3T97A

Molecular architecture of the transport channel of the nuclear pore complex: nup62/nup54
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
56
structure length
56
Chain Sequence
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular architecture of the transport channel of the nuclear pore complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup54
total genus 25
structure length 56
sequence length 56
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3t97A00
1J2JB 1CZQA 3O8ZA 2QM7A 1GU5A 2C9LY 1HJBA 1HWTC 2WPQA 2WT7B 1X8YA 3M0AA 1SP4A 1HBWA 5AW3B 3I5CA 2WTYA 2WWWA 3TNUB 2YO2A 3LIEA 1G2CB 3TK1A 3V4QA 2WPSA 3IR9A 3NXSA 3KQGA 1A02F 4I2LC 5AVZB 3KDPB 2WT7A 5APTA 2C9NY 3P32A 1FOSF 2JJLA 3MGNA 1HUCA 4C7NA 5AW4B 3M9BA 5AVSB 1OWAA 3VMYA 4I6MC 4AQRD 5AW9B 4C7NB 5AW8B 2R5DA 3P7KA 1JNMA 2W6AA 1MFZA 1GK6A 5AVQB 2E43A 3M91A 4AYCA 3A3YB 2Z5HA 3L35A 4HYTB 3V4WA 3SWFA 5AVRB 3TNUA 1H8AA 2P7JA 2ZXEB 5AW0B 3HE4A 3HE5A 5APYA 1GTWA 2XU6A 1GU4A 5AW2B 2Q5UA 2P2UA 3TYYA 4GT1A 1S9KE 3A5TA 3P8MC 4AUWA 2VRSA 3VN0A 5AW5B 1GK4A 3HTKA 3L37A 5APUA 5APWA 1S9KD 2P67A 3OAKA 2BASA 4KHXA 1NWQA 2YNYA 5AW1B 4RESB 1MV8A 4C46A 1CSBA 1GD2E 1CI6A 3VMZA 1A02J 3A2AA 2H7HA 1CI6B 5AVTB 2R3CA 1NAFA 5CMZA 3V5BA 1GZLA 3M9HA 4LC1A 4JYBA 1T2KD 1FAVA 3UIAA 2KP8A 5APSA 1JUNA 5AVWB 5AW7B 3NFQA 4M3LA 2R32A 3VYIA 5AVUB 3L36A 5APVA 3B8EB 3HE5B 2YO3A 1MUUA 2XV5A 3HE4B 4EOTA 3VTPC 1KQLA 3LIDA 3M0DA 1YYCA 3M06A 1FOSE 3A7OA 5AVXB 3MD0A 2QM8A 2XZRA 4JYCA 3T97A 2W27A 2N9BA 3NTNA 2WPRA 5AVYB 4XE5B 5AW6B 4DZOA 3VMXA 4B86A 1DH3A 5AVVB 2IPPA 4GKGA 5APQA 1SLQA 2R5BA 5APXA 2Q7CA 1H88A 2Q3IA 1T2KC 1H89A 1OXZA 2Z5IA 2E42A 1IO4A 3NMDA 2ZFCA
chains in the Genus database with same CATH superfamily
2FKWB 3H1IJ 3O8ZA 1BDDA 1SQBE 4WB4A 2QM7A 1L0LJ 1RF1C 1BE3D 3RK3B 1HF9A 3I55P 2HG5D 2E76B 1HWTC 1NOHA 1SP4A 1USDA 1GL2C 1SQVJ 2CPSA 3L74G 3CI9A 3II6A 2J5UA 5E79H 5AW3B 3CCRP 1M7LA 5K5GB 1K73Q 1G2CA 3L70G 3L74J 3O6QA 2FYUD 3L71E 1OZHA 1PPJG 2WPVB 4Y99B 3TNUB 4XFJA 1SQBK 2WSCH 3LIEA 3AEFC 1YTZT 2Q3EA 3TK1A 3V4QA 4DCKA 3KQGA 1SQQE 5CJ0A 4PV1C 1JEKA 1LT9C 2UWJE 3KDPB 3WUTA 4DJGA 4MN4C 4DOJA 4JYCA 1SFCD 1FJPA 2C9NY 1RE4C 1BE3J 4OGQB 1RQUA 1L4AC 5TJHA 4C7NA 4JF7A 3L70E 1L4AB 5AW4B 2A45G 3RL0D 5KLVG 1Q7YQ 1AQ5A 2D2CC 4I6MC 4GDOA 4WWIA 1L0NG 1N7SB 3RL0C 4A7PA 1FZGA 5AW8B 5B5EE 1BDCA 3RL0g 2FYNB 2YMYA 4KT0J 2W6AA 1S1CX 3RK2C 1MFZA 1GK6A 1AVOA 2FYNC 3GHGA 1RY3A 1UIXA 2WSFJ 3H1JG 4PJ0E 2PRRA 4W7YA 3CCMP 2O1KA 3CCEP 3EFGA 3M91A 2O01J 5EFWB 5KJ7C 3A3YB 2IBZI 3WU2H 2RKLA 2SPZA 3HD7D 3JSVC 3SWFA 5AVRB 3H1LD 2P7JA 3VOPA 4RKUJ 1S5LE 1KILE 1KV4A 3HE5A 3KYQA 3CX5E 3SWYA 2E76D 2XU6A 3L72D 5BU5A 1KYOD 3D6ZA 1GTWA 4U3FE 1GU4A 2GA1A 2P2UA 3IFMA 3RK3C 3TYYA 1W2BO 4U7JA 2FFDB 2YMKA 3P8CE 4BRYB 3A5TA 3W67A 2KXPB 1X22A 1JOCA 1GK4A 2PAJA 4WY4C 3HTKA 5AW5B 1Y47A 1NTMK 2GUSA 2LXCB 3MHVA 3R4YA 3AEDC 2FXOA 5APUA 5M1BA 2BASA 1Q86Q 2FXPA 5AW1B 2XKMA 4D6TJ 1BCCG 1W5CE 1OVUA 2GM4A 3L74D 3A0BH 1NYHA 1H0TA 1BGYD 2YKPA 2OYIB 1A02J 1N2DC 2KYVA 5DJTB 1JM0A 1WMKA 3A0HE 2CK3H 2QG4A 5AVTB 2HPCB 1NTME 1SFCA 2IYPA 1FE6A 1JY3O 1EZVG 1NHLA 2ZYAA 3VP8A 4IFFA 4JQ0D 4N78D 3H1HD 4PD4D 3RBZA 3IAOA 2QJPB 1FZFA 2IX7C 3KXDA 1BCCJ 1PZQA 2B88A 2D2CB 4H0LD 1EDKA 2B89A 3T97B 2HFED 3GF3A 2OYHA 1OW6A 5CJ4A 2FYZA 4HJGH 4NPFX 4WY4B 5CCHC 4N6JA 2OTJP 4D6TD 1VF5C 1K9MQ 3HE4B 2B87A 3KZIE 1PGQA 3RK3E 3WMM0 2A06D 2BCCE 1NTKJ 1ZN5A 1L0LK 2M5AA 3TSIA 1N86A 2H89C 5GTHH 3S4RA 4WVZA 2YXQB 3M06A 4UB8E 3H1HG 1LJ2A 3LW5J 1EXIA 2K3RA 1NU1K 5E79E 1PP9J 2HLOA 5AVXB 3BCCE 1LTGC 2AEJA 1JY2O 2NPSD 1SQXK 2Y0DA 1BSNA 1L0LD 1BCCD 3BCCG 3M9QA 1FZAA 3BCCJ 4Y28J 1YHQP 2WPRA 1PP9E 3ZDMA 4R4LA 2HR3A 1KYOH 1YQ3C 1KMIZ 3AE3C 3MIWA 3SFDC 2I8DA 5KLVK 4DZOA 3VMXA 4HH2A 4B86A 1ZXGA 1SQXD 2H43A 4LLHA 1YJ9P 5AVVB 2BCCJ 2A45I 2JO1A 3F89A 5APXA 3GW6A 1RF0A 1H88A 1DX7A 3CCQP 1NTMG 2JKVA 3EFFK 2E42A 5CHXA 1Q90D 2Z4EA 5AVQB 1XTGB 2O01H 3HD7B 4H0LB 1FU1A 2K9JA 3Q2YA 1J2JB 1CZQA 3E1RA 1USEA 3H1KD 1Q82Q 3G6EP 2C9LY 3GF7A 1BCCE 1FS0E 2QJPC 3U59A 2I1KA 3PH0A 2XDJA 1NVOA 2WPQA 5DJUB 4N78E 3RK2B 1EZVD 1LNQA 1QLED 3H6PA 3SSUA 2E75C 1OFCX 1AQTA 3I5CA 