3T97A

Molecular architecture of the transport channel of the nuclear pore complex: nup62/nup54
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
56
structure length
56
Chain Sequence
WDRTLIENGEKITSLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEESVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nuclear pore complex protein Nup54
publication title Molecular architecture of the transport channel of the nuclear pore complex.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 25
structure length 56
sequence length 56
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3t97A00
4M3LA 5AW0B 1FOSE 2KP8A 3A3YB 1CI6B 5AW3B 2ZFCA 4LC1A 4AQRD 1H89A 2R5BA 3L35A 2Q3IA 2C9NY 2IPPA 3NMDA 1MFZA 5AW4B 1GTWA 1JUNA 1MUUA 1G2CB 1DH3A 3HE4B 3T97A 2C9LY 4JYBA 5AVRB 1HBWA 3LIEA 5CMZA 2QM8A 2YO2A 4C7NB 1A02F 3SWFA 5AVVB 1CI6A 1T2KD 2QM7A 2W27A 2E42A 5AVWB 3VMYA 5AVQB 1S9KD 5AW9B 5APXA 5AVXB 3NTNA 3HTKA 2YO3A 3VN0A 4B86A 3IR9A 1OXZA 2XV5A 2Z5HA 2R3CA 4C7NA 4I6MC 3V4QA 3MGNA 4GT1A 4DZOA 3M0DA 1H88A 4AUWA 1S9KE 2JJLA 2R5DA 5AW8B 2Q5UA 3TYYA 5AVZB 5APTA 3A7OA 1J2JB 3VTPC 2P7JA 2N9BA 3TNUB 1CZQA 3L36A 4XE5B 3M9BA 3M91A 1GD2E 3M0AA 1T2KC 2H7HA 1X8YA 4GKGA 2Q7CA 3VYIA 3UIAA 1GU4A 2W6AA 5AW7B 3M9HA 1GK4A 1SP4A 5APVA 3HE4A 1GZLA 2P2UA 5AVTB 3NFQA 4C46A 3LIDA 3A5TA 2BASA 1HWTC 2XU6A 2E43A 1JNMA 3VMXA 3TNUA 2WT7B 3P32A 1YYCA 1H8AA 1HUCA 1FAVA 3HE5B 2ZXEB 3P8MC 3M06A 1IO4A 2WPSA 1GU5A 1CSBA 3O8ZA 3KDPB 3V4WA 4JYCA 2XZRA 4AYCA 1GK6A 3MD0A 3KQGA 4I2LC 5AW1B 2WT7A 2R32A 1NAFA 5APSA 2WPQA 3A2AA 2WTYA 3HE5A 1KQLA 2Z5IA 5AW2B 3P7KA 4EOTA 3VMZA 2YNYA 2VRSA 5AVUB 4HYTB 3TK1A 4RESB 2WWWA 3I5CA 5AVYB 1OWAA 2WPRA 2P67A 5APYA 3OAKA 1SLQA 5APQA 3L37A 4KHXA 1MV8A 1HJBA 1A02J 3V5BA 3B8EB 5AW6B 1FOSF 5APWA 1NWQA 3NXSA 5AVSB 5APUA 5AW5B
chains in the Genus database with same CATH superfamily
2JKVA 3BCCE 4RKUJ 3L35A 4IFDK 1BE3D 1SS1A 2A45H 5AW4B 1GMJA 1GTWA 4WBAA 2FYUK 4JYBA 5M1BA 5BU5A 3SWFA 2Q1KA 3CXHI 1L0LK 2PP6A 3CPWO 3P8CD 4ZNCA 1S9KD 1LTJB 1KMIZ 1OX3A 1EDIA 2YO3A 3HD7D 3TGUG 4WVZA 1LWUB 1NU1J 2R5DA 3A0BE 2FYUD 1J2JB 4OGQC 1USEA 3N4XA 1LTBC 1UIXA 1T2KC 3EFFK 1X8YA 1L0LD 2OYHC 2B87A 2OTLP 4I7ZC 1GW3A 1Q81Q 4WWIA 3CCMP 2N1TA 1JTHB 1QLED 2JEEA 3PRJA 3TF5A 3GG2A 1AV1A 5BVZA 1USDA 4IOIH 4DJGA 3KZIH 3I55P 4PD4I 2YMYA 1QVGO 3AE8C 2E5TA 5CJ0A 2OYOA 1X0TA 3H1HE 1BGYJ 4D6TJ 2QE7H 3TGUE 3H1JD 1R5LA 1SQXK 1H89A 2A06E 1KB9D 1Q90D 2AXTE 3SFEC 1M1JC 1MFZA 1CW5A 1JMBA 1NTMJ 2AEMA 1OMIA 1ZV8A 2JDIH 2NPSB 5CMZA 4JBZA 1M57D 3MHVA 1RE4A 2M5AA 3HRNA 1VQ9P 1SQBK 3GHGA 1YQ3C 3D71A 1IC2A 1SQXD 1EXIA 2CPSA 3L75J 2HODA 3I56P 3E1RA 4BRYA 3L71G 3MGNA 3C8VA 3L73D 2P7JA 2PFXA 3TNUB 3CCLP 4TT3H 1T3UA 1NTZJ 3O6QB 1SQBD 4WY4C 3BVHA 1NTKJ 2J59M 1RE3A 3B71A 5BU8B 1RH5B 1RF1C 3H1IE 2OYIB 3H32A 5KAFE 3GMAA 3BCCD 3HE5A 2KZJA 1VQOP 3P7KA 1IK7A 1LP1B 1E79H 3C9IA 4O9BA 2HPCA 1BSNA 4GIFA 3L71E 3H1LG 1P84H 3RL0B 1JUNA 2E75D 4YXDC 2Y9YA 3OW2O 2GA1A 4UB6H 3W67A 1KZUB 1RQUA 2Y9ZA 2ZYAA 3EWKA 2KOGA 2ZVOB 2Z5HA 2DW3A 3V4QA 4GT1A 4DZOA 1EZVG 5C39A 1HJ0A 1OVRA 3AE4C 1OW8A 2IX7C 2OTKE 3LW5H 4OGQB 1QX8A 5AVTB 1YJ9P 4RJTA 3OJAB 3M06A 2WPSA 3ABVC 4I7ZB 1NU1G 3S1KA 3H1HD 3CCJP 3VOPA 1KYOH 2L5GB 2J5UA 2W6JH 2R32A 4BWNA 1KTMA 3CCRP 2A06D 5APYA 4IL6E 2POHA 1FDMA 1TU3F 2N1TD 2ZVNB 1IFIA 3KHUA 2K88A 3GW6A 3SSUA 2OTJP 5CCGC 1KN7A 1ZP0C 4U7JA 2BCCE 1DEBA 3T97A 5B66E 2ZAEB 4U3FE 2KSEA 2H88C 1M1JB 3JCUE 5AVQB 3Q5RA 3RGUA 1PGPA 5TJHA 1VQLP 4D6TG 3MTUE 2K9JA 3MIWA 3FX0A 1KFNA 1LTJC 4NPDA 1Q86Q 1GL2A 5AVZB 3A7OA 2N9BA 1CZQA 1N7SD 1NOHA 1JY3P 1VF5D 1AVYA 1IFNA 1NTMG 4XFJA 2H8PD 2IZ0A 3V2PA 5GTIE 1SQVJ 1GK4A 3H1ID 2GM4A 1NO4A 3AE3C 3BRVB 2XU6A 4WY4B 3IN6A 3L75G 1PZQA 1BDCA 2LKMA 2XZRA 4N3YB 3G4SP 5KLVG 3Q5SA 1NAFA 2QSIA 2Z5IA 3HUSA 1NTZG 1RF1B 1YBKA 2P67A 3L74G 4IL6X 1PGQA 4ZMDA 5AVSB 2K1AA 1SFCA 2A45G 2PRRA 1URQD 4XA4A 3FWNA 2WSCJ 2KZIA 1KB9I 1FDIA 1GDTA 2Q9IA 5E79H 1RHZB 2E75C 3TDKA 2I8DA 4PJ0E 5GTIH 3E1IA 3A0HE 2NPSC 1BSHA 3VMAA 2IYOA 1VQ5P 1VQPP 2IBZG 5CCHA 3QWOC 1QEXA 1QGKB 2JJLA 4H0LD 1S5LH 3PJSK 2Q5UA 5KLVE 4YTPC 2IFNA 2V4HA 3L70E 2FYZA 1HTLC 2Q3EA 4R4LA 5KJ7A 3PP5A 1NTZE 1LWUA 3S9OA 