZOYC 2KXPB 1JO5A 1OZHA 1BSNA 4H0LD 1LWUC 1QGKB 2QJYC 3H1HG 4I2LC 4WVZA 4BRYA 4Z1MH 1FJPA 1SQXJ 4N6JA 2KSEA 3AE8C 2JWAA 3RK3E 2OQQA 1HH0A 1GW3A 2J5UA 1LTJC 1OMIA 1PP9J 1FZCA 1T8ZA 2R3CA 2KOGA 3CX5E 1KB9H 1VQMP 2R32A 1ZXGA 2E74C 4O9BA 3GF3A 1LP1A 2E5TA 2IBZD 1JY2P 3GMAA 4QMAA 3L4FA 3CCQP 1KYOD 1W2EA 3L73J 3MTUE 3PHLA 3RBXA 3BCCE 1NU1G 5BU5A 5L8RJ 1S5LE 1SQBE 1L0LK 4PJ0H 3L36A 3CWBG 4W7ZA 5B66H 2M5AA 1EDKA 1QVFO 1KQLA 1YBKA 3TDKA 3L72G 5AW7B 4AYCA 1ZR4A 1VQKP 4H44B 2GM4A 2CK3H 2WMMA 1YJ9P 1RH5B 2FY8A 1H89A 1NO4A 3H1HJ 3HE4A 3V6IA 2O1JA 1N7SC 3G9RA 2KS1B 1VPCA 1PP9D 2WITA 1SFCA 2ZAEB 1QL1A 3TYYA 2QA4P 1K8AQ 1LWUA 1P84D 2WSCJ 1YITP 3VMXA 2CPBA 3SFEC 3RL0g 1RF0C 2IBZI 1NU1D 2LKMA 3II6A 3EFFK 1J1DC 1YJWP 1NU1E 3BRVB 1L0LG 2B88A 5AVWB 1YTZI 2KB7P 2ZT9B 2RKLA 2KK7A 3P8CE 2P2UA 3KZIH 3P7KA 4H13C 4BWNA 3HUSB 1E79H 1PGQA 4GKGA 5KLIB 4JBZA 1NTME 2OGUA 2ZJSE 3L71E 4JPZB 4OGQC 5APUA 3HD7D 1UIIA 1X79B 2BCCJ 4GOEA 5CCHD 1DD4A 2OYHB 2XU6A 2JO1A 3V5BA 2XKMA 4R4MA 1OX3A 3AE5C 2E42A 3HE5B 2B89A 1LTAC 3H25A 1SVFA 1J1DB 1ZP0C 1MKMA 2FYUK 2N9BA 1CI6A 3HD7B 5BU8B 4D6TE 3F89A 2KLUA 1HVVA 3KQGA 1G2CB 1NTMK 1T3UA 1SQQJ 4IFMA 4PV1C 3GHGC 3TNUB 1SQVE 2KLVA 2XV5A 3F5HA 1X8YA 3H1IJ 1L4AD 1PPJE 1URQC 2M3EA 2QJPB 3I5CA 1FZGA 1PGPA 2HPCA 2DW3A 3NMDA 3CCMP 1IK7A 1YTZT 4H0LB 5K5GB 1K73Q 1N7SA 5AW5B 5CCGD 1BGYD 3G4SP 3CMAP 1NTZK 4IL6E 3PH0A 2QRXA 1BSHA 2D2CC 5KAIE 1NWQA 1URQA 1NTMG 5TJHA 3T97B 1VF5D 2ITAA 1OFCX 3R4YA 4ZKUA 2O01H 1GDTA 1ZV8A 2IBZE 4EOTA 5AVQB 1ZMEC 1NTMD 4GT1A 1FZFA 1BE3D 1VQ9P 1SQBG 4A7PA 2WSEJ 1JB0J 1OW8A 1URQB 3H1HD 1SQXE 1YIJP 1LTBC 2N1TD 3AE7C 1YQ4C 3IR9A 3L71G 2IYPA 3H1LD 1EZVD 2QM8A 3AEGC 1NTKJ 2Q3IA 4IL6X 2L91A 2YIUB 3L75J 5APVA 2JEEA 4ZNCA 2K9JA 3SWYA 3BATA 4AQRD 5APQA 3AECC 3B4SA 1QL2A 1SQXK 2W6JH 5APWA 3W68A 1Q86Q 1SQPG 1NJIQ 2QEXP 1KQSO 3CLQA 4RKUJ 5KLVJ 2E75C 2MJZA 3U59A 1MZ9A 1D7MA 1Q7YQ 1FZCC 4LGDE 2N9YB 1R5SA 1GL2B 2IDBA 3TSIA 2JKVA 2GUVA 3T97A 3HE5A 1RF1A 1L0NJ 2XZRA 3RL0C 2PGDA 1GD2E 1NAFA 2IBZG 1M1JC 4RESB 1KYOI 1FOSF 1N7SB 4AUWA 3RK2C 4TLFA 1KQGB 1S1CX 1M8OB 1S5LX 3CPWO 4UB6E 1FJKA 1L0LE 2I8DA 2O1KA 3V2NA 2J59M 4OWFA 5KLVK 4Y99C 2FKWB 2OTKE 2PP6A 4C7NA 3H32B 4L73A 1SQVJ 2HG5D 5AW9B 1G2CA 2L5GB 5KJ7C 2G8YA 2H43A 5AVSB 3M0AA 3M91A 1JUNA 4D6TJ 3MUDC 2FBWC 1CI6B 2PFXA 3NFQA 4N78D 1NKNA 1SQXG 3L37A 2W83C 2G3AA 1VL2A 3O6QB 4L75A 1Z56A 3Q5SA 1FDOA 2KZIA 3B71A 1OXZA 1LT1A 1PPJD 1IFJA 1RY3A 2KS1A 4RO0A 4NPDA 2VRSA 4N3YB 3S9OA 3V2PA 2C0XA 2IFMA 1KILA 3MHVA 3S1KA 3HUSA 1RQUA 4JYCA 5EFWB 1EDJA 3L70E 5CMZA 1T3JA 1PZQA 3A5TA 4LC1A 1NU1K 3VMYA 3V4WA 1NTKD 3HD7C 3B5NA 3KZIE 3PRJA 1PIXA 2KI7B 