1SQVG 3C1LA 2E74D 1M1JB 2ZYDA 1PV3A 1J1EC 5GTHE 2MJZA 1K05A 2KS1A 2E74C 1P84I 2KSEA 1JY3N 1IC2A 1YQ4C 1LTJC 2KZIA 2QVAA 5KKZC 1NO4A 3IR9A 3CC2P 3PHLA 2OYOA 1LWUC 1M57D 4D6TE 4EDFA 4I2LC 5AVZB 1A02F 1EDJA 3Q3DA 3VMAA 2WT7A 1K04A 3H1KJ 1ZMEC 1JCDA 3BRVB 1U7JA 3P32A 3RK3D 1KB9D 2CPBA 1KZUB 1KILB 3B5NA 1FOSF 1RH5B 2M0BA 3M9BA 1KFMA 1OWAA 3CXHI 3VMYA 4U3FJ 2PP6A 1SQQK 1EC5A 1JY3P 2XNDH 3L70D 3CC4P 2R5DA 1JMBA 5CBOA 1JNMA 1S2EA 3BCCD 1AJYA 1P84H 1RE3A 1LT9B 1N7LA 4AYCA 2Y0EA 1OX3A 3RK2D 4C7RA 1J1EB 2Z5HA 1SQQD 3L35A 1URQA 3FXEA 4HYTB 3V4WA 1EXJA 3TDKA 2KS1B 4CPGA 1VQ7P 2ZT9C 1LTSC 3H1ID 3HE4A 2HYNA 2ZYGA 3GMAA 3N7NA 2ZVNB 4D6TG 3RL0B 3Q5RA 3H1HE 4PD4E 3U1CA 1L0ND 2Q5UA 3AECC 3PLNA 1L2PA 4GT1A 1T3UA 2E76C 3L70J 2JR8A 1Q81Q 1KQSO 3TGUE 4QMAA 1LTAC 1DD4A 4BWNA 1HH0A 3H25A 4H13B 5APWA 3HD7A 3JCUE 4ZKPA 3G71P 3L73E 1NWQA 1Y8AA 3G9RA 2YNYA 3OA7A 3PRJA 4EYYQ 1GMJA 1NKNA 1SQQJ 1JY2N 2BEZF 2Y0CA 3MZWB 1OW7A 3H1IG 4GODA 2Q1KA 3I56P 1NTZD 3L71J 1FC2C 1PPJD 2AXTH 2FYUG 2H7HA 3L74E 1E5WA 2FYUE 2KNCB 2IBZD 3L75E 4PD4H 2LR2A 2O01N 1NAFA 3W68A 3KZIH 2G3AA 3PTZA 5CMZA 1T6AA 1NTZG 1R5SA 3V5BA 1VQ9P 1NTZK 1OVVA 3G3ZA 2ZVOB 4YTPC 2KNCA 2QIWA 1GDTA 3H1IE 3L4FA 1YI2P 3S1KA 3H1JE 3QWOC 4Z1MH 2A06G 2IFNA 1SQPJ 2FYUK 2L5GB 3E1IA 4PV1B 5APSA 5CBNA 2KLUA 5AW7B 3NFQA 1IFDA 3AE9C 2R32A 2K37A 3CLQA 3L72E 3L72G 4UB8H 5KLVD 1SQXJ 1VDFA 1QL2A 2M5AB 2ITAA 3FXDA 3HE5B 4H13D 4EOTA 1M1JA 1NTZE 3VTPC 1FZCC 3HD7C 3D70A 3LIDA 1VQPP 1JCCA 1YYCA 1ZV8A 3AEEC 1L4AD 4W80A 1VQNP 1ZLLA 2OYHB 3A7OA 3A0HH 2OTLP 4L75A 1BSHA 4L76A 3T97A 2W27A 2N9BA 3A0BE 2K9JB 4R4MA 5KLIB 3CXHD 4H13C 1L4AA 3L75D 4Y99C 5AW6B 1URQB 5GTIE 1RE4A 2P10A 3U1AA 5KLVJ 2HPCA 2WSCJ 4ASVA 1LT9A 3CWBD 1DD3A 2IPPA 1RE3C 3JC22 1SQXE 2Q7CA 4PV1D 2W83C 2Q3IA 1H89A 3L73D 1OXZA 2C0XA 2Z5IA 1SQPE 1NU1J 2IZ1A 1IFPA 2NZ2A 3H1JJ 3R2PA 3CWBG 2QRXA 3S9OA 5KJ7D 1IFJA 1S3JA 2QJYB 2E5YA 1KILA 2KI7B 3B5NB 3CXHH 2IZ0A 1YJWP 3CCUP 1GU5A 1HJBA 1FZBA 1U7MA 2WSEJ 3MP7B 2WT7B 1QVGO 4KJMA 4OGQC 3M0AA 3GG2A 5GTIH 1HBWA 3L75J 1K8AQ 1NKZB 4PJ0H 1BE3G 2WSFH 3CX5D 1SQPK 2FYUJ 1J1DC 3L75G 1Q2NA 4PD4I 4ZNCA 1KQFB 5KAIH 5B5EH 2WTYA 2R44A 1PPJE 1LTTC 2B87B 1NTKD 2YO2A 3AEBC 5C39A 5H2FH 2XNXA 3WUVA 1NAYA 2N1TC 3BATA 1YTZI 3MTUE 4WY4A 3L73J 1P84E 1NU1G 3ABVC 3V6IA 3GLMA 3TGUJ 4UB6E 3WUUA 1PL5A 3TF5A 3G4SP 1PP9G 5AVSB 3AE6C 2ZT9D 3B4SA 1LT1A 5AW9B 4AQRD 2OGUA 3H1HJ 2FY8A 3IF4A 4OH8B 4C7NB 1EDLA 1RQVA 1PGJA 2HODB 2LKMA 2Y9YA 1URQC 3AEGC 2KIKA 1RF0C 2IDBA 3FGAD 1H0TB 1QEXA 1IK9A 3GHGC 1IK7A 3TGUG 4YXWH 3Q5SA 3H1LJ 2ZFCA 3TNUA 1AV1A 1H8AA 5AW0B 3CWBE 1GW3A 1LGHB 2JDIH 5APYA 3SFEC 3TGUD 5KLIC 1VF5D 4TT3H 3CCSP 2O3JA 3MUDC 1FDOA 1RHZB 3B5NC 1FBMA 2W8ZA 1AA0A 2FFDA 3SWKA 3VN0A 3PJSK 2B9BA 1R5LA 2RH0A 3H1KE 4WBAA 4JBZA 1S9KD 2P67A 1N7SC 1EQ7A 3OAKA 4KHXA 1KFNA 1PIXA 1DEBA 1QL1A 3EWKA 3WU2E 4RJTA 1VQ5P 3E7KA 2J58A 1MV8A 2IBZE 4WY4D 1CSBA 1LTJB 2GUVA 5KKZB 1GD2E 1CI6A 1NJIQ 5CCHA 3A2AA 3CX5H 3GHGB 1KYOI 2AXCA 1FDIA 1GL2A 3HRNA 3Q5PA 2E5TA 2OYHC 5TISE 2R3CA 2Q9IA 1N7SA 1VQOP 1X0TA 2ZJSE 1ZRTD 2YKOA 4K3AA 2K1AA 2WMMA 3FWNA 5BU8B 1ZR2A 4U3FD 1SFCB 1T8ZA 5B66H 3CCJP 1DIPA 1S4XA 2ZXXA 1T2KD 1GL2D 3C8VA 1FAVA 4JYBA 2ZAEB 5CCGD 1KB9E 3CMEP 3UIAA 5CCGC 2OTKE 3MUDA 3N4XA 1HGZA 4JPZB 5AVWB 1MZ9A 1T3JA 2FBWC 4IL6E 4M3LA 5H2FE 1JUNA 5AVUB 2YIUB 4IOIH 4N3YB 3B8EB 5APVA 2YO3A 3CC7P 2XV5A 1QVFO 4OWFA 4EIJA 4GOEA 2P1JA 2E75D 1BGYE 3HTKB 4BXLA 1E79H 3M0DA 1HGVA 2J59M 4U3FG 4YPCA 2KK7A 1L0NJ 3QH9A 2AEMA 3V2RA 4BRYA 2NRGA 1NTKK 1FOSE 2M8RA 2L91A 4L73A 1KTMA 2M3EA 3H1LG 2AXTE 3HUSC 3MD0A 5B66E 2XZRA 2QE7H 2QJKB 3IN6A 4L74A 1R8EA 3NTNA 2YKQA 3H1KG 1EZVE 1VL2A 4H0LC 4LGDE 1N73C 1MKMA 4ZKUA 2KLVA 2RN0A 5BVZA 1RF1B 1L0NE 3V2NA 1JY2P 1N8RQ 2ZT9B 2YXRB 3JCUH 1NTMD 1BGYJ 1D7MA 4IL6X 1NTKE 2NPSA 5CCHD 4ZMDA 2N1TB 1JB0J 2QEXP 4OGQD 2YIUC 3KHUA 1VF5B 2PGDA 1G1JA 4YXDC 3OJAB 1KC8Q 2OYIA 2DW3A 2OQQA 3P8CD 1LP1B 1WT6A 2FXMA 1IO4A 3NMDA 3L71G 1L0NK 2WITA 1CW5A 1N7SD 1N73B 4XA4A 1LWUB 2V4HA 5CCGA 2IBZG 2R3SA 2KSJA 1SFCC 2V7QJ 4HKZH 3RBXA 4IFDK 1LTIC 1X8YA 1SQXG 2RMZA 4NPEA 1NTMJ 2IFMA 2JEEA 3CPWO 1LWUA 2IYOA 4I1LA 3CCLP 1JTHB 2K9YA 3C9IA 3D6YA 2WWWA 