1ZR4A 3L74E 1W2EA 3AE6C 2W90A 4H44D 3A5TA 3U1CA 1JNMA 2C0XA 2Q6QA 3FXDA 1SVFA 2MKVA 2KNCB 3V4WA 3AEBC 2OGUA 3IFMA 1L0NJ 3CL3D 1PPJG 1BCCJ 1G1IA 2XDJA 3R2PA 2OARA 1RQVA 3KPEA 1PP9J 5GTHH 5B5EH 2I1JA 2WSEJ 2BCCD 1MV8A 3B8EB 1IFJA 2JP3A 2K3RA 5KKZC 2IBZE 4U3FD 2KP8A 3A3YB 1XTGB 1L2PA 4W7YA 3Q5PA 3ZDMA 4IFMA 2QJPC 4YPCA 2O1JA 1JOCA 2QA4P 2K37A 4C7NB 2QM7A 4GDOA 1HF9A 4GOFA 2WSFJ 2QJKB 3MUDC 3QH9A 1RF0C 1VQ7P 3VN0A 4B86A 1OXZA 3L72E 1FZEA 1JB0J 2WSSH 3KZIE 1PPJE 3AE5C 2ZYGA 1N73C 1Y9BA 1OVUA 4EDFA 3M9BA 2KUBA 3S4RA 2HYNA 1N7SC 4GKGA 5AW7B 1LTTC 3AE9C 2RN0A 2O01N 1FZFA 1NVOA 3VMXA 3TNUA 2WT7B 2QEXP 2QRXA 3GHGC 3IF4A 3O6QA 2IFMA 3AECC 2J58A 1YIJP 1KILA 1GL2D 2LXBA 3CWBJ 1ZMEC 1VDFA 3G9RA 1KQLA 4IFFA 4EOTA 4RESB 3B5NC 4OH8B 1JY3N 1DD3A 1SQVG 1A02J 3V5BA 5APUA 5KLVK 1FZCB 2JO1A 3NMDA 1YJNP 2KB7P 1URQC 2W83C 2M3BA 3OA7A 1LP1A 2C9LY 1JCCA 4C7RA 5CBOA 2KS1A 1L4AA 2QM8A 5AVVB 2M8RA 4L73A 1NAYA 5AW9B 5KLVD 1KILE 3L70D 2FFDC 3H1KG 2FYUJ 2E75B 3U1AA 2I1KA 1SFCD 1NTZD 1IK9A 4PV1D 2BEQD 4I6MC 1SQPG 3L74D 1L0LJ 3VTPC 1AQ5A 3M0AA 2PGDA 3SFDC 1X9VA 1DD4A 1P84E 1M56D 5CCHD 1SQQG 1NGMB 4A7PA 3CXHH 1GK6A 1ZOYC 2B89A 4UB6E 5APSA 2IBZD 3EFGA 3D6YA 5H2FH 3H1JJ 4ASVA 1NH4A 2OYHA 3TK1A 2KSJA 3GF7A 3H1KE 1DX7A 1CI6B 3AEDC 4HKZH 4LC1A 4CPGA 2R5BA 2Q3IA 1SQPE 1JY3O 1W2BO 1LT9A 5KKZB 1BCCG 1OIPA 2N1TB 3AEGC 1HBWA 1ZR2A 4NPEA 1VQNP 3LIEA 1SQXJ 2E74D 3L72D 2LR2A 3CLQA 3VMYA 1PPJD 1KFMA 1VQMP 2QJPB 3CI9A 3L73J 2P1JA 4OVNF 1SQQE 4PD4H 1KYOE 1JEKA 1M1JA 1SQBJ 1AJYA 2JWDA 4DT0A 3BASA 1YTZI 3MP7B 2KLVA 5EFWB 2FKWB 5KTBA 2JR8A 2WITA 1N73B 1ZLLA 2D2CD 3KXDA 3HD7C 1PFIA 2XKMA 4LLHA 1N7SB 1J1DC 3BCCJ 2V7QJ 4JYCA 3B4SA 2M5AB 4I2LC 1BCCE 3GHGB 3CD6P 3VMZA 4WY4A 1VQKP 1YJWP 4HH2A 2YXRB 1QL2A 3H1LE 4HJGH 5AW0B 2MJZA 5AW3B 3B5NB 2ZT9D 1RF1A 3TGUD 1HGZA 3BATA 3HTKB 1KILD 1G2CB 3AE7C 3CWBG 1EDLA 2W8ZA 1LGHB 3U59A 1URQB 2G8YA 3NTNA 4R4MA 1EZVE 3H32B 2B88A 2QJKC 3RBXA 1GW4A 3BRTB 2XNDH 1EQ7A 1H88A 1AFOA 2JWAA 4PV1C 2FFDB 1P84D 1NYHA 4H13D 2H7HA 2ZYDA 1L4AD 1X22A 2HPCB 3M9HA 3TSIA 1BGYG 1Q82Q 1SP4A 3HE4A 1SQPK 2WSEH 1YTZT 1HWTC 1NU1E 3H1HJ 5CBNA 2FYUG 1FDOA 5E79E 3VP9A 3H1KD 5AW1B 2Z4EA 3K5BA 2KI7B 3CCSP 2YNYA 5AVUB 3FWLA 1SQPD 2KNCA 2OQQA 1SQQK 4EIJA 1OWAA 2WPVB 2WSFH 3CX5E 4W80A 4M3LA 1IFMA 1S5LE 1Z56A 3F5HA 4Y28J 1IJDB 2RKLA 5DJUB 2FBWC 1FZCC 2Y0DA 3L71D 1YQ4C 5AVRB 2LXCB 3SWKA 1SQQD 1T2KD 3USSA 1D7MA 1BGYE 1NTKG 4D6TE 2Y0EA 3H1JG 1KYOD 2KYVA 1KQGB 2E74C 3CC2P 2Y0CA 3R4YA 4C7NA 2YIUC 5CCGA 1NTME 1FU1A 1U7MA 3H1IJ 2IYPA 1NJIQ 5GTHE 1Q7YQ 5B5EE 2A45I 1SQXG 4GODA 1LTIC 3LIDA 3RK3E 3L75E 3CX5H 3D6ZA 3L73G 1HUCA 3P8MC 1IO4A 1LTJA 3O8ZA 2R44A 1LJ2A 2E76D 3MD0A 3HD7B 3KQGA 1JCDA 3H1LD 1SQBG 4OWFA 4LGDE 2FXMA 2WT7A 2FY8A 5KLIC 3A2AA 2WTYA 1BDDA 1J1DB 5CJ4A 4K3AA 1NTKE 2IBZI 2K9JB 1JY2P 1YITP 2KLUA 2YKOA 2H43A 1VQ6P 1DIPA 1N7LA 1NWQA 2UWJE 3SWYA 5TISH 2KIKA 1S5LX 1JTHA 1WT6A 2ZT9C 2O3JA 1DH3A 1EZVD 1MKMA 1KILC 1NU1K 4L76A 2YO2A 2W27A 4WY4D 1FZAA 2G3AA 2NZ2A 2N1TC 1N2DC 1Y47A 2P58A 2YKPA 1JMMA 3M0DA 4AUWA 1NU1D 2XNXA 2O01J 1PGOA 3WUUA 4N6JA 1GD2E 3WUTA 2Q7CA 4GOEA 3D70A 1EDJA 2W6AA 2KK7A 4PV1B 4YXWH 1L4AC 3AEFC 4QMAA 3NFQA 2NPSA 1W5CE 1YYCA 3PHLA 1FC2C 3VP8A 2IZ1A 1ZRTE 1VF5C 3CX5D 2BCCJ 2CK3H 4HYTB 1U7JA 1RE4C 4U3FJ 1KQSO 1H0TB 1FJPA 2M0BA 3G6EP 1NTMK 3V6IA 1VL2A 2IDBA 1YHQP 3H1HG 2ZFCA 1S2EA 1VQ8P 1M7LA 1BGYD 2C9NY 4D6TD 1S3JA 3EQ2A 2A06G 1CI6A 2OYIA 3RBZA 1BE3J 4HB1A 1FZGA 2E42A 1VPCA 1NTMD 2H89C 1N8RQ 3FGAD 3RL0g 1RE3C 1G1JA 2ZJSE 1NTZK 1VQ4P 3RK2D 3CXHE 4ZKPA 3G3ZA 3WUVA 4JF7A 2E74B 2V7QH 1NTKK 2WQYC 5APTA 3RK3D 5H2FE 3L75D 2FYNB 1P84I 1LT9C 2YIUB 1E5WA 1YI2P 3UIAA 1EXJA 3MUDA 1GZLA 1RF0A 3CC4P 1GU5A 1NTKD 3ITKA 1K8AQ 4H0LC 5CCGD 2RH0A 4DOJA 4AYCA 1N73A 1ZN5A 1Q2NA 3L4FA 1FJKA 1UIIA 2D2CB 2E76C 3A0BH 3CMEP 3H1IG 1N7SA 1SQVE 4ASWA 2WVRA 5AVYB 4H44C 2BEZF 2N9YB 1FOSF 5KLIB 1M8OB 2QG4A 1IFDA 4PD4E 3H6PA 2GUSA 2L91A 2IPPA 3JSVC 1K05A 1MUUA 5KJ7D 3PLNA 5KLVJ 4Z1MH 3L70J 4UB8E 3V2NA 1A02F 1MFTA 3CCQP 3B5NA 2ZT9B 1J1EC 1KYOI 5APXA 3L74J 3HTKA 1G2CA 1KILB 4ZKUA 3II6A 1JY2N 2AEJA 2B87B 1L0NG 2R3SA 2NRGA 1JO5A 4W7ZA 1URQA 1PV3A 1DEEG 2AXTH 1PP9G 3MZWB 1K04A 4I1LA 