2M0BA 1SQBD 2P58A 3L73G 2FFDC 1VQ4P 2BEZF 1QVGO 2WZ7A 2YMKA 1IFDA 3A0BE 5CJ0A 3M9QA 1LWUB 4EIJA 2B87B 1NAYA 2KIKA 4WY4C 1NHLA 1NH4A 5GTIH 1YI2P 3MD0A 4WY4D 3RK3C 3AE1C 3CWBE 3IAOA 4H0LC 5KKZC 3K5BA 1SQBK 1K04A 2YNYA 1JY2N 3M9BA 1KB9I 1G1JA 4GIFA 3U1AA 1SQPD 3JCUE 1AFOA 3A0HH 2NPSD 1Q90D 2WT7A 1N73B 1FZEA 4WB4A 1L0NE 2IFNA 3P8CD 1DH3A 2A45G 4HYTB 1ZRTE 5B5EE 1FDMA 1FAVA 2RH0A 3CCJP 1P84E 1M57D 2M5AB 3AE4C 1AV1A 3OJAB 4YTPC 2HODB 1L4AB 2RN0A 3O8ZA 3UIAA 2ZFCA 3H1JJ 1VQ8P 1OVRA 2Z5IA 4WBAA 3TGUD 1EDLA 1SQBJ 2Y9YA 3I56P 3BCCJ 1VQNP 1JCDA 1U57A 1KTMA 3L73E 3S4RA 1KN7A 1IFNA 1NTZE 3CL3D 1IFMA 1KC8Q 2Y9ZA 1AQTA 3FX0A 5AVVB 3L70G 1KYOE 2FFDA 1BCCJ 2WVRA 4K3AA 3V2RA 4D6TD 4DOJA 5AW6B 2OYIA 5CCGC 1SFCC 3OW2O 1XTGB 2FYNB 3FWNA 2ZVOB 4JQ0D 1EXJA 3KDPB 3CXHH 5DJUB 4HJGH 5BVZA 1FZCB 4C46A 2QJKC 3WU2H 4DJGA 2HLOA 5E79H 4YXWH 4GODA 2O01J 4HH2A 4EI2A 3R2PA 1ZR2A 1DEEG 2N1TA 5AW3B 3VMZA 1AJYA 4WWIA 1KD1Q 1LTJB 2QM7A 3A0BH 2WSEH 1Q82Q 4BRYB 3FXEA 3CC4P 2ZT9C 5CHXA 2ZVNB 4PD4E 1LTTC 2RMZA 5B66E 2N1TB 4EYYQ 2H88C 1FZBA 2HYNA 3JC22 3D6YA 1VQOP 2WWWA 4IL6H 1QX8A 1PGJA 3CC2P 1GL2D 2ZYDA 3AEEC 1SQQG 2P7JA 4PV1D 1L0NG 3QWOC 2NZ2A 5TISE 3I55P 1M1KQ 1LTIC 1IFPA 1LJ2A 2YMYA 3L70D 1LGHB 1RE4A 1NTZG 4H13B 1BDDA 1BCCD 1SQVG 4UB8H 1HF9A 2MKVA 1PPJG 1KMIZ 3SWKA 4UB8E 3KYQA 3RGUA 2WSFJ 1SQPK 4BXLA 1EQ7A 2E76B 1WRGA 4I7ZB 2AEJA 4K35A 2OTJP 1EZVI 2XNDH 2GA1A 3TGUJ 3M0DA 1LTJA 3M06A 2H89C 3QH9A 4JYBA 1VQ6P 3A2AA 4NPEA 1EC5A 1YYCA 4H44C 2HODA 2V7QJ 1ZLLA 1GW4A 1IK9A 1E5WA 4U3FD 5H2FE 3V2QA 1S72P 1NTMJ 1KV4A 2GUSA 1LTSC 3TK1A 3L75G 2WSSH 1EDIA 1RHZB 5AW1B 1S3JA 3MZWB 5APYA 4YXDC 3CX5H 1M56D 5KTBA 3FGAD 2C0WA 5AW8B 1N73A 2YKPA 3GHGB 2Y0EA 1SQPJ 3L35A 2OYIB 3H1LJ 3LIDA 3WUUA 3LIEA 2FFDB 1HWTC 2NRGA 5E79E 5KLVG 1WT6A 3HTKA 4PD4I 1OVUA 2A06G 3JSVC 4OGQB 2WPRA 1A02F 2QJKB 3VMAA 5APSA 1S5LH 3AE2C 5CJ4A 2JDIH 1GMJA 1L4AA 1KILD 1NOHA 2JP3A 2K37A 1KQFB 3CC7P 1BGYG 3CX5D 5KLIC 4GOFA 5KAIH 3B5NB 2BEQD 2ZXEB 4GDOA 1JY3O 1KILE 1L2PA 1LT9C 2E5YA 1FE6A 3P8MC 4LLHA 4ASWA 5CCGA 1FOSE 2C9NY 1X22A 2Q1KA 2WT7B 1HTLC 5AVTB 3AE9C 1S9KD 1KILB 1NKZB 2AXTH 2JR8A 2IZ1A 4U3FJ 5APTA 1T2KC 1GTWA 1JNMA 1NYHA 3WMM0 1MFTA 1R5LA 2P10A 1SP4A 1N73C 1MV8A 4KHXA 3BRTB 1YQ3C 2YO2A 5AW2B 5CCHC 1Q81Q 3CCEP 1L0LD 2B87A 2JWDA 1BE3G 3AEFC 3FXDA 1GU5A 3CWBD 3JCUH 5TISH 4PV1B 2P1JA 2D2CB 4PD4D 4H44D 1VQPP 3CCLP 3Q2YA 1LT9B 2NPSA 2PAJA 3A3YB 3RK2B 2E75B 1DD3A 2E75D 2QG4A 1DX7A 1JCCA 1P84H 2UWJE 1KZUB 3L70J 4I1LA 2BCCD 2AXCA 2QSIA 3H32A 1KB9E 4XE5B 4Y99B 5AVZB 4B86A 4C7NB 3C8VA 3CCRP 1GZLA 1PP9E 5AVXB 3IN6A 1QLED 2HFED 2KYVA 1PL5A 1JEKA 1BCCG 1SQVD 3G6EP 