3D71A 2OYIC 1XTCC 2POHA 2I1JA 1LP1A 1SS1A 1G2CB 3O6QB 1X9VA 3BRTB 2WPSA 2Q6QA 5L8RJ 3AE7C 3NXSA 1NGMB 2QJYC 5KAFH 1VQ6P 2N9YB 4UB6H 3CMAP 1PP9D 1KB9H 1FDMA 1AVYA 5APTA 1FJKA 5KAFE 3BVHA 2N1TD 2P58A 4W7ZA 3H32B 1IFIA 1JO5A 2WQYC 4O9BA 4NPDA 2JJLA 3V2PA 1KORA 1HUCA 2WSEH 3BASA 3MGNA 4IFMA 1X79B 3ITKA 3CD6P 1J1DB 2FFDC 3PP5A 4GIFA 2E74B 1YIJP 1EDIA 1SQQG 2WVRA 3P7KA 1HVVA 1NTKG 3H32A 1OMIA 4H44D 3CWBJ 5TISH 2E75B 2JWDA 1ZRTE 4H44C 2V7QH 3H1LE 1DEEG 1FZCA 3OW2O 2E43A 3CX5I 2W90A 1M1JC 3AEAC 2G8YA 3HUSB 1KB9I 2ZXEB 3H1JD 3V2QA 1M56D 1TU3F 1BGYG 1NH4A 3VP9A 1VQ8P 1W2EA 5AW2B 3B71A 1YBKA 2QJKC 1YITP 1JMMA 1S9KE 1S72P 1URQD 1G1IA 1M1KQ 3P8MC 4AUWA 1SQBD 2VRSA 2M3BA 4TLFA 5KTBA 1HTLC 2QA4P 1BE3E 2PFXA 3Q1MA 2D2CD 1Z56A 3L37A 3L73G 3K5BA 2H8PD 2A45H 2WSSH 4RESB 4C46A 3AE5C 1M8OB 1YJNP 1HJ0A 2MKVA 3USSA 2QSIA 2A06E 2BCCD 2N1TA 3VMZA 1ZR4A 1WRGA 2NPSB 1CI6B 1MFTA 3LW5H 3B5ND 1GW4A 3AE1C 1PGPA 2JP3A 2KOGA 1SQVE 2H88C 1ZP0C 1U57A 2JWAA 1RF1A 1ZW0A 1GZLA 1KYOE 2BCCG 1OIPA 1AFOA 1SQVD 1VQMP 3M9HA 4IL6H 1L0LE 2K88A 2WZ7A 3FX0A 1KQGB 1P84D 1KILD 1IZNB 1SQBJ 4LC1A 4ASWA 4DT0A 1PFIA 1SQPD 2BEQD 1KILC 1NU1E 2AEFA 2KP8A 3CL3D 2Y9ZA 1VPCA 3AE4C 1SQVK 2O1JA 3FWLA 3VYIA 3L36A 1OW8A 1MUUA 1SVFA 2KUBA 5KAIE 1VQKP 1QGKB 1JTHA 1KQLA 1FZEA 1SQBG 1L0LG 5KLVE 4RO0A 2NPSC 4OVNF 3RGUA 2C0WA 1ZOYC 3CXHE 3EQ2A 2OARA 3AE8C 1S5LX 2QM8A 1IFNA 2HODA 3F5HA 4I7ZB 3KPEA 4I7ZC 4H44B 1QX8A 1IJDB 2LXBA 1KD1Q 5AVYB 1N73A 4XE5B 1VQLP 1PGOA 3HUSA 4HB1A 1UIIA 2KZJA 4K35A 1DH3A 2W6JH 1FZCB 4EI2A 1EZVI 1GL2B 1NTZJ 3L71D 5KJ7A 3M0DC 1Y9BA 3AE2C 4GKGA 4GOFA 1SLQA 2R5BA 5APQA 3CCVP 1LTJA 1T2KC 3L72J 2W6BA 1VQ4P 1KN7A 1LTBC 1NU1D 2KB7P 1S5LH 1M90Q 1SQPG 1IFMA 1OVRA
chains in the Genus database with same CATH topology
2FKWB 3O8ZA 4WB4A 2QM7A 1RF1C 3RK3B 2HG5D 1HWTC 1NOHA 1SP4A 1GL2C 2CPSA 5AW3B 3CI9A 3II6A 1M7LA 1G2CA 4Y99B 3TNUB 1SQBK 2WSCH 3LIEA 3TK1A 1YTZT 3V4QA 3KQGA 5CJ0A 4DOJA 1LT9C 3KDPB 1FJPA 1SFCD 2C9NY 1RE4C 1L4AC 4C7NA 4JF7A 1L4AB 5AW4B 2A45G 3RL0D 1AQ5A 4I6MC 3RL0C 1N7SB 1FZGA 5AW8B 2YMYA 2W6AA 3RK2C 1MFZA 1GK6A 5AVQB 3GHGA 1RY3A 4W7YA 2O1KA 3EFGA 3M91A 5KJ7C 3A3YB 3HD7D 3SWFA 5AVRB 2P7JA 3VOPA 3HE5A 3KYQA 3SWYA 1GTWA 2XU6A 5BU5A 1GU4A 3BVHA 2FFDB 3IFMA 2P2UA 3RK3C 3TYYA 3P8CE 3A5TA 2PAJA 1JOCA 1GK4A 5AW5B 4WY4C 3HTKA 1NTMK 2GUSA 5APUA 2BASA 5AW1B 2XKMA 2GM4A 2YKPA 1A02J 1N2DC 2KYVA 5AVTB 2HPCB 1SFCA 1JY3O 1NHLA 3VP8A 1FZFA 4IFFA 2Z4EA 4N78D 2IX7C 2HFED 2OYHA 5CJ4A 2FYZA 4WY4B 5CCHC 4N6JA 3HE4B 3WMM0 1ZN5A 1L0LK 3TSIA 1N86A 3M06A 1NU1K 2HLOA 5AVXB 1LTGC 2NPSD 1JY2O 4JYCA 1SQXK 3M9QA 1FZAA 2WPRA 3MIWA 5KLVK 4DZOA 3VMXA 4HH2A 4B86A 2H43A 4LLHA 5AVVB 2A45I 5APXA 1RF0A 1H88A 1DX7A 2E42A 5CHXA 2O01H 3HD7B 1XTGB 1FU1A 1J2JB 1CZQA 2C9LY 3U59A 2I1KA 2XDJA 2WPQA 4N78E 3RK2B 3H6PA 3I5CA 1M1JB 1J1EC 2MJZA 1JY3N 1IC2A 1LTJC 1NO4A 3IR9A 1LWUC 1A02F 4I2LC 5AVZB 2WT7A 1JCDA 3BRVB 3P32A 3RK3D 2CPBA 1KZUB 1KILB 3B5NA 1FOSF 3M9BA 1KFMA 1OWAA 3VMYA 2PP6A 1SQQK 1JY3P 2R5DA 1JNMA 1RE3A 1LT9B 1N7LA 4AYCA 3RK2D 4C7RA 1J1EB 2Z5HA 3L35A 4HYTB 1URQA 3V4WA 1LTSC 3HE4A 2HYNA 3N7NA 3RL0B 3U1CA 2Q5UA 4GT1A 1T3UA 1LTAC 1HH0A 5APWA 3HD7A 4ZKPA 1NWQA 2YNYA 3OA7A 1NKNA 4W80A 1JY2N 2H7HA 1E5WA 1NAFA 5CMZA 3V5BA 1NTZK 3G3ZA 1GDTA 3L4FA 2IFNA 2FYUK 2L5GB 3E1IA 5APSA 5AW7B 3NFQA 1IFDA 2R32A 3CLQA 1VDFA 1QL2A 3HE5B 4EOTA 1M1JA 3VTPC 1FZCC 3HD7C 3LIDA 1JCCA 1YYCA 1ZV8A 1L4AD 1ZLLA 2OYHB 3A7OA 3T97A 2W27A 2N9BA 5AW6B 1L4AA 4Y99C 1URQB 1RE4A 2HPCA 3U1AA 1LT9A 2IPPA 1RE3C 2Q7CA 2Q3IA 1H89A 1OXZA 2C0XA 2Z5IA 3R2PA 5KJ7D 1IFJA 1GU5A 1KILA 3B5NB 1HJBA 1FZBA 2WT7B 3M0AA 1HBWA 1NKZB 2WSFH 1SQPK 1J1DC 2WTYA 1LTTC 2YO2A 2XNXA 2N1TC 3BATA 3MTUE 1YTZI 4WY4A 5AVSB 4AQRD 5AW9B 4C7NB 4OH8B 2HODB 2LKMA 1URQC 1RF0C 1IK9A 3GHGC 3TNUA 1H8AA 5AW0B 1GW3A 1LGHB 5APYA 3B5NC 1FBMA 2FFDA 3VN0A 4WBAA 1S9KD 2P67A 1N7SC 1EQ7A 3OAKA 4KHXA 1KFNA 1DEBA 1QL1A 2J58A 1MV8A 4WY4D 1CSBA 1LTJB 2GUVA 1GD2E 1CI6A 5CCHA 3A2AA 3GHGB 3HRNA 1GL2A 2OYHC 2R3CA 2Q9IA 1N7SA 2YKOA 5BU8B 1ZR2A 1SFCB 1T8ZA 1T2KD 1GL2D 4JYBA 1FAVA 5CCGD 3UIAA 5CCGC 3MUDA 3N4XA 1HGZA 1JUNA 5AVWB 1MZ9A 1T3JA 4M3LA 5AVUB 4N3YB 3B8EB 