2PAJA 1OZHA 5APVA 1ZRTD 1OVVA 2FFDA 4DCKA 1U57A 4TLFA 4JQ0D 1H8AA 1FAVA 3H25A 1FS0E 1JM0A 4H13B 5L8RJ 3KDPB 2KS1B 1L4AB 1NHLA 2QJYC 1S1CX 2E5YA 2FXOA 4UB8H 2AEFA 1OFCX 2WWWA 1NKNA 2C0WA 2KXPB 1VF5B 3JC22 4Y99C 2W6BA 3NXSA 1KV4A 2NPSD 1QL1A 1X79B 2ITAA 2WSCH 1L0NE 2YXQB 3CCVP 3L72J 1M90Q 1GL2C 1Y8AA 1PP9E 3AEEC 2HODB 1EZVI 2BCCG 3CXHD 5KAFH 4BRYB 1K73Q 3W68A 1T3JA 4U3FG 2AXCA 1SQVK 1FE6A 3RK2C 2OYHB 4N78E 3CC7P 1JY2O 1MZ9A 3RK3C 3HUSC 4NPFX 4K35A 1PIXA 2P2UA 1BE3G 1K9MQ 2BASA 2CPBA 3P32A 1LT9B 3HE5B 1SFCC 1SQVD 3CCUP 1FZBA 1KQFB 1AQTA 2ZXXA 3CX5I 4PD4D 1HH0A 5AW2B 1PGJA 2QIWA 4H0LB 3RL0D 3I5CA 3OAKA 1KD1Q 1SLQA 5APQA 2HG5D 3GLMA 4KHXA 3TGUJ 5AW6B 3HD7A 2E76B 5AW5B 1HVVA 1FOSE 1HGVA 4AQRD 5CCHC 1L0LG 1IFPA 3Q2YA 1EDKA 4H44B 1OW6A 3CWBE 4KJMA 2SPZA 3AE2C 2K9YA 2O01H 5KJ7C 1LWUC 1NKZB 3M9QA 1BE3E 5AVWB 1LTAC 1ZW0A 1KORA 4IL6H 3IR9A 1M1KQ 1WRGA 1J1EB 3IAOA 4L75A 4OGQD 3P8CE 2QVAA 1S9KE 5AW8B 1LTGC 3FXEA 3WU2E 4XE5B 3M91A 2YMKA 3L70G 3VYIA 1GU4A 5B66H 3B5ND 1L0NK 1R8EA 2P10A 2FYUE 2FYNC 5TISE 1EC5A 2E43A 2GUVA 3JCUH 5KAIE 2RMZA 3V2QA 3H1KJ 1L0LE 1PL5A 1RY3A 1SQPJ 1LT1A 3AE1C 1LNQA 3M0DC 4BXLA 1ZXGA 1WMKA 2HFED 2WPQA 2WZ7A 3GF3A 1T8ZA 2FXPA 1L0ND 5CHXA 1BCCD 2HLOA 3LW5J 2QJYB 1KC8Q 1FBMA 3L37A 2D2CC 1HJBA 3T97B 1PP9D 3WMM0 3L71J 4JPZB 1SQQJ 1H0TA 1QVFO 2WMMA 3N7NA 4Y99B 3WU2H 3HE4B 3H1JE 3KYQA 4EYYQ 1KB9E 3G71P 1GL2B 3V2RA 3CCEP 4N78D 5AVXB 2YKQA 5KAIH 3PTZA 3Q1MA 2XV5A 3BCCG 1S72P 2HR3A 2R3CA 1N86A 3TYYA 4KT0J 1FZCA 3L72G 1OW7A 1SQXE 3L36A 5K5GB 3CMAP 1AA0A 1S4XA 3PH0A 3RK2B 3AEAC 3L73E 5DJTB 4C46A 4PJ0H 2OYIC 4WB4A 3RK3B 3C1LA 3H1LJ 1T6AA 2ZXEB 3HUSB 3A0HH 1CSBA 2B9BA 1SQBE 3E7KA 3F89A 1LTSC 1R5SA 4MN4C 4EI2A 2M3EA 4L74A 1SFCB 4H13C 1IZNB 3Q3DA 2VRSA 1KB9H 1XTCC 2WPRA 2O1KA 3CWBD 1AVOA 4RO0A 3RL0C 5APWA
chains in the Genus database with same CATH topology
5AW0B 1IFDA 2MJZA 1SFCA 5AW3B 3B5NB 3H6PA 3L35A 2A45G 2GUSA 1URQD 4IFDK 1RF1A 4XA4A 2IPPA 1HGZA 2A45H 3BATA 5AW4B 3HTKB 1KILD 1GTWA 1GDTA 1MUUA 5KJ7D 4WBAA 2Q9IA 1G2CB 2FYUK 4JYBA 5BU5A 3V2NA 1A02F 3SWFA 3B5NA 1L0LK 2PP6A 1J1EC 1LGHB 3U59A 1URQB 3P8CD 1S9KD 1LTJB 3E1IA 5APXA 3NTNA 3HTKA 2NPSC 2YO3A 1G2CA 1KILB 3HD7D 4ZKUA 3II6A 3H32B 1LWUB 1JY2N 5CCHA 1GW4A 3BRTB 1EQ7A 1H88A 1AFOA 2JJLA 1JO5A 2R5DA 4W7ZA 2Q5UA 1URQA 2FFDB 1J2JB 2IFNA 2FYZA 3N4XA 1HTLC 1LTBC 5KJ7A 3PP5A 1T2KC 4I1LA 2H7HA 1X8YA 1LWUA 2OYHC 1L4AD 1ZR4A 2HPCB 3M9HA 3TSIA 1GW3A 1SP4A 2PAJA 5APVA 1W2EA 3HE4A 1SQPK 2N1TA 1JTHB 2WSEH 2FFDA 3A5TA 1YTZT 1HWTC 3U1CA 2JEEA 1JNMA 2C0XA 1H8AA 1FAVA 1SVFA 3KDPB 3V4WA 3IFMA 1L4AB 1NHLA 5BVZA 3CL3D 2XDJA 1G1IA 3R2PA 3VP9A 5AW1B 2OARA 2Z4EA 3KPEA 2YMYA 2YNYA 5AVUB 2WWWA 2I1JA 1SQQK 1NKNA 1OWAA 4EIJA 5CJ0A 2C0WA 2WSFH 1MV8A 3B8EB 1IFJA 4Y99C 4W80A 2W6BA 3NXSA 4M3LA 2NPSD 1QL1A 1IFMA 1X79B 2KP8A 3A3YB 1SQXK 1H89A 1XTGB 1Z56A 2WSCH 1IJDB 4W7YA 1M1JC 1MFZA 4IFMA 1CW5A 1GL2C 1FZCC 2O1JA 1JOCA 5AVRB 1ZV8A 2HODB 2NPSB 5CMZA 4C7NB 1T2KD 2QM7A 1RE4A 3HRNA 1T3JA 1SQBK 2KYVA 1RF0C 3GHGA 1IC2A 3VN0A 4B86A 2CPSA 2HODA 1OXZA 4C7NA 1FZEA 5CCGA 1SQVK 3MGNA 3RK2C 2OYHB 1N73C 1FU1A 4N78E 2P7JA 3TNUB 1JY2O 3M9BA 1T3UA 1MZ9A 2HYNA 3RK3C 1N7SC 3HUSC 4GKGA 2A45I 4WY4C 5AW7B 1LTTC 1LTIC 2P2UA 3BVHA 2J59M 3LIDA 2BASA 1FZFA 1RE3A 2CPBA 5BU8B 3VMXA 3TNUA 2WT7B 3P32A 1LT9B 1HUCA 3HE5B 3P8MC 1SFCC 3GHGC 1IO4A 1LTJA 3O8ZA 2IFMA 1RF1C 2J58A 1FZBA 2OYIB 1KILA 3MD0A 3HD7B 3KQGA 1JCDA 1GL2D 3H32A 1VDFA 4LGDE 2FXMA 2WT7A 3A2AA 1HH0A 2WTYA 3HE5A 1KQLA 5AW2B 4IFFA 1J1DB 3P7KA 5CJ4A 4EOTA 4RESB 3B5NC 3RL0D 3I5CA 1JY2P 4OH8B 3OAKA 1JY3N 1SLQA 2YKOA 5APQA 2HG5D 4KHXA 2H43A 1A02J 3V5BA 5AW6B 1N7LA 3HD7A 1NWQA 5APUA 5AW5B 5KLVK 1HVVA 3C9IA 1FZCB 3SWYA 4O9BA 1FOSE 2HPCA 1HGVA 4AQRD 4GIFA 5CCHC 1JTHA 1WT6A 3NMDA 2KB7P 3RL0B 1URQC 2M3BA 1JUNA 3OA7A 1DH3A 2C9LY 1JCCA 4C7RA 2O01H 1KILC 1NU1K 5KJ7C 1L4AA 2QM8A 2YO2A 5AVVB 2M8RA 1LWUC 2W27A 1NKZB 3M9QA 4WY4D 5AVWB 1FZAA 1LTAC 5AW9B 2N1TC 1KZUB 1N2DC 2FFDC 3U1AA 3IR9A 2I1KA 2KOGA 1SFCD 2YKPA 2Z5HA 1JMMA 1WRGA 1IK9A 4I6MC 1J1EB 3V4QA 4GT1A 4DZOA 3M0DA 4AUWA 3P8CE 1S9KE 5AW8B 3VTPC 1LTGC 2XNXA 1AQ5A 4XE5B 3M91A 4N6JA 1GD2E 3M0AA 2IX7C 2Q7CA 3VYIA 1GU4A 