1HGZA 3L71J 3RK3D 1IZNB 1J1EB 2CPSA 2FXOA 2W27A 2OTLP 2FYNC 2WSFH 1DIPA 2IX7C 1J2JB 1OW6A 3O6QA 4C7RA 1VQ5P 1RF1B 3MP7B 1BGYE 1NTKK 1JTHA 1UIXA 2B9BA 3LW5H 3CXHD 3EFGA 2KUBA 1N2DC 3AEAC 3CXHE 3L74G 3GLMA 1AVYA 1X9VA 1U7JA 1OWAA 2QE7H 2R5DA 2YKOA 1CZQA 2YO3A 3MIWA 2IZ0A 3VP9A 2YIUC 3BASA 3CCUP 2ZYGA 2H7HA 3HRNA 1SQQK 2E74B 1FS0E 2SPZA 1EZVE 1FU1A 3AE6C 1K05A 4ASVA 2E43A 3PLNA 1OVVA 1J1EC 4R4LA 2AXTE 1FDIA 3L75E 2E76D 3H1HE 3H6PA 1JY2O 3EWKA 3EQ2A 3G3ZA 1YHQP 4L76A 3TF5A 4HB1A 1RE3C 1KFMA 3PP5A 3D71A 3L75D 3MGNA 3E7KA 1JM0A 4OH8B 2Q7CA 1JMMA 2YXQB 4XFJA 2OYOA 2Q9IA 1GL2A 1T6AA 4TT3H 2KNCB 3MUDA 5KAFE 1HBWA 1M1JB 2A06D 1IJDB 3RK3B 1OIPA 2E76C 5KAFH 1VQ7P 4NPFX 4OVNF 1SFCD 2KNCA 5KLVD 3RBZA 1JOCA 1HGVA 1JY3P 2M8RA 3L73D 3RL0D 4L74A 1GU4A 3WU2E 1PP9G 1LTGC 3TGUE 4ZKPA 2Z4EA 1H0TA 3CI9A 2K9JB 3CX5I 4XA4A 3H1JG 2HR3A 3B5ND 4JF7A 3RK2D 3CWBJ 1NTZD 3BCCD 3PTZA 3BCCG 5KKZB 1S9KE 5KJ7A 2NPSC 1IO4A 1USEA 3C1LA 3E1IA 3H1KJ 4PD4H 1W2BO 2W6AA 1SQVK 3H1JD 4KT0J 3TNUA 1H0TB 1H88A 1HJBA 1HJ0A 3SWFA 3B5NC 3HD7A 1M1JA 2A45I 2YKQA 5AVUB 1BGYJ 2R3SA 1BE3E 1JTHB 5AVRB 5B5EH 1TU3F 2QVAA 1IFIA 1Q2NA 1L0NK 2QIWA 2WQYC 3HUSC 5C39A 4DZOA 2LXCB 4DCKA 3ABVC 1PFIA 3P32A 4Y28J 4PJ0E 4CPGA 1SS1A 2K9YA 3BVHA 1SQQD 2BCCE 5AVYB 3NXSA 2FYUJ 5AW4B 1GK4A 3H1IE 1KORA 3G71P 2HPCB 2O01N 1AQ5A 3CXHI 4HKZH 1SQQE 1YJNP 3CMEP 5APXA 1CW5A 2FXPA 2QJYB 4IFFA 1RE4C 1VDFA 2Y0DA 1BCCE 1AVOA 3C9IA 3LW5J 1LT9A 2Z5HA 1IC2A 1N7SD 2I1KA 1NTZJ 3OAKA 3AEBC 3CD6P 3TGUG 4ZMDA 1S2EA 2P67A 2YXRB 3D70A 1NTKG 1R8EA 3IFMA 2LXBA 3H1JE 1S4XA 3Q1MA 2OYHA 3L74E 3OA7A 4KJMA 1QEXA 2J58A 2O3JA 2H8PD 3H1KG 4U3FE 2AEMA 4W7YA 1SLQA 1BDCA 3PJSK 2Q3EA 1RE3A 3H1KD 3GW6A 3VOPA 4RJTA 3GF7A 1L0ND 2PRRA 1EZVG 1A02J 3H1LG 1G1IA 2WTYA 1USDA 1NU1J 2KSJA 2I1JA 3M0DC 3VTPC 2XNXA 1Y9BA 3CCSP 5CBNA 1NVOA 2NPSB 2WPQA 2FXMA 2KZJA 5GTHH 3KXDA 1HUCA 5DJTB 1ZRTD 3W67A 5GTHE 5KLVE 3D6ZA 4IFDK 1RF1C 2E74D 5GTIE 1N8RQ 4H13D 3Q5PA 2A06E 3L72J 4I7ZC 3VYIA 2C9LY 2M3BA 1SFCB 2WPSA 2FYUE 3H1IG 1LP1B 1ZN5A 3HTKB 2R5BA 3KHUA 3HE4B 1NTKE 5M1BA 1VQLP 4UB6H 1JY3N 1VF5B 3ZDMA 2BASA 2AEFA
chains in the Genus database with same CATH topology
1BGYJ 3L71J 2BCCJ 3L74J 1BE3J 1L0NJ 1NTMJ 1PP9J 1KYOI 3H1HJ 4U3FJ 1NU1J 2FYUJ 3H1JJ 1P84I 1SQPJ 1SQBJ 3CXHI 3H1LJ 3BCCJ 3CX5I 1NTKJ 1SQVJ 4PD4I 2IBZI 3L75J 1SQQJ 3CWBJ 4D6TJ 3L73J 3L72J 3H1IJ 1BCCJ 3H1KJ 1NTZJ 3L70J 5KLVJ 1EZVI 1KB9I 1L0LJ 1SQXJ 3TGUJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY J;  3L71 J;  2BCC J;  3L74 J;  1BE3 J;  1L0N J;  1NTM J;  1PP9 J;  1KYO I;  3H1H J;  4U3F J;  1NU1 J;  2FYU J;  3H1J J;  1P84 I;  1SQP J;  1SQB J;  3CXH I;  3H1L J;  3BCC J;  3CX5 I;  1NTK J;  1SQV J;  4PD4 I;  2IBZ I;  3L75 J;  1SQQ J;  3CWB J;  4D6T J;  3L73 J;  3L72 J;  3H1I J;  1BCC J;  3H1K J;  1NTZ J;  3L70 J;  5KLV J;  1EZV I;  1KB9 I;  1L0L J;  1SQX J;  3TGU J; 