5APVA 2YO3A 2XV5A 4EIJA 2P1JA 3HTKB 3M0DA 1HGVA 2J59M 3V2RA 1FOSE 1NTKK 2M8RA 3MD0A 3HUSC 2XZRA 3NTNA 2YKQA 1N73C 4LGDE 4ZKUA 1RF1B 2KLVA 5BVZA 3V2NA 1JY2P 5CCHD 2NPSA 2N1TB 1G1JA 3OJAB 2OYIA 3P8CD 2FXMA 1WT6A 1IO4A 3NMDA 2WITA 1L0NK 1CW5A 1N7SD 1N73B 4XA4A 1LWUB 5CCGA 2KSJA 1SFCC 4IFDK 1LTIC 1X8YA 2IFMA 2JEEA 1LWUA 4I1LA 1JTHB 3C9IA 2WWWA 2OYIC 1XTCC 2POHA 2I1JA 1G2CB 1X9VA 3BRTB 2WPSA 2OYIB 3NXSA 1FDMA 5APTA 1FJKA 2N1TD 4W7ZA 3H32B 1IFIA 1JO5A 4O9BA 3V2PA 2JJLA 3BASA 1HUCA 2WSEH 3MGNA 4IFMA 1X79B 1J1DB 2FFDC 3PP5A 4GIFA 3P7KA 1HVVA 3H32A 2E43A 1FZCA 1M1JC 3HUSB 2ZXEB 3V2QA 1NH4A 3VP9A 1W2EA 5AW2B 1JMMA 1S9KE 1URQD 1G1IA 3P8MC 4AUWA 2VRSA 5KTBA 2M3BA 1HTLC 1Z56A 3L37A 2H8PD 2A45H 4RESB 4C46A 3VMZA 1ZR4A 2N1TA 1WRGA 2NPSB 1CI6B 3LW5H 3B5ND 1GW4A 2KOGA 1RF1A 1GZLA 1AFOA 3M9HA 2WZ7A 4LC1A 1KILD 1PFIA 1KILC 2KP8A 3CL3D 1VPCA 1SQVK 2O1JA 3VYIA 3L36A 1MUUA 1SVFA 1JTHA 1KQLA 1FZEA 2NPSC 2C0WA 3EQ2A 2OARA 2QM8A 1IFNA 2HODA 3KPEA 1IJDB 1N73A 5AVYB 4XE5B 3HUSA 1DH3A 1FZCB 1GL2B 5KJ7A 3M0DC 4GKGA 5APQA 1SLQA 2R5BA 1LTJA 1T2KC 2W6BA 1LTBC 2KB7P 1IFMA 2ZFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2J B;  1CZQ A;  3O8Z A;  2QM7 A;  1GU5 A;  2C9L Y;  1HJB A;  1HWT C;  2WPQ A;  2WT7 B;  1X8Y A;  3M0A A;  1SP4 A;  1HBW A;  5AW3 B;  3I5C A;  2WTY A;  2WWW A;  3TNU B;  2YO2 A;  3LIE A;  1G2C B;  3TK1 A;  3V4Q A;  2WPS A;  3IR9 A;  3NXS A;  3KQG A;  1A02 F;  4I2L C;  5AVZ B;  3KDP B;  2WT7 A;  5APT A;  2C9N Y;  3P32 A;  1FOS F;  2JJL A;  3MGN A;  1HUC A;  4C7N A;  5AW4 B;  3M9B A;  5AVS B;  1OWA A;  3VMY A;  4I6M C;  4AQR D;  5AW9 B;  4C7N B;  5AW8 B;  2R5D A;  3P7K A;  1JNM A;  2W6A A;  1MFZ A;  1GK6 A;  5AVQ B;  2E43 A;  3M91 A;  4AYC A;  3A3Y B;  2Z5H A;  3L35 A;  4HYT B;  3V4W A;  3SWF A;  5AVR B;  3TNU A;  1H8A A;  2P7J A;  2ZXE B;  5AW0 B;  3HE4 A;  3HE5 A;  5APY A;  1GTW A;  2XU6 A;  1GU4 A;  5AW2 B;  2Q5U A;  2P2U A;  3TYY A;  4GT1 A;  1S9K E;  3A5T A;  3P8M C;  4AUW A;  2VRS A;  3VN0 A;  5AW5 B;  1GK4 A;  3HTK A;  3L37 A;  5APU A;  5APW A;  1S9K D;  2P67 A;  3OAK A;  2BAS A;  4KHX A;  1NWQ A;  2YNY A;  5AW1 B;  4RES B;  1MV8 A;  4C46 A;  1CSB A;  1GD2 E;  1CI6 A;  3VMZ A;  1A02 J;  3A2A A;  2H7H A;  1CI6 B;  5AVT B;  2R3C A;  1NAF A;  5CMZ A;  3V5B A;  1GZL A;  3M9H A;  4LC1 A;  4JYB A;  1T2K D;  1FAV A;  3UIA A;  2KP8 A;  5APS A;  1JUN A;  5AVW B;  5AW7 B;  3NFQ A;  4M3L A;  2R32 A;  3VYI A;  5AVU B;  3L36 A;  5APV A;  3B8E B;  3HE5 B;  2YO3 A;  1MUU A;  2XV5 A;  3HE4 B;  4EOT A;  3VTP C;  1KQL A;  3LID A;  3M0D A;  1YYC A;  3M06 A;  1FOS E;  3A7O A;  5AVX B;  3MD0 A;  2QM8 A;  2XZR A;  4JYC A;  3T97 A;  2W27 A;  2N9B A;  3NTN A;  2WPR A;  5AVY B;  4XE5 B;  5AW6 B;  4DZO A;  3VMX A;  4B86 A;  1DH3 A;  5AVV B;  2IPP A;  4GKG A;  5APQ A;  1SLQ A;  2R5B A;  5APX A;  2Q7C A;  1H88 A;  2Q3I A;  1T2K C;  1H89 A;  1OXZ A;  2Z5I A;  2E42 A;  1IO4 A;  3NMD A;  2ZFC A; 
#chains in the Genus database with same CATH topology
 2FKW B;  3H1I J;  3O8Z A;  1BDD A;  1SQB E;  4WB4 A;  2QM7 A;  1L0L J;  1RF1 C;  1BE3 D;  3RK3 B;  1HF9 A;  3I55 P;  2HG5 D;  2E76 B;  1HWT C;  1NOH A;  1SP4 A;  1USD A;  1GL2 C;  1SQV J;  2CPS A;  3L74 G;  3CI9 A;  3II6 A;  2J5U A;  5E79 H;  5AW3 B;  3CCR P;  1M7L A;  5K5G B;  1K73 Q;  1G2C A;  3L70 G;  3L74 J;  3O6Q A;  2FYU D;  3L71 E;  1OZH A;  1PPJ G;  2WPV B;  4Y99 B;  3TNU B;  4XFJ A;  1SQB K;  2WSC H;  3LIE A;  3AEF C;  1YTZ T;  2Q3E A;  3TK1 A;  3V4Q A;  4DCK A;  3KQG A;  1SQQ E;  5CJ0 A;  4PV1 C;  1JEK A;  1LT9 C;  2UWJ E;  3KDP B;  3WUT A;  4DJG A;  4MN4 C;  4DOJ A;  4JYC A;  1SFC D;  1FJP A;  2C9N Y;  1RE4 C;  1BE3 J;  4OGQ B;  1RQU A;  1L4A C;  5TJH A;  4C7N A;  4JF7 A;  3L70 E;  1L4A B;  5AW4 B;  2A45 G;  3RL0 D;  5KLV G;  1Q7Y Q;  1AQ5 A;  2D2C C;  4I6M C;  4GDO A;  4WWI A;  1L0N G;  1N7S B;  3RL0 C;  4A7P A;  1FZG A;  5AW8 B;  5B5E E;  1BDC A;  3RL0 g;  2FYN B;  2YMY A;  4KT0 J;  2W6A A;  1S1C X;  3RK2 C;  1MFZ A;  1GK6 A;  1AVO A;  2FYN C;  3GHG A;  1RY3 A;  1UIX A;  2WSF J;  3H1J G;  4PJ0 E;  2PRR A;  4W7Y A;  3CCM P;  2O1K A;  3CCE P;  3EFG A;  3M91 A;  