2W6AA 3B5ND 1L0NK 3LW5H 1X9VA 1L4AC 5AVTB 3NFQA 2E43A 2NPSA 2GUVA 1YYCA 3V2QA 3OJAB 3M06A 2WPSA 5CCHD 3VP8A 1RY3A 1GK6A 3VOPA 2L5GB 3M0DC 2R32A 5APSA 2HFED 2WPQA 2WZ7A 3EFGA 1T8ZA 2OYHA 1NH4A 5CHXA 3TK1A 4HYTB 1RE4C 2HLOA 2KSJA 5APYA 2POHA 1FDMA 1FBMA 3L37A 1FJPA 1HJBA 2N1TD 1NTMK 1DX7A 1IFIA 1CI6B 3WMM0 2ZFCA 4LC1A 2R5BA 1M7LA 2Q3IA 1JY3O 5CCGC 2C9NY 3N7NA 1LT9A 4Y99B 3EQ2A 1DEBA 3HE4B 3T97A 3KYQA 2N1TB 1HBWA 1ZR2A 3LIEA 1CI6A 2OYIA 1FZGA 2E42A 3CLQA 1VPCA 1M1JB 3VMYA 1GL2B 5AVQB 3V2RA 1KFMA 4N78D 3CI9A 5AVXB 2YKQA 1RE3C 1G1JA 2P1JA 1NTZK 3MTUE 3MIWA 3RK2D 2XV5A 4ZKPA 2R3CA 1KFNA 1LTJC 3G3ZA 4JF7A 1N86A 1NTKK 1M1JA 3TYYA 1GL2A 5AVZB 5APTA 3A7OA 1FZCA 2N9BA 1CZQA 3RK3D 1N7SD 3BASA 1NOHA 1JY3P 1YTZI 3L36A 1IFNA 2KLVA 1LT9C 1E5WA 2H8PD 3V2PA 3UIAA 2FKWB 3RK2B 5KTBA 1GK4A 2WITA 1N73B 3MUDA 1GZLA 2GM4A 1NO4A 1RF0A 1ZLLA 3BRVB 4C46A 2OYIC 2XU6A 4WB4A 3HD7C 1PFIA 2XKMA 4LLHA 3RK3B 1N7SB 2ZXEB 3HUSB 1GU5A 4WY4B 1CSBA 1J1DC 1LTSC 4JYCA 5CCGD 2LKMA 2XZRA 4DOJA 4N3YB 4AYCA 1N73A 1ZN5A 4I2LC 3L4FA 1FJKA 1SFCB 3GHGB 1NAFA 1N7SA 2Z5IA 3HUSA 3VMZA 1RF1B 2VRSA 4WY4A 1XTCC 4HH2A 5AVYB 2WPRA 2O1KA 2P67A 1QL2A 3RL0C 1FOSF 5APWA 5AVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3L A;  5AW0 B;  1FOS E;  2KP8 A;  3A3Y B;  1CI6 B;  5AW3 B;  2ZFC A;  4LC1 A;  4AQR D;  1H89 A;  2R5B A;  3L35 A;  2Q3I A;  2C9N Y;  2IPP A;  3NMD A;  1MFZ A;  5AW4 B;  1GTW A;  1JUN A;  1MUU A;  1G2C B;  1DH3 A;  3HE4 B;  3T97 A;  2C9L Y;  4JYB A;  5AVR B;  1HBW A;  3LIE A;  5CMZ A;  2QM8 A;  2YO2 A;  4C7N B;  1A02 F;  3SWF A;  5AVV B;  1CI6 A;  1T2K D;  2QM7 A;  2W27 A;  2E42 A;  5AVW B;  3VMY A;  5AVQ B;  1S9K D;  5AW9 B;  5APX A;  5AVX B;  3NTN A;  3HTK A;  2YO3 A;  3VN0 A;  4B86 A;  3IR9 A;  1OXZ A;  2XV5 A;  2Z5H A;  2R3C A;  4C7N A;  4I6M C;  3V4Q A;  3MGN A;  4GT1 A;  4DZO A;  3M0D A;  1H88 A;  4AUW A;  1S9K E;  2JJL A;  2R5D A;  5AW8 B;  2Q5U A;  3TYY A;  5AVZ B;  5APT A;  3A7O A;  1J2J B;  3VTP C;  2P7J A;  2N9B A;  3TNU B;  1CZQ A;  3L36 A;  4XE5 B;  3M9B A;  3M91 A;  1GD2 E;  3M0A A;  1T2K C;  2H7H A;  1X8Y A;  4GKG A;  2Q7C A;  3VYI A;  3UIA A;  1GU4 A;  2W6A A;  5AW7 B;  3M9H A;  1GK4 A;  1SP4 A;  5APV A;  3HE4 A;  1GZL A;  2P2U A;  5AVT B;  3NFQ A;  4C46 A;  3LID A;  3A5T A;  2BAS A;  1HWT C;  2XU6 A;  2E43 A;  1JNM A;  3VMX A;  3TNU A;  2WT7 B;  3P32 A;  1YYC A;  1H8A A;  1HUC A;  1FAV A;  3HE5 B;  2ZXE B;  3P8M C;  3M06 A;  1IO4 A;  2WPS A;  1GU5 A;  1CSB A;  3O8Z A;  3KDP B;  3V4W A;  4JYC A;  2XZR A;  4AYC A;  1GK6 A;  3MD0 A;  3KQG A;  4I2L C;  5AW1 B;  2WT7 A;  2R32 A;  1NAF A;  5APS A;  2WPQ A;  3A2A A;  2WTY A;  3HE5 A;  1KQL A;  2Z5I A;  5AW2 B;  3P7K A;  4EOT A;  3VMZ A;  2YNY A;  2VRS A;  5AVU B;  4HYT B;  3TK1 A;  4RES B;  2WWW A;  3I5C A;  5AVY B;  1OWA A;  2WPR A;  2P67 A;  5APY A;  3OAK A;  1SLQ A;  5APQ A;  3L37 A;  4KHX A;  1MV8 A;  1HJB A;  1A02 J;  3V5B A;  3B8E B;  5AW6 B;  1FOS F;  5APW A;  1NWQ A;  3NXS A;  5AVS B;  5APU A;  5AW5 B; 
#chains in the Genus database with same CATH topology
 2JKV A;  3BCC E;  4RKU J;  3L35 A;  4IFD K;  1BE3 D;  1SS1 A;  2A45 H;  5AW4 B;  1GMJ A;  1GTW A;  4WBA A;  2FYU K;  4JYB A;  5M1B A;  5BU5 A;  3SWF A;  2Q1K A;  3CXH I;  1L0L K;  2PP6 A;  3CPW O;  3P8C D;  4ZNC A;  1S9K D;  1LTJ B;  1KMI Z;  1OX3 A;  1EDI A;  2YO3 A;  3HD7 D;  3TGU G;  4WVZ A;  1LWU B;  1NU1 J;  2R5D A;  3A0B E;  2FYU D;  1J2J B;  4OGQ C;  1USE A;  3N4X A;  1LTB C;  1UIX A;  1T2K C;  3EFF K;  1X8Y A;  1L0L D;  2OYH C;  2B87 A;  2OTL P;  4I7Z C;  1GW3 A;  1Q81 Q;  4WWI A;  3CCM P;  2N1T A;  1JTH B;  1QLE D;  2JEE A;  3PRJ A;  3TF5 A;  3GG2 A;  1AV1 A;  5BVZ A;  1USD A;  4IOI H;  4DJG A;  3KZI H;  3I55 P;  4PD4 I;  2YMY A;  1QVG O;  3AE8 C;  2E5T A;  5CJ0 A;  2OYO A;  1X0T A;  3H1H E;  1BGY J;  4D6T J;  2QE7 H;  3TGU E;  3H1J D;  1R5L A;  1SQX K;  1H89 A;  2A06 E;  1KB9 D;  1Q90 D;  2AXT E;  3SFE C;  1M1J C;  1MFZ A;  1CW5 A;  1JMB A;  1NTM J;  2AEM A;  1OMI A;  1ZV8 A;  2JDI H;  2NPS B;  5CMZ A;  4JBZ A;  1M57 D;  3MHV A;  1RE4 A;  2M5A A;  3HRN A;  1VQ9 P;  1SQB K;  3GHG A;  1YQ3 C;  3D71 A;  1IC2 