#chains in the Genus database with same CATH topology
 4IOI H;  1MUU A;  3A0H E;  3B8E B;  1DEB A;  1PV3 A;  5H2F H;  3WUV A;  3Q5R A;  3AED C;  1Y47 A;  3ITK A;  1BE3 J;  4U3F G;  3FWL A;  1N86 A;  4I6M C;  1RF0 A;  1FBM A;  2W6B A;  2N1T C;  2K1A A;  3L72 D;  5CBO A;  3L71 D;  1GK6 A;  3SSU A;  2W90 A;  2ZYA A;  2R44 A;  1XTC C;  3VN0 A;  2JJL A;  2V7Q H;  1AA0 A;  2ZT9 D;  1SQX D;  3L72 E;  5CCH A;  3H1K E;  3N4X A;  3U1C A;  1M7L A;  2WPV B;  3SFD C;  1W5C E;  1CSB A;  3VP8 A;  3Q3D A;  2KP8 A;  1VF5 C;  1GL2 C;  1KYO H;  3GG2 A;  1KIL C;  1JMB A;  2K3R A;  1U7M A;  2K88 A;  2D2C D;  3N7N A;  1T2K D;  1EXI A;  3GHG A;  1LNQ A;  3H1L E;  3RL0 B;  1SQP E;  4WY4 B;  1K9M Q;  2IYO A;  2POH A;  2OYH C;  4M3L A;  4U7J A;  3H1I D;  2BCC G;  1KB9 D;  1L0L J;  2Q6Q A;  2V4H A;  3NTN A;  4YPC A;  2OYI C;  1PGO A;  2FYU D;  2IPP A;  1Y8A A;  3V4Q A;  3USS A;  4EDF A;  1MFZ A;  2Q5U A;  3L74 J;  2XDJ A;  5AW0 B;  3CCV P;  2A45 H;  2WSC H;  1H8A A;  1X0T A;  2W8Z A;  2FYU G;  1ZW0 A;  2FYZ A;  3WUT A;  1FZA A;  3L74 D;  4W80 A;  1URQ D;  1L4A C;  1N7L A;  3AE3 C;  5KJ7 D;  1NGM B;  1P84 I;  3M9H A;  3A7O A;  1RQV A;  1OW7 A;  3IF4 A;  4D6T G;  2LR2 A;  1KFN A;  1FC2 C;  1WMK A;  3E1R A;  2ZXX A;  3KPE A;  2Y0C A;  4MN4 C;  4N78 E;  4OGQ D;  4WY4 A;  1M90 Q;  2OAR A;  4DT0 A;  2QJP C;  1ZOY C;  2KXP B;  1JO5 A;  1OZH A;  1BSN A;  4H0L D;  1LWU C;  1QGK B;  2QJY C;  3H1H G;  4I2L C;  4WVZ A;  4BRY A;  4Z1M H;  1FJP A;  1SQX J;  4N6J A;  2KSE A;  3AE8 C;  2JWA A;  3RK3 E;  2OQQ A;  1HH0 A;  1GW3 A;  2J5U A;  1LTJ C;  1OMI A;  1PP9 J;  1FZC A;  1T8Z A;  2R3C A;  2KOG A;  3CX5 E;  1KB9 H;  1VQM P;  2R32 A;  1ZXG A;  2E74 C;  4O9B A;  3GF3 A;  1LP1 A;  2E5T A;  2IBZ D;  1JY2 P;  3GMA A;  4QMA A;  3L4F A;  3CCQ P;  1KYO D;  1W2E A;  3L73 J;  3MTU E;  3PHL A;  3RBX A;  3BCC E;  1NU1 G;  5BU5 A;  5L8R J;  1S5L E;  1SQB E;  1L0L K;  4PJ0 H;  3L36 A;  3CWB G;  4W7Z A;  5B66 H;  2M5A A;  1EDK A;  1QVF O;  1KQL A;  1YBK A;  3TDK A;  3L72 G;  5AW7 B;  4AYC A;  1ZR4 A;  1VQK P;  4H44 B;  2GM4 A;  2CK3 H;  2WMM A;  1YJ9 P;  1RH5 B;  2FY8 A;  1H89 A;  1NO4 A;  3H1H J;  3HE4 A;  3V6I A;  2O1J A;  1N7S C;  3G9R A;  2KS1 B;  1VPC A;  1PP9 D;  2WIT A;  1SFC A;  2ZAE B;  1QL1 A;  3TYY A;  2QA4 P;  1K8A Q;  1LWU A;  1P84 D;  2WSC J;  1YIT P;  3VMX A;  2CPB A;  3SFE C;  3RL0 g;  