2O01 J;  5EFW B;  5KJ7 C;  3A3Y B;  2IBZ I;  3WU2 H;  2RKL A;  2SPZ A;  3HD7 D;  3JSV C;  3SWF A;  5AVR B;  3H1L D;  2P7J A;  3VOP A;  4RKU J;  1S5L E;  1KIL E;  1KV4 A;  3HE5 A;  3KYQ A;  3CX5 E;  3SWY A;  2E76 D;  2XU6 A;  3L72 D;  5BU5 A;  1KYO D;  3D6Z A;  1GTW A;  4U3F E;  1GU4 A;  2GA1 A;  2P2U A;  3IFM A;  3RK3 C;  3TYY A;  1W2B O;  4U7J A;  2FFD B;  2YMK A;  3P8C E;  4BRY B;  3A5T A;  3W67 A;  2KXP B;  1X22 A;  1JOC A;  1GK4 A;  2PAJ A;  4WY4 C;  3HTK A;  5AW5 B;  1Y47 A;  1NTM K;  2GUS A;  2LXC B;  3MHV A;  3R4Y A;  3AED C;  2FXO A;  5APU A;  5M1B A;  2BAS A;  1Q86 Q;  2FXP A;  5AW1 B;  2XKM A;  4D6T J;  1BCC G;  1W5C E;  1OVU A;  2GM4 A;  3L74 D;  3A0B H;  1NYH A;  1H0T A;  1BGY D;  2YKP A;  2OYI B;  1A02 J;  1N2D C;  2KYV A;  5DJT B;  1JM0 A;  1WMK A;  3A0H E;  2CK3 H;  2QG4 A;  5AVT B;  2HPC B;  1NTM E;  1SFC A;  2IYP A;  1FE6 A;  1JY3 O;  1EZV G;  1NHL A;  2ZYA A;  3VP8 A;  4IFF A;  4JQ0 D;  4N78 D;  3H1H D;  4PD4 D;  3RBZ A;  3IAO A;  2QJP B;  1FZF A;  2IX7 C;  3KXD A;  1BCC J;  1PZQ A;  2B88 A;  2D2C B;  4H0L D;  1EDK A;  2B89 A;  3T97 B;  2HFE D;  3GF3 A;  2OYH A;  1OW6 A;  5CJ4 A;  2FYZ A;  4HJG H;  4NPF X;  4WY4 B;  5CCH C;  4N6J A;  2OTJ P;  4D6T D;  1VF5 C;  1K9M Q;  3HE4 B;  2B87 A;  3KZI E;  1PGQ A;  3RK3 E;  3WMM 0;  2A06 D;  2BCC E;  1NTK J;  1ZN5 A;  1L0L K;  2M5A A;  3TSI A;  1N86 A;  2H89 C;  5GTH H;  3S4R A;  4WVZ A;  2YXQ B;  3M06 A;  4UB8 E;  3H1H G;  1LJ2 A;  3LW5 J;  1EXI A;  2K3R A;  1NU1 K;  5E79 E;  1PP9 J;  2HLO A;  5AVX B;  3BCC E;  1LTG C;  2AEJ A;  1JY2 O;  2NPS D;  1SQX K;  2Y0D A;  1BSN A;  1L0L D;  1BCC D;  3BCC G;  3M9Q A;  1FZA A;  3BCC J;  4Y28 J;  1YHQ P;  2WPR A;  1PP9 E;  3ZDM A;  4R4L A;  2HR3 A;  1KYO H;  1YQ3 C;  1KMI Z;  3AE3 C;  3MIW A;  3SFD C;  2I8D A;  5KLV K;  4DZO A;  3VMX A;  4HH2 A;  4B86 A;  1ZXG A;  1SQX D;  2H43 A;  4LLH A;  1YJ9 P;  5AVV B;  2BCC J;  2A45 I;  2JO1 A;  3F89 A;  5APX A;  3GW6 A;  1RF0 A;  1H88 A;  1DX7 A;  3CCQ P;  1NTM G;  2JKV A;  3EFF K;  2E42 A;  5CHX A;  1Q90 D;  2Z4E A;  5AVQ B;  1XTG B;  2O01 H;  3HD7 B;  4H0L B;  1FU1 A;  2K9J A;  3Q2Y A;  1J2J B;  1CZQ A;  3E1R A;  1USE A;  3H1K D;  1Q82 Q;  3G6E P;  2C9L Y;  3GF7 A;  1BCC E;  1FS0 E;  2QJP C;  3U59 A;  2I1K A;  3PH0 A;  2XDJ A;  1NVO A;  2WPQ A;  5DJU B;  4N78 E;  3RK2 B;  1EZV D;  1LNQ A;  1QLE D;  3H6P A;  3SSU A;  2E75 C;  1OFC X;  1AQT A;  3I5C A;  1SQV G;  3C1L A;  2E74 D;  1M1J B;  2ZYD A;  1PV3 A;  1J1E C;  5GTH E;  2MJZ A;  1K05 A;  2KS1 A;  2E74 C;  1P84 I;  2KSE A;  1JY3 N;  1IC2 A;  1YQ4 C;  1LTJ C;  2KZI A;  2QVA A;  5KKZ C;  1NO4 A;  3IR9 A;  3CC2 P;  3PHL A;  2OYO A;  1LWU C;  1M57 D;  4D6T E;  4EDF A;  4I2L C;  5AVZ B;  1A02 F;  1EDJ A;  3Q3D A;  3VMA A;  2WT7 A;  1K04 A;  3H1K J;  1ZME C;  1JCD A;  3BRV B;  1U7J A;  3P32 A;  3RK3 D;  1KB9 D;  2CPB A;  1KZU B;  1KIL B;  3B5N A;  1FOS F;  1RH5 B;  2M0B A;  3M9B A;  1KFM A;  1OWA A;  3CXH I;  3VMY A;  4U3F J;  2PP6 A;  1SQQ K;  1EC5 A;  1JY3 P;  2XND H;  3L70 D;  3CC4 P;  2R5D A;  1JMB A;  5CBO A;  1JNM A;  1S2E A;  3BCC D;  1AJY A;  1P84 H;  1RE3 A;  1LT9 B;  1N7L A;  4AYC A;  2Y0E A;  1OX3 A;  3RK2 D;  4C7R A;  1J1E B;  2Z5H A;  1SQQ D;  3L35 A;  1URQ A;  3FXE A;  4HYT B;  3V4W A;  1EXJ A;  3TDK A;  2KS1 B;  4CPG A;  1VQ7 P;  2ZT9 C;  1LTS C;  3H1I D;  3HE4 A;  2HYN A;  2ZYG A;  3GMA A;  3N7N A;  2ZVN B;  4D6T G;  3RL0 B;  3Q5R A;  3H1H E;  4PD4 E;  3U1C A;  1L0N D;  2Q5U A;  3AEC C;  3PLN A;  1L2P A;  4GT1 A;  1T3U A;  2E76 C;  3L70 J;  2JR8 A;  1Q81 Q;  1KQS O;  3TGU E;  4QMA A;  1LTA C;  1DD4 A;  4BWN A;  1HH0 A;  3H25 A;  4H13 B;  5APW A;  3HD7 A;  3JCU E;  4ZKP A;  3G71 P;  3L73 E;  1NWQ A;  1Y8A A;  3G9R A;  2YNY A;  3OA7 A;  3PRJ A;  4EYY Q;  1GMJ A;  1NKN A;  1SQQ J;  1JY2 N;  2BEZ F;  2Y0C A;  3MZW B;  1OW7 A;  3H1I G;  4GOD A;  2Q1K A;  3I56 P;  1NTZ D;  3L71 J;  1FC2 C;  1PPJ D;  2AXT H;  2FYU G;  2H7H A;  3L74 E;  1E5W A;  2FYU E;  2KNC B;  2IBZ D;  3L75 E;  4PD4 H;  2LR2 A;  2O01 N;  1NAF A;  3W68 A;  3KZI H;  2G3A A;  3PTZ A;  5CMZ A;  1T6A A;  1NTZ G;  1R5S A;  3V5B