A;  1SQX D;  1EXI A;  2CPS A;  3L75 J;  2HOD A;  3I56 P;  3E1R A;  4BRY A;  3L71 G;  3MGN A;  3C8V A;  3L73 D;  2P7J A;  2PFX A;  3TNU B;  3CCL P;  4TT3 H;  1T3U A;  1NTZ J;  3O6Q B;  1SQB D;  4WY4 C;  3BVH A;  1NTK J;  2J59 M;  1RE3 A;  3B71 A;  5BU8 B;  1RH5 B;  1RF1 C;  3H1I E;  2OYI B;  3H32 A;  5KAF E;  3GMA A;  3BCC D;  3HE5 A;  2KZJ A;  1VQO P;  3P7K A;  1IK7 A;  1LP1 B;  1E79 H;  3C9I A;  4O9B A;  2HPC A;  1BSN A;  4GIF A;  3L71 E;  3H1L G;  1P84 H;  3RL0 B;  1JUN A;  2E75 D;  4YXD C;  2Y9Y A;  3OW2 O;  2GA1 A;  4UB6 H;  3W67 A;  1KZU B;  1RQU A;  2Y9Z A;  2ZYA A;  3EWK A;  2KOG A;  2ZVO B;  2Z5H A;  2DW3 A;  3V4Q A;  4GT1 A;  4DZO A;  1EZV G;  5C39 A;  1HJ0 A;  1OVR A;  3AE4 C;  1OW8 A;  2IX7 C;  2OTK E;  3LW5 H;  4OGQ B;  1QX8 A;  5AVT B;  1YJ9 P;  4RJT A;  3OJA B;  3M06 A;  2WPS A;  3ABV C;  4I7Z B;  1NU1 G;  3S1K A;  3H1H D;  3CCJ P;  3VOP A;  1KYO H;  2L5G B;  2J5U A;  2W6J H;  2R32 A;  4BWN A;  1KTM A;  3CCR P;  2A06 D;  5APY A;  4IL6 E;  2POH A;  1FDM A;  1TU3 F;  2N1T D;  2ZVN B;  1IFI A;  3KHU A;  2K88 A;  3GW6 A;  3SSU A;  2OTJ P;  5CCG C;  1KN7 A;  1ZP0 C;  4U7J A;  2BCC E;  1DEB A;  3T97 A;  5B66 E;  2ZAE B;  4U3F E;  2KSE A;  2H88 C;  1M1J B;  3JCU E;  5AVQ B;  3Q5R A;  3RGU A;  1PGP A;  5TJH A;  1VQL P;  4D6T G;  3MTU E;  2K9J A;  3MIW A;  3FX0 A;  1KFN A;  1LTJ C;  4NPD A;  1Q86 Q;  1GL2 A;  5AVZ B;  3A7O A;  2N9B A;  1CZQ A;  1N7S D;  1NOH A;  1JY3 P;  1VF5 D;  1AVY A;  1IFN A;  1NTM G;  4XFJ A;  2H8P D;  2IZ0 A;  3V2P A;  5GTI E;  1SQV J;  1GK4 A;  3H1I D;  2GM4 A;  1NO4 A;  3AE3 C;  3BRV B;  2XU6 A;  4WY4 B;  3IN6 A;  3L75 G;  1PZQ A;  1BDC A;  2LKM A;  2XZR A;  4N3Y B;  3G4S P;  5KLV G;  3Q5S A;  1NAF A;  2QSI A;  2Z5I A;  3HUS A;  1NTZ G;  1RF1 B;  1YBK A;  2P67 A;  3L74 G;  4IL6 X;  1PGQ A;  4ZMD A;  5AVS B;  2K1A A;  1SFC A;  2A45 G;  2PRR A;  1URQ D;  4XA4 A;  3FWN A;  2WSC J;  2KZI A;  1KB9 I;  1FDI A;  1GDT A;  2Q9I A;  5E79 H;  1RHZ B;  2E75 C;  3TDK A;  2I8D A;  4PJ0 E;  5GTI H;  3E1I A;  3A0H E;  2NPS C;  1BSH A;  3VMA A;  2IYO A;  1VQ5 P;  1VQP P;  2IBZ G;  5CCH A;  3QWO C;  1QEX A;  1QGK B;  2JJL A;  4H0L D;  1S5L H;  3PJS K;  2Q5U A;  5KLV E;  4YTP C;  2IFN A;  2V4H A;  3L70 E;  2FYZ A;  1HTL C;  2Q3E A;  4R4L A;  5KJ7 A;  3PP5 A;  1NTZ E;  1LWU A;  3S9O A;  1ZR4 A;  3L74 E;  1W2E A;  3AE6 C;  2W90 A;  4H44 D;  3A5T A;  3U1C A;  1JNM A;  2C0X A;  2Q6Q A;  3FXD A;  1SVF A;  2MKV A;  2KNC B;  3V4W A;  3AEB C;  2OGU A;  3IFM A;  1L0N J;  3CL3 D;  1PPJ G;  1BCC J;  1G1I A;  2XDJ A;  3R2P A;  2OAR A;  1RQV A;  3KPE A;  1PP9 J;  5GTH H;  5B5E H;  2I1J A;  2WSE J;  2BCC D;  1MV8 A;  3B8E B;  1IFJ A;  2JP3 A;  2K3R A;  5KKZ C;  2IBZ E;  4U3F D;  2KP8 A;  3A3Y B;  1XTG B;  1L2P A;  4W7Y A;  3Q5P A;  3ZDM A;  4IFM A;  2QJP C;  4YPC A;  2O1J A;  1JOC A;  2QA4 P;  2K37 A;  4C7N B;  2QM7 A;  4GDO A;  1HF9 A;  4GOF A;  2WSF J;  2QJK B;  3MUD C;  3QH9 A;  1RF0 C;  1VQ7 P;  3VN0 A;  4B86 A;  1OXZ A;  3L72 E;  1FZE A;  1JB0 J;  2WSS H;  3KZI E;  1PPJ E;  3AE5 C;  2ZYG A;  1N73 C;  1Y9B A;  1OVU A;  4EDF A;  3M9B A;  2KUB A;  3S4R A;  2HYN A;  1N7S C;  4GKG A;  5AW7 B;  1LTT C;  3AE9 C;  2RN0 A;  2O01 N;  1FZF A;  1NVO A;  3VMX A;  3TNU A;  2WT7 B;  2QEX P;  2QRX A;  3GHG C;  3IF4 A;  3O6Q A;  2IFM A;  3AEC C;  2J58 A;  1YIJ P;  1KIL A;  1GL2 D;  2LXB A;  3CWB J;  1ZME C;  1VDF A;  3G9R A;  1KQL A;  4IFF A;  4EOT A;  4RES B;  3B5N C;  4OH8 B;  1JY3 N;  1DD3 A;  1SQV G;  1A02 J;  3V5B A;  5APU A;  5KLV K;  1FZC B;  2JO1 A;  3NMD A;  1YJN P;  2KB7 P;  1URQ C;  2W83 C;  2M3B A;  3OA7 A;  1LP1 A;  2C9L Y;  1JCC A;  4C7R A;  5CBO A;  2KS1 A;  1L4A A;  2QM8 A;  5AVV B;  2M8R A;  4L73 A;  1NAY A;  5AW9 B;  5KLV D;  1KIL E;  3L70 D;  2FFD C;  3H1K G;  2FYU J;  2E75 B;  3U1A A;  2I1K A;  1SFC D;  1NTZ D;  1IK9 A;  4PV1 D;  2BEQ D;  4I6M C;  1SQP G;  3L74 D;  1L0L J;  3VTP C;  1AQ5 A;  3M0A A;  2PGD A;  3SFD C;  1X9V A;  1DD4 A;  1P84 E;  1M56 D;  5CCH D;  1SQQ G;  1NGM B;  4A7P A;  3CXH H;  1GK6 A;  1ZOY C;  2B89 A;  4UB6 E;  5APS A;  2IBZ D;  3EFG A;  3D6Y A;  5H2F H;  3H1J J;  4ASV