1RF0 C;  2IBZ I;  1NU1 D;  2LKM A;  3II6 A;  3EFF K;  1J1D C;  1YJW P;  1NU1 E;  3BRV B;  1L0L G;  2B88 A;  5AVW B;  1YTZ I;  2KB7 P;  2ZT9 B;  2RKL A;  2KK7 A;  3P8C E;  2P2U A;  3KZI H;  3P7K A;  4H13 C;  4BWN A;  3HUS B;  1E79 H;  1PGQ A;  4GKG A;  5KLI B;  4JBZ A;  1NTM E;  2OGU A;  2ZJS E;  3L71 E;  4JPZ B;  4OGQ C;  5APU A;  3HD7 D;  1UII A;  1X79 B;  2BCC J;  4GOE A;  5CCH D;  1DD4 A;  2OYH B;  2XU6 A;  2JO1 A;  3V5B A;  2XKM A;  4R4M A;  1OX3 A;  3AE5 C;  2E42 A;  3HE5 B;  2B89 A;  1LTA C;  3H25 A;  1SVF A;  1J1D B;  1ZP0 C;  1MKM A;  2FYU K;  2N9B A;  1CI6 A;  3HD7 B;  5BU8 B;  4D6T E;  3F89 A;  2KLU A;  1HVV A;  3KQG A;  1G2C B;  1NTM K;  1T3U A;  1SQQ J;  4IFM A;  4PV1 C;  3GHG C;  3TNU B;  1SQV E;  2KLV A;  2XV5 A;  3F5H A;  1X8Y A;  3H1I J;  1L4A D;  1PPJ E;  1URQ C;  2M3E A;  2QJP B;  3I5C A;  1FZG A;  1PGP A;  2HPC A;  2DW3 A;  3NMD A;  3CCM P;  1IK7 A;  1YTZ T;  4H0L B;  5K5G B;  1K73 Q;  1N7S A;  5AW5 B;  5CCG D;  1BGY D;  3G4S P;  3CMA P;  1NTZ K;  4IL6 E;  3PH0 A;  2QRX A;  1BSH A;  2D2C C;  5KAI E;  1NWQ A;  1URQ A;  1NTM G;  5TJH A;  3T97 B;  1VF5 D;  2ITA A;  1OFC X;  3R4Y A;  4ZKU A;  2O01 H;  1GDT A;  1ZV8 A;  2IBZ E;  4EOT A;  5AVQ B;  1ZME C;  1NTM D;  4GT1 A;  1FZF A;  1BE3 D;  1VQ9 P;  1SQB G;  4A7P A;  2WSE J;  1JB0 J;  1OW8 A;  1URQ B;  3H1H D;  1SQX E;  1YIJ P;  1LTB C;  2N1T D;  3AE7 C;  1YQ4 C;  3IR9 A;  3L71 G;  2IYP A;  3H1L D;  1EZV D;  2QM8 A;  3AEG C;  1NTK J;  2Q3I A;  4IL6 X;  2L91 A;  2YIU B;  3L75 J;  5APV A;  2JEE A;  4ZNC A;  2K9J A;  3SWY A;  3BAT A;  4AQR D;  5APQ A;  3AEC C;  3B4S A;  1QL2 A;  1SQX K;  2W6J H;  5APW A;  3W68 A;  1Q86 Q;  1SQP G;  1NJI Q;  2QEX P;  1KQS O;  3CLQ A;  4RKU J;  5KLV J;  2E75 C;  2MJZ A;  3U59 A;  1MZ9 A;  1D7M A;  1Q7Y Q;  1FZC C;  4LGD E;  2N9Y B;  1R5S A;  1GL2 B;  2IDB A;  3TSI A;  2JKV A;  2GUV A;  3T97 A;  3HE5 A;  1RF1 A;  1L0N J;  2XZR A;  3RL0 C;  2PGD A;  1GD2 E;  1NAF A;  2IBZ G;  1M1J C;  4RES B;  1KYO I;  1FOS F;  1N7S B;  4AUW A;  3RK2 C;  4TLF A;  1KQG B;  1S1C X;  1M8O B;  1S5L X;  3CPW O;  4UB6 E;  1FJK A;  1L0L E;  2I8D A;  2O1K A;  3V2N A;  2J59 M;  4OWF A;  5KLV K;  4Y99 C;  2FKW B;  2OTK E;  2PP6 A;  4C7N A;  3H32 B;  4L73 A;  1SQV J;  2HG5 D;  5AW9 B;  1G2C A;  2L5G B;  5KJ7 C;  2G8Y A;  2H43 A;  5AVS B;  3M0A A;  3M91 A;  1JUN A;  4D6T J;  3MUD C;  2FBW C;  1CI6 B;  2PFX A;  3NFQ A;  4N78 D;  1NKN A;  1SQX G;  3L37 A;  2W83 C;  2G3A A;  1VL2 A;  3O6Q B;  4L75 A;  1Z56 A;  3Q5S A;  1FDO A;  2KZI A;  3B71 A;  1OXZ A;  1LT1 A;  1PPJ D;  1IFJ A;  1RY3 A;  2KS1 A;  4RO0 A;  4NPD A;  