A;  1VQ9 P;  1NTZ K;  1OVV A;  3G3Z A;  2ZVO B;  4YTP C;  2KNC A;  2QIW A;  1GDT A;  3H1I E;  3L4F A;  1YI2 P;  3S1K A;  3H1J E;  3QWO C;  4Z1M H;  2A06 G;  2IFN A;  1SQP J;  2FYU K;  2L5G B;  3E1I A;  4PV1 B;  5APS A;  5CBN A;  2KLU A;  5AW7 B;  3NFQ A;  1IFD A;  3AE9 C;  2R32 A;  2K37 A;  3CLQ A;  3L72 E;  3L72 G;  4UB8 H;  5KLV D;  1SQX J;  1VDF A;  1QL2 A;  2M5A B;  2ITA A;  3FXD A;  3HE5 B;  4H13 D;  4EOT A;  1M1J A;  1NTZ E;  3VTP C;  1FZC C;  3HD7 C;  3D70 A;  3LID A;  1VQP P;  1JCC A;  1YYC A;  1ZV8 A;  3AEE C;  1L4A D;  4W80 A;  1VQN P;  1ZLL A;  2OYH B;  3A7O A;  3A0H H;  2OTL P;  4L75 A;  1BSH A;  4L76 A;  3T97 A;  2W27 A;  2N9B A;  3A0B E;  2K9J B;  4R4M A;  5KLI B;  3CXH D;  4H13 C;  1L4A A;  3L75 D;  4Y99 C;  5AW6 B;  1URQ B;  5GTI E;  1RE4 A;  2P10 A;  3U1A A;  5KLV J;  2HPC A;  2WSC J;  4ASV A;  1LT9 A;  3CWB D;  1DD3 A;  2IPP A;  1RE3 C;  3JC2 2;  1SQX E;  2Q7C A;  4PV1 D;  2W83 C;  2Q3I A;  1H89 A;  3L73 D;  1OXZ A;  2C0X A;  2Z5I A;  1SQP E;  1NU1 J;  2IZ1 A;  1IFP A;  2NZ2 A;  3H1J J;  3R2P A;  3CWB G;  2QRX A;  3S9O A;  5KJ7 D;  1IFJ A;  1S3J A;  2QJY B;  2E5Y A;  1KIL A;  2KI7 B;  3B5N B;  3CXH H;  2IZ0 A;  1YJW P;  3CCU P;  1GU5 A;  1HJB A;  1FZB A;  1U7M A;  2WSE J;  3MP7 B;  2WT7 B;  1QVG O;  4KJM A;  4OGQ C;  3M0A A;  3GG2 A;  5GTI H;  1HBW A;  3L75 J;  1K8A Q;  1NKZ B;  4PJ0 H;  1BE3 G;  2WSF H;  3CX5 D;  1SQP K;  2FYU J;  1J1D C;  3L75 G;  1Q2N A;  4PD4 I;  4ZNC A;  1KQF B;  5KAI H;  5B5E H;  2WTY A;  2R44 A;  1PPJ E;  1LTT C;  2B87 B;  1NTK D;  2YO2 A;  3AEB C;  5C39 A;  5H2F H;  2XNX A;  3WUV A;  1NAY A;  2N1T C;  3BAT A;  1YTZ I;  3MTU E;  4WY4 A;  3L73 J;  1P84 E;  1NU1 G;  3ABV C;  3V6I A;  3GLM A;  3TGU J;  4UB6 E;  3WUU A;  1PL5 A;  3TF5 A;  3G4S P;  1PP9 G;  5AVS B;  3AE6 C;  2ZT9 D;  3B4S A;  1LT1 A;  5AW9 B;  4AQR D;  2OGU A;  3H1H J;  2FY8 A;  3IF4 A;  4OH8 B;  4C7N B;  1EDL A;  1RQV A;  1PGJ A;  2HOD B;  2LKM A;  2Y9Y A;  1URQ C;  3AEG C;  2KIK A;  1RF0 C;  2IDB A;  3FGA D;  1H0T B;  1QEX A;  1IK9 A;  3GHG C;  1IK7 A;  3TGU G;  4YXW H;  3Q5S A;  3H1L J;  2ZFC A;  3TNU A;  1AV1 A;  1H8A A;  5AW0 B;  3CWB E;  1GW3 A;  1LGH B;  2JDI H;  5APY A;  3SFE C;  3TGU D;  5KLI C;  1VF5 D;  4TT3 H;  3CCS P;  2O3J A;  3MUD C;  1FDO A;  1RHZ B;  3B5N C;  1FBM A;  2W8Z A;  1AA0 A;  2FFD A;  3SWK A;  3VN0 A;  3PJS K;  2B9B A;  1R5L A;  2RH0 A;  3H1K E;  4WBA A;  4JBZ A;  1S9K D;  2P67 A;  1N7S C;  1EQ7 A;  3OAK A;  4KHX A;  1KFN A;  1PIX A;  1DEB A;  1QL1 A;  3EWK A;  3WU2 E;  4RJT A;  1VQ5 P;  3E7K A;  2J58 A;  1MV8 A;  2IBZ E;  4WY4 D;  1CSB A;  1LTJ B;  2GUV A;  5KKZ B;  1GD2 E;  1CI6 A;  1NJI Q;  5CCH A;  3A2A A;  3CX5 H;  3GHG B;  1KYO I;  2AXC A;  1FDI A;  1GL2 A;  3HRN A;  3Q5P A;  2E5T A;  2OYH C;  5TIS E;  2R3C A;  2Q9I A;  1N7S A;  1VQO P;  1X0T A;  2ZJS E;  1ZRT D;  2YKO A;  4K3A A;  2K1A A;  2WMM A;  3FWN A;  5BU8 B;  1ZR2 A;  4U3F D;  1SFC B;  1T8Z A;  5B66 H;  3CCJ P;  1DIP A;  1S4X A;  2ZXX A;  1T2K D;  1GL2 D;  3C8V A;  1FAV A;  4JYB A;  2ZAE B;  5CCG D;  1KB9 E;  3CME P;  3UIA A;  5CCG C;  2OTK E;  3MUD A;  3N4X A;  1HGZ A;  4JPZ B;  5AVW B;  1MZ9 A;  1T3J A;  2FBW C;  4IL6 E;  4M3L A;  5H2F E;  1JUN A;  5AVU B;  2YIU B;  4IOI H;  4N3Y B;  3B8E B;  5APV A;  2YO3 A;  3CC7 P;  2XV5 A;  1QVF O;  4OWF A;  4EIJ A;  4GOE A;  2P1J A;  2E75 D;  1BGY E;  3HTK B;  4BXL A;  1E79 H;  3M0D A;  1HGV A;  2J59 M;  4U3F G;  4YPC A;  2KK7 A;  1L0N J;  3QH9 A;  2AEM A;  3V2R A;  4BRY A;  2NRG A;  1NTK K;  1FOS E;  2M8R A;  2L91 A;  4L73 A;  1KTM A;  2M3E A;  3H1L G;  2AXT E;  3HUS C;  3MD0 A;  5B66 E;  2XZR A;  2QE7 H;  2QJK B;  3IN6 A;  4L74 A;  1R8E A;  3NTN A;  2YKQ A;  3H1K G;  1EZV E;  1VL2 A;  4H0L C;  4LGD E;  1N73 C;  1MKM A;  4ZKU A;  2KLV A;  2RN0 A;  5BVZ A;  1RF1 B;  1L0N E;  3V2N A;  1JY2 P;  1N8R Q;  2ZT9 B;  2YXR B;  3JCU H;  1NTM D;  1BGY J;  1D7M A;  4IL6 X;  1NTK E;  2NPS A;  5CCH D;  4ZMD A;  2N1T B;  1JB0 J;  2QEX P;  4OGQ D;  2YIU C;  3KHU A;  1VF5 B;  2PGD A;  1G1J A;  4YXD C;  3OJA B;  1KC8 Q;  2OYI A;  2DW3 A;  2OQQ A;  3P8C D;  1LP1 B;  