A;  1NH4 A;  2OYH A;  3TK1 A;  2KSJ A;  3GF7 A;  3H1K E;  1DX7 A;  1CI6 B;  3AED C;  4HKZ H;  4LC1 A;  4CPG A;  2R5B A;  2Q3I A;  1SQP E;  1JY3 O;  1W2B O;  1LT9 A;  5KKZ B;  1BCC G;  1OIP A;  2N1T B;  3AEG C;  1HBW A;  1ZR2 A;  4NPE A;  1VQN P;  3LIE A;  1SQX J;  2E74 D;  3L72 D;  2LR2 A;  3CLQ A;  3VMY A;  1PPJ D;  1KFM A;  1VQM P;  2QJP B;  3CI9 A;  3L73 J;  2P1J A;  4OVN F;  1SQQ E;  4PD4 H;  1KYO E;  1JEK A;  1M1J A;  1SQB J;  1AJY A;  2JWD A;  4DT0 A;  3BAS A;  1YTZ I;  3MP7 B;  2KLV A;  5EFW B;  2FKW B;  5KTB A;  2JR8 A;  2WIT A;  1N73 B;  1ZLL A;  2D2C D;  3KXD A;  3HD7 C;  1PFI A;  2XKM A;  4LLH A;  1N7S B;  1J1D C;  3BCC J;  2V7Q J;  4JYC A;  3B4S A;  2M5A B;  4I2L C;  1BCC E;  3GHG B;  3CD6 P;  3VMZ A;  4WY4 A;  1VQK P;  1YJW P;  4HH2 A;  2YXR B;  1QL2 A;  3H1L E;  4HJG H;  5AW0 B;  2MJZ A;  5AW3 B;  3B5N B;  2ZT9 D;  1RF1 A;  3TGU D;  1HGZ A;  3BAT A;  3HTK B;  1KIL D;  1G2C B;  3AE7 C;  3CWB G;  1EDL A;  2W8Z A;  1LGH B;  3U59 A;  1URQ B;  2G8Y A;  3NTN A;  4R4M A;  1EZV E;  3H32 B;  2B88 A;  2QJK C;  3RBX A;  1GW4 A;  3BRT B;  2XND H;  1EQ7 A;  1H88 A;  1AFO A;  2JWA A;  4PV1 C;  2FFD B;  1P84 D;  1NYH A;  4H13 D;  2H7H A;  2ZYD A;  1L4A D;  1X22 A;  2HPC B;  3M9H A;  3TSI A;  1BGY G;  1Q82 Q;  1SP4 A;  3HE4 A;  1SQP K;  2WSE H;  1YTZ T;  1HWT C;  1NU1 E;  3H1H J;  5CBN A;  2FYU G;  1FDO A;  5E79 E;  3VP9 A;  3H1K D;  5AW1 B;  2Z4E A;  3K5B A;  2KI7 B;  3CCS P;  2YNY A;  5AVU B;  3FWL A;  1SQP D;  2KNC A;  2OQQ A;  1SQQ K;  4EIJ A;  1OWA A;  2WPV B;  2WSF H;  3CX5 E;  4W80 A;  4M3L A;  1IFM A;  1S5L E;  1Z56 A;  3F5H A;  4Y28 J;  1IJD B;  2RKL A;  5DJU B;  2FBW C;  1FZC C;  2Y0D A;  3L71 D;  1YQ4 C;  5AVR B;  2LXC B;  3SWK A;  1SQQ D;  1T2K D;  3USS A;  1D7M A;  1BGY E;  1NTK G;  4D6T E;  2Y0E A;  3H1J G;  1KYO D;  2KYV A;  1KQG B;  2E74 C;  3CC2 P;  2Y0C A;  3R4Y A;  4C7N A;  2YIU C;  5CCG A;  1NTM E;  1FU1 A;  1U7M A;  3H1I J;  2IYP A;  1NJI Q;  5GTH E;  1Q7Y Q;  5B5E E;  2A45 I;  1SQX G;  4GOD A;  1LTI C;  3LID A;  3RK3 E;  3L75 E;  3CX5 H;  3D6Z A;  3L73 G;  1HUC A;  3P8M C;  1IO4 A;  1LTJ A;  3O8Z A;  2R44 A;  1LJ2 A;  2E76 D;  3MD0 A;  3HD7 B;  3KQG A;  1JCD A;  3H1L D;  1SQB G;  4OWF A;  4LGD E;  2FXM A;  2WT7 A;  2FY8 A;  5KLI C;  3A2A A;  2WTY A;  1BDD A;  1J1D B;  5CJ4 A;  4K3A A;  1NTK E;  2IBZ I;  2K9J B;  1JY2 P;  1YIT P;  2KLU A;  2YKO A;  2H43 A;  1VQ6 P;  1DIP A;  1N7L A;  1NWQ A;  2UWJ E;  3SWY A;  5TIS H;  2KIK A;  1S5L X;  1JTH A;  1WT6 A;  2ZT9 C;  2O3J A;  1DH3 A;  1EZV D;  1MKM A;  1KIL C;  1NU1 K;  4L76 A;  2YO2 A;  2W27 A;  4WY4 D;  1FZA A;  2G3A A;  2NZ2 A;  2N1T C;  1N2D C;  1Y47 A;  2P58 A;  2YKP A;  1JMM A;  3M0D A;  4AUW A;  1NU1 D;  2XNX A;  2O01 J;  1PGO A;  3WUU A;  4N6J A;  1GD2 E;  3WUT A;  2Q7C A;  4GOE A;  3D70 A;  1EDJ A;  2W6A A;  2KK7 A;  4PV1 B;  4YXW H;  1L4A C;  3AEF C;  4QMA A;  3NFQ A;  2NPS A;  1W5C E;  1YYC A;  3PHL A;  1FC2 C;  3VP8 A;  2IZ1 A;  1ZRT E;  1VF5 C;  3CX5 D;  2BCC J;  2CK3 H;  4HYT B;  1U7J A;  1RE4 C;  4U3F J;  1KQS O;  1H0T B;  1FJP A;  2M0B A;  3G6E P;  1NTM K;  3V6I A;  1VL2 A;  2IDB A;  1YHQ P;  3H1H G;  2ZFC A;  1S2E A;  1VQ8 P;  1M7L A;  1BGY D;  2C9N Y;  4D6T D;  1S3J A;  3EQ2 A;  2A06 G;  1CI6 A;  2OYI A;  3RBZ A;  1BE3 J;  4HB1 A;  1FZG A;  2E42 A;  1VPC A;  1NTM D;  2H89 C;  1N8R Q;  3FGA D;  3RL0 g;  1RE3 C;  1G1J A;  2ZJS E;  1NTZ K;  1VQ4 P;  3RK2 D;  3CXH E;  4ZKP A;  3G3Z A;  3WUV A;  4JF7 A;  2E74 B;  2V7Q H;  1NTK K;  2WQY C;  5APT A;  3RK3 D;  5H2F E;  3L75 D;  2FYN B;  1P84 I;  1LT9 C;  2YIU B;  1E5W A;  1YI2 P;  3UIA A;  1EXJ A;  3MUD A;  1GZL A;  1RF0 A;  3CC4 P;  1GU5 A;  1NTK D;  3ITK A;  1K8A Q;  4H0L C;  5CCG D;  2RH0 A;  4DOJ A;  4AYC A;  1N73 A;  1ZN5 A;  1Q2N A;  3L4F A;  1FJK A;  1UII A;  2D2C B;  2E76 C;  3A0B H;  3CME P;  3H1I G;  1N7S A;  1SQV E;  4ASW A;  2WVR A;  5AVY B;  4H44 C;  2BEZ F;  2N9Y B;  1FOS F;  5KLI B;  1M8O B;  2QG4 A;  1IFD A;  4PD4 E;  3H6P A;  2GUS A;  2L91 A;  2IPP A;  3JSV C;  1K05 A;  1MUU A;  5KJ7 D;  3PLN A;  5KLV J;  4Z1M H;  3L70 J;  4UB8 E;  3V2N A;  1A02 F;  1MFT