2VRS A;  4N3Y B;  3S9O A;  3V2P A;  2C0X A;  2IFM A;  1KIL A;  3MHV A;  3S1K A;  3HUS A;  1RQU A;  4JYC A;  5EFW B;  1EDJ A;  3L70 E;  5CMZ A;  1T3J A;  1PZQ A;  3A5T A;  4LC1 A;  1NU1 K;  3VMY A;  3V4W A;  1NTK D;  3HD7 C;  3B5N A;  3KZI E;  3PRJ A;  1PIX A;  2KI7 B;  2M0B A;  1SQB D;  2P58 A;  3L73 G;  2FFD C;  1VQ4 P;  2BEZ F;  1QVG O;  2WZ7 A;  2YMK A;  1IFD A;  3A0B E;  5CJ0 A;  3M9Q A;  1LWU B;  4EIJ A;  2B87 B;  1NAY A;  2KIK A;  4WY4 C;  1NHL A;  1NH4 A;  5GTI H;  1YI2 P;  3MD0 A;  4WY4 D;  3RK3 C;  3AE1 C;  3CWB E;  3IAO A;  4H0L C;  5KKZ C;  3K5B A;  1SQB K;  1K04 A;  2YNY A;  1JY2 N;  3M9B A;  1KB9 I;  1G1J A;  4GIF A;  3U1A A;  1SQP D;  3JCU E;  1AFO A;  3A0H H;  2NPS D;  1Q90 D;  2WT7 A;  1N73 B;  1FZE A;  4WB4 A;  1L0N E;  2IFN A;  3P8C D;  1DH3 A;  2A45 G;  4HYT B;  1ZRT E;  5B5E E;  1FDM A;  1FAV A;  2RH0 A;  3CCJ P;  1P84 E;  1M57 D;  2M5A B;  3AE4 C;  1AV1 A;  3OJA B;  4YTP C;  2HOD B;  1L4A B;  2RN0 A;  3O8Z A;  3UIA A;  2ZFC A;  3H1J J;  1VQ8 P;  1OVR A;  2Z5I A;  4WBA A;  3TGU D;  1EDL A;  1SQB J;  2Y9Y A;  3I56 P;  3BCC J;  1VQN P;  1JCD A;  1U57 A;  1KTM A;  3L73 E;  3S4R A;  1KN7 A;  1IFN A;  1NTZ E;  3CL3 D;  1IFM A;  1KC8 Q;  2Y9Z A;  1AQT A;  3FX0 A;  5AVV B;  3L70 G;  1KYO E;  2FFD A;  1BCC J;  2WVR A;  4K3A A;  3V2R A;  4D6T D;  4DOJ A;  5AW6 B;  2OYI A;  5CCG C;  1SFC C;  3OW2 O;  1XTG B;  2FYN B;  3FWN A;  2ZVO B;  4JQ0 D;  1EXJ A;  3KDP B;  3CXH H;  5DJU B;  4HJG H;  5BVZ A;  1FZC B;  4C46 A;  2QJK C;  3WU2 H;  4DJG A;  2HLO A;  5E79 H;  4YXW H;  4GOD A;  2O01 J;  4HH2 A;  4EI2 A;  3R2P A;  1ZR2 A;  1DEE G;  2N1T A;  5AW3 B;  3VMZ A;  1AJY A;  4WWI A;  1KD1 Q;  1LTJ B;  2QM7 A;  3A0B H;  2WSE H;  1Q82 Q;  4BRY B;  3FXE A;  3CC4 P;  2ZT9 C;  5CHX A;  2ZVN B;  4PD4 E;  1LTT C;  2RMZ A;  5B66 E;  2N1T B;  4EYY Q;  2H88 C;  1FZB A;  2HYN A;  3JC2 2;  3D6Y A;  1VQO P;  2WWW A;  4IL6 H;  1QX8 A;  1PGJ A;  3CC2 P;  1GL2 D;  2ZYD A;  3AEE C;  1SQQ G;  2P7J A;  4PV1 D;  1L0N G;  3QWO C;  2NZ2 A;  5TIS E;  3I55 P;  1M1K Q;  1LTI C;  1IFP A;  1LJ2 A;  2YMY A;  3L70 D;  1LGH B;  1RE4 A;  1NTZ G;  4H13 B;  1BDD A;  1BCC D;  1SQV G;  4UB8 H;  1HF9 A;  2MKV A;  1PPJ G;  1KMI Z;  3SWK A;  4UB8 E;  3KYQ A;  3RGU A;  2WSF J;  1SQP K;  4BXL A;  1EQ7 A;  2E76 B;  1WRG A;  4I7Z B;  2AEJ A;  4K35 A;  2OTJ P;  1EZV I;  2XND H;  2GA1 A;  3TGU J;  3M0D A;  1LTJ A;  3M06 A;  2H89 C;  3QH9 A;  4JYB A;  1VQ6 P;  3A2A A;  4NPE A;  1EC5 A;  1YYC A;  4H44 C;  2HOD A;  2V7Q J;  1ZLL A;  1GW4 A;  1IK9 A;  1E5W A;  4U3F D;  5H2F E;  3V2Q A;  1S72 P;  1NTM J;  1KV4 A;  2GUS