1WT6 A;  2FXM A;  1IO4 A;  3NMD A;  3L71 G;  1L0N K;  2WIT A;  1CW5 A;  1N7S D;  1N73 B;  4XA4 A;  1LWU B;  2V4H A;  5CCG A;  2IBZ G;  2R3S A;  2KSJ A;  1SFC C;  2V7Q J;  4HKZ H;  3RBX A;  4IFD K;  1LTI C;  1X8Y A;  1SQX G;  2RMZ A;  4NPE A;  1NTM J;  2IFM A;  2JEE A;  3CPW O;  1LWU A;  2IYO A;  4I1L A;  3CCL P;  1JTH B;  2K9Y A;  3C9I A;  3D6Y A;  2WWW A;  3D71 A;  2OYI C;  1XTC C;  2POH A;  2I1J A;  1LP1 A;  1SS1 A;  1G2C B;  3O6Q B;  1X9V A;  3BRT B;  2WPS A;  2Q6Q A;  5L8R J;  3AE7 C;  3NXS A;  1NGM B;  2QJY C;  5KAF H;  1VQ6 P;  2N9Y B;  4UB6 H;  3CMA P;  1PP9 D;  1KB9 H;  1FDM A;  1AVY A;  5APT A;  1FJK A;  5KAF E;  3BVH A;  2N1T D;  2P58 A;  4W7Z A;  3H32 B;  1IFI A;  1JO5 A;  2WQY C;  4O9B A;  4NPD A;  2JJL A;  3V2P A;  1KOR A;  1HUC A;  2WSE H;  3BAS A;  3MGN A;  4IFM A;  1X79 B;  3ITK A;  3CD6 P;  1J1D B;  2FFD C;  3PP5 A;  4GIF A;  2E74 B;  1YIJ P;  1EDI A;  1SQQ G;  2WVR A;  3P7K A;  1HVV A;  1NTK G;  3H32 A;  1OMI A;  4H44 D;  3CWB J;  5TIS H;  2E75 B;  2JWD A;  1ZRT E;  4H44 C;  2V7Q H;  3H1L E;  1DEE G;  1FZC A;  3OW2 O;  2E43 A;  3CX5 I;  2W90 A;  1M1J C;  3AEA C;  2G8Y A;  3HUS B;  1KB9 I;  2ZXE B;  3H1J D;  3V2Q A;  1M56 D;  1TU3 F;  1BGY G;  1NH4 A;  3VP9 A;  1VQ8 P;  1W2E A;  5AW2 B;  3B71 A;  1YBK A;  2QJK C;  1YIT P;  1JMM A;  1S9K E;  1S72 P;  1URQ D;  1G1I A;  1M1K Q;  3P8M C;  4AUW A;  1SQB D;  2VRS A;  2M3B A;  4TLF A;  5KTB A;  1HTL C;  2QA4 P;  1BE3 E;  2PFX A;  3Q1M A;  2D2C D;  1Z56 A;  3L37 A;  3L73 G;  3K5B A;  2H8P D;  2A45 H;  2WSS H;  4RES B;  4C46 A;  3AE5 C;  1M8O B;  1YJN P;  1HJ0 A;  2MKV A;  3USS A;  2QSI A;  2A06 E;  2BCC D;  2N1T A;  3VMZ A;  1ZR4 A;  1WRG A;  2NPS B;  1CI6 B;  1MFT A;  3LW5 H;  3B5N D;  1GW4 A;  3AE1 C;  1PGP A;  2JP3 A;  2KOG A;  1SQV E;  2H88 C;  1ZP0 C;  1U57 A;  2JWA A;  1RF1 A;  1ZW0 A;  1GZL A;  1KYO E;  2BCC G;  1OIP A;  1AFO A;  1SQV D;  1VQM P;  3M9H A;  4IL6 H;  1L0L E;  2K88 A;  2WZ7 A;  3FX0 A;  1KQG B;  1P84 D;  1KIL D;  1IZN B;  1SQB J;  4LC1 A;  4ASW A;  4DT0 A;  1PFI A;  1SQP D;  2BEQ D;  1KIL C;  1NU1 E;  2AEF A;  2KP8 A;  3CL3 D;  2Y9Z A;  1VPC A;  3AE4 C;  1SQV K;  2O1J A;  3FWL A;  3VYI A;  3L36 A;  1OW8 A;  1MUU A;  1SVF A;  2KUB A;  5KAI E;  1VQK P;  1QGK B;  1JTH A;  1KQL A;  1FZE A;  1SQB G;  1L0L G;  5KLV E;  4RO0 A;  2NPS C;  4OVN F;  3RGU A;  2C0W A;  1ZOY C;  3CXH E;  3EQ2 A;  2OAR A;  3AE8 C;  1S5L X;  2QM8 A;  1IFN A;  2HOD A;  3F5H A;  4I7Z B;  3KPE A;  4I7Z C;  4H44 B;  1QX8 A;  1IJD B;  2LXB A;  1KD1 Q;  5AVY B;  1N73 A;  4XE5 B;  1VQL P;  1PGO A;  3HUS A;  4HB1 A;  1UII A;  2KZJ A;  4K35 A;  1DH3 A;  2W6J H;  1FZC B;  4EI2 A;  1EZV I;  1GL2 B;  1NTZ J;  3L71 D;  5KJ7 A;  3M0D C;  1Y9B A;  3AE2 C;  4GKG A;  4GOF A;  1SLQ A;  2R5B A;  5APQ A;  3CCV P;  1LTJ A;  1T2K C;  3L72 J;  2W6B A;  1VQ4 P;  1KN7 A;  1LTB C;  1NU1 D;  2KB7 P;  1S5L H;  1M90 Q;  1SQP G;  1IFM A;  1OVR A; 
#chains in the Genus database with same CATH homology
 2FKW B;  3O8Z A;  4WB4 A;  2QM7 A;  1RF1 C;  3RK3 B;  2HG5 D;  1HWT C;  1NOH A;  1SP4 A;  1GL2 C;  2CPS A;  5AW3 B;  3CI9 A;  3II6 A;  1M7L A;  1G2C A;  4Y99 B;  3TNU B;  1SQB K;  2WSC H;  3LIE A;  3TK1 A;  1YTZ T;  3V4Q A;  3KQG A;  5CJ0 A;  4DOJ A;  1LT9 C;  3KDP B;  1FJP A;  1SFC D;  2C9N Y;  1RE4 C;  1L4A C;  4C7N A;  4JF7 A;  1L4A B;  5AW4 B;  2A45 G;  3RL0 D;  1AQ5 A;  4I6M C;  3RL0 C;  1N7S B;  1FZG A;  5AW8 B;  2YMY A;  2W6A A;  3RK2 C;  1MFZ A;  1GK6 A;  5AVQ B;  3GHG A;  1RY3 A;  4W7Y A;  2O1K A;  3EFG A;  3M91 A;  5KJ7 C;  3A3Y B;  3HD7 D;  3SWF A;  5AVR B;  2P7J A;  3VOP A;  3HE5 A;  3KYQ A;  3SWY A;  1GTW A;  2XU6 A;  5BU5 A;  1GU4 A;  3BVH A;  2FFD B;  3IFM A;  2P2U A;  3RK3 C;  3TYY A;  3P8C E;  3A5T A;  2PAJ A;  1JOC A;  1GK4 A;  5AW5 B;  4WY4 C;  3HTK A;  1NTM K;  2GUS A;  5APU A;  2BAS A;  5AW1 B;  2XKM A;  2GM4 A;  2YKP A;  1A02 J;  1N2D C;  2KYV A;  5AVT B;  2HPC B;  1SFC A;  1JY3 O;  1NHL A;  3VP8 A;  1FZF A;  4IFF A;  2Z4E A;  4N78 D;  2IX7 C;  2HFE D;  2OYH A;  5CJ4 A;  2FYZ A;  4WY4 B;  5CCH C;  4N6J A;  3HE4 B;  3WMM 0;  1ZN5 A;  1L0L K;  