A;  3CCQ P;  3B5N A;  2ZT9 B;  1J1E C;  1KYO I;  5APX A;  3L74 J;  3HTK A;  1G2C A;  1KIL B;  4ZKU A;  3II6 A;  1JY2 N;  2AEJ A;  2B87 B;  1L0N G;  2R3S A;  2NRG A;  1JO5 A;  4W7Z A;  1URQ A;  1PV3 A;  1DEE G;  2AXT H;  1PP9 G;  3MZW B;  1K04 A;  4I1L A;  2PAJ A;  1OZH A;  5APV A;  1ZRT D;  1OVV A;  2FFD A;  4DCK A;  1U57 A;  4TLF A;  4JQ0 D;  1H8A A;  1FAV A;  3H25 A;  1FS0 E;  1JM0 A;  4H13 B;  5L8R J;  3KDP B;  2KS1 B;  1L4A B;  1NHL A;  2QJY C;  1S1C X;  2E5Y A;  2FXO A;  4UB8 H;  2AEF A;  1OFC X;  2WWW A;  1NKN A;  2C0W A;  2KXP B;  1VF5 B;  3JC2 2;  4Y99 C;  2W6B A;  3NXS A;  1KV4 A;  2NPS D;  1QL1 A;  1X79 B;  2ITA A;  2WSC H;  1L0N E;  2YXQ B;  3CCV P;  3L72 J;  1M90 Q;  1GL2 C;  1Y8A A;  1PP9 E;  3AEE C;  2HOD B;  1EZV I;  2BCC G;  3CXH D;  5KAF H;  4BRY B;  1K73 Q;  3W68 A;  1T3J A;  4U3F G;  2AXC A;  1SQV K;  1FE6 A;  3RK2 C;  2OYH B;  4N78 E;  3CC7 P;  1JY2 O;  1MZ9 A;  3RK3 C;  3HUS C;  4NPF X;  4K35 A;  1PIX A;  2P2U A;  1BE3 G;  1K9M Q;  2BAS A;  2CPB A;  3P32 A;  1LT9 B;  3HE5 B;  1SFC C;  1SQV D;  3CCU P;  1FZB A;  1KQF B;  1AQT A;  2ZXX A;  3CX5 I;  4PD4 D;  1HH0 A;  5AW2 B;  1PGJ A;  2QIW A;  4H0L B;  3RL0 D;  3I5C A;  3OAK A;  1KD1 Q;  1SLQ A;  5APQ A;  2HG5 D;  3GLM A;  4KHX A;  3TGU J;  5AW6 B;  3HD7 A;  2E76 B;  5AW5 B;  1HVV A;  1FOS E;  1HGV A;  4AQR D;  5CCH C;  1L0L G;  1IFP A;  3Q2Y A;  1EDK A;  4H44 B;  1OW6 A;  3CWB E;  4KJM A;  2SPZ A;  3AE2 C;  2K9Y A;  2O01 H;  5KJ7 C;  1LWU C;  1NKZ B;  3M9Q A;  1BE3 E;  5AVW B;  1LTA C;  1ZW0 A;  1KOR A;  4IL6 H;  3IR9 A;  1M1K Q;  1WRG A;  1J1E B;  3IAO A;  4L75 A;  4OGQ D;  3P8C E;  2QVA A;  1S9K E;  5AW8 B;  1LTG C;  3FXE A;  3WU2 E;  4XE5 B;  3M91 A;  2YMK A;  3L70 G;  3VYI A;  1GU4 A;  5B66 H;  3B5N D;  1L0N K;  1R8E A;  2P10 A;  2FYU E;  2FYN C;  5TIS E;  1EC5 A;  2E43 A;  2GUV A;  3JCU H;  5KAI E;  2RMZ A;  3V2Q A;  3H1K J;  1L0L E;  1PL5 A;  1RY3 A;  1SQP J;  1LT1 A;  3AE1 C;  1LNQ A;  3M0D C;  4BXL A;  1ZXG A;  1WMK A;  2HFE D;  2WPQ A;  2WZ7 A;  3GF3 A;  1T8Z A;  2FXP A;  1L0N D;  5CHX A;  1BCC D;  2HLO A;  3LW5 J;  2QJY B;  1KC8 Q;  1FBM A;  3L37 A;  2D2C C;  1HJB A;  3T97 B;  1PP9 D;  3WMM 0;  3L71 J;  4JPZ B;  1SQQ J;  1H0T A;  1QVF O;  2WMM A;  3N7N A;  4Y99 B;  3WU2 H;  3HE4 B;  3H1J E;  3KYQ A;  4EYY Q;  1KB9 E;  3G71 P;  1GL2 B;  3V2R A;  3CCE P;  4N78 D;  5AVX B;  2YKQ A;  5KAI H;  3PTZ A;  3Q1M A;  2XV5 A;  3BCC G;  1S72 P;  2HR3 A;  2R3C A;  1N86 A;  3TYY A;  4KT0 J;  1FZC A;  3L72 G;  1OW7 A;  1SQX E;  3L36 A;  5K5G B;  3CMA P;  1AA0 A;  1S4X A;  3PH0 A;  3RK2 B;  3AEA C;  3L73 E;  5DJT B;  4C46 A;  4PJ0 H;  2OYI C;  4WB4 A;  3RK3 B;  3C1L A;  3H1L J;  1T6A A;  2ZXE B;  3HUS B;  3A0H H;  1CSB A;  2B9B A;  1SQB E;  3E7K A;  3F89 A;  1LTS C;  1R5S A;  4MN4 C;  4EI2 A;  2M3E A;  4L74 A;  1SFC B;  4H13 C;  1IZN B;  3Q3D A;  2VRS A;  1KB9 H;  1XTC C;  2WPR A;  2O1K A;  3CWB D;  1AVO A;  4RO0 A;  3RL0 C;  5APW A; 
#chains in the Genus database with same CATH homology
 5AW0 B;  1IFD A;  2MJZ A;  1SFC A;  5AW3 B;  3B5N B;  3H6P A;  3L35 A;  2A45 G;  2GUS A;  1URQ D;  4IFD K;  1RF1 A;  4XA4 A;  2IPP A;  1HGZ A;  2A45 H;  3BAT A;  5AW4 B;  3HTK B;  1KIL D;  1GTW A;  1GDT A;  1MUU A;  5KJ7 D;  4WBA A;  2Q9I A;  1G2C B;  2FYU K;  4JYB A;  5BU5 A;  3V2N A;  1A02 F;  3SWF A;  3B5N A;  1L0L K;  2PP6 A;  1J1E C;  1LGH B;  3U59 A;  1URQ B;  3P8C D;  1S9K D;  1LTJ B;  3E1I A;  5APX A;  3NTN A;  3HTK A;  2NPS C;  2YO3 A;  1G2C A;  1KIL B;  3HD7 D;  4ZKU A;  3II6 A;  3H32 B;  1LWU B;  1JY2 N;  5CCH A;  1GW4 A;  3BRT B;  1EQ7 A;  1H88 A;  1AFO A;  2JJL A;  1JO5 A;  2R5D A;  4W7Z A;  2Q5U A;  1URQ A;  2FFD B;  1J2J B;  2IFN A;  2FYZ A;  3N4X A;  1HTL C;  1LTB C;  5KJ7 A;  3PP5 A;  1T2K C;  4I1L A;  2H7H A;  1X8Y A;  1LWU A;  2OYH C;  1L4A D;  1ZR4 A;  2HPC B;  3M9H A;  3TSI A;  1GW3 A;  1SP4 A;  2PAJ A;  5APV A;  1W2E A;  3HE4 A;  1SQP K;  2N1T A;  1JTH B;  2WSE H;  2FFD A;  3A5T A;  1YTZ T;  1HWT C;  3U1C A;  2JEE A;  1JNM A;  2C0X A;  1H8A A;  1FAV A;  1SVF A;  3KDP B;  3V4W A;  3IFM A;  1L4A B;  1NHL A;  5BVZ A;  3CL3 D;  2XDJ A;  1G1I A;  3R2P A;  3VP9 A;  5AW1 B;  2OAR A;  2Z4E A;  3KPE A;  2YMY A;  2YNY A;  5AVU B;  2WWW A;  2I1J A;  1SQQ K;  1NKN A;  1OWA A;  4EIJ A;  5CJ0 A;  2C0W A;  2WSF H;  1MV8 A;  3B8E B;  1IFJ A;  4Y99 C;  4W80 A;  2W6B A;  3NXS A;  4M3L A;  2NPS D;  1QL1 A;  1IFM A;  1X79 B;  2KP8 A;  3A3Y B;  1SQX K;  1H89 A;  1XTG B;  1Z56 A;  2WSC H;  1IJD B;  4W7Y A;  1M1J C;  1MFZ A;  4IFM A;  1CW5 A;  1GL2 C;  1FZC C;  2O1J A;  1JOC A;  5AVR B;  1ZV8 A;  2HOD B;  2NPS B;  5CMZ A;  4C7N B;  1T2K D;  2QM7 A;  1RE4 A;  3HRN A;  1T3J A;  1SQB K;  2KYV A;  1RF0 C;  3GHG A;  1IC2 A;  3VN0 A;  4B86 A;  2CPS A;  2HOD A;  1OXZ A;  4C7N A;  1FZE A;  5CCG A;  1SQV K;  3MGN A;  3RK2 C;  2OYH B;  1N73 C;  1FU1 A;  4N78 E;  2P7J A;  3TNU B;  1JY2 O;  3M9B A;  1T3U A;  1MZ9 A;  2HYN A;  3RK3 C;  1N7S C;  3HUS C;  4GKG A;  2A45 I;  4WY4 C;  5AW7 B;  1LTT C;  1LTI C;  2P2U A;  3BVH A;  2J59 M;  3LID A;  2BAS A;  1FZF A;  1RE3 A;  2CPB A;  5BU8 B;  3VMX A;  3TNU A;  2WT7 B;  3P32 A;  1LT9 B;  1HUC A;  3HE5 B;  3P8M C;  1SFC C;  3GHG C;  1IO4 A;  1LTJ A;  3O8Z A;  2IFM A;  1RF1 C;  2J58 A;  1FZB A;  2OYI B;  1KIL A;  3MD0 A;  3HD7 B;  3KQG A;  1JCD A;  1GL2 D;  3H32 A;  1VDF A;  4LGD E;  2FXM A;  2WT7 A;  3A2A A;  1HH0 A;  2WTY A;  3HE5 A;  1KQL A;  5AW2 B;  4IFF A;  1J1D B;  3P7K A;  5CJ4 A;  4EOT A;  4RES B;  3B5N C;  3RL0 D;  3I5C A;  1JY2 P;  4OH8 B;  3OAK A;  1JY3 N;  1SLQ A;  2YKO A;  5APQ A;  2HG5 D;  4KHX A;  2H43 A;  1A02 J;  3V5B A;  5AW6 B;  1N7L A;  3HD7 A;  1NWQ A;  5APU A;  5AW5 B;  5KLV K;  1HVV A;  3C9I A;  1FZC B;  3SWY A;  4O9B A;  1FOS E;  2HPC A;  1HGV A;  4AQR D;  4GIF A;  5CCH C;  1JTH A;  1WT6 A;  3NMD A;  2KB7 P;  3RL0 B;  1URQ C;  2M3B A;  1JUN A;  3OA7 A;  1DH3 A;  2C9L Y;  1JCC A;  4C7R A;  2O01 H;  1KIL C;  1NU1 K;  5KJ7 C;  1L4A A;  2QM8 A;  2YO2 A;  5AVV B;  2M8R A;  1LWU C;  2W27 A;  1NKZ B;  3M9Q A;  4WY4 D;  5AVW B;  1FZA A;  1LTA C;  5AW9 B;  2N1T C;  1KZU B;  1N2D C;  2FFD C;  3U1A A;  3IR9 A;  2I1K A;  2KOG A;  1SFC D;  2YKP A;  2Z5H A;  1JMM A;  1WRG A;  1IK9 A;  4I6M C;  1J1E B;  3V4Q A;  4GT1 A;  4DZO A;  3M0D A;  4AUW A;  3P8C E;  1S9K E;  5AW8 B;  3VTP C;  1LTG C;  2XNX A;  1AQ5 A;  4XE5 B;  3M91 A;  4N6J A;  1GD2 E;  3M0A A;  2IX7 C;  2Q7C A;  3VYI A;  1GU4 A;  2W6A A;  3B5N D;  1L0N K;  3LW5 H;  1X9V A;  1L4A C;  5AVT B;  3NFQ A;  2E43 A;  2NPS A;  2GUV A;  1YYC A;  3V2Q A;  3OJA B;  3M06 A;  2WPS A;  5CCH D;  3VP8 A;  1RY3 A;  1GK6 A;  3VOP A;  2L5G B;  3M0D C;  2R32 A;  5APS A;  2HFE D;  2WPQ A;  2WZ7 A;  3EFG A;  1T8Z A;  2OYH A;  1NH4 A;  5CHX A;  3TK1 A;  4HYT B;  1RE4 C;  2HLO A;  2KSJ A;  5APY A;  2POH A;  1FDM A;  1FBM A;  3L37 A;  1FJP A;  1HJB A;  2N1T D;  1NTM K;  1DX7 A;  1IFI A;  1CI6 B;  3WMM 0;  2ZFC A;  4LC1 A;  2R5B A;  1M7L A;  2Q3I A;  1JY3 O;  5CCG C;  2C9N Y;  3N7N A;  1LT9 A;  4Y99 B;  3EQ2 A;  1DEB A;  3HE4 B;  3T97 A;  3KYQ A;  2N1T B;  1HBW A;  1ZR2 A;  3LIE A;  1CI6 A;  2OYI A;  1FZG A;  2E42 A;  3CLQ A;  1VPC A;  1M1J B;  3VMY A;  1GL2 B;  5AVQ B;  3V2R A;  1KFM A;  4N78 D;  3CI9 A;  5AVX B;  2YKQ A;  1RE3 C;  1G1J A;  2P1J A;  1NTZ K;  3MTU E;  3MIW A;  3RK2 D;  2XV5 A;  4ZKP A;  2R3C A;  1KFN A;  1LTJ C;  3G3Z A;  4JF7 A;  1N86 A;  1NTK K;  1M1J A;  3TYY A;  1GL2 A;  5AVZ B;  5APT A;  3A7O A;  1FZC A;  2N9B A;  1CZQ A;  3RK3 D;  1N7S D;  3BAS A;  1NOH A;  1JY3 P;  1YTZ I;  3L36 A;  1IFN A;  2KLV A;  1LT9 C;  1E5W A;  2H8P D;  3V2P A;  3UIA A;  2FKW B;  3RK2 B;  5KTB A;  1GK4 A;  2WIT A;  1N73 B;  3MUD A;  1GZL A;  2GM4 A;  1NO4 A;  1RF0 A;  1ZLL A;  3BRV B;  4C46 A;  2OYI C;  2XU6 A;  4WB4 A;  3HD7 C;  1PFI A;  2XKM A;  4LLH A;  3RK3 B;  1N7S B;  2ZXE B;  3HUS B;  1GU5 A;  4WY4 B;  1CSB A;  1J1D C;  1LTS C;  4JYC A;  5CCG D;  2LKM A;  2XZR A;  4DOJ A;  4N3Y B;  4AYC A;  1N73 A;  1ZN5 A;  4I2L C;  3L4F A;  1FJK A;  1SFC B;  3GHG B;  1NAF A;  1N7S A;  2Z5I A;  3HUS A;  3VMZ A;  1RF1 B;  2VRS A;  4WY4 A;  1XTC C;  4HH2 A;  5AVY B;  2WPR A;  2O1K A;  2P67 A;  1QL2 A;  3RL0 C;  1FOS F;  5APW A;  5AVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...