A;  1LTS C;  3TK1 A;  3L75 G;  2WSS H;  1EDI A;  1RHZ B;  5AW1 B;  1S3J A;  3MZW B;  5APY A;  4YXD C;  3CX5 H;  1M56 D;  5KTB A;  3FGA D;  2C0W A;  5AW8 B;  1N73 A;  2YKP A;  3GHG B;  2Y0E A;  1SQP J;  3L35 A;  2OYI B;  3H1L J;  3LID A;  3WUU A;  3LIE A;  2FFD B;  1HWT C;  2NRG A;  5E79 E;  5KLV G;  1WT6 A;  3HTK A;  4PD4 I;  1OVU A;  2A06 G;  3JSV C;  4OGQ B;  2WPR A;  1A02 F;  2QJK B;  3VMA A;  5APS A;  1S5L H;  3AE2 C;  5CJ4 A;  2JDI H;  1GMJ A;  1L4A A;  1KIL D;  1NOH A;  2JP3 A;  2K37 A;  1KQF B;  3CC7 P;  1BGY G;  3CX5 D;  5KLI C;  4GOF A;  5KAI H;  3B5N B;  2BEQ D;  2ZXE B;  4GDO A;  1JY3 O;  1KIL E;  1L2P A;  1LT9 C;  2E5Y A;  1FE6 A;  3P8M C;  4LLH A;  4ASW A;  5CCG A;  1FOS E;  2C9N Y;  1X22 A;  2Q1K A;  2WT7 B;  1HTL C;  5AVT B;  3AE9 C;  1S9K D;  1KIL B;  1NKZ B;  2AXT H;  2JR8 A;  2IZ1 A;  4U3F J;  5APT A;  1T2K C;  1GTW A;  1JNM A;  1NYH A;  3WMM 0;  1MFT A;  1R5L A;  2P10 A;  1SP4 A;  1N73 C;  1MV8 A;  4KHX A;  3BRT B;  1YQ3 C;  2YO2 A;  5AW2 B;  5CCH C;  1Q81 Q;  3CCE P;  1L0L D;  2B87 A;  2JWD A;  1BE3 G;  3AEF C;  3FXD A;  1GU5 A;  3CWB D;  3JCU H;  5TIS H;  4PV1 B;  2P1J A;  2D2C B;  4PD4 D;  4H44 D;  1VQP P;  3CCL P;  3Q2Y A;  1LT9 B;  2NPS A;  2PAJ A;  3A3Y B;  3RK2 B;  2E75 B;  1DD3 A;  2E75 D;  2QG4 A;  1DX7 A;  1JCC A;  1P84 H;  2UWJ E;  1KZU B;  3L70 J;  4I1L A;  2BCC D;  2AXC A;  2QSI A;  3H32 A;  1KB9 E;  4XE5 B;  4Y99 B;  5AVZ B;  4B86 A;  4C7N B;  3C8V A;  3CCR P;  1GZL A;  1PP9 E;  5AVX B;  3IN6 A;  1QLE D;  2HFE D;  2KYV A;  1PL5 A;  1JEK A;  1BCC G;  1SQV D;  3G6E P;  1HGZ A;  3L71 J;  3RK3 D;  1IZN B;  1J1E B;  2CPS A;  2FXO A;  2W27 A;  2OTL P;  2FYN C;  2WSF H;  1DIP A;  2IX7 C;  1J2J B;  1OW6 A;  3O6Q A;  4C7R A;  1VQ5 P;  1RF1 B;  3MP7 B;  1BGY E;  1NTK K;  1JTH A;  1UIX A;  2B9B A;  3LW5 H;  3CXH D;  3EFG A;  2KUB A;  1N2D C;  3AEA C;  3CXH E;  3L74 G;  3GLM A;  1AVY A;  1X9V A;  1U7J A;  1OWA A;  2QE7 H;  2R5D A;  2YKO A;  1CZQ A;  2YO3 A;  3MIW A;  2IZ0 A;  3VP9 A;  2YIU C;  3BAS A;  3CCU P;  2ZYG A;  2H7H A;  3HRN A;  1SQQ K;  2E74 B;  1FS0 E;  2SPZ A;  1EZV E;  1FU1 A;  3AE6 C;  1K05 A;  4ASV A;  2E43 A;  3PLN A;  1OVV A;  1J1E C;  4R4L A;  2AXT E;  1FDI A;  3L75 E;  2E76 D;  3H1H E;  3H6P A;  1JY2 O;  3EWK A;  3EQ2 A;  3G3Z A;  1YHQ P;  4L76 A;  3TF5 A;  4HB1 A;  1RE3 C;  1KFM A;  3PP5 A;  3D71 A;  3L75 D;  3MGN A;  3E7K A;  1JM0 A;  4OH8 B;  2Q7C A;  1JMM A;  2YXQ B;  4XFJ A;  2OYO A;  2Q9I A;  1GL2 A;  1T6A A;  4TT3 H;  2KNC B;  3MUD A;  5KAF E;  1HBW A;  1M1J B;  2A06 D;  1IJD B;  3RK3 B;  1OIP A;  2E76 C;  5KAF H;  1VQ7 P;  4NPF X;  4OVN F;  1SFC D;  2KNC A;  5KLV D;  3RBZ A;  1JOC A;  1HGV A;  1JY3 P;  2M8R A;  3L73 D;  3RL0 D;  4L74 A;  1GU4 A;  3WU2 E;  1PP9 G;  1LTG C;  3TGU E;  4ZKP A;  2Z4E A;  1H0T A;  3CI9 A;  2K9J B;  3CX5 I;  4XA4 A;  3H1J G;  2HR3 A;  3B5N D;  4JF7 A;  3RK2 D;  3CWB J;  1NTZ D;  3BCC D;  3PTZ A;  3BCC G;  5KKZ B;  1S9K E;  5KJ7 A;  2NPS C;  1IO4 A;  1USE A;  3C1L A;  3E1I A;  3H1K J;  4PD4 H;  1W2B O;  2W6A A;  1SQV K;  3H1J D;  4KT0 J;  3TNU A;  1H0T B;  1H88 A;  1HJB A;  1HJ0 A;  3SWF A;  3B5N C;  3HD7 A;  1M1J A;  2A45 I;  2YKQ A;  5AVU B;  1BGY J;  2R3S A;  1BE3 E;  1JTH B;  5AVR B;  5B5E H;  1TU3 F;  2QVA A;  1IFI A;  1Q2N A;  1L0N K;  2QIW A;  2WQY C;  3HUS C;  5C39 A;  4DZO A;  2LXC B;  4DCK A;  3ABV C;  1PFI A;  3P32 A;  4Y28 J;  4PJ0 E;  4CPG A;  1SS1 A;  2K9Y A;  3BVH A;  1SQQ D;  2BCC E;  5AVY B;  3NXS A;  2FYU J;  5AW4 B;  1GK4 A;  3H1I E;  1KOR A;  3G71 P;  2HPC B;  2O01 N;  1AQ5 A;  3CXH I;  4HKZ H;  1SQQ E;  1YJN P;  3CME P;  5APX A;  1CW5 A;  2FXP A;  2QJY B;  4IFF A;  1RE4 C;  1VDF A;  2Y0D A;  1BCC E;  1AVO A;  3C9I A;  3LW5 J;  1LT9 A;  2Z5H A;  1IC2 A;  1N7S D;  2I1K A;  1NTZ J;  3OAK A;  3AEB C;  3CD6 P;  3TGU G;  4ZMD A;  1S2E A;  2P67 A;  2YXR B;  3D70 A;  1NTK G;  1R8E A;  3IFM A;  2LXB A;  3H1J E;  1S4X A;  3Q1M A;  2OYH A;  3L74 E;  3OA7 A;  4KJM A;  1QEX A;  2J58 A;  2O3J A;  2H8P D;  3H1K G;  4U3F E;  2AEM A;  4W7Y A;  1SLQ A;  1BDC A;  3PJS K;  2Q3E A;  1RE3 A;  3H1K D;  3GW6 A;  3VOP A;  4RJT A;  3GF7 A;  1L0N D;  2PRR A;  1EZV G;  1A02 J;  3H1L G;  1G1I A;  2WTY A;  1USD A;  1NU1 J;  2KSJ A;  2I1J A;  3M0D C;  3VTP C;  2XNX A;  1Y9B A;  3CCS P;  5CBN A;  1NVO A;  2NPS B;  2WPQ A;  2FXM A;  2KZJ A;  5GTH H;  3KXD A;  1HUC A;  5DJT B;  1ZRT D;  3W67 A;  5GTH E;  5KLV E;  3D6Z A;  4IFD K;  1RF1 C;  2E74 D;  5GTI E;  1N8R Q;  4H13 D;  3Q5P A;  2A06 E;  3L72 J;  4I7Z C;  3VYI A;  2C9L Y;  2M3B A;  1SFC B;  2WPS A;  2FYU E;  3H1I G;  1LP1 B;  1ZN5 A;  3HTK B;  2R5B A;  3KHU A;  3HE4 B;  1NTK E;  5M1B A;  1VQL P;  4UB6 H;  1JY3 N;  1VF5 B;  3ZDM A;  2BAS A;  2AEF A; 
#chains in the Genus database with same CATH homology
 1BGY J;  3L71 J;  2BCC J;  3L74 J;  1BE3 J;  1L0N J;  1NTM J;  1PP9 J;  1KYO I;  3H1H J;  4U3F J;  1NU1 J;  2FYU J;  3H1J J;  1P84 I;  1SQP J;  1SQB J;  3CXH I;  3H1L J;  3BCC J;  3CX5 I;  1NTK J;  1SQV J;  4PD4 I;  2IBZ I;  3L75 J;  1SQQ J;  3CWB J;  4D6T J;  3L73 J;  3L72 J;  3H1I J;  1BCC J;  3H1K J;  1NTZ J;  3L70 J;  5KLV J;  1EZV I;  1KB9 I;  1L0L J;  1SQX J;  3TGU J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...