3TSI A;  1N86 A;  3M06 A;  1NU1 K;  2HLO A;  5AVX B;  1LTG C;  2NPS D;  1JY2 O;  4JYC A;  1SQX K;  3M9Q A;  1FZA A;  2WPR A;  3MIW A;  5KLV K;  4DZO A;  3VMX A;  4HH2 A;  4B86 A;  2H43 A;  4LLH A;  5AVV B;  2A45 I;  5APX A;  1RF0 A;  1H88 A;  1DX7 A;  2E42 A;  5CHX A;  2O01 H;  3HD7 B;  1XTG B;  1FU1 A;  1J2J B;  1CZQ A;  2C9L Y;  3U59 A;  2I1K A;  2XDJ A;  2WPQ A;  4N78 E;  3RK2 B;  3H6P A;  3I5C A;  1M1J B;  1J1E C;  2MJZ A;  1JY3 N;  1IC2 A;  1LTJ C;  1NO4 A;  3IR9 A;  1LWU C;  1A02 F;  4I2L C;  5AVZ B;  2WT7 A;  1JCD A;  3BRV B;  3P32 A;  3RK3 D;  2CPB A;  1KZU B;  1KIL B;  3B5N A;  1FOS F;  3M9B A;  1KFM A;  1OWA A;  3VMY A;  2PP6 A;  1SQQ K;  1JY3 P;  2R5D A;  1JNM A;  1RE3 A;  1LT9 B;  1N7L A;  4AYC A;  3RK2 D;  4C7R A;  1J1E B;  2Z5H A;  3L35 A;  4HYT B;  1URQ A;  3V4W A;  1LTS C;  3HE4 A;  2HYN A;  3N7N A;  3RL0 B;  3U1C A;  2Q5U A;  4GT1 A;  1T3U A;  1LTA C;  1HH0 A;  5APW A;  3HD7 A;  4ZKP A;  1NWQ A;  2YNY A;  3OA7 A;  1NKN A;  4W80 A;  1JY2 N;  2H7H A;  1E5W A;  1NAF A;  5CMZ A;  3V5B A;  1NTZ K;  3G3Z A;  1GDT A;  3L4F A;  2IFN A;  2FYU K;  2L5G B;  3E1I A;  5APS A;  5AW7 B;  3NFQ A;  1IFD A;  2R32 A;  3CLQ A;  1VDF A;  1QL2 A;  3HE5 B;  4EOT A;  1M1J A;  3VTP C;  1FZC C;  3HD7 C;  3LID A;  1JCC A;  1YYC A;  1ZV8 A;  1L4A D;  1ZLL A;  2OYH B;  3A7O A;  3T97 A;  2W27 A;  2N9B A;  5AW6 B;  1L4A A;  4Y99 C;  1URQ B;  1RE4 A;  2HPC A;  3U1A A;  1LT9 A;  2IPP A;  1RE3 C;  2Q7C A;  2Q3I A;  1H89 A;  1OXZ A;  2C0X A;  2Z5I A;  3R2P A;  5KJ7 D;  1IFJ A;  1GU5 A;  1KIL A;  3B5N B;  1HJB A;  1FZB A;  2WT7 B;  3M0A A;  1HBW A;  1NKZ B;  2WSF H;  1SQP K;  1J1D C;  2WTY A;  1LTT C;  2YO2 A;  2XNX A;  2N1T C;  3BAT A;  3MTU E;  1YTZ I;  4WY4 A;  5AVS B;  4AQR D;  5AW9 B;  4C7N B;  4OH8 B;  2HOD B;  2LKM A;  1URQ C;  1RF0 C;  1IK9 A;  3GHG C;  3TNU A;  1H8A A;  5AW0 B;  1GW3 A;  1LGH B;  5APY A;  3B5N C;  1FBM A;  2FFD A;  3VN0 A;  4WBA A;  1S9K D;  2P67 A;  1N7S C;  1EQ7 A;  3OAK A;  4KHX A;  1KFN A;  1DEB A;  1QL1 A;  2J58 A;  1MV8 A;  4WY4 D;  1CSB A;  1LTJ B;  2GUV A;  1GD2 E;  1CI6 A;  5CCH A;  3A2A A;  3GHG B;  3HRN A;  1GL2 A;  2OYH C;  2R3C A;  2Q9I A;  1N7S A;  2YKO A;  5BU8 B;  1ZR2 A;  1SFC B;  1T8Z A;  1T2K D;  1GL2 D;  4JYB A;  1FAV A;  5CCG D;  3UIA A;  5CCG C;  3MUD A;  3N4X A;  1HGZ A;  1JUN A;  5AVW B;  1MZ9 A;  1T3J A;  4M3L A;  5AVU B;  4N3Y B;  3B8E B;  5APV A;  2YO3 A;  2XV5 A;  4EIJ A;  2P1J A;  3HTK B;  3M0D A;  1HGV A;  2J59 M;  3V2R A;  1FOS E;  1NTK K;  2M8R A;  3MD0 A;  3HUS C;  2XZR A;  3NTN A;  2YKQ A;  1N73 C;  4LGD E;  4ZKU A;  1RF1 B;  2KLV A;  5BVZ A;  3V2N A;  1JY2 P;  5CCH D;  2NPS A;  2N1T B;  1G1J A;  3OJA B;  2OYI A;  3P8C D;  2FXM A;  1WT6 A;  1IO4 A;  3NMD A;  2WIT A;  1L0N K;  1CW5 A;  1N7S D;  1N73 B;  4XA4 A;  1LWU B;  5CCG A;  2KSJ A;  1SFC C;  4IFD K;  1LTI C;  1X8Y A;  2IFM A;  2JEE A;  1LWU A;  4I1L A;  1JTH B;  3C9I A;  2WWW A;  2OYI C;  1XTC C;  2POH A;  2I1J A;  1G2C B;  1X9V A;  3BRT B;  2WPS A;  2OYI B;  3NXS A;  1FDM A;  5APT A;  1FJK A;  2N1T D;  4W7Z A;  3H32 B;  1IFI A;  1JO5 A;  4O9B A;  3V2P A;  2JJL A;  3BAS A;  1HUC A;  2WSE H;  3MGN A;  4IFM A;  1X79 B;  1J1D B;  2FFD C;  3PP5 A;  4GIF A;  3P7K A;  1HVV A;  3H32 A;  2E43 A;  1FZC A;  1M1J C;  3HUS B;  2ZXE B;  3V2Q A;  1NH4 A;  3VP9 A;  1W2E A;  5AW2 B;  1JMM A;  1S9K E;  1URQ D;  1G1I A;  3P8M C;  4AUW A;  2VRS A;  5KTB A;  2M3B A;  1HTL C;  1Z56 A;  3L37 A;  2H8P D;  2A45 H;  4RES B;  4C46 A;  3VMZ A;  1ZR4 A;  2N1T A;  1WRG A;  2NPS B;  1CI6 B;  3LW5 H;  3B5N D;  1GW4 A;  2KOG A;  1RF1 A;  1GZL A;  1AFO A;  3M9H A;  2WZ7 A;  4LC1 A;  1KIL D;  1PFI A;  1KIL C;  2KP8 A;  3CL3 D;  1VPC A;  1SQV K;  2O1J A;  3VYI A;  3L36 A;  1MUU A;  1SVF A;  1JTH A;  1KQL A;  1FZE A;  2NPS C;  2C0W A;  3EQ2 A;  2OAR A;  2QM8 A;  1IFN A;  2HOD A;  3KPE A;  1IJD B;  1N73 A;  5AVY B;  4XE5 B;  3HUS A;  1DH3 A;  1FZC B;  1GL2 B;  5KJ7 A;  3M0D C;  4GKG A;  5APQ A;  1SLQ A;  2R5B A;  1LTJ A;  1T2K C;  2W6B A;  1LTB C;  2KB